BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c77481_g1_i1 len=2861 path=[1:0-2860]

Length=2861
                                                                      Score     E

ref|XP_009629366.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    710   0.0      
ref|XP_009782253.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    702   0.0      
ref|XP_004245125.1|  PREDICTED: protein EARLY FLOWERING 3-like          657   0.0      
ref|XP_006355312.1|  PREDICTED: protein EARLY FLOWERING 3-like          657   0.0      
ref|XP_006342510.1|  PREDICTED: protein EARLY FLOWERING 3-like          645   0.0      
emb|CDP08210.1|  unnamed protein product                                639   0.0      
ref|XP_002278577.1|  PREDICTED: protein EARLY FLOWERING 3               623   0.0      Vitis vinifera
ref|XP_009784952.1|  PREDICTED: protein EARLY FLOWERING 3-like          618   0.0      
emb|CBI20609.3|  unnamed protein product                                615   0.0      
ref|XP_004253100.1|  PREDICTED: protein EARLY FLOWERING 3               612   0.0      
gb|KDP34132.1|  hypothetical protein JCGZ_07703                         598   0.0      
ref|XP_007012227.1|  Hydroxyproline-rich glycoprotein family prot...    595   0.0      
ref|XP_006340248.1|  PREDICTED: protein EARLY FLOWERING 3-like          590   0.0      
gb|AIN75607.1|  EARLY FLOWERING 3                                       589   0.0      
ref|XP_009594922.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    584   0.0      
ref|XP_009594920.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    573   0.0      
ref|XP_002516480.1|  conserved hypothetical protein                     574   0.0      Ricinus communis
ref|XP_011095302.1|  PREDICTED: protein EARLY FLOWERING 3-like          572   0.0      
ref|XP_011081715.1|  PREDICTED: LOW QUALITY PROTEIN: protein EARL...    566   0.0      
ref|XP_004251173.1|  PREDICTED: protein EARLY FLOWERING 3-like          548   3e-180   
gb|KHN29734.1|  Protein EARLY FLOWERING 3                               538   7e-175   
ref|XP_009337143.1|  PREDICTED: protein EARLY FLOWERING 3-like          535   4e-174   
gb|KDO79979.1|  hypothetical protein CISIN_1g004928mg                   535   1e-173   
ref|XP_003523640.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    535   1e-173   
ref|XP_008357349.1|  PREDICTED: protein EARLY FLOWERING 3-like          533   2e-173   
ref|XP_006475975.1|  PREDICTED: protein EARLY FLOWERING 3-like          535   2e-173   
ref|XP_006450775.1|  hypothetical protein CICLE_v10007592mg             533   4e-173   
ref|XP_009782254.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    523   1e-170   
ref|XP_010097101.1|  hypothetical protein L484_019540                   526   3e-170   
ref|XP_009629368.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    520   3e-169   
ref|XP_004291013.1|  PREDICTED: protein EARLY FLOWERING 3-like          503   2e-161   
gb|AFZ78447.1|  early flowering 3                                       501   1e-160   
ref|XP_009361544.1|  PREDICTED: protein EARLY FLOWERING 3-like          492   2e-157   
ref|XP_003603108.1|  Protein EARLY FLOWERING                            487   2e-155   
gb|AFR60580.1|  early flowering 3/high response                         485   1e-154   
ref|XP_011019541.1|  PREDICTED: protein EARLY FLOWERING 3               482   2e-153   
ref|XP_010244364.1|  PREDICTED: protein EARLY FLOWERING 3               482   1e-152   
ref|XP_003550290.1|  PREDICTED: protein EARLY FLOWERING 3-like          479   4e-152   
ref|XP_007160974.1|  hypothetical protein PHAVU_001G032900g             467   1e-147   
gb|KHN17209.1|  Protein EARLY FLOWERING 3                               456   1e-143   
ref|XP_007221988.1|  hypothetical protein PRUPE_ppa002858mg             447   3e-141   
ref|XP_002309522.1|  EARLY FLOWERING 3 family protein                   448   5e-141   Populus trichocarpa [western balsam poplar]
ref|XP_010669115.1|  PREDICTED: protein EARLY FLOWERING 3               448   2e-140   
ref|XP_008220435.1|  PREDICTED: protein EARLY FLOWERING 3               446   1e-139   
ref|XP_004143036.1|  PREDICTED: protein EARLY FLOWERING 3-like          435   3e-135   
ref|XP_008377913.1|  PREDICTED: protein EARLY FLOWERING 3-like          424   4e-135   
ref|XP_007024385.1|  Hydroxyproline-rich glycoprotein family prot...    434   2e-134   
ref|XP_008444497.1|  PREDICTED: protein EARLY FLOWERING 3               431   1e-133   
ref|XP_004501482.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    429   3e-133   
ref|XP_004168028.1|  PREDICTED: protein EARLY FLOWERING 3-like          429   3e-133   
ref|XP_008797900.1|  PREDICTED: protein EARLY FLOWERING 3               416   8e-128   
ref|XP_008351957.1|  PREDICTED: protein EARLY FLOWERING 3-like          415   8e-128   
ref|XP_008393666.1|  PREDICTED: protein EARLY FLOWERING 3               415   8e-128   
ref|XP_010267078.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    411   3e-125   
ref|XP_010049159.1|  PREDICTED: protein EARLY FLOWERING 3               405   2e-124   
gb|KHF99548.1|  Protein EARLY FLOWERING 3 -like protein                 402   1e-122   
gb|AAQ73529.1|  early flowering 3                                       397   3e-121   Mesembryanthemum crystallinum
ref|XP_006466166.1|  PREDICTED: protein EARLY FLOWERING 3-like          391   2e-118   
ref|XP_008806826.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    390   1e-117   
ref|XP_006426449.1|  hypothetical protein CICLE_v10024969mg             389   1e-117   
gb|KDO58686.1|  hypothetical protein CISIN_1g004483mg                   389   1e-117   
ref|XP_010910484.1|  PREDICTED: protein EARLY FLOWERING 3               387   7e-117   
ref|XP_007160975.1|  hypothetical protein PHAVU_001G032900g             376   8e-114   
ref|XP_008806834.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    379   9e-114   
gb|EYU29309.1|  hypothetical protein MIMGU_mgv1a022839mg                373   3e-113   
ref|XP_002276544.3|  PREDICTED: protein EARLY FLOWERING 3 isoform X1    375   1e-112   Vitis vinifera
emb|CBI35994.3|  unnamed protein product                                374   2e-112   
ref|XP_010924961.1|  PREDICTED: protein EARLY FLOWERING 3-like          375   2e-112   
ref|XP_004498925.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    366   4e-110   
ref|XP_009400544.1|  PREDICTED: protein EARLY FLOWERING 3-like          367   2e-109   
emb|CAN70608.1|  hypothetical protein VITISV_040198                     372   1e-107   Vitis vinifera
emb|CAN65004.1|  hypothetical protein VITISV_023490                     373   2e-107   Vitis vinifera
ref|XP_009401962.1|  PREDICTED: protein EARLY FLOWERING 3-like          358   3e-106   
gb|KHG06245.1|  Protein EARLY FLOWERING 3 -like protein                 351   7e-104   
gb|KDP40820.1|  hypothetical protein JCGZ_24819                         351   3e-103   
ref|XP_004498928.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    338   7e-100   
ref|XP_010526070.1|  PREDICTED: protein EARLY FLOWERING 3               338   2e-99    
ref|XP_010915307.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    337   2e-98    
gb|KFK29903.1|  early flowering 3                                       330   5e-97    
ref|XP_010915306.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    334   7e-97    
ref|XP_010267079.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    330   2e-96    
ref|XP_008244743.1|  PREDICTED: protein EARLY FLOWERING 3 isoform X2    331   6e-96    
gb|KEH39956.1|  EARLY flowering protein, putative                       324   1e-94    
ref|XP_007216534.1|  hypothetical protein PRUPE_ppa026719mg             326   3e-94    
ref|XP_008244742.1|  PREDICTED: protein EARLY FLOWERING 3 isoform X1    325   5e-94    
ref|XP_008807710.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    319   2e-92    
gb|KDO58687.1|  hypothetical protein CISIN_1g004483mg                   318   6e-92    
ref|XP_010526158.1|  PREDICTED: protein EARLY FLOWERING 3-like          317   1e-91    
ref|XP_003567779.1|  PREDICTED: protein EARLY FLOWERING 3-like          318   2e-91    
ref|XP_008244744.1|  PREDICTED: protein EARLY FLOWERING 3 isoform X3    316   1e-90    
ref|XP_004960992.1|  PREDICTED: protein EARLY FLOWERING 3-like          313   2e-89    
ref|XP_010417373.1|  PREDICTED: protein EARLY FLOWERING 3-like          310   8e-89    
ref|XP_006408833.1|  hypothetical protein EUTSA_v10001926mg             308   2e-88    
ref|XP_010429612.1|  PREDICTED: protein EARLY FLOWERING 3-like          308   3e-88    
ref|XP_002878908.1|  hypothetical protein ARALYDRAFT_481449             305   4e-87    
ref|XP_008807709.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    305   9e-87    
ref|XP_006853900.1|  hypothetical protein AMTR_s00036p00168840          305   4e-86    
ref|XP_004969003.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    301   4e-85    
ref|NP_180164.1|  protein EARLY FLOWERING 3                             297   3e-84    Arabidopsis thaliana [mouse-ear cress]
gb|KEH39954.1|  EARLY flowering protein, putative                       294   6e-84    
ref|XP_010472622.1|  PREDICTED: protein EARLY FLOWERING 3-like          294   6e-83    
ref|XP_002515898.1|  hypothetical protein RCOM_1486170                  296   7e-83    Ricinus communis
ref|XP_010062565.1|  PREDICTED: protein EARLY FLOWERING 3-like          293   2e-82    
gb|AGT16064.1|  hydroxyproline-rich glycoprotein family protein         293   4e-82    
ref|XP_004969002.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    292   8e-82    
gb|AGT16850.1|  hydroxyproline-rich glycoprotein family protein         291   1e-81    
gb|AGT17012.1|  hydroxyproline-rich glycoprotein family protein         290   3e-81    
ref|XP_011011714.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    285   2e-79    
ref|XP_011011712.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    285   5e-79    
ref|XP_006293368.1|  hypothetical protein CARUB_v10022728mg             281   2e-78    
ref|XP_010097102.1|  hypothetical protein L484_019541                   270   1e-77    
ref|XP_009625226.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    280   3e-77    
ref|XP_006357460.1|  PREDICTED: protein EARLY FLOWERING 3-like          277   2e-76    
gb|AEA50867.1|  elf3a                                                   261   4e-75    
ref|NP_001169653.1|  uncharacterized protein LOC100383534               273   7e-75    Zea mays [maize]
ref|XP_008462380.1|  PREDICTED: protein EARLY FLOWERING 3               271   9e-75    
ref|XP_004242270.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    272   1e-74    
gb|EEE54823.1|  hypothetical protein OsJ_02258                          271   2e-74    Oryza sativa Japonica Group [Japonica rice]
gb|AGW16337.1|  Hd-q                                                    270   4e-74    
dbj|BAL63008.1|  Hd17                                                   270   7e-74    
dbj|BAL45488.1|  early flowering 3                                      268   7e-74    
gb|EEC70910.1|  hypothetical protein OsI_02465                          270   7e-74    Oryza sativa Indica Group [Indian rice]
ref|XP_010654568.1|  PREDICTED: protein EARLY FLOWERING 3 isoform X2    264   7e-74    
gb|EAY99610.1|  hypothetical protein OsI_21588                          270   9e-74    Oryza sativa Indica Group [Indian rice]
dbj|BAL63009.1|  Hd17                                                   269   1e-73    
dbj|BAA83571.1|  putative early flowering 3                             267   4e-73    Oryza sativa Japonica Group [Japonica rice]
gb|KEH39955.1|  EARLY flowering protein, putative                       259   2e-72    
ref|XP_004141800.1|  PREDICTED: uncharacterized protein LOC101208149    264   2e-72    
ref|XP_002440379.1|  hypothetical protein SORBIDRAFT_09g030700          263   8e-72    Sorghum bicolor [broomcorn]
ref|XP_004298565.1|  PREDICTED: uncharacterized protein LOC101299956    259   3e-70    
ref|XP_002458017.1|  hypothetical protein SORBIDRAFT_03g025560          259   3e-70    Sorghum bicolor [broomcorn]
ref|XP_011080316.1|  PREDICTED: protein EARLY FLOWERING 3-like          259   4e-70    
ref|XP_006583036.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    254   7e-69    
ref|XP_006585544.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    253   1e-68    
ref|XP_009407571.1|  PREDICTED: protein EARLY FLOWERING 3-like          252   3e-68    
ref|XP_009384215.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    250   1e-67    
ref|XP_004969004.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    247   4e-67    
ref|XP_009625227.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    247   6e-67    
gb|KHN11326.1|  Protein FAR1-RELATED SEQUENCE 11                        254   1e-66    
gb|ABL11477.1|  ELF3 protein                                            244   7e-65    Triticum aestivum [Canadian hard winter wheat]
emb|CAA72719.1|  nematode responsive protein                            241   3e-64    Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ96537.1|  predicted protein                                      237   9e-63    
dbj|BAJ94845.1|  predicted protein                                      236   2e-62    
gb|KEH39953.1|  EARLY flowering protein, putative                       229   4e-62    
gb|AEZ53982.1|  early flowering protein 3                               234   1e-61    
ref|XP_010322854.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    231   2e-61    
gb|AEW48248.1|  early flowering 3                                       232   6e-61    
ref|XP_010322857.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    229   6e-61    
dbj|BAM09631.1|  ELF3-like protein                                      231   1e-60    
ref|XP_008673213.1|  PREDICTED: uncharacterized protein LOC100383...    228   3e-60    
gb|AEA50868.1|  elf3b                                                   216   3e-59    
ref|XP_009778080.1|  PREDICTED: protein EARLY FLOWERING 3-like          223   5e-58    
ref|XP_006646013.1|  PREDICTED: protein EARLY FLOWERING 3-like          219   5e-57    
ref|XP_006583033.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    214   2e-55    
ref|XP_006583035.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    214   2e-55    
gb|KEH18269.1|  early flowering protein, putative                       214   4e-55    
emb|CDO97951.1|  unnamed protein product                                213   1e-54    
ref|XP_010106119.1|  hypothetical protein L484_003122                   213   2e-54    
ref|XP_006646014.1|  PREDICTED: protein EARLY FLOWERING 3-like          211   2e-54    
ref|XP_011072464.1|  PREDICTED: protein EARLY FLOWERING 3-like          206   2e-53    
ref|XP_010267081.1|  PREDICTED: protein EARLY FLOWERING 3-like          198   2e-51    
gb|KDO79981.1|  hypothetical protein CISIN_1g004928mg                   196   3e-51    
ref|XP_008650078.1|  PREDICTED: protein EARLY FLOWERING 3-like          201   3e-51    
gb|KDO79982.1|  hypothetical protein CISIN_1g004928mg                   197   3e-51    
gb|KDO79980.1|  hypothetical protein CISIN_1g004928mg                   192   2e-50    
gb|KDO79983.1|  hypothetical protein CISIN_1g004928mg                   192   2e-50    
emb|CAN79509.1|  hypothetical protein VITISV_038336                     191   2e-50    Vitis vinifera
ref|XP_004510333.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    196   3e-49    
ref|XP_009384525.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    194   5e-49    
gb|EMT17013.1|  Protein EARLY FLOWERING 3                               193   2e-48    
ref|XP_007135598.1|  hypothetical protein PHAVU_010G142900g             190   2e-47    
gb|EMS61286.1|  hypothetical protein TRIUR3_19149                       190   2e-47    
ref|XP_007135599.1|  hypothetical protein PHAVU_010G142900g             190   2e-47    
ref|XP_010097103.1|  hypothetical protein L484_019542                   186   5e-47    
emb|CDY35321.1|  BnaA04g15260D                                          184   1e-45    
emb|CDX76735.1|  BnaC08g33210D                                          180   2e-44    
ref|XP_009140718.1|  PREDICTED: protein EARLY FLOWERING 3               180   3e-44    
emb|CDY66493.1|  BnaCnng51090D                                          176   2e-43    
ref|XP_006297383.1|  hypothetical protein CARUB_v10013409mg             176   4e-43    
ref|XP_006406284.1|  hypothetical protein EUTSA_v10020453mg             171   2e-41    
ref|XP_006385404.1|  hypothetical protein POPTR_0003s04030g             166   4e-41    
ref|XP_010466369.1|  PREDICTED: protein EARLY FLOWERING 3-like          168   1e-40    
ref|XP_010536214.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    164   5e-40    
gb|AAX23847.1|  hypothetical protein At3g21320                          162   6e-40    Arabidopsis thaliana [mouse-ear cress]
gb|KHN39274.1|  Protein EARLY FLOWERING 3                               166   2e-39    
ref|XP_010536213.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    163   3e-39    
emb|CDY48882.1|  BnaA03g36210D                                          162   5e-39    
ref|NP_188769.1|  uncharacterized protein                               163   5e-39    Arabidopsis thaliana [mouse-ear cress]
emb|CDY56915.1|  BnaCnng31360D                                          160   4e-38    
emb|CDY32422.1|  BnaC03g42060D                                          159   8e-38    
gb|ABP81864.1|  EARLY FLOWERING 3                                       155   9e-38    Pisum sativum [garden pea]
emb|CDY51450.1|  BnaA05g36670D                                          159   1e-37    
ref|XP_009145486.1|  PREDICTED: protein EARLY FLOWERING 3               159   1e-37    
ref|XP_009117036.1|  PREDICTED: protein EARLY FLOWERING 3               160   1e-37    
ref|XP_002885435.1|  hypothetical protein ARALYDRAFT_342282             159   2e-37    
ref|NP_001288828.1|  protein EARLY FLOWERING 3                          160   2e-37    
ref|XP_009109647.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    158   2e-37    
ref|XP_009109631.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    158   3e-37    
ref|XP_010510094.1|  PREDICTED: protein EARLY FLOWERING 3-like          153   1e-35    
ref|XP_009135744.1|  PREDICTED: protein EARLY FLOWERING 3-like          150   1e-34    
ref|XP_010545644.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    149   3e-34    
ref|XP_010545643.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    148   6e-34    
ref|XP_010488144.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    147   9e-34    
dbj|BAB01726.1|  unnamed protein product                                145   1e-32    Arabidopsis thaliana [mouse-ear cress]
gb|ACU18593.1|  unknown                                                 134   4e-32    Glycine max [soybeans]
ref|XP_010488142.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    133   4e-29    
dbj|BAD97868.1|  ELF3 homologue                                         128   1e-27    Lemna aequinoctialis
gb|AEK05757.1|  early flowering 3                                       124   2e-27    
dbj|BAD97872.1|  ELF3 homologue                                         127   3e-27    Lemna gibba
ref|XP_009771094.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    125   3e-27    
gb|AEK05758.1|  early flowering 3                                       122   4e-27    
ref|XP_009771093.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    124   5e-27    
ref|XP_009771092.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    125   7e-27    
gb|AAM97051.1|  unknown protein                                         123   1e-26    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009109656.1|  PREDICTED: uncharacterized protein LOC103835...    122   6e-26    
gb|AEK05763.1|  early flowering 3                                       117   2e-25    
gb|AEK26570.1|  early flowering 3                                       114   3e-24    
ref|XP_010535272.1|  PREDICTED: uncharacterized protein LOC104810626    115   8e-24    
ref|NP_001043361.1|  Os01g0566100                                       110   3e-22    Oryza sativa Japonica Group [Japonica rice]
gb|EPS62660.1|  hypothetical protein M569_12130                         105   2e-21    
gb|EYU20385.1|  hypothetical protein MIMGU_mgv1a014747mg                103   2e-21    
ref|XP_002303218.2|  hypothetical protein POPTR_0003s04040g             100   5e-19    Populus trichocarpa [western balsam poplar]
emb|CDY11505.1|  BnaA09g40710D                                        98.6    7e-18    
gb|AFR60581.1|  early flowering 3/high response                       90.5    1e-17    
ref|XP_001766802.1|  predicted protein                                96.7    7e-17    
dbj|BAL49857.1|  self-incompatibility locus early-flowering 3         92.8    1e-16    
gb|EYU21410.1|  hypothetical protein MIMGU_mgv1a006681mg              93.2    2e-16    
gb|EPS65488.1|  hypothetical protein M569_09288                       85.1    5e-16    
dbj|BAL49854.1|  arabidopsis ELF3 homolog                             92.8    6e-16    
dbj|BAL49863.1|  self-incompatibility locus early-flowering 3         92.8    6e-16    
dbj|BAL49865.1|  self-incompatibility locus early-flowering 3         92.8    6e-16    
dbj|BAL49860.1|  self-incompatibility locus early-flowering 3         92.8    7e-16    
dbj|BAL49861.1|  self-incompatibility locus early-flowering 3         92.8    7e-16    
dbj|BAL49859.1|  self-incompatibility locus early-flowering 3         92.4    7e-16    
gb|AFK35699.1|  unknown                                               86.7    2e-15    
ref|XP_002978467.1|  hypothetical protein SELMODRAFT_443909           90.9    3e-15    
gb|AEK05745.1|  early flowering 3                                     86.3    2e-14    
gb|AEK05755.1|  early flowering 3                                     86.3    2e-14    
gb|AEK05746.1|  early flowering 3                                     85.9    2e-14    
gb|AEK05742.1|  early flowering 3                                     85.5    3e-14    
gb|AEK05754.1|  early flowering 3                                     85.5    3e-14    
gb|AEK05739.1|  early flowering 3                                     85.5    4e-14    
emb|CDY62750.1|  BnaC01g43670D                                        85.1    8e-14    
gb|AEK05743.1|  early flowering 3                                     82.8    3e-13    
dbj|BAL49855.1|  self-incompatibility locus early-flowering 3         83.6    4e-13    
gb|AEZ53983.1|  early flowering protein 3 mutant eam8.k               76.6    2e-12    
gb|AEW48250.1|  early flowering 3                                     79.3    2e-12    
dbj|BAL49856.1|  arabidopsis ELF3 homolog                             80.5    4e-12    
ref|XP_010546508.1|  PREDICTED: uncharacterized protein LOC104818577  74.7    7e-12    
ref|XP_001766717.1|  predicted protein                                79.3    1e-11    
dbj|BAL49858.1|  arabidopsis ELF3 homolog                             77.8    2e-11    
ref|XP_006601668.1|  PREDICTED: protein EARLY FLOWERING 3-like        73.9    3e-11    
ref|NP_001056770.2|  Os06g0142600                                     75.5    9e-11    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002974988.1|  hypothetical protein SELMODRAFT_415241           68.6    2e-08    
ref|XP_001753903.1|  predicted protein                                67.8    4e-08    
ref|XP_002970302.1|  hypothetical protein SELMODRAFT_411196           67.4    5e-08    
gb|EPS58039.1|  hypothetical protein M569_16778                       63.5    1e-07    
ref|XP_002977406.1|  hypothetical protein SELMODRAFT_443557           63.9    5e-07    
gb|KEH18268.1|  hypothetical protein MTR_8g015470                     56.6    6e-06    
gb|EPS65489.1|  hypothetical protein M569_09289                       58.2    1e-05    
ref|XP_010478952.1|  PREDICTED: uncharacterized protein LOC104757864  54.3    4e-05    



>ref|XP_009629366.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009629367.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Nicotiana 
tomentosiformis]
Length=650

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/696 (58%), Positives = 472/696 (68%), Gaps = 70/696 (10%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNN-ASNLIPPS  2161
             +MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF+ GVLP NPNN  + L PPS
Sbjct  10    VMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFNSGVLPLNPNNNTAKLPPPS  69

Query  2160  PSQGNGHERRMFLPMHLPPSTYSAEKLHAHSSDSNTPLTQFESRKKTDEDDFRVPVFVNS  1981
              +QG+GHER ++ P+  PPS + A+K   HSSD NT L QFE  K+T+EDDF VPVFVNS
Sbjct  70    SNQGSGHERVVYFPVQHPPSGHLADKPPGHSSDPNTLLEQFELNKRTEEDDFTVPVFVNS  129

Query  1980  NISQSIGKFYKNSEREKVSPSSPAFLGRSTKDAKHTRGGNLRHQESSRQLPATREQSVKA  1801
                 + G    N + EK+SPS P F G   KD +      LR Q  S+      E++ K 
Sbjct  130   KPGHANGS--HNLDMEKLSPSGPVFSGHPNKDLEGLTNLILRQQRDSQN-----EENPKC  182

Query  1800  SLSSRSTDKKEHCIKHTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESIIDSKVGDAND  1621
               +SR                  H    + P+       + G  + PE            
Sbjct  183   IPASRE-----------------HRTTSNSPSKECRFDRQVGCTIIPE------------  213

Query  1620  DAVVSGPIKGVEIGDSSVPINCFQTEGQII--NVGNDVESQENQTCRSPQTQKVDRGDNS  1447
                   P+ GV  GDS  P+  F +E QII  N+ N +ESQE++TC+S QT  VD+GD+ 
Sbjct  214   ------PVTGVNDGDS-YPMKEFASEEQIITNNLINGMESQEDRTCKSIQTGIVDQGDDL  266

Query  1446  SETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIA  1267
             SETS+VE +SG DISPDDVVGIIG K FWKARR IV+QQRVFA+QVFELHRLIKVQKLIA
Sbjct  267   SETSIVESMSGTDISPDDVVGIIGLKRFWKARREIVSQQRVFAIQVFELHRLIKVQKLIA  326

Query  1266  ESPNFLLEDTAYLGKPLKVSSAKRLLPPFE-YIKAPQNVPKHKNDSEKPHLRMECSAENT  1090
             ESPN +LED AYLGKPLK SS KRL  P E  I+  Q+VPK KNDSEKP+ RMECSAENT
Sbjct  327   ESPNSMLEDAAYLGKPLKSSSGKRL--PLECIIRESQSVPKRKNDSEKPNFRMECSAENT  384

Query  1089  VGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPVMTPSEGL  910
             VGKASLSSVQN +Q  S +P  GNPP   V+ND+N  PWCF QP GHQWLIPVM+PSEGL
Sbjct  385   VGKASLSSVQNGSQLSSHRPFSGNPPPTPVTNDANTSPWCFQQPPGHQWLIPVMSPSEGL  444

Query  909   VYKPYPGPGFMSP---GCGPPPVSTPVMGNFFAPPAYGLPTSQYHYQGMGDPFAPPIGHG  739
             VYKP+PGPGF SP   GCGPP      MGNFF PPA G+P     YQGMG PFAPP GHG
Sbjct  445   VYKPFPGPGFTSPINGGCGPP----GSMGNFF-PPAIGVPGPHPRYQGMGVPFAPPTGHG  499

Query  738   YFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNMPSQKNGDAD  559
             YFP Y MPVMN  +S+S VE+ N FT  G Q Q+SGG  N N+QHQ+S N PS+KNG  +
Sbjct  500   YFPHYSMPVMNPPISSSTVEESNQFTSPGFQRQLSGGVDNFNIQHQDSSNGPSEKNG--N  557

Query  558   VSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDASQPP  379
             V D  R  A +DNE+QAS ASSPS RA    VS   +GR++L LFPTSP      A+  P
Sbjct  558   VPDVLRFQATRDNELQASTASSPSERA---AVSNATQGRNMLSLFPTSP------ATDNP  608

Query  378   DTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
             D  H ARVI+VVPHN RSA+ESAARIFQSIQ+ERKQ
Sbjct  609   D--HSARVIKVVPHNPRSATESAARIFQSIQEERKQ  642



>ref|XP_009782253.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Nicotiana 
sylvestris]
Length=640

 Score =   702 bits (1812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/695 (57%), Positives = 466/695 (67%), Gaps = 78/695 (11%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  2158
             +MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF+ GVLP N NN +       
Sbjct  10    VMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFNSGVLPANSNNNT-------  62

Query  2157  SQGNGHERRMFLPMHLPPSTYSAEKLHAHSSDSNTPLTQFESRKKTDEDDFRVPVFVNSN  1978
             ++G+GHER ++ P+  PPS + A+K   HSSD NT L QFE  K+T+EDDF VPVFVNS 
Sbjct  63    AKGSGHERVVYFPVQHPPSGHLADKPPGHSSDPNTLLQQFELNKRTEEDDFTVPVFVNSK  122

Query  1977  ISQSIGKFYKNSEREKVSPSSPAFLGRSTKDAKHTRGGNLRHQESSRQLPATREQSVKAS  1798
                + G    N + EK+SPS P F GR  KD +      LR Q  S+      E++ K  
Sbjct  123   PDHATGS--HNLDMEKLSPSGPVFSGRPNKDLEGLTDRILRQQRESQN-----EENPKCI  175

Query  1797  LSSRSTDKKEHCIKHTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESIIDSKVGDANDD  1618
              +SR                  H    + P+       + G  + PE             
Sbjct  176   PASRE-----------------HRTTSNSPSKECRFERQVGCTIIPE-------------  205

Query  1617  AVVSGPIKGVEIGDSSVPINCFQTEGQII--NVGNDVESQENQTCRSPQTQKVDRGDNSS  1444
                  P+ G++ GDS  P+  F +E QII  N+ N  ESQE++ C+S QT  +D+GDN S
Sbjct  206   -----PVTGIDDGDS-YPMKEFASEEQIITNNLINGTESQEDRICKSLQTGIMDQGDNLS  259

Query  1443  ETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAE  1264
             ETS+VE +SG DISPDDVVGIIG K FWKARRAIVNQQRVFA+QVFELHRLIKVQKLIAE
Sbjct  260   ETSIVESMSGTDISPDDVVGIIGLKRFWKARRAIVNQQRVFAIQVFELHRLIKVQKLIAE  319

Query  1263  SPNFLLEDTAYLGKPLKVSSAKRLLPPFE-YIKAPQNVPKHKNDSEKPHLRMECSAENTV  1087
             SPN +LED  YLGKPLK SS KRL  P E  I+  Q+VPK KNDSEKP+ RMECSAENTV
Sbjct  320   SPNSMLEDAGYLGKPLKNSSGKRL--PLECIIRESQSVPKRKNDSEKPNFRMECSAENTV  377

Query  1086  GKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPVMTPSEGLV  907
             GKASLSSVQN +Q  S +P  GNPP   V+ND+N  PWCF QP GHQWLIPVM+PSEGLV
Sbjct  378   GKASLSSVQNGSQLSSHRPFSGNPPPMPVTNDANTSPWCFQQPPGHQWLIPVMSPSEGLV  437

Query  906   YKPYPGPGFMSP---GCGPPPVSTPVMGNFFAPPAYGLPTSQYHYQGMGDPFAPPIGHGY  736
             YKP+PGPGF +P   GCGPP      MGNFF PPA G+P    HYQG G PFAPP GHGY
Sbjct  438   YKPFPGPGFTNPINGGCGPP----GSMGNFF-PPAIGVPGPHPHYQGTGVPFAPPTGHGY  492

Query  735   FPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNMPSQKNGDADV  556
             FP YGMPVMN  +S+S VE+ N FT  G Q Q+SGG  N N+QHQ+S N+PS+KNG  +V
Sbjct  493   FPHYGMPVMNLPISSSTVEESNQFTSPGFQRQLSGGIDNFNIQHQDSSNVPSEKNG--NV  550

Query  555   SDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDASQPPD  376
              D  R  A +DNE+QAS ASSPS RA   T     +GR++L LFPTSP  +        +
Sbjct  551   PDVLRFQATRDNELQASTASSPSERAADTT-----QGRNMLSLFPTSPATD--------N  597

Query  375   TGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
             T H ARVI+VVPHN RSA+ SAARIFQSIQ+ERKQ
Sbjct  598   TDHSARVIKVVPHNPRSATASAARIFQSIQEERKQ  632



>ref|XP_004245125.1| PREDICTED: protein EARLY FLOWERING 3-like [Solanum lycopersicum]
Length=644

 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/692 (55%), Positives = 459/692 (66%), Gaps = 66/692 (10%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  2158
             +MGPMFPRLHVNDT+KGGPRAPPRNKMALYEQLSIPSQRF+ GVLP +PNN S + PPS 
Sbjct  10    VMGPMFPRLHVNDTDKGGPRAPPRNKMALYEQLSIPSQRFNSGVLPLDPNNTSKMAPPSS  69

Query  2157  SQGNGHERRMFLPMHLPPSTYSAEKLHAHSSDSNTPLTQFESRKKTDEDDFRVPVFVNSN  1978
             SQG+GH+R  +LP+  PPS   A+K   HSSD +T L Q+E +K+T+EDDF VP+FVNS 
Sbjct  70    SQGSGHDRSGYLPIQHPPSRRLADKPPGHSSDPSTLLQQYELKKRTEEDDFTVPIFVNSK  129

Query  1977  ISQSIGKFYKNSEREKVSPSSPAFLGRSTKDAKHTRGGNLRHQESSRQLPATREQSVKAS  1798
             + Q+ G    N   EK+SPS   F     K+ +      LR Q +S+      ++++K +
Sbjct  130   LGQAHGSH--NVNMEKLSPSGQLFC--PNKELEGVTHLTLRQQRNSQN-----KENLKCT  180

Query  1797  LSSRSTDKKEHCIKHTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESIIDSKVGDANDD  1618
             L+ R         K                                E  +D +VG ++  
Sbjct  181   LARREKTTSNSASK--------------------------------ECRLDPQVGCSS--  206

Query  1617  AVVSGPIKGVEIGDSSVPINCFQTEGQII--NVGNDVESQENQTCRSPQTQKVDRGDNSS  1444
               +  P+KG   G SS P   F +E Q+   ++ ND ESQE++  +S QT  +DRGD+ S
Sbjct  207   --IPEPVKGTYDG-SSYPRKEFVSEEQLTANDLVNDTESQEDRAHKSLQTGNLDRGDDLS  263

Query  1443  ETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAE  1264
             ETS VE ISG DISPDD+VGIIG K FWKARRAIVNQQRVFA+QVFELHRLIKVQ+LIA 
Sbjct  264   ETSRVESISGTDISPDDIVGIIGLKRFWKARRAIVNQQRVFAIQVFELHRLIKVQRLIAG  323

Query  1263  SPNFLLEDTAYLGKPLKVSSAKRLLPPFEYI-KAPQNVPKHKNDSEKPHLRMECSAENTV  1087
             SPN  LED AYLGKPLK SS KRL  P + I +  Q+V K K+DSEKPH RME +AE+ V
Sbjct  324   SPNSSLEDPAYLGKPLKSSSIKRL--PLDCIVRESQSVLKRKHDSEKPHFRMEHTAESNV  381

Query  1086  GKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPVMTPSEGLV  907
             GKASLS+VQN +Q  S KP  G P    V+NDSN GPWCF QP GHQWLIPVM+PSEGLV
Sbjct  382   GKASLSTVQNGSQLSSHKPFSGTPLPTPVTNDSNAGPWCFQQPPGHQWLIPVMSPSEGLV  441

Query  906   YKPYPGPGFMSPGCGP-PPVSTPVMGNFFAPPAYGLPTSQYHYQGMGDPFAPPIGHGYFP  730
             YKP+PGPGF SP CG  PP S+P MGNFFA P YG+P    HYQGMG PFAPP GHGYF 
Sbjct  442   YKPFPGPGFTSPICGSGPPGSSPTMGNFFA-PTYGVPAPNPHYQGMGVPFAPPTGHGYFR  500

Query  729   PYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNMPSQKNGDADVSD  550
              YGMP MN  +S++A E+ N +T  G Q Q SG   ++N+QHQ+S N+ +QK    +V D
Sbjct  501   QYGMPAMNPPISSTASEESNQYTMPGLQHQFSGVVDDVNIQHQDSSNVLNQKK--ENVPD  558

Query  549   AHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDAS-QPPDT  373
               R  + KDNE+QAS ASSP   A          GR++L LFPTSPV +  D S Q    
Sbjct  559   VVRYQSTKDNEVQASSASSPIETA----------GRNMLSLFPTSPVTDNRDGSPQACVP  608

Query  372   GHPARVIRVVPHNARSASESAARIFQSIQKER  277
              +PARVI+VVPHNARSA+ES ARIFQSIQ+ER
Sbjct  609   DNPARVIKVVPHNARSATESVARIFQSIQQER  640



>ref|XP_006355312.1| PREDICTED: protein EARLY FLOWERING 3-like [Solanum tuberosum]
Length=656

 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/694 (54%), Positives = 456/694 (66%), Gaps = 60/694 (9%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  2158
             +MGPMFPRLHVNDT+KGGPRAPPRNKMALYEQLSIPSQRF+ GVLP +PNN S + PPS 
Sbjct  10    VMGPMFPRLHVNDTDKGGPRAPPRNKMALYEQLSIPSQRFNSGVLPLDPNNTSKMGPPSS  69

Query  2157  SQGNGHERRMFLPMHLPPSTYSAEKLHAHSSDSNTPLTQFESRKKTDEDDFRVPVFVNSN  1978
             SQG+GH+R  + P+  PPS + A+K   HSSD NT L Q+E +K+T+EDDF VP+FVNS 
Sbjct  70    SQGSGHDRGGYFPIQHPPSRHLADKPPGHSSDPNTLLQQYELKKRTEEDDFTVPIFVNSK  129

Query  1977  ISQSIGKFYKNSEREKVSPSSPAFLGRSTKDAKHTRGGNLRHQESSRQLPATREQSVKAS  1798
             +  +      N + EK+SPS P F     K+ +      LR Q +S+      +++ K +
Sbjct  130   LGHA--NKSHNLDMEKLSPSGPVFC--PNKELEGVTDLTLRQQRNSQN-----KENPKCT  180

Query  1797  LSSRSTDKKEHCIKHTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESIIDSKVGDANDD  1618
             ++ R         K                                E  +D +VG     
Sbjct  181   VARREKTTSNSASK--------------------------------ECRLDPQVGCT---  205

Query  1617  AVVSGPIKGVEIGDSSVPINCFQTEGQII--NVGNDVESQENQTCRSPQTQKVDRGDNSS  1444
              ++  P+K V   DSS P   F +E Q+   ++ ND ESQE++  +S QT  +DRGD+ S
Sbjct  206   -IIPEPVK-VTYDDSSYPRKAFISEEQLTANDLVNDTESQEDKAHKSLQTGNLDRGDDLS  263

Query  1443  ETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAE  1264
             ETS VE ISG DISPD +VGIIG K FWKARRAIVNQQRVFAVQVFELHRLIKVQ+LIA 
Sbjct  264   ETSRVESISGTDISPDVIVGIIGLKRFWKARRAIVNQQRVFAVQVFELHRLIKVQRLIAG  323

Query  1263  SPNFLLEDTAYLGKPLKVSSAKRLLPPFEYI-KAPQNVPKHKNDSEKPHLRMECSAENTV  1087
             SPN  LED  YLGKPLK SS KRL  P + I +  Q+V K K+DSEKP+ RME SAE+TV
Sbjct  324   SPNSSLEDPTYLGKPLKSSSVKRL--PLDCIVRESQSVLKRKHDSEKPNFRMEYSAESTV  381

Query  1086  GKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPVMTPSEGLV  907
             GKASLS+VQN +Q  + KP  GNP    V+NDSN GPWCF QP GHQWLIPVM+PSEGLV
Sbjct  382   GKASLSTVQNGSQLSNHKPFSGNPLPTPVTNDSNAGPWCFQQPPGHQWLIPVMSPSEGLV  441

Query  906   YKPYPGPGFMSPGCGPPPV-STPVMGNFFAPPAYGLPTSQYHYQGMGDPFAPPIGHGYFP  730
             YKP+PGP F  P CG  P  STP MGNFFA P YG+P    HYQGMG PFAPP GHGYF 
Sbjct  442   YKPFPGPEFTGPICGGGPAGSTPTMGNFFA-PTYGVPAPNPHYQGMGVPFAPPTGHGYFR  500

Query  729   PYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNMPSQKNGDADVSD  550
              YGMPVMN  +S+ A E+ N FT  G Q Q+SG   N N+QHQ+S N+ ++KN   +  D
Sbjct  501   QYGMPVMNPPISSPATEESNQFTLPGLQQQLSGVVDNFNIQHQDSSNVLNEKND--NFPD  558

Query  549   AHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDAS-QPPDT  373
               R    KDNE+QAS ASSP  R    +      GR++L LFPTSPV +  D S Q    
Sbjct  559   VVRFQTTKDNELQASTASSPIERTHETSTG----GRNMLSLFPTSPVTDNRDGSPQACVP  614

Query  372   GHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
              +PARVI+VVPHNARSA+ES ARIFQSIQ+ERKQ
Sbjct  615   DNPARVIKVVPHNARSATESVARIFQSIQQERKQ  648



>ref|XP_006342510.1| PREDICTED: protein EARLY FLOWERING 3-like [Solanum tuberosum]
Length=719

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/742 (53%), Positives = 471/742 (63%), Gaps = 91/742 (12%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  2158
             +MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF HG+   NPNNA+       
Sbjct  10    LMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFKHGI-SNNPNNAN-------  61

Query  2157  SQGNGHERRMFLPMHLPPSTYSAEKLHAHSSDSNTPLTQFESRKKTDEDDFRVPVFVNSN  1978
              QGNG E   F  + LPPS +  E  H+ SS+S TPL   ES KKT+EDDF VPVFV S 
Sbjct  62    IQGNGRENDDFFSVQLPPSRHPTENPHSCSSNSKTPLLPVESNKKTEEDDFSVPVFVKSK  121

Query  1977  ISQSIGKFYKNSEREKVSPSSPAFLGRSTKDAKHTRGGNLRHQESSRQLPATREQSVKAS  1798
               Q  GK Y   +  K+S S+    G S KD          + E+S+Q+   R+ S   S
Sbjct  122   AGQGDGKLYSTLDGRKLSASTAVLSGHSRKDL---------NDENSKQIAVGRKISCN-S  171

Query  1797  LSSRSTDKKEHCIKHTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESIIDSKVGDANDD  1618
              S  S DK +  +K  D    L  E RD P N   +  K+ + L+PE  +DS+VG     
Sbjct  172   TSIPSMDKLDDVLKKADVQ--LQYEPRDDPDNTFGIFCKNDL-LRPECRVDSQVGGT---  225

Query  1617  AVVSGPIKGVEIGDSSVPINCFQTEGQII---NVGNDVESQENQTCRSPQTQKVDRGDNS  1447
              ++S P++ V+ GDSS+ +    ++ QI    N  ND ES+E++   S QT+ VD+GD+ 
Sbjct  226   -MLSEPVRVVDNGDSSLLVKDVASKEQISPNNNHSNDKESKEDKASESLQTKIVDQGDDL  284

Query  1446  SETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIA  1267
             SETSMVE ISGM ISPDDVVGIIGQKHFW ARRAI NQQR FAVQVFELHRLIKVQ+LIA
Sbjct  285   SETSMVESISGMYISPDDVVGIIGQKHFWNARRAIANQQRAFAVQVFELHRLIKVQRLIA  344

Query  1266  ESPNFLLEDTAYL----------------------------------------------G  1225
              S + +LED+AYL                                              G
Sbjct  345   SSQS-MLEDSAYLSKAVKDSSAKKLPLEYIVRDGHNVSKQRKNFEKPNTRMECSAENTVG  403

Query  1224  KPLKVSSAKRLLPPFEYI-KAPQNVPKHKNDSEKPHLRMECSAENTVGKASLSSVQNATQ  1048
             KP+K SSAKRL  P EYI +   NV K + D EKP+  MECSAENTVGKAS SSVQN +Q
Sbjct  404   KPVKDSSAKRL--PLEYIVRDGHNVSKQRKDFEKPNFSMECSAENTVGKASFSSVQNNSQ  461

Query  1047  APSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGPGFMSPG  868
               S    PG+    +++NDS MGPW F+QPSGHQWLIPVMTPSEGLVYKPYPGPG  S  
Sbjct  462   PSSYSLFPGH----LITNDSTMGPWSFNQPSGHQWLIPVMTPSEGLVYKPYPGPGVTSSI  517

Query  867   CG--PPPVSTPVMGNFFAPPAYGLPTSQYHYQGMGDPFAPPIGHGYFPPYGMPVMNSAVS  694
             CG   PP STP++GN  A P+YG+P S + YQG+  PFAPP GH YFP YGMP +N A+S
Sbjct  518   CGGYGPPGSTPIIGN-HAAPSYGIPASHHQYQGVRMPFAPPAGHNYFPSYGMPAINPAIS  576

Query  693   TSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEI  514
             +S V+Q + F   G Q Q+SGGG N +VQ QNS NMPS KNG  DV    + H+ +D E+
Sbjct  577   SSPVDQSSQFVAQGLQGQLSGGGANFSVQRQNSSNMPSNKNG-TDV----KSHSYRDAEM  631

Query  513   QASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVD-ASQPPDTGHPARVIRVVPH  337
             QAS ASSPS  A  + V    E R+VLPLFPTSP     D +SQP    H ARVI+VVP 
Sbjct  632   QASTASSPSGTANKIIVDNATERRNVLPLFPTSPATKNPDISSQPQVPSHHARVIKVVPR  691

Query  336   NARSASESAARIFQSIQKERKQ  271
             NARSA+ESAARIFQSIQ+ERKQ
Sbjct  692   NARSATESAARIFQSIQEERKQ  713



>emb|CDP08210.1| unnamed protein product [Coffea canephora]
Length=713

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/718 (53%), Positives = 469/718 (65%), Gaps = 49/718 (7%)
 Frame = -3

Query  2334  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPP-SP  2158
             MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF HGV+P N N+++N IPP S 
Sbjct  11    MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFKHGVVPINSNSSANGIPPVSS  70

Query  2157  SQGNGHERRMFLPMHLPPSTYSAEKLHAHSSDSNTPLTQFESRKKTDEDDFRVPVFVNSN  1978
             SQGNG +R  F    LP    + EK  ++  DS+ PL   E +KK +EDDFRVP+F+ SN
Sbjct  71    SQGNGQQRGAFCSHQLPLPGQATEKSASNYFDSSAPLMPVEQKKKLEEDDFRVPIFMQSN  130

Query  1977  ISQSIGKFYKNSEREKVSPSSPAFLGRSTK-------------DAKHTRGGNLRHQ--ES  1843
             + Q  GK Y N +R   + SSPA+   STK             D   + G   R Q  E+
Sbjct  131   MGQDRGKTYSNMDRG--NSSSPAYTEHSTKNVPVTDNEPRQTVDIGPSVGQESRSQNEEN  188

Query  1842  SRQLPATREQSVKASLSSRSTDKKEHCIKHTDTDFPLHSEQRDGPANNSDLSHKSGINLQ  1663
              R+     EQS+++   S S +K E  ++  +T   L  E R+   +       +  NL 
Sbjct  189   IRESMGGGEQSIRSVSISSSLNKAEVGLRQAETY--LRPESRNNSVDKCSRFSNADHNLL  246

Query  1662  P----ESIIDSKVGDANDDAVVSGPIKGVEIGDSSVPINCFQTE-GQIINVGNDVESQEN  1498
             P    E+   S++   N   V   P  G+   +SS     FQ E G+I +   D ES E+
Sbjct  247   PDHRAETHSKSRIPGNN---VFDEPTMGISNPNSSASRFDFQAEEGRIFD---DTESCED  300

Query  1497  QTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFA  1318
             +TCRS  T   DR D++SETSMV+ ISG++ISPDDVVGIIGQKHFWKARRAIVNQQRVFA
Sbjct  301   KTCRSLPTGIADRDDDASETSMVDSISGLEISPDDVVGIIGQKHFWKARRAIVNQQRVFA  360

Query  1317  VQVFELHRLIKVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYI-KAPQNVPKHK  1141
             VQVFELHRLIKVQ++IA SP+ LLED+AYLGKP+K S+ K+L  P +YI KA  NV K K
Sbjct  361   VQVFELHRLIKVQRMIAGSPHLLLEDSAYLGKPIKGSAPKKL--PIDYIVKAIPNVSKQK  418

Query  1140  NDSEKPHLRMECSAENTVGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQ  961
             NDSEKP+ ++ECSAENTVGKASLSSVQN +  PS +P   N P    + D + G WCF Q
Sbjct  419   NDSEKPNHKIECSAENTVGKASLSSVQNGSHLPSHRPFSANSP---ATGDYSSGSWCFQQ  475

Query  960   PSGHQWLIPVMTPSEGLVYKPYPGPGFMSPGCG--PPPVSTPVMGNFFAPPAYGLPTSQY  787
             P GHQWLIPVM+PSEGLVYKPYPGPG+M+P CG   PP S+P+MGNF   PAYG+P S +
Sbjct  476   PQGHQWLIPVMSPSEGLVYKPYPGPGYMAPACGGCGPPGSSPMMGNFLN-PAYGIPAS-H  533

Query  786   HYQGMGD--PFAPPIG-HGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNL  616
             HYQ MG   PFA P G  GYFPPYGM V+N  ++ SA EQMN     G   Q    G N 
Sbjct  534   HYQAMGGVPPFAAPAGPQGYFPPYGMAVLNQGITGSAGEQMNHLAVPGPYGQSPRLGPNY  593

Query  615   NVQHQNSCNMPSQKNGDADVSDA-HRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRS  439
             ++Q QNS N+P+QK+G   + DA  +LHA +++E+Q S ASSPS R  G       E   
Sbjct  594   DIQRQNSGNVPNQKSG--AIPDAVQQLHASRESELQISTASSPSERVQGSGRGNAAERGD  651

Query  438   VLPLFPTSPVVNIVDA--SQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
             VLPLFPT+PVV        QP +    ARVI+VVPHN R A+ES ARIFQSIQ+ERKQ
Sbjct  652   VLPLFPTTPVVEAPSGHVQQPQEVSSSARVIKVVPHNGRLATESVARIFQSIQEERKQ  709



>ref|XP_002278577.1| PREDICTED: protein EARLY FLOWERING 3 [Vitis vinifera]
 ref|XP_010648311.1| PREDICTED: protein EARLY FLOWERING 3 [Vitis vinifera]
Length=725

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/723 (52%), Positives = 464/723 (64%), Gaps = 45/723 (6%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPP-S  2161
             IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLS+PSQR + GV+P   NNASNL+PP S
Sbjct  10    IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSVPSQRCNPGVMPLKSNNASNLVPPAS  69

Query  2160  PSQGNGHERRMFLPMHLPPST--YSAEKLHAHSSDS---NTPLTQFESRKKT-DEDDFRV  1999
              SQG+GHER +F P H+ PST  +  EKLHA  SD+   NTPL QFE RKK  DEDDFRV
Sbjct  70    SSQGSGHERGVFFPHHISPSTPTHLPEKLHARHSDAVILNTPLAQFEQRKKQGDEDDFRV  129

Query  1998  PVFVNSNISQSIGKFYKNSEREKVSPSSPAFLGRST-------KDAKHTRGGNLRHQESS  1840
             P+FV+S  ++  G+   + +RE ++PSS   LG S        K+ K T    L  ++  
Sbjct  130   PIFVHSG-TEFHGRNQNSIDREILTPSSSTCLGHSINLQNACEKELKQTSSNGLSVRQDK  188

Query  1839  R--------QLPATREQSVKASLSSRSTDKKEHCIKHTDTDFPLHSEQRD-GPANNSDLS  1687
             R           ++RE S K++ +  + +K +  +K  +   P   + RD   AN S L 
Sbjct  189   RSQGDVNRKDYVSSREYSEKSASNLSTKEKIDESMKQVNK--PSSEDFRDQSSANFSSLH  246

Query  1686  HKSGINLQPESIIDSKVGDANDDAVVSGPIKGVEIGDSSVPINCFQTEG--QIINVGNDV  1513
                G  LQ  +   +++G+ +    VS          S V  + +  +G        ND 
Sbjct  247   DTDGCLLQ-GNRAGAQLGEPDHVDCVSVETARDAWNASRVRSSSYSGDGLGSPSEPDNDG  305

Query  1512  ESQENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQ  1333
               + ++TC + Q   VD  D+ SETSMV+ +SG+DI+PDDVVGIIGQKHFWKARRAIVNQ
Sbjct  306   ACRGDKTCGTLQKGNVDTNDDLSETSMVDSMSGLDITPDDVVGIIGQKHFWKARRAIVNQ  365

Query  1332  QRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGKP-LKVSSAKRLLPPFEYI-KAPQ  1159
             QRVFAVQVFELHRLIKVQ+LIA SP+ +++++AYLGKP LK S AK+L  P EY+ K P 
Sbjct  366   QRVFAVQVFELHRLIKVQRLIAGSPHLMVDESAYLGKPSLKSSPAKKL--PLEYVVKPPP  423

Query  1158  NVPKHKNDSEKPHLRMECSAENTVGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMG  979
             N+  HK+D E+   ++ECSAEN VGK  L SV+N     +  P  GNPP      DS MG
Sbjct  424   NMVMHKDDYERASHQLECSAENAVGKTHLPSVKNGNPPSNYGPYIGNPPPAPAPTDSKMG  483

Query  978   PWCFHQPSGHQWLIPVMTPSEGLVYKPYPGPGFMSPGCG--PPPVSTPVMGNFFAPPAYG  805
             PWC+ QP GHQWL+PVM+PSEGLVYKPYPGPGFMS  CG   P  S P+ G+F   PAYG
Sbjct  484   PWCYPQPPGHQWLVPVMSPSEGLVYKPYPGPGFMSTVCGGCGPMGSAPMTGSFIN-PAYG  542

Query  804   LPTSQYHYQGMG-DPFAPPIGHGYFPPYGMPVMNS-AVSTSAVEQMNSFTRTGS---QAQ  640
             +P+S +H+QG+G  P  PPIGHGYFPPYGM VMN   +S SAVEQMN F   GS     Q
Sbjct  543   VPSS-HHHQGIGVHPGTPPIGHGYFPPYGMSVMNHPTISGSAVEQMNRFAGHGSLSQSGQ  601

Query  639   VSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVS  460
             +SGGG + N+QHQNSCN+P+ K     +    +    KD+E Q S ASSPS R   V   
Sbjct  602   LSGGGASFNMQHQNSCNVPTPKRA---IPQGVKFPMSKDSEFQGSTASSPSEREQQVGTG  658

Query  459   GPMEGRSVLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKE  280
                EGR  LPLFP +P        QP  T  P RVIRVVPHN RSA+ESAARIFQSIQ E
Sbjct  659   DTAEGRDPLPLFPMAPAAIPAGDPQPNGTDQPTRVIRVVPHNPRSATESAARIFQSIQDE  718

Query  279   RKQ  271
             RKQ
Sbjct  719   RKQ  721



>ref|XP_009784952.1| PREDICTED: protein EARLY FLOWERING 3-like [Nicotiana sylvestris]
Length=650

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/704 (52%), Positives = 446/704 (63%), Gaps = 79/704 (11%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  2158
             +MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF  G LP N  N SN +PP  
Sbjct  10    VMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFSPGDLPLN--NNSNSVPPYS  67

Query  2157  SQGNGHERRMFLPMHLPPSTYSAEKLHAHSSDSNTPLTQFESRKKTDEDDFRVPVFVNSN  1978
             SQGN HER +F    LP S +  EK H  S  SNTPL + ESRK+T+++DFR+P F N  
Sbjct  68    SQGNEHERVVFFSRQLPASRHPVEKPHGRSYGSNTPLQKVESRKQTEKNDFRIPTFGNFK  127

Query  1977  ISQSIGKFYKNSEREKVSPSSPAFLGRSTKDAKHTRG------GNLRHQESSRQLPATRE  1816
             + Q  GKF  N + EK++PS+ A  G S K+ K   G      G +++ E+S+     R 
Sbjct  128   VDQGHGKFNNNIDMEKLTPSNQAISGCSNKELKEITGLITRQLGKIQNGENSKD----RA  183

Query  1815  QSVKASLSSRSTDKKEHCIKHTDTDFPLHSEQRDGPANN-SDLSHKSGINLQ--PESIID  1645
              S K +  S S DK E  +K TD    LH + R   AN   DL   + + LQ  P+S++D
Sbjct  184   ISRKCTSDSLSMDKAEGILKQTDK--LLHFKPRKNHANTFGDLQKTNIVRLQVRPDSLVD  241

Query  1644  SKVGDANDDAVVSGPIKGVEIGDSSVPINCFQTEGQIINVGNDVESQENQTCRSPQTQKV  1465
                                          C    G  ++V  D E  E +TC+S QT + 
Sbjct  242   -----------------------------CTVFAGSALDV--DKEFHEQKTCKSSQTGET  270

Query  1464  DRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIK  1285
             DR D+ SETSMVEC+S +DISPDD+V IIGQKHFW+ARRAI NQQRV AVQVFELHRL+K
Sbjct  271   DRSDDLSETSMVECVSKVDISPDDIVRIIGQKHFWRARRAIANQQRVLAVQVFELHRLLK  330

Query  1284  VQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEY-IKAPQNVPKHKNDSEKPHLRME  1108
             VQKLIA SPN +LED + LGKPLK  S KRL    EY +KAP+NV K KNDSEKP+ RME
Sbjct  331   VQKLIASSPNSILEDGSSLGKPLKRLSTKRLA--LEYNVKAPENVSKQKNDSEKPNSRME  388

Query  1107  CSAENTVGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPVM  928
              +AEN VG+ SLS  +  ++ PS  P+P       V + S+MGPW F+QPSGHQWLIPVM
Sbjct  389   SNAENDVGETSLSCRRPLSETPS--PTP-------VKHVSHMGPWLFNQPSGHQWLIPVM  439

Query  927   TPSEGLVYKPYPGPGFMSP---GCGPPPVSTPVMGNFFAPPAYGLPTSQYHYQGMGDPFA  757
             +PSEGLVYKP+PGP FMSP   GCGPP    P+ GNF A PAY        YQG G PFA
Sbjct  440   SPSEGLVYKPHPGPAFMSPVYGGCGPP---IPMTGNFLA-PAY--------YQGTGAPFA  487

Query  756   PPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVS-GGGVNLNVQHQNSCNMPS  580
             P   HGYFPP+ MPVMN  + + A++Q +    TG Q  +S    VN ++Q QNS N+  
Sbjct  488   PQPSHGYFPPFDMPVMNPVIPSPAIDQPDQVAATGFQGLLSRDQEVNFHIQQQNSSNVAR  547

Query  579   QKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVV-N  403
             + N  A      RL+  +D+E+QAS ASSP  R  G+ V     GRSV PLFPT P + N
Sbjct  548   ENNVAA--PKVVRLYPSRDSELQASTASSPRERGHGLDVGNSTGGRSVFPLFPTFPAISN  605

Query  402   IVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
                +SQP    H ARVI+VVP NA +A+ESAARIFQSIQ+ERKQ
Sbjct  606   PASSSQPHFPSHTARVIKVVPRNASAATESAARIFQSIQEERKQ  649



>emb|CBI20609.3| unnamed protein product [Vitis vinifera]
Length=671

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/706 (52%), Positives = 456/706 (65%), Gaps = 65/706 (9%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPP-S  2161
             IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLS+PSQR + GV+P   NNASNL+PP S
Sbjct  10    IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSVPSQRCNPGVMPLKSNNASNLVPPAS  69

Query  2160  PSQGNGHERRMFLPMHLPPST--YSAEKLHAHSSDS---NTPLTQFESRKKT-DEDDFRV  1999
              SQG+GHER +F P H+ PST  +  EKLHA  SD+   NTPL QFE RKK  DEDDFRV
Sbjct  70    SSQGSGHERGVFFPHHISPSTPTHLPEKLHARHSDAVILNTPLAQFEQRKKQGDEDDFRV  129

Query  1998  PVFVNSNISQSIGKFYKNSEREKVSPSSPAFLGRSTKDAKHTRGGNLRHQESSRQLPATR  1819
             P+FV+S  ++  G+   + +RE ++PSS   L + ++       G++  ++      ++R
Sbjct  130   PIFVHSG-TEFHGRNQNSIDREILTPSSSTCLDKRSQ-------GDVNRKD----YVSSR  177

Query  1818  EQSVKASLSSRSTDKKEHCIKHTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESIIDSK  1639
             E S K++ +  + +K +  +K  +              ++ D   +S  N    S+ D+ 
Sbjct  178   EYSEKSASNLSTKEKIDESMKQVNK------------PSSEDFRDQSSANF--SSLHDTD  223

Query  1638  VGDA-NDDAVVSGPIKGVEIGDSSVPINCFQTEGQIINVGNDVESQENQTCRSPQTQKVD  1462
               DA N   V S    G  +G  S P              ND   + ++TC + Q   VD
Sbjct  224   --DAWNASRVRSSSYSGDGLGSPSEP-------------DNDGACRGDKTCGTLQKGNVD  268

Query  1461  RGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKV  1282
               D+ SETSMV+ +SG+DI+PDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKV
Sbjct  269   TNDDLSETSMVDSMSGLDITPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKV  328

Query  1281  QKLIAESPNFLLEDTAYLGKP-LKVSSAKRLLPPFEYI-KAPQNVPKHKNDSEKPHLRME  1108
             Q+LIA SP+ +++++AYLGKP LK S AK+L  P EY+ K P N+  HK+D E+   ++E
Sbjct  329   QRLIAGSPHLMVDESAYLGKPSLKSSPAKKL--PLEYVVKPPPNMVMHKDDYERASHQLE  386

Query  1107  CSAENTVGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPVM  928
             CSAEN VGK  L SV+N     +  P  GNPP      DS MGPWC+ QP GHQWL+PVM
Sbjct  387   CSAENAVGKTHLPSVKNGNPPSNYGPYIGNPPPAPAPTDSKMGPWCYPQPPGHQWLVPVM  446

Query  927   TPSEGLVYKPYPGPGFMSPGCG--PPPVSTPVMGNFFAPPAYGLPTSQYHYQGMG-DPFA  757
             +PSEGLVYKPYPGPGFMS  CG   P  S P+ G+F   PAYG+P+S +H+QG+G  P  
Sbjct  447   SPSEGLVYKPYPGPGFMSTVCGGCGPMGSAPMTGSFIN-PAYGVPSS-HHHQGIGVHPGT  504

Query  756   PPIGHGYFPPYGMPVMNS-AVSTSAVEQMNSFTRTGS---QAQVSGGGVNLNVQHQNSCN  589
             PPIGHGYFPPYGM VMN   +S SAVEQMN F   GS     Q+SGGG + N+QHQNSCN
Sbjct  505   PPIGHGYFPPYGMSVMNHPTISGSAVEQMNRFAGHGSLSQSGQLSGGGASFNMQHQNSCN  564

Query  588   MPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPV  409
             +P+ K     +    +    KD+E Q S ASSPS R   V      EGR  LPLFP +P 
Sbjct  565   VPTPKRA---IPQGVKFPMSKDSEFQGSTASSPSEREQQVGTGDTAEGRDPLPLFPMAPA  621

Query  408   VNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
                    QP  T  P RVIRVVPHN RSA+ESAARIFQSIQ ERKQ
Sbjct  622   AIPAGDPQPNGTDQPTRVIRVVPHNPRSATESAARIFQSIQDERKQ  667



>ref|XP_004253100.1| PREDICTED: protein EARLY FLOWERING 3 [Solanum lycopersicum]
Length=722

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/743 (52%), Positives = 466/743 (63%), Gaps = 90/743 (12%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  2158
             +MGPMFPRLHVNDTEKGGP+APPRNKMALYEQLSIPSQRF +G+   N NNA        
Sbjct  10    LMGPMFPRLHVNDTEKGGPKAPPRNKMALYEQLSIPSQRFKYGI-SNNRNNAD-------  61

Query  2157  SQGNGHERRMFLPMHLPPSTYSAEKLHAHSSDSNTPLTQFESRKKTDEDDFRVPVFVNSN  1978
              QGNG E   F  + LPPS + AE  H+ SS+S TPL   ES KKT+EDDFRVP+FV S 
Sbjct  62    IQGNGRENDDFFSVQLPPSRHPAENPHSCSSNSKTPLLPVESNKKTEEDDFRVPIFVKSK  121

Query  1977  ISQSIGKFYKNSEREKVSPSSPAFLGRSTKDAKHTRGGNLRHQESSRQLPATREQSVKAS  1798
              SQ  GK Y   +  K+S S+    G S KD          + E+ +Q+   RE S   S
Sbjct  122   ASQGNGKLYSTLDGRKLSASTAVISGHSRKDL---------NDENFKQIAVGREISCN-S  171

Query  1797  LSSRSTDKKEHCIKHTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESIIDSKVGDANDD  1618
              S  S DK +  +K  D    L  E R+ P N   +  K+ + LQPE  +D +VG     
Sbjct  172   TSIPSMDKLDDLLKKADVQ--LQYEPRNDPDNTLGILCKNDL-LQPECRVDPQVGGT---  225

Query  1617  AVVSGPIKGVEIGDSSVPINCFQTEGQII---NVGNDVESQENQTCRSPQTQKVDRGDNS  1447
              ++S P++ V+IGDSS+ +    ++  II   N  ND ES+E++   S QT+ V++ D+ 
Sbjct  226   -MLSEPVRVVDIGDSSLLVKDVASKEHIIPNNNQSNDKESKEDKASESLQTKIVNQDDDL  284

Query  1446  SETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIA  1267
             SETSMVE I GM ISPDDVV IIGQKHFW ARRAI  QQR FAVQVFELHRLIKVQ+LIA
Sbjct  285   SETSMVESIFGMYISPDDVVAIIGQKHFWNARRAIATQQRAFAVQVFELHRLIKVQRLIA  344

Query  1266  ESPNFLLEDTAYL----------------------------------------------G  1225
              S + +LED+AYL                                              G
Sbjct  345   SSQS-MLEDSAYLSKAVKDSSPKKLPLEYIARDGHNVPKQRKNFEKPNTRMECSAENTEG  403

Query  1224  KPLKVSSAKRLLPPFEYI-KAPQNVPKHKNDSEKPHLRMECSAENTVGKASLSSVQNATQ  1048
             KP+K SSAKRLL   EYI +   NV K K D EKP++ MECSAENTVGK S SSVQN +Q
Sbjct  404   KPVKDSSAKRLL--LEYIPRDGHNVSKQKKDFEKPNISMECSAENTVGKGSFSSVQNNSQ  461

Query  1047  APSCKPSPGNPPLPVVSNDSNM-GPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGPGFMSP  871
             + S     G+P    ++NDS M GPW F+QPSGHQWLIPVMTPSEGLVYKPY GPG  S 
Sbjct  462   SSSYSLFSGHP----IANDSTMGGPWSFNQPSGHQWLIPVMTPSEGLVYKPYLGPGVTSS  517

Query  870   GCG--PPPVSTPVMGNFFAPPAYGLPTSQYHYQGMGDPFAPPIGHGYFPPYGMPVMNSAV  697
              CG   PP STP++GN  A P+YG+P S + YQG+  PF PP GH YFP YG+P +N A+
Sbjct  518   ICGGYGPPGSTPIIGNHSA-PSYGIPASHHQYQGVRMPFTPPAGHNYFPSYGIPAINPAI  576

Query  696   STSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNE  517
             S+SAV+Q + F   G Q Q+SGGG N +VQ QNS NMPS KNG        +  +C+D E
Sbjct  577   SSSAVDQSSLFVAQGLQGQLSGGGANFSVQRQNSSNMPSNKNG---TFPEVKSRSCRDAE  633

Query  516   IQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVD-ASQPPDTGHPARVIRVVP  340
             +QAS ASSPS  A  +TV    E R+VLPLFPTSP    +D +SQP    H ARVI+VVP
Sbjct  634   MQASTASSPSGTANKITVDNATERRNVLPLFPTSPATKNLDISSQPQLPSHHARVIKVVP  693

Query  339   HNARSASESAARIFQSIQKERKQ  271
              NARSA+ESAARIFQSIQ+ERKQ
Sbjct  694   RNARSATESAARIFQSIQEERKQ  716



>gb|KDP34132.1| hypothetical protein JCGZ_07703 [Jatropha curcas]
Length=718

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/721 (51%), Positives = 451/721 (63%), Gaps = 50/721 (7%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPP-S  2161
             IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF+H VLP NP+ ASNLIP  S
Sbjct  10    IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFNHAVLPLNPSKASNLIPAAS  69

Query  2160  PSQGNGHERRMFLPMHLPP-STYSAEKLHAHSSDSNTPLT--QFESRKKTD-EDDFRVPV  1993
              SQG+G ER +  P H+PP S++  E LH+HSS  N   +  Q E RKK   EDDFRVPV
Sbjct  70    SSQGSGFERSLQFPNHVPPTSSHLVENLHSHSSGGNLNASSPQLEQRKKVGYEDDFRVPV  129

Query  1992  FVNSNISQSIGKFYKNSEREKVSPSSPAFLGRSTK-------DAKH--TRGGNLR---HQ  1849
             FV S +   + K     +  K +P S  +L  S K       D K+  +R  NLR     
Sbjct  130   FVQSGMGGCLPKSQNGIDGGKPTPFSQNYLSHSVKVKDAGDSDKKNYSSRVPNLRLDTRN  189

Query  1848  ESSRQLP---ATREQSVKASLSSRSTDKKEHCIKHTDTDFPLHSEQRDGPANNSDLSHKS  1678
             +S  +L    ++R+ SV++S +  +T KK   +     D   + +  D P  N     ++
Sbjct  190   QSEEKLEVCVSSRDHSVRSS-TKFATRKKIASL----GDAYQNQQNPDLPGANFSRFCEN  244

Query  1677  GINLQPESIIDSKVGDANDDAVVSGPIKGVEIGDSSVPI-------NCFQTEGQIINVGN  1519
                LQ ES    +  ++ +   V    + +E G+   P        +C       I    
Sbjct  245   DDFLQQESTAFLQQDNSGNGEGVPELTREIEKGNIFCPRSDSLSREDCSSPNKPEI----  300

Query  1518  DVESQENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIV  1339
             D E    +TCRS Q    D+ D+ SETSMV+ IS +DISPD+VVGIIGQKHFWKARRAIV
Sbjct  301   DCELSGEKTCRSLQFGNGDKSDDVSETSMVDSISALDISPDEVVGIIGQKHFWKARRAIV  360

Query  1338  NQQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGK-PLKVSSAKRLLPPFEYIKAP  1162
             NQQR+FAVQVFELHRLIKVQ+LIA SP+ LLED  YLG  P KVS AK+L P F  +  P
Sbjct  361   NQQRLFAVQVFELHRLIKVQRLIAASPDLLLEDGTYLGTPPTKVSPAKKLPPEF-VVSPP  419

Query  1161  QNVPKHKNDSEKPHLRMECSAENTVGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNM  982
              +V K K+  EKP+ +MECSAEN +GK S SS +N +Q  +     GNPP   V  DS M
Sbjct  420   VHVAKRKDYPEKPNHKMECSAENAIGKTSFSSAKNGSQPSNNGSYLGNPPPVPVPTDSKM  479

Query  981   GPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGPGFMSPGCG--PPPVSTPVMGNFFAPPAY  808
              PWCF    GHQWL+PVM+PSEGLVYKPY  PGF+   CG   P  ++P++GNF   P Y
Sbjct  480   SPWCFQHSLGHQWLVPVMSPSEGLVYKPYNAPGFLGSACGGCGPFGASPMVGNFIN-PTY  538

Query  807   GLPTSQYHYQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFT---RTGSQAQV  637
             G+P S +H+QG G  F P + HGYFPPYGMPVM+ A+S SAVEQMN F     TG   QV
Sbjct  539   GIPPSSHHHQGTG--FIPGV-HGYFPPYGMPVMHPAMSGSAVEQMNYFAGAGSTGQTGQV  595

Query  636   SGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSG  457
             SGGG N NVQHQ+SCN+P+QK+G   V    +  A KD E++ S ASSP  R  GV    
Sbjct  596   SGGGANFNVQHQSSCNLPNQKSG--SVPQVPKFRASKDTELRGSTASSPGERVQGVGTVE  653

Query  456   PMEGRSVLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKER  277
               EGR  L LFP +P      ASQP +T  P RVI+VVPHN RSA+ESAARIF+SIQ ER
Sbjct  654   AAEGRDALLLFPVAPAT-PEGASQPQETDMPTRVIKVVPHNPRSATESAARIFKSIQAER  712

Query  276   K  274
             K
Sbjct  713   K  713



>ref|XP_007012227.1| Hydroxyproline-rich glycoprotein family protein, putative [Theobroma 
cacao]
 gb|EOY29846.1| Hydroxyproline-rich glycoprotein family protein, putative [Theobroma 
cacao]
Length=714

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/723 (51%), Positives = 440/723 (61%), Gaps = 56/723 (8%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  2158
             IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF   VLP NP+N S+L+PP  
Sbjct  10    IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFSPAVLPLNPSNKSSLVPPGS  69

Query  2157  SQGNGH-ERRMFLP--MHLPPSTYSAEKLHAH---SSDSNTPLTQFESRKKTDEDDFRVP  1996
             S      ER M  P  + L  ST  AEK        +  N PL + E RK  DEDDF VP
Sbjct  70    SSQGSSLERNMLFPSRVSLSTSTNLAEKFSTRQLGGASVNAPLARLEQRKVRDEDDFMVP  129

Query  1995  VFVNSNISQSIGKFYKNSEREKVSPSSPAFLGRSTK-----DAKHTRGG----NLRHQ--  1849
             VFVNS       K    S+ EK++P SP +  R  K     D    R      NLR +  
Sbjct  130   VFVNSETGHQHNKTKNGSDGEKLTPLSPTYPSRLIKLQNVCDKDPNRSSYSVVNLRKEVR  189

Query  1848  ---ESSRQLPATREQSVKASLSSRSTDKKEHCIKHT----DTDFPLHSEQRDGPANNSDL  1690
                E S ++ ++RE+SVK +    + +K +  +K      D D   H   R    + +D 
Sbjct  190   DQIEESSRVCSSRERSVKTAADLSTREKSDGHVKEANMSPDQDCGEHPASRLSRLHENDA  249

Query  1689  S----HKSGINLQPESIIDSKVGDANDDAVVSGPIKGVEIGDSSVPINCFQTEGQIINVG  1522
                   K+G N   E + D   G  +    +S        G+ S P              
Sbjct  250   CLQQPAKNGCNNGAELMRDIDEGILSRQRSMS-----YSEGNHSGPDE----------TN  294

Query  1521  NDVESQENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAI  1342
             ND E + ++TC S Q    D+ DN SETS+V+  SG DISPDDVV IIGQKHF KARRAI
Sbjct  295   NDSECRGDKTCGSLQWANEDKSDNVSETSIVDSASGSDISPDDVVEIIGQKHFLKARRAI  354

Query  1341  VNQQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAP  1162
             VNQQR+FAVQVFELHRLIKVQ+LIA SP+ LLEDTAYL KP    S  + LPP E+I  P
Sbjct  355   VNQQRIFAVQVFELHRLIKVQRLIAGSPHILLEDTAYLSKPSFQGSPAKKLPP-EFIVKP  413

Query  1161  QNVPKHKNDSEKPHLRMECSAENTVGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNM  982
                 K K+D+EKP  +MECSAEN VG+ SLSSV+N +Q  +  P  GNPP   V+ D+ M
Sbjct  414   LPHTKCKDDTEKPSHKMECSAENAVGRTSLSSVKNGSQPSNYGPFLGNPPPAPVNGDNKM  473

Query  981   GPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGPGFMSPGCG--PPPVSTPVMGNFFAPPAY  808
              PWCFHQ  GHQWL+PVM+PSEGL+YKPY GPGFM   CG   P   TP+ GNF    AY
Sbjct  474   NPWCFHQMPGHQWLVPVMSPSEGLIYKPYTGPGFMGSICGGCGPFGQTPMTGNFMT-SAY  532

Query  807   GLPTSQYHYQGMGD-PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQA---Q  640
             G+      +QG+G  P APP+GH YFPPYGMPVMN AVS SAVEQMN F   GS A   Q
Sbjct  533   GVAAPP--HQGIGVLPGAPPVGHSYFPPYGMPVMNPAVSGSAVEQMNQFAGPGSYAHNGQ  590

Query  639   VSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVS  460
              SGGG N N+QHQNSCN+PS+KNG   +S   +  A KD E+Q S ASSP  R       
Sbjct  591   FSGGGANFNMQHQNSCNLPSEKNG--AISHVMKFQASKDTELQGSTASSPGERVQRDGTR  648

Query  459   GPMEGRSVLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKE  280
                EG++ LPLF T+P + +  A QP D+    RVIRVVPHN RSA+ESAARIFQSIQ+E
Sbjct  649   SAAEGKNALPLFRTAPTI-LEGAPQPHDSEQTTRVIRVVPHNPRSATESAARIFQSIQEE  707

Query  279   RKQ  271
             RKQ
Sbjct  708   RKQ  710



>ref|XP_006340248.1| PREDICTED: protein EARLY FLOWERING 3-like [Solanum tuberosum]
Length=609

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/695 (51%), Positives = 427/695 (61%), Gaps = 102/695 (15%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  2158
             +MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQR++ G LP N +N++NL PP  
Sbjct  10    VMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRYNPGDLPHNSSNSANLFPPHS  69

Query  2157  SQGNGHERRMFLPMHLPPSTYSAEKLHAHSSDSNTPLTQFESRKKTDEDDFRVPVFVNSN  1978
             SQ N HER +F    LP   +  EK +  SS SNTPL + +S+++T ++DFRVP F NS 
Sbjct  70    SQENEHERGVFFSRQLPALRHPVEKPYGCSSGSNTPLREVKSKRQTQKEDFRVPTFGNS-  128

Query  1977  ISQSIGKFYKNSEREKVSPSSPAFLGRSTKDAKHTRGGNLRHQESSRQLPATREQSVKAS  1798
                                                           ++   +RE   K +
Sbjct  129   ----------------------------------------------KEHAVSREDYFKGT  142

Query  1797  LSSRSTDKKEHCIKHTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESIIDSKVGDANDD  1618
               S S DK++  +K TD     H + R+   N    SHK+ I +Q E   DS+V      
Sbjct  143   SDSLSIDKRDGTLKRTDQ--LSHFKPRENLVNTFGESHKTNI-VQLEFRSDSQV------  193

Query  1617  AVVSGPIKGVEIGDSSVPINCFQTEGQIINVGNDVESQENQTCRSPQTQKVDRGDNSSET  1438
                                +C    G +I+V +D  SQE++TC+S QT ++   D  SET
Sbjct  194   -------------------DCTVFSGSVIDVDDD--SQEDKTCKSSQTGEMAHSDELSET  232

Query  1437  SMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAESP  1258
             SMVE +S MDISPDDVV +IGQKHFWKARRAI NQQR+ AVQVFELHRL+KVQKLIA SP
Sbjct  233   SMVEYVSEMDISPDDVVRMIGQKHFWKARRAIANQQRMLAVQVFELHRLLKVQKLIAGSP  292

Query  1257  NFLLEDTAYLGKPLKVSSAKRLLPPFEY-IKAPQNVPKHKNDSEKPHLRMECSAENTVGK  1081
             N  LED AYLGKPLK  SAKR+    E+ +KAP+NV +HKNDSEKP+ RMEC+AEN VGK
Sbjct  293   NVNLEDNAYLGKPLKRLSAKRI--SLEHSVKAPENVSRHKNDSEKPNPRMECNAENDVGK  350

Query  1080  ASLSSVQNATQAPSCKP-SPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPVMTPSEGLVY  904
              SLSSVQN  Q  SC P S    P P V +DS M PW F+Q  GHQWLIP+M+PSEGL++
Sbjct  351   TSLSSVQNGCQPSSCNPLSEKQLPTP-VKHDSLMSPWYFNQAPGHQWLIPMMSPSEGLMF  409

Query  903   KPYPGPGFMSP---GCGPPPVSTPVMGNFFAPPAYGLPTSQYHYQGMGDPFAPPIGHGYF  733
             KP+ GP  MSP   GCG PP STP+MGNF A PAYGL            PFAPP GHGYF
Sbjct  410   KPHSGPAVMSPVYGGCG-PPGSTPMMGNFLA-PAYGL------------PFAPPTGHGYF  455

Query  732   PPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNMPSQKNGDADVS  553
              P+GMPVMN A+ + A  Q N    + S+ Q+SGG  + N+QHQNS N  S+ +G   + 
Sbjct  456   RPFGMPVMNPAIPSPAQYQSNQVAASHSKGQLSGGRASFNIQHQNSSNAGSENDG--TMP  513

Query  552   DAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVV-NIVDASQPPD  376
             +  RL+  +D+E+QAS ASSPS R   V +     GRS    FPTSP V N V   QP  
Sbjct  514   EGVRLYPSRDSELQASTASSPSERIRAVDMGNSTRGRSAFHHFPTSPAVDNPVLRPQPHF  573

Query  375   TGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
                PAR I+V PHNARSA+ES ARIFQSIQ ERKQ
Sbjct  574   PLRPARAIKVTPHNARSATESVARIFQSIQDERKQ  608



>gb|AIN75607.1| EARLY FLOWERING 3 [Dimocarpus longan]
Length=726

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/729 (51%), Positives = 453/729 (62%), Gaps = 56/729 (8%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPP-S  2161
             IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIP+QRF+  VLPPNP+N+S+L+PP S
Sbjct  10    IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPTQRFNPAVLPPNPSNSSSLVPPGS  69

Query  2160  PSQGNGHERRMFLPMHLPPSTYS--AEKLHAHSSDSNT---PLTQFESRKKT-DEDDFRV  1999
              SQG+G ER +  P+ +P  T S   EK HA  S  +T   PL Q E RKK  DEDDF V
Sbjct  70    SSQGSGPERNVPFPISVPHKTPSRLTEKFHARQSAGSTLTIPLPQLEQRKKAGDEDDFTV  129

Query  1998  PVFVNSNISQSIGKFYKNSEREKVSPSSPAFLGRSTK-------DAKHTRGGNL------  1858
             PV+V+S  +Q+  K +   +  K+SP  P + G S K       D K +   +L      
Sbjct  130   PVYVHSGKNQNSSKTHNGVDGGKLSPYGPPYPGHSLKSQNVYDNDPKRSSLSDLNLRQEA  189

Query  1857  RHQESSRQLPAT----REQSVKASLSSRSTDKKEHCIKHTDTDFPLHSEQRDGPANNSDL  1690
             RHQ  S + P T    R+ S+K S +  S +K +  +K      P+  E RD P ++ + 
Sbjct  190   RHQ--SEENPNTNFSSRDHSLKPSATLSSREKIDGLVKEASAS-PIQ-ESRDLPESHFNR  245

Query  1689  SHKSGINLQPESI-----IDSKVGDANDDA--VVSGPIKGVEIGDSSVPINCFQTEGQII  1531
              + +  +L+PE+      +D + GD  +    +  G +     G  S   N    E  I 
Sbjct  246   PNDNDTSLRPETRTRSQPVDRRCGDGVESMRDINKGVVHQSRSGSHSREDNSCPIEPDI-  304

Query  1530  NVGNDVESQENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKAR  1351
                 D E +E +TC S Q    D+ D  SETSMV+ ISG+DISPDDVVGIIGQKHFWKAR
Sbjct  305   ----DSEYREEKTCGSLQLGDRDKSDAVSETSMVDSISGLDISPDDVVGIIGQKHFWKAR  360

Query  1350  RAIVNQQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGKP-LKVSSAKRLLPPFEY  1174
             +AI NQQRVFAVQVFELHRLIKVQ+LIA SP  LLED+AYLGK  L  S AK+   P EY
Sbjct  361   KAIANQQRVFAVQVFELHRLIKVQQLIAGSPQLLLEDSAYLGKASLNSSPAKKF--PSEY  418

Query  1173  IKAPQ-NVPKHKNDSEKPHLRMECSAENTVGKASLSSVQNATQAPSCKPSPGNPPLPVVS  997
             +  P  ++ K K+D EKP   MECSAEN VGK S+SSV+N +Q  +      NPP   V+
Sbjct  419   VVKPLPHIVKRKDDFEKPKHNMECSAENAVGKMSVSSVKNGSQPSNYGSYLANPPAASVA  478

Query  996   NDSNMGPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGPGFM---SPGCGPPPVSTPVMGNF  826
             +DS M PW FHQ  G QWLIPVM+PSEGL+YKPYPGPGFM     G   P   TP+ GNF
Sbjct  479   SDSRMAPWYFHQSPGQQWLIPVMSPSEGLIYKPYPGPGFMGPVCGGGCGPFGPTPIPGNF  538

Query  825   FAPPAYGLPTSQYHYQGMGD-PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGS  649
                PAYG+P    H QG+G  P A P+GHGYFPPYGMP+MN +VS+SA EQ N     GS
Sbjct  539   MH-PAYGVPAPHTH-QGIGAMPGAHPVGHGYFPPYGMPIMNQSVSSSAAEQKNQSAGPGS  596

Query  648   QAQ---VSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRA  478
               Q   +SGGG N NVQH++SCN+P+QK G   +  A +  A KD ++Q S ASS   R 
Sbjct  597   LLQNGLLSGGGANFNVQHESSCNVPTQKKG--AIPQAMQFQASKDMDVQGSTASSTGERM  654

Query  477   PGVTVSGPMEGRSVLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIF  298
                      EG+   P F  +  V    A QP DT  P RVIRVVPHN RSA+ES ARIF
Sbjct  655   QHDETGATAEGQEAQPHFSMA-SVPPQGAPQPQDTEQPTRVIRVVPHNPRSATESVARIF  713

Query  297   QSIQKERKQ  271
             QSIQ+ERKQ
Sbjct  714   QSIQEERKQ  722



>ref|XP_009594922.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Nicotiana 
tomentosiformis]
Length=639

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/699 (52%), Positives = 436/699 (62%), Gaps = 80/699 (11%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  2158
             +MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF+ G LP N  N +N +PP  
Sbjct  10    VMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFNPGDLPLN--NNTNTVPPYS  67

Query  2157  SQGNGHERRMFLPMHLPPSTYSAEKLHAHSSDSNTPLTQFESRKKTDEDDFRVPVFVNSN  1978
             SQGN HER +F    LP      EK H  S DSNTPL + +SRK+T+++DFR+P F    
Sbjct  68    SQGNDHERGVFFSRQLPDP---VEKPHGSSCDSNTPLQKVKSRKQTEKNDFRIPTF-GIK  123

Query  1977  ISQSIGKFYKNSEREKVSPSSPAFLGRSTKDAKH-----TRG-GNLRHQESSRQLPATRE  1816
             + Q   K Y   + EK+SPS+ A  G S K++K      TR  G ++H E+S+    +R 
Sbjct  124   VDQGHVKSYNILDMEKLSPSNQAISGCSNKESKEITCLITRQLGKIQHGENSKAGAISR-  182

Query  1815  QSVKASLSSRSTDKKEHCIKHTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESIIDSKV  1636
                K++  S S DK E  +K TD    LH + R   AN                      
Sbjct  183   ---KSTSDSLSLDKAEGILKQTDK--LLHFKPRKNHANT--------------------F  217

Query  1635  GDANDDAVVSGPIKGVEIGDSSVPINCFQTEGQIINVGNDVESQENQTCRSPQTQKVDRG  1456
             G+     +V    +    GD      C    G  ++V N  ES E++TC+S QT  + R 
Sbjct  218   GELQTTNIVRLQFRPDSRGD------CTVFSGSAVDVDN--ESPEDKTCKSSQTGDMGRS  269

Query  1455  DNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQK  1276
             D+ SETSMVE +  MDISPDD+V IIGQK FW+ARRAI NQQRV AVQVFELHRL+KVQK
Sbjct  270   DDLSETSMVEYVPEMDISPDDIVRIIGQKRFWRARRAIANQQRVLAVQVFELHRLLKVQK  329

Query  1275  LIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEY-IKAPQNVPKHKNDSEKPHLRMECSA  1099
             LIA SPN +L D + LGKPLK  S KRL    EY +KAP+NV K KNDSEKP+ R E +A
Sbjct  330   LIASSPNSMLGDGSSLGKPLKRLSTKRLA--LEYNVKAPENVSKQKNDSEKPNSRTESNA  387

Query  1098  ENTVGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPVMTPS  919
             EN VG+ SLSS +  ++  S  P+P       V +DS+MGPW F+Q SG QWLIPVM+PS
Sbjct  388   EN-VGETSLSSRRPLSEIAS--PTP-------VKHDSHMGPWLFNQSSGQQWLIPVMSPS  437

Query  918   EGLVYKPYPGPGFMSP---GCGPPPVSTPVMGNFFAPPAYGLPTSQYHYQGMGDPFAPPI  748
             EGLVYKP+PGP F SP   GCGPP    P   NF A PAY        YQ MG PFAPP 
Sbjct  438   EGLVYKPHPGPAFTSPVYGGCGPP---NP---NFLA-PAY--------YQRMGAPFAPPT  482

Query  747   GHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNMPSQKNG  568
             GHGYFPP+GM VMN  + + A++Q +    T SQ Q S G  N N+QHQNS N+ S+ N 
Sbjct  483   GHGYFPPFGMSVMNPVIPSPAIDQPDQIAETSSQGQFSEGRANFNIQHQNSSNVASENN-  541

Query  567   DADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDAS  388
                + D  RL+  +D+E+QAS ASSPS R+  V V     GR V PLFPTSP  N     
Sbjct  542   -VTMPDV-RLYLSRDSELQASTASSPSERSRRVDVVNSTGGRIVFPLFPTSPASNPDLKR  599

Query  387   QPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
             Q      P +VI+VVPHNARSA+ESAARIFQSIQ+ERKQ
Sbjct  600   QQHFPSSPTKVIKVVPHNARSATESAARIFQSIQEERKQ  638



>ref|XP_009594920.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Nicotiana 
tomentosiformis]
Length=654

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/715 (50%), Positives = 436/715 (61%), Gaps = 97/715 (14%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  2158
             +MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF+ G LP N  N +N +PP  
Sbjct  10    VMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFNPGDLPLN--NNTNTVPPYS  67

Query  2157  SQ---------------GNGHERRMFLPMHLPPSTYSAEKLHAHSSDSNTPLTQFESRKK  2023
             SQ               GN HER +F    LP      EK H  S DSNTPL + +SRK+
Sbjct  68    SQEDAIQLCRCDSIFLKGNDHERGVFFSRQLPDP---VEKPHGSSCDSNTPLQKVKSRKQ  124

Query  2022  TDEDDFRVPVFVNSNISQSIGKFYKNSEREKVSPSSPAFLGRSTKDAKH-----TRG-GN  1861
             T+++DFR+P F    + Q   K Y   + EK+SPS+ A  G S K++K      TR  G 
Sbjct  125   TEKNDFRIPTF-GIKVDQGHVKSYNILDMEKLSPSNQAISGCSNKESKEITCLITRQLGK  183

Query  1860  LRHQESSRQLPATREQSVKASLSSRSTDKKEHCIKHTDTDFPLHSEQRDGPANNSDLSHK  1681
             ++H E+S+    +R    K++  S S DK E  +K TD    LH + R   AN       
Sbjct  184   IQHGENSKAGAISR----KSTSDSLSLDKAEGILKQTDK--LLHFKPRKNHANT------  231

Query  1680  SGINLQPESIIDSKVGDANDDAVVSGPIKGVEIGDSSVPINCFQTEGQIINVGNDVESQE  1501
                            G+     +V    +    GD      C    G  ++V N  ES E
Sbjct  232   --------------FGELQTTNIVRLQFRPDSRGD------CTVFSGSAVDVDN--ESPE  269

Query  1500  NQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVF  1321
             ++TC+S QT  + R D+ SETSMVE +  MDISPDD+V IIGQK FW+ARRAI NQQRV 
Sbjct  270   DKTCKSSQTGDMGRSDDLSETSMVEYVPEMDISPDDIVRIIGQKRFWRARRAIANQQRVL  329

Query  1320  AVQVFELHRLIKVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEY-IKAPQNVPKH  1144
             AVQVFELHRL+KVQKLIA SPN +L D + LGKPLK  S KRL    EY +KAP+NV K 
Sbjct  330   AVQVFELHRLLKVQKLIASSPNSMLGDGSSLGKPLKRLSTKRLA--LEYNVKAPENVSKQ  387

Query  1143  KNDSEKPHLRMECSAENTVGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFH  964
             KNDSEKP+ R E +AEN VG+ SLSS +  ++  S  P+P       V +DS+MGPW F+
Sbjct  388   KNDSEKPNSRTESNAEN-VGETSLSSRRPLSEIAS--PTP-------VKHDSHMGPWLFN  437

Query  963   QPSGHQWLIPVMTPSEGLVYKPYPGPGFMSP---GCGPPPVSTPVMGNFFAPPAYGLPTS  793
             Q SG QWLIPVM+PSEGLVYKP+PGP F SP   GCGPP    P   NF A PAY     
Sbjct  438   QSSGQQWLIPVMSPSEGLVYKPHPGPAFTSPVYGGCGPP---NP---NFLA-PAY-----  485

Query  792   QYHYQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLN  613
                YQ MG PFAPP GHGYFPP+GM VMN  + + A++Q +    T SQ Q S G  N N
Sbjct  486   ---YQRMGAPFAPPTGHGYFPPFGMSVMNPVIPSPAIDQPDQIAETSSQGQFSEGRANFN  542

Query  612   VQHQNSCNMPSQKNGDA-DVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSV  436
             +QHQNS N+ S+ N    DV    RL+  +D+E+QAS ASSPS R+  V V     GR V
Sbjct  543   IQHQNSSNVASENNVTMPDV----RLYLSRDSELQASTASSPSERSRRVDVVNSTGGRIV  598

Query  435   LPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
              PLFPTSP  N     Q      P +VI+VVPHNARSA+ESAARIFQSIQ+ERKQ
Sbjct  599   FPLFPTSPASNPDLKRQQHFPSSPTKVIKVVPHNARSATESAARIFQSIQEERKQ  653



>ref|XP_002516480.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45821.1| conserved hypothetical protein [Ricinus communis]
Length=720

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/723 (50%), Positives = 457/723 (63%), Gaps = 54/723 (7%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFD-HGVLPPNPNNASNLIPP-  2164
             +MGPMFPRLHVNDT+KGGPRAPPRNKMALYEQLSIPSQRF+ HG L  NP+ A+NL+P  
Sbjct  14    MMGPMFPRLHVNDTDKGGPRAPPRNKMALYEQLSIPSQRFNNHGALLHNPSKATNLVPAA  73

Query  2163  SPSQGNGHERRMFLPMHLPPSTYS--AEKLHAHSSD---SNTPLTQFESRKKT-DEDDFR  2002
             S SQG+G+ER + LP+H+PPST+S   EKLH+   D   SN    Q E RKK  DEDDFR
Sbjct  74    SSSQGSGYERNLHLPLHVPPSTHSHLDEKLHSRQPDGGNSNAASAQIEQRKKKGDEDDFR  133

Query  2001  VPVFVNSNISQSIGKFYKNSEREKVSPSSPAFLGRST-------KDAKH--TRGGNLRH-  1852
             VPVF++S + QS+GK     + E  +     +LG ST       KD K+  +RG NLR  
Sbjct  134   VPVFLHSGMGQSLGKTQSGIDMENSTSFGQNYLGHSTRLRDAGDKDQKNNISRGPNLRQD  193

Query  1851  -----QESSRQLPATREQSVKASLSSRSTDKKEHCIKHTDTDFPLHSEQRDGPANNSDLS  1687
                  +E+     ++R  SV++  SS S   KE  I   +   P      D  A++S L 
Sbjct  194   ARNQSKENLEACVSSRGHSVRSFTSSPS---KELMIVRPEDASPSQQNLDDPVASSSSLC  250

Query  1686  HKSGINLQPESIIDSKVGDANDDAVVSGPIKGVEIGDSSVPI-NCFQTEGQIINVGN---  1519
                    Q  S    +  D+  D  V    + +E G+   P+ +   TE   +N  N   
Sbjct  251   ENDVCLQQEASAALLQQNDSGHDEGVPELTRELEKGNGPQPMSDSHSTED--LNSPNEPE  308

Query  1518  -DVESQENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAI  1342
              D E   +++  S Q    D+ D+ SE SM++ +S +D+SPDDVVGIIGQKHFWKARRAI
Sbjct  309   IDSEHHGDRSYMSVQFGNGDKSDDVSEISMLDSVSALDVSPDDVVGIIGQKHFWKARRAI  368

Query  1341  VNQQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGKP-LKVSSAKRLLPPFE-YIK  1168
             V+QQR+FAVQVFELHRLIKVQ+LIA SP+ LLE++ YLGKP +KVS AK+  PP E  + 
Sbjct  369   VSQQRLFAVQVFELHRLIKVQRLIAGSPHLLLEESTYLGKPSMKVSPAKK--PPSENVVT  426

Query  1167  APQNVPKHKNDSEKPHLRMECSAENTVGKASLSSVQNATQAPSCKPSPGNP-PLPVVSND  991
              P +V K K D EK +  ME SAEN VGK   SSV+N +Q  +C P  GNP P+PV + D
Sbjct  427   PPVHVSKRKYDPEKLNHNMEYSAENAVGK--FSSVKNGSQPSNCGPYTGNPKPVPVAA-D  483

Query  990   SNMGPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGPGFMSPGCGP--PPVSTPVMGNFFAP  817
             S M PWCF    GHQWL+PVM+PSEGLVYKPY  PGFM   CG   P   +PV GNF   
Sbjct  484   SKMAPWCFQHSLGHQWLVPVMSPSEGLVYKPYAAPGFMGSVCGGCRPFGPSPVTGNFMD-  542

Query  816   PAYGLPTSQYHYQG-MGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQ  640
             P YG+P S + +QG M  P  P +GHGYFPPYGMP+M+S +  SAVEQMN + + G   Q
Sbjct  543   PTYGVPASHHPHQGTMPMPGVPALGHGYFPPYGMPIMSSTMPGSAVEQMNYYGQAG---Q  599

Query  639   VSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVS  460
             +SGGG N+ VQH    ++  QK+G   +   ++  A KD E++ S ASSPS R  G   +
Sbjct  600   LSGGGANIVVQHP---SLQLQKSG--SIPRVNKPRASKDTELRGSTASSPSERVQGAGNA  654

Query  459   GPMEGRSVLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKE  280
                E R  LPLFPT+P+  +  A+QP  T  P  VI+VVPHN RSA+ESAARIFQSIQ+E
Sbjct  655   QAAETRDPLPLFPTAPIA-LEGATQPQLTNQPRGVIKVVPHNRRSATESAARIFQSIQEE  713

Query  279   RKQ  271
             RKQ
Sbjct  714   RKQ  716



>ref|XP_011095302.1| PREDICTED: protein EARLY FLOWERING 3-like [Sesamum indicum]
Length=678

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/696 (50%), Positives = 447/696 (64%), Gaps = 38/696 (5%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  2158
             IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF H +LP NPNNAS L+PPS 
Sbjct  10    IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFSHQMLPLNPNNAS-LVPPS-  67

Query  2157  SQGNGHERRMFLPMHLPPSTYSAEKLHAHSSDSNTPLTQFESRKKTDEDDFRVPVFVNSN  1978
              QG  +ER MF    LP + + +EK ++  SD +TPLT+ + RKK DEDDFRVP+FV S 
Sbjct  68    DQGLANERGMFYTYQLP-NRHQSEKQYSQYSDLSTPLTKVKQRKKLDEDDFRVPIFVQSV  126

Query  1977  ISQSIGKFYKNSEREKVSPSSPAFLGRSTKDAKHTRGGNLRHQESSRQLPATREQSVKAS  1798
              SQ  GK+    +RE +SPS+ +     +K     +GG  + +E+  +    R   VKA 
Sbjct  127   PSQEYGKY--TYDRENLSPSNHSNSNHPSK----KQGGKCQTEENPEEFSTDR---VKAI  177

Query  1797  LSSRSTDKKEHCIKHTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESIIDSKVGDANDD  1618
              +S   +K E   K TD+   L  E  D PA++ D        L+ +  +++ +  A  +
Sbjct  178   SNSSPIEKAEGLKKQTDSS--LCHEPGDNPADSVD-------RLKTDDNVETDLC-AESE  227

Query  1617  AVVSGPIKGVEIGDSSVPINCFQTEGQII--NVGNDVESQENQTCRSPQTQKVDRGDNSS  1444
              V+S  I  V+  +SS  +    +E Q I  ++ N+ ES+E+ + RS Q +K++RGD+ S
Sbjct  228   PVLSENIATVDKRNSSTSVRSSPSEDQNICHDLSNETESREDGSSRSLQMRKLERGDSVS  287

Query  1443  ETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAE  1264
             E+S V+ +S  DI+PDDVVGIIGQK FWKARRAI NQQRVFAVQVFELHRL+KVQ+LIA 
Sbjct  288   ESSGVDSLSRPDITPDDVVGIIGQKRFWKARRAIANQQRVFAVQVFELHRLVKVQRLIAA  347

Query  1263  SPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPHLRMECSAENTVG  1084
             SP+ LL+D+AY+GKP+K +  KR L  +    A  +V K K +SEKP  R E SAENT+G
Sbjct  348   SPHLLLDDSAYVGKPMKSTPGKRTLLNYPVKAAIPDVSKEKGESEKPSRRNESSAENTLG  407

Query  1083  KASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPVMTPSEGLVY  904
             + S SS Q      SC P   N   P +++D N GP CF+QP G+ WLIPVM+PSEGL+Y
Sbjct  408   RGSFSSTQAGVPPQSCMPVSSNSQAPPMNSDHNAGPGCFNQPHGYHWLIPVMSPSEGLIY  467

Query  903   KPYPGPGFMSPGCG--PPPVSTPVMGNFFAPPAYGLPTSQYHYQGMGDPFAPPIG-HGYF  733
             KPYPGPGF+ P CG   PP S P+MGN    PAYG+P     YQ    P  P  G HGYF
Sbjct  468   KPYPGPGFVGPACGGCGPPGSNPMMGNIMG-PAYGVPAPHPQYQ--WPPTFPLAGPHGYF  524

Query  732   PPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNMPSQKNGDADVS  553
             PPY MP+M   +S S+V+QMN  +  G   Q S G  N+NVQ   S  MPS  N  A   
Sbjct  525   PPYSMPMM--TLSGSSVDQMNIPSIRG---QASTGEANVNVQLHKSYAMPS-NNNQASPE  578

Query  552   DAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDASQ--PP  379
               + +H  KD E+QAS  SSP         S  +EGR++LPLFPTSP ++   + Q   P
Sbjct  579   ALNNVHVSKDMEVQASTESSPIDVLHDGRASSIVEGRNILPLFPTSPAIDTNSSPQLPQP  638

Query  378   DTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
             +     +VI+VVPHNARSA+ESAARIF+SIQ+ER+Q
Sbjct  639   EPEQTTQVIKVVPHNARSATESAARIFRSIQEERRQ  674



>ref|XP_011081715.1| PREDICTED: LOW QUALITY PROTEIN: protein EARLY FLOWERING 3 [Sesamum 
indicum]
Length=694

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/709 (50%), Positives = 445/709 (63%), Gaps = 48/709 (7%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  2158
             +MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF H V+P +P+N++  + P  
Sbjct  10    MMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFSHPVMPCDPSNSAANLVPRL  69

Query  2157  SQGNGHERRMFLPMHLPPSTYSAEKLHAHSSDSNTPLTQFESRKKTDEDDFRVPVFVNSN  1978
             SQG G++R M     +PP  + +E  ++  SD +T   Q + RKK +E D+ VPVFV+S 
Sbjct  70    SQGGGNDRGMCFSRQVPPG-HPSENQYSQYSDFSTSSPQLQQRKKLNEGDYSVPVFVHSI  128

Query  1977  ISQSIGKFYKNSEREKVSPSSPAFLGRSTK--DAKHT--------RGGNLRHQESSRQLP  1828
              SQ   K+  N +RE++S S+P     S K  DA+ T        + GN + +E+S+++ 
Sbjct  129   ASQEFDKYSINMDRERLSSSNPHIFDHSLKSQDAEETGMNEHSTRQEGNNQKRENSKEVV  188

Query  1827  ATREQSVKASLSSRSTDKKEHCIKHTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESII  1648
                   VKA  +S STDK+  C         L  E RD P++N D   K+   ++PE   
Sbjct  189   VGW---VKAISNSSSTDKQTGC--------SLIHESRDEPSDNID-RLKTDNCVRPELCA  236

Query  1647  DSK-VGDANDDAVVSGPIKGVEIGDSSVPINCFQTEGQ--IINVGNDVESQENQTCRSPQ  1477
             +S+   +   +A +      V   +SS       +E Q  +  V ND ES E+ +CRSPQ
Sbjct  237   ESQPSSNRQCNAALRKNTISVARRNSSDSNKGLPSEDQNLVHGVSNDTESSEDGSCRSPQ  296

Query  1476  TQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELH  1297
                +++GD+ SETS+++ ISG+DI+PDDVV +IGQKHFWKARRA+VNQQR+FAVQVFELH
Sbjct  297   MNNLEKGDSVSETSVLDTISGLDITPDDVVSMIGQKHFWKARRALVNQQRLFAVQVFELH  356

Query  1296  RLIKVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPHL  1117
             RLIKVQKLI+ SP+ LLED+ YLGKPLK    K+ LP    +KA  NV K K D+EKP  
Sbjct  357   RLIKVQKLISASPHVLLEDSGYLGKPLKPLHGKK-LPLGCAVKAIPNVSKQKGDTEKPSH  415

Query  1116  RMECSAENTVGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSG-HQWL  940
             + E SAENTV KAS+SS QN     SC P   N P P V+       WCF+QP G HQWL
Sbjct  416   KKEGSAENTVEKASISSAQNGGLPSSCGPLSANSPAPSVNQS-----WCFNQPQGPHQWL  470

Query  939   IPVMTPSEGLVYKPYPGPGFMSPGCGPPPVSTPVMGNFFAPPAYGLPTSQYHYQGMGDPF  760
             IPVM+PSEGLVYKPYPGPGFM   C  PP S P+MGN   P  YGLP     YQ    P 
Sbjct  471   IPVMSPSEGLVYKPYPGPGFMGQPCA-PPASNPMMGNILTP--YGLPAPPPQYQ---LPS  524

Query  759   APPIG-HGYF-PPYGMPVMNSAV-STSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCN  589
              PP+G HGY  PPYGMP+MN+A  S S+VEQMN     G  +       N   QH N   
Sbjct  525   FPPVGPHGYLPPPYGMPIMNTAAFSGSSVEQMNPPATLGRFSGGEENETNFINQHHNLFT  584

Query  588   MPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPV  409
              PSQKNG A   D +   A KD ++QAS  SSP  R  G   S  +EGR++LPLFPTS  
Sbjct  585   SPSQKNG-AVPDDINLRRASKDIDMQASTGSSPIERRSGSQASNNLEGRNMLPLFPTSGA  643

Query  408   VNIVDASQPPDTGHP---ARVIRVVPHNARSASESAARIFQSIQKERKQ  271
             ++   ++  P    P   +RVI+V+PHNA SASESAARIF+SIQ+ERKQ
Sbjct  644   ISASKST--PQVATPERQSRVIKVIPHNALSASESAARIFRSIQEERKQ  690



>ref|XP_004251173.1| PREDICTED: protein EARLY FLOWERING 3-like [Solanum lycopersicum]
Length=603

 Score =   548 bits (1411),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 331/698 (47%), Positives = 416/698 (60%), Gaps = 114/698 (16%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  2158
             +MGPMFPRL+VNDTEKGGPRAPPRNKMALYEQLSIPSQR++ G LP N +N++NL+ P P
Sbjct  10    VMGPMFPRLNVNDTEKGGPRAPPRNKMALYEQLSIPSQRYNPGDLPHNSSNSANLVLPHP  69

Query  2157  SQGNGHERRMFLPMHLPPSTYSAEKLHAHSSDSNTPLTQFESRKKTDEDDFRVPVFVNSN  1978
             SQ N HER +     LP   +  EK +  SS SNTPL + +S+++T+++DFRVP F N  
Sbjct  70    SQENEHERGVLFSRQLPALRHPVEKPYGRSSGSNTPLREVKSKRQTEKEDFRVPTFDN--  127

Query  1977  ISQSIGKFYKNSEREKVSPSSPAFLGRSTKDAKHTRGGNLRHQESSRQLPATREQSVKAS  1798
                                                                ++E++V   
Sbjct  128   ---------------------------------------------------SKERAVNTE  136

Query  1797  LSSRST---DKKEHCIKHTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESIIDSKVGDA  1627
               S+ T   DK++  +K TD                  LSH     + P   + +  G++
Sbjct  137   DYSKGTSDIDKRDSTLKRTD-----------------QLSH-----VTPRENLVNTFGES  174

Query  1626  NDDAVVSGPIKGVEIGDSSVPINCFQTEGQIINVGNDVESQENQTCRSPQTQKVDRGDNS  1447
             +   +V    +      S   ++C    G +I+V ND  SQE++TC+S QT ++   D  
Sbjct  175   HKTNIVQLEFR------SDCQVDCTVFSGSVIDVDND--SQEDKTCKSSQTGEMAHSDEL  226

Query  1446  SETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIA  1267
             SETSMVE +S MDISPD+VV +IGQKHFWKARRAI NQQR  A+QVFELHRL+KVQKLIA
Sbjct  227   SETSMVEYVSEMDISPDNVVRMIGQKHFWKARRAIANQQRTLALQVFELHRLLKVQKLIA  286

Query  1266  ESPNFLLEDTAYLGKPLKVSSAKRLLPPFEY-IKAPQNVPKHKNDSEKPHLRMECSAENT  1090
              SPN  LED AYLGKPLK  SAKR+    E+ +KAP+ V + KNDSEKP  RMEC+AEN 
Sbjct  287   GSPNLNLEDNAYLGKPLKRLSAKRVC--LEHSVKAPEIVSRPKNDSEKPKGRMECNAEND  344

Query  1089  VGKASLSSVQNATQAPSCKP-SPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPVMTPSEG  913
             VGK SLSSV+   Q  SC P S    P P V +DS M PW F+QP GHQWLIP+M+PSEG
Sbjct  345   VGKTSLSSVR---QPSSCNPLSEKQLPTP-VKHDSLMSPWYFNQPPGHQWLIPMMSPSEG  400

Query  912   LVYKPYPGPGFMSP---GCGPPPVSTPVMGNFFAPPAYGLPTSQYHYQGMGDPFAPPIGH  742
             LVYKP+ GP  MSP   GCG PP STP+ GNF A  AYGL            PFAPP GH
Sbjct  401   LVYKPHSGPAVMSPVYGGCG-PPGSTPMTGNFLA-SAYGL------------PFAPPTGH  446

Query  741   GYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNMPSQKNGDA  562
             GYF P+GMPV N A+ +    Q N    + S+ Q+SGG  + N+QH NS N+ S+ +G  
Sbjct  447   GYFRPFGMPVTNPAIPSPTQNQSNQVVASHSKGQLSGGRASFNIQHPNSSNVGSESDG--  504

Query  561   DVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVV-NIVDASQ  385
              + +  RL+  +D+E+ AS A SPS     V +     GRS    FPTSP V N +   Q
Sbjct  505   TLPEVVRLYPSRDSELHASTAGSPSEITRAVDMGNSTRGRSAFHHFPTSPAVDNPILRPQ  564

Query  384   PPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
             P     PAR I+ +PHNARSA+ES ARIFQSIQ+ERKQ
Sbjct  565   PHFPERPARAIKAIPHNARSATESVARIFQSIQEERKQ  602



>gb|KHN29734.1| Protein EARLY FLOWERING 3 [Glycine soja]
Length=714

 Score =   538 bits (1386),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 343/716 (48%), Positives = 430/716 (60%), Gaps = 42/716 (6%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPP-S  2161
             +MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQ SIPSQRF+ GVLP NPN +SN +PP S
Sbjct  10    VMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQFSIPSQRFNSGVLPLNPNISSNTVPPAS  69

Query  2160  PSQGNGHERRMFLPMHLPPS--TYSAEKLHAHSSDSNTPLTQFESRKKTDEDDFRVPVFV  1987
              S G   ER    P+HLPP    + AEK ++  S+        E RKK DEDDFRVPV+ 
Sbjct  70    SSLGTVPERNCVYPVHLPPQRPIHRAEKCNSRQSEGTNLSASLEQRKKVDEDDFRVPVYF  129

Query  1986  NSNISQSIGKFYKNSEREKVSPSSPAFLGRST-------KDAKHTRGGNLRHQESSRQ--  1834
             +S   Q   K  ++   +K++P+   + G S        +D K      +  ++  R   
Sbjct  130   HSRTGQCNDKSVESFNGKKLTPTGSRYFGGSISGQSDCERDPKQFGSSVVNMRKDVRSEI  189

Query  1833  --LPATREQSVKASLSSRSTDKKE--HCIKHTDTDFPLHSEQRDGPANNSDLSHKSGINL  1666
               LP       +AS+S RS   +E  H +       P + E +D   +  +   +    L
Sbjct  190   DVLPQVSTSKEQASMSVRSISTRENIHTLLRQAKVTP-NREFQDCHVSKFNRLQQGETCL  248

Query  1665  QPESIIDSKVGDANDDAVVSGPIKGVEIGDSSVPINCFQTEGQIINVGNDVESQENQTCR  1486
             Q E  ++S+  D  D+  +    +  + G++  P     +    IN   D E  + +   
Sbjct  249   QLECGVESRSNDIGDNGCLVESARETDKGNA--PTANQTSPADAIN---DTEHHDTRMGS  303

Query  1485  SPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVF  1306
               Q   ++  DN+S+ SMVE +S + ISPDDVVGIIGQKHFWKARRAI NQQRVFAVQVF
Sbjct  304   PIQMGNLNESDNASKISMVENLSTVRISPDDVVGIIGQKHFWKARRAIANQQRVFAVQVF  363

Query  1305  ELHRLIKVQKLIAESPNFLLEDTAYLGK-PLKVSSAKRLLPPFEYIKAP--QNVPKHKND  1135
             ELHRLIKVQ+LIA SP+ LLED A+LGK P K S+ K+L    EY+  P  QN+ K K+D
Sbjct  364   ELHRLIKVQQLIAGSPDILLEDGAFLGKSPPKGSTPKKLA--LEYVVKPRQQNL-KRKDD  420

Query  1134  SEKPHLRMECSAENTVGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQ-P  958
             SEK + +MECSAEN VGK SLSSV++ +    C P PGN     V+ DS MGPWCF+Q P
Sbjct  421   SEKLNHKMECSAENAVGKTSLSSVKDGSHLSKCTPFPGNQHQTNVAADSGMGPWCFNQSP  480

Query  957   SGHQWLIPVMTPSEGLVYKPYPGPGFMSPGCGPPPVST--PVMGNFFAPPAYGLPTSQYH  784
              GH WLIPVMTPSEGLVYKPYPGPGF   GCG         ++G  F  P YG+PTS   
Sbjct  481   PGHPWLIPVMTPSEGLVYKPYPGPGFTGTGCGGGCGPFVPALLGGSFMNPGYGIPTS---  537

Query  783   YQGMG-DPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQV----SGGGVN  619
             +QG+G  P   P  HGY PPYGMPVMNS++S S VEQ N F+  GS         GG  N
Sbjct  538   HQGVGVPPDTHPGSHGYLPPYGMPVMNSSMSESVVEQGNQFSALGSHGHNGHLPGGGKAN  597

Query  618   LNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRS  439
              N  +++SCN+P Q+NG   +S   +    KD E+Q + ASSPS  A G++     EGR 
Sbjct  598   HNTNNKSSCNLPVQRNG--AISHVLKHQTSKDFELQETSASSPSEMAQGLSTGQVAEGRD  655

Query  438   VLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
             VLPLFP  P        Q  +TG   RVI+VVPHN RSA+ SAARIFQSIQ+ RKQ
Sbjct  656   VLPLFPMVP-AEPESVPQSLETGQHTRVIKVVPHNRRSATASAARIFQSIQEGRKQ  710



>ref|XP_009337143.1| PREDICTED: protein EARLY FLOWERING 3-like [Pyrus x bretschneideri]
Length=674

 Score =   535 bits (1377),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 347/707 (49%), Positives = 427/707 (60%), Gaps = 63/707 (9%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  2158
             +MGPMFPRLHVND +KGGPRAPPRNKMALYEQLSIPSQRF+ GVLP N NN         
Sbjct  9     VMGPMFPRLHVNDADKGGPRAPPRNKMALYEQLSIPSQRFNPGVLPLNSNN---------  59

Query  2157  SQGNGHERRMFLPMHLPPST--YSAEKLHAHSSDS---NTPLTQFE-SRKKTDEDDFRVP  1996
              QG+  +  +  P+H  PST  + AE LH   SD    N P  Q + +RK  DEDDF VP
Sbjct  60    -QGSRSDGNLPFPLHGHPSTPTHQAEMLHGRQSDRANVNLPFEQTKLTRKIGDEDDFSVP  118

Query  1995  VFVNSNISQSIGKFYKNSEREKVSPSSPAFLGRSTKDAKHTRGGNLRHQESSRQLPATRE  1816
              FV S +     K    S++EK++P S    G   K  K+    + + Q SS  L   RE
Sbjct  119   EFVQSRMGLCHSKTQIVSDKEKLTPISSPHSGHLVK-VKNAAKKDPK-QISSPTLNLRRE  176

Query  1815  QSVKASLSSRSTD-KKEHCIKHTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESIIDSK  1639
               V AS +    +       +  ++D  L  E R G   N        +  Q + +++S 
Sbjct  177   --VNASPNQEDAECSVPRFNRLAESDACLQQESRSGSRPN--------VTGQGDGLVESS  226

Query  1638  VGDANDDAVVSGPIKGVEIGDSSVP--INCFQTEGQIINV-GNDVESQENQTCRSPQTQK  1468
                           + VE G  S    ++C + +    N   ND E + +  C SPQ   
Sbjct  227   --------------RDVEKGTVSRERSVSCSRADPSSPNEPDNDSEYRGDTACISPQMGH  272

Query  1467  VDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLI  1288
             VD+GD+ SETSMV+ ISGMDISPDDVVGIIGQKHFW AR+AIVNQQR+FAVQVFELHRL+
Sbjct  273   VDKGDDVSETSMVDSISGMDISPDDVVGIIGQKHFWTARKAIVNQQRLFAVQVFELHRLV  332

Query  1287  KVQKLIAESPNFLLEDTAYLG-KPLKVSSAKRLLPPFEYIKAP-QNVPKHKNDSEKPHLR  1114
             KVQ+LIA SP+ LLEDTA+LG   L+ S AK+L    EY+  P  +V K K++ E+P+ +
Sbjct  333   KVQRLIAGSPHLLLEDTAFLGTSTLRGSPAKKL--SSEYVVKPLLHVVKRKHEPEEPNNK  390

Query  1113  MECSAENTVGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIP  934
             MECSAEN VGK S SSV+N +Q  +  P  GNP    V+ D+   PWCFHQ  GHQ LIP
Sbjct  391   MECSAENAVGKTSHSSVRNGSQTSNNGPYLGNPQPTPVATDNKANPWCFHQSPGHQLLIP  450

Query  933   VMTPSEGLVYKPYPGPGFMSPGCG--PPPVSTPVMGNFFAPPAYGLPTSQYHYQGMGD-P  763
             VM+PSEGLVYKPY GPG+M   CG   P  STP+ GNF   P YG+P+S  H+QGMG  P
Sbjct  451   VMSPSEGLVYKPYNGPGYMGAVCGGCGPFGSTPMAGNFVK-PTYGVPSS--HHQGMGVLP  507

Query  762   FAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQA---QVSGGGVNLNVQHQNSC  592
               P +GH YFPPYGM VMN A+STS VEQM+ F   GS     Q SGGG N N+QHQ+SC
Sbjct  508   VPPSLGHTYFPPYGMSVMNPAMSTSPVEQMHWFAGPGSHGHTDQSSGGGTNSNLQHQSSC  567

Query  591   NMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSP  412
             NMPS+KN    +  A +     D+ +Q S A+S   RAP V  +   EG   L L P  P
Sbjct  568   NMPSRKN--VTIPHAKKFQPSNDSGLQGSTANSTGDRAP-VRTNQNAEGSDALQLLPMVP  624

Query  411   VVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
             V+      Q  DT  P R I+VVPHN R+A+ SAARIFQSIQ ERKQ
Sbjct  625   VIPD-GVPQSHDTDQPTRAIKVVPHNPRTATASAARIFQSIQAERKQ  670



>gb|KDO79979.1| hypothetical protein CISIN_1g004928mg [Citrus sinensis]
Length=723

 Score =   535 bits (1378),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 351/729 (48%), Positives = 440/729 (60%), Gaps = 59/729 (8%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  2158
             IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIP+QRF  GVLP NP+N+S+L+PP  
Sbjct  10    IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPTQRFSTGVLPLNPSNSSSLVPPVS  69

Query  2157  S-QGNGHERRMFLPMHLPPST--YSAEKLHAH---SSDSNTPLTQFE-SRKKTDEDDFRV  1999
             S QGNG ER +     + PST  +  EK H+     +  NT L   E S+K ++EDDF V
Sbjct  70    SSQGNGLERNLLFAHSVHPSTPTHLDEKCHSDQPAGATLNTHLQHHEQSKKVSEEDDFAV  129

Query  1998  PVFVNSNISQSIGKFYKNSEREKVSPSSPAFLGRSTK----------------DAKHTRG  1867
             P+F  + + Q  GK   + ++  +SP +P+   +STK                 +   +G
Sbjct  130   PIFDQAGMGQCHGKSQSDVDKGNLSPFNPSNTRKSTKFQNACDKNPKRSSSSSISLRQQG  189

Query  1866  GNLRHQESSRQLPATREQSVKASLSSRSTDKKEHCIKHTDTDFPLHSEQRDGP----ANN  1699
             G++  QE+ +   +      K+S++    +K +  +K           +  G      N+
Sbjct  190   GHV-CQENPKICISIGNFPAKSSVNLSIREKIDGIVKEVSASPNQEYREISGSDFSRIND  248

Query  1698  SD--LSHKSGINLQPESI-----IDSKVGDANDDAVVSGPIKGVEIGDSSVPINCFQTEG  1540
             SD  L  +SG  L P        +DS  GD   + V+         GD+    +C    G
Sbjct  249   SDASLRLESGAGLPPNGCCRYDDVDS-TGDFQKEVVLQ------PRGDTHSTEDCGHRSG  301

Query  1539  QIINVGNDVESQENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFW  1360
                 + ND     ++TC S Q    D+ D+ SETSMV+ +SG+D+SPDDVVGIIG KHFW
Sbjct  302   ----LHNDSRYHVDKTCGSLQLGSGDKSDDVSETSMVDSMSGVDMSPDDVVGIIGHKHFW  357

Query  1359  KARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGKP-LKVSSAKRLLPP  1183
             KARRAIVNQQRVFAVQVFELHRLIKVQ+LIAESP+ LLE++A LGKP LK S AK+L  P
Sbjct  358   KARRAIVNQQRVFAVQVFELHRLIKVQQLIAESPDVLLEESACLGKPSLKASPAKKL--P  415

Query  1182  FEYIKAPQ-NVPKHKNDSEKPHLRMECSAENTVGKASLSSVQNATQAPSCKPSPGNPPLP  1006
              EY+  P  +  K K DSEKP+ ++E SAEN VGK SLSSV+N +Q  +  P   N P P
Sbjct  416   LEYVVKPLPHSVKRKVDSEKPNHKIESSAENAVGKTSLSSVKNGSQPSNYGPYCANQPPP  475

Query  1005  VVSNDSNMGPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGPGFMSPGCG---PPPVSTPVM  835
             + + +S M  WCFHQ  G QWLIPVM+PSEGL+YKPYPGPGFM   CG    P    P+ 
Sbjct  476   MEATNSRMAHWCFHQSPGQQWLIPVMSPSEGLIYKPYPGPGFMGTVCGGGCSPFGPAPLT  535

Query  834   GNFFAPPAYGLPTSQYHYQGMG-DPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTR  658
             GNF   P YG+ TS    QG G  P A  +GHGYFPPYGMPVMN +VS SA EQ N F  
Sbjct  536   GNFMH-PDYGI-TSPIPLQGNGVMPGAHLVGHGYFPPYGMPVMNPSVSGSAAEQKNQFAV  593

Query  657   TGSQAQVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRA  478
              GS+ Q S G  N  +  ++SCN+P+QKNG   V    +  A KD E+Q S ASSP  R 
Sbjct  594   PGSRDQFSQGDANFYMPQESSCNVPAQKNG--AVPPVRQFQASKDTELQGSTASSPGERV  651

Query  477   PGVTVSGPMEGRSVLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIF  298
              G  +    EG   L +   SPVV    A QP D   P +VI+VVPHN RSA+ES ARIF
Sbjct  652   RGDGMGHAAEGTDALQVSTVSPVVQEA-APQPHDADQPTKVIKVVPHNPRSATESVARIF  710

Query  297   QSIQKERKQ  271
             QSIQ+ERKQ
Sbjct  711   QSIQEERKQ  719



>ref|XP_003523640.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Glycine 
max]
 ref|XP_006578075.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Glycine 
max]
 gb|ACJ61495.1| early flowering 3 [Glycine max]
Length=714

 Score =   535 bits (1377),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 342/716 (48%), Positives = 429/716 (60%), Gaps = 42/716 (6%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPP-S  2161
             +MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQ SIPSQRF+ GVLP NPN +SN +PP S
Sbjct  10    VMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQFSIPSQRFNSGVLPLNPNISSNTVPPAS  69

Query  2160  PSQGNGHERRMFLPMHLPPS--TYSAEKLHAHSSDSNTPLTQFESRKKTDEDDFRVPVFV  1987
              S     ER    P+HLPP    + AEK ++  S+        E RKK DEDDFRVPV+ 
Sbjct  70    SSLRTVPERNCVYPVHLPPQRPIHRAEKCNSRQSEGTNLSASLEQRKKVDEDDFRVPVYF  129

Query  1986  NSNISQSIGKFYKNSEREKVSPSSPAFLGRST-------KDAKHTRGGNLRHQESSRQ--  1834
             +S   Q   K  ++   +K++P+   + G S        +D K      +  ++  R   
Sbjct  130   HSRTGQCNDKSVESFNGKKLTPTGSRYFGGSISGQSDCERDPKQFGSSVVNMRKDVRSEI  189

Query  1833  --LPATREQSVKASLSSRSTDKKE--HCIKHTDTDFPLHSEQRDGPANNSDLSHKSGINL  1666
               LP       +AS+S RS   +E  H +       P + E +D   +  +   +    L
Sbjct  190   DVLPQVSTSKEQASMSVRSISTRENIHTLLRQAKVTP-NREFQDCHVSKFNRLQQGETCL  248

Query  1665  QPESIIDSKVGDANDDAVVSGPIKGVEIGDSSVPINCFQTEGQIINVGNDVESQENQTCR  1486
             Q E  ++S+  D  D+  +    +  + G++  P     +    IN   D E  + +   
Sbjct  249   QLECGVESRSNDIGDNGCLVESARETDKGNA--PTANQTSPADAIN---DTEHHDTRMGS  303

Query  1485  SPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVF  1306
               Q   ++  DN+S+ SMVE +S + ISPDDVVGIIGQKHFWKARRAI NQQRVFAVQVF
Sbjct  304   PIQRGNLNESDNASKISMVENLSTVRISPDDVVGIIGQKHFWKARRAIANQQRVFAVQVF  363

Query  1305  ELHRLIKVQKLIAESPNFLLEDTAYLGK-PLKVSSAKRLLPPFEYIKAP--QNVPKHKND  1135
             ELHRLIKVQ+LIA SP+ LLED A+LGK P K S+ K+L    EY+  P  QN+ K K+D
Sbjct  364   ELHRLIKVQQLIAGSPDILLEDGAFLGKSPPKGSTPKKLA--LEYVVKPRQQNL-KRKDD  420

Query  1134  SEKPHLRMECSAENTVGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQ-P  958
             SEK + +MECSAEN VGK SLSSV++ +    C P PGN     V+ DS MGPWCF+Q P
Sbjct  421   SEKLNHKMECSAENAVGKTSLSSVKDGSHLSKCTPFPGNQHQTNVAADSGMGPWCFNQSP  480

Query  957   SGHQWLIPVMTPSEGLVYKPYPGPGFMSPGCGPPPVST--PVMGNFFAPPAYGLPTSQYH  784
              GH WLIPVMTPSEGLVYKPYPGPGF   GCG         ++G  F  P YG+PTS   
Sbjct  481   PGHPWLIPVMTPSEGLVYKPYPGPGFTGTGCGGGCGPFVPALLGGSFMNPGYGIPTS---  537

Query  783   YQGMG-DPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQV----SGGGVN  619
             +QG+G  P   P  HGY PPYGMPVMNS++S S VEQ N F+  GS         GG  N
Sbjct  538   HQGVGVPPDTHPGSHGYLPPYGMPVMNSSMSESVVEQGNQFSALGSHGHNGHLPGGGKAN  597

Query  618   LNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRS  439
              N  +++SCN+P Q+NG   +S   +    KD E+Q + ASSPS  A G++     EGR 
Sbjct  598   HNTNNKSSCNLPVQRNG--AISHVLKHQTSKDFELQETSASSPSEMAQGLSTGQVAEGRD  655

Query  438   VLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
             VLPLFP  P        Q  +TG   RVI+VVPHN RSA+ SAARIFQSIQ+ RKQ
Sbjct  656   VLPLFPMVP-AEPESVPQSLETGQHTRVIKVVPHNRRSATASAARIFQSIQEGRKQ  710



>ref|XP_008357349.1| PREDICTED: protein EARLY FLOWERING 3-like [Malus domestica]
Length=674

 Score =   533 bits (1373),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 347/707 (49%), Positives = 424/707 (60%), Gaps = 63/707 (9%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  2158
             +MGPMFPRLHVND +KGGPRAPPRNKMALYEQLSIPSQRF+ GVLP N NN         
Sbjct  9     VMGPMFPRLHVNDADKGGPRAPPRNKMALYEQLSIPSQRFNPGVLPLNSNN---------  59

Query  2157  SQGNGHERRMFLPMHLPPST--YSAEKLHAHSSDS---NTPLTQFE-SRKKTDEDDFRVP  1996
              QG+  +  +  P+H  PST  + AE LH   SD    N P  Q   +RK  DEDDF VP
Sbjct  60    -QGSRSDGNLPFPLHGHPSTPTHQAEMLHGRQSDRANVNLPFEQTNLTRKIGDEDDFSVP  118

Query  1995  VFVNSNISQSIGKFYKNSEREKVSPSSPAFLGRSTKDAKHTRGGNLRHQESSRQLPATRE  1816
              FV S +     K    S++EK++P S    G   K  K+    + + Q SS  L   RE
Sbjct  119   EFVQSRMGLGHSKTQIVSDKEKLTPISSPHSGHLVK-VKNAAKKDPK-QISSPTLNLRRE  176

Query  1815  QSVKASLSSRSTD-KKEHCIKHTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESIIDSK  1639
               V AS +    +       +  D+D  L    R G   N        +  Q + +++S 
Sbjct  177   --VNASPNQEDAECSVPRFNRLADSDACLQQVSRSGSQPN--------VTGQGDGLVESS  226

Query  1638  VGDANDDAVVSGPIKGVEIGDSSVP--INCFQTEGQIIN-VGNDVESQENQTCRSPQTQK  1468
                           + VE G  S    ++C   +    N   ND E + ++ C SPQ   
Sbjct  227   --------------RDVEKGTVSRERSVSCSXADPSSPNEADNDSEYRGDRACISPQMGH  272

Query  1467  VDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLI  1288
             VD+ D++SETSMV+ ISGMDISPDDVVGIIGQKHFW AR+AIVNQQR+FAVQVFELHRLI
Sbjct  273   VDKSDDASETSMVDSISGMDISPDDVVGIIGQKHFWTARKAIVNQQRLFAVQVFELHRLI  332

Query  1287  KVQKLIAESPNFLLEDTAYLG-KPLKVSSAKRLLPPFEYIKAP-QNVPKHKNDSEKPHLR  1114
             KVQ+LIA SP+ LLEDTA+LG   L+ S AK+L    EY+  P  +V K K+  E+P+ +
Sbjct  333   KVQRLIAGSPHLLLEDTAFLGTSTLRGSPAKKL--SSEYVVKPLLHVVKRKHXPEEPNNK  390

Query  1113  MECSAENTVGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIP  934
              ECSAEN VGK S SSV+N +Q  +  P  GNP    V+ D+   PWCFHQ  GHQ LIP
Sbjct  391   XECSAENAVGKTSHSSVRNGSQTSNYGPYIGNPQPTPVATDNKANPWCFHQSPGHQLLIP  450

Query  933   VMTPSEGLVYKPYPGPGFMSPGCG--PPPVSTPVMGNFFAPPAYGLPTSQYHYQGMGD-P  763
             VM+PSEGLVYKPY GPG+M   CG   P  STP+ GNF   P YG+P+S  H+QGMG  P
Sbjct  451   VMSPSEGLVYKPYNGPGYMGAVCGGCGPFGSTPMAGNFVK-PTYGVPSS--HHQGMGVLP  507

Query  762   FAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQA---QVSGGGVNLNVQHQNSC  592
               P +GH YFPPYGM VMN A+STSAVEQM+ F   GS     Q SGGG N N+QHQ+SC
Sbjct  508   VPPSLGHTYFPPYGMSVMNPAMSTSAVEQMHWFAGPGSHGHTDQSSGGGTNSNLQHQSSC  567

Query  591   NMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSP  412
             NMPS+KN    +  A +     D+ +Q S A+S   RAP V  +   EG   L L P  P
Sbjct  568   NMPSRKN--VTIPHAKKFQPSNDSGLQGSTANSTGDRAP-VRTNQNAEGSDALQLLPMVP  624

Query  411   VVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
             V+      Q  DT  P R I+VVPHN R+A+ SAARIFQSIQ ERKQ
Sbjct  625   VIPD-GVPQSHDTDQPTRAIKVVPHNPRTATASAARIFQSIQAERKQ  670



>ref|XP_006475975.1| PREDICTED: protein EARLY FLOWERING 3-like [Citrus sinensis]
Length=723

 Score =   535 bits (1377),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 352/728 (48%), Positives = 439/728 (60%), Gaps = 57/728 (8%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  2158
             IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIP+QRF  GVLP NP+N+S+L+PP  
Sbjct  10    IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPTQRFSTGVLPLNPSNSSSLVPPVS  69

Query  2157  S-QGNGHERRMFLPMHLPPST--YSAEKLHAH---SSDSNTPLTQFE-SRKKTDEDDFRV  1999
             S QGNG ER +     + PST  +  EK H+     +  NT L   E S+K ++EDDF V
Sbjct  70    SSQGNGLERNLLFAHSVHPSTPTHLDEKCHSDQPAGATLNTHLQHHEQSKKVSEEDDFAV  129

Query  1998  PVFVNSNISQSIGKFYKNSEREKVSPSSPAFLGRSTK-----DAKHTRG----------G  1864
             P+F  + + Q  GK   + ++  +SP +P+   +STK     D    R           G
Sbjct  130   PIFDQAGMGQCHGKSQSDVDKGNLSPFNPSNTRKSTKFQNACDKNPKRSSSSSISLRQQG  189

Query  1863  NLRHQESSRQLPATREQSVKASLSSRSTDKKEHCIKHT----DTDFPLHSEQRDGPANNS  1696
                 QE+ +   +      K+S++    +K +  +K      + ++   S       N+S
Sbjct  190   GHACQENPKICISIGNFPAKSSVNLSIREKIDGIVKEVSASPNQEYREISGSDFSRINDS  249

Query  1695  D--LSHKSGINLQPESI-----IDSKVGDANDDAVVSGPIKGVEIGDSSVPINCFQTEGQ  1537
             D  L  +SG  L P        +DS  GD   + V+         GD+    +C    G 
Sbjct  250   DASLRLESGAGLPPNGCCRYDDVDS-TGDFQKEVVLQ------PRGDTHSTEDCGHRSG-  301

Query  1536  IINVGNDVESQENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWK  1357
                + ND     ++TC S Q    D+ D+ SETSMV+ +SG+D+SPDDVVGIIG KHFWK
Sbjct  302   ---LHNDSRYHVDKTCGSLQLGSGDKSDDVSETSMVDSMSGVDMSPDDVVGIIGHKHFWK  358

Query  1356  ARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGKP-LKVSSAKRLLPPF  1180
             ARRAIVNQQRVFAVQVFELHRLIKVQ+LIAESP+ LLE++A LGKP LK S AK+L  P 
Sbjct  359   ARRAIVNQQRVFAVQVFELHRLIKVQQLIAESPDVLLEESACLGKPSLKASPAKKL--PL  416

Query  1179  EYIKAPQ-NVPKHKNDSEKPHLRMECSAENTVGKASLSSVQNATQAPSCKPSPGNPPLPV  1003
             EY+  P  +  K K DSEKP+ ++E SAEN VGK SLSSV+N +Q  +  P   N P P+
Sbjct  417   EYVVKPLPHSVKRKVDSEKPNHKIESSAENAVGKTSLSSVKNGSQPSNYGPYCANQPPPM  476

Query  1002  VSNDSNMGPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGPGFMSPGCG---PPPVSTPVMG  832
              + +S M  WCFHQ  G QWLIPVM+PSEGL+YKPYPGPGFM   CG    P    P+ G
Sbjct  477   EATNSRMAHWCFHQSPGQQWLIPVMSPSEGLIYKPYPGPGFMGTVCGGGCSPFGPAPLTG  536

Query  831   NFFAPPAYGLPTSQYHYQGMG-DPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRT  655
             NF   P YG+ TS    QG G  P A  +GHGYFPPYGMPVMN +VS SA EQ N F   
Sbjct  537   NFMH-PDYGI-TSPIPLQGNGVMPGAHLVGHGYFPPYGMPVMNPSVSGSAAEQKNQFAVP  594

Query  654   GSQAQVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAP  475
             GS+ Q S G  N  +  ++SCN+P+QKNG   V    +  A KD E+Q S ASSP  R  
Sbjct  595   GSRDQFSQGDANFYMPQESSCNVPAQKNG--AVPPVRQFQASKDTELQGSTASSPGERVR  652

Query  474   GVTVSGPMEGRSVLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQ  295
             G  +    EG   L +   SPVV    A QP D   P +VI+VVPHN RSA+ES ARIFQ
Sbjct  653   GDGMGHAAEGTDALQVSTVSPVVQEA-APQPHDADQPTKVIKVVPHNPRSATESVARIFQ  711

Query  294   SIQKERKQ  271
             SIQ+ERKQ
Sbjct  712   SIQEERKQ  719



>ref|XP_006450775.1| hypothetical protein CICLE_v10007592mg [Citrus clementina]
 gb|ESR64015.1| hypothetical protein CICLE_v10007592mg [Citrus clementina]
Length=723

 Score =   533 bits (1374),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 351/729 (48%), Positives = 441/729 (60%), Gaps = 59/729 (8%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  2158
             IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIP+QRF  GVLP NP+N+S+L+PP  
Sbjct  10    IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPTQRFSTGVLPLNPSNSSSLVPPVS  69

Query  2157  S-QGNGHERRMFLPMHLPPST--YSAEKLHAH---SSDSNTPLTQFE-SRKKTDEDDFRV  1999
             S QGNG ER +     + PST  +  EK H+     +  NT L   E S+K ++EDDF V
Sbjct  70    SSQGNGLERNLLFAHSVHPSTPTHLDEKCHSDQPAGATLNTHLQHHEQSKKVSEEDDFAV  129

Query  1998  PVFVNSNISQSIGKFYKNSEREKVSPSSPAFLGRSTK----------------DAKHTRG  1867
             P+F  + + Q  GK   + ++  +SP +P+   +STK                 +   +G
Sbjct  130   PIFDQAGMGQCHGKSQSDVDKGNLSPFNPSNTRKSTKFQNACDKNPKRSSSSSISLRQQG  189

Query  1866  GNLRHQESSRQLPATREQSVKASLSSRSTDKKEHCIKHT----DTDFPLHSEQRDGPANN  1699
             G++  QE+ +   +      K+S++    +K +  +K      + ++   S       N+
Sbjct  190   GHV-CQENPKICISIGNFPAKSSVNLSIREKIDGIVKEVSASPNQEYREISGSDFSRIND  248

Query  1698  SD--LSHKSGINLQPESI-----IDSKVGDANDDAVVSGPIKGVEIGDSSVPINCFQTEG  1540
             SD  L  +SG  L P        +DS  GD   + V+         GD+    +C    G
Sbjct  249   SDASLRLESGAGLPPNGCCRYDDVDS-TGDFQKEVVLQ------PRGDTHSTEDCGHRSG  301

Query  1539  QIINVGNDVESQENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFW  1360
                 + ND     ++TC S Q    D+ D+ SETSMV+ +SG+D+SPDDVVGIIG KHFW
Sbjct  302   ----LHNDSRYHVDKTCGSLQLGSGDKSDDVSETSMVDSMSGVDMSPDDVVGIIGHKHFW  357

Query  1359  KARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGKP-LKVSSAKRLLPP  1183
             KARRAIVNQQRVFAVQVFELHRLIKVQ+LIAESP+ LLE++A LGKP LK S AK+L  P
Sbjct  358   KARRAIVNQQRVFAVQVFELHRLIKVQQLIAESPDVLLEESACLGKPSLKASPAKKL--P  415

Query  1182  FEYIKAPQ-NVPKHKNDSEKPHLRMECSAENTVGKASLSSVQNATQAPSCKPSPGNPPLP  1006
              EY+  P  +  K K DSEKP+ ++E SAEN VGK SLSSV+  +Q  +  P   N P P
Sbjct  416   LEYVVKPLPHSVKRKVDSEKPNHKIESSAENAVGKTSLSSVKMGSQPSNYGPYCANQPPP  475

Query  1005  VVSNDSNMGPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGPGFMSPGCG---PPPVSTPVM  835
             + + +S M  WCFHQ  G QWLIPVM+PSEGL+YKPYPGPGFM   CG    P    P+ 
Sbjct  476   MEATNSRMAHWCFHQSPGQQWLIPVMSPSEGLIYKPYPGPGFMGTVCGGGCSPFGPAPLT  535

Query  834   GNFFAPPAYGLPTSQYHYQGMG-DPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTR  658
             GNF   P YG+ TS    QG G  P A  +GHGYFPPYGMPVMN +VS SA EQ N F  
Sbjct  536   GNFMH-PDYGI-TSPIPLQGNGVMPGAHLVGHGYFPPYGMPVMNPSVSGSAAEQKNQFAV  593

Query  657   TGSQAQVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRA  478
              GS+ Q S G  N  +  ++SCN+P+QKNG   V    +  A KD E+Q S ASSP  R 
Sbjct  594   PGSRDQFSQGDANFYMPQESSCNVPAQKNG--AVPPVRQFQASKDTELQGSTASSPGERV  651

Query  477   PGVTVSGPMEGRSVLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIF  298
              G  +    EG   L L   SPVV    A QP D   P +VI+VVPHN RSA+ES ARIF
Sbjct  652   RGDGMGHAAEGTDALQLSTVSPVVQEA-APQPHDADQPTKVIKVVPHNPRSATESVARIF  710

Query  297   QSIQKERKQ  271
             QSIQ+ERKQ
Sbjct  711   QSIQEERKQ  719



>ref|XP_009782254.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Nicotiana 
sylvestris]
Length=598

 Score =   523 bits (1346),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 276/419 (66%), Positives = 315/419 (75%), Gaps = 26/419 (6%)
 Frame = -3

Query  1515  VESQENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVN  1336
              E QE++ C+S QT  +D+GDN SETS+VE +SG DISPDDVVGIIG K FWKARRAIVN
Sbjct  194   FERQEDRICKSLQTGIMDQGDNLSETSIVESMSGTDISPDDVVGIIGLKRFWKARRAIVN  253

Query  1335  QQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFE-YIKAPQ  1159
             QQRVFA+QVFELHRLIKVQKLIAESPN +LED  YLGKPLK SS KRL  P E  I+  Q
Sbjct  254   QQRVFAIQVFELHRLIKVQKLIAESPNSMLEDAGYLGKPLKNSSGKRL--PLECIIRESQ  311

Query  1158  NVPKHKNDSEKPHLRMECSAENTVGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMG  979
             +VPK KNDSEKP+ RMECSAENTVGKASLSSVQN +Q  S +P  GNPP   V+ND+N  
Sbjct  312   SVPKRKNDSEKPNFRMECSAENTVGKASLSSVQNGSQLSSHRPFSGNPPPMPVTNDANTS  371

Query  978   PWCFHQPSGHQWLIPVMTPSEGLVYKPYPGPGFMSP---GCGPPPVSTPVMGNFFAPPAY  808
             PWCF QP GHQWLIPVM+PSEGLVYKP+PGPGF +P   GCGPP      MGNFF PPA 
Sbjct  372   PWCFQQPPGHQWLIPVMSPSEGLVYKPFPGPGFTNPINGGCGPP----GSMGNFF-PPAI  426

Query  807   GLPTSQYHYQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGG  628
             G+P    HYQG G PFAPP GHGYFP YGMPVMN  +S+S VE+ N FT  G Q Q+SGG
Sbjct  427   GVPGPHPHYQGTGVPFAPPTGHGYFPHYGMPVMNLPISSSTVEESNQFTSPGFQRQLSGG  486

Query  627   GVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPME  448
               N N+QHQ+S N+PS+KNG  +V D  R  A +DNE+QAS ASSPS RA   T     +
Sbjct  487   IDNFNIQHQDSSNVPSEKNG--NVPDVLRFQATRDNELQASTASSPSERAADTT-----Q  539

Query  447   GRSVLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
             GR++L LFPTSP  +        +T H ARVI+VVPHN RSA+ SAARIFQSIQ+ERKQ
Sbjct  540   GRNMLSLFPTSPATD--------NTDHSARVIKVVPHNPRSATASAARIFQSIQEERKQ  590


 Score =   187 bits (475),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 111/239 (46%), Positives = 143/239 (60%), Gaps = 21/239 (9%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  2158
             +MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF+ GVLP N NN +       
Sbjct  10    VMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFNSGVLPANSNNNT-------  62

Query  2157  SQGNGHERRMFLPMHLPPSTYSAEKLHAHSSDSNTPLTQFESRKKTDEDDFRVPVFVNSN  1978
             ++G+GHER ++ P+  PPS + A+K   HSSD NT L QFE  K+T+EDDF VPVFVNS 
Sbjct  63    AKGSGHERVVYFPVQHPPSGHLADKPPGHSSDPNTLLQQFELNKRTEEDDFTVPVFVNSK  122

Query  1977  ISQSIGKFYKNSEREKVSPSSPAFLGRSTKDAKHTRGGNLRHQESSRQ------LPATRE  1816
                + G    N + EK+SPS P F GR  KD +      LR Q  S+       +PA+RE
Sbjct  123   PDHATGS--HNLDMEKLSPSGPVFSGRPNKDLEGLTDRILRQQRESQNEENPKCIPASRE  180

Query  1815  QSVKA---SLSSRSTDKKEHCIKHTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESII  1648
                 +   S   R   +++   K   T      +Q D  +  S +   SG ++ P+ ++
Sbjct  181   HRTTSNSPSKECRFERQEDRICKSLQTGI---MDQGDNLSETSIVESMSGTDISPDDVV  236



>ref|XP_010097101.1| hypothetical protein L484_019540 [Morus notabilis]
 gb|EXB66902.1| hypothetical protein L484_019540 [Morus notabilis]
Length=727

 Score =   526 bits (1356),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 339/730 (46%), Positives = 437/730 (60%), Gaps = 57/730 (8%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDH--GVLPPNPNNASNLIP-  2167
             I+GPMFPRLHVND +KGGPRAPPRNKMALYEQLSIPSQR +   GV+P NPN ++N++P 
Sbjct  10    IVGPMFPRLHVNDADKGGPRAPPRNKMALYEQLSIPSQRGNSASGVVPLNPNFSANMVPS  69

Query  2166  PSPSQGNGHERRMFLPMHLPPST--YSAEKLHAHSSD----SNTPLTQFESRKKTDE-DD  2008
              + SQ +G ER +  P HLPPST  + +EK  A  SD     N P  Q E R+K +  +D
Sbjct  70    ATSSQASGVERYLVYPRHLPPSTPTHWSEKFQARHSDVLLYGNAPEAQLEQREKVERNED  129

Query  2007  FRVPVFVNSNISQSIGKFYKNSEREKVSPSSPAFLGR-------STKDAKHTRGGNLRHQ  1849
             F VPVFV + ++QS  +   +  RE  +  S    G+       STK+ KH     +  +
Sbjct  130   FIVPVFVQARVNQSHDRSQNSIGRETFASISSTRSGQPVEQQSISTKEPKHNNFTAVSKR  189

Query  1848  -----ESSRQLPATREQSVKASLSSRSTDKKEHCIKHTDTDFPLH-----SEQRDGPANN  1699
                  ES+  +    E +    +S+  T  +E      +TD  L      S Q  G    
Sbjct  190   QDVKSESNENMTTCGESARGCVISATDTSSRE------NTDGLLKEAKATSNQHRGGHVG  243

Query  1698  SDLS--HKSGINLQPESIIDSKVGDANDDAVVSGPIKGVEIGDSSVPIN--CFQTEG---  1540
             S+LS  H     L  +S  + ++  A     +    + +E  ++S P +  C + +    
Sbjct  244   SNLSRLHDGEACLHQDSRTNRQLDSAKRGDDIVDSTRDIERENASQPRSESCCEEDNSGP  303

Query  1539  QIINVGNDVESQENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFW  1360
             +     +   S  N+TC S Q + V++GD+ SETSMV+ ISG+DIS DDVVG+IGQKHFW
Sbjct  304   KEPETDSKYNSNSNRTCISSQIENVNKGDDLSETSMVDSISGVDISSDDVVGVIGQKHFW  363

Query  1359  KARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPF  1180
             KAR+AI  QQRVFAVQVFELHRLIKVQ+LIA SP+ +LED A+LGK     S    LPP 
Sbjct  364   KARKAITIQQRVFAVQVFELHRLIKVQRLIAGSPHLMLEDGAFLGKSSLKGSPVMKLPPE  423

Query  1179  EYIKAPQNVPKHKNDSEKPHLRMECSAENTVGKASLSSVQNATQAPSCKPSPGNPPLPVV  1000
               IK+P  V   K+DS+KP+ +MECSAEN VGK SLSSVQ+ +Q+ +  P  GNP   V 
Sbjct  424   YCIKSPPRVSNCKDDSKKPNHKMECSAENAVGKTSLSSVQSGSQSLNYGPYMGNPQPVVA  483

Query  999   SNDSNMGPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGPGFMSPGCG--PPPVSTPVMGNF  826
               D+ MGPW      G QWL+PVM+P+EGLVYKPY GPG M   CG   P  S P  GNF
Sbjct  484   MTDNKMGPWS----PGPQWLVPVMSPTEGLVYKPYSGPGLMGTSCGGYGPFGSAPGTGNF  539

Query  825   FAPPAYGLPTSQYHYQGMG-DPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGS  649
              +  +YG+  S  H QG G  P   P+ H YF PYGMPV+N A S S VEQ N F R   
Sbjct  540   VS-SSYGISAS--HPQGFGVHPGTSPVCHTYFHPYGMPVINPATSGSTVEQANPFVRPDP  596

Query  648   QAQVS---GGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRA  478
             Q+Q     GGGVNL+++ Q+ C++P+QKNG   VS A +L A + N++  S  SSP  RA
Sbjct  597   QSQTGPALGGGVNLSMEQQSFCHVPTQKNG--SVSQATKLQASERNDLHGSTGSSPGERA  654

Query  477   PGVTVSGPMEGRSVLP-LFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARI  301
              GV +    E R  LP LFP +PVV    A+   D   P RVI+VVPHN RSA+ESAARI
Sbjct  655   NGVGILHNAEERDPLPLLFPMAPVV-PEGATDSQDANQPTRVIKVVPHNPRSATESAARI  713

Query  300   FQSIQKERKQ  271
             F+ IQ+ERKQ
Sbjct  714   FRFIQEERKQ  723



>ref|XP_009629368.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Nicotiana 
tomentosiformis]
Length=608

 Score =   520 bits (1338),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 277/419 (66%), Positives = 315/419 (75%), Gaps = 24/419 (6%)
 Frame = -3

Query  1515  VESQENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVN  1336
              + QE++TC+S QT  VD+GD+ SETS+VE +SG DISPDDVVGIIG K FWKARR IV+
Sbjct  202   FDRQEDRTCKSIQTGIVDQGDDLSETSIVESMSGTDISPDDVVGIIGLKRFWKARREIVS  261

Query  1335  QQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFE-YIKAPQ  1159
             QQRVFA+QVFELHRLIKVQKLIAESPN +LED AYLGKPLK SS KRL  P E  I+  Q
Sbjct  262   QQRVFAIQVFELHRLIKVQKLIAESPNSMLEDAAYLGKPLKSSSGKRL--PLECIIRESQ  319

Query  1158  NVPKHKNDSEKPHLRMECSAENTVGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMG  979
             +VPK KNDSEKP+ RMECSAENTVGKASLSSVQN +Q  S +P  GNPP   V+ND+N  
Sbjct  320   SVPKRKNDSEKPNFRMECSAENTVGKASLSSVQNGSQLSSHRPFSGNPPPTPVTNDANTS  379

Query  978   PWCFHQPSGHQWLIPVMTPSEGLVYKPYPGPGFMSP---GCGPPPVSTPVMGNFFAPPAY  808
             PWCF QP GHQWLIPVM+PSEGLVYKP+PGPGF SP   GCGPP      MGNFF PPA 
Sbjct  380   PWCFQQPPGHQWLIPVMSPSEGLVYKPFPGPGFTSPINGGCGPP----GSMGNFF-PPAI  434

Query  807   GLPTSQYHYQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGG  628
             G+P     YQGMG PFAPP GHGYFP Y MPVMN  +S+S VE+ N FT  G Q Q+SGG
Sbjct  435   GVPGPHPRYQGMGVPFAPPTGHGYFPHYSMPVMNPPISSSTVEESNQFTSPGFQRQLSGG  494

Query  627   GVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPME  448
               N N+QHQ+S N PS+KNG  +V D  R  A +DNE+QAS ASSPS RA    VS   +
Sbjct  495   VDNFNIQHQDSSNGPSEKNG--NVPDVLRFQATRDNELQASTASSPSERA---AVSNATQ  549

Query  447   GRSVLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
             GR++L LFPTSP  +  D        H ARVI+VVPHN RSA+ESAARIFQSIQ+ERKQ
Sbjct  550   GRNMLSLFPTSPATDNPD--------HSARVIKVVPHNPRSATESAARIFQSIQEERKQ  600


 Score =   194 bits (494),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 116/240 (48%), Positives = 147/240 (61%), Gaps = 15/240 (6%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNP-NNASNLIPPS  2161
             +MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF+ GVLP NP NN + L PPS
Sbjct  10    VMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFNSGVLPLNPNNNTAKLPPPS  69

Query  2160  PSQGNGHERRMFLPMHLPPSTYSAEKLHAHSSDSNTPLTQFESRKKTDEDDFRVPVFVNS  1981
              +QG+GHER ++ P+  PPS + A+K   HSSD NT L QFE  K+T+EDDF VPVFVNS
Sbjct  70    SNQGSGHERVVYFPVQHPPSGHLADKPPGHSSDPNTLLEQFELNKRTEEDDFTVPVFVNS  129

Query  1980  NISQSIGKFYKNSEREKVSPSSPAFLGRSTKDAKHTRGGNLRHQESSRQ------LPATR  1819
                 + G    N + EK+SPS P F G   KD +      LR Q  S+       +PA+R
Sbjct  130   KPGHANGS--HNLDMEKLSPSGPVFSGHPNKDLEGLTNLILRQQRDSQNEENPKCIPASR  187

Query  1818  EQSVKA---SLSSRSTDKKEHCIKHTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESII  1648
             E    +   S   R   +++   K   T      +Q D  +  S +   SG ++ P+ ++
Sbjct  188   EHRTTSNSPSKECRFDRQEDRTCKSIQTGI---VDQGDDLSETSIVESMSGTDISPDDVV  244



>ref|XP_004291013.1| PREDICTED: protein EARLY FLOWERING 3-like [Fragaria vesca subsp. 
vesca]
Length=704

 Score =   503 bits (1294),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 337/719 (47%), Positives = 431/719 (60%), Gaps = 57/719 (8%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  2158
             +MGPMFPRLHVND +KGGPRAPPRNKMALYEQLSIPSQR +HG +P + N+ S++  P+ 
Sbjct  11    VMGPMFPRLHVNDPDKGGPRAPPRNKMALYEQLSIPSQRSNHGAMPLHQNSNSSMGSPAL  70

Query  2157  S-QGNGHERRMFLPMHLPPSTYSAEKLHAHSSDSNTPLTQFESRKKT-DEDDFRVPVFVN  1984
             S QGNG ER +  P+H  P+  +     +   + NT   Q + RK+  +EDDF VPVF  
Sbjct  71    SNQGNGPERNLPFPVHARPAAPTHHSGQSDGVNVNTASVQPQQRKRGGNEDDFMVPVF-Q  129

Query  1983  SNISQSIGKFYKNSEREKVSPSSPA-------FLGRSTKDAKHTRGGNLRHQESSRQLPA  1825
             S + Q   +      + K++P + +       F   + KD + +   +L  +  SR+   
Sbjct  130   SRMGQCQSRTQNGGGKAKLTPFNQSHPDHGIIFKSATKKDQRQSSSPSLNLRRESRRETE  189

Query  1824  --------TREQSVKASLSSRSTDKKEHCIKHTDTDFPLHS------EQRDGPANNSDLS  1687
                      R+ SVKA+ S  + ++          D P+++      E  D P    + S
Sbjct  190   EDRNASSPARDHSVKAATSISTRER---------VDIPMNANTSRNQEYEDHPVPTFNRS  240

Query  1686  HKSGINLQPESIIDSKVGDANDDAVVSGPIKGVEIGDSSVPINCFQTEGQIINVGNDVES  1507
               S   LQ +S   +++ D      +    + VE G  S         G+  +  N+ ++
Sbjct  241   CDSDACLQQDSRSGTQLNDTRQGDGLLESTRDVEKGTVSQ-ARSISRFGENPSSPNEPDN  299

Query  1506  QENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQR  1327
                    SPQ    D+GD+ SETSMV+ +SGMDISPDDVVGIIG KHFWKAR+AIVNQQR
Sbjct  300   DSEYRMWSPQRGNADKGDDVSETSMVDSVSGMDISPDDVVGIIGPKHFWKARKAIVNQQR  359

Query  1326  VFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPK  1147
             +FAVQVFELHRLIKVQ+LIA SP+ LLED+A+LG  L+ S AK+L  P +Y+  P  + K
Sbjct  360   LFAVQVFELHRLIKVQRLIAGSPHILLEDSAFLGTSLRRSPAKKL--PADYVVKPL-LLK  416

Query  1146  HKNDSEKPHLRMECSAENTVGKASLSSVQNATQAPSCKPSPGN-PPLPVVSNDSNMGPWC  970
              K++SEK + +MECSAEN V KA LSSV+N +Q     P  GN P    +  D+   PWC
Sbjct  417   RKHESEKSNNKMECSAENAVEKAPLSSVKNCSQPSHHVPYVGNPPAPAPLPADNKAAPWC  476

Query  969   FHQPSGHQWLIPVMTPSEGLVYKPYPGPGFMSPGCG--PPPVSTPVMGNFFAPPAYGLPT  796
             FHQP GHQ+LIPVM+PSEGLVYKPY GPGF+   CG   P  S+P+ GNF   PAYG+P 
Sbjct  477   FHQPPGHQYLIPVMSPSEGLVYKPYNGPGFVGAVCGGCGPFGSSPMTGNFIK-PAYGVPG  535

Query  795   SQYHYQGMGDPFAP-PIGHGYFPPYGMPVMNSAVSTSAVEQMNSFT---RTGSQAQVSGG  628
                H+QGMG   AP P    YFPPYGM VMN  +S+SAVEQMN F      GS  Q+SG 
Sbjct  536   P--HHQGMGVLPAPHPT---YFPPYGMSVMNPTMSSSAVEQMNWFAGPGLHGSTDQLSG-  589

Query  627   GVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPME  448
               N N+QHQ+SCNMP+ KN  A +  A +  A   +E+Q S A+SP  RAP VT     E
Sbjct  590   --NSNLQHQSSCNMPTPKN--AAIPRAMKSRASNPSELQGSTANSPGDRAPVVTDQTAGE  645

Query  447   GRSVLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
                 L LFPT P V      QP  T    RVIRVVPHN RSA+ SAARIFQSIQ+ERKQ
Sbjct  646   S-DALQLFPTVPAV-PERVPQPHVTNQATRVIRVVPHNPRSATASAARIFQSIQEERKQ  702



>gb|AFZ78447.1| early flowering 3 [Lens culinaris]
Length=702

 Score =   501 bits (1289),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 324/726 (45%), Positives = 414/726 (57%), Gaps = 74/726 (10%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPP-S  2161
             +MGP+FPRLHV DTEKGGPRAPPRNKMALYEQ SIPSQRF+   LP +PNN++N +PP S
Sbjct  10    MMGPLFPRLHVGDTEKGGPRAPPRNKMALYEQFSIPSQRFN---LPLHPNNSTNSVPPAS  66

Query  2160  PSQGNGHERRMFLPMHLPPSTY---SAEKLHAHSSDSNT--PLTQFESRKKTDEDDFRVP  1996
              SQG  HER    P HL P T    + + L   S  +N    + Q E RKK DEDDFRVP
Sbjct  67    SSQGTVHERNYIFPGHLTPETLIRQAGKHLSRQSKGANLNGSIAQIEHRKKVDEDDFRVP  126

Query  1995  VFVNSNISQSIGKFYKNSEREKVSPSSPAFLGRSTKDAKHTR--------------GGNL  1858
             V+V SNI QS  K  ++ + +++  +   + G   K  K  R              G ++
Sbjct  127   VYVRSNIGQSNEKRPESFDGKRLPSTGSRYFG-FLKPGKIDRERELIQNGSTVVNAGTDV  185

Query  1857  RHQ-ESSRQLPATREQSVKASLSSRSTDKKEHCIKHT---------DTDFPLHSEQRDGP  1708
             R++ +   Q+   +E  V ++ ++ + ++ +  ++           D     HS  R G 
Sbjct  186   RNEIDGPPQVSPNKEHPVTSARNASTGERVDALVRQVKVTPNQEVQDRRVFKHSSLRQGD  245

Query  1707  AN-NSDLSHKSGINLQPESIIDSKVGDANDDAVVSGPIKGVEIGDSSVPINCFQTEGQII  1531
             A    D   +S  N           G    D ++       E+  S+ PI    +  Q I
Sbjct  246   ARLRQDCRAESQSN-----------GHGQSDGLLEST---REVDTSNGPIVNQISPTQAI  291

Query  1530  NVGNDVESQENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKAR  1351
                ND E  +  T    Q   +++ DN S+ S VE +S + ISPDDVV +IGQKHFWKAR
Sbjct  292   ---NDTEYHDTGTGSPKQLGNLNKNDNISKISRVENLSTVKISPDDVVAVIGQKHFWKAR  348

Query  1350  RAIVNQQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYI  1171
             +AI NQQRVFAVQVFELHRLIKVQ+LIA SP+ L +D A+LGK L   S  + LP    +
Sbjct  349   KAIANQQRVFAVQVFELHRLIKVQQLIAGSPDLLFDDGAFLGKSLPDGSTPKKLPLEYVV  408

Query  1170  KAPQNVPKHKNDSEKPHLRMECSAENTVGKASLSSVQNATQAPSCKPSPGNPPLPVVSND  991
             K      K K DSEK +  MECSAEN VGK S+SSV+N +   S  P  GNP    ++ D
Sbjct  409   KTRLQNLKRKVDSEKINQNMECSAENAVGKTSISSVKNTSHLSSSMPFAGNPHQGNMAAD  468

Query  990   SNMGPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGPGFMSP---GCGPPPVSTPVMGNFFA  820
             + MGPWCF+Q  GHQWLIPVM+PSEGLVYKPYPGPGF      GCGP   S    G  F 
Sbjct  469   NGMGPWCFNQSPGHQWLIPVMSPSEGLVYKPYPGPGFTGTNFGGCGPYGASPS--GGTFM  526

Query  819   PPAYGLPTSQYHYQGMGDPFAPPIGHGYFPPY-GMPVMNSAVSTSAVEQMNSFTRTGSQA  643
              P+YG+P       G          H YFPPY GMPVM +A S SAVE +N F+  G   
Sbjct  527   NPSYGIPPPPEIPPG---------SHAYFPPYGGMPVMKAAASESAVEHVNQFSAHGQNH  577

Query  642   QVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTV  463
             ++S    N N  +Q+SCN+P+Q+N   D S        K+ ++Q S ASSPS  A  ++ 
Sbjct  578   RLSEDEDNCNKHNQSSCNLPAQRN--EDTSHVMYHQRSKEFDLQMSTASSPSEMAQEMST  635

Query  462   SGPMEGRSVLPLFPTSPVVNIVDASQPP--DTGHPARVIRVVPHNARSASESAARIFQSI  289
                 EGR VLPLF   P+V+    S P   +TG   RVI+VVPHN RSA+ESAARIFQSI
Sbjct  636   GQVAEGRDVLPLF---PMVSAEPESVPHSLETGQQTRVIKVVPHNRRSATESAARIFQSI  692

Query  288   QKERKQ  271
             Q+ERKQ
Sbjct  693   QEERKQ  698



>ref|XP_009361544.1| PREDICTED: protein EARLY FLOWERING 3-like [Pyrus x bretschneideri]
Length=701

 Score =   492 bits (1267),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 347/727 (48%), Positives = 422/727 (58%), Gaps = 76/727 (10%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  2158
             +MGPMFPRLHVND +KGGPRAPPRNKMALYEQLSIPSQRF+ GVLP N NN         
Sbjct  9     VMGPMFPRLHVNDADKGGPRAPPRNKMALYEQLSIPSQRFNPGVLPLNSNN---------  59

Query  2157  SQGNGHERRMFLPMHLPPST--YSAEKLHAHSSDS---NTPLTQFESRKKT-DEDDFRVP  1996
              QG+  +  +  P+    ST  + A   H   SD    N P    + R+K  DEDDF VP
Sbjct  60    -QGSRSDGNLAFPLRGRTSTPTHQAVMFHGRQSDRANVNVPFEHTDLRRKIGDEDDFSVP  118

Query  1995  VFVNSNISQSIGKFYKNSEREKVSPSSP------AFLGRSTKDAKHTRGGNLRHQESSRQ  1834
             VFV S +     K    SE +  S SSP             KD K      L     +R+
Sbjct  119   VFVQSRMGLGHSKTPIGSEEKLTSISSPHSDHLVKVRNVGKKDPKQISSPTL---NLTRE  175

Query  1833  LPATREQS-VKASLSSRSTDKKEHCIKHT--DTDFPLHSE----QRDGPANNSDLSH--K  1681
             L + RE+  ++ S SS+    K      T    D P+ +     Q D   +    +   +
Sbjct  176   LRSEREEDLIEVSGSSKGHSGKFAAKISTIQKIDGPVEANASPNQEDAECSVPRFNRLAE  235

Query  1680  SGINLQPESIIDSK--VGDANDDAVVSGPIKGVEIGDSS--VPINCFQTEGQIINV-GND  1516
             S   LQ ES   S+  V    D  V S   + VE G  S    ++C   +    N   ND
Sbjct  236   SDACLQQESRSGSQPNVTGQGDGLVESS--RDVEKGTLSQEKSVSCSGADPTSPNDPDND  293

Query  1515  VESQENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVN  1336
              E + ++ C S Q   VD+ D+ SETSMV+ ISGMDISPDDVVGIIGQKHFWKAR+AIVN
Sbjct  294   SEYRGDRKCISLQMGHVDKSDDVSETSMVDSISGMDISPDDVVGIIGQKHFWKARKAIVN  353

Query  1335  QQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLG-KPLKVSSAKRLLPPFEYIKAP-  1162
             QQR+FAVQVFELHRLIKVQ+LIA SP+ LLEDTA+LG   L+ S A +L    EY+  P 
Sbjct  354   QQRLFAVQVFELHRLIKVQRLIAGSPHLLLEDTAFLGTSTLRGSPATKL--SSEYVVKPL  411

Query  1161  QNVPKHKNDSEKPHLRMECSAENTVGKA-SLSSVQNATQAPSCKPSPGNP-PLPVVSNDS  988
              +V K K++ EKP+ +MECSAEN VGK+ SL             P  GNP P P+ S+ +
Sbjct  412   LHVVKRKHEPEKPNNKMECSAENAVGKSQSL-----------VFPYLGNPQPTPMASDKA  460

Query  987   NMGPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGPGFMSPGCGPPPV---STPVMGNFFAP  817
             +  PWCFHQ  GHQ LIPVM+PSEGLVYKPY GPGFM            STP+MGNF   
Sbjct  461   S--PWCFHQSPGHQLLIPVMSPSEGLVYKPYNGPGFMGGPVCGGCGPYGSTPMMGNFVK-  517

Query  816   PAYGLPTSQYHYQGMGDPFAPPI--GHGYFPPYGMPVMNSAVSTSAVEQMNSF---TRTG  652
             P+YG+P+  +H QGMG    PP   GH YFPPYGM VMN A+ +SAVEQM+ F      G
Sbjct  518   PSYGVPS--HHLQGMGVLPVPPSLNGHTYFPPYGMSVMNPAMPSSAVEQMHWFAGPVSHG  575

Query  651   SQAQVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPG  472
                Q SGGG N N+QHQ+SCNMP QKN    + +A RL    D+ +Q S A++   RAP 
Sbjct  576   HTDQSSGGGANSNLQHQSSCNMP-QKN--VTIPNAKRLQPSNDSGLQGSTANNTGDRAPM  632

Query  471   VTVSGPMEGRSVLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQS  292
              T   P EG   L LFP +PV+      Q  D G P R I+VVPHN R+A+ SAARIFQS
Sbjct  633   RTDQNP-EGSDALQLFPMAPVIPD-GVPQSHDIGQPMRAIKVVPHNPRTATASAARIFQS  690

Query  291   IQKERKQ  271
             IQ ERKQ
Sbjct  691   IQAERKQ  697



>ref|XP_003603108.1| Protein EARLY FLOWERING [Medicago truncatula]
 gb|AES73359.1| early flowering protein [Medicago truncatula]
Length=688

 Score =   487 bits (1253),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 313/715 (44%), Positives = 404/715 (57%), Gaps = 66/715 (9%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPN-PNNASNLIPPS  2161
             +MGP+FPRLHV DTEKGGPRAPPRNKMALYEQ SIPSQRF+   LPP+ PN + N +PPS
Sbjct  10    VMGPLFPRLHVGDTEKGGPRAPPRNKMALYEQFSIPSQRFN---LPPHHPNTSINTVPPS  66

Query  2160  PS-QGNGHERRMFLPMHLPPSTYSAEKLHAHSSDSNTPLTQFESRKKTDEDDFRVPVFVN  1984
              S QG  HER    P HL P T + +   +   + N  L+Q E RKK DEDDFRVPV++ 
Sbjct  67    SSSQGAVHERNYVFPGHLTPETLTRQ---SEGKNLNASLSQLEQRKKIDEDDFRVPVYIR  123

Query  1983  SNISQSIGKFYKNSEREKVSPSSPAFLGRSTKDAKHTRGGNLRHQES-------------  1843
             S I QS  K +++ + + ++ +     G   K  +  R  +L +  +             
Sbjct  124   SKIGQSNDKSHESFDGKNLTSAGSRNFG-FFKAGRINRERDLNNPRTDVRNEIDGPPQVS  182

Query  1842  -SRQLPATREQSVKASLSSRSTDKKEHCIKHTDTD----FPLHSEQRDGPANNSDLSHKS  1678
              +++ P T  +      SS ++ ++   I++ +      F L S ++     + D   +S
Sbjct  183   PNKEQPFTSARDTSNGESSNTSVRQAKVIQNQEFQDRAVFKLSSSRQGDGCLHQDCRAES  242

Query  1677  GINLQPESIIDSKVGDANDDAVVSGPIKGVEIGDSSVPINCFQTEGQIINVGNDVESQEN  1498
               N           G    DA V       EIG S+ PI    +  + IN     E  + 
Sbjct  243   QSN-----------GTGQRDASVEST---REIGKSNDPIANQTSPTEAIN---GTEYHDT  285

Query  1497  QTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFA  1318
              T     +  +++ DN S+ S VE +S + ISPDDVV IIGQK FWKAR+AI NQQRVFA
Sbjct  286   GTGSPIHSGNLNKNDNISKISRVEDLSTLKISPDDVVAIIGQKQFWKARKAIANQQRVFA  345

Query  1317  VQVFELHRLIKVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAP--QNVPKH  1144
             VQVFELHRLIKVQ+LIA SP+ L ED A+LGK L   S  + L   EY+  P  QN+ K 
Sbjct  346   VQVFELHRLIKVQQLIAGSPDLLFEDGAFLGKSLPDGSTPKKLA-LEYVVKPRLQNL-KR  403

Query  1143  KNDSEKPHLRMECSAENTVGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFH  964
             K DSE  +  MECSAEN VGK S+SSV+N +   S  P  GNP    ++ ++ MGPW F+
Sbjct  404   KVDSENVNQNMECSAENAVGKTSISSVKNGSHLSSSTPFAGNPHHGNMAAENGMGPWGFN  463

Query  963   QPSGHQWLIPVMTPSEGLVYKPYPGPGFMSPGC-GPPPVSTPVMGNFFAPPAYGLPTSQY  787
             Q  GHQWLIPVM+PSEGLVYKPYPGPGF      G  P   P     F  P+YG+P    
Sbjct  464   QSPGHQWLIPVMSPSEGLVYKPYPGPGFTGTNYGGSGPFGAPPSCGTFMNPSYGMPPPPE  523

Query  786   HYQGMGDPFAPPIGHGYFPPYG-MPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNV  610
                G          H Y+PPYG MP M +A S S VE +N F+       +S G  + N 
Sbjct  524   TPPG---------SHAYYPPYGSMPFMKAAASESVVEHVNQFSARVQSRHLSEGEADCNK  574

Query  609   QHQNSCNMPSQKNGDADVSDAHRLH--ACKDNEIQASCASSPSVRAPGVTVSGPMEGRSV  436
              +Q+SCN+P Q+NG    +  H +H    K+ E+Q S ASSPS    G++     E R  
Sbjct  575   HNQSSCNLPVQRNG----ATTHVMHHQRSKEFELQMSTASSPSEMTQGMSTGQVAEERDA  630

Query  435   LPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
             LPLFP  P V     +Q  +TG   RVI+VVPHN RSA+ESAARIFQSIQ+ERKQ
Sbjct  631   LPLFPMVP-VEPEGVAQSIETGQQTRVIKVVPHNRRSATESAARIFQSIQEERKQ  684



>gb|AFR60580.1| early flowering 3/high response [Pisum sativum subsp. sativum]
Length=702

 Score =   485 bits (1248),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 314/710 (44%), Positives = 402/710 (57%), Gaps = 42/710 (6%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPP-S  2161
             +MGP+FPRLHV DTEKGGPRAPPRNKMALYEQ SIPSQRF+   LP +PN ++N +PP S
Sbjct  10    MMGPLFPRLHVGDTEKGGPRAPPRNKMALYEQFSIPSQRFN---LPLHPNTSNNSVPPAS  66

Query  2160  PSQGNGHERRMFLPMHLPPSTYSAE-----KLHAHSSDSNTPLTQFESRKKTDEDDFRVP  1996
              SQG  HER    P HL P T   +           ++ N  L Q E RKK DEDDFRVP
Sbjct  67    SSQGTVHERNYVFPGHLTPETLIRQAGKHLSRQTKGANLNASLAQIEHRKKVDEDDFRVP  126

Query  1995  VFVNSNISQSIGKFYKNSEREKVSPSSPAFLGRSTKDAKHTRGGNLRHQESSRQLPATRE  1816
             V+V SNI QS  K  ++ + ++   +   + G   K  K  R  + R Q  S  + A  +
Sbjct  127   VYVRSNIGQSNEKRIESFDGKRPPSTGSRYFG-FLKPGKSDRERDPR-QHGSAVVNAVTD  184

Query  1815  QSVKASLSSRSTDKKEH-CIKHTDTDFPLHSEQ--RDGPAN-NSDLSHKSGINLQPESII  1648
                      + +  KEH      D     HS+   R G    N ++  +    L      
Sbjct  185   VRNDIDGPPQVSPNKEHPSSSARDGSIGEHSDTLVRQGKVTANQEVQDRRVFKLSSLRQG  244

Query  1647  DSKV-GDANDDAVVSGPIKGVEIGDSSVPINCFQTEGQIIN------VGNDVESQENQTC  1489
             D+++  D   ++  +G  +   + +S+  ++  ++ G I+N        N  E  +  T 
Sbjct  245   DARLRQDCRAESQSNGHGQSDSLLESTREVD--KSNGPIVNQTSPTQAINGTEYHDTGTG  302

Query  1488  RSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQV  1309
                Q    ++ D+ S+ S VE +S + ISPDDVV +IGQKHFWKAR+ I NQQRVFAVQV
Sbjct  303   SPKQLGNSNKNDSISKISRVEDLSTVKISPDDVVAVIGQKHFWKARKEIANQQRVFAVQV  362

Query  1308  FELHRLIKVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKNDSE  1129
             FELHRLIKVQ+LIA SP+ L +D A+LGK L   S  + L     +KA     K K DSE
Sbjct  363   FELHRLIKVQQLIAGSPDLLFDDGAFLGKSLPDGSTPKKLSLEYVVKARLQNLKRKVDSE  422

Query  1128  KPHLRMECSAENTVGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGH  949
             K +  MECSAEN VGK S+SSV+N +   S  P  GNP    V+ D+ MGPWCF+Q  GH
Sbjct  423   KINQNMECSAENAVGKTSISSVKNTSHLSSSMPFAGNPHQGNVAADNGMGPWCFNQSPGH  482

Query  948   QWLIPVMTPSEGLVYKPYPGPGFMSP---GCGPPPVSTPVMGNFFAPPAYGLPTSQYHYQ  778
             QWLIPVM+PSEGLVYKPYPGPGF      GCG  P +    G  F  P+YG+P       
Sbjct  483   QWLIPVMSPSEGLVYKPYPGPGFTGTNFGGCG--PYAAAPSGGTFMNPSYGIPPPPETPP  540

Query  777   GMGDPFAPPIGHGYFPPY-GMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQ  601
             G            YFPPY GMPVM +A S SAVE +N F+  G   ++S    + N  +Q
Sbjct  541   G---------SQAYFPPYGGMPVMKAAASESAVEHVNQFSARGQSRRLSEDEADCNKHNQ  591

Query  600   NSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFP  421
             +S ++P Q+NG       H+    K+ E+Q S ASSPS  A  ++     EGR VLPLFP
Sbjct  592   SSYDLPVQRNGATSHVMYHQ--RSKEFEVQMSTASSPSEMAQEMSTGQVAEGRDVLPLFP  649

Query  420   TSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
               P V         +TG   RVI+VVPHN RSA+ESAARIFQSIQ+ERKQ
Sbjct  650   MVP-VEPESVPHSLETGQKTRVIKVVPHNRRSATESAARIFQSIQEERKQ  698



>ref|XP_011019541.1| PREDICTED: protein EARLY FLOWERING 3 [Populus euphratica]
Length=713

 Score =   482 bits (1241),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 329/727 (45%), Positives = 426/727 (59%), Gaps = 65/727 (9%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPP-S  2161
             IMGPMFPRLHVNDT+KGGPRAPPRNKMALYEQLSIPSQRF+  VLP N +N S+L P  S
Sbjct  10    IMGPMFPRLHVNDTDKGGPRAPPRNKMALYEQLSIPSQRFNPDVLPRNSSNTSDLAPTGS  69

Query  2160  PSQGNGHERRMFLPMHLPPSTYS--AEKLHAHSSDS---NTPLTQFESRKKT-DEDDFRV  1999
              SQG+G ER    P ++PP T +  AEK H+   D    NTP+     RKK  +EDDF V
Sbjct  70    SSQGSGLERHFPYPHYVPPPTPNDVAEKYHSCQPDGRNLNTPVAPLMQRKKVGEEDDFTV  129

Query  1998  PVFVNSNISQSIGKFYKNSEREKVSPSSPAFLGRSTK-----DAKH--TRGGNLRHQESS  1840
             PVFV+S   Q   K   ++ +EK++   P +LG S++     D  H  + G NLR   S+
Sbjct  130   PVFVHSGKGQGQTKMQTSAAQEKLASLCPNYLGHSSRFQNAGDNDHFGSTGLNLRRDTSN  189

Query  1839  RQLPATREQSVKASLSSRSTDKKEHCIKHT-------DTDFP------LHSEQRDGPANN  1699
             +      E +++  +SS      +H  +H+         D P       + + ++   +N
Sbjct  190   QS-----EDNLEVCVSS-----TDHIARHSTNLQTREKNDMPEEGNASQNQQYQNNLVSN  239

Query  1698  SDLSHKSGINLQPESI--IDSKVGDANDDAVVSGPIK-GVEI----GDSSVPINCFQ-TE  1543
                 H++   LQ E+   + S   +  D    S   K  + I     DS +  +C    E
Sbjct  240   FTRLHENDTCLQQETSARLQSNHSEHGDHVPESRRQKEKINIFQPGNDSHLRKDCSSPNE  299

Query  1542  GQIINVGNDVESQENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHF  1363
              +I     D E   ++TC S Q +  D+ +++SETSMV+ IS +DISPDDVVGIIGQKHF
Sbjct  300   PEI-----DSECFGDKTCGSLQFRNGDKSNDASETSMVDSISVLDISPDDVVGIIGQKHF  354

Query  1362  WKARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPP  1183
             WKARRAI NQQRVF+VQVFELHRLIKVQ+LIA SP+ LLE+   L KP    S  + LP 
Sbjct  355   WKARRAIANQQRVFSVQVFELHRLIKVQQLIAGSPHLLLEEEVRLAKPPLKGSPCKNLPS  414

Query  1182  FEYIKAPQNVPKHKNDSEKPHLRMECSAENTVGKASLSSVQNATQAPSCKPSPGNPPLPV  1003
                +  P +V KHK++SE P+ +MECSAEN V K   +SV N  Q P+ +P  G P +P+
Sbjct  415   ECVVTPPVHVAKHKDNSENPNHKMECSAENAVEKTPFTSVNNG-QPPNFRPHAGLPTVPM  473

Query  1002  VSNDSNMGPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGP--GFMSPGCGPPPVSTPVMGN  829
              + D+ M PWCFH   G QWL+PVM+PSEGLVYKPY  P       G   P    P+ GN
Sbjct  474   AA-DTKMAPWCFHPSPGLQWLVPVMSPSEGLVYKPYTAPGFMGSGCGGCGPFGPIPLTGN  532

Query  828   FFAPPAYGLPTSQYHYQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGS  649
             F    AYG+PTS YH      P APP+ +  FPPYGMP MN A+S SA       T    
Sbjct  533   FMT-SAYGVPTSHYHQGIEVSPGAPPVDNACFPPYGMPGMNPAISGSAGSGSCGQT----  587

Query  648   QAQVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGV  469
              AQ  GG ++ N+ HQ+SCN  +QK+    V    +L A K+  +Q S  SSPS R  GV
Sbjct  588   -AQFPGGILSSNMPHQSSCNERTQKS--EAVLQGKKLQASKNTSVQGSTGSSPSGRVQGV  644

Query  468   TVSGPMEGRSVLPLFP-TSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQS  292
                   +GR+ LP FP T+P      + Q  +T   ++VI+VVPHN RSA+ESAARIFQS
Sbjct  645   GTVQAADGRAALPPFPVTTPCPE--GSPQHQETDQLSKVIKVVPHNGRSATESAARIFQS  702

Query  291   IQKERKQ  271
             IQ+ RKQ
Sbjct  703   IQEGRKQ  709



>ref|XP_010244364.1| PREDICTED: protein EARLY FLOWERING 3 [Nelumbo nucifera]
Length=786

 Score =   482 bits (1241),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 324/790 (41%), Positives = 439/790 (56%), Gaps = 118/790 (15%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGV---LPPNPNNASNLIP  2167
             IMGP+FPRLHVND +KGGPRAPPRNKMALYEQLSIPSQRF+ G+   LP  PNNASNL+P
Sbjct  10    IMGPLFPRLHVNDADKGGPRAPPRNKMALYEQLSIPSQRFNSGLAPTLPLPPNNASNLVP  69

Query  2166  -PSPSQGNGHERRMFLPMHL-PPSTYS-----------------------------AEKL  2080
               S SQG  HER +F  +++ PP+ +S                             A + 
Sbjct  70    STSSSQGGAHERSVFSQIYVSPPTPHSRSSDGANLNGTVAECDRKSTKNANYRISNATRN  129

Query  2079  HAHSSDSNT-------PLTQFESRKKTDEDDFRVPVFVNSNISQSIGKFYKNSEREKVSP  1921
                ++D N+        L  +   K  DEDD RVP +++S ++    K   N   E+ +P
Sbjct  130   LLSTNDCNSCHRPDFSNLKNYCGDKLEDEDDLRVPTYIHSGVASCSNKDLPNPNGERCTP  189

Query  1920  SSP--------AFLGRSTKDAKHTRGGNLRHQES--SRQLPATREQSVKASLSSRSTDKK  1771
              SP        A   R  K    T   +++ Q +   +Q  +TR+   +  + +++ +  
Sbjct  190   LSPTHPSPSKLAPGNRPLKALAATGSSSMQPQSTCDKQQKTSTRDMKSRVHVRNQNEENL  249

Query  1770  EHCIKHTDT------------------DFPLHSEQRDGPANNSDLSHKSGINL-----QP  1660
             + C+   D+                  +  + SE +   ++ +D   +S  N+     + 
Sbjct  250   KECVTSRDSAEKDAIHSSTGEKNAKFLNRAIASENQILESSQADDFRRSNNNVSRAYEEQ  309

Query  1659  ESIIDSKVGDANDDAVVSGPIKGVEIGDSS----VPINCF---QTEGQIINVGNDVESQE  1501
              SI+  +   + D  +V   + GVE G+ S    VP +      ++       ND +  E
Sbjct  310   RSILLPENCVSGDAVLVE--LVGVEKGNISREKAVPFSRASPGNSDRSPKRAENDRDYHE  367

Query  1500  NQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVF  1321
             +    S Q    D+ D++SETSMV+ ISG+DISPDDVVG+IG KHFWKARRAIVNQQ+VF
Sbjct  368   DMAHESLQVGDADKNDDASETSMVDSISGLDISPDDVVGVIGPKHFWKARRAIVNQQKVF  427

Query  1320  AVQVFELHRLIKVQKLIAESPNFLLEDTAYLGKP-LKVSSAKRLLPPFEYIKAPQNVPKH  1144
             AVQVFELHRLIKVQ+LIA SP+ L ++  YLGKP LKVS AK L   +  +K+P    KH
Sbjct  428   AVQVFELHRLIKVQRLIAGSPHLLFDNNPYLGKPSLKVSPAKNLTSEYA-LKSPPGGVKH  486

Query  1143  KNDSEKPHLRMECSAENTVGKASLSSVQNA------TQAPSCKPSPGNPPLPVVSNDSNM  982
             K D++KP    EC+AENTVG+ +L S+         +Q  S  P  GNP         + 
Sbjct  487   KTDAQKPKQDAECAAENTVGEPTLPSLSTGVNKGLVSQNSSHGPHSGNP---------SS  537

Query  981   GPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGP-----GFMSP-GCGPPPVSTPVMGNFFA  820
             GPWCFH P G+QWL+P+M+PSEGL+YKPY GP     GFM+P   G  P+S P M   F 
Sbjct  538   GPWCFHPPPGNQWLVPIMSPSEGLIYKPYVGPCPPTAGFMAPVYGGRGPLSLPPMAGDFM  597

Query  819   PPAYGLPTSQYHYQGMG-DPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRT---G  652
               AYG+P S  H QG+G  P APP+G  YFPPYG+PV++  +S SAVEQ N    +   G
Sbjct  598   NTAYGVPAS--HQQGIGVIPGAPPVGQTYFPPYGVPVLSPGISASAVEQRNPMAGSHPNG  655

Query  651   SQAQVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAH--RLHACKDNEIQASCASSPSVRA  478
                ++S G  N  + +Q+S N  +QK   ++    H  +    KD+E+Q S ASSP  R+
Sbjct  656   HSERLSTGDANFKMHYQSSYNNSNQK---SETISCHIWKFQTSKDSELQGSTASSPCERS  712

Query  477   PGVTVSGPMEGRSVLPLFPTSPVVNIVD-ASQPPDTGHPARVIRVVPHNARSASESAARI  301
              G       EGR  LPLFP +P V + D   +   +G   RVI+VVPHN RSA+ESA RI
Sbjct  713   QGSGSGNVAEGRDALPLFPMAPAVQVQDQVPKSHSSGQQTRVIKVVPHNRRSATESAVRI  772

Query  300   FQSIQKERKQ  271
             FQSIQKER+Q
Sbjct  773   FQSIQKERQQ  782



>ref|XP_003550290.1| PREDICTED: protein EARLY FLOWERING 3-like [Glycine max]
 gb|KHN37008.1| Protein EARLY FLOWERING 3 [Glycine soja]
Length=713

 Score =   479 bits (1232),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 320/735 (44%), Positives = 400/735 (54%), Gaps = 81/735 (11%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  2158
             + GPMFPRLHVND EKGGPRAPPRNKMALYEQ SIPSQ+F+  +LP  PN++SN++PP P
Sbjct  10    LGGPMFPRLHVNDAEKGGPRAPPRNKMALYEQFSIPSQKFNPRLLPRKPNSSSNIVPP-P  68

Query  2157  SQGNGHERRMFLPMHLPPST--YSAEKLHAHSSD----SNTPLTQFESRKKTDEDDFRVP  1996
             +QGNGHER    P+     T  + AE   +  SD    SNT L Q E RKK D+D   + 
Sbjct  69    TQGNGHERSYVYPVRFSSQTPTHRAESYISRQSDDGSRSNTSLVQLERRKKVDDD---IH  125

Query  1995  VFVNSNISQSIGKFYKNSEREKVSP-------SSPAFLGRSTKD-------------AKH  1876
             V+  S I QS  K  ++ + +K +P        S A      KD              K 
Sbjct  126   VYTCSGIDQSNDKTMESVDGKKFTPFGARNFCYSVAVQNDGDKDPTQFSSCSLPVDLRKD  185

Query  1875  TRGGNLR--HQESSRQLPATREQSVKASLSSRSTDKKEHCIKHTDTDFPLHSEQRDGPAN  1702
              R GN    H  SSR+ P       K S+ + S+ +    +       P + E +D    
Sbjct  186   VRNGNEANPHVSSSRRKP-------KMSVKNNSSGEIIDSLMMQAKVIP-NLEDQDYSVP  237

Query  1701  NSDLSHKSGINLQPESIIDSKVGDANDDAVVSGPIKGVEIGDSSVPINCFQT---EGQII  1531
             N    H+    LQ E +  S+  D      +    + ++ G++ VP  CF +   + + +
Sbjct  238   NISRLHQDDTCLQKECVAGSQSNDVEHGDDLLNSTRDIDNGNALVPRGCFHSAANQTRPL  297

Query  1530  NVGNDVESQENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKAR  1351
                ND E  +  T    Q    D  DN S+ S V  +S + +SPDDVVGI+GQKHFWKAR
Sbjct  298   EATNDAEYHDTGTGGPIQKGNFDERDNISKISTVTNLSSLIVSPDDVVGILGQKHFWKAR  357

Query  1350  RAIVNQQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGK-PLKVSSAKRLLPPFEY  1174
             R I NQQ VFAVQVFELHRLIKVQ+LIA SP+ LLED A++GK PL  S  K +    E 
Sbjct  358   RKIANQQSVFAVQVFELHRLIKVQQLIAASPDVLLEDVAFMGKFPLTESPPKNI--SLEV  415

Query  1173  IKAPQNV-PKHKNDSEKPHLRMECSAENTVGK-ASLSSVQNATQAPSCKPSPGNPPLPVV  1000
             +  PQ   PK KNDSEK + + ECSAEN V K  S SS +N +   +  P  G P    V
Sbjct  416   VVEPQQQNPKRKNDSEKLNHKTECSAENAVAKRTSFSSPKNGSHLANHTPFSGTPHQANV  475

Query  999   SNDSNMGPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGPGF---MSPGCGPPPVSTPVMGN  829
             ++D+   PWCF+Q  GHQWLIPVM+PSEGLVYKPYPGPGF   M  GCG P    P+   
Sbjct  476   ASDNKTSPWCFNQTPGHQWLIPVMSPSEGLVYKPYPGPGFKGTMHGGCGGPFGQAPLSAT  535

Query  828   FFAPPAYGLPTSQYHYQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGS  649
             F   PAY  P S  H      PF PP  H YF P+GMPVMN A S SAVEQ+N F   GS
Sbjct  536   FMN-PAYQFPAS--HPVVGVSPFVPPASHTYFAPFGMPVMNQATSGSAVEQVNQFAAQGS  592

Query  648   QAQ---VSGGGVNLNVQH-QNSCNMPSQKNGDADVSDAHRLH-----ACKDNEIQASCAS  496
               Q    S  G + N  H Q+S N+P QKNG        RLH     A K+  +Q S  S
Sbjct  593   HGQNGHSSVEGADFNTHHNQSSSNLPVQKNGA-------RLHVKKSQALKERGLQGSTRS  645

Query  495   SPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASE  316
             SPS  A G+      +G     L           +    +T    + I+VVPHN +SA+E
Sbjct  646   SPSEMAQGIRAGKIADGSDAQSL-----------SLHAVETRQQTQAIKVVPHNRKSATE  694

Query  315   SAARIFQSIQKERKQ  271
             SAARIFQSIQ+ERKQ
Sbjct  695   SAARIFQSIQEERKQ  709



>ref|XP_007160974.1| hypothetical protein PHAVU_001G032900g [Phaseolus vulgaris]
 gb|ESW32968.1| hypothetical protein PHAVU_001G032900g [Phaseolus vulgaris]
Length=713

 Score =   467 bits (1202),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 312/727 (43%), Positives = 403/727 (55%), Gaps = 65/727 (9%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPP--  2164
             + GPMFPRLHVND EKGGPRAPPRNKMALYEQLS+PSQRF+  +LP  PN++SNL+ P  
Sbjct  10    VAGPMFPRLHVNDAEKGGPRAPPRNKMALYEQLSVPSQRFNPRLLPLKPNSSSNLVAPPV  69

Query  2163  SPSQGNGHERRMFLPMHLPPS--TYSAEKLHAHSSD---SNTPLTQFESRKKTDEDDFRV  1999
             S +QGNGHER    P+ LP     + AE   +  SD   SNT   Q E RK+ DEDD  V
Sbjct  70    SSTQGNGHERSYAYPVRLPSQIPAHRAESYISRQSDGSRSNTSSVQLERRKRADEDD--V  127

Query  1998  PVFVNSNISQSIGKFYKNSEREKVSP----------------SSPAFLGRSTKDA-KHTR  1870
               ++ S I  S  K  K+   EK++P                  P   G    D  KH R
Sbjct  128   HAYICSRIGHSNDKTMKSFNGEKITPLGARNFCSVSVQDDGERGPTLFGSLPVDMRKHVR  187

Query  1869  GGNLRHQESSRQLPATREQSVKASLSSRSTDKKEHCIKHTDTDFPLHSEQRDGPANNSDL  1690
              GN  H   S    ++R+Q  K S+ ++S+ +    +       P + E +D    +   
Sbjct  188   SGNEAHPHVS----SSRQQQ-KMSVKNKSSGEVIDSLVMQAKVIP-NQEDQDCSVPSLSR  241

Query  1689  SHKSGINLQPESIIDSKVGDANDDAVVSGPIKGVEIGDSSVPINCFQTEGQI---INVGN  1519
             SH+ G  LQ E +   +  D      +    + ++ G++ VP +CF +       +    
Sbjct  242   SHQDGACLQQECVAGPQSNDVEHRNGLLSSTRDMDNGNALVPKSCFYSAANQTCPVEATG  301

Query  1518  DVESQENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIV  1339
             DVE  +  T    Q    D   + S+ S V  +S   +SPDDVVGI+GQK FWKARR I 
Sbjct  302   DVEYHDIGTEGPMQKGIFDEIGDVSKISTVTNLSSQVVSPDDVVGILGQKRFWKARRKIA  361

Query  1338  NQQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGK-PLKVSSAKRLLPPFEYIKAP  1162
             NQQRVFAVQVFELHRLIKVQ+LIA SPN L+ED A+LGK PL+ S+ K +    + +  P
Sbjct  362   NQQRVFAVQVFELHRLIKVQQLIASSPNVLIEDGAFLGKFPLEGSTPKTI--SLQVVVEP  419

Query  1161  QNV-PKHKNDSEKPHLRMECSAENTV-GKASLSSVQNATQAPSCKPSPGNPPLPVVSNDS  988
             Q   PK KN+SEKP+ + ECSAEN V  K S SS +N +   +  P  G P    V++D+
Sbjct  420   QQQNPKRKNNSEKPNHKTECSAENAVEKKTSFSSPKNGSHLTNHSPFSGIPHQTDVASDN  479

Query  987   NMGPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGPGF---MSPGCGPPPVSTPVMGNFFAP  817
                PW F+Q   HQWLIP+M+PSEGL+YKPYP P F   M  GCG P    P +G  F  
Sbjct  480   GTSPWSFNQSPQHQWLIPIMSPSEGLIYKPYPRPAFTGMMPAGCGGPLGQAP-LGATFMN  538

Query  816   PAYGLPTSQYHYQGMG-DPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQ  640
             PAY  P S   +Q +G  PF  P  H YF PYGMPV+N A S SA E +N F   GS  Q
Sbjct  539   PAYQFPAS---HQVVGVSPFVSPANHTYFSPYGMPVVNQAASGSAAEHVNQFATQGSHGQ  595

Query  639   ---VSGGGVNLNVQH-QNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPG  472
                 S  G N N  H Q+S N+P Q++G   +S   +L   K+ ++Q S AS+ S     
Sbjct  596   NGHSSVEGANFNTHHNQSSSNLPVQRSG--AMSHVKKLQVSKERQLQGSTASTASETPQR  653

Query  471   VTVSGPMEGRSVLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQS  292
             +      EG     L      ++ VDA Q        +VI+VVPHN +SA+ESAARIFQS
Sbjct  654   IKARNITEGSDAHSL-----SLHSVDARQ------QTQVIKVVPHNGKSATESAARIFQS  702

Query  291   IQKERKQ  271
             IQ+ERKQ
Sbjct  703   IQEERKQ  709



>gb|KHN17209.1| Protein EARLY FLOWERING 3 [Glycine soja]
Length=697

 Score =   456 bits (1173),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 307/721 (43%), Positives = 389/721 (54%), Gaps = 73/721 (10%)
 Frame = -3

Query  2331  GPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFD-HGVLPPNPNNASNLIPP--S  2161
             GPMFPRLHVND EKGGPRAPPRNKMALYEQ SIPSQRF+ H  LP  PN++SN++PP  S
Sbjct  12    GPMFPRLHVNDAEKGGPRAPPRNKMALYEQFSIPSQRFNPH--LPRKPNSSSNIVPPPTS  69

Query  2160  PSQGNGHERRMFLPMHLPPSTYSAEKLHAHSSDSNTPLTQFESRKKTDEDDFRVPVFVNS  1981
              ++GNG ER                +     + SNT L Q E RKK D+    + V+  S
Sbjct  70    STEGNGRERSYI------------SRQSDDGARSNTSLVQLERRKKVDDG---IHVYTCS  114

Query  1980  NISQSIGKFYKNSEREKVSP-------SSPAFLGRSTKDA-----------KHTRGGNLR  1855
              I QS  K  ++   +K++P        S A      KD            K  R GN  
Sbjct  115   RIDQSNDKMLESFNGKKLTPFGARNFCYSVAVQNGGDKDTTQFGFLPADMRKDARKGN--  172

Query  1854  HQESSRQLPATREQSVKASLSSRSTDKKEHCIKHTDTDFPLHSEQRDGPANNSDLSHKSG  1675
               E++  + ++R Q +K S+  +S+ +    +       P + E +D    N +  H+  
Sbjct  173   --EANPHVSSSR-QKLKLSVKPKSSGEIIDSLVMQAKVIP-NQEDQDYSVPNINRLHQDD  228

Query  1674  INLQPESIIDSKVGDANDDAVVSGPIKGVEIGDSSVPINCFQTEGQI---INVGNDVESQ  1504
               LQ E +  S+  D      +    + ++ G++ VP  CF +       +   ND E  
Sbjct  229   ACLQKECVAGSQSNDIEHGGDLLNSTRDMDNGNALVPRGCFHSAANQTHPLEATNDAEYH  288

Query  1503  ENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRV  1324
             + +T    Q    D  DN S+ S V  +S + +SPDDVVGI+GQKHFWKARR I NQQ V
Sbjct  289   DTRTGGPIQKGNFDESDNISKISTVTNLSSLIVSPDDVVGILGQKHFWKARRKIANQQSV  348

Query  1323  FAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGK-PLKVSSAKRLLPPFEYIKAPQNV-P  1150
             FAVQVFELHRLIKVQ+LIA SP+ LLED A++GK PL  S  K      E +  PQ   P
Sbjct  349   FAVQVFELHRLIKVQQLIAASPDVLLEDGAFMGKFPLMGSPPKNKNISLEVVVEPQQQNP  408

Query  1149  KHKNDSEKPHLRMECSAENTVG-KASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPW  973
             K KNDSEK + + ECSAEN V  K S SS +N +   +  P  G P     ++D+   PW
Sbjct  409   KQKNDSEKLNHKTECSAENAVAKKKSFSSPKNGSHHTNHTPFSGTPHQANEASDNKTSPW  468

Query  972   CFHQPSGHQWLIPVMTPSEGLVYKPYPGPGFMSP---GCGPPPVSTPVMGNFFAPPAYGL  802
             CF+Q  GHQWLIPVM+PSEGLVYKPYPGPGFM     GCG P    P +G  F  PAY  
Sbjct  469   CFNQAPGHQWLIPVMSPSEGLVYKPYPGPGFMGTMNGGCGGPFGQAP-LGATFMNPAYQF  527

Query  801   PTSQYHYQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGG--  628
             P S  H      PF PP  H YFP +GMPV+N A S S VEQ+N F   GS  Q      
Sbjct  528   PAS--HPVVGVSPFVPPASHAYFPSFGMPVVNQATSGSTVEQVNQFAAQGSHGQNGHSYI  585

Query  627   -GVNLNVQH-QNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGP  454
              G + N  H Q+S N+P  KNG        +  A K+  +Q S  SSPS  A G+     
Sbjct  586   EGTDFNTHHNQSSSNLPVLKNG--ATLHVKKSQASKERGLQGSTISSPSEMAQGIRAGKI  643

Query  453   MEGRSVLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERK  274
              EG     L           + Q  +T    +VI+VVPHN +SA+ESAARIFQSIQ+ERK
Sbjct  644   AEGNDAHSL-----------SLQAVETRQQTQVIKVVPHNRKSATESAARIFQSIQEERK  692

Query  273   Q  271
             Q
Sbjct  693   Q  693



>ref|XP_007221988.1| hypothetical protein PRUPE_ppa002858mg [Prunus persica]
 gb|EMJ23187.1| hypothetical protein PRUPE_ppa002858mg [Prunus persica]
Length=626

 Score =   447 bits (1151),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 250/425 (59%), Positives = 298/425 (70%), Gaps = 16/425 (4%)
 Frame = -3

Query  1521  NDVESQENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAI  1342
             ND E + ++TC SPQ   VD+ D+ SETSMV+ ISG+DISPDDVVGIIGQKHFWKAR+AI
Sbjct  206   NDSEYRGDRTCISPQMGHVDKSDDVSETSMVDSISGLDISPDDVVGIIGQKHFWKARKAI  265

Query  1341  VNQQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLG-KPLKVSSAKRLLPPFEYIKA  1165
             VNQQR+FAVQVFELHRLIKVQ+LIA SPN LLEDTA+LG   L+ S AK+L    EY+  
Sbjct  266   VNQQRLFAVQVFELHRLIKVQRLIAGSPNLLLEDTAFLGTSSLRGSPAKKL--SSEYVVK  323

Query  1164  P-QNVPKHKNDSEKPHLRMECSAENTVGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDS  988
             P   V K K++ EKP+ ++ECSAEN VGK SLSSV+N +Q  +  P  GNP    V  D+
Sbjct  324   PLLRVVKRKHEPEKPNNKIECSAENAVGKTSLSSVKNGSQTSNYGPYVGNPQPTPVGTDN  383

Query  987   NMGPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGPGFMSPGCG--PPPVSTPVMGNFFAPP  814
                PWCFHQ  GHQ LIPVM+PSEGLVYKPY GPGFM P CG   P  STP+ GNF   P
Sbjct  384   KASPWCFHQSPGHQLLIPVMSPSEGLVYKPYHGPGFMGPVCGGCGPFNSTPMTGNFVK-P  442

Query  813   AYGLPTSQYHYQGMGD-PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQV  637
              YG+P S +H+QG G  P  PP+GH YFPPYGM VMN A+ +S +EQM+ F   GS  Q+
Sbjct  443   NYGVPAS-HHHQGTGVLPAPPPLGHTYFPPYGMSVMNPAMPSSGIEQMHWFAGPGSHGQI  501

Query  636   ---SGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVT  466
                SGGG N NVQHQ+SCNMPSQK+G   +  A    A  D+E+Q S A+SP   A  + 
Sbjct  502   DQLSGGGTNSNVQHQSSCNMPSQKSG--AIPHAMMFQASNDSELQGSTANSPGDTA-RLG  558

Query  465   VSGPMEGRSVLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQ  286
                  EG   L LFP +PV+     +QP D+G P R IRVVPHN R+A+ SAARIFQSIQ
Sbjct  559   TDQNAEGSDALQLFPMAPVIP-EGVAQPHDSGQPTRAIRVVPHNPRTATASAARIFQSIQ  617

Query  285   KERKQ  271
             +ERKQ
Sbjct  618   EERKQ  622


 Score =   101 bits (251),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIP  2167
             +MGPMFPRLHVND +KGGPRAPPRNKMALYEQLSIPSQRF+  V+P NPNN S+++P
Sbjct  9     VMGPMFPRLHVNDADKGGPRAPPRNKMALYEQLSIPSQRFNPVVMPLNPNNTSSVVP  65



>ref|XP_002309522.1| EARLY FLOWERING 3 family protein [Populus trichocarpa]
 gb|EEE93045.1| EARLY FLOWERING 3 family protein [Populus trichocarpa]
Length=663

 Score =   448 bits (1152),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 313/712 (44%), Positives = 400/712 (56%), Gaps = 85/712 (12%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPP-S  2161
             IMGPMFPRLHVNDT+KGGPRAPPRNKMALYEQLSIPSQRF+  VLP N +N S+L P  S
Sbjct  10    IMGPMFPRLHVNDTDKGGPRAPPRNKMALYEQLSIPSQRFNPDVLPRNSSNTSDLAPTGS  69

Query  2160  PSQGNGHERRMFLPMHLPPSTYS--AEKLHAHSSDS---NTPLTQFESRKKT-DEDDFRV  1999
              SQG+G ER    P ++P  T +  AEK H+   D    NTP+     RKK  +EDDF V
Sbjct  70    SSQGSGLERHFPYPHYVPSPTPTDVAEKYHSRQPDGRNLNTPVAPLMQRKKVGEEDDFTV  129

Query  1998  PVFVNSNISQSIG----KFYKNSEREKVSPSSPAFLGRSTKDAKHTRGGNLRHQESSRQL  1831
             PVFV+S   Q +        ++ +  +V  SS   + R + + + TR  N   +E +   
Sbjct  130   PVFVHSGKGQGLNLRPDTSNQSEDNLEVCVSSSDHIARHSTNLR-TREKNDIPEEGN---  185

Query  1830  PATREQSVKASLSSRSTDKKEHCIKHTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESI  1651
              A++ Q  + +L S  T   E                     N++ L  ++   LQ    
Sbjct  186   -ASQNQQYRNNLVSNFTRLHE---------------------NDTCLQQETSARLQSNH-  222

Query  1650  IDSKVGDANDDAVVSGPIKGVEIGDSSVPINCFQTEG-QIINVGNDVESQENQTCRSPQT  1474
               S+ GD                    VP +  Q E   I   GND  S   + C SP  
Sbjct  223   --SEHGD-------------------HVPESRRQKEKINIFQPGND--SHLRKDCSSPNE  259

Query  1473  QKVDR--------GDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFA  1318
              ++D         G+++SETSMV+ +S +DISPDDVVGIIGQKHFWKARRAI NQQRVF+
Sbjct  260   PEIDSECFGDKTCGNDASETSMVDSVSVLDISPDDVVGIIGQKHFWKARRAIANQQRVFS  319

Query  1317  VQVFELHRLIKVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKN  1138
             VQ+FELHRLIKVQ+LIA SP+ LLE+  +L KP    S  + LP    +  P +V KHK+
Sbjct  320   VQLFELHRLIKVQQLIAGSPHVLLEEEVHLAKPPMKGSPCKNLPSECAVTPPVHVAKHKD  379

Query  1137  DSEKPHLRMECSAENTVGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQP  958
             +SE P+ +MEC AEN VGK   +SV+N  Q P+  P  G   +P+ S D+ M PWCFH P
Sbjct  380   NSENPNHKMECFAENAVGKTPFASVKNG-QPPNFGPHAGPTTVPMAS-DTKMAPWCFHPP  437

Query  957   SGHQWLIPVMTPSEGLVYKPYPGP--GFMSPGCGPPPVSTPVMGNFFAPPAYGLPTSQYH  784
              G QWL+PVM+PSEG VYKPY  P       G   P    P+  NF    AY +PTS YH
Sbjct  438   PGLQWLVPVMSPSEGFVYKPYTAPGFMGSGCGGCGPFGPIPLTDNFMT-SAYAIPTSHYH  496

Query  783   YQGMG-DPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQ  607
              QG+G  P APP+G+  F PYGMP MN A+S SA       T     AQ  GG ++ N+ 
Sbjct  497   -QGIGVSPGAPPVGNACFAPYGMPGMNPAISGSAGSGSCGQT-----AQFPGGILSSNMP  550

Query  606   HQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPL  427
             HQ+SCN  +QK+    V +  +L A K+  +Q S  SSPS R  GV      +GR+    
Sbjct  551   HQSSCNERTQKS--EAVLEGMKLRASKNTSVQGSTGSSPSGRVQGVGTVQAADGRAAF-P  607

Query  426   FPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
                        A Q  +T   ++VI+VVPHN RSA+ES ARIFQSIQ+ RKQ
Sbjct  608   PFPVTPPCPEGAPQHQETDQLSKVIKVVPHNGRSATESVARIFQSIQEGRKQ  659



>ref|XP_010669115.1| PREDICTED: protein EARLY FLOWERING 3 [Beta vulgaris subsp. vulgaris]
Length=709

 Score =   448 bits (1152),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 312/726 (43%), Positives = 408/726 (56%), Gaps = 67/726 (9%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIP-PS  2161
             IMGPMFPRLHVNDT KGGPRAPPRNKMALYEQL+IPSQR++ G +P + NN++   P  S
Sbjct  10    IMGPMFPRLHVNDTGKGGPRAPPRNKMALYEQLTIPSQRYNSGAMPLHQNNSNTTAPSTS  69

Query  2160  PSQGNGHERRMFLPMHLPPSTYSAEKLHA---HSSDSNTPLTQFESRKK-TDEDDFRVPV  1993
              +QG  HE+ M+ P++   +  S +++      + + +  L Q E++K+  +EDDF VPV
Sbjct  70    TTQGTSHEQNMYFPLYRTHTASSYDEVQVSRPEAVELSNQLAQGETQKQPLEEDDFMVPV  129

Query  1992  FVNSNISQSIGKFYKNSEREKVSPSSPAFLGRSTKDAKHTRGGNLRHQESSRQLPATREQ  1813
             F         G    +   E+ +      LG S  +A H  G     + +   L + ++ 
Sbjct  130   FSQPGTKPCNGNTETSMHEERRN-----HLGSSHSNALHCTGEKETDKSNRGDLVSKQQT  184

Query  1812  SVKASLSSRSTDKKEHCIKHTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESIIDSKVG  1633
               +   SSR ++        T     L  E+ DG     D   +SG   +    I  K  
Sbjct  185   QNQDGRSSRVSNAFTRYSSDT-----LMREKDDG-LWRKDAFAESGYQDKYRMGIFEKTD  238

Query  1632  -----DANDDAVVSGPIKGVEIGDSSVP-----INCFQTEGQIINVG------NDVES--  1507
                  D  DD        GV + D  +      I+   ++G   +VG      N+++S  
Sbjct  239   ASLRQDHEDDVSAIDATNGVGVSDQQLESPLQEISLRLSQGHGPHVGHLYRGDNNIDSRM  298

Query  1506  QENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQR  1327
             Q  +  +S + + +D+GD  SETSMV+ IS +DI+PDDVV IIG+KHFWKAR AI NQQR
Sbjct  299   QRVEEYQSLEKESMDKGDAVSETSMVDSISELDITPDDVVRIIGRKHFWKARTAIANQQR  358

Query  1326  VFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGK-PLKVSSAKRLLPPFEYIKAPQNVP  1150
             VFAVQ+FELHRL+KVQKLIAESP+ LLE +A++GK  LK SS K   P +  +KA  +  
Sbjct  359   VFAVQIFELHRLLKVQKLIAESPDMLLEGSAFVGKSSLKGSSVKHYSPQYA-VKALAHKT  417

Query  1149  KHKNDSEKPHLRMECSAENTVGKASLSSVQNATQAPSCKPSPGNP--PLPVVSNDSNMGP  976
               K DS K   ++E +AEN V K+     QNA Q  + +PS  N     P  + D  M P
Sbjct  418   APKVDSHKATDKVEGTAENAVAKSPPIPPQNAIQPAAHQPSSVNTVSSFPPTNIDPKMNP  477

Query  975   WCFHQPSGHQWLIPVMTPSEGLVYKPYPGPGFMSPGCG--PPPVSTPVMGNFFAPPAYGL  802
             W F QP+ HQWL+PVMTPSEGLVYKPYP PG + P CG   P   TPVM        Y +
Sbjct  478   WSFPQPAPHQWLVPVMTPSEGLVYKPYPAPGCIGPACGGCGPVGPTPVMN------PYAM  531

Query  801   PTSQYHYQGMGDP----FAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTR---TGSQA  643
             PT  Y  QGMG P    F    G GYFPPYGMP+M+ +VS S VEQ+N F+     G   
Sbjct  532   PTPHYQ-QGMGMPPGMHFG---GQGYFPPYGMPIMSPSVSGSTVEQLNQFSGPNPYGQTG  587

Query  642   QVSGGGVNL-NVQHQNSCNM-PSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGV  469
             Q  G  VN  ++QHQ+S ++ PSQKNG   ++ A R    K+ E+Q S ASSPS R    
Sbjct  588   QPVGTSVNFGSMQHQSSLHIHPSQKNG--TIASAARPQPPKERELQGSTASSPSQRT-RE  644

Query  468   TVSGPMEGRSVLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSI  289
             T +  M GR  LPLF  +P   I        T  P RVIRVVPH  +S  ESAARIFQSI
Sbjct  645   TGTALMGGRDALPLFLAAPTTQISGGF---PTEKPTRVIRVVPH--KSTRESAARIFQSI  699

Query  288   QKERKQ  271
             Q+ER+Q
Sbjct  700   QEERRQ  705



>ref|XP_008220435.1| PREDICTED: protein EARLY FLOWERING 3 [Prunus mume]
Length=731

 Score =   446 bits (1148),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 249/425 (59%), Positives = 297/425 (70%), Gaps = 16/425 (4%)
 Frame = -3

Query  1521  NDVESQENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAI  1342
             ND E   ++TC SPQ   VD+ D+ SETSMV+ +SG+DISPDDVVGIIGQKHFWKAR+AI
Sbjct  311   NDSEYHGDRTCISPQMGHVDKSDDVSETSMVDSVSGLDISPDDVVGIIGQKHFWKARKAI  370

Query  1341  VNQQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLG-KPLKVSSAKRLLPPFEYIKA  1165
             VNQQR+FAVQVFELHRLIKVQ+LIA +PN LLEDTA+LG   L+ S AK+L    EY+  
Sbjct  371   VNQQRLFAVQVFELHRLIKVQRLIAGAPNLLLEDTAFLGTSSLRGSPAKKL--SSEYVVK  428

Query  1164  P-QNVPKHKNDSEKPHLRMECSAENTVGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDS  988
             P   V K K++ EKP+ ++ECSAEN VGK SLSSV+N +Q  +  P  GNP    V  D+
Sbjct  429   PLLRVVKRKHEPEKPNNKIECSAENAVGKTSLSSVKNGSQTSNYGPYVGNPQPTPVGTDN  488

Query  987   NMGPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGPGFMSPGCG--PPPVSTPVMGNFFAPP  814
                PWCFHQ  GHQ LIPVM+PSEGLVYKPY GPGF+ P CG   P  STP+ GNF   P
Sbjct  489   KASPWCFHQSPGHQLLIPVMSPSEGLVYKPYHGPGFVGPVCGGCGPFNSTPMTGNFVK-P  547

Query  813   AYGLPTSQYHYQGMGD-PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQV  637
              YG+P S +H+QG G  P  PP+GH YFPPYGM VMN A+ +S VEQM+ F   GS  Q+
Sbjct  548   NYGVPAS-HHHQGTGVLPVPPPLGHTYFPPYGMSVMNPAMPSSGVEQMHWFAGPGSHGQI  606

Query  636   ---SGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVT  466
                SGGG N NVQHQ+SCNMPSQK+G   +  A    A  D+E+Q S  +SP  RA  + 
Sbjct  607   DQLSGGGTNSNVQHQSSCNMPSQKSG--AIPHAMMFQASNDSELQGSTTNSPGDRA-RLG  663

Query  465   VSGPMEGRSVLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQ  286
                  EG   L LFP SPV+     +QP D+G P R IRVVPHN R+A+ SAARIFQSIQ
Sbjct  664   TDRNAEGSDALQLFPMSPVIP-GGVAQPHDSGQPTRAIRVVPHNPRTATASAARIFQSIQ  722

Query  285   KERKQ  271
             +ERKQ
Sbjct  723   EERKQ  727



>ref|XP_004143036.1| PREDICTED: protein EARLY FLOWERING 3-like [Cucumis sativus]
 gb|KGN62407.1| hypothetical protein Csa_2G352370 [Cucumis sativus]
Length=716

 Score =   435 bits (1118),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 320/745 (43%), Positives = 415/745 (56%), Gaps = 100/745 (13%)
 Frame = -3

Query  2334  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIP-PSP  2158
             M PMFPRLHVNDTEKG PRAPPRNKMALYEQ ++PS+R   GVLP   N +S  +  PS 
Sbjct  11    MEPMFPRLHVNDTEKGWPRAPPRNKMALYEQFTVPSKRSSPGVLPLKTNISSKPVAIPSS  70

Query  2157  SQGNGHERRMFLPMHL--PPSTY---SAEKLHAHSSDSNTPLTQFESRKKT----DEDDF  2005
             SQG G +  + LP++L  P ST    + + L +   + N PL Q E  ++T    DEDDF
Sbjct  71    SQGTGADGNLRLPLNLSSPTSTSQVGNTQALPSGEVNENPPLVQPEQSRQTTEAEDEDDF  130

Query  2004  RVPVFVNSNISQSIGKFYKNSEREKVSPSSPAF-------------------LGRSTKDA  1882
              VPV+  S +   I     +  +EK+S   P                     L  S+  +
Sbjct  131   MVPVYDQSRMG--ISGVQNSDHKEKLSSPGPKHSDCSTILQAGYEKGQNDLDLTSSSAHS  188

Query  1881  KHTRGGNLRHQESSRQLPATREQSVKASLSSRSTD--KKEHCIKHTDTDFPLHSEQRDGP  1708
             +    GN +  E SR  P    +S    L   +TD  +KE  I   D  F   S  R   
Sbjct  189   RQVTNGN-KVNEKSRVHP---RKSTTNLLDRGNTDGLQKETNISK-DQIFQDKSNTRFDK  243

Query  1707  ANNSD--LSHKSGINLQPES---IID----SKVGDANDDAVVSGPIKGVEIGDSSVPINC  1555
               +SD  L   S  N+Q +    ++D    ++ G+A+     S P   V+   S      
Sbjct  244   LQDSDVRLHRHSRSNIQLDESGCVVDVVEPTRFGEAD-----SVPCSRVDTHSS------  292

Query  1554  FQTEGQIINVGNDVESQENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIG  1375
              + E  I+ V N VE+   +T  S Q    D+ D  SE SMV+ +SG +I PDDVVGIIG
Sbjct  293   LKNERLIVPVDN-VENHVERTYSSMQVGNADKSDIVSENSMVDSLSGSEICPDDVVGIIG  351

Query  1374  QKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGK----PLKVS  1207
             QKHFWKARRAI+NQQRVF VQVFELHRLIKVQ+LIA SP+ LLED  +L      PL   
Sbjct  352   QKHFWKARRAIINQQRVFEVQVFELHRLIKVQRLIAGSPHLLLEDGVFLDNSSPSPLP--  409

Query  1206  SAKRLLPPFEYIKAPQNVPKHKNDSEKPHLRMECSAENTVGKASLSSVQNATQAPSCKPS  1027
              AK+L   +      Q  P   +D +KP   +ECSAEN VGK SL       +  +C+PS
Sbjct  410   -AKKLRSDYTVKSHVQLQP--SDDPKKPKHNVECSAENAVGKTSL-----PLEPINCQPS  461

Query  1026  PGNP----PLPV-VSNDSNMGPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGPGFMSPGCG  862
                P    P P  VS+D+ +  W  +Q S H WL+PVM+PSEGL+YKPYPGPGF+  GCG
Sbjct  462   TNGPYSVNPQPTSVSSDNKLSSW--YQTSAHHWLVPVMSPSEGLIYKPYPGPGFIYGGCG  519

Query  861   PPPVSTPVMGNFFAPPAYGLPTSQYHYQGMGD-PFAPPIGHGYFPPYGMPVMNSAVSTSA  685
             P     P+M      P+YG P S   +QG+G  P  P +G  +FPPYGMPVMN  +S  A
Sbjct  520   PYGPMAPMMN-----PSYGFPASV--HQGIGALPTTPMVGGSFFPPYGMPVMNPGMSGFA  572

Query  684   VEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNMPSQKNGDAD--VSDAHRLHACKDNEIQ  511
             V+Q+N +  TG   Q+SGG    N+QHQ S ++ +Q++ D +  VS   +  A K +E+Q
Sbjct  573   VDQVNWY--TGDPNQLSGGVAASNIQHQTSYDVSTQRDRDENQTVSRTAKSQAPKRSEVQ  630

Query  510   ASCAS----SPSVRAPGVTVSGPMEGRSVLPLFPTS-PVVNIVDASQPPDTGHPARVIRV  346
              S AS    SP+ +  G  V+   E  +VL LFP + P+V   +  QP D+    RVIRV
Sbjct  631   VSTASSPVCSPTSKVQGNKVNRTAESHNVLSLFPVAQPLVE--EGPQPSDSDQ-TRVIRV  687

Query  345   VPHNARSASESAARIFQSIQKERKQ  271
             VPHN RSA+ESAARIFQSIQ ERKQ
Sbjct  688   VPHNRRSANESAARIFQSIQNERKQ  712



>ref|XP_008377913.1| PREDICTED: protein EARLY FLOWERING 3-like, partial [Malus domestica]
Length=435

 Score =   424 bits (1091),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 243/425 (57%), Positives = 290/425 (68%), Gaps = 17/425 (4%)
 Frame = -3

Query  1521  NDVESQENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAI  1342
             ND E + ++ C SPQ   VD+ D++SETSMV+ ISGMDISPDDVVGIIGQKHFW AR+AI
Sbjct  16    NDSEYRGDRACISPQMGHVDKSDDASETSMVDSISGMDISPDDVVGIIGQKHFWTARKAI  75

Query  1341  VNQQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLG-KPLKVSSAKRLLPPFEYIKA  1165
             VNQQR+FAVQVFELHRLIKVQ+LIA SP+ LLEDTA+LG   L+ S AK+L    EY+  
Sbjct  76    VNQQRLFAVQVFELHRLIKVQRLIAGSPHLLLEDTAFLGTSTLRGSPAKKL--SSEYVVK  133

Query  1164  P-QNVPKHKNDSEKPHLRMECSAENTVGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDS  988
             P  +V K K+  E+P+ + ECSAEN VGK S SSV+N +Q  +  P  GNP    V+ D+
Sbjct  134   PLLHVVKRKHXPEEPNNKXECSAENAVGKTSHSSVRNGSQTSNYGPYIGNPQPTPVATDN  193

Query  987   NMGPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGPGFMSPGCG--PPPVSTPVMGNFFAPP  814
                PWCFHQ  GHQ LIPVM+PSEGLVYKPY GPG+M   CG   P  STP+ GNF   P
Sbjct  194   KANPWCFHQSPGHQLLIPVMSPSEGLVYKPYNGPGYMGAVCGGCGPFGSTPMAGNFVK-P  252

Query  813   AYGLPTSQYHYQGMGD-PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQA--  643
              YG+P+S  H+QGMG  P  P +GH YFPPYGM VMN A+STSAVEQM+ F   GS    
Sbjct  253   TYGVPSS--HHQGMGVLPVPPSLGHTYFPPYGMSVMNPAMSTSAVEQMHWFAGPGSHGHT  310

Query  642   -QVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVT  466
              Q SGGG N N+QHQ+SCNMPS+KN    +  A +     D+ +Q S A+S   RAP V 
Sbjct  311   DQSSGGGTNSNLQHQSSCNMPSRKN--VTIPHAKKFQPSNDSGLQGSTANSTGDRAP-VR  367

Query  465   VSGPMEGRSVLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQ  286
              +   EG   L L P  PV+      Q  DT  P R I+VVPHN R+A+ SAARIFQSIQ
Sbjct  368   TNQNAEGSDALQLLPMVPVIPD-GVPQSHDTDQPTRAIKVVPHNPRTATASAARIFQSIQ  426

Query  285   KERKQ  271
              ERKQ
Sbjct  427   AERKQ  431



>ref|XP_007024385.1| Hydroxyproline-rich glycoprotein family protein, putative [Theobroma 
cacao]
 gb|EOY27007.1| Hydroxyproline-rich glycoprotein family protein, putative [Theobroma 
cacao]
Length=774

 Score =   434 bits (1116),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 318/782 (41%), Positives = 419/782 (54%), Gaps = 113/782 (14%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG---VLPPNPN-NASNLI  2170
             +M PMFPRLHVNDTE+GGPRAPPRNKMALYEQLSIPSQRF+ G   VLP  PN N+S + 
Sbjct  11    VMSPMFPRLHVNDTERGGPRAPPRNKMALYEQLSIPSQRFNSGSLPVLPLPPNSNSSLVP  70

Query  2169  PPSPSQGNGHERRMFLPM-HLPPSTYSAEKLHAHS------------------------S  2065
               S S G G+ R MF+P  + P S+  AEK H++S                        S
Sbjct  71    SISSSHGGGNGRSMFMPFGNSPESSILAEKFHSYSIPGIKLNTMKGNQEKKSTKATDYQS  130

Query  2064  DSNTP------------------LTQFESRKKTDEDDFRVPVFVNSNISQSIGKFYKNSE  1939
                TP                    +F  RK   +DD RVP  V S   ++  +  ++  
Sbjct  131   LDTTPPIPAISKSNPLQPLHFSNFKKFSLRKLGHDDDLRVPTSVLSGRDRNCSRSKQSGG  190

Query  1938  REKVSPSS-PAFLGRSTKDAKHTRGGNLRHQESSRQLPATREQSVKASLSSRSTDKKEHC  1762
             +E  S  +  + +   T + K  +      Q+S R      E++ + S SS+   ++ + 
Sbjct  191   QENFSKLNLNSSMQLQTANEKQMKENYSVDQKSRRYFGNEAEENGRLSRSSQDLMERSNS  250

Query  1761  IK--------HTDTDFPL---HSEQRDGPANNSDLSHKSG-INL-----QPESIIDSKVG  1633
             ++         T +D P    +SE    P    +  +KS  +N+      P +++  +  
Sbjct  251   VQSTRDKILADTSSDLPTKIKNSESLKRPHAFLNQENKSSSVNMVNSVDGPNALLLQECV  310

Query  1632  DANDDAVVSGPIKGVEIG----DSSVPIN--CFQTEGQIIN-----VGNDVESQENQTCR  1486
                D  +    I  VE G    ++S   N  C +    + N     + N  ++ E + C 
Sbjct  311   ATQDKMIFRENIL-VESGRCRENTSKVRNESCLRQSLGVDNGSPNVLENTSKAHEEKKCG  369

Query  1485  SPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVF  1306
             + +   V   +N  + + VE IS +DI PDDVVGIIG+K FWK RRAIVNQQRVFAVQVF
Sbjct  370   AMEVGVVGGHNNVPDAATVESISHLDICPDDVVGIIGEKQFWKVRRAIVNQQRVFAVQVF  429

Query  1305  ELHRLIKVQKLIAESPNFLLEDTAYLGKP-LKVSSAKRLLPPFEYIKAPQNVPKHKNDSE  1129
             ELHRLIKVQ+LIA SP+ L EDT ++GKP L VS  K+L  P  Y+  P  + K K+ S+
Sbjct  430   ELHRLIKVQRLIAGSPHMLFEDTFFMGKPSLDVSPIKKL--PSNYVLEPPLIVKVKDSSQ  487

Query  1128  KPHLRMECSAENTVGKASLSSVQNATQA------PSCKPSPGNPPLPVVSNDSNMGPWCF  967
             KP++ +EC+ EN V K  L S  + T        P   P  GN     ++ ++   PWCF
Sbjct  488   KPNISIECADENAVAKLPLPSANDDTSKGLVALQPKYGPYLGNALSTPLAANTRTSPWCF  547

Query  966   HQPSGHQWLIPVMTPSEGLVYKPYPGP-----GFMSP---GCGPPPVSTPVMGNFFAPPA  811
               P G QWL+PVM+PSEGLVYKPY GP     GFM+P    CG  PV+    G  F   A
Sbjct  548   -SPFGSQWLVPVMSPSEGLVYKPYAGPCPPTAGFMAPVYDSCG--PVNLATGGGDFLNTA  604

Query  810   YGLPTSQYHYQGMGD-PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQA-QV  637
             YG+P S  H QG+G  P    IG  YFP YGMPVMN +VS SAVEQM+ F     +  Q+
Sbjct  605   YGVPAS--HQQGIGILPGNSAIGQTYFPHYGMPVMNPSVSDSAVEQMSPFIGVQLKGNQL  662

Query  636   SGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSG  457
             S G VN  + HQ+SCNM SQ +  A      +L A K++EIQ S ASSPS RA G     
Sbjct  663   STGDVNFTIAHQSSCNMSSQVS-QAISYCVGKLPASKESEIQGSTASSPSERARG-----  716

Query  456   PMEGRSVLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKER  277
                    LPLFPT P +   D +    +G   RVI+VVPHN+R A+ESAARIFQSIQ+ER
Sbjct  717   -----DALPLFPTEPTIQASDHNA-RSSGQQTRVIKVVPHNSRLATESAARIFQSIQEER  770

Query  276   KQ  271
             KQ
Sbjct  771   KQ  772



>ref|XP_008444497.1| PREDICTED: protein EARLY FLOWERING 3 [Cucumis melo]
 ref|XP_008444498.1| PREDICTED: protein EARLY FLOWERING 3 [Cucumis melo]
Length=717

 Score =   431 bits (1107),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 306/730 (42%), Positives = 407/730 (56%), Gaps = 69/730 (9%)
 Frame = -3

Query  2334  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIP-PSP  2158
             M PMFPRLHVNDTEKG PRAPPRNKMALYEQ ++PS+R   GVLP   N +S  +  PS 
Sbjct  11    MEPMFPRLHVNDTEKGWPRAPPRNKMALYEQFTVPSKRSSPGVLPLKTNISSKPVAIPSS  70

Query  2157  SQGNGHERRMFLPMHLPPSTYSAE-----KLHAHSSDSNTPLTQFESRKKT----DEDDF  2005
             SQG G +  + LP++L  +T +++      L +   + N PL Q E  ++T    DEDDF
Sbjct  71    SQGTGADGNLRLPLNLSSTTSTSQVGNSQALPSGEVNENPPLVQPEQSQQTTEAEDEDDF  130

Query  2004  RVPVFVNSNISQSIGKFYKNSEREKVSPSSPAFLGRST-KDAKHTRGGNLRHQESS----  1840
              VPV+  S + +S      +  +EK+S   P     ST   A + +G N     SS    
Sbjct  131   MVPVYNQSRMGKS--GVQNSDHKEKLSSPGPKHSDCSTILQAGYEKGQNDLDLTSSSAHS  188

Query  1839  RQLPATREQSVKASLSSRSTDKKEHCIKHTD-----TDFPLHSEQRDGPANNSDLSHKSG  1675
             RQ+   ++ + K+ +  R +        +TD     T+       +D      D    SG
Sbjct  189   RQVTNGKKVNEKSGVHPRKSTTNLSDRGNTDGLQKETNISKDKIFQDKSNTRFDKLQDSG  248

Query  1674  INLQPESIIDSKVGDANDDAVVSGPIKGVEIGDSSVPINCFQTEGQIINVG-----NDVE  1510
             + LQ  S  + ++ ++     V  P +  E+   SVP +   +   + N       ++VE
Sbjct  249   VRLQRHSRSNIQLDESGCVVDVIEPTRFGEV--DSVPCSRVDSHSSLKNESFNVPVDNVE  306

Query  1509  SQENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQ  1330
             +   +T  S Q    D+ D  SE SMV+ ISG +I PDDVVGIIGQKHFWKARRAI+NQQ
Sbjct  307   NHVERTYSSMQVGNADKSDIVSENSMVDSISGSEICPDDVVGIIGQKHFWKARRAIINQQ  366

Query  1329  RVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLG----KPLKVSSAKRLLPPFEYIKAP  1162
             RVF VQVFELHRLIKVQ+LIA SP+ LLED  +L      PL    AK+L   +      
Sbjct  367   RVFEVQVFELHRLIKVQRLIAGSPHLLLEDGVFLDSSSPSPLP---AKKLRSDYTVKSHV  423

Query  1161  QNVPKHKNDSEKPHLRMECSAENTVGKASLSSVQNATQAPSCKPSPGNP-----PLPV-V  1000
             Q  P   +D +KP   +ECSAEN VGK SL       +  +C+PS   P     P P  V
Sbjct  424   QLQP--SDDPKKPKHNVECSAENAVGKTSL-----PLEPINCQPSTNGPYSVQNPQPTSV  476

Query  999   SNDSNMGPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGPGFMSPGCGPPPVSTPVMGNFFA  820
             S+D+ +  W  +Q S H WL+PVM+PSEGL+YKPYPGPGF+  GCGP    TP+M     
Sbjct  477   SSDNKLSSW--YQTSAHHWLVPVMSPSEGLIYKPYPGPGFIYGGCGPYGPMTPMMN----  530

Query  819   PPAYGLPTSQYHYQGMGD-PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQA  643
              P+YG P S   +QG+G  P  P +G  +FPPYGMPVMN  +S  AV+Q+N +   G   
Sbjct  531   -PSYGFPASV--HQGIGALPSTPMVGGSFFPPYGMPVMNPGMSGFAVDQVNWY--AGDPN  585

Query  642   QVSGGGVNLNVQHQNSCNMPSQKNGDAD--VSDAHRLHACKDNEIQASCASSPSVRAPGV  469
             Q+SGG    N+QHQ S ++ +Q++ D +  VS   +  A K +E+Q S ASSP V +P  
Sbjct  586   QLSGGVAASNIQHQTSYDVSTQRDRDENQTVSRTAKSQAPKRSEVQVSTASSP-VCSPPS  644

Query  468   TVSGPMEGRSV----LPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARI  301
              V G    R+     +          + +  QP D+    RVIRVVPHN RSA+ESAARI
Sbjct  645   KVQGNKANRTAESHNVLPLFPLAPPLVEEGPQPSDSDQ-TRVIRVVPHNRRSANESAARI  703

Query  300   FQSIQKERKQ  271
             FQSIQ ERKQ
Sbjct  704   FQSIQNERKQ  713



>ref|XP_004501482.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Cicer arietinum]
Length=699

 Score =   429 bits (1103),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 302/742 (41%), Positives = 395/742 (53%), Gaps = 110/742 (15%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  2158
             +MGP+FPRLHV DTEKGGPRAPPRNKMALYEQ SIPSQRF+   LP +PN ++N +PPS 
Sbjct  11    MMGPLFPRLHVGDTEKGGPRAPPRNKMALYEQFSIPSQRFN---LPLHPNTSTNTVPPSS  67

Query  2157  S-QGNGHERRMFLPMHLPPST--YSAEK---LHAHSSDSNTPLTQFESRKKTDEDDFRVP  1996
             S QG   ER      HL   T  + AEK   L     + NT L+Q E RKK DEDDF VP
Sbjct  68    SIQGTVLERNYVFRGHLTSQTPIHQAEKRSSLQLEGVNLNTSLSQLEQRKKVDEDDFMVP  127

Query  1995  VFVNSNISQSIGKFYKNSEREKVSPSSPAFLGRSTKDAKHTRGGNLRHQESSRQLPATRE  1816
             V+V S I QS  K  ++ + +K++ +   + G S                          
Sbjct  128   VYVRSKIGQSNDKSLESFDGKKLNSTRSRYFGFS--------------------------  161

Query  1815  QSVKASLSSRSTDKKEHCIKHTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESIIDSKV  1636
                KA  +    D K++     +T   + +E    P  + +  H         S+ D   
Sbjct  162   ---KAGKTDCERDPKQYGSHLVNTKIDVRNEIDGPPQVSPNKEHPF------TSVRDIST  212

Query  1635  GDANDDAVVSGPIK-GVEIGDSSVPINCFQTEGQIINVGND---VESQENQTCRS----P  1480
             G++ D  V    +    E  D +V    F +  Q+     +    ESQ N   +S     
Sbjct  213   GESVDTLVRQAKVTLNQEFSDCAV--FKFSSLRQVDACSREECGTESQSNGIRQSNTLVE  270

Query  1479  QTQKVDRGDN--SSETSMVECISGMDI------SP---------DDVVGIIGQKHFWKAR  1351
              T+ VD+ ++  +++TS  E I+G +       SP         D++  I G ++    +
Sbjct  271   STRGVDKSNDPIANQTSPTEAINGTEYKDTWTGSPIQKGNLNRKDNISKISGVENLSTLK  330

Query  1350  ------RAIVNQQRVF-------------AVQVFELHRLIKVQKLIAESPNFLLEDTAYL  1228
                    AI+ Q+  +             AVQVFELHRLIKVQ+LIA SP+ L ED AYL
Sbjct  331   ISPDDVVAIIGQKHFWRARKAIANQQRVFAVQVFELHRLIKVQQLIAGSPDLLFEDGAYL  390

Query  1227  GKPLKVSSAKRLLPPFEYIKAP--QNVPKHKNDSEKPHLRMECSAENTVGKASLSSVQNA  1054
             GK   V    + L   EY+  P  QN+ K K+DSEK +  MECSAEN VGK S+SSV+N 
Sbjct  391   GKSPPVGCTTKKL-SLEYVVKPREQNL-KRKDDSEKINQEMECSAENAVGKTSISSVKNG  448

Query  1053  TQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGPGFMS  874
             +   +  P  GNP    ++ DS MGPWCF+Q  GHQWLIPVM+PSEGLVYKPYPGPGF  
Sbjct  449   SYLSTATPFAGNPHQGNMAADSGMGPWCFNQSPGHQWLIPVMSPSEGLVYKPYPGPGFTG  508

Query  873   PGCGPPPVSTPVMGNFFAPPAYGLPTSQYHYQGMGDPFAPPIGHGYFPPY-GMPVMNSAV  697
               CG      P+    F  P+YG+P           P  PP  H YFPPY GMPV  +AV
Sbjct  509   TNCGE---YGPIGAAPFMNPSYGMPAP---------PETPPGSHAYFPPYGGMPVTKAAV  556

Query  696   STSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNE  517
             + SAV  +N F+  G    +S    N N  +Q  CN+P+Q+NG        + H  K+ E
Sbjct  557   AESAVGHVNQFSAHGQNDHLSEVEANHNKHNQIPCNLPAQRNGATSHVMNRQRH--KEFE  614

Query  516   IQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPH  337
             +Q S ASSPS  A G+++    EGR VLPLFP  P+   V   Q P+T   +RVI+VVPH
Sbjct  615   LQGSTASSPSEMAQGMSIGQVSEGRDVLPLFPMVPLEPEV-VPQSPETRQQSRVIKVVPH  673

Query  336   NARSASESAARIFQSIQKERKQ  271
             N R+A+ESAARIFQSIQ+ERKQ
Sbjct  674   NRRTATESAARIFQSIQEERKQ  695



>ref|XP_004168028.1| PREDICTED: protein EARLY FLOWERING 3-like [Cucumis sativus]
Length=715

 Score =   429 bits (1103),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 321/736 (44%), Positives = 410/736 (56%), Gaps = 83/736 (11%)
 Frame = -3

Query  2334  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIP-PSP  2158
             M PMFPRLHVNDTEKG PRAPPRNKMALYEQ ++PS+R   GVLP   N +S  +  PS 
Sbjct  11    MEPMFPRLHVNDTEKGWPRAPPRNKMALYEQFTVPSKRSSPGVLPLKTNISSKPVAIPSS  70

Query  2157  SQGNGHERRMFLPMHL--PPSTYSAEKLHAHSS---DSNTPLTQFESRKKT----DEDDF  2005
             SQG G +  + LP++L  P ST       A  S   + N PL Q E  ++T    DEDDF
Sbjct  71    SQGTGADGNLRLPLNLSSPTSTSQVGNTQALPSGEVNENPPLVQPEQSRQTTEAEDEDDF  130

Query  2004  RVPVFVNSNISQSIGKFYKNSEREKVSPSSPAFLGRST-KDAKHTRGGNLRHQESS----  1840
              VPV+  S +   I     +  +EK+S   P     ST   A + +G N     SS    
Sbjct  131   MVPVYDQSRMG--ISGVQNSDHKEKLSSPGPKHSDCSTILQAGYEKGQNDLDLTSSSAHS  188

Query  1839  RQLPATREQSVKA---------SLSSR-STD--KKEHCIKHTDTDFPLHSEQRDGPANNS  1696
             RQ+    + + K+         +LS R +TD  +KE  I   D  F   S  R     +S
Sbjct  189   RQVTNGNKVNEKSRVHPRKSTTNLSDRGNTDGLQKETNISK-DQIFQDKSNTRFDKLQDS  247

Query  1695  DLS----HKSGINLQPESIIDSKVGDANDDAVVSGPIKGVEIGDSSVPINCFQTEGQIIN  1528
             D+      +S I L     +   V       V S P   V+   S       + E  I+ 
Sbjct  248   DVRLHRHSRSNIQLDESGCVVDVVEPTRFGEVDSVPCSRVDTHSS------LKNERLIVP  301

Query  1527  VGNDVESQENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARR  1348
             V N VE+   +T  S Q    D+ D  SE SMV+ +SG +I PDDV GIIGQKHFWKARR
Sbjct  302   VDN-VENHVERTYSSMQVGNADKSDIVSENSMVDSLSGSEICPDDV-GIIGQKHFWKARR  359

Query  1347  AIVNQQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGK----PLKVSSAKRLLPPF  1180
             AI+NQQRVF VQVFELHRLIKVQ+LIA SP+ LLED  +L      PL    AK+L   +
Sbjct  360   AIINQQRVFEVQVFELHRLIKVQRLIAGSPHLLLEDGVFLDNSSPSPLP---AKKLRSDY  416

Query  1179  EYIKAPQNVPKHKNDSEKPHLRMECSAENTVGKASLSSVQNATQAPSCKPSPGNP----P  1012
                   Q  P   +D +KP   +ECSAEN VGK SL       +  +C+PS   P    P
Sbjct  417   TVKSHVQLQP--SDDPKKPKHNVECSAENAVGKTSL-----PLEPINCQPSTNGPYSVNP  469

Query  1011  LPV-VSNDSNMGPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGPGFMSPGCGPPPVSTPVM  835
              P  VS+D+ +  W  +Q S H WL+PVM+PSEGL+YKPYPGPGF+  GCGP     P+M
Sbjct  470   QPTSVSSDNKLSSW--YQTSAHHWLVPVMSPSEGLIYKPYPGPGFIYGGCGPYGPMAPMM  527

Query  834   GNFFAPPAYGLPTSQYHYQGMGD-PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTR  658
                   P+YG P S   +QG+G  P  P +G  +FPPYGMPVMN  +S  AV+Q+N +  
Sbjct  528   N-----PSYGFPASV--HQGIGALPTTPMVGGSFFPPYGMPVMNPGMSGFAVDQVNWY--  578

Query  657   TGSQAQVSGGGVNLNVQHQNSCNMPSQKNGDAD--VSDAHRLHACKDNEIQASCAS----  496
             TG   Q+SGG    N+QHQ S ++ +Q++ D +  VS   +  A K +E+Q S AS    
Sbjct  579   TGDPNQLSGGVAASNIQHQTSYDVSTQRDRDENQTVSRTAKSQAPKRSEVQVSTASSPVC  638

Query  495   SPSVRAPGVTVSGPMEGRSVLPLFPTS-PVVNIVDASQPPDTGHPARVIRVVPHNARSAS  319
             SP+ +  G  V+   E  +VL LFP + P+V   +  QP D+    RVIRVVPHN RSA+
Sbjct  639   SPTSKVQGNKVNRTAESHNVLSLFPVAQPLVE--EGPQPSDSDQ-TRVIRVVPHNRRSAN  695

Query  318   ESAARIFQSIQKERKQ  271
             ESAARIFQSIQ ERKQ
Sbjct  696   ESAARIFQSIQNERKQ  711



>ref|XP_008797900.1| PREDICTED: protein EARLY FLOWERING 3 [Phoenix dactylifera]
Length=757

 Score =   416 bits (1070),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 315/785 (40%), Positives = 413/785 (53%), Gaps = 137/785 (17%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGV--LPPNPNNASNLIP-  2167
             IMGP+FPRLHVNDT+KGGPRAPPRNKMALYEQLSIPSQRF+     +P  P NAS L+P 
Sbjct  10    IMGPLFPRLHVNDTDKGGPRAPPRNKMALYEQLSIPSQRFNSAASSVPLPPPNASTLVPS  69

Query  2166  PSPSQGNGHERRMFLPMHLPPST--YSAEKLHAHSSDS---NTPLTQFESR---------  2029
              S SQG GHER ++ P ++P  T  +S+E++++ S D    N    +F  R         
Sbjct  70    ASSSQGCGHERNVYSPFYMPAHTPAHSSERVNSCSFDGMNLNATRMEFARRSIKHTSNRS  129

Query  2028  --------------------------KKTDEDDFRVPVFVNSNISQSIGKFYKNSEREK-  1930
                                       K  DEDDFRVP FV S I          S+R+  
Sbjct  130   LNAAGSVAERSSLRQHDSNGKNSCEKKLDDEDDFRVPTFVQSGIGAC-------SDRDAP  182

Query  1929  -VSPSSPAFLGRSTKDAKHTRGGNLRHQESSRQLP-ATREQSVKASLSSRSTD-------  1777
              + P   A + +S +  K+T    +    SS Q P A  + S + + S +S D       
Sbjct  183   LMGPEKLALISKSPQ--KNTSTTFI----SSLQCPNANDKPSEQTNTSDKSIDFDRNNGG  236

Query  1776  -----------KKEHCIKHTDTDFPLHSEQRDGPANNS----DLSHKSGINLQPESIIDS  1642
                         KE  + H ++      E    P+N S    D  H+S IN+  +S   S
Sbjct  237   KKPKETLVIEDLKERSVPHQES-----GENFGEPSNVSKVPLDRDHQSTINVLEKSRHGS  291

Query  1641  K--VGDANDDAVVSGP-----IKGVEIGDSSVPINCFQTEGQIINVGNDVESQE--NQTC  1489
                  D+  + V+ GP     I  VE  D+S   N   ++  + N      + +  N  C
Sbjct  292   TGFSRDSCGNGVLGGPKNMNDINLVESRDASRARNKSMSKPSLENSHGTSSTADKCNGEC  351

Query  1488  RSPQTQKVD-----RGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRV  1324
                +  +++     + D  SE SMV+ ISG +ISPDD+VG+IG KHFWKARRAIVNQQRV
Sbjct  352   GDKENGRLEMKDGEKKDEVSEASMVDSISGWEISPDDIVGVIGPKHFWKARRAIVNQQRV  411

Query  1323  FAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKH  1144
             FA+QVFELHRLIKVQKLIA SP+ LLE   YL K        + LPP    ++     KH
Sbjct  412   FALQVFELHRLIKVQKLIAASPHLLLEGNPYLNK-FSAKVPSKSLPPEGNTESLLQTVKH  470

Query  1143  KNDSEKPHLRMECSAENTVGKASLSSVQNAT------QAPSCKPSPGNPPLPVVSNDSNM  982
             K+  +KP+   EC +EN  G  +  S ++        Q P  +P  G P    ++ ++N 
Sbjct  471   KDSFQKPNQNAECPSENAAGAPTFPSCEDEVNQGLHDQVPRNEPYSGTPSPMSMAPENNP  530

Query  981   GPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGP-----GFMSPGCGP-PPVSTPVMGNFFA  820
               WCFH P+ +QWL+PVM+PSEGLVYKPY GP     GFM P  G   P+S P     F 
Sbjct  531   SAWCFHLPA-NQWLVPVMSPSEGLVYKPYTGPCPPTGGFMGPVYGSCTPLSLPPAAGDFM  589

Query  819   PPAYGLPTSQYHYQGMGDPF-APPIGHGYFP-PYGMPVMNSAVSTSAVEQMNSFTRTGSQ  646
              PAYG+P S +  Q MG P  APP+   YFP PYG+PV+N  +S+SAVEQ+N +   G  
Sbjct  590   NPAYGVPAS-HQPQNMGVPSGAPPVAPNYFPAPYGLPVVNPVISSSAVEQVNPWPGLGPH  648

Query  645   AQVSGGGVNLNVQH-QNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGV  469
              Q+         QH + SCNM   K+     S   +  A KD+E+Q S ASSP  +A   
Sbjct  649   GQID--------QHSRGSCNMSHPKS--EAFSCFWKFQASKDSELQGSTASSPCKKA---  695

Query  468   TVSGPMEGRSVLPLFPTSPVVNIVDA-SQPPDTGHPARVIRVVPHNARSASESAARIFQS  292
                   E    LPLFP +P  +  +  SQ     +  RVI+VVPHNARSA+ESAARIF+S
Sbjct  696   -----QEESDALPLFPMAPATDGPNRPSQSSGRENQTRVIKVVPHNARSATESAARIFRS  750

Query  291   IQKER  277
             IQKER
Sbjct  751   IQKER  755



>ref|XP_008351957.1| PREDICTED: protein EARLY FLOWERING 3-like [Malus domestica]
Length=713

 Score =   415 bits (1067),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 237/427 (56%), Positives = 289/427 (68%), Gaps = 19/427 (4%)
 Frame = -3

Query  1521  NDVESQENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAI  1342
             ND E + ++ C SPQT  VD+ D+ SETSMV+ ISGMDISPDDVVGIIGQK FWKAR+AI
Sbjct  292   NDSEYRGDRKCISPQTGHVDKSDDVSETSMVDSISGMDISPDDVVGIIGQKXFWKARKAI  351

Query  1341  VNQQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLG-KPLKVSSAKRLLPPFEYIKA  1165
             VNQQR+FAVQVFELHRLIKVQ+LIA SP+ LLEDTA++G   L+ S AK+L    EY+  
Sbjct  352   VNQQRLFAVQVFELHRLIKVQQLIAGSPHLLLEDTAFMGTSTLRGSPAKKL--SSEYVVK  409

Query  1164  PQ-NVPKHKNDSEKPHLRMECSAENTVGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDS  988
             P  ++ K K++ EKP+ +MECSAEN VGK S +SV+N +Q  +  P  GNP   ++++D+
Sbjct  410   PLLHIVKRKHEPEKPNNKMECSAENAVGKTSHNSVKNGSQTSNYGPYLGNPQPTLMASDN  469

Query  987   NMGPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGPGFMSPGCGPPPV---STPVMGNFFAP  817
                PWCFHQ  GHQ+LIPVM+PSEGLV KPY GPGFM            STP+ GNF   
Sbjct  470   KASPWCFHQSXGHQFLIPVMSPSEGLVXKPYNGPGFMGGPVCGGCGPYGSTPMTGNFVK-  528

Query  816   PAYGLPTSQYHYQGMGDPFAPP--IGHGYFPPYGMPVMNSAVSTSAVEQMNSF---TRTG  652
             P+YG+P+  +H QGMG    PP   GH YFPPYGM VMN  + +SAVEQM+ F      G
Sbjct  529   PSYGVPS--HHLQGMGVLPVPPSLSGHTYFPPYGMSVMNPGMPSSAVEQMHWFAGPVSHG  586

Query  651   SQAQVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPG  472
                Q  GGG N N+QHQ+SCNMPSQKN    +  A RL    D+ +Q S A++   RAP 
Sbjct  587   HTNQSXGGGANSNLQHQSSCNMPSQKN--VTIPHAKRLQPSNDSGLQGSTANNTGDRAPM  644

Query  471   VTVSGPMEGRSVLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQS  292
              T   P EG   L LFP + V+      Q  DTG P R I+VVPHN R+A+ SAARIFQS
Sbjct  645   RTDQNP-EGSDALQLFPMAXVIPD-GVPQSSDTGQPTRAIKVVPHNPRTATASAARIFQS  702

Query  291   IQKERKQ  271
             IQ ERKQ
Sbjct  703   IQAERKQ  709


 Score =   122 bits (305),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 89/147 (61%), Gaps = 17/147 (12%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  2158
             ++GPMFPRLHVND +KGGPRAPPRNKMALYEQLSIPSQRF+ GVLP N  N         
Sbjct  9     VVGPMFPRLHVNDADKGGPRAPPRNKMALYEQLSIPSQRFNPGVLPLNSIN---------  59

Query  2157  SQGNGHERRMFLPMHLPPS--TYSAEKLHAHSSDS---NTPLTQFESRKKTD-EDDFRVP  1996
              QG+  +  +  P+H  PS  T+ A   H   SD    N P  Q + R+K   EDDF VP
Sbjct  60    -QGSRSDGNLAFPLHGHPSTPTHQAVIFHGRQSDGANVNVPFGQTDLRRKIGYEDDFSVP  118

Query  1995  VFVNSNISQSIGKFYKNSEREKVSPSS  1915
             VFV S +     K    SE EK++P S
Sbjct  119   VFVQSRMGLGHSKTQIGSE-EKLTPIS  144



>ref|XP_008393666.1| PREDICTED: protein EARLY FLOWERING 3 [Malus domestica]
Length=713

 Score =   415 bits (1066),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 237/427 (56%), Positives = 289/427 (68%), Gaps = 19/427 (4%)
 Frame = -3

Query  1521  NDVESQENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAI  1342
             ND E + ++ C SPQT  VD+ D+ SETSMV+ ISGMDISPDDVVGIIGQK FWKAR+AI
Sbjct  292   NDSEYRGDRKCISPQTGHVDKSDDVSETSMVDSISGMDISPDDVVGIIGQKXFWKARKAI  351

Query  1341  VNQQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLG-KPLKVSSAKRLLPPFEYIKA  1165
             VNQQR+FAVQVFELHRLIKVQ+LIA SP+ LLEDTA++G   L+ S AK+L    EY+  
Sbjct  352   VNQQRLFAVQVFELHRLIKVQQLIAGSPHLLLEDTAFMGTSTLRGSPAKKL--SSEYVVK  409

Query  1164  PQ-NVPKHKNDSEKPHLRMECSAENTVGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDS  988
             P  ++ K K++ EKP+ +MECSAEN VGK S +SV+N +Q  +  P  GNP   ++++D+
Sbjct  410   PLLHIVKRKHEPEKPNNKMECSAENAVGKTSHNSVKNGSQTSNYGPYLGNPQPTLMASDN  469

Query  987   NMGPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGPGFMSPGCGPPPV---STPVMGNFFAP  817
                PWCFHQ  GHQ+LIPVM+PSEGLV KPY GPGFM            STP+ GNF   
Sbjct  470   KASPWCFHQSXGHQFLIPVMSPSEGLVXKPYNGPGFMGGPVCGGCGPYGSTPMTGNFVK-  528

Query  816   PAYGLPTSQYHYQGMGDPFAPP--IGHGYFPPYGMPVMNSAVSTSAVEQMNSF---TRTG  652
             P+YG+P+  +H QGMG    PP   GH YFPPYGM VMN  + +SAVEQM+ F      G
Sbjct  529   PSYGVPS--HHLQGMGVLPVPPSLSGHTYFPPYGMSVMNPGMPSSAVEQMHWFAGPVSHG  586

Query  651   SQAQVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPG  472
                Q  GGG N N+QHQ+SCNMPSQKN    +  A RL    D+ +Q S A++   RAP 
Sbjct  587   HTNQSXGGGANSNLQHQSSCNMPSQKN--VTIPHAKRLQPSNDSGLQGSTANNTGDRAPM  644

Query  471   VTVSGPMEGRSVLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQS  292
              T   P EG   L LFP + V+      Q  DTG P R I+VVPHN R+A+ SAARIFQS
Sbjct  645   RTDQNP-EGSDALQLFPMAXVIPD-GVPQSSDTGQPTRAIKVVPHNPRTATASAARIFQS  702

Query  291   IQKERKQ  271
             IQ ERKQ
Sbjct  703   IQAERKQ  709



>ref|XP_010267078.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Nelumbo 
nucifera]
Length=796

 Score =   411 bits (1056),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 316/798 (40%), Positives = 420/798 (53%), Gaps = 124/798 (16%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGV-----LPPNPNNASNL  2173
             I GP+FPRLHVNDTEKGGPRAPPRNKMALYE LSIPSQRF+  +     LPPN N+ +++
Sbjct  10    ITGPLFPRLHVNDTEKGGPRAPPRNKMALYELLSIPSQRFNPRLAPTLPLPPN-NSCTSV  68

Query  2172  IPPSPSQGNGHERRMFLPMHL--PPSTYSAEKLHAHSSDS---NTPLTQFESRKKT----  2020
                S SQ  GHER +  P +L  P ST+SA KLH+ SSD    N  + +F+ RK T    
Sbjct  69    SSISSSQSGGHERSVLSPFYLQPPTSTHSAGKLHSSSSDGANLNGTMAEFD-RKSTKNVN  127

Query  2019  ---------------------------------DEDDFRVPVFVNSNISQSIGKFYKNSE  1939
                                              DEDD RVPVFV+S +S    K   N+ 
Sbjct  128   HRPSNATTGLLSTSDRSSCHSHAFSNLRKRIPGDEDDLRVPVFVHSQVSPCSDKDIPNTS  187

Query  1938  REKVSPSSPAFLGRST--------------------------KDAKHTRGGNLRHQESSR  1837
             RE+ SP       RST                          K  K TR  +++ ++  R
Sbjct  188   RERFSPFISTNSDRSTVAEDNSPLKTAAATCNSSMQPQNACDKSQKPTRTTDMKSKQHVR  247

Query  1836  -QLPATREQSVKA--------SLSSRSTDKKEHCIKHTDTDFPLHSEQRDGPANNSDLSH  1684
              Q     +++V          S+SS   ++    +KH  T    + E ++G   +  L  
Sbjct  248   NQFKENLKETVTGKNHAENSTSISSMG-ERIAEPLKHDKTSG--NQELQNGQVGSRRLCD  304

Query  1683  KSGINLQPE--SIIDSKVGDANDDAVVSGPIKGVEIG-------DSSVPINCFQTEGQII  1531
                   Q    ++     GDA+   V    ++   I          + P+N  +   +  
Sbjct  305   ADAERHQENGSAMFPKICGDADVHLVEPNEVEKENISRERNESCSEASPVNSHRNPERAE  364

Query  1530  NVGNDVESQENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKAR  1351
             N G+     E     S Q   VD  D++SE+SMV+ + G DISPDD VG+IG+K FWKAR
Sbjct  365   NGGH---YHEEMVHESLQVGDVDGNDDASESSMVDSVLGADISPDDAVGVIGKKRFWKAR  421

Query  1350  RAIVNQQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGK-PLKVSSAKRLLPPFEY  1174
             RAIVNQQ++FAVQVFELHRLI+VQ+LIA SP+ LL+    LGK PLK S  K+L   +  
Sbjct  422   RAIVNQQKLFAVQVFELHRLIEVQRLIAGSPHLLLDGNPCLGKPPLKESPVKKLTSKY-V  480

Query  1173  IKAPQNVPKHKNDSEKPHLRMECSAENTVGKAS-LSSVQN---ATQAPSCKPSPGNPPLP  1006
             IK+P  V K K DS+ P+   E +AENT+ K + LS+  N    +Q     P  GNPPL 
Sbjct  481   IKSPPCV-KKKVDSQNPNQNAEGAAENTLRKPTPLSNGVNKGLVSQQSCHGPHSGNPPLA  539

Query  1005  VVSNDSNMGPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGP-----GFMSP---GCGPPPV  850
              ++ D+  GPW F+ P G++WL+P+M+PSEGLV+KP  GP     GFM+P    CGPP +
Sbjct  540   PMATDNKSGPWYFYPPPGNRWLVPIMSPSEGLVHKPVVGPCPLTAGFMAPVYGDCGPPSL  599

Query  849   STPVMGNFFAPPAYGLPTSQYHYQGMGD-PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQM  673
             S P+ G+F +  AYG+P S  H QG+G  P A P+G  YFP YG+PV+N  +  S+V+Q 
Sbjct  600   S-PMAGDFMS-TAYGIPAS--HQQGIGIFPGALPVGQTYFPSYGVPVLNPGIFASSVDQT  655

Query  672   NSFTRT---GSQAQVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASC  502
             N        G     S G    N+ H +S N  +  +         +    KD+E Q S 
Sbjct  656   NPLVGVWPHGHAESFSSGDAYFNLHHHSSYNNSNHNSESISCC-TWKFQMSKDSEPQGST  714

Query  501   ASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVD-ASQPPDTGHPARVIRVVPHNARS  325
             ASSP  R      +   EGR  LPLFP +P V + +   Q   +    RVIRVVPHN RS
Sbjct  715   ASSPCERTRSTGANNIAEGRDPLPLFPMAPAVQVQNPVLQSRSSDQQTRVIRVVPHNRRS  774

Query  324   ASESAARIFQSIQKERKQ  271
             A+ESAARIFQSIQKER++
Sbjct  775   ATESAARIFQSIQKERQK  792



>ref|XP_010049159.1| PREDICTED: protein EARLY FLOWERING 3 [Eucalyptus grandis]
 gb|KCW81636.1| hypothetical protein EUGRSUZ_C02997 [Eucalyptus grandis]
Length=698

 Score =   405 bits (1041),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 230/418 (55%), Positives = 275/418 (66%), Gaps = 16/418 (4%)
 Frame = -3

Query  1500  NQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVF  1321
             N+TC +       R D++SE S+ + +SG DISPDDVVGIIGQKHFWKARRAIVNQQRVF
Sbjct  285   NETCGALLMVDAGRNDDASEVSIADSVSGFDISPDDVVGIIGQKHFWKARRAIVNQQRVF  344

Query  1320  AVQVFELHRLIKVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHK  1141
             AVQVFELHRLIKVQKLIA SP+ L+ED + LGK   V+S  +          P     HK
Sbjct  345   AVQVFELHRLIKVQKLIAGSPHLLIEDVSGLGKTSLVNSPAKKFSEDHNGGYPSQTTNHK  404

Query  1140  NDSEKPHLRMECSAENTVGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQ  961
              + EKP  +MECSAEN VGK S+SSV++A Q     P   NPPL  +  D  MGPW + Q
Sbjct  405   EEQEKPGHQMECSAENAVGKTSISSVKSANQLSDYGPGMRNPPLAPIVPDVKMGPWGYPQ  464

Query  960   PSGHQWLIPVMTPSEGLVYKPYPGPGFMSPGCG--PPPVSTPVMGNFFAPPAYGLPTSQY  787
             PSG QWLIPVM+PSEGLVYKPYP PG     CG   P  S+P+M N    PAYG+P    
Sbjct  465   PSGQQWLIPVMSPSEGLVYKPYPVPGLTGTACGGCGPYNSSPMMAN-IPNPAYGVPL-HP  522

Query  786   HYQGMGDPFA-PPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTR---TGSQAQVSGGGVN  619
             H+QG G P   PP GH YFP YGMPVM+  VS S+VEQ N F+R    G   Q+SGG VN
Sbjct  523   HHQGFGFPSGVPPPGHSYFPTYGMPVMSFNVSGSSVEQTNRFSRPVQYGQTGQLSGGEVN  582

Query  618   LNVQHQNSCNMPSQKNGD-ADVSDAHRLHACKDNEIQASCASSPSVRAP-GVTVSGPMEG  445
              N+QHQNS N+P Q+ G  A +    +  A KD+E+Q S ASSPS + P G+      +G
Sbjct  583   -NLQHQNSSNLPKQRKGSVAQI----KFQANKDSELQVSTASSPSEKPPEGLGNVQSSDG  637

Query  444   RSVLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
             +  LPLFP +P V+    SQ  +   P RVIR VPHNARSA+ES ARIF+SIQ+ERKQ
Sbjct  638   KEALPLFPVAPAVS-EGGSQLREAEQPTRVIRSVPHNARSATESVARIFRSIQEERKQ  694


 Score =   156 bits (394),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 97/137 (71%), Gaps = 7/137 (5%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  2158
             IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF  G+LP NPNN+SNL+ P+ 
Sbjct  10    IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFGSGMLPLNPNNSSNLVSPAS  69

Query  2157  S-QGNGHERRMFLPMHLPPS--TYSAEKLHAHSSDSNTP---LTQFESRKKT-DEDDFRV  1999
             S QG G  R ++ P HLPPS  T+ +E+L+A  S   +P   L + E RK   D DDF V
Sbjct  70    SNQGTGSARNLYFPRHLPPSTPTHLSERLNAGKSGGTSPANSLARVEQRKNAGDGDDFMV  129

Query  1998  PVFVNSNISQSIGKFYK  1948
             PV+V S   Q   K  K
Sbjct  130   PVYVQSGTGQGKNKNSK  146



>gb|KHF99548.1| Protein EARLY FLOWERING 3 -like protein [Gossypium arboreum]
Length=733

 Score =   402 bits (1033),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 305/774 (39%), Positives = 402/774 (52%), Gaps = 139/774 (18%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPP-S  2161
             +M PMFPRLHVNDTEKGGP+APPRNKMALYEQLSIPSQRF+   LP  PNN ++L+P  S
Sbjct  12    VMSPMFPRLHVNDTEKGGPKAPPRNKMALYEQLSIPSQRFN-SALPLPPNNTNSLVPSIS  70

Query  2160  PSQGNGHERRMFLPM---HLPPSTYSAEKLHAHS------------------------SD  2062
              S G G+E  MF+P    H P S   AEK H++S                        S 
Sbjct  71    SSHGEGNESSMFMPFENSHEPSSL--AEKFHSYSIHGAKISSTKENQHNQFPKATDYHSL  128

Query  2061  SNTPLT-----------------QFESRKKTDEDDFRVPVFVNSNI--SQSIGKFYKNSE  1939
               TP T                 +F  RK   +DD RVP  V S I  S S  K  +N E
Sbjct  129   DTTPSTTAVCKSTFLSPHFSNFKKFSPRKLGHDDDLRVPTSVLSAIDRSCSCNKHGENQE  188

Query  1938  RE-----------------KVSPSSPAFLGRSTKDAKHTRGGNLRHQESSRQLPATREQS  1810
             R                   V P S  ++    ++       N    ++S  L +T+ ++
Sbjct  189   RFPELNLSSSMQLRSANEISVGPKSKRYVENQAEENGRLFRSNQDLADTSSNL-STKMKN  247

Query  1809  VKASLSSRSTDKKEHCIKHTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESIIDSKVGD  1630
              K+     ++  KE+ I   D    L+ E R     N+ L H+SG +L+  S + ++   
Sbjct  248   SKSLKRPHNSCNKENKISSVDI---LNGEVRA----NAWLHHESGRSLENASNVRNE---  297

Query  1629  ANDDAVVSGPIKGVEIGDSSVPINCFQTEGQIINVGNDVESQENQTCRSPQTQKVDRGDN  1450
                    S   + +E+ + S  +N  +T           ++ E +   + Q + ++R + 
Sbjct  298   -------SCSRQSLEVDNGS--LNALETR---------YKTHEEKNAGTTQVRGLNRHNK  339

Query  1449  SSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLI  1270
                TSM+E +  +++ PDD+VGIIGQKHFWK R AI++QQR+FA+QVFELHRLIKVQ+LI
Sbjct  340   VPSTSMLESVYCLNMCPDDIVGIIGQKHFWKVRIAIIDQQRIFAMQVFELHRLIKVQRLI  399

Query  1269  AESPNFLLEDTAYLGK-PLKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPHLRMECSAEN  1093
             A SP  LLEDT Y+GK  L VS  K+L    + +  P  + K ++ S+KP + +E + EN
Sbjct  400   AASPKILLEDTYYMGKLSLDVSPFKKL--SSDNVSEPPLIVKIRDRSQKPKIGIEYADEN  457

Query  1092  TVGKASLSSVQN------ATQAPSCKPSPGNPPLPVVSNDSNMG---PWCFHQPSGHQWL  940
              V K    S          TQ P   P   N  +   S  +N G   PW F  P G QWL
Sbjct  458   AVAKLPHPSANGDTHKGLLTQRPKYGPYSAN--VLSTSRATNTGSSSPWGF-SPPGSQWL  514

Query  939   IPVMTPSEGLVYKPYPGP-----GFMSP---GCGPPPVSTPVMGNFFAPPAYGLPTSQYH  784
             +PVM+PSEGLVYKPY GP     G ++P    CGP  ++T   G  F    YG+  S  +
Sbjct  515   VPVMSPSEGLVYKPYAGPCPPTAGILAPVYGSCGPLNLATG--GGDFLSSTYGVSAS--Y  570

Query  783   YQGMGD-PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQA-QVSGGGVNLNV  610
              QG G  P  PPIG  YFP YG PV N +VS S VEQM+ FT   S   ++S G VN  +
Sbjct  571   QQGFGILPGNPPIGQTYFPHYGTPVRNPSVSGSVVEQMSPFTGVKSMGNRLSTGDVNFTI  630

Query  609   QHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLP  430
               Q+SCN+ SQ +         +L A K++EIQAS ASSPS R  G            LP
Sbjct  631   AQQSSCNISSQMSQAISFC-VTKLPASKESEIQASTASSPSERTKG----------DALP  679

Query  429   LFPTSPVVNIVDASQPPDT-GHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
             LFPT P       +   DT G   RVI+VVPHN + A+ESAARIFQSIQ+ERKQ
Sbjct  680   LFPTKPTTQA--CTHKADTSGQQTRVIKVVPHNRKLATESAARIFQSIQEERKQ  731



>gb|AAQ73529.1| early flowering 3 [Mesembryanthemum crystallinum]
Length=705

 Score =   397 bits (1020),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 311/722 (43%), Positives = 423/722 (59%), Gaps = 65/722 (9%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  2158
             IMGPMFPRLHVNDTE+GGPRAPPRNKMALYEQL++PSQR++ G +P +P+  S+L   + 
Sbjct  10    IMGPMFPRLHVNDTERGGPRAPPRNKMALYEQLTVPSQRYNTGAVPHHPSKNSSLNSSTS  69

Query  2157  S-QGNGHERRMFLPMHLPPSTYSAEKLHAHSSDS---NTPLTQFESRKK-TDEDDFRVPV  1993
             + QG GHER M++P++  PS  S ++L     ++   ++  TQ E+ KK  +EDDF VPV
Sbjct  70    TNQGTGHERDMYIPLYRTPSGPSYDELPVRQPEAVSLSSGPTQVENTKKPIEEDDFMVPV  129

Query  1992  FVNSNISQSIGKFYKNSEREKVS-PSSPA---FLGRSTKDAKHTRGGNLRHQESSRQLPA  1825
             F    I Q   K   + + E+ + PSS     FL  S K A    G       +SR++  
Sbjct  130   FSQPGIGQCNSKTQNSIDGERQTHPSSNHPVPFLCSSEKQANKMSG-----DITSRRVVI  184

Query  1824  TREQ-SVKA-SLSSRSTD---KKEHCIKHTDTDFPLHSEQRDGPANNSDLSHKSGINLQP  1660
              R+Q +++A + S+RS+D   +++ C +  DT    + E+R      S+L        Q 
Sbjct  185   NRDQRNLRAYNASTRSSDILTREKDCGRRKDTS--QYQEKR----MLSNLEKTDACLYQD  238

Query  1659  ES----IIDSKVGDANDDAVVSGPIKGVEIGDSSVPIN-CFQTEGQIINVGNDVESQENQ  1495
                    + ++ G+ + +  +    K + +     P+  C   +   +N+  ++   E  
Sbjct  239   HEDRLLAVGTRFGETDSEPPLESTHKVMSLRLMHNPLKGCGYNDVDAVNI--EMPRLEEH  296

Query  1494  TCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAV  1315
                  + + +DR ++ SETSMV+ +SG+++ PDDVVGIIG+KHFWKAR AIVNQQRVFAV
Sbjct  297   LL---ERENIDRANDVSETSMVDSVSGVEVCPDDVVGIIGRKHFWKARTAIVNQQRVFAV  353

Query  1314  QVFELHRLIKVQKLIAESPNFLLEDTAYLGK-PLKVSSAKRLLPPFEYIKAPQNVPKHKN  1138
             QVFELHRL+KVQK IA SP+ LLE  A++GK  LK S+AK+    F  +KA  +  K K+
Sbjct  354   QVFELHRLLKVQKHIAGSPHVLLEGAAFVGKTTLKDSAAKKFSSEFG-VKAFVHTIKQKD  412

Query  1137  DSEKPHLRMECSAENTVGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQP  958
             DS KP  + E +AEN V KA+  S QNA Q P+  P   +PP   V+ D  M PW + QP
Sbjct  413   DSRKPTDKTEGTAENAVPKAAPHS-QNAVQ-PAGYPPASSPP---VNTDPKMNPWSYPQP  467

Query  957   SGHQWLIPVMTPSEGLVYKPYPGPGFM---SPGCGPPPVSTPVMGNFFAPPAYGLPTSQY  787
               HQWL+PVMTPSEGLVYKPYP P  M     G   P   T V GN      YG+P    
Sbjct  468   QVHQWLVPVMTPSEGLVYKPYPAPPGMVGPGCGGYGPGGPTSVGGNMMN-MGYGMPNP--  524

Query  786   HYQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRT----GSQAQVSGGGVN  619
             H+QG    F    G GYFPPY MP+M+  +S SAV+QMN F+      G   Q + G VN
Sbjct  525   HFQGAVH-FG---GQGYFPPYPMPMMSPVMSGSAVDQMNQFSGGPNPFGQMNQPAAGSVN  580

Query  618   LNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASC-ASSPSVR-APGVTVSGPMEG  445
               +QHQNSCN P Q+   A  +    L + ++ E+Q S  +SSPS R A G   S P + 
Sbjct  581   QTLQHQNSCNKPGQRRETAAPAAMAPL-SRREGELQGSTGSSSPSKRGAQGTGTSPPTKE  639

Query  444   RSV----LPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKER  277
             R      LPLFPT+PV    + + P +    +RVI+VVPHN +S  ESAARIFQSIQ ER
Sbjct  640   RDALPLPLPLFPTAPVAEKSEGAPPVEKA--SRVIKVVPHNPKSTKESAARIFQSIQAER  697

Query  276   KQ  271
             +Q
Sbjct  698   RQ  699



>ref|XP_006466166.1| PREDICTED: protein EARLY FLOWERING 3-like [Citrus sinensis]
Length=750

 Score =   391 bits (1005),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 303/778 (39%), Positives = 394/778 (51%), Gaps = 128/778 (16%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG---VLPPNPNNASNLIP  2167
             +  PMFPRLHVND EKGGPRAPPRNKMALYEQLSIPS R+  G   +LP  P N ++L+ 
Sbjct  10    VTSPMFPRLHVNDKEKGGPRAPPRNKMALYEQLSIPSHRYSSGSAPMLPLPPPNGTSLVS  69

Query  2166  PSPSQGNGHERRMFLPM-HLPPSTYSAEKLHAHSSD------------------------  2062
                S   GHER +F  + + P  ++SAEKLH++SS+                        
Sbjct  70    SMSSSNGGHERSVFTQLCNSPAPSFSAEKLHSYSSNGIKLNNMMANQERKSVKPSNYQCL  129

Query  2061  -----------SNTP-------LTQFESRKKTDEDDFRVPVFV------NSNISQSIGKF  1954
                        S++P          F  RK  DEDD RV           SN  QS  + 
Sbjct  130   NAAGPLSSNAKSSSPKPSNFSNFRHFSLRKPEDEDDLRVSSAQLGISPHCSNSQQSKDRK  189

Query  1953  YKNSEREKVS--PSSPAFLGRSTKDAKHTRGGNLRHQESSRQLPATREQSVKASLSSRST  1780
             +K  +R  +    S P    ++ +D   T    + +  S   +P  R++ + A +SS   
Sbjct  190   FKQKKRSALGDIKSRPRTRNQNDEDTPQTSPDPVDNYTS---IPLNRDRDL-ADVSSIHP  245

Query  1779  DKKEHCIKHTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESIIDSKVGDANDDAVVSGP  1600
              K  H          L+ E R       +  H +   L  E +       A  D V    
Sbjct  246   SKVRHLESLKRAHSSLNQENRSSSMETLNSLHSTNSRLHQECV-------ALRDEVAHNY  298

Query  1599  IKGVEIGDSSVPINCFQTEGQII---NVGND---------VESQENQTCRSPQTQKVDRG  1456
                +E        N F+   +     ++G+D         VE  E++  RS Q ++VD+ 
Sbjct  299   SLLMETAMDIDKDNAFKVRTESCLRPSLGDDNSSPKELENVECHEDKNERSVQVREVDKQ  358

Query  1455  DNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQK  1276
             DN S T MV  +S + +SPDDVVG+IG+K FWKARRAI++QQRVF +QVFELHRL+KVQ+
Sbjct  359   DNVSNTYMVGSVSALAVSPDDVVGVIGEKQFWKARRAIIDQQRVFTLQVFELHRLLKVQR  418

Query  1275  LIAESPNFLLEDTAYLGK-PLKVSSAK-RLLPPFEYIKAPQNVPKHKNDSEKPHLRMECS  1102
             LIA SPN LLED    GK PL    AK R LP          + K KNDS  P    +C+
Sbjct  419   LIARSPNLLLEDNLCAGKPPLNTCQAKLRSLP---------CIVKAKNDSPNPDPGSQCA  469

Query  1101  AENTVGK---------ASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMG--PWCFHQPS  955
              +N V           +S   V   +   SC    GN P    +N  N+   PWCF  P 
Sbjct  470   DDNAVANIPHPFINNDSSKGFVSQQSNNGSCS---GNVPPAPAANSKNIKQTPWCF-PPP  525

Query  954   GHQWLIPVMTPSEGLVYKPYPGP-----GFMSPGCGP-PPVSTPVMGNFFAPPAYGLPTS  793
             G+QWL+ VM+PSEGLVYKPY GP     GF++P  G   PVS    G  F   AYG+P S
Sbjct  526   GNQWLVSVMSPSEGLVYKPYTGPCPPTTGFVAPFYGSCRPVSLNPTGVDFLNTAYGVPAS  585

Query  792   QYHYQGMGD-PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSF--TRTGSQAQVSGGGV  622
               H +G+G  P  PP+G   FPPYGMPVMN ++S +AV+QM  F          +S   +
Sbjct  586   --HQEGIGILPTTPPLGQTGFPPYGMPVMNQSISGTAVDQMIPFPPKDQSKDNHLSMVDI  643

Query  621   NLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGR  442
             N  + HQ+S NM SQ       S   +  A K++E+QAS ASSPS RA G          
Sbjct  644   NFMIPHQSSRNMSSQM-SRVITSCLEKFQASKESEVQASTASSPSERAKG----------  692

Query  441   SVLPLFPTSPVVNIVDASQPPDTG-HPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
               LPLFP +P+V + D  Q   TG   ARVI+VVP N R A+ESAARIF+SIQ+ERKQ
Sbjct  693   DALPLFPMAPIVQVSD--QNDQTGEQQARVIKVVPCNPRLATESAARIFRSIQEERKQ  748



>ref|XP_008806826.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Phoenix 
dactylifera]
Length=762

 Score =   390 bits (1001),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 305/775 (39%), Positives = 402/775 (52%), Gaps = 125/775 (16%)
 Frame = -3

Query  2334  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDH--GVLPPNPNNASNLI-PP  2164
             MGP+FPRLHVNDT+KGGPRAPPRNKMALYE+LSIPSQRF+     LPP P NA  L+   
Sbjct  23    MGPLFPRLHVNDTDKGGPRAPPRNKMALYERLSIPSQRFNSTASALPPCPRNARTLVSSA  82

Query  2163  SPSQGNGHERRMFLPMHLPPST--YSAEKLHAHSSDS---NTPLTQFESR----------  2029
             S SQG G ER ++ P ++P  T  +S+E++++HSSD    N    +FE R          
Sbjct  83    SLSQGCGQERSVYSPFYMPAHTPVHSSERVNSHSSDGMNLNATRMEFEQRSIKNMSNRTL  142

Query  2028  ------------------------KKTDEDDFRVPVFVNSNISQSIGKFYKNSEREKVSP  1921
                                     K  DEDDFRVP FV S I         + +   + P
Sbjct  143   NATGPVAECSSLHQQDTKAKNSSEKLDDEDDFRVPTFVRSGIG--------DIDAPAMGP  194

Query  1920  SSPAFLGRS-TKDAKHTRGGNLRHQESSRQLPATREQSVKASLSSRSTDKKEHCIKHTDT  1744
                    +S  K+   T   +L+H       P    + ++ S +SR+ D+     K  +T
Sbjct  195   EKLTHFSKSPQKNTSTTFNSSLQH-------PNANNEPLEQSHTSRNFDRNRGDKKPKET  247

Query  1743  DFPLHSEQRDGPANN-----------SDLSHKSGINLQPESIIDSKVG---DANDDAVVS  1606
                   ++R  P              SD  H + IN+  +S +  + G   ++  + V+ 
Sbjct  248   LEIKELKERSVPHQASGEPSNIAKVPSDRHHTNNINVFDKS-LHGRTGFCQESCGNGVID  306

Query  1605  GP-----IKGVEIGDSSVPI----------NCFQTEGQIINVGNDVESQENQTCRSPQTQ  1471
             GP     I  VE  D+S+            N ++T              EN T    + +
Sbjct  307   GPRSLNDINSVENWDASMARNESAPKPSLGNSYRTSSMADKCNEKGCDNENDTL---EMR  363

Query  1470  KVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRL  1291
               +  D +SE SMV+ ISG++ISP DVVG+IG KHFWKAR AIVNQQRVFAVQVFELHRL
Sbjct  364   DGENNDEASEASMVDSISGLEISPYDVVGVIGPKHFWKARSAIVNQQRVFAVQVFELHRL  423

Query  1290  IKVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPHLRM  1111
             IKVQKLIA SP+ LLE   YL K   V    + LPP    K+     K K  S+KP+   
Sbjct  424   IKVQKLIAGSPHLLLEGNPYLNKS-SVEVPSKNLPPQGNRKSQLQAVKLKVGSQKPNQNA  482

Query  1110  ECSAENTVGKASLSSVQNAT------QAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGH  949
             EC  EN  G   L S ++        Q P   P  G  P   ++ ++    WCFH PS +
Sbjct  483   ECLLENPGGAPPLPSHEDRVNRGPHDQVPRNGPYSGPSPPMSMAPENKPSAWCFHPPS-N  541

Query  948   QWLIPVMTPSEGLVYKPYPGP-----GFMSPGCGP-PPVSTPVMGNFFAPPAYGLPTSQY  787
             QWL+PVM+PSEGLVYKPY GP     GFM+P  G   P+S P +   F  PAYG+P S +
Sbjct  542   QWLVPVMSPSEGLVYKPYTGPCPPTGGFMAPVYGSCTPLSLPPVAGDFLNPAYGVPAS-H  600

Query  786   HYQGMGD-PFAPPIGHGYFP-PYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLN  613
               Q MG    AP I   YFP PYG+PV N  +S+SA +Q++     GS+       V ++
Sbjct  601   QPQNMGVLSGAPAIAPNYFPTPYGLPVANPDISSSADKQVSPL--PGSKPN-----VQID  653

Query  612   VQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVL  433
              Q  +S +M   K+ +A      R  A KD+E+Q S ASSP  +          EG   L
Sbjct  654   RQSWSSNDMLHPKS-EAFSGCLLRFQASKDSELQGSTASSPCEKE--------QEGTDAL  704

Query  432   PLFPTSPVVNI-VDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
             PLF  +P  +     SQ    G+ ARVI+VVPHNARSA+E+AARIF+SIQ+ER+Q
Sbjct  705   PLFHMAPATDGPTRPSQFRGRGNQARVIKVVPHNARSATETAARIFKSIQEERQQ  759



>ref|XP_006426449.1| hypothetical protein CICLE_v10024969mg [Citrus clementina]
 gb|ESR39689.1| hypothetical protein CICLE_v10024969mg [Citrus clementina]
Length=750

 Score =   389 bits (1000),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 304/778 (39%), Positives = 395/778 (51%), Gaps = 128/778 (16%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG---VLPPNPNNASNLIP  2167
             +  PMFPRLHVND EKGGPRAPPRNKMALYEQLSIPS R+  G   +LP  P N ++L+ 
Sbjct  10    VTSPMFPRLHVNDKEKGGPRAPPRNKMALYEQLSIPSHRYSSGSAPMLPLPPPNGTSLVS  69

Query  2166  PSPSQGNGHERRMFLPM-HLPPSTYSAEKLHAHSSD------------------------  2062
                S   GHER +F  + + P  ++SAEKLH++SS+                        
Sbjct  70    SMSSSNGGHERSVFTQLCNSPAPSFSAEKLHSYSSNGIKLNNMMANQERKSVKPSNYQCL  129

Query  2061  -SNTPLT-----------------QFESRKKTDEDDFRVPVFV------NSNISQSIGKF  1954
              +  PL+                  F  RK  DEDD RV           SN  QS  + 
Sbjct  130   NAAGPLSSNSKSSSPKPSNFSNFRHFSLRKPEDEDDLRVSSAQLGISPHCSNSQQSKDRK  189

Query  1953  YKNSEREKVS--PSSPAFLGRSTKDAKHTRGGNLRHQESSRQLPATREQSVKASLSSRST  1780
             +K  +R  +    S P    ++ +D   T    + +  S   +P  R++ + A +SS   
Sbjct  190   FKQKKRSALGDIKSRPRTRNQNDEDTPQTSPDPVDNYTS---IPLNRDRDL-ADVSSIRP  245

Query  1779  DKKEHCIKHTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESIIDSKVGDANDDAVVSGP  1600
              K  H          L+ E R       +  H +   L  E +       A  D V    
Sbjct  246   SKVRHLESLKRAHSSLNQENRSSSMETLNSLHSTNSRLHQECV-------ALRDEVAHNY  298

Query  1599  IKGVEIGDSSVPINCFQTEGQII---NVGND---------VESQENQTCRSPQTQKVDRG  1456
                +E        N F+   +     ++G+D         VE  E++  RS Q ++VD+ 
Sbjct  299   SLLMETAMDIDKDNAFKVRKESCLRPSLGDDNSSPKELENVECHEDKNERSVQVREVDKQ  358

Query  1455  DNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQK  1276
             DN S T MV  +S + +SPDDVVG+IG+K FWKARRAI++QQRVF +QVFELHRL+KVQ+
Sbjct  359   DNVSNTYMVGSVSALAVSPDDVVGVIGEKQFWKARRAIIDQQRVFTLQVFELHRLLKVQR  418

Query  1275  LIAESPNFLLEDTAYLGK-PLKVSSAK-RLLPPFEYIKAPQNVPKHKNDSEKPHLRMECS  1102
             LIA SPN LLED   +GK PL    AK R LP          + K KN S  P    +C+
Sbjct  419   LIARSPNLLLEDNLCVGKPPLNTCQAKLRSLP---------CIVKAKNYSPNPDPGSQCA  469

Query  1101  AENTVGK---------ASLSSVQNATQAPSCKPSPGN-PPLP-VVSNDSNMGPWCFHQPS  955
              +N V           +S   V   +   SC    GN PP P   S +    PWCF  P+
Sbjct  470   DDNAVANIPHPFINNDSSKGFVSQQSNNGSCS---GNVPPAPGANSKNIKQTPWCF-PPT  525

Query  954   GHQWLIPVMTPSEGLVYKPYPGP-----GFMSPGCGP-PPVSTPVMGNFFAPPAYGLPTS  793
             G+QWL+ VM+PSEGLVYKPY GP     GF++P  G   PVS    G  F   AYG+P S
Sbjct  526   GNQWLVSVMSPSEGLVYKPYTGPCPPTTGFVAPFYGSCSPVSLNPTGADFLNTAYGVPAS  585

Query  792   QYHYQGMGD-PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSF--TRTGSQAQVSGGGV  622
               H +G+G  P  PP+G   FPPYGMPVMN ++S +AV+QM  F          +S   +
Sbjct  586   --HQEGIGILPTTPPLGQTGFPPYGMPVMNQSISGTAVDQMIPFPPKDQSKDNHLSMVDI  643

Query  621   NLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGR  442
             N  + HQ+S NM SQ N     S   +  A K++E+QAS ASSPS RA G          
Sbjct  644   NFMIPHQSSRNMSSQMN-RVITSCLEKFQASKESEVQASTASSPSERAKG----------  692

Query  441   SVLPLFPTSPVVNIVDASQPPDTG-HPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
               LPLFP +P+V   D  Q   TG   ARVI+VVP N R A+ESAARIF+SIQ+ERKQ
Sbjct  693   DALPLFPMAPIVQASD--QNDQTGEQQARVIKVVPCNPRLATESAARIFRSIQEERKQ  748



>gb|KDO58686.1| hypothetical protein CISIN_1g004483mg [Citrus sinensis]
Length=750

 Score =   389 bits (999),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 304/778 (39%), Positives = 395/778 (51%), Gaps = 128/778 (16%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG---VLPPNPNNASNLIP  2167
             +  PMFPRLHVND EKGGPRAPPRNKMALYEQLSIPS R+  G   +LP  P N ++L+ 
Sbjct  10    VTSPMFPRLHVNDKEKGGPRAPPRNKMALYEQLSIPSHRYSSGSAPMLPLPPPNGTSLVS  69

Query  2166  PSPSQGNGHERRMFLPM-HLPPSTYSAEKLHAHSSD------------------------  2062
                S   GHER +F  + + P  ++SAEKLH++SS+                        
Sbjct  70    SMSSSNGGHERSVFTQLCNSPAPSFSAEKLHSYSSNGIKLNNMMANQERKSVKPSNYQCL  129

Query  2061  -SNTPLT-----------------QFESRKKTDEDDFRVPVFV------NSNISQSIGKF  1954
              +  PL+                  F  RK  DEDD RV           SN  QS  + 
Sbjct  130   NAAGPLSSNSKSSSPKPSNFSNFRHFSLRKPEDEDDLRVSSAQLGISPHCSNSQQSKDRK  189

Query  1953  YKNSEREKVS--PSSPAFLGRSTKDAKHTRGGNLRHQESSRQLPATREQSVKASLSSRST  1780
             +K  +R  +    S P    ++ +D   T    + +  S   +P  R++ + A +SS   
Sbjct  190   FKQKKRSALGDIKSRPRTRNQNDEDTPQTSPDPVDNYTS---IPLNRDRDL-ADVSSIHP  245

Query  1779  DKKEHCIKHTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESIIDSKVGDANDDAVVSGP  1600
              K  H          L+ E R       +  H +   L  E +       A  D V    
Sbjct  246   SKVRHLESLKRAHSSLNQENRSSSMETLNSLHSTNSRLHQECV-------ALRDEVAHNY  298

Query  1599  IKGVEIGDSSVPINCFQTEGQII---NVGND---------VESQENQTCRSPQTQKVDRG  1456
                +E        N F+   +     ++G+D         VE  E++  RS Q ++VD+ 
Sbjct  299   SLLMETAMDIDKDNAFKVRTESCLRPSLGDDNSSPKELENVECHEDKNERSVQVREVDKQ  358

Query  1455  DNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQK  1276
             DN S T MV  +S + +SPDDVVG+IG+K FWKARRAI++QQRVF +QVFELHRL+KVQ+
Sbjct  359   DNVSNTYMVGSVSALAVSPDDVVGVIGEKQFWKARRAIIDQQRVFTLQVFELHRLLKVQR  418

Query  1275  LIAESPNFLLEDTAYLGK-PLKVSSAK-RLLPPFEYIKAPQNVPKHKNDSEKPHLRMECS  1102
             LIA SPN LLED   +GK PL    AK R LP          + K KN S  P    +C+
Sbjct  419   LIARSPNLLLEDNLCVGKPPLNTCQAKLRSLP---------CIVKAKNYSPNPDPGSQCA  469

Query  1101  AENTVGK---------ASLSSVQNATQAPSCKPSPGN-PPLP-VVSNDSNMGPWCFHQPS  955
              +N V           +S   V   +   SC    GN PP P   S +    PWCF  P+
Sbjct  470   DDNAVANIPHPFINNDSSKGFVSQQSNNGSCS---GNVPPAPGANSKNIKQTPWCF-PPT  525

Query  954   GHQWLIPVMTPSEGLVYKPYPGP-----GFMSPGCGP-PPVSTPVMGNFFAPPAYGLPTS  793
             G+QWL+ VM+PSEGLVYKPY GP     GF++P  G   PVS    G  F   AYG+P S
Sbjct  526   GNQWLVSVMSPSEGLVYKPYTGPCPPTTGFVAPFYGSCSPVSLNPTGADFLNTAYGVPAS  585

Query  792   QYHYQGMGD-PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSF--TRTGSQAQVSGGGV  622
               H +G+G  P  PP+G   FPPYGMPVMN ++S +AV+QM  F          +S   +
Sbjct  586   --HQEGIGILPTTPPLGQTGFPPYGMPVMNQSISGTAVDQMIPFPPKDQSKDNHLSMVDI  643

Query  621   NLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGR  442
             N  + HQ+S NM SQ N     S   +  A K++E+QAS ASSPS RA G          
Sbjct  644   NFMIPHQSSRNMSSQMN-RVITSCLEKFQASKESEVQASTASSPSERAKG----------  692

Query  441   SVLPLFPTSPVVNIVDASQPPDTG-HPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
               LPLFP +P+V   D  Q   TG   ARVI+VVP N R A+ESAARIF+SIQ+ERKQ
Sbjct  693   DALPLFPMAPIVQASD--QNDQTGEQQARVIKVVPCNPRLATESAARIFRSIQEERKQ  748



>ref|XP_010910484.1| PREDICTED: protein EARLY FLOWERING 3 [Elaeis guineensis]
Length=755

 Score =   387 bits (994),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 303/774 (39%), Positives = 405/774 (52%), Gaps = 117/774 (15%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGV--LPPNPNNASNLIP-  2167
             +MGP+FPRLHVNDT+KGGPRAPPRNKMALYEQLSIPSQRF+     +P  P N S L+P 
Sbjct  10    MMGPLFPRLHVNDTDKGGPRAPPRNKMALYEQLSIPSQRFNSTASSVPLPPPNTSTLVPS  69

Query  2166  PSPSQGNGHERRMFLPMHLPPST--YSAEKLHAHSSDSNTP-------------------  2050
              S SQG GH+R +  P ++P     YS+E++H+ S D   P                   
Sbjct  70    ASSSQGCGHDRSVHSPFYVPAHAPAYSSERVHSRSFDGVNPSATRMEFARRSMKHMGNRS  129

Query  2049  ------------LTQFES-------RKKTDEDDFRVPVFVNSNISQSIGKFYKNSEREKV  1927
                         L Q +S       +K  DEDDFRVP FV S I     +       EK+
Sbjct  130   LNAAGSVAERSSLRQHDSDAKDSCEKKLDDEDDFRVPTFVQSEIGACSDRDAPLMGPEKL  189

Query  1926  SPSSPAFLGRSTKDAKHTRGGNLRHQESS---RQLPATREQSV---------KASLSSRS  1783
             +P S +      K+   T   +++ Q ++    +L  T ++S+         K   +   
Sbjct  190   TPVSKS----PHKNTSMTYISSVQCQNANDKPSELTNTSDKSIDFDRNHGEKKRKQTLPI  245

Query  1782  TDKKEHCIKHTDTDFPLHSEQRDGPANNS----DLSHKSGINLQPESIIDSK--VGDAND  1621
              D KE  + H +       E    P+N +    D  H S IN+  +S   S     D+  
Sbjct  246   DDLKERSVPHQEL-----GENFGEPSNVAKVPLDRDHTSTINVFEKSRYGSTGFSQDSCG  300

Query  1620  DAVVSGP-----IKGVEIGDSSVPINCFQTEGQIINVGNDVESQENQTCR----SPQTQK  1468
             + V+ GP     I  +   D+S   N   ++   +N  +     + + C     + + + 
Sbjct  301   NGVLGGPKNVNDINSIANKDASRARNESTSKPSHVNGHSTSSMADEEWCDKENGTLEMKD  360

Query  1467  VDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLI  1288
              +R D  SE SMV+ ISG++ISPDDVV +IG KHFWKARRAIVNQQRVFA+QVFELHRLI
Sbjct  361   GERKDEVSEASMVDSISGLEISPDDVVSVIGPKHFWKARRAIVNQQRVFALQVFELHRLI  420

Query  1287  KVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPHLRME  1108
             KVQ+LIA SPN LLE   YL +      +K L P       PQ V K K+ S+K +   +
Sbjct  421   KVQQLIAASPNLLLEGNPYLNESSAKVPSKSLSPEENTKSQPQTV-KDKDGSQKANQNAD  479

Query  1107  CSAENTVGKASLSSVQNAT------QAPSCKPSPGNPPLPVV-SNDSNMGPWCFHQPSGH  949
                ENT G   L S ++        Q P   P  G  PLPV  ++++N   WCFH P+ +
Sbjct  480   RPPENTAGAPPLPSHEDGVNRGPHDQVPRNGPYSGT-PLPVSRASENNPSAWCFHLPA-N  537

Query  948   QWLIPVMTPSEGLVYKPYPGP-----GFMSPGCGP-PPVSTPVMGNFFAPPAYGLPTSQY  787
             QWL+PVM+PSEGLVYKPY GP     GFM+P  G   P+S P +   F  PAYG+P S +
Sbjct  538   QWLVPVMSPSEGLVYKPYTGPCPPTGGFMAPVYGSCTPLSLPPVAGDFMNPAYGVPAS-H  596

Query  786   HYQGMGD-PFAPPIGHGYFP-PYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLN  613
               Q MG    AP +   YFP P G+PV N  V++SAVEQ++    +G   Q+        
Sbjct  597   QPQNMGVLSRAPAVAPNYFPAPCGLPVENPIVTSSAVEQISPLPGSGPHGQID-------  649

Query  612   VQH-QNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSV  436
              QH ++SCNM S    +A      +  + KD E+Q S ASSP  +          E R  
Sbjct  650   -QHSRSSCNM-SHPKSEAFSCCFWKFQSSKDTELQGSTASSPCDKV--------REERDA  699

Query  435   LPLFPTSPVVNIVDA-SQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKER  277
             LPLFP +   +  +  SQ     +  RVI+VVPHNARSA+ESAARIF+SIQ+ R
Sbjct  700   LPLFPMALATDGPNRPSQSSGRENHTRVIKVVPHNARSATESAARIFRSIQEGR  753



>ref|XP_007160975.1| hypothetical protein PHAVU_001G032900g [Phaseolus vulgaris]
 gb|ESW32969.1| hypothetical protein PHAVU_001G032900g [Phaseolus vulgaris]
Length=651

 Score =   376 bits (965),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 267/664 (40%), Positives = 350/664 (53%), Gaps = 63/664 (9%)
 Frame = -3

Query  2154  QGNGHERRMFLPMHLPPS--TYSAEKLHAHSSD---SNTPLTQFESRKKTDEDDFRVPVF  1990
             QGNGHER    P+ LP     + AE   +  SD   SNT   Q E RK+ DEDD  V  +
Sbjct  11    QGNGHERSYAYPVRLPSQIPAHRAESYISRQSDGSRSNTSSVQLERRKRADEDD--VHAY  68

Query  1989  VNSNISQSIGKFYKNSEREKVSP----------------SSPAFLGRSTKDA-KHTRGGN  1861
             + S I  S  K  K+   EK++P                  P   G    D  KH R GN
Sbjct  69    ICSRIGHSNDKTMKSFNGEKITPLGARNFCSVSVQDDGERGPTLFGSLPVDMRKHVRSGN  128

Query  1860  LRHQESSRQLPATREQSVKASLSSRSTDKKEHCIKHTDTDFPLHSEQRDGPANNSDLSHK  1681
               H   S    ++R+Q  K S+ ++S+ +    +       P + E +D    +   SH+
Sbjct  129   EAHPHVS----SSRQQQ-KMSVKNKSSGEVIDSLVMQAKVIP-NQEDQDCSVPSLSRSHQ  182

Query  1680  SGINLQPESIIDSKVGDANDDAVVSGPIKGVEIGDSSVPINCFQTEGQI---INVGNDVE  1510
              G  LQ E +   +  D      +    + ++ G++ VP +CF +       +    DVE
Sbjct  183   DGACLQQECVAGPQSNDVEHRNGLLSSTRDMDNGNALVPKSCFYSAANQTCPVEATGDVE  242

Query  1509  SQENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQ  1330
               +  T    Q    D   + S+ S V  +S   +SPDDVVGI+GQK FWKARR I NQQ
Sbjct  243   YHDIGTEGPMQKGIFDEIGDVSKISTVTNLSSQVVSPDDVVGILGQKRFWKARRKIANQQ  302

Query  1329  RVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGK-PLKVSSAKRLLPPFEYIKAPQNV  1153
             RVFAVQVFELHRLIKVQ+LIA SPN L+ED A+LGK PL+ S+ K +    + +  PQ  
Sbjct  303   RVFAVQVFELHRLIKVQQLIASSPNVLIEDGAFLGKFPLEGSTPKTI--SLQVVVEPQQQ  360

Query  1152  -PKHKNDSEKPHLRMECSAENTV-GKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMG  979
              PK KN+SEKP+ + ECSAEN V  K S SS +N +   +  P  G P    V++D+   
Sbjct  361   NPKRKNNSEKPNHKTECSAENAVEKKTSFSSPKNGSHLTNHSPFSGIPHQTDVASDNGTS  420

Query  978   PWCFHQPSGHQWLIPVMTPSEGLVYKPYPGPGF---MSPGCGPPPVSTPVMGNFFAPPAY  808
             PW F+Q   HQWLIP+M+PSEGL+YKPYP P F   M  GCG P    P +G  F  PAY
Sbjct  421   PWSFNQSPQHQWLIPIMSPSEGLIYKPYPRPAFTGMMPAGCGGPLGQAP-LGATFMNPAY  479

Query  807   GLPTSQYHYQGMG-DPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQ---  640
               P S   +Q +G  PF  P  H YF PYGMPV+N A S SA E +N F   GS  Q   
Sbjct  480   QFPAS---HQVVGVSPFVSPANHTYFSPYGMPVVNQAASGSAAEHVNQFATQGSHGQNGH  536

Query  639   VSGGGVNLNVQH-QNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTV  463
              S  G N N  H Q+S N+P Q++G   +S   +L   K+ ++Q S AS+ S     +  
Sbjct  537   SSVEGANFNTHHNQSSSNLPVQRSG--AMSHVKKLQVSKERQLQGSTASTASETPQRIKA  594

Query  462   SGPMEGRSVLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQK  283
                 EG     L      ++ VDA Q        +VI+VVPHN +SA+ESAARIFQSIQ+
Sbjct  595   RNITEGSDAHSL-----SLHSVDARQ------QTQVIKVVPHNGKSATESAARIFQSIQE  643

Query  282   ERKQ  271
             ERKQ
Sbjct  644   ERKQ  647



>ref|XP_008806834.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Phoenix 
dactylifera]
Length=759

 Score =   379 bits (973),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 302/775 (39%), Positives = 399/775 (51%), Gaps = 128/775 (17%)
 Frame = -3

Query  2334  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDH--GVLPPNPNNASNLI-PP  2164
             MGP+FPRLHVNDT+KGGPRAPPRNKMALYE+LSIPSQRF+     LPP P NA  L+   
Sbjct  23    MGPLFPRLHVNDTDKGGPRAPPRNKMALYERLSIPSQRFNSTASALPPCPRNARTLVSSA  82

Query  2163  SPSQGNGHERRMFLPMHLPPST--YSAEKLHAHSSDS---NTPLTQFESR----------  2029
             S SQG G ER ++ P ++P  T  +S+E++++HSSD    N    +FE R          
Sbjct  83    SLSQGCGQERSVYSPFYMPAHTPVHSSERVNSHSSDGMNLNATRMEFEQRSIKNMSNRTL  142

Query  2028  ------------------------KKTDEDDFRVPVFVNSNISQSIGKFYKNSEREKVSP  1921
                                     K  DEDDFRVP FV S I         + +   + P
Sbjct  143   NATGPVAECSSLHQQDTKAKNSSEKLDDEDDFRVPTFVRSGIG--------DIDAPAMGP  194

Query  1920  SSPAFLGRS-TKDAKHTRGGNLRHQESSRQLPATREQSVKASLSSRSTDKKEHCIKHTDT  1744
                    +S  K+   T   +L+H       P    + ++ S +SR+ D+     K  +T
Sbjct  195   EKLTHFSKSPQKNTSTTFNSSLQH-------PNANNEPLEQSHTSRNFDRNRGDKKPKET  247

Query  1743  DFPLHSEQRDGPANN-----------SDLSHKSGINLQPESIIDSKVG---DANDDAVVS  1606
                   ++R  P              SD  H + IN+  +S +  + G   ++  + V+ 
Sbjct  248   LEIKELKERSVPHQASGEPSNIAKVPSDRHHTNNINVFDKS-LHGRTGFCQESCGNGVID  306

Query  1605  GP-----IKGVEIGDSSVPI----------NCFQTEGQIINVGNDVESQENQTCRSPQTQ  1471
             GP     I  VE  D+S+            N ++T              EN T    + +
Sbjct  307   GPRSLNDINSVENWDASMARNESAPKPSLGNSYRTSSMADKCNEKGCDNENDTL---EMR  363

Query  1470  KVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRL  1291
               +  D +SE SMV+ ISG++ISP DVVG+IG KHFWKAR AIVNQQRVFAVQVFELHRL
Sbjct  364   DGENNDEASEASMVDSISGLEISPYDVVGVIGPKHFWKARSAIVNQQRVFAVQVFELHRL  423

Query  1290  IKVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPHLRM  1111
             I   KLIA SP+ LLE   YL K   V    + LPP    K+     K K  S+KP+   
Sbjct  424   I---KLIAGSPHLLLEGNPYLNKS-SVEVPSKNLPPQGNRKSQLQAVKLKVGSQKPNQNA  479

Query  1110  ECSAENTVGKASLSSVQNAT------QAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGH  949
             EC  EN  G   L S ++        Q P   P  G  P   ++ ++    WCFH PS +
Sbjct  480   ECLLENPGGAPPLPSHEDRVNRGPHDQVPRNGPYSGPSPPMSMAPENKPSAWCFHPPS-N  538

Query  948   QWLIPVMTPSEGLVYKPYPGP-----GFMSPGCGP-PPVSTPVMGNFFAPPAYGLPTSQY  787
             QWL+PVM+PSEGLVYKPY GP     GFM+P  G   P+S P +   F  PAYG+P S +
Sbjct  539   QWLVPVMSPSEGLVYKPYTGPCPPTGGFMAPVYGSCTPLSLPPVAGDFLNPAYGVPAS-H  597

Query  786   HYQGMGD-PFAPPIGHGYFP-PYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLN  613
               Q MG    AP I   YFP PYG+PV N  +S+SA +Q++     GS+       V ++
Sbjct  598   QPQNMGVLSGAPAIAPNYFPTPYGLPVANPDISSSADKQVSPL--PGSKPN-----VQID  650

Query  612   VQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVL  433
              Q  +S +M   K+ +A      R  A KD+E+Q S ASSP  +          EG   L
Sbjct  651   RQSWSSNDMLHPKS-EAFSGCLLRFQASKDSELQGSTASSPCEKE--------QEGTDAL  701

Query  432   PLFPTSPVVNI-VDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
             PLF  +P  +     SQ    G+ ARVI+VVPHNARSA+E+AARIF+SIQ+ER+Q
Sbjct  702   PLFHMAPATDGPTRPSQFRGRGNQARVIKVVPHNARSATETAARIFKSIQEERQQ  756



>gb|EYU29309.1| hypothetical protein MIMGU_mgv1a022839mg [Erythranthe guttata]
Length=621

 Score =   373 bits (958),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 286/732 (39%), Positives = 375/732 (51%), Gaps = 171/732 (23%)
 Frame = -3

Query  2334  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSPS  2155
             MGPMFPRLHVNDT+KGGP+APPRNKMALYEQLSIPSQRF           +SN +P    
Sbjct  13    MGPMFPRLHVNDTDKGGPKAPPRNKMALYEQLSIPSQRFT--------TPSSNPVPRPQE  64

Query  2154  QGNGHERRMFLPMHLPPSTYSAEKLHAHSSDSNTPLT-QFESRKKTDEDDFRVPVFVNSN  1978
               N     MF    LP + + +EK H+  SDS  P + + E RKK+DEDDFRVP F++  
Sbjct  65    FAN-----MFFSNKLP-TQHQSEKQHSQYSDSTAPPSAKVERRKKSDEDDFRVPTFLHPR  118

Query  1977  ISQSIGKF---------------------------YKNSEREKVSPSSPAFLGRSTKDAK  1879
               Q  G++                             N+  EK+  S P+F  R +K  K
Sbjct  119   PIQECGEYDHNNNNNNNNNNNNNNNNNNNNNNNNNNNNNSTEKIGTSMPSFFNRPSKFRK  178

Query  1878  HTRGGNLRHQESSRQLPATREQSVKASLSSRSTDKKEHCIKHTD-----TDFPLHSEQRD  1714
                   L       ++  ++EQ       SR+ +++   + H +         L  E+ +
Sbjct  179   AKPNDVL-------EISTSQEQG-----KSRNKEERSKEVVHNNRVTKVVSNSLSVEKAE  226

Query  1713  GPANNSDLSHKSGINLQPESIIDSKVGDANDDAVVSGPIKGVEIGDSSVPINCFQTEGQI  1534
                  +DLS + G    P S+ +  +               +E   S+     F ++   
Sbjct  227   ESNKQTDLSLRHGPRDAPASVFEENIA-------------ALEKRSSTNSARAFSSK---  270

Query  1533  INVGNDVESQENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKA  1354
                  D+   E              G +  E S++E IS +D++PDDVVGIIG KHFWKA
Sbjct  271   -----DLRGDERGG-----------GGSVCEDSVLESISRVDVTPDDVVGIIGPKHFWKA  314

Query  1353  RRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEY  1174
             RRAIVNQQRVFAVQVFELHRLIKVQK IA SP+ L E++ Y+ KP K S   ++    +Y
Sbjct  315   RRAIVNQQRVFAVQVFELHRLIKVQKSIAASPHLLHEESPYVSKPKKDSPITKIA--IKY  372

Query  1173  -IKAPQNVPKHK-NDSEKPHLRMECSAENTVGK-ASLSSVQNATQAPSCKPSPGNPPLPV  1003
              IK+  N+PK K  + +KP    E SAEN   + +S +SVQN      C PS       +
Sbjct  373   PIKSIPNIPKQKVVEPKKPTQEKEVSAENIARRESSFASVQN------CAPS------SI  420

Query  1002  VSNDSNMGPWCFHQ-PSGHQWLIPVMTPSEGLVYKPYPGPGFMSP-----GCGPPPVSTP  841
              SN +   PW F+Q P GHQWLIPVM+PSEGLVYKPYPGPGF+ P     GCG P  S P
Sbjct  421   SSNGNARSPWAFNQSPHGHQWLIPVMSPSEGLVYKPYPGPGFVGPAPSSGGCG-PVGSNP  479

Query  840   VMGNFFAPPAYGLPTSQYHYQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFT  661
               G+F +P          H+Q     +  P  H YFPPYGMP+MN               
Sbjct  480   STGDFLSP----------HHQ-----YPLPAHHPYFPPYGMPIMNPP------------P  512

Query  660   RTGSQAQVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVR  481
              +G  A      V++   + N  ++P     D +V+            +Q S  SS  V+
Sbjct  513   FSGPDAD----DVSIQCPNLNDSHVPE----DVEVA------------VQVSDVSSSPVQ  552

Query  480   APGVTVSGPMEGRSVLPLFPTSPVVNIVDAS--QPPDTGHPARVIRVVPHNARSASESAA  307
               GV V      RSVL LFPTSP V+    S  +PP +G   +VI+VVPHNARSA+ESAA
Sbjct  553   DSGVEV------RSVLQLFPTSPAVDDAAWSSQRPPKSGQ-QQVIKVVPHNARSATESAA  605

Query  306   RIFQSIQKERKQ  271
             RIFQSIQ+ERK+
Sbjct  606   RIFQSIQEERKR  617



>ref|XP_002276544.3| PREDICTED: protein EARLY FLOWERING 3 isoform X1 [Vitis vinifera]
Length=740

 Score =   375 bits (963),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 295/768 (38%), Positives = 387/768 (50%), Gaps = 124/768 (16%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQ-RFDHGVLPPNPNNASNLIPPS  2161
             +M P+FPRLHVND EKGGPRAPPRNKMALYEQLS+P        +LP  PNN+ +L+P +
Sbjct  10    VMSPLFPRLHVNDAEKGGPRAPPRNKMALYEQLSVPKVPSRSTVILPLLPNNSGSLVPSA  69

Query  2160  PS-QGNGHERRMFLPM-HLPPSTYSAEKLHAHSS---DSNTPLTQFESRKKT--------  2020
             PS QG+GHER +  P  + P S +S E  H HSS   + +  LT  E +  T        
Sbjct  70    PSTQGSGHERNVVTPFCYTPTSAHSDENHHFHSSSGVNMSFELTNLEQKSGTFYHIPNVT  129

Query  2019  ------------------------DEDDFRVPVFVNSNISQSIGKFY---KNSEREKVS-  1924
                                      EDD  VP F  S I   I  +Y   +N  +E+ + 
Sbjct  130   GQLPLQANCSYSQPHSLSKLKNHRGEDDSEVPTFCQSGI---IPDYYNAPQNMNKERATC  186

Query  1923  PSSPAFLGRSTKDAKHTRGGNLRHQESSRQLPA-----TREQSVKASLSSRSTDKKEH--  1765
                 + +   +   KH R  N+ H   S    A     TR++  + S  +R++  KE+  
Sbjct  187   LDLNSSVQLESACGKHQRNLNVSHSRESISATASSGLLTRDEIFEPSKRARTSLTKENKR  246

Query  1764  -CIKHTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESIIDSKVGDANDDAVVSGPIKGV  1588
               +  T+    +H           D  H+  + L PE          N D  +  P K V
Sbjct  247   NVVVDTNRLEDIH-----------DSLHQGSMTL-PE----------NTD--LPNPSKAV  282

Query  1587  EIGDSSVPINCFQTEGQIINVGNDVESQENQTCRSPQTQKVDRGDNSSETSMVECISGMD  1408
               G  S        +G   + G + E +E +   S Q   +DR  + S  +MV  + G D
Sbjct  283   GGGYVSTSPKPSLLDGHRRSGGLEHELEEQKESESLQMGSIDRNCHVSNANMVGSMLGFD  342

Query  1407  ISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYL  1228
             ISPDDVVGIIG KHFWK R AIVNQQRVFAVQVFELHRLIKVQ+LIA SP   L++  YL
Sbjct  343   ISPDDVVGIIGHKHFWKTRNAIVNQQRVFAVQVFELHRLIKVQRLIAGSPEGQLDNNLYL  402

Query  1227  GKPLKVSSAKRL--------LPPFEYIKAPQNVPKHKNDSEKPHLRMECSAENTVGKASL  1072
              +P   SS K+L        LP     + P  +   KN S+K     E + ++ VG    
Sbjct  403   AEP--ASSTKKLPSESPTKKLPSESVQQLPSQIADPKNGSQKQDSNNEGAVKDAVGNPPF  460

Query  1071  SSVQN-----ATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPVMTPSEGLV  907
             +S  +     A Q  + +P    PP+ + + D+    WCFH   G+QWL+PVM+PSEGL+
Sbjct  461   ASPVDVDKIYAAQQTNQRPLENQPPVSMAT-DTQPTSWCFHPSQGNQWLVPVMSPSEGLI  519

Query  906   YKPYPG-----PGFMSPGCGP-PPVSTPVMGNFFAPPAYGLPTSQYHYQGMGD-PFAPPI  748
             YKPY G     P  MSP  G   PV+  VMG  F    YG+P S    QG+   P  P +
Sbjct  520   YKPYAGQCSPTPRLMSPFYGNYRPVNLTVMGGDFFNTTYGIPISL--QQGIEIVPSNPFL  577

Query  747   GHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQA-----QVSGGGVNLNVQ---HQNSC  592
             G  YFPPYG P++N + S SAVEQMN     G Q+      VS G +N  VQ   +Q+  
Sbjct  578   GQTYFPPYGKPLVNPSTSGSAVEQMN--LSVGDQSSRPNNHVSVGDINATVQSVHYQSLG  635

Query  591   NMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSP  412
             NMPSQK+G   +    +  A K +E+Q S AS+PS RA              LPLFP +P
Sbjct  636   NMPSQKSGGI-LGCFGKFQASKSSELQVSTASTPSKRAQA----------DALPLFPVAP  684

Query  411   VVNIVD-ASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
              +   D   Q        R I+VVPH  +SASESAARIF+SIQ+ER Q
Sbjct  685   KIQESDQLDQIHGNEKQTRAIKVVPHKHKSASESAARIFRSIQEERNQ  732



>emb|CBI35994.3| unnamed protein product [Vitis vinifera]
Length=730

 Score =   374 bits (961),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 295/767 (38%), Positives = 386/767 (50%), Gaps = 124/767 (16%)
 Frame = -3

Query  2334  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQ-RFDHGVLPPNPNNASNLIPPSP  2158
             M P+FPRLHVND EKGGPRAPPRNKMALYEQLS+P        +LP  PNN+ +L+P +P
Sbjct  1     MSPLFPRLHVNDAEKGGPRAPPRNKMALYEQLSVPKVPSRSTVILPLLPNNSGSLVPSAP  60

Query  2157  S-QGNGHERRMFLPM-HLPPSTYSAEKLHAHSS---DSNTPLTQFESRKKT---------  2020
             S QG+GHER +  P  + P S +S E  H HSS   + +  LT  E +  T         
Sbjct  61    STQGSGHERNVVTPFCYTPTSAHSDENHHFHSSSGVNMSFELTNLEQKSGTFYHIPNVTG  120

Query  2019  -----------------------DEDDFRVPVFVNSNISQSIGKFY---KNSEREKVS-P  1921
                                     EDD  VP F  S I   I  +Y   +N  +E+ +  
Sbjct  121   QLPLQANCSYSQPHSLSKLKNHRGEDDSEVPTFCQSGI---IPDYYNAPQNMNKERATCL  177

Query  1920  SSPAFLGRSTKDAKHTRGGNLRHQESSRQLPA-----TREQSVKASLSSRSTDKKEH---  1765
                + +   +   KH R  N+ H   S    A     TR++  + S  +R++  KE+   
Sbjct  178   DLNSSVQLESACGKHQRNLNVSHSRESISATASSGLLTRDEIFEPSKRARTSLTKENKRN  237

Query  1764  CIKHTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESIIDSKVGDANDDAVVSGPIKGVE  1585
              +  T+    +H           D  H+  + L PE          N D  +  P K V 
Sbjct  238   VVVDTNRLEDIH-----------DSLHQGSMTL-PE----------NTD--LPNPSKAVG  273

Query  1584  IGDSSVPINCFQTEGQIINVGNDVESQENQTCRSPQTQKVDRGDNSSETSMVECISGMDI  1405
              G  S        +G   + G + E +E +   S Q   +DR  + S  +MV  + G DI
Sbjct  274   GGYVSTSPKPSLLDGHRRSGGLEHELEEQKESESLQMGSIDRNCHVSNANMVGSMLGFDI  333

Query  1404  SPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLG  1225
             SPDDVVGIIG KHFWK R AIVNQQRVFAVQVFELHRLIKVQ+LIA SP   L++  YL 
Sbjct  334   SPDDVVGIIGHKHFWKTRNAIVNQQRVFAVQVFELHRLIKVQRLIAGSPEGQLDNNLYLA  393

Query  1224  KPLKVSSAKRL--------LPPFEYIKAPQNVPKHKNDSEKPHLRMECSAENTVGKASLS  1069
             +P   SS K+L        LP     + P  +   KN S+K     E + ++ VG    +
Sbjct  394   EP--ASSTKKLPSESPTKKLPSESVQQLPSQIADPKNGSQKQDSNNEGAVKDAVGNPPFA  451

Query  1068  SVQN-----ATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPVMTPSEGLVY  904
             S  +     A Q  + +P    PP+ + + D+    WCFH   G+QWL+PVM+PSEGL+Y
Sbjct  452   SPVDVDKIYAAQQTNQRPLENQPPVSMAT-DTQPTSWCFHPSQGNQWLVPVMSPSEGLIY  510

Query  903   KPYPG-----PGFMSPGCGP-PPVSTPVMGNFFAPPAYGLPTSQYHYQGMGD-PFAPPIG  745
             KPY G     P  MSP  G   PV+  VMG  F    YG+P S    QG+   P  P +G
Sbjct  511   KPYAGQCSPTPRLMSPFYGNYRPVNLTVMGGDFFNTTYGIPISL--QQGIEIVPSNPFLG  568

Query  744   HGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQA-----QVSGGGVNLNVQ---HQNSCN  589
               YFPPYG P++N + S SAVEQMN     G Q+      VS G +N  VQ   +Q+  N
Sbjct  569   QTYFPPYGKPLVNPSTSGSAVEQMN--LSVGDQSSRPNNHVSVGDINATVQSVHYQSLGN  626

Query  588   MPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPV  409
             MPSQK+G   +    +  A K +E+Q S AS+PS RA              LPLFP +P 
Sbjct  627   MPSQKSGGI-LGCFGKFQASKSSELQVSTASTPSKRAQA----------DALPLFPVAPK  675

Query  408   VNIVD-ASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
             +   D   Q        R I+VVPH  +SASESAARIF+SIQ+ER Q
Sbjct  676   IQESDQLDQIHGNEKQTRAIKVVPHKHKSASESAARIFRSIQEERNQ  722



>ref|XP_010924961.1| PREDICTED: protein EARLY FLOWERING 3-like [Elaeis guineensis]
 ref|XP_010924963.1| PREDICTED: protein EARLY FLOWERING 3-like [Elaeis guineensis]
Length=754

 Score =   375 bits (963),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 298/772 (39%), Positives = 394/772 (51%), Gaps = 115/772 (15%)
 Frame = -3

Query  2334  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDH--GVLPPNPNNASNLIP-P  2164
             MGP+FPRLHVND++KGGPRAPPRNKMALYEQLSIPSQRF+     LP  P+NAS L+P  
Sbjct  11    MGPLFPRLHVNDSDKGGPRAPPRNKMALYEQLSIPSQRFNSTASALPFPPHNASTLVPLA  70

Query  2163  SPSQGNGHERRMFLPMHLPPST--YSAEKLHAHSSDS---NTPLTQFESR----------  2029
             S S G GHER ++ P ++P  T  +S+E++++HSSD    N    +FE R          
Sbjct  71    SSSLGCGHERSVYSPFYMPARTPVHSSERVNSHSSDGMNLNATRMEFEQRSIKHTGNRTL  130

Query  2028  -------------------------KKTDEDDFRVPVFVNSNISQSIGKFYKNSEREKVS  1924
                                      K  D DDFRVP FV S I+        + +   V 
Sbjct  131   NSTGPVAECSSLHQHDSKDKNSCEKKLHDTDDFRVPTFVQSGIN--------DIDAPAVG  182

Query  1923  PSSPAFLGRS-TKDAKHTRGGNLRHQESSRQLPATREQSVKASLSSRSTDKKEHCIKHTD  1747
             P       +S  K+A  T   +L+   ++ +     EQS  ++L +R+ D      K  +
Sbjct  183   PEKLTHFSKSPQKNASTTFNSSLQCPNANDK---PLEQSNTSNLKTRTFDGNRGDKKPKE  239

Query  1746  TDFPLHSEQRDGPANN----------SDLSHKSGINLQPESIIDSKVG---DANDDAVVS  1606
             T      ++R  P             SD  H S IN+  ES    + G   ++ ++ V+ 
Sbjct  240   TLVIKELKERSVPHQESGEQSNAKAPSDRDHTSNINVLEES-HHGRTGFCQESCENDVMD  298

Query  1605  GP-----IKGVEIGDSSVPINCFQTE---GQIINVGNDVESQENQTCRSP----QTQKVD  1462
             GP     I  VE  D S+  N    E   G      +  +    + C +     + +  +
Sbjct  299   GPRSLNDINSVENWDVSMARNESMLEPSLGSSCGTPSIADKCNEKGCDNENGTLEMRDGE  358

Query  1461  RGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKV  1282
             + D  SE S ++ ISG++ISP DVVG+IG KHFWKARRAIV QQR FAVQVFELHRLIKV
Sbjct  359   KKDEVSEASKMDFISGLEISPYDVVGVIGPKHFWKARRAIVTQQRAFAVQVFELHRLIKV  418

Query  1281  QKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPHLRMECS  1102
             QKL A SP+ LLE   YL K   V    +  PP    K+  +  K K DS+KP+   EC 
Sbjct  419   QKLFAGSPHLLLEGDPYLNK-CSVKVPSKNPPPEGNRKSQPHSVKLKVDSQKPNQNAECL  477

Query  1101  AENTVGKASLSSVQNAT------QAPSCKPSPGNPPLPV-VSNDSNMGPWCFHQPSGHQW  943
              EN  G   L S +N        Q P  +P  G P  P+ V+ ++  G WCFH P+ +QW
Sbjct  478   LENPGGAPPLPSRENTVNRGPYDQVPRNRPYSG-PSTPMSVAPENKPGAWCFHPPA-NQW  535

Query  942   LIPVMTPSEGLVYKPYPGP-----GFMSPGCGP-PPVSTPVMGNFFAPPAYGLPTSQYHY  781
             L+PVM+PSEGLVYKPY GP     GFM+P  G   P+S P +   F   AYG+P S    
Sbjct  536   LVPVMSPSEGLVYKPYTGPCPPTGGFMAPVYGSRTPLSLPPVAGDFLNAAYGVPASHQPQ  595

Query  780   QGMGDPFAPPIGHGYFP-PYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQH  604
                    AP     YFP PYG+ V N  +S+SA EQ++    +    Q+         +H
Sbjct  596   NIDVVSGAPATAPNYFPTPYGLHVANPIISSSADEQVSPLPGSKPNIQID--------RH  647

Query  603   QNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLF  424
               S         +A      R  A KD+E+Q S ASSP  +A         EG   LPLF
Sbjct  648   SWSSGNMLHPRSEAFSGGLLRFQASKDSELQGSTASSPCEKA--------QEGTDALPLF  699

Query  423   PTSPVVNI-VDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
             P +P  +    +SQ     +   VI+VVPHNARSA+ESAARIF+SIQ+ER+Q
Sbjct  700   PMAPATDGPTRSSQFSGRDNQNLVIKVVPHNARSATESAARIFRSIQEERQQ  751



>ref|XP_004498925.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Cicer arietinum]
 ref|XP_004498926.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Cicer arietinum]
 ref|XP_004498927.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X3 [Cicer arietinum]
Length=662

 Score =   366 bits (940),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 277/712 (39%), Positives = 370/712 (52%), Gaps = 91/712 (13%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDT-EKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPS  2161
             ++GPMFPRLHVNDT EKGGPRAPPRNKMALYE  ++P QRF       N ++ S+ + PS
Sbjct  15    VVGPMFPRLHVNDTTEKGGPRAPPRNKMALYEHFNVPFQRF---NNNSNSSSNSHPLTPS  71

Query  2160  PSQGNGHERRMFLPMHLPPSTYS--AEKLHAHSSDS---NTPLTQFESRKKTDEDDFRVP  1996
              + GN  ER   +P++LP  T +  AE   +H S+    +T   Q   RKK D D     
Sbjct  72    STLGNDPERSYIVPVNLPSQTATQRAESYTSHQSNEANMDTLSAQLGQRKKVDGDGSH--  129

Query  1995  VFVNSNISQSIGKFYKNSEREKVSPSSP-----AFLGRSTKDAKHTRGGNLRHQESSRQL  1831
              + +S I QS  K  K+   +K++P        +  G +  D   T+ G+L        L
Sbjct  130   AYDHSRIGQSNNKTMKSFNGKKLTPVGARNFCCSVAGENDGDKDQTQFGSL--------L  181

Query  1830  PATREQSVKASLSSRSTDKKEHCIKHTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESI  1651
                R+   K+ L   +      C+           +Q      ++D  H  G       +
Sbjct  182   VKMRKDVNKSRLHQGNA-----CV-----------QQXXXXQESNDSEHGDG-------L  218

Query  1650  IDSKVGDANDDAVVSGPIKGVEIGDSSVPINCFQTEGQIINVGNDVESQENQTCRSPQTQ  1471
             IDS +   N +++V        +  +SV           +   ND E  +       Q  
Sbjct  219   IDSAMDIDNRNSLVLRSCSHSTVDQTSV-----------LEATNDTEYHDTNIDSPMQKG  267

Query  1470  KVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRL  1291
               +  D+ S+TS +E +S M++SPD +V I+GQKHFWKARR I  QQRVFAVQVFELHRL
Sbjct  268   NSEGSDDLSKTSTLESLSSMELSPDGIVQILGQKHFWKARRKITTQQRVFAVQVFELHRL  327

Query  1290  IKVQKLIAESPNFLLEDTAYLGK-PLKVSSAKRLLPPFEYIKAP--QNVPKHKNDSEKPH  1120
             IKVQ+LIA S + L ED A LGK PL+ S+ K +    E I  P  QN  K ++ SEK +
Sbjct  328   IKVQQLIAGSSDLLFEDAAILGKFPLQASTPKSI--SLEVIVEPPTQN-HKQQDHSEKLN  384

Query  1119  LRMECSAENTVGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWL  940
              ++E SAEN VGK S SS +  +   +  P  GNP      +  N+    F+   G+QWL
Sbjct  385   HKLEHSAENGVGKTSFSSQKYGSHLSNYTPFYGNP------HQENVVSRSFNHSPGYQWL  438

Query  939   IPVMTPSEGLVYKPYPGPGFMSPGCGPPPVSTPVMGNF-FAPPAYGLPTSQYHYQGMGDP  763
             IPVM+PSEGLVYKPYPGPGF  P  G      P   N  F  PAYG+P   +H      P
Sbjct  439   IPVMSPSEGLVYKPYPGPGFTGPMYGGCGPFGPGPPNGAFMNPAYGIP--DFHQAVAVSP  496

Query  762   FAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRT---GSQAQVSGGGVNLNVQHQNSC  592
             F PP  + +FPP+ +P MN + S S VEQ N F       S    S  G + N  +Q+SC
Sbjct  497   FIPPGSYAHFPPHCVPAMNQSASGSVVEQANRFAAQVSHDSNGNSSLVGASFNTHNQSSC  556

Query  591   NMPSQKNGDADVSDAHRLHACK-----DNEIQASCASSPSVRAPGVTVSGPMEGRSVLPL  427
             N+ +QKNG         LH  K     + E+Q    S P+ +   + +    EGR  L  
Sbjct  557   NLTNQKNGAT-------LHITKFQPSIERELQGIPTSRPNEKE--IRIEKSAEGRDALSP  607

Query  426   FPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
               T+P V+  +  Q  +T    +VIRVVPHN RSAS SAARIFQSIQ+ERKQ
Sbjct  608   SFTAPSVS-EEVFQSLETKQKPQVIRVVPHNPRSASVSAARIFQSIQEERKQ  658



>ref|XP_009400544.1| PREDICTED: protein EARLY FLOWERING 3-like [Musa acuminata subsp. 
malaccensis]
Length=754

 Score =   367 bits (942),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 288/770 (37%), Positives = 403/770 (52%), Gaps = 109/770 (14%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG--VLPPNPNNASNLIPP  2164
             +MGP+FPRLHVND +KGGPRAPPRNKMALYEQLS+PSQRF+     LP  P N+SNL+P 
Sbjct  10    VMGPLFPRLHVNDPDKGGPRAPPRNKMALYEQLSVPSQRFNSASSTLPFPPRNSSNLVPS  69

Query  2163  SP-SQGNGHERRMFLPMHLPP--STYSAEKLHAHSSDS-NTPLTQFESRKKTDEDDFRVP  1996
              P SQG GH + MF P+++ P     SAE +++ +SD  N+  T+ E  +K+ +      
Sbjct  70    LPSSQGCGHRKNMFSPLYMTPPVPVRSAEVINSQTSDRMNSIATRMEFERKSIKQTSSGN  129

Query  1995  VF--------------VNSNISQSIGKFYKNSEREKVSPSSPAF-----LGRSTKDAKHT  1873
             +F               N N+ +S GK   + +   V    P F     L    KDA  T
Sbjct  130   LFGTGSAAAECSTQRPRNPNVKKSRGKMLDDVDDIVV----PTFDQSEVLASLKKDAHMT  185

Query  1872  RGGNLRHQESSRQL---PATREQSVKA------------SLSSRSTDKKEHCIKHTDTDF  1738
               G L    SSRQ    PA  + SV+             S+ ++S +   +       + 
Sbjct  186   DAGKL-STLSSRQTHKSPAAIDFSVQCPNSNEKPLGQTDSIETKSKNSIINRFGKNSKET  244

Query  1737  PLHSEQRDGPANNSDLSHKSGINLQPESIIDSKVGDANDDAVVS--------------GP  1600
              L  E ++   N++  SH++   L   S  D  V D   +  V+              G 
Sbjct  245   SLIEEPKETKENSA--SHRAAERL--SSSKDCLVRDNTGNLHVTEKSVNGNPELYQENGN  300

Query  1599  IKGVEIGDSSVPINCFQTEGQIINVGNDVESQENQ-------TCRSPQTQKVDRG-----  1456
             + G +  +  V +N  + +     + ++   ++ Q        C+   +  ++ G     
Sbjct  301   LNGCQTLNDHVLLNNAEAQRARSELCSEASPEKGQRTLNLSENCQKEGSGSLEYGDAVRQ  360

Query  1455  DNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQK  1276
             D++ E SMV+ +S + ISPDD+VG+IG KHFWKARRAI+NQQRVFA+QVFELHRLIKVQK
Sbjct  361   DDTLEPSMVDTVSWLGISPDDIVGVIGPKHFWKARRAIINQQRVFAIQVFELHRLIKVQK  420

Query  1275  LIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPHLRMECSAE  1096
             L+A SP+ LLE   Y+ +    + +K LLP       P+   + K+D +KP   +E   +
Sbjct  421   LMAASPHLLLEGNPYISRSPVEAPSKTLLPQGNTTSQPEEF-RPKDDHQKPKQNVEQPPD  479

Query  1095  NTVGKASLSSVQNA------TQAPSCKPSPGN-PPLPVVSNDSNMGPWCFHQPSGHQWLI  937
             +  G  +L + ++        Q P   P+ G   P+PV  +D +  PWCF  P  +QWL+
Sbjct  480   DISGIPALPACEDGPKGGSQGQVPKVGPNSGYLSPVPVAPDDKS-SPWCF-PPLANQWLV  537

Query  936   PVMTPSEGLVYKPYPGP-----GFMSPGCGPPPVSTPVMGNFFAPPAYGLPTSQYHYQGM  772
             PVM+PSEGLVYKPY GP     GFM+P     P+    +   F   AYG+P S +    M
Sbjct  538   PVMSPSEGLVYKPYMGPCPPTGGFMTPHGSCTPLGMSHVAGDFINSAYGVPAS-HRPPNM  596

Query  771   GDPFAPP-IGHGYFP-PYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQN  598
             G    PP I   YFP PYG+  +N  +STSAVEQ+N+    GSQ  V  G  +     ++
Sbjct  597   GVMSGPPAIVPHYFPTPYGIQALNPLISTSAVEQVNNL--AGSQPNVQTGQCS-----RS  649

Query  597   SCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPT  418
             SCNM S    +A      +    K++E+Q S ASSP+ +A          GRS  PL  T
Sbjct  650   SCNM-SHHPKEAFSGHRGKFRESKNSELQGSTASSPAEKAQP-------NGRSTSPLLST  701

Query  417   SPVVNIVDA-SQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
             +   N  +  SQ        RVI+VVPHNARSA+ESAARIF+SIQKER+Q
Sbjct  702   ALAANNHNCPSQSSGRDSCTRVIKVVPHNARSATESAARIFRSIQKERQQ  751



>emb|CAN70608.1| hypothetical protein VITISV_040198 [Vitis vinifera]
Length=1138

 Score =   372 bits (954),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 211/374 (56%), Positives = 250/374 (67%), Gaps = 16/374 (4%)
 Frame = -3

Query  1365  FWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGKP-LKVSSAKRLL  1189
             FW   +   +QQRVFAVQVFELHRLIKVQ+LIA SP+ +++++AYLGKP LK S AK+L 
Sbjct  768   FWTVWKERNSQQRVFAVQVFELHRLIKVQRLIAGSPHLMVDESAYLGKPSLKSSPAKKL-  826

Query  1188  PPFEYI-KAPQNVPKHKNDSEKPHLRMECSAENTVGKASLSSVQNATQAPSCKPSPGNPP  1012
              P EY+ K P N+  HK+D E+   ++ECSAEN VGK  L SV+N     +  P  GNPP
Sbjct  827   -PLEYVVKPPPNMVMHKDDYERASHQLECSAENAVGKTHLPSVKNGNPPSNYGPYIGNPP  885

Query  1011  LPVVSNDSNMGPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGPGFMSPGCG--PPPVSTPV  838
                   DS MGPWC+ QP GHQWL+PVM+PSEGLVYKPYPGPGFMS  CG   P    P+
Sbjct  886   PAPAPTDSKMGPWCYPQPPGHQWLVPVMSPSEGLVYKPYPGPGFMSTVCGGCGPMGPAPM  945

Query  837   MGNFFAPPAYGLPTSQYHYQGMG-DPFAPPIGHGYFPPYGMPVMNS-AVSTSAVEQMNSF  664
              G+F   PAYG+P+S +H+QG+G  P  PPIGHGYFPPYGM VMN   +S SAVEQMN F
Sbjct  946   TGSFIN-PAYGVPSS-HHHQGIGVHPGTPPIGHGYFPPYGMSVMNHPTISGSAVEQMNRF  1003

Query  663   TRTGS---QAQVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASS  493
                GS     Q+SGGG + N+QHQNSCN+P+ K     +    +    KD+E Q S ASS
Sbjct  1004  AGHGSLSQSGQLSGGGASFNMQHQNSCNVPTPKRA---IPQGVKFPMSKDSEFQGSTASS  1060

Query  492   PSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASES  313
             PS R   V      EGR  LPLFP +P        QP  T  P RVIRVVPHN RSA+ES
Sbjct  1061  PSEREQQVGTGDTAEGRDPLPLFPMAPAAIPAGDPQPNGTDQPTRVIRVVPHNPRSATES  1120

Query  312   AARIFQSIQKERKQ  271
             AARIFQSIQ ERKQ
Sbjct  1121  AARIFQSIQDERKQ  1134



>emb|CAN65004.1| hypothetical protein VITISV_023490 [Vitis vinifera]
Length=1255

 Score =   373 bits (957),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 294/768 (38%), Positives = 385/768 (50%), Gaps = 124/768 (16%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQ-RFDHGVLPPNPNNASNLIPPS  2161
             +M P+FPRLHVND EKGGPRAPPRNKMALYEQ S+P        +LP  PNN+ +L+P +
Sbjct  531   VMSPLFPRLHVNDAEKGGPRAPPRNKMALYEQFSVPKVPSRSTVILPLLPNNSGSLVPSA  590

Query  2160  PS-QGNGHERRMFLPM-HLPPSTYSAEKLHAHSS---DSNTPLTQFESRKKT--------  2020
             PS QG+GHER +  P  + P S +S E  H HSS   + +  LT  E +  T        
Sbjct  591   PSTQGSGHERNVVTPFCYTPTSAHSDENHHFHSSSGVNMSFELTNLEQKSGTFYHIPNVT  650

Query  2019  ------------------------DEDDFRVPVFVNSNISQSIGKFY---KNSEREKVSP  1921
                                      EDD  VP F  S I   I  +Y   +N  +E+ + 
Sbjct  651   GQLPLQANCSYSQPHSLSKLKNHRGEDDSEVPTFCQSGI---IPDYYNAPQNMNKERATC  707

Query  1920  SSP-AFLGRSTKDAKHTRGGNLRHQESSRQLPA-----TREQSVKASLSSRSTDKKEH--  1765
                 + +   +   KH R  N+ H   S    A     TR++  + S  +R++  KE+  
Sbjct  708   LDLNSSVQLESACGKHQRNLNVSHSRESISATASSGLLTRDEIFEPSKRARTSLTKENKR  767

Query  1764  -CIKHTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESIIDSKVGDANDDAVVSGPIKGV  1588
               +  T+    +H           D  H+  + L PE          N D  +  P K V
Sbjct  768   NVVVDTNRLEDIH-----------DSLHQGSMTL-PE----------NTD--LPNPSKAV  803

Query  1587  EIGDSSVPINCFQTEGQIINVGNDVESQENQTCRSPQTQKVDRGDNSSETSMVECISGMD  1408
               G  S        +G   + G + E +E +   S Q   +DR  + S  +MV  + G D
Sbjct  804   GGGYVSTSPKPSLLDGHRRSGGLEHELEEQKESESLQMGSIDRNCHVSNANMVGSMLGFD  863

Query  1407  ISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYL  1228
             ISPDDVVGIIG KHFWK R AIVNQQRVFAVQVFELHRLIKVQ+LIA SP   L++  YL
Sbjct  864   ISPDDVVGIIGHKHFWKTRNAIVNQQRVFAVQVFELHRLIKVQRLIAGSPEGQLDNNLYL  923

Query  1227  GKPLKVSSAKRL--------LPPFEYIKAPQNVPKHKNDSEKPHLRMECSAENTVGKASL  1072
              +P   SS K+L        LP     + P  +   KN S+K     E + ++ VG    
Sbjct  924   AEP--ASSTKKLPSESPTKKLPSESVQQLPSQIADPKNGSQKQDSNNEGAVKDAVGNPPF  981

Query  1071  SSVQN-----ATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPVMTPSEGLV  907
             +S  +     A Q  + +P    PP  + + D+    WCFH   G+QWL+PVM+PSEGL+
Sbjct  982   ASPVDIDKIYAAQQTNQRPLENQPPASMAT-DTQPTSWCFHPSQGNQWLVPVMSPSEGLI  1040

Query  906   YKPYPG-----PGFMSPGCGP-PPVSTPVMGNFFAPPAYGLPTSQYHYQGMGD-PFAPPI  748
             YKPY G     P  MSP  G   PV+  VMG  F    YG+P S    QG+   P  P +
Sbjct  1041  YKPYAGQCSPTPRLMSPFYGNYRPVNLTVMGGDFFNTTYGIPISL--QQGIEIVPSNPFL  1098

Query  747   GHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQA-----QVSGGGVNLNVQ---HQNSC  592
             G  YFPPYG P++N + S SAVEQMN     G Q+      VS G +N  VQ   +Q+  
Sbjct  1099  GQTYFPPYGKPLVNPSTSGSAVEQMN--LSVGDQSSRPNNHVSVGDINATVQSVHYQSLG  1156

Query  591   NMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSP  412
             NMPSQK+G   +    +  A K +E+Q S AS+PS RA              LPLFP +P
Sbjct  1157  NMPSQKSGGI-LGCFGKFQASKSSELQVSTASTPSKRAQA----------DALPLFPVAP  1205

Query  411   VVNIVD-ASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
              +   D   Q        R I+VVPH  +SASESAARIF+SIQ+ER Q
Sbjct  1206  KIQESDQLDQIHGNEKQTRAIKVVPHKHKSASESAARIFRSIQEERNQ  1253



>ref|XP_009401962.1| PREDICTED: protein EARLY FLOWERING 3-like [Musa acuminata subsp. 
malaccensis]
Length=736

 Score =   358 bits (919),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 290/768 (38%), Positives = 389/768 (51%), Gaps = 122/768 (16%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG--VLPPNPNNASNLIPP  2164
             IMGP+FPRLHVND +KGGPRAPPRNKMALYEQ S+PSQR +     LP    NA  L+P 
Sbjct  10    IMGPLFPRLHVNDADKGGPRAPPRNKMALYEQHSVPSQRLNRSSSALPLPHQNACLLVPS  69

Query  2163  SP-SQGNGHERRMFLPMHLPPST--YSAEKLHAHSSDSNTPLTQFESR------------  2029
             +P SQG G ER +  P  +P +T  YS+EK+    SD   P ++ E R            
Sbjct  70    NPLSQGCGQERNVLSPFFMPRNTPAYSSEKVDCQLSDGIDPNSRLEERSLKHVNSRNLNL  129

Query  2028  ---------------------KKTDEDDFRVPVF------VNSNISQSIGKFYK----NS  1942
                                  K  D DDFRVP F      + SN   S+    K    N+
Sbjct  130   MRSTAHCSLLRHPKSKSSHEKKMDDVDDFRVPTFDKSEPALCSNKDTSVMGSVKLTSFNT  189

Query  1941  EREKVSPSSP--AFLGRSTKDAKHTRGGNLRHQESSRQLPATREQSVKASLSSRSTDKKE  1768
             + ++ SP++   + +  ST   KH    ++ + +SS+   + +E+  + SL      +K 
Sbjct  190   KSQQKSPNATLNSSIRYSTSYFKHFEQTDVSNMQSSKFGGSEKERQPEESLVIAEHREKS  249

Query  1767  HCIKHTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESIIDSKVGDANDDAVVSGP----  1600
                   + + P+ ++  +G  + ++ S   G++   ES         N D +  GP    
Sbjct  250   PPSARVE-ERPIVAKVSNGARDVTEKSRCGGVSSCQESY-------QNGDLI--GPRTMN  299

Query  1599  -IKGVEIGDSSVPINCFQTEGQIINVGN-DVESQENQTCRSPQTQKVDRGDNSSETSMVE  1426
              +  VE GD S      Q    +++ GN +   +EN    S      +R D +SE S+ +
Sbjct  300   KVDVVENGDGSQK---RQRTTNMVDNGNLENNVKENG---SLGEHIAERKDEASEASIDD  353

Query  1425  CISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNFLL  1246
              ISG++ISPDDVVG+IG KHFWKARRA +NQQRVFA+QVFELHRLIKVQK IA SP+ LL
Sbjct  354   SISGLEISPDDVVGVIGPKHFWKARRAFMNQQRVFAIQVFELHRLIKVQKSIAASPHLLL  413

Query  1245  EDTAYLGK-PLKVSSAKRLLPPFEYIKAPQNVPKHKN-DSEKPHLRMECSAEN-------  1093
             E   YL K P+K  S   LL     + + Q+  K K+ + +K   + +   EN       
Sbjct  414   EGNPYLSKSPVKAPSKVPLLDC--NMNSQQDAVKQKDAERQKSDQKKDLQTENIARAPPP  471

Query  1092  TVGK----ASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPVMT  925
             T G+     S   V  +    +  PS   PP      D+N  PWC H P  +QWL+PVM+
Sbjct  472   TCGERIDGGSHRQVLESGPRSAVPPSHSTPP------DNNPSPWCLH-PPANQWLVPVMS  524

Query  924   PSEGLVYKPY-----PGPGFMSP---GCGPPPVSTPVMGNFFAPPAYGLPTSQYHYQGMG  769
             PSEGL+YKPY     P  GF++P   GC   P+  P +   F   AYG+P S        
Sbjct  525   PSEGLIYKPYTGSCAPSSGFLAPVYGGCM--PLGVPSLAGNFMNTAYGVPASHRPPDTGV  582

Query  768   DPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQN-SC  592
                A  +   YFP YG+P MN  VSTSAVEQ+ +   +     +         QH   SC
Sbjct  583   LAGASAVATNYFPAYGIPSMNPIVSTSAVEQVTNLACSRPNGHID--------QHSMISC  634

Query  591   NMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSP  412
             NM S    +A      +  A KD E+QAS ASSP  +A         E   VLPLFP +P
Sbjct  635   NM-SHSRSEAISGCFLKFQASKDTELQASSASSPCEKA-------QTEASDVLPLFPMAP  686

Query  411   VV-NIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
                N+V  S+       A+ I+VVPHNARSA ES ARIFQSIQ+ER Q
Sbjct  687   KKENLVCPSRSSGRDSQAQAIKVVPHNARSAIESVARIFQSIQEERLQ  734



>gb|KHG06245.1| Protein EARLY FLOWERING 3 -like protein [Gossypium arboreum]
Length=701

 Score =   351 bits (900),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 275/745 (37%), Positives = 372/745 (50%), Gaps = 119/745 (16%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG---VLPPNPNNASNLIP  2167
             +M PMFPRLHVND EKGGP+APPRNKMALYEQLSI SQRF+ G   +LP  PNN++ L+P
Sbjct  18    VMNPMFPRLHVNDAEKGGPKAPPRNKMALYEQLSITSQRFNSGSQSMLPFPPNNSNILVP  77

Query  2166  P-SPSQGNGHERRMFLPM-----------------HLPPSTYSAEKLHAHSSDSNT----  2053
               S S G G+ER MF+P+                  +P +  S  K +     S T    
Sbjct  78    SMSSSHGGGNERNMFMPLANSHESSVLADEKFNSCSIPGTKLSTMKGNQDRKSSKTTKCR  137

Query  2052  ------PL-----TQFESRKKTDEDDFRVPVFVNSNISQSIGKFYKNSEREKVSPS----  1918
                   PL      +F  R    +DD  VP  +   + ++ G   ++  RE+ S S    
Sbjct  138   SFDPLQPLHFSKFKKFSYRSVGLDDDLTVPTSILPGMDRNHGCSKQSEGRERFSKSNLSS  197

Query  1917  SPAFLGRSTKDAKHTRGGNLRHQESSRQLPATREQSVKASLSSRSTDKKEHCIKHTDTDF  1738
             S  F   + K  K     N R  E+S+ L   R  S+ ++        ++  +  T  D 
Sbjct  198   SMQFWASNKKQMKE----NGRLCENSQDL-MERSNSIVST--------RDEILAGTSLDL  244

Query  1737  PLHSEQRDGPANNSDLSHKSGINLQPESIIDSKVGDANDDAVVSGPIKGVEIGDSSVPIN  1558
                S +   P +   L     +  Q    I   V ++ND                 VP  
Sbjct  245   ---STKIKNPGS---LKRPHAVMNQENKSITVDVLNSND-----------------VPDA  281

Query  1557  CFQTEGQIINVGNDVES--QENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVG  1384
                   Q + V N+  +   E +T  + + + V+R +N  + S  E IS  DI PDDVV 
Sbjct  282   RLICSRQSLGVDNENRNLVHEEKTHGATEVEGVNRHNNVPDAS--EYISASDICPDDVVE  339

Query  1383  IIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGKP-LKVS  1207
             IIG+KHFWK RRAI NQQRVF+VQVFELHRLIKVQ+LIA SP+ L EDT ++ KP   VS
Sbjct  340   IIGEKHFWKVRRAIANQQRVFSVQVFELHRLIKVQRLIAGSPHMLFEDTFHIDKPSFDVS  399

Query  1206  SAKRLLPPFEYIKAPQNVPKHKNDSEKPHLRMECSAENTVGKASLSSVQNATQA-----P  1042
             + K+L    + +  P  + K K++S KP   +EC+ +N   +   +S  + T+      P
Sbjct  400   AIKKL--SSDDVPQPPLISKVKSNSRKPDTNIECANDNAFAELPCASANDETKGLVIHQP  457

Query  1041  SCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGP-----GFM  877
               +   GN    +++ +S + PWC   P G+QWL+P+M+PSEGLVYKPY  P     G +
Sbjct  458   KYESYSGNAFSTLMTANSGLSPWCV-SPPGNQWLVPIMSPSEGLVYKPYTWPIPPTAGLL  516

Query  876   SP---GCGPPPVSTPVMGNFFAPPAYGLPTSQYHYQGMGDPFAPPIGHGYFPPYGMPVMN  706
             +P    CG   V+  V G  F   A  L  S  H   +     PPI    FP YGMPVMN
Sbjct  517   TPVYGSCG--TVNLGVSGRDFLNTAKNLAASHQHDIEILRT-DPPISQTTFPHYGMPVMN  573

Query  705   SAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACK  526
              +V+ SA+EQM+      S+A       N  +   +SCN  SQ +     S   +L A  
Sbjct  574   PSVTGSALEQMSLVIAVQSKA-------NFTMAQPSSCNTSSQPSQAISYS-TQKLPAPN  625

Query  525   DNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDASQPPDTGHPARVIRV  346
             + EIQ + ASSPS RA              LPLFPT P     +           +VI+V
Sbjct  626   ETEIQGTTASSPSERA----------KVDALPLFPTEPPTTAANCDARTHQQR-TKVIKV  674

Query  345   VPHNARSASESAARIFQSIQKERKQ  271
             +PHN  SA+ESAARIFQSIQ+ERKQ
Sbjct  675   IPHNHVSATESAARIFQSIQEERKQ  699



>gb|KDP40820.1| hypothetical protein JCGZ_24819 [Jatropha curcas]
Length=766

 Score =   351 bits (900),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 299/792 (38%), Positives = 388/792 (49%), Gaps = 142/792 (18%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG---VLPPNPNNASNLIP  2167
             IM P+FPRLHVNDTEKGGP+APPRNKMALYEQLSIPSQRF  G   +LP  PNN + LIP
Sbjct  10    IMSPIFPRLHVNDTEKGGPKAPPRNKMALYEQLSIPSQRFSSGSSSMLPLPPNNGNKLIP  69

Query  2166  P-SPSQGNGHERRMFLPMHLPPSTYSAEKLHAHS---------------------SDSNT  2053
               + SQG   ER  F   + P S+ S E   +HS                      D N 
Sbjct  70    SMALSQGGSFERSTFC--NSPASSLSEESF-SHSFGGVKLSTKMASPEWKSMNSTDDRNL  126

Query  2052  PLTQ----------FESR-----------KKTDEDDFRVPVFVNSNISQSIGKFYKNSER  1936
               TQ          F+S            K  DE DF VP       SQS      +S+ 
Sbjct  127   KTTQPLSFIAESNSFQSHNFANFKNVSCNKFGDEKDFGVPT-----SSQSGAVLLCSSKH  181

Query  1935  EKVSPSSPA--------FLGRSTKDAKHTRGGNLRHQESSRQL-------------PATR  1819
              K   S P         F   S K  K T   N + +ES R+              P  R
Sbjct  182   NKEQDSQPCWNLSFSMQFQNGSEKRRKGTGTVNQKARESMRKQAEENAKISHAFLDPVER  241

Query  1818  EQSVKASLSSRSTDKKEH---CIKHTDTDFPLHSEQRDGPANNSDLSHKSGINLQ----P  1660
               SV +     S D        +K T+      S +R  P +N + S  SG  L+     
Sbjct  242   PASVPSVQDKTSVDASSSPSAKVKRTE------SLKRAHPLSNQENSSSSGNVLKGLHGT  295

Query  1659  ESIIDSKVGDANDDAVVSGPIKGVEIGDSSVPINCFQTEGQ---IINVGN------DVES  1507
              S ++    +  D  +V      VE   S    N  +   +     ++GN      D+E+
Sbjct  296   NSWLNKNFIEMQDRKIVHKDKDLVEFALSMGKENASKMRHESCSWFSLGNYNRSHSDIEN  355

Query  1506  --QENQ-TCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVN  1336
               + NQ    S Q   V R D+ S+TSM++ +S   I+ D+V+ +IG+  FW+ARRAIV 
Sbjct  356   VIKTNQDKYGSLQVGNVQRRDDVSKTSMMDSVSAFGITSDNVIRVIGEGQFWEARRAIVK  415

Query  1335  QQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGKP-LKVSSAKRLLPPFEYIKAPQ  1159
             QQR F +QVFELHRLIKVQ LIA SP+ LLED  YL K  L+VS  K++       + P 
Sbjct  416   QQREFKIQVFELHRLIKVQMLIAGSPDLLLEDNIYLAKASLEVSPVKKVASE-NAREQPP  474

Query  1158  NVPKHKNDSEKPHLRMECSAENTVGKASLSSVQNAT-------QAPSCKPSPGNPPLPVV  1000
              + K K+ S+KP+   E + EN V K  L  V N T       Q+     S G    P+ 
Sbjct  475   LIDKQKDVSQKPYPSAEFADENAVVKLPLPHVNNETSKGLLTQQSNDGSHSEGVLLSPIA  534

Query  999   SNDSNMGPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGP-----GFMSP---GCGPPPVST  844
             +N +   PWCF  P G+QWL+PVM+ SEGLVYKPY GP     GF++P    CG  P++ 
Sbjct  535   AN-TRQSPWCF-PPQGNQWLVPVMSHSEGLVYKPYAGPCPPTAGFIAPVYGKCG--PMNL  590

Query  843   PVMGNFFAPPAYGLPTSQYHYQGMGD-PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNS  667
             P  G  F   A G+       QG+G  P  PP+G  YFPP+ MPVM+ ++S SAVE +  
Sbjct  591   PAGGGDFLNAACGV------QQGIGILPMIPPLGQTYFPPHAMPVMSPSISVSAVELVTP  644

Query  666   FTRTGSQ-AQVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSP  490
             F    S+  Q S G +     HQ+SCNM SQ +    +    +  A K++E+Q S ASSP
Sbjct  645   FIAPPSKDNQSSAGDIKFAFPHQSSCNMLSQMS--RVILCGGKFQASKESEVQESTASSP  702

Query  489   SVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESA  310
               R  G            LP FPT P   + D +   +      VI+VVPHN +SA+ESA
Sbjct  703   FKRPKG----------DALPFFPTEPTTQVSDPNVQLNELR-THVIKVVPHNPKSATESA  751

Query  309   ARIFQSIQKERK  274
             ARIFQSIQ+ERK
Sbjct  752   ARIFQSIQEERK  763



>ref|XP_004498928.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X4 [Cicer arietinum]
Length=626

 Score =   338 bits (866),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 263/704 (37%), Positives = 356/704 (51%), Gaps = 111/704 (16%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDT-EKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPS  2161
             ++GPMFPRLHVNDT EKGGPRAPPRNKMALYE  ++P QRF++     N ++ S+ + PS
Sbjct  15    VVGPMFPRLHVNDTTEKGGPRAPPRNKMALYEHFNVPFQRFNNNS---NSSSNSHPLTPS  71

Query  2160  PSQGNGHERRMFLPMHLPPSTYS--AEKLHAHSSDS---NTPLTQFESRKKTDEDDFRVP  1996
              + GN  ER   +P++LP  T +  AE   +H S+    +T   Q   RKK D D     
Sbjct  72    STLGNDPERSYIVPVNLPSQTATQRAESYTSHQSNEANMDTLSAQLGQRKKVDGDGSH--  129

Query  1995  VFVNSNISQSIGKFYKNSEREKVSPSSP-----AFLGRSTKDAKHTRGGNLRHQESSRQL  1831
              + +S I QS  K  K+   +K++P        +  G +  D   T+ G+L        L
Sbjct  130   AYDHSRIGQSNNKTMKSFNGKKLTPVGARNFCCSVAGENDGDKDQTQFGSL--------L  181

Query  1830  PATREQSVKASLSSRSTDKKEHCIKHTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESI  1651
                R+   K+ L   +      C+           +Q      ++D  H  G       +
Sbjct  182   VKMRKDVNKSRLHQGNA-----CV-----------QQXXXXQESNDSEHGDG-------L  218

Query  1650  IDSKVGDANDDAVVSGPIKGVEIGDSSVPINCFQTEGQIINVGNDVESQENQTCRSPQTQ  1471
             IDS +   N +++V        +  +SV           +   ND E  +       Q  
Sbjct  219   IDSAMDIDNRNSLVLRSCSHSTVDQTSV-----------LEATNDTEYHDTNIDSPMQKG  267

Query  1470  KVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRL  1291
               +  D+ S+TS +E +S M++SPD +V I+GQKHFWKARR I  QQRVFAVQVFELHRL
Sbjct  268   NSEGSDDLSKTSTLESLSSMELSPDGIVQILGQKHFWKARRKITTQQRVFAVQVFELHRL  327

Query  1290  IKVQKLIAESPNFLLEDTAYLGK-PLKVSSAKRLLPPFEYIKAP--QNVPKHKNDSEKPH  1120
             IKVQ+LIA S + L ED A LGK PL+ S+ K +    E I  P  QN  K ++ SEK +
Sbjct  328   IKVQQLIAGSSDLLFEDAAILGKFPLQASTPKSI--SLEVIVEPPTQN-HKQQDHSEKLN  384

Query  1119  LRMECSAENTVGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWL  940
              ++E SAEN VGK S SS +  +   +  P  GNP      +  N+    F+   G+QWL
Sbjct  385   HKLEHSAENGVGKTSFSSQKYGSHLSNYTPFYGNP------HQENVVSRSFNHSPGYQWL  438

Query  939   IPVMTPSEGLVYKPYPGPGFMSPGCGPPPVSTPVMGNF-FAPPAYGLPTSQYHYQGMGDP  763
             IPVM+PSEGLVYKPYPGPGF  P  G      P   N  F  PAYG+P   +H      P
Sbjct  439   IPVMSPSEGLVYKPYPGPGFTGPMYGGCGPFGPGPPNGAFMNPAYGIP--DFHQAVAVSP  496

Query  762   FAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNMP  583
             F PP  + +FPP+ +P MN + S S VEQ N              G  L++         
Sbjct  497   FIPPGSYAHFPPHCVPAMNQSASGSVVEQKN--------------GATLHIT--------  534

Query  582   SQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVN  403
                          +     + E+Q    S P+ +   + +    EGR  L    T+P V+
Sbjct  535   -------------KFQPSIERELQGIPTSRPNEKE--IRIEKSAEGRDALSPSFTAPSVS  579

Query  402   IVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
               +  Q  +T    +VIRVVPHN RSAS SAARIFQSIQ+ERKQ
Sbjct  580   -EEVFQSLETKQKPQVIRVVPHNPRSASVSAARIFQSIQEERKQ  622



>ref|XP_010526070.1| PREDICTED: protein EARLY FLOWERING 3 [Tarenaya hassleriana]
Length=679

 Score =   338 bits (867),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 289/757 (38%), Positives = 369/757 (49%), Gaps = 160/757 (21%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDH-GVLPPNPNNASNLIPPS  2161
             +M P+FPRLHVND +KGGPRAPPRNKMALYEQLSIPSQRF+H G +PP  +N        
Sbjct  10    MMEPLFPRLHVNDADKGGPRAPPRNKMALYEQLSIPSQRFNHQGTVPPGSSN--------  61

Query  2160  PSQGNGHERRMFLPMHLPPST--YSAEKLHAHSS--DSNTPLTQFESRKKT-DEDDFRVP  1996
               Q    ER ++    +  S   + AEK  +  S  ++    T+ + R+   +EDDF VP
Sbjct  62    --QTRSMERNLYFQHQVSTSVPAHPAEKFVSQKSCPETVRSFTRHDQRQMVGEEDDFMVP  119

Query  1995  VFVNSNISQSIGKFYKNSEREKVSPSSPAFLGRSTKDAKHTRGGNLRHQESSRQLPATRE  1816
             VF+             NS RE+    + + + +       T GGN R  E         +
Sbjct  120   VFL-------------NSRREQSHDGTKSRMDKEKPRIVAT-GGN-RSVEIEEVTGKDPK  164

Query  1815  QSVKASLSSRSTDKKEHCIKHTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESI---ID  1645
             Q+   S SSR   +            P     R G +N S       ++L P  +   ID
Sbjct  165   QNGSLSTSSRQEVRD-----------PSKENPRQGASNYS-------LDLSPRELREAID  206

Query  1644  SKVGDANDDAVVSG-PIKGVEIGDSSVPINCFQTEGQIINVGNDVESQENQTCRSPQTQK  1468
              +   +  D V    P +           N    E       N VESQ      S Q + 
Sbjct  207   VRKSASKCDTVSDAHPRQEAR--------NRLNQEAD-----NGVESQLGGG--SLQERD  251

Query  1467  VDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLI  1288
              +  D  SETSMV+ IS  D+SPDDVVGIIGQK FWKARRAI NQQRVFAVQVFELHRLI
Sbjct  252   GEASDGLSETSMVDSISSADVSPDDVVGIIGQKRFWKARRAIANQQRVFAVQVFELHRLI  311

Query  1287  KVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPHL-RM  1111
             KVQKLIA SP+ LL+D  YLG   K S  K+LLP  EYI  P  +P  K+DS+K +   +
Sbjct  312   KVQKLIAASPHLLLDDGTYLG---KSSPIKKLLPGEEYIVKP--LPPVKDDSKKDNQHEI  366

Query  1110  ECSAENTVGKA-SLSSVQN------ATQAPSCKPSPGNPPL-PVVSNDSNM-----GPWC  970
             ECSAEN VG+  S+SS +N        Q P    +P  PP+ P  +  + M     G WC
Sbjct  367   ECSAENAVGRMRSISSGKNNDNSHQQQQQPPLNYTPCVPPVAPAATTKTQMAATSGGQWC  426

Query  969   FHQP--SGHQWLIPVMTPSEGLVYKPYPGPGFMSPGCG-------PPPVSTPVMGNFF-A  820
             F QP    HQWLIPVM+PSEGL+YKPY GPG    GC        P P++   + NF   
Sbjct  427   FPQPPAGNHQWLIPVMSPSEGLIYKPYLGPGLTGSGCEGYYSQFMPAPMA---VSNFMGG  483

Query  819   PPAYGLPTSQYHYQGMGDPFAPPIGHG-------------YFPPYGMPVMNSAVS-----  694
             PP YG+P             APP  +G             Y P Y +P MN   S     
Sbjct  484   PPVYGMP-------------APPPPNGFQSPGPGPGPGPAYLPHYAVPSMNVNFSGQHHH  530

Query  693   --TSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDN  520
                   EQMN      + +        ++ Q Q+SCN PS  N          + A    
Sbjct  531   HHHHHSEQMNQLVHPNTPS------ATMSAQQQSSCNFPSSNNNT-------NVAATTQP  577

Query  519   EIQASCAS-SPSVRAP-----GVTVSGPMEGRSVLPLFPT--------SPVVNIVDASQP  382
             + Q+  A   P  R       G T S P +  + + LFPT        +  +    A++ 
Sbjct  578   QPQSRLAKPRPRKRESNRVLQGSTGSSPGDSGNAVRLFPTGENNRGSLTMTMTTTTATKG  637

Query  381   PDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
                G   RVI+VVPHN ++ASESAARIF+SIQ+ERKQ
Sbjct  638   AAAGIGTRVIKVVPHNPKAASESAARIFRSIQEERKQ  674



>ref|XP_010915307.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Elaeis 
guineensis]
Length=752

 Score =   337 bits (865),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 274/773 (35%), Positives = 394/773 (51%), Gaps = 118/773 (15%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDH---GVLPPNPNNASNLIP  2167
             IM PMFPRLHVNDT+KGGPRAPPRNKMALYEQLSIPS RF+     VLP  P+NAS L+ 
Sbjct  11    IMNPMFPRLHVNDTDKGGPRAPPRNKMALYEQLSIPSHRFNSTAASVLPLPPHNASILVS  70

Query  2166  PSPSQGNGHERRMFLPMH---------------------LPPSTYSAEKL----------  2080
              + SQ  GHER +  P +                     +PP+T    K           
Sbjct  71    TASSQECGHERSVSSPYYTPSDAPVHNFRKVHSHSSNGKIPPATIRKFKRPARHGNQRSS  130

Query  2079  HAHSSDSNTPLTQ----FESRKKTDEDD-FRVPV-----FVNSNISQSIGKFYKNSEREK  1930
             HA SS ++  L      ++ +  ++EDD FRVP      F   +    + K  + S    
Sbjct  131   HAASSIADCNLLHPHDVYDRKNSSEEDDDFRVPTFIHSEFAKCSSKNMLVKEMQKSSASG  190

Query  1929  VSPSSPAFLGRSTKDAKHTRGGNLRHQESSRQLPATREQSVKASLSSRSTDKKEHCIKHT  1750
             V   + ++    +  A+ +   +   ++ S  +  +R+        S    ++   IK  
Sbjct  191   VKEPAESYSCTVSSSAQLSNFYDKPLEQKSACVANSRKHETN---HSEKEHRETRGIKEQ  247

Query  1749  DTDFPLHSEQRDGPANNSDLSHKSGIN---LQPESIIDSKVG-------DANDDAVVSGP  1600
               +F  H E  +  +  S  S K+ ++   ++  + ID           +++D+  + G 
Sbjct  248   TEEFAFHPENGEKISEPSVFS-KAFLDHECIRIRNAIDKTCSGNTERSQESSDNGCL-GE  305

Query  1599  IKGVEI------GDSSVPINCFQTEGQIINVGNDVESQENQTCR-------SPQTQKVDR  1459
             ++ +E       GD+ +   C  ++    N   D    +N   +       S +    DR
Sbjct  306   LRCLESRDVMENGDARLRSGCC-SKSSPRNSHRDANMADNCYLKLGDKAGVSLELGDGDR  364

Query  1458  GDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQ  1279
                 S+TSM + I+G++IS D+VVG+IG K FW  R AI+NQQR+FA+Q+FELHRLIKVQ
Sbjct  365   NGEMSDTSM-DSIAGLNISLDEVVGVIGPKQFWTVRTAIINQQRIFALQLFELHRLIKVQ  423

Query  1278  KLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPHLRMECSA  1099
             KL+A SP+ LL D       +     K L  P E     Q + + K++ ++ +  ++C  
Sbjct  424   KLLAASPHLLLGDNHGSNNSMLELPTKNL--PAESNVELQPLTEQKDNVQEQNQNIKCPT  481

Query  1098  ENTVGKASLS----SVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPV  931
             E      S S      +   Q PS +P  G PP   V+ D++ GPWCF QP  +QWL+PV
Sbjct  482   EKRGVHPSPSPDGGLSKELDQLPSSEPCSGKPPAVPVAPDNSPGPWCF-QPPANQWLVPV  540

Query  930   MTPSEGLVYKPY-----PGPGFMSP---GCGPPPVSTPVMGNFFAPPAYGLPTSQYHYQG  775
             M+P+EGL+YKPY     P  GFM+P   GCGP  +    +G  F   AYG+P + +    
Sbjct  541   MSPTEGLIYKPYSGFCPPSAGFMAPIYGGCGPMQLQ---VGGDFMNQAYGVPAT-HQQLN  596

Query  774   MGDPF-APPIGHGYFP-PYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQH-  604
             MG PF +P +   YFP PYG+PV+N  + TS VEQ++  TR   Q +          QH 
Sbjct  597   MGTPFRSPGVALNYFPAPYGLPVVNPVIPTSVVEQVSPLTRPMEQTE----------QHS  646

Query  603   QNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVL--P  430
             Q+SCNM + KN +A    + +L+A KD E+Q S ASSP  R  G       EGR  L  P
Sbjct  647   QSSCNMLNLKN-EAFGGCSWKLNASKDCELQGSTASSPCERVQG-------EGRDALDHP  698

Query  429   LFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
             + P +     +  S   D  +   VI+VVPHNA SA+ESAARIF+SIQ+ER+Q
Sbjct  699   VAPLTKRSRQLLRSNESD--YQTHVIKVVPHNASSATESAARIFRSIQEERRQ  749



>gb|KFK29903.1| early flowering 3 [Arabis alpina]
Length=625

 Score =   330 bits (846),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 270/720 (38%), Positives = 357/720 (50%), Gaps = 141/720 (20%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTE-KGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPP-  2164
             I+ PMFPRLHVND++ +GGPRAPPRNKMALYEQLSIPSQRF          N   L+PP 
Sbjct  11    ILEPMFPRLHVNDSDNRGGPRAPPRNKMALYEQLSIPSQRF----------NNHTLVPPE  60

Query  2163  -SPSQGNGHERRMFLPMHLPPS--TYSAEKLHAHSSDSNTPLTQFESRKKT--DEDDFRV  1999
              S +Q    E  +++   +  +   +SAE      S     +    S++K   +EDDF V
Sbjct  61    HSSTQACAGETFLYVQQQVSSAAIVHSAENFVTQGSY----IENVRSQRKMVGEEDDFAV  116

Query  1998  PVFVNSNISQSIGKFYKNSEREKVSPSSPAFLGRSTKDAKHTRGGNLRHQESSRQLPATR  1819
             PV  NS   QS G     +  EKV P+S   +  S++ +   +  N    E S+Q    R
Sbjct  117   PVLGNSRKVQSYGT--NKNVTEKVKPTS--LVALSSRRSSEIQEVN---PEVSKQNDVVR  169

Query  1818  EQ---SVKASLSSRSTDKKEHCIKHTDTDFPLHSEQR-DGPANNSDLSHKSGINLQPESI  1651
             EQ   ++K       + ++E  +  +D     + + R D  +     +   G      + 
Sbjct  170   EQVKENMKQGAFLYKSAREEMNVDKSD----YYGDNRCDASSRQESRNRFDGDGETCGNG  225

Query  1650  IDSKVGDANDDAVVSGPIKGVEIGDSSVPINCFQTEGQIINVGNDVESQENQTCRSPQTQ  1471
             ++S++   ++    +G    V+ GD                 G   E Q N+        
Sbjct  226   VESQLAKESNSGGGNGSPDEVDNGDE---------------YGRSGEQQRNE--------  262

Query  1470  KVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRL  1291
               +  D+ SE SMV+ I   ++SPDD+VG+IGQK FW+AR+AI NQQR+FAVQ+FELHRL
Sbjct  263   --EASDDGSENSMVDSILSENVSPDDIVGVIGQKRFWRARKAINNQQRLFAVQLFELHRL  320

Query  1290  IKVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQ-NVPKHKNDSEKP--H  1120
             IKVQ+LIA SP+ LL+D  YLG+    SS  + L P EYI  PQ  V KH++DSEK   H
Sbjct  321   IKVQRLIAASPDLLLDDVTYLGRGSAKSSPLKKLLPSEYIVKPQPRVAKHRDDSEKTSNH  380

Query  1119  LRMECSAENTVGKASLSSVQNATQAPSCKPSPGNPPL-PVVSNDSNMGP---------WC  970
              +MECSAEN  G+  +              SP NPP  P  SN S   P         WC
Sbjct  381   HKMECSAENAFGRTHV--------------SPVNPPASPAASNGSYKTPTGVNGGGGGWC  426

Query  969   F----HQPSGHQWLIPVMTPSEGLVYKPYPGPGFMSPGCGPPPVSTPVMGNFFAP--PAY  808
             F      P  +QWLIPVM+PSEGL+YKPYPGPG   P CG         G++  P  P Y
Sbjct  427   FPPPQPIPGNNQWLIPVMSPSEGLIYKPYPGPGHTGPACG------GYYGHYNIPTGPTY  480

Query  807   GLPTSQYHYQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQ-MNSFTRTGSQAQVSG  631
             GLP   +H  G+G P        YFPPYGMP  N +      EQ +N F+  G+   +  
Sbjct  481   GLPNPAFH-PGVGFP-------SYFPPYGMP--NPSWQQPPTEQTVNQFSHPGN---LHN  527

Query  630   GGVNL-NVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGP  454
               +N    Q Q+SCN P   N  A+ +            I+    S P +R         
Sbjct  528   PAMNTQQQQQQSSCNFPPNSN-TANRAATTPQPHPHPPPIR----SQPRIRESS------  576

Query  453   MEGRSVLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERK  274
               G     L  T+ V                RVIRVVPHNAR ASE+AARIFQSIQ+ERK
Sbjct  577   -NGSEPQRLAKTTTVA--------------TRVIRVVPHNARLASENAARIFQSIQEERK  621



>ref|XP_010915306.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Elaeis 
guineensis]
Length=779

 Score =   334 bits (857),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 282/806 (35%), Positives = 403/806 (50%), Gaps = 157/806 (19%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDH---GVLPPNPNNASNLIP  2167
             IM PMFPRLHVNDT+KGGPRAPPRNKMALYEQLSIPS RF+     VLP  P+NAS L+ 
Sbjct  11    IMNPMFPRLHVNDTDKGGPRAPPRNKMALYEQLSIPSHRFNSTAASVLPLPPHNASILVS  70

Query  2166  PSPSQG---------------------------NGHERRMFLPMHLPPS--TYSAEKLHA  2074
              + SQ                             GHER +  P + P     ++  K+H+
Sbjct  71    TASSQNLSFSIAFLIQFDMKSKILKRNWCANKECGHERSVSSPYYTPSDAPVHNFRKVHS  130

Query  2073  HSSDSNTP---LTQFE-----------------------------SRKKTDE--DDFRVP  1996
             HSS+   P   + +F+                              RK + E  DDFRVP
Sbjct  131   HSSNGKIPPATIRKFKRPARHGNQRSSHAASSIADCNLLHPHDVYDRKNSSEEDDDFRVP  190

Query  1995  VFVNSNISQSIGKFYKNSEREKVSPSSPAFLGRSTKDAKHTRGGNLRHQESSRQL-----  1831
              F++S  ++   K     E +K S S         K+   +    +    SS QL     
Sbjct  191   TFIHSEFAKCSSKNMLVKEMQKSSAS-------GVKEPAESYSCTV---SSSAQLSNFYD  240

Query  1830  -PATREQSVKASLSSRSTD--KKEH----CIKHTDTDFPLHSEQRDGPANNSDLSHKSGI  1672
              P  ++ +  A+     T+  +KEH     IK    +F  H E  +  +  S  S K+ +
Sbjct  241   KPLEQKSACVANSRKHETNHSEKEHRETRGIKEQTEEFAFHPENGEKISEPSVFS-KAFL  299

Query  1671  N---LQPESIIDSKVG-------DANDDAVVSGPIKGVEI------GDSSVPINCFQTEG  1540
             +   ++  + ID           +++D+  + G ++ +E       GD+ +   C  ++ 
Sbjct  300   DHECIRIRNAIDKTCSGNTERSQESSDNGCL-GELRCLESRDVMENGDARLRSGCC-SKS  357

Query  1539  QIINVGNDVESQENQTC----RSPQTQKVDRGDNSSETS--MVECISGMDISPDDVVGII  1378
                N   D    +N       ++  + ++  GD + E S   ++ I+G++IS D+VVG+I
Sbjct  358   SPRNSHRDANMADNCYLKLGDKAGVSLELGDGDRNGEMSDTSMDSIAGLNISLDEVVGVI  417

Query  1377  GQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGKPLKVSSAK  1198
             G K FW  R AI+NQQR+FA+Q+FELHRLIKVQKL+A SP+ LL D       +     K
Sbjct  418   GPKQFWTVRTAIINQQRIFALQLFELHRLIKVQKLLAASPHLLLGDNHGSNNSMLELPTK  477

Query  1197  RLLPPFEYIKAPQNVPKHKNDSEKPHLRMECSAENTVGKASLS----SVQNATQAPSCKP  1030
              L  P E     Q + + K++ ++ +  ++C  E      S S      +   Q PS +P
Sbjct  478   NL--PAESNVELQPLTEQKDNVQEQNQNIKCPTEKRGVHPSPSPDGGLSKELDQLPSSEP  535

Query  1029  SPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPVMTPSEGLVYKPY-----PGPGFMSP--  871
               G PP   V+ D++ GPWCF QP  +QWL+PVM+P+EGL+YKPY     P  GFM+P  
Sbjct  536   CSGKPPAVPVAPDNSPGPWCF-QPPANQWLVPVMSPTEGLIYKPYSGFCPPSAGFMAPIY  594

Query  870   -GCGPPPVSTPVMGNFFAPPAYGLPTSQYHYQGMGDPF-APPIGHGYFP-PYGMPVMNSA  700
              GCGP  +    +G  F   AYG+P + +    MG PF +P +   YFP PYG+PV+N  
Sbjct  595   GGCGPMQLQ---VGGDFMNQAYGVPAT-HQQLNMGTPFRSPGVALNYFPAPYGLPVVNPV  650

Query  699   VSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQH-QNSCNMPSQKNGDADVSDAHRLHACKD  523
             + TS VEQ++  TR   Q +          QH Q+SCNM + KN +A    + +L+A KD
Sbjct  651   IPTSVVEQVSPLTRPMEQTE----------QHSQSSCNMLNLKN-EAFGGCSWKLNASKD  699

Query  522   NEIQASCASSPSVRAPGVTVSGPMEGRSVL--PLFPTSPVVNIVDASQPPDTGHPARVIR  349
              E+Q S ASSP  R  G       EGR  L  P+ P +     +  S   D  +   VI+
Sbjct  700   CELQGSTASSPCERVQG-------EGRDALDHPVAPLTKRSRQLLRSNESD--YQTHVIK  750

Query  348   VVPHNARSASESAARIFQSIQKERKQ  271
             VVPHNA SA+ESAARIF+SIQ+ER+Q
Sbjct  751   VVPHNASSATESAARIFRSIQEERRQ  776



>ref|XP_010267079.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Nelumbo 
nucifera]
Length=682

 Score =   330 bits (847),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 254/673 (38%), Positives = 347/673 (52%), Gaps = 81/673 (12%)
 Frame = -3

Query  2103  STYSAEKLHAHSSDSNTPLTQFESRKKTDEDDFRVPVFVNSNISQSIGKFYKNSEREKVS  1924
             ST      H+H+       +    R   DEDD RVPVFV+S +S    K   N+ RE+ S
Sbjct  25    STSDRSSCHSHA------FSNLRKRIPGDEDDLRVPVFVHSQVSPCSDKDIPNTSRERFS  78

Query  1923  PSSPAFLGRST--------------------------KDAKHTRGGNLRHQESSR-QLPA  1825
             P       RST                          K  K TR  +++ ++  R Q   
Sbjct  79    PFISTNSDRSTVAEDNSPLKTAAATCNSSMQPQNACDKSQKPTRTTDMKSKQHVRNQFKE  138

Query  1824  TREQSVKA--------SLSSRSTDKKEHCIKHTDTDFPLHSEQRDGPANNSDLSHKSGIN  1669
               +++V          S+SS   ++    +KH  T    + E ++G   +  L       
Sbjct  139   NLKETVTGKNHAENSTSISSMG-ERIAEPLKHDKTSG--NQELQNGQVGSRRLCDADAER  195

Query  1668  LQPE--SIIDSKVGDANDDAVVSGPIKGVEIG-------DSSVPINCFQTEGQIINVGND  1516
              Q    ++     GDA+   V    ++   I          + P+N  +   +  N G+ 
Sbjct  196   HQENGSAMFPKICGDADVHLVEPNEVEKENISRERNESCSEASPVNSHRNPERAENGGH-  254

Query  1515  VESQENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVN  1336
                 E     S Q   VD  D++SE+SMV+ + G DISPDD VG+IG+K FWKARRAIVN
Sbjct  255   --YHEEMVHESLQVGDVDGNDDASESSMVDSVLGADISPDDAVGVIGKKRFWKARRAIVN  312

Query  1335  QQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGK-PLKVSSAKRLLPPFEYIKAPQ  1159
             QQ++FAVQVFELHRLI+VQ+LIA SP+ LL+    LGK PLK S  K+L   +  IK+P 
Sbjct  313   QQKLFAVQVFELHRLIEVQRLIAGSPHLLLDGNPCLGKPPLKESPVKKLTSKY-VIKSPP  371

Query  1158  NVPKHKNDSEKPHLRMECSAENTVGKAS-LSSVQN---ATQAPSCKPSPGNPPLPVVSND  991
              V K K DS+ P+   E +AENT+ K + LS+  N    +Q     P  GNPPL  ++ D
Sbjct  372   CV-KKKVDSQNPNQNAEGAAENTLRKPTPLSNGVNKGLVSQQSCHGPHSGNPPLAPMATD  430

Query  990   SNMGPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGP-----GFMSP---GCGPPPVSTPVM  835
             +  GPW F+ P G++WL+P+M+PSEGLV+KP  GP     GFM+P    CGPP +S P+ 
Sbjct  431   NKSGPWYFYPPPGNRWLVPIMSPSEGLVHKPVVGPCPLTAGFMAPVYGDCGPPSLS-PMA  489

Query  834   GNFFAPPAYGLPTSQYHYQGMGD-PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTR  658
             G+F +  AYG+P S  H QG+G  P A P+G  YFP YG+PV+N  +  S+V+Q N    
Sbjct  490   GDFMS-TAYGIPAS--HQQGIGIFPGALPVGQTYFPSYGVPVLNPGIFASSVDQTNPLVG  546

Query  657   T---GSQAQVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPS  487
                 G     S G    N+ H +S N  +  +         +    KD+E Q S ASSP 
Sbjct  547   VWPHGHAESFSSGDAYFNLHHHSSYNNSNHNSESISCC-TWKFQMSKDSEPQGSTASSPC  605

Query  486   VRAPGVTVSGPMEGRSVLPLFPTSPVVNIVD-ASQPPDTGHPARVIRVVPHNARSASESA  310
              R      +   EGR  LPLFP +P V + +   Q   +    RVIRVVPHN RSA+ESA
Sbjct  606   ERTRSTGANNIAEGRDPLPLFPMAPAVQVQNPVLQSRSSDQQTRVIRVVPHNRRSATESA  665

Query  309   ARIFQSIQKERKQ  271
             ARIFQSIQKER++
Sbjct  666   ARIFQSIQKERQK  678



>ref|XP_008244743.1| PREDICTED: protein EARLY FLOWERING 3 isoform X2 [Prunus mume]
Length=748

 Score =   331 bits (848),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 273/780 (35%), Positives = 381/780 (49%), Gaps = 133/780 (17%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGV--LPPNPNNASNLIPP  2164
             ++ P+FPR HVNDT+KGGPR PPRNKMALYEQ SIPSQ F  G   + P P+N   L+PP
Sbjct  10    LISPVFPRFHVNDTDKGGPRPPPRNKMALYEQFSIPSQSFTSGSASMLPLPHNDRRLVPP  69

Query  2163  -SPSQGNGHERRMFLP----------------------------------MHLPPSTY--  2095
              S S  + +ER +  P                                  +   PS Y  
Sbjct  70    TSWSDVSSNERNILTPPCNFLVVPSDPAEKIQSYDPTGANLNTMMADCERISTKPSNYLN  129

Query  2094  ------SAEKLHAHSSDSNTPLTQFESRKKTDEDDFRVPV--------FVNSNISQSIGK  1957
                   SA K  +      +    F   K  +ED  +VP           NS  S+   K
Sbjct  130   TTGPSSSAAKYDSFQPKKTSHFRNFSLEKYGNEDYLKVPSPFQGTALQCRNSQQSKEKEK  189

Query  1956  FYKNSEREKVSPSSPAFL-GRSTKDAKHTRGGNLRHQESSRQLPATREQSVKASLS----  1792
                 S  E++  S    + G +T D K  + G   H+E + ++  T E  V+ S+S    
Sbjct  190   LPCLSSMEQLKSSCIKKINGSNTIDLKLRQCGR-NHEEENPKVSQTNEDPVERSVSLALA  248

Query  1791  -----SRSTDKKEHCIKHTDTDFPLH-SEQRDGPANNSDLSH--KSGINLQPESIIDSKV  1636
                  + ++    + +K++++    H S  ++  ++ +DLS    S   L  ES+     
Sbjct  249   IVKDFANTSSSPSNTVKNSESLKRAHASLSQENRSSVNDLSKLCSSSARLHRESMTVHDR  308

Query  1635  GDANDDAVVSGPIKGVEIGDSSVPINCFQTEGQIIN------VGNDVESQENQTCRSPQT  1474
                 D  +V   I   +   S V      T   + +      +GN+ E  E + C   Q 
Sbjct  309   VALRDGILVQSRIGTAKEISSKVREKSCLTPSLVDDNRISGGLGNENECCE-EKCGVAQV  367

Query  1473  QKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHR  1294
               +   ++ S+ S+++C S M ISP DV+G+IG K F + R+AIV+QQRVFAVQVFELHR
Sbjct  368   GNLCGHEDISDMSIMDCNSAMGISPHDVMGVIGAKQFCEMRKAIVSQQRVFAVQVFELHR  427

Query  1293  LIKVQKLIAESPNFLLEDTAYLGKP-LKVSSAKRLLPPFEY-IKAPQNVPKHKNDSEKPH  1120
             LIKVQ+LIA SP+ LLED  +L KP +KV   K++  P E+ ++ P  + K K+  +KPH
Sbjct  428   LIKVQRLIAGSPHLLLEDNDFLSKPAIKVPPVKKV--PLEHALELPPLIVKPKDHPQKPH  485

Query  1119  LRMECSAENTVGKASLSSVQN-------ATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQ  961
                EC  EN VGK  L  V N        TQ P  KP+                 WC   
Sbjct  486   SSGECVEENAVGKFPLPPVNNRTSSRGLVTQQPYSKPA----------------LWCLQP  529

Query  960   PSGHQWLIPVMTPSEGLVYKPY-----PGPGFMSP---GCGPPPVSTPVMGNFFAPPAYG  805
             P G+ W +PV + SE L Y+PY     P  GFM+P    CGP  ++        A   Y 
Sbjct  530   PPGNMWFVPVTSSSEELAYQPYTGRCAPTGGFMAPMYGSCGPASLNPGARDYLNA--TYS  587

Query  804   LPTSQYHYQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGS---QAQVS  634
              P+   + QGMG    PP+    FPPYGMP++N ++S+SAVE M  F+   S   + Q+S
Sbjct  588   NPS--LYQQGMGI-GTPPLLQTCFPPYGMPIINPSLSSSAVENMTPFSGGHSNWHENQLS  644

Query  633   GGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGP  454
              G +N  + HQ+SCNM  Q +        + + A K +EIQ + ASSPS R  G      
Sbjct  645   FGEINFTLPHQSSCNMSGQMSQVMPCYVGN-IQASKGSEIQGTTASSPSDRTLG------  697

Query  453   MEGRSVLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERK  274
                 + LPLFPT+P      + +P  + H  R I+VVPHN +SASESAARIF SIQ+ERK
Sbjct  698   ----NALPLFPTAP-----QSQEPCKSEHQTRAIKVVPHNTKSASESAARIFLSIQEERK  748



>gb|KEH39956.1| EARLY flowering protein, putative [Medicago truncatula]
Length=654

 Score =   324 bits (831),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 270/710 (38%), Positives = 359/710 (51%), Gaps = 93/710 (13%)
 Frame = -3

Query  2334  MGPMFPRLHVNDT-EKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIP--P  2164
             +GPMFPRLHVNDT EKGGPRAPPRNKMALYEQ S+P QR    + P + +++SN IP   
Sbjct  12    VGPMFPRLHVNDTTEKGGPRAPPRNKMALYEQFSVPFQR----LNPNSHSSSSNSIPLTS  67

Query  2163  SPSQGNGHERRMFLPMHLP--PSTYSAEKLHAHSSDS---NTPLTQFESRKKTDEDDFRV  1999
             S + GN  ER    P+ LP     + A+   +H S+    +T  TQ E  KK D DD R 
Sbjct  68    SSTMGNDLERSNIFPVRLPSQADAHRAKSYISHQSNGANLDTLSTQLEQGKKVDGDDSRA  127

Query  1998  PVFVNSNISQSIGKFYKNSEREKVSPSSPAFLGRSTKDAKHTRGGNLRHQESSRQLPATR  1819
               + +S I QS  K   +   EK++   P                       SRQ     
Sbjct  128   --YDHSRIGQSNHKMTNSFNGEKITLVIP-----------------------SRQNTVI-  161

Query  1818  EQSVKASLSSRSTDKKEHCIKHTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESIIDSK  1639
               SVK++L+    D +    K      P   +Q    +N         IN  P+    ++
Sbjct  162   --SVKSALTGEIIDSRVRQGK----KIPDEEDQECSVSN---------INRFPQGDSCTR  206

Query  1638  VGDANDDAVVSGPIKGVEIGDSSVPINCFQTEGQIINVGNDVESQENQTCRSPQTQKVDR  1459
               ++ND     G +      D+    +       ++   ND E  +       Q    + 
Sbjct  207   -QESNDIEHSDGLLDTAMDMDNRNSFHSTVDRTMVLEAANDTEYHDANIDSPIQKGNSEG  265

Query  1458  GDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQ  1279
               + S  S +E +S + +SPD VV I+GQ+ FWKARR I NQQR FAVQVFELHRLIKVQ
Sbjct  266   SGDLSNISTIENLSSLKLSPDGVVQILGQQLFWKARRKITNQQRAFAVQVFELHRLIKVQ  325

Query  1278  KLIAESPNFLLEDTAYLGK-PLKVSSAKRLLPPFEYIKAPQNVP-KHKNDSEKPHLRMEC  1105
              LIA S N +L+  A L K PL+ S  K L    E +   Q    K ++ SE  + R++C
Sbjct  326   HLIAGSSNLMLDAAAILEKFPLQESIPKSL--SLEVVVESQTKNHKQQDHSESLNHRLDC  383

Query  1104  SAENTVGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPVMT  925
             SAE  V K S S  +  +   +  P  GN      S+ +N+G   F+Q  GHQWLIPVM+
Sbjct  384   SAEKGVEKTSCSYQKYGSHLSNYTPFSGN------SDQANVGSQYFNQSPGHQWLIPVMS  437

Query  924   PSEGLVYKPYPGPGFMSP--------GCGPPPVSTPVMGNFFAPPAYGLPTSQYHYQGMG  769
             PSEGLVYKPYPGPG+           G GPP V+       F  PAYG+P   +H     
Sbjct  438   PSEGLVYKPYPGPGYTGAVYGGYRPFGQGPPDVT-------FMNPAYGVP--DFHQAIAV  488

Query  768   DPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGV---NLNVQHQN  598
              PF PP G+ YFPP+G+P M  + S SAVEQ+N F+  GS+ Q     +   N    +Q+
Sbjct  489   PPFIPPGGYPYFPPHGVPAMYQSASVSAVEQVNQFSAHGSRNQNGTSSLEEANFYTHNQS  548

Query  597   SCNMPSQKNGDADVSDAHRLHACKDN-EIQASCASSPSVRAPGVTVSGPMEGRSVLPLFP  421
             SCN+ +QKNG         LH  K     +    SSP  +A  +      E R  L    
Sbjct  549   SCNLTNQKNGAT-------LHVRKPQPSRERELESSPGEKAQEIIKEKSAEERDTLSSSF  601

Query  420   TSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
             T P+V+  +  +  +T    +VIRVVPHN RSA+ SAARIFQSIQ+ERK+
Sbjct  602   TVPIVS-KEVLKSLETRQKPQVIRVVPHNPRSATVSAARIFQSIQEERKR  650



>ref|XP_007216534.1| hypothetical protein PRUPE_ppa026719mg [Prunus persica]
 gb|EMJ17733.1| hypothetical protein PRUPE_ppa026719mg [Prunus persica]
Length=756

 Score =   326 bits (836),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 267/775 (34%), Positives = 375/775 (48%), Gaps = 115/775 (15%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGV--LPPNPNNASNLIPP  2164
             ++ P+FPR HV+DT+KGGPRAPPRNKMALYEQ SIPSQ F  G   + P P+N   LIPP
Sbjct  10    LISPVFPRFHVDDTDKGGPRAPPRNKMALYEQFSIPSQSFTSGSASMLPRPHNDRRLIPP  69

Query  2163  -SPSQGNGHERR------MFLP--------------------------MHLPPSTY----  2095
              S S  + +ER       + +P                          +   PS Y    
Sbjct  70    TSWSDVSSNERNTPPCNFLVVPSDPAEKIQSYNSTGANLNTMMADCERISTKPSNYLNTT  129

Query  2094  ----SAEKLHAHSSDSNTPLTQFESRKKTDEDDFRVPVFVNSNISQSIGKFYKNSEREKV  1927
                 SA K  +      +    F   K   ED  +VP        Q      ++ EREK+
Sbjct  130   GPSSSAAKYDSFQPKKTSNFRNFSLEKYGHEDYLKVPSPFQGTALQCRNS-QQSKEREKL  188

Query  1926  SPSSPAFLGRSTKDAKHTRGGNLR-------HQESSRQLPATREQSVKASLS--------  1792
                S     RS+   K +   +L+       H+E + ++  T E  V+ S+S        
Sbjct  189   PCLSSMEQLRSSCIKKISNSIDLKLRQCGRNHEEGNPKVSQTNEDPVERSVSLALAIVKD  248

Query  1791  -SRSTDKKEHCIKHTDTDFPLH---SEQRDGPANNSDLSHKSGINLQPESIIDSKVGDAN  1624
              + ++    + +K++++    H   S++     N+  +   S   L  ES+         
Sbjct  249   FANTSSSPSNTVKNSESLKRAHVSLSQENRSSVNDLSVLCSSSARLHRESMTVHDRVALR  308

Query  1623  DDAVVSGPI-KGVEIGDSSVPINCFQ----TEGQIIN-VGNDVESQENQTCRSPQTQKVD  1462
             D  +V   I    EI       +C       + +I   +GN+ E  E + C   +   + 
Sbjct  309   DGILVQSRIGTAKEISAKVREKSCLTPSLVDDNRISGGLGNERECCE-ENCGVARVGNLC  367

Query  1461  RGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKV  1282
               ++ S+ S+++C S M ISP DV+G+IG K F + R+AIV+QQRVFA QVFELHRLIKV
Sbjct  368   GHEDISDMSIMDCNSAMGISPHDVMGVIGAKQFCEMRKAIVSQQRVFAAQVFELHRLIKV  427

Query  1281  QKLIAESPNFLLEDTAYLGK-PLKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPHLRMEC  1105
             Q+LIA SP+ LLED  +L K  +KV   K++  P E+   P   P  K+  +KPH   EC
Sbjct  428   QRLIAGSPHLLLEDNDFLSKSAIKVPPVKKV--PLEHALEP---PPPKDYPQKPHSSGEC  482

Query  1104  SAENTVGKASLSSVQNATQAPSCKPSPGN-------PPLPVVSNDSNMGPWCFHQPSGHQ  946
               EN VGK  L  V N T +        N        P    + +S    WC   P G+ 
Sbjct  483   VEENAVGKFPLPPVNNRTSSRGLVTQQSNYGQYSNKSPSASATTNSKPALWCLQPPPGNM  542

Query  945   WLIPVMTPSEGLVYKPYPGP-----GFMSP---GCGPPPVSTPVMGNFFAPPAYGLPTSQ  790
             W +PV + SE L YKPY GP     GF++P    CGP  ++        A  +       
Sbjct  543   WFVPVTSSSEELAYKPYTGPCAPTGGFIAPMYGSCGPASLNPGARDYLNATSS----NPS  598

Query  789   YHYQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGS---QAQVSGGGVN  619
              + QGMG    PP+   YFPPYGMP++N ++S+SAVE M  F+   S   + Q+S G +N
Sbjct  599   LYQQGMGI-GTPPLLQTYFPPYGMPIINPSLSSSAVENMTPFSGGHSNWHENQLSFGEIN  657

Query  618   LNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRS  439
               + HQ+SCNM SQ +        + + A K +EIQ + ASSPS R  G          +
Sbjct  658   FTLPHQSSCNMASQMSQVMPCYVGN-IQASKGSEIQGTTASSPSDRTLG----------N  706

Query  438   VLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERK  274
              LPLFP +P      + +P  + H  R I+VVPHN +SASESAARIF SIQ+ERK
Sbjct  707   ALPLFPMAP-----QSQEPCQSEHQTRAIKVVPHNTKSASESAARIFLSIQEERK  756



>ref|XP_008244742.1| PREDICTED: protein EARLY FLOWERING 3 isoform X1 [Prunus mume]
Length=750

 Score =   325 bits (834),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 273/782 (35%), Positives = 381/782 (49%), Gaps = 135/782 (17%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGV--LPPNPNNASNLIPP  2164
             ++ P+FPR HVNDT+KGGPR PPRNKMALYEQ SIPSQ F  G   + P P+N   L+PP
Sbjct  10    LISPVFPRFHVNDTDKGGPRPPPRNKMALYEQFSIPSQSFTSGSASMLPLPHNDRRLVPP  69

Query  2163  -SPSQGNGHERRMFLP----------------------------------MHLPPSTY--  2095
              S S  + +ER +  P                                  +   PS Y  
Sbjct  70    TSWSDVSSNERNILTPPCNFLVVPSDPAEKIQSYDPTGANLNTMMADCERISTKPSNYLN  129

Query  2094  ------SAEKLHAHSSDSNTPLTQFESRKKTDEDDFRVPV--------FVNSNISQSIGK  1957
                   SA K  +      +    F   K  +ED  +VP           NS  S+   K
Sbjct  130   TTGPSSSAAKYDSFQPKKTSHFRNFSLEKYGNEDYLKVPSPFQGTALQCRNSQQSKEKEK  189

Query  1956  FYKNSEREKVSPSSPAFL-GRSTKDAKHTRGGNLRHQESSRQLPATREQSVKASLS----  1792
                 S  E++  S    + G +T D K  + G   H+E + ++  T E  V+ S+S    
Sbjct  190   LPCLSSMEQLKSSCIKKINGSNTIDLKLRQCGR-NHEEENPKVSQTNEDPVERSVSLALA  248

Query  1791  -----SRSTDKKEHCIKHTDTDFPLH-SEQRDGPANNSDLSH--KSGINLQPESIIDSKV  1636
                  + ++    + +K++++    H S  ++  ++ +DLS    S   L  ES+     
Sbjct  249   IVKDFANTSSSPSNTVKNSESLKRAHASLSQENRSSVNDLSKLCSSSARLHRESMTVHDR  308

Query  1635  GDANDDAVVSGPIKGVEIGDSSVPINCFQTEGQIIN------VGNDVESQENQTCRSPQT  1474
                 D  +V   I   +   S V      T   + +      +GN+ E  E + C   Q 
Sbjct  309   VALRDGILVQSRIGTAKEISSKVREKSCLTPSLVDDNRISGGLGNENECCE-EKCGVAQV  367

Query  1473  QKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVN--QQRVFAVQVFEL  1300
               +   ++ S+ S+++C S M ISP DV+G+IG K F + R+AIV+  QQRVFAVQVFEL
Sbjct  368   GNLCGHEDISDMSIMDCNSAMGISPHDVMGVIGAKQFCEMRKAIVSLSQQRVFAVQVFEL  427

Query  1299  HRLIKVQKLIAESPNFLLEDTAYLGKP-LKVSSAKRLLPPFEY-IKAPQNVPKHKNDSEK  1126
             HRLIKVQ+LIA SP+ LLED  +L KP +KV   K++  P E+ ++ P  + K K+  +K
Sbjct  428   HRLIKVQRLIAGSPHLLLEDNDFLSKPAIKVPPVKKV--PLEHALELPPLIVKPKDHPQK  485

Query  1125  PHLRMECSAENTVGKASLSSVQN-------ATQAPSCKPSPGNPPLPVVSNDSNMGPWCF  967
             PH   EC  EN VGK  L  V N        TQ P  KP+                 WC 
Sbjct  486   PHSSGECVEENAVGKFPLPPVNNRTSSRGLVTQQPYSKPA----------------LWCL  529

Query  966   HQPSGHQWLIPVMTPSEGLVYKPY-----PGPGFMSP---GCGPPPVSTPVMGNFFAPPA  811
               P G+ W +PV + SE L Y+PY     P  GFM+P    CGP  ++        A   
Sbjct  530   QPPPGNMWFVPVTSSSEELAYQPYTGRCAPTGGFMAPMYGSCGPASLNPGARDYLNA--T  587

Query  810   YGLPTSQYHYQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGS---QAQ  640
             Y  P+   + QGMG    PP+    FPPYGMP++N ++S+SAVE M  F+   S   + Q
Sbjct  588   YSNPS--LYQQGMGI-GTPPLLQTCFPPYGMPIINPSLSSSAVENMTPFSGGHSNWHENQ  644

Query  639   VSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVS  460
             +S G +N  + HQ+SCNM  Q +        + + A K +EIQ + ASSPS R  G    
Sbjct  645   LSFGEINFTLPHQSSCNMSGQMSQVMPCYVGN-IQASKGSEIQGTTASSPSDRTLG----  699

Query  459   GPMEGRSVLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKE  280
                   + LPLFPT+P      + +P  + H  R I+VVPHN +SASESAARIF SIQ+E
Sbjct  700   ------NALPLFPTAP-----QSQEPCKSEHQTRAIKVVPHNTKSASESAARIFLSIQEE  748

Query  279   RK  274
             RK
Sbjct  749   RK  750



>ref|XP_008807710.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Phoenix 
dactylifera]
Length=684

 Score =   319 bits (818),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 247/715 (35%), Positives = 341/715 (48%), Gaps = 130/715 (18%)
 Frame = -3

Query  2334  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDH---GVLPPNPNNASNLIPP  2164
             M PMFPRLHVNDT+KGGPRAPPRNKMALYEQLSIPS RF+     V P  P+NAS  +  
Sbjct  1     MRPMFPRLHVNDTDKGGPRAPPRNKMALYEQLSIPSHRFNSKAASVFPLPPHNASTPVSS  60

Query  2163  SPSQGNGHERRMFLPMHLPPST--YSAEKLHAHSSDSNTPLTQFESRKK-----------  2023
             + +QG GHER +  P ++PP    +   K+H+HSS+   P +     K+           
Sbjct  61    ASNQGGGHERSVLSPYYIPPDAPAHKFRKVHSHSSNGKIPRSTIRKFKRPVRHGNQRSSH  120

Query  2022  -----------------------TDEDDFRVPVFVNSNISQSIGKFYKNSEREKVSPSSP  1912
                                     ++DDFRVP FV+S  ++   K     E +K S S  
Sbjct  121   AACSIAGYNLLHSHDVYDRKNSSEEDDDFRVPTFVHSESAKCSSKNMPVKETQKSSASGV  180

Query  1911  AFLGRSTKDAKHTRGGNLRHQESSRQLPATREQSVKASLSSRSTDKKEH----CIKHTDT  1744
               L  S     ++    L      + L      +V +     +  +K H     IK    
Sbjct  181   NELAESYSCTMNSSA--LLSNSYDKPLEQKSACAVNSRKHGSNHSEKMHQETRGIKEQTE  238

Query  1743  DFPLHSEQRD-----------------------------GPANNSDLSHKSGINLQPESI  1651
             +F  H+E R+                             G    S  S+ +G  L     
Sbjct  239   EFAFHTENREKLSELLTFSKASLDHECIRIRNAIEKTCYGDIGRSQESYDNGC-LGELGC  297

Query  1650  IDSKVGDANDDA-VVSGPIKGVEI----GDSSVPINCFQTEGQIINVGNDVESQENQTCR  1486
             +DS+    N DA + SG      +     D ++  NC++  G   +V             
Sbjct  298   LDSRYATENGDARLTSGCFSKSSLRNSHKDQNMADNCYRKLGDKASV-------------  344

Query  1485  SPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVF  1306
             S + +  DR    S+TSM + I+G++ISPDDVVG+IG K FW AR AI+NQQR+FA+Q+F
Sbjct  345   SLELRDGDRNGEMSDTSM-DSIAGLNISPDDVVGVIGPKQFWTARTAIINQQRIFALQLF  403

Query  1305  ELHRLIKVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKNDSEK  1126
             ELHRLIKVQKL+A SP+ LL D       +     K L  P E+    Q + + ++D ++
Sbjct  404   ELHRLIKVQKLLAASPHLLLGDNHGSNSSMSELPTKNL--PAEFNVELQPLTEQRDDIQE  461

Query  1125  PHLRMECSAENTVGKASLS----SVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQP  958
              +  ++C AE      S S      +   Q PSC+P  G P    V+ D+  GP CF  P
Sbjct  462   QNQNIKCPAEKRGVHTSPSPDGGLSKKLDQLPSCEPCSGKPSTVPVAPDNRTGPLCFQSP  521

Query  957   SGHQWLIPVMTPSEGLVYKPYPG-----PGFMSP---GCGPPPVSTPVMGNFFAPPAYGL  802
             + +QWL+PVM+P+EGL+YKPY G      GFM+P    CGP P+   V+G+F     YG+
Sbjct  522   T-NQWLVPVMSPTEGLIYKPYTGFCPPTAGFMAPIYGSCGPLPLQ--VVGDFMN-QGYGV  577

Query  801   PTSQYHYQGMGDPFAPPIGHG----YFP-PYGMPVMNSAVSTSAVEQMNSFTRTGSQAQV  637
             P S       G PF     HG    YFP PYG+PV+N  + TS VE + S TR     + 
Sbjct  578   PASHQQLDMGGTPFR---SHGVPLNYFPAPYGLPVVNPLIPTSVVEHVRSMTRPMEHTEQ  634

Query  636   SGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPG  472
                        Q SCNM + +N +A    + +L+  K  E+Q S ASSP  R  G
Sbjct  635   YS---------QGSCNMLNLEN-EAFGGCSWKLNVSKGCELQGSTASSPCERVQG  679



>gb|KDO58687.1| hypothetical protein CISIN_1g004483mg [Citrus sinensis]
Length=693

 Score =   318 bits (816),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 263/711 (37%), Positives = 348/711 (49%), Gaps = 125/711 (18%)
 Frame = -3

Query  2145  GHERRMFLPM-HLPPSTYSAEKLHAHSSD-------------------------SNTPLT  2044
             GHER +F  + + P  ++SAEKLH++SS+                         +  PL+
Sbjct  20    GHERSVFTQLCNSPAPSFSAEKLHSYSSNGIKLNNMMANQERKSVKPSNYQCLNAAGPLS  79

Query  2043  -----------------QFESRKKTDEDDFRVPVFV------NSNISQSIGKFYKNSERE  1933
                               F  RK  DEDD RV           SN  QS  + +K  +R 
Sbjct  80    SNSKSSSPKPSNFSNFRHFSLRKPEDEDDLRVSSAQLGISPHCSNSQQSKDRKFKQKKRS  139

Query  1932  KVS--PSSPAFLGRSTKDAKHTRGGNLRHQESSRQLPATREQSVKASLSSRSTDKKEHCI  1759
              +    S P    ++ +D   T    + +  S   +P  R++ + A +SS    K  H  
Sbjct  140   ALGDIKSRPRTRNQNDEDTPQTSPDPVDNYTS---IPLNRDRDL-ADVSSIHPSKVRHLE  195

Query  1758  KHTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESIIDSKVGDANDDAVVSGPIKGVEIG  1579
                     L+ E R       +  H +   L  E +       A  D V       +E  
Sbjct  196   SLKRAHSSLNQENRSSSMETLNSLHSTNSRLHQECV-------ALRDEVAHNYSLLMETA  248

Query  1578  DSSVPINCFQTEGQII---NVGND---------VESQENQTCRSPQTQKVDRGDNSSETS  1435
                   N F+   +     ++G+D         VE  E++  RS Q ++VD+ DN S T 
Sbjct  249   MDIDKDNAFKVRTESCLRPSLGDDNSSPKELENVECHEDKNERSVQVREVDKQDNVSNTY  308

Query  1434  MVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPN  1255
             MV  +S + +SPDDVVG+IG+K FWKARRAI++QQRVF +QVFELHRL+KVQ+LIA SPN
Sbjct  309   MVGSVSALAVSPDDVVGVIGEKQFWKARRAIIDQQRVFTLQVFELHRLLKVQRLIARSPN  368

Query  1254  FLLEDTAYLGK-PLKVSSAK-RLLPPFEYIKAPQNVPKHKNDSEKPHLRMECSAENTVGK  1081
              LLED   +GK PL    AK R LP          + K KN S  P    +C+ +N V  
Sbjct  369   LLLEDNLCVGKPPLNTCQAKLRSLP---------CIVKAKNYSPNPDPGSQCADDNAVAN  419

Query  1080  ---------ASLSSVQNATQAPSCKPSPGN-PPLP-VVSNDSNMGPWCFHQPSGHQWLIP  934
                      +S   V   +   SC    GN PP P   S +    PWCF  P+G+QWL+ 
Sbjct  420   IPHPFINNDSSKGFVSQQSNNGSCS---GNVPPAPGANSKNIKQTPWCF-PPTGNQWLVS  475

Query  933   VMTPSEGLVYKPYPGP-----GFMSPGCGP-PPVSTPVMGNFFAPPAYGLPTSQYHYQGM  772
             VM+PSEGLVYKPY GP     GF++P  G   PVS    G  F   AYG+P S  H +G+
Sbjct  476   VMSPSEGLVYKPYTGPCPPTTGFVAPFYGSCSPVSLNPTGADFLNTAYGVPAS--HQEGI  533

Query  771   GD-PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSF--TRTGSQAQVSGGGVNLNVQHQ  601
             G  P  PP+G   FPPYGMPVMN ++S +AV+QM  F          +S   +N  + HQ
Sbjct  534   GILPTTPPLGQTGFPPYGMPVMNQSISGTAVDQMIPFPPKDQSKDNHLSMVDINFMIPHQ  593

Query  600   NSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFP  421
             +S NM SQ N     S   +  A K++E+QAS ASSPS RA G            LPLFP
Sbjct  594   SSRNMSSQMNR-VITSCLEKFQASKESEVQASTASSPSERAKG----------DALPLFP  642

Query  420   TSPVVNIVDASQPPDTG-HPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
              +P+V   D  Q   TG   ARVI+VVP N R A+ESAARIF+SIQ+ERKQ
Sbjct  643   MAPIVQASD--QNDQTGEQQARVIKVVPCNPRLATESAARIFRSIQEERKQ  691



>ref|XP_010526158.1| PREDICTED: protein EARLY FLOWERING 3-like [Tarenaya hassleriana]
Length=664

 Score =   317 bits (811),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 270/739 (37%), Positives = 359/739 (49%), Gaps = 140/739 (19%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDH-GVLPPNPNNASNLIPPS  2161
             IM P+FPRLHV D +KGGPRAPPRNKMALYEQLSIPSQRF+H G+LPP P+N        
Sbjct  10    IMEPLFPRLHVKDADKGGPRAPPRNKMALYEQLSIPSQRFNHQGMLPPGPSN--------  61

Query  2160  PSQGNGHERRMFLPMHLPPSTYS--AEKLHAHS---SDSNTPLTQFESRKKTDEDDFRVP  1996
               Q  G ER  +    +  ST+     K  + +   ++  +     ++    +EDDF VP
Sbjct  62    --QARGMERNRYFHHQVSSSTFMWPVGKFVSQNPCVANMRSLARHDQTEMAGEEDDFMVP  119

Query  1995  VFVNSNISQSIGKFYKNSEREKVSPSSPAFLGRSTKDAKHTRGGNLRHQESSRQLPATRE  1816
             VF+NS  + S G      + EK+SP   A   RS +     +  NL   E       +R+
Sbjct  120   VFLNSGRANSHGM-----DGEKLSPVVAASCPRSVE----IQEANLEDLEDGSLSAGSRQ  170

Query  1815  QSV---KASLSSRSTDKKEHCIKHTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESIID  1645
                   K +    +  K    +   +T+      + D   NN+    +SG  L       
Sbjct  171   DGRDPGKENPRQGTAKKPLDVVAREETNVSKSVSKCDR-GNNALSRQESGNRL-------  222

Query  1644  SKVGDANDDAVVSGPIKGVEIGDSSVPINCFQTEGQIINVGNDVE-SQENQTCRSPQTQK  1468
                 D +D        KG +I          +       V ND +    ++ C S Q + 
Sbjct  223   ----DQDDGE------KGTDISQLRGESRSGKGHSSPDEVDNDHDRCVRSRACMSSQPRN  272

Query  1467  VDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLI  1288
              +  D  SETSMV+ IS  DISPDD+VGIIGQK FWKAR+AI NQQRVFAVQVFELHRL+
Sbjct  273   GEASDGISETSMVDSISSEDISPDDMVGIIGQKRFWKARKAISNQQRVFAVQVFELHRLV  332

Query  1287  KVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEY-IKAPQN--VPKHKNDSEKPHL  1117
             KVQ+L+A SP+ LL+D  YLGK    +S  +   P EY ++ P +    K +++ EK + 
Sbjct  333   KVQRLMAASPHLLLDDGTYLGKSSPKNSLVKKRFPGEYNLQPPLSCIATKCRDNFEKDNR  392

Query  1116  R-MECSAENTVGK-ASLSSVQNATQAPSCKPSPGNPPLPVVSNDS--------NMGPWCF  967
             + MECSAEN VGK  S+SS +N            +PP   ++           N G WCF
Sbjct  393   QEMECSAENAVGKTTSVSSCKNHKDD-------SDPPAAAIAATETEMTTTGCNGGLWCF  445

Query  966   HQPSGHQWLIPVMTPSEGLVYKPYPGPGFMSPGCG-------PPPVSTPVMGNFF-APPA  811
               P  HQWL+PVM+PSEGLVYKPY  PG +  GCG       P P++   + NF    P 
Sbjct  446   -PPQPHQWLVPVMSPSEGLVYKPYSSPGIVGSGCGGYYSRFMPAPMA---VSNFIGGGPV  501

Query  810   YGLPTSQYHYQGMGDPFAPPIGH-GYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVS  634
              G+P           P+ P IG  GYFPPY  P +N   S                    
Sbjct  502   CGIPGFP-----APQPYHPGIGFSGYFPPYSGPTVNPNFS--------------------  536

Query  633   GGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASC----ASSPSVRAPGVT  466
               G   +VQ Q+SCN P+               A    + Q+SC    A++P    P VT
Sbjct  537   --GHLEDVQQQSSCNFPT---------------AAAQPQPQSSCNFPNAATPPQPRPLVT  579

Query  465   VSGPMEGRSVLPL-------------FPTSPVVNIVDASQPPDTGHPA-RVIRVVPHNAR  328
                P    S   +                 P+V   + S+  +    A RVI+VVPHN +
Sbjct  580   KPRPWNRESSRVMQGRSGSGPGSGMSRSALPLVRAAENSRGNERLLAATRVIKVVPHNPK  639

Query  327   SASESAARIFQSIQKERKQ  271
             +ASESAARIF+SIQ+ERKQ
Sbjct  640   AASESAARIFRSIQEERKQ  658



>ref|XP_003567779.1| PREDICTED: protein EARLY FLOWERING 3-like [Brachypodium distachyon]
Length=734

 Score =   318 bits (815),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 283/764 (37%), Positives = 396/764 (52%), Gaps = 124/764 (16%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  2158
             +MGP+FPRLHVNDT KGGPRAPPRNKMALYEQ S+PSQRF      P+  ++S L   SP
Sbjct  17    VMGPLFPRLHVNDTLKGGPRAPPRNKMALYEQFSVPSQRFT-----PHRASSSALSSASP  71

Query  2157  SQGNGHERRMFLPMHLPPS--TYSAEKLHAHSSDSNTPLTQFES----------------  2032
              Q  G +R +F    +P +    S+E ++ +S+  +   T+ ES                
Sbjct  72    GQIGGSDRPLFPSFCVPSNEPARSSEHINTNSNGRDGNATRVESGRHSTQLKSKDTYAAG  131

Query  2031  -------------------RKKTDEDDFRVP-VFVNSNISQSIGKFYKNSEREKVSPSS-  1915
                                +K T++DDF VP VF +     S  +  +  E+    PS+ 
Sbjct  132   STAECSSQRRENSVKNSSGKKLTNDDDFTVPSVFCSGVPPHSTQEVVRIQEKSTAFPSTS  191

Query  1914  -----PAFLGRSTK----DAKHTRGGNLRHQESSRQLPATREQSVKASLSSRSTDKKEHC  1762
                  P     S K    D ++  G N+    S R  P+ ++++   ++++   +++   
Sbjct  192   PYKSGPTMSKSSAKCSNTDKRYLEGTNVSDMRS-RDSPSIKDKAPLKTMTNLDVEERS--  248

Query  1761  IKHTDTDFPLHSEQRDGPANNSDLSHK---SGINLQPESIIDSKVGDA---NDDAVVSGP  1600
                  + F + S+++ G A++   SH+   S +N+  +    ++V  A   N++A  S  
Sbjct  249   -----SSFQI-SKEKAGKADDKISSHRDKLSDLNVFDKQHARTEVHQARRTNENAAESQN  302

Query  1599  IKGVEIGDSSVPINCFQTEGQIINVGNDVESQENQTCRSPQTQKVDRGDNSSETSMVECI  1420
                   G SS  +        ++  G  V  ++ +  RS     V + D+SS+ S VE +
Sbjct  303   APKAGNGPSSTNVE-RNGASNLLEKGLRVTGEKRK--RSEGHHNVQK-DDSSDLS-VESL  357

Query  1419  SGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNFLLED  1240
              G++ISPDDVVG IG KHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIA SP+ L+E 
Sbjct  358   PGLEISPDDVVGAIGPKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAASPHLLIEG  417

Query  1239  TAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPHLRMECSAENTVGKASLSS--  1066
                LG  L  S  K+ L      K P +  K+K+D++    ++E S +N  G  +  S  
Sbjct  418   DPCLGSALATS--KKKLAAGNVEKQPPSA-KNKDDAQLTLQQVEYSKDNIEGNQASPSQD  474

Query  1065  ----VQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPVMTPSEGLVYKP  898
                 VQ+  QA S      NPP    + D+    WC   P  +QWL+PVM+PSEGLVYKP
Sbjct  475   DVVVVQHNNQAASNGGDTSNPPAIPAAPDNKQSNWC--TPPQNQWLVPVMSPSEGLVYKP  532

Query  897   YPGP-----GFMSP---GCGPPPVSTPVMGNFFAPPAYGLPT-SQYHYQGMGDPFAPPIG  745
             Y GP      F++P    C   P+S P     F    YG+    Q  + G+G P    + 
Sbjct  533   YTGPCPPAGSFLAPFYASCA--PLSLPSTAGDFMNSPYGIHMPHQPQHMGLGGPPP--MP  588

Query  744   HGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQH--QNSCNMPSQKN  571
               YFPP+ MPVMN  VS SAVEQ+         ++++    N +V+H  +NSCNM     
Sbjct  589   PMYFPPFSMPVMNPVVSASAVEQV---------SRIAPARPNAHVEHYSRNSCNM----R  635

Query  570   GDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDA  391
              +A  +   R HA +D+E+QAS A+S    +P     G   G +  P  PTS   N    
Sbjct  636   NEAMSAGIWRFHASRDSELQASSAAS----SPFDRQQGEARGPAAPPPIPTSSAGN----  687

Query  390   SQP-PDTG---HPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
              QP P TG   +PA VIRVVPH AR+ASESAARIF+SIQ ER+Q
Sbjct  688   GQPQPSTGSKENPAGVIRVVPHTARTASESAARIFRSIQMERQQ  731



>ref|XP_008244744.1| PREDICTED: protein EARLY FLOWERING 3 isoform X3 [Prunus mume]
Length=735

 Score =   316 bits (810),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 270/775 (35%), Positives = 375/775 (48%), Gaps = 135/775 (17%)
 Frame = -3

Query  2316  RLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGV--LPPNPNNASNLIPP-SPSQGN  2146
             R HVNDT+KGGPR PPRNKMALYEQ SIPSQ F  G   + P P+N   L+PP S S  +
Sbjct  2     RFHVNDTDKGGPRPPPRNKMALYEQFSIPSQSFTSGSASMLPLPHNDRRLVPPTSWSDVS  61

Query  2145  GHERRMFLP----------------------------------MHLPPSTY--------S  2092
              +ER +  P                                  +   PS Y        S
Sbjct  62    SNERNILTPPCNFLVVPSDPAEKIQSYDPTGANLNTMMADCERISTKPSNYLNTTGPSSS  121

Query  2091  AEKLHAHSSDSNTPLTQFESRKKTDEDDFRVPV--------FVNSNISQSIGKFYKNSER  1936
             A K  +      +    F   K  +ED  +VP           NS  S+   K    S  
Sbjct  122   AAKYDSFQPKKTSHFRNFSLEKYGNEDYLKVPSPFQGTALQCRNSQQSKEKEKLPCLSSM  181

Query  1935  EKVSPSSPAFL-GRSTKDAKHTRGGNLRHQESSRQLPATREQSVKASLS---------SR  1786
             E++  S    + G +T D K  + G   H+E + ++  T E  V+ S+S         + 
Sbjct  182   EQLKSSCIKKINGSNTIDLKLRQCGR-NHEEENPKVSQTNEDPVERSVSLALAIVKDFAN  240

Query  1785  STDKKEHCIKHTDTDFPLH-SEQRDGPANNSDLSH--KSGINLQPESIIDSKVGDANDDA  1615
             ++    + +K++++    H S  ++  ++ +DLS    S   L  ES+         D  
Sbjct  241   TSSSPSNTVKNSESLKRAHASLSQENRSSVNDLSKLCSSSARLHRESMTVHDRVALRDGI  300

Query  1614  VVSGPIKGVEIGDSSVPINCFQTEGQIIN------VGNDVESQENQTCRSPQTQKVDRGD  1453
             +V   I   +   S V      T   + +      +GN+ E  E + C   Q   +   +
Sbjct  301   LVQSRIGTAKEISSKVREKSCLTPSLVDDNRISGGLGNENECCE-EKCGVAQVGNLCGHE  359

Query  1452  NSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVN--QQRVFAVQVFELHRLIKVQ  1279
             + S+ S+++C S M ISP DV+G+IG K F + R+AIV+  QQRVFAVQVFELHRLIKVQ
Sbjct  360   DISDMSIMDCNSAMGISPHDVMGVIGAKQFCEMRKAIVSLSQQRVFAVQVFELHRLIKVQ  419

Query  1278  KLIAESPNFLLEDTAYLGKP-LKVSSAKRLLPPFEY-IKAPQNVPKHKNDSEKPHLRMEC  1105
             +LIA SP+ LLED  +L KP +KV   K++  P E+ ++ P  + K K+  +KPH   EC
Sbjct  420   RLIAGSPHLLLEDNDFLSKPAIKVPPVKKV--PLEHALELPPLIVKPKDHPQKPHSSGEC  477

Query  1104  SAENTVGKASLSSVQN-------ATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQ  946
               EN VGK  L  V N        TQ P  KP+                 WC   P G+ 
Sbjct  478   VEENAVGKFPLPPVNNRTSSRGLVTQQPYSKPA----------------LWCLQPPPGNM  521

Query  945   WLIPVMTPSEGLVYKPY-----PGPGFMSP---GCGPPPVSTPVMGNFFAPPAYGLPTSQ  790
             W +PV + SE L Y+PY     P  GFM+P    CGP  ++        A   Y  P+  
Sbjct  522   WFVPVTSSSEELAYQPYTGRCAPTGGFMAPMYGSCGPASLNPGARDYLNA--TYSNPS--  577

Query  789   YHYQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGS---QAQVSGGGVN  619
              + QGMG    PP+    FPPYGMP++N ++S+SAVE M  F+   S   + Q+S G +N
Sbjct  578   LYQQGMGI-GTPPLLQTCFPPYGMPIINPSLSSSAVENMTPFSGGHSNWHENQLSFGEIN  636

Query  618   LNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRS  439
               + HQ+SCNM  Q +        + + A K +EIQ + ASSPS R  G          +
Sbjct  637   FTLPHQSSCNMSGQMSQVMPCYVGN-IQASKGSEIQGTTASSPSDRTLG----------N  685

Query  438   VLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERK  274
              LPLFPT+P      + +P  + H  R I+VVPHN +SASESAARIF SIQ+ERK
Sbjct  686   ALPLFPTAP-----QSQEPCKSEHQTRAIKVVPHNTKSASESAARIFLSIQEERK  735



>ref|XP_004960992.1| PREDICTED: protein EARLY FLOWERING 3-like [Setaria italica]
Length=748

 Score =   313 bits (802),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 287/781 (37%), Positives = 387/781 (50%), Gaps = 140/781 (18%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLP--------------  2200
             +MGP+FPRLHVNDT KGGPRAPPRNKMALYEQ S+PS RF                    
Sbjct  14    VMGPLFPRLHVNDTVKGGPRAPPRNKMALYEQFSVPSHRFSAAAAAPAAPAPAPPWHAHR  73

Query  2199  PNPNNASNLIP-PSPSQGNGHERRMFLPMHLPPST---YSAEKLHAHSSDSNTPLTQFES  2032
             P P  A++ +P  S SQ  G +R +F P +  PST    S++ ++A+S+      T+ ES
Sbjct  74    PAPGAATSAVPSTSASQAGGSDRPLF-PSYCVPSTEPVRSSDHMNANSNGRAGNATRTES  132

Query  2031  -----------------------------------RKKTDEDDFRVPVFVNSNISQSIGK  1957
                                                +K T++DDF VP  + S I      
Sbjct  133   GRLSTHLKSKDTNAAGLTAECSSKHRENTTKNSSGKKLTNDDDFTVPSVLYSGIP-----  187

Query  1956  FYKNSEREKVSP--------SSPAFLGRSTK----DAKHTRGGNLRHQESSRQLPATREQ  1813
                +S +EK +P        S PA    S K    D  H  G  +     S   P  +E+
Sbjct  188   --PHSTQEKFTPFPTKSPYKSMPAMYKSSAKCSNTDRTHLEGMKVS-DAISMGSPGIKEK  244

Query  1812  S-----VKASLSSRSTDKKEHCIKHTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESII  1648
                   +   +  R++  +    K    D P  S  RD       L+  +  + Q   I 
Sbjct  245   EPTKVRIDLEIEERTSSFQTSKEKSGRLD-PKVSSYRD------KLNKYNVADKQSSEIA  297

Query  1647  DSKVGDANDDAVVSGPIKGVEIGDSSVPINCFQTEGQ--IINVGNDVESQENQTCRSPQT  1474
               +  +  ++A  +      E+  S+ P    +  G   ++ +G     +E    R    
Sbjct  298   SYQTRNRKENAGETQNPPEAEMAPSAKPYAGMEQNGNSDLLELG----LRETGEKRKRSH  353

Query  1473  QKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHR  1294
               V+  D+ S++S VE +  M+ISPDDVV  IG KHFWKARRAIVNQQRVFAVQVFELHR
Sbjct  354   HGVEHNDDLSDSS-VESLPEMEISPDDVVSAIGPKHFWKARRAIVNQQRVFAVQVFELHR  412

Query  1293  LIKVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPHLR  1114
             LIKVQKLIA SP+ L+E    L K L  S  K+ L   +  K  Q+  K+K+D ++   +
Sbjct  413   LIKVQKLIAASPHLLIEGDPCLDKALAAS--KKKLAGGDAEKQHQSA-KYKDDVQQTLQQ  469

Query  1113  MECSAENTVG------KASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSG  952
             +E S +NT        +  + +VQ+  QA +      NPP     +D+    WC   P  
Sbjct  470   LEHSKDNTEADQPSPTQDDVVAVQHNNQAAATAAVNSNPPTMPTPSDNKQNSWCI-PPPP  528

Query  951   HQWLIPVMTPSEGLVYKPY-----PGPGFMS---PGCGPPPVSTP-VMGNFFAPPAYGLP  799
             +QWL+PVM+PSEGLVYKPY     P   F++   P C   PVS P   G+F + P YG+P
Sbjct  529   NQWLVPVMSPSEGLVYKPYAGHCPPAGSFLAPFYPSCA--PVSLPSTAGDFMSSP-YGIP  585

Query  798   TSQYHYQGMG-DPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGV  622
                +  Q MG     PP+   YFPP+ MPVMN+AVS SAVEQ+       S    S    
Sbjct  586   MP-HQPQHMGVPGPPPPMPPMYFPPFSMPVMNTAVSASAVEQV-------SHVAASRPNG  637

Query  621   NLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGR  442
             ++    ++SCNM S    +A  +D  R HA KD+E+Q S ASS   R  G       EGR
Sbjct  638   HIEQHSRSSCNM-SNLRSEALSADIWRFHASKDSELQGSSASSTFDRQQG-------EGR  689

Query  441   SVLPLFPTSPVVNIVDASQP-PDTG---HPARVIRVVPHNARSASESAARIFQSIQKERK  274
                  FP+S V N     QP P +G   +P RVIRVVPH +R+ASESAARIF+SI+ ER+
Sbjct  690   GPAQPFPSSSVGN----GQPQPSSGSRENPGRVIRVVPHTSRTASESAARIFESIKMERQ  745

Query  273   Q  271
             Q
Sbjct  746   Q  746



>ref|XP_010417373.1| PREDICTED: protein EARLY FLOWERING 3-like [Camelina sativa]
Length=713

 Score =   310 bits (795),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 279/755 (37%), Positives = 374/755 (50%), Gaps = 124/755 (16%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF-DHGVLPPNPNNASN-LIPP  2164
             I+ PMFPRLHVND +KGGPRAPPRNKMALYEQLSIPSQRF DH  L  N  +++  L+ P
Sbjct  10    ILEPMFPRLHVNDADKGGPRAPPRNKMALYEQLSIPSQRFGDHASLSHNSRSSTTTLVHP  69

Query  2163  SPSQGNGHERRMFLPMHLPPSTYSAEKLHAHSS----DSNTPLTQFESRKKT-DEDDFRV  1999
               SQ  G ER +    HL  S  +    +  S     ++   L Q + RK   +E++F V
Sbjct  70    PGSQSCGVERNL-SSRHLDSSAANEATENCVSQMSFMENVRSLAQHDQRKMVREEEEFAV  128

Query  1998  PVFVNSNISQSIGKFYKNSEREKVSPSSPAFLGRSTKDAKHTRGGNLRHQESSRQLPATR  1819
             PVF+NS  SQ  G+     E+EK +P     +  S++ +        + QE +R  P ++
Sbjct  129   PVFINSRRSQGHGRTKSGIEKEKHTP----LVAPSSRHS-------TQFQEVNR--PGSK  175

Query  1818  EQSVKASLSSRSTDKKEHCIKHTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESIIDSK  1639
             +    A+ S+   + +E    +T +          G   + DLS   G+NL+  +    +
Sbjct  176   QNICLATFSN--LEGREQVKANTKSG---------GFVISLDLSVTEGMNLEKSASSYDR  224

Query  1638  VGDANDDAVVSGPIKGVEI------------GDSSVPINCFQTEG----QIINVGNDVES  1507
             V D N         +                 +S +       EG    + I+ G   E 
Sbjct  225   VNDGNASLRQESKNRXXXXXXXXXXXXTDNGAESHLATESHLEEGHGSPEDIDTGR--EY  282

Query  1506  QENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQR  1327
               N+ C S Q    D  D+ S+ SMV+ IS +D+SPDDVVG++GQK FW+AR+AI NQQR
Sbjct  283   SRNRGCASLQQINEDASDDVSDDSMVDSISSIDVSPDDVVGVLGQKRFWRARKAIANQQR  342

Query  1326  VFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGK-PLKVSSAKRLLPPFEYIK--APQN  1156
             VFAVQ+FELHRLIKVQKLIA SP+ LL++  +LGK   K    K+L+P    +K   P  
Sbjct  343   VFAVQLFELHRLIKVQKLIAASPDILLDEINFLGKVSAKSYPVKKLVPSEFMVKPPLPHV  402

Query  1155  VPKHKNDSEKPHL-RMECSAENTVGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMG  979
             V K + DSEK +  +ME SAEN VG+  LS+  +  Q  +  P P NPP    +N     
Sbjct  403   VVKQRGDSEKTNQHKMESSAENVVGR--LSNQGHHHQQSNYMPFPNNPPASPAANG----  456

Query  978   PWCF---HQPSGH-QWLIPVMTPSEGLVYKPYPGPGFMSPGCGPPPVSTPVMGNFFAPPA  811
              +CF     PSG+ QWLIPVM+PSEGL+YKP+       PG G P          F PP 
Sbjct  457   -YCFPPQPPPSGNQQWLIPVMSPSEGLIYKPH-------PGMGHPGGYYGGYYGHFIPPP  508

Query  810   YGLPTSQYHYQGMGDPFAPPIGHGYFPPYG-MPVMNSAVSTSAVEQ------MNSFTRTG  652
               +P  QYH  G+G  F P   +GYFPPYG MP M +   +   +Q      MN F   G
Sbjct  509   MVMP--QYH-PGIG--FPPHPSNGYFPPYGIMPTMMNPYCSGQQQQPPNEQHMNQFGYPG  563

Query  651   S----------QAQVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASC  502
             +            Q    G   N Q Q+S N  + +          R    +    Q S 
Sbjct  564   NFQHQQQPNEHMNQFVCPGNLQNTQQQSSVNEAAAQEQQQPTKSYPRARKSR----QGST  619

Query  501   ASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDASQPPDT-----------------  373
              SSPS       V G    +S  P        NI +  +P D                  
Sbjct  620   GSSPS------GVEGIAGNKSFRPFSTIDDSNNINN--EPEDMMTTTTTTTRTTVTQTTR  671

Query  372   -GHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
              G   RVI+VVPHNA+ ASE+AARIF+SIQ+ERK+
Sbjct  672   DGGVTRVIKVVPHNAKLASENAARIFRSIQEERKR  706



>ref|XP_006408833.1| hypothetical protein EUTSA_v10001926mg [Eutrema salsugineum]
 gb|ESQ50286.1| hypothetical protein EUTSA_v10001926mg [Eutrema salsugineum]
Length=672

 Score =   308 bits (790),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 282/738 (38%), Positives = 360/738 (49%), Gaps = 132/738 (18%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF--DHGVLPPNPNNASNLIPP  2164
             I+ PMFPRLHVND ++G PRAPPRNKMALYEQLSIPSQRF  D+G L    +N+S L+PP
Sbjct  10    ILEPMFPRLHVNDADRG-PRAPPRNKMALYEQLSIPSQRFSTDNGALL---HNSSTLVPP  65

Query  2163  S--PSQGNGHERRMFLPMHLPPS--TYSAEKLHAHSS--DSNTPLTQFESRK-KTDEDDF  2005
                 SQ  G ER +    HL  S   ++ EK  + +S  +    L+Q E RK   +ED+F
Sbjct  66    VGPSSQPCGVERNLSA-QHLDSSAAVHATEKFVSQTSFMEKVRNLSQHEQRKIAREEDEF  124

Query  2004  RVPVFVNSNISQSIGKFYKNSEREKVSPSSPAFLGRSTKDAKHTRGGNLRHQESSRQLPA  1825
              VP+FVNS   Q  G+      +EK S      L R        RGG      +S  + A
Sbjct  125   AVPIFVNSRRFQFHGRTKSGIMKEKHST-----LVREQPKGSAKRGGF----GNSLDISA  175

Query  1824  TREQSVKASLSSRSTDKKEHCIKHTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESIID  1645
             T E  ++ S SS        C +  D +  L  E R    N  D   + G   Q   ++D
Sbjct  176   TEEMDLEKSASS--------CDRVNDCNAALRRESR----NRLD---RDGGETQ---VMD  217

Query  1644  SKVGDANDDAVVSGPIKGVEIGDSSVPINCFQTEGQIINVGNDVESQENQTCRSPQTQKV  1465
             +  G  +  A+ S   +G                G   +V N  E   ++   S Q    
Sbjct  218   TDNGVESHLAMESHTEEG---------------HGNPNDVNNGREYCRSRGYASLQQINE  262

Query  1464  DRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIK  1285
             +  D+ S+ SMV+ IS MD+SPDDVVG++GQK FW+AR+AI NQQRVFAVQ+FELHRLIK
Sbjct  263   EASDDVSDNSMVDSISSMDVSPDDVVGVLGQKRFWRARKAIANQQRVFAVQLFELHRLIK  322

Query  1284  VQKLIAESPNFLLEDTAYLGK-PLKVSSAKRLLPPFEYIK--APQNVPKHKNDSEKP-HL  1117
             VQ+LIA SP+ LL+D  YLGK   K    K+LLP    +K   PQ +     DSEK    
Sbjct  323   VQRLIAASPDVLLDDINYLGKVAAKTYPVKKLLPSEFILKPPLPQVIKHTSGDSEKTDQN  382

Query  1116  RMECSAENTVGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQP------S  955
             +MECSAEN VG+      Q+  Q  +  P   NPP     N S     C+  P       
Sbjct  383   KMECSAENVVGRL---PNQSHHQPSNYMPFASNPP-----NASQASNGCYFPPQPPPSGG  434

Query  954   GHQWLIPVMTPSEGLVYKPYPGPGFMSPGCGPPPVSTPVMGNFFAPPAYGLPTSQYHYQG  775
               QWLIPVM+PSEGL+YKP+PGPG   P CG         G+F   P             
Sbjct  435   NQQWLIPVMSPSEGLIYKPHPGPGQTGPVCG------GYYGHFMPAPMVMGNFMGGGGPP  488

Query  774   MGDPFA--PPIGHGYFPPYGM------PVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVN  619
                P    P  G+GYFPPYGM      P  +        EQMN F   G+    S     
Sbjct  489   PYHPGMGFPSPGNGYFPPYGMMPTMMNPYCSGQQQQQPNEQMNQFVHPGNFQNASA----  544

Query  618   LNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVT-VSGPMEGR  442
             LN Q ++S +       +A      R ++      Q S  SSPS    G+  VSG    R
Sbjct  545   LNTQQESSVHE------EAPQQQTTRSYSRARKSRQGSTGSSPS----GLERVSGKNSFR  594

Query  441   SVLPLFPTSPVVNIVDASQPP--------------------DTGHPARVIRVVPH-NARS  325
                   P S V +  D +  P                    D G   RVI+VVPH NA+ 
Sbjct  595   ------PFSAVDD--DNNNEPEQTMTTTTTTTRTTVTQTTRDGGGVTRVIKVVPHNNAKL  646

Query  324   ASESAARIFQSIQKERKQ  271
             ASE+AARIF+SIQ+ERK+
Sbjct  647   ASENAARIFRSIQEERKR  664



>ref|XP_010429612.1| PREDICTED: protein EARLY FLOWERING 3-like [Camelina sativa]
Length=706

 Score =   308 bits (790),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 283/757 (37%), Positives = 384/757 (51%), Gaps = 135/757 (18%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF-DHGVLPPNPNNASN-LIPP  2164
             ++ PMFPRLHVND +KGGPRAPPRNKMALYEQLSIPSQRF DH  L  N  +++  L+ P
Sbjct  10    VLEPMFPRLHVNDADKGGPRAPPRNKMALYEQLSIPSQRFGDHASLSHNSRSSTTTLVHP  69

Query  2163  SPSQGNGHERRMFLPMHLPPST--YSAEKLHAHSS--DSNTPLTQFESRKKT-DEDDFRV  1999
               SQ  G ER +    HL  S    + E   +  S  ++   L Q + RK   +E++F V
Sbjct  70    LGSQSCGVERNL-SSRHLDSSAPNEATENCVSQMSFMENVRSLAQHDQRKMVREEEEFAV  128

Query  1998  PVFVNSNISQSIGKFYKNSEREKVSPSSPAFLGRSTKDAKHTRGGNLRHQESSRQLPATR  1819
             PVF+NS  SQ  G+     E+EK +P     L  S++ +        + QE +R  P ++
Sbjct  129   PVFINSRRSQGPGRTKSGIEKEKHTP----LLAPSSRHS-------TQFQEENR--PGSK  175

Query  1818  EQSVKASLSSRSTDKKEHCIKHTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESIIDSK  1639
             +    A+ S+   + +E    +  +          G   + DLS   G NL+  +    +
Sbjct  176   QNICLATFSN--LEGREQVKANAKSG---------GFVISLDLSVTEGKNLEKSASSYDR  224

Query  1638  VGDAN--------DDAVVSGPIKGVEIGD----SSVPINCFQTEG----QIINVGNDVES  1507
             V D +        +    +G   GV+  D    S +       EG    + I+ G   E 
Sbjct  225   VNDCDASLRQESRNRLYRNGGDIGVKDTDNGAESHLATESHLEEGHGSPEDIDTGR--EY  282

Query  1506  QENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQR  1327
               N+ C S Q    D  D+ S+ SMV+ IS +D+SPDDVVG++GQK FW+AR+AI NQQR
Sbjct  283   SRNRGCASLQQINEDASDDVSDDSMVDSISSVDVSPDDVVGVLGQKRFWRARKAIANQQR  342

Query  1326  VFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGK------PLK--VSSAKRLLPPFEYI  1171
             VFAVQ+FELHRLIKVQKLIA SP+ LL++  +LGK      P+K  V+S   + PP  ++
Sbjct  343   VFAVQLFELHRLIKVQKLIAASPDILLDEINFLGKVSAKSYPVKKLVASEFMVKPPLPHV  402

Query  1170  KAPQNVPKHKNDSEKP-HLRMECSAENTVGKASLSSVQNATQAPSCKPSPGNPPLPVVSN  994
                  V K + DSEK    +ME SAEN VG+  LS+  +  Q  +  P P NPP    +N
Sbjct  403   -----VVKQRGDSEKTDQHKMESSAENVVGR--LSNQGHHHQQSTYMPFPNNPPASPAAN  455

Query  993   DSNMGPWCF---HQPSGH-QWLIPVMTPSEGLVYKPYPGPGFMSPGCGPPPVSTPVMGNF  826
                   +CF     PSG+ QWLIPVM+PSEGL+YKP+PG G   PG           G+F
Sbjct  456   G-----YCFPPQPPPSGNQQWLIPVMSPSEGLIYKPHPGMGH--PGG--------YYGHF  500

Query  825   FAPPAYGLPTSQYHYQGMGDPFAPPIGHGYFPPYG-MPVMNSAVSTSAVEQ-----MNSF  664
                P   +   QYH  G+G  F P   +GYFPPYG MP M +   +   +Q     MN F
Sbjct  501   MPQP---MVMPQYH-PGIG--FPPHPSNGYFPPYGIMPTMMNPYCSGQQQQPNEQHMNQF  554

Query  663   TRTGSQAQVSGGGVN--------LNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQA  508
                G+  Q     +N         N Q Q+S N  + +          R    +    Q 
Sbjct  555   GYPGNFQQQPNEHMNQFVHPGNLRNTQQQSSVNEAAAQEQQQPTKSYPRARKSR----QG  610

Query  507   SCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDASQPPDT---------------  373
             S  SSPS R  G+ V+     +S  P        NI +  +P D                
Sbjct  611   STGSSPSGRE-GIAVN-----KSFRPFSAVDDSNNINN--EPEDMTTTTTTTTRTTVTQT  662

Query  372   ---GHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
                G   RVI+VVPHNA+ ASE+AARIF+SIQ+ERK+
Sbjct  663   TRDGGVTRVIKVVPHNAKLASENAARIFRSIQEERKR  699



>ref|XP_002878908.1| hypothetical protein ARALYDRAFT_481449 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55167.1| hypothetical protein ARALYDRAFT_481449 [Arabidopsis lyrata subsp. 
lyrata]
Length=686

 Score =   305 bits (781),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 278/742 (37%), Positives = 366/742 (49%), Gaps = 124/742 (17%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF-DHGVLPPNPNNASNLIPPS  2161
             I+ PMFPRLHVND +KGGPRAPPRNKMALYEQLSIPSQRF DHG L    NN S L+ P 
Sbjct  10    ILEPMFPRLHVNDADKGGPRAPPRNKMALYEQLSIPSQRFGDHGTL--RSNNTSTLVHPG  67

Query  2160  PSQGNGHERRMFLPMHLPPST--YSAEKLHAHSS--DSNTPLTQFESRKKT-DEDDFRVP  1996
             PS       R     HL  S    + EK  +  S  ++   + Q + RK   +E+DF VP
Sbjct  68    PSNQPCGVERNLSAQHLDSSAANQATEKFVSQMSFMENVRSVAQHDQRKMVREEEDFAVP  127

Query  1995  VFVNSNISQSIGKFYKNSEREKVSPSSPAFLGRSTKDAKHTRGGNLRHQESSRQLPATRE  1816
             V++NS  SQ  G+     E+EK +P     +  S +++       L+ QE +R    + +
Sbjct  128   VYINSRRSQGHGRNKTGIEKEKHTP----LVEPSPRNS-------LQFQEVNR---TSSK  173

Query  1815  QSVKASLSSRSTDKKEHCIKHTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESIIDSKV  1636
             Q+V++    R   K +               +  G   + DLS    I+L+  +    +V
Sbjct  174   QNVRSKPEGRDQVKAK--------------AKSGGFVISLDLSVTEEIDLEKSASSYDRV  219

Query  1635  GDANDDAVVSGP-----------IKGVEIG-DSSVPINCFQTEGQII--NVGNDVESQEN  1498
              D N                   +K  + G +S +       +G     ++    E   +
Sbjct  220   NDCNASLRQESRNRLYRDGGETRVKDTDNGAESHLETESHSEDGHCSPEDIDTGREYSRS  279

Query  1497  QTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFA  1318
             + C S Q    +  D+ S+ SMV+ IS MD+SPDDVVGI+GQK FW+AR+AI NQQRVFA
Sbjct  280   RGCASLQQINEEASDDVSDDSMVDSISSMDVSPDDVVGILGQKRFWRARKAIANQQRVFA  339

Query  1317  VQVFELHRLIKVQKLIAESPNFLLEDTAYLGK-PLKVSSAKRLLPPFEYIK--APQNVPK  1147
             VQ+FELHRLIKVQKLIA SP+ LL++  +LGK   K    K+LLP    +K   P  V K
Sbjct  340   VQLFELHRLIKVQKLIAASPDLLLDEINFLGKVSAKSYPVKKLLPSEFLVKPPIPHVVVK  399

Query  1146  HKNDSEKP-HLRMECSAENTVGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWC  970
              + DSEK    +ME SAEN VG+    S Q   Q  +  P   NPP    +N      +C
Sbjct  400   QRGDSEKTDQHKMESSAENVVGRF---SNQGHHQQSNYMPFANNPPASPAANG-----YC  451

Query  969   F---HQPSGH-QWLIPVMTPSEGLVYKPYPGPGFMSPGCGPPPVSTPVMGNFFAPPAYGL  802
             +     PSG+ QWLIPVM+PSEGL+YKP+PG   M             M     P    +
Sbjct  452   YPPQPPPSGNQQWLIPVMSPSEGLIYKPHPG---MGHTGHYGGYYGHYM-----PTPMVM  503

Query  801   PTSQYHYQGMGDPFAPPIGHGYFPPYG-MPVMNSAVSTSAV-------EQMNSFTRTG--  652
             P  QYH  GMG    PP G+GYFPPYG MP M +   +          +QMN F   G  
Sbjct  504   P--QYH-PGMG---FPPPGNGYFPPYGIMPTMMNPYCSGQQQQQQQPNDQMNQFGHHGNL  557

Query  651   --SQAQVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRA  478
               +Q Q S       +QHQ     P++    A  S             Q S  SSPS   
Sbjct  558   QNTQQQQSSVNAAAALQHQ----QPTKSYPRARKSR------------QGSTGSSPS--G  599

Query  477   PGVTVSGPMEGRSVLPLFPTSPVVNIVD-------------ASQPPDTGHPARVIRVVPH  337
             P   +SG    R    +   S + N  +                  D G   RVI+VVPH
Sbjct  600   P-QGISGSKSFRPFSAVDEDSKINNAPEQMMTTTTTTSTTVTQTTRDGGGVTRVIKVVPH  658

Query  336   NARSASESAARIFQSIQKERKQ  271
             NA+ ASE+AARIFQSIQ+ER++
Sbjct  659   NAKLASENAARIFQSIQEERQR  680



>ref|XP_008807709.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Phoenix 
dactylifera]
Length=711

 Score =   305 bits (780),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 247/742 (33%), Positives = 341/742 (46%), Gaps = 157/742 (21%)
 Frame = -3

Query  2334  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDH---GVLPPNPNNASNLIPP  2164
             M PMFPRLHVNDT+KGGPRAPPRNKMALYEQLSIPS RF+     V P  P+NAS  +  
Sbjct  1     MRPMFPRLHVNDTDKGGPRAPPRNKMALYEQLSIPSHRFNSKAASVFPLPPHNASTPVSS  60

Query  2163  SPSQ---------------------------GNGHERRMFLPMHLPPST--YSAEKLHAH  2071
             + +Q                           G GHER +  P ++PP    +   K+H+H
Sbjct  61    ASNQKLSFLFASLIHVDMKSKILKRHWCANKGGGHERSVLSPYYIPPDAPAHKFRKVHSH  120

Query  2070  SSDSNTPLTQFESRKK----------------------------------TDEDDFRVPV  1993
             SS+   P +     K+                                   ++DDFRVP 
Sbjct  121   SSNGKIPRSTIRKFKRPVRHGNQRSSHAACSIAGYNLLHSHDVYDRKNSSEEDDDFRVPT  180

Query  1992  FVNSNISQSIGKFYKNSEREKVSPSSPAFLGRSTKDAKHTRGGNLRHQESSRQLPATREQ  1813
             FV+S  ++   K     E +K S S    L  S     ++    L      + L      
Sbjct  181   FVHSESAKCSSKNMPVKETQKSSASGVNELAESYSCTMNSSA--LLSNSYDKPLEQKSAC  238

Query  1812  SVKASLSSRSTDKKEH----CIKHTDTDFPLHSEQRD-----------------------  1714
             +V +     +  +K H     IK    +F  H+E R+                       
Sbjct  239   AVNSRKHGSNHSEKMHQETRGIKEQTEEFAFHTENREKLSELLTFSKASLDHECIRIRNA  298

Query  1713  ------GPANNSDLSHKSGINLQPESIIDSKVGDANDDA-VVSGPIKGVEI----GDSSV  1567
                   G    S  S+ +G  L     +DS+    N DA + SG      +     D ++
Sbjct  299   IEKTCYGDIGRSQESYDNGC-LGELGCLDSRYATENGDARLTSGCFSKSSLRNSHKDQNM  357

Query  1566  PINCFQTEGQIINVGNDVESQENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVV  1387
               NC++  G   +V             S + +  DR    S+TSM + I+G++ISPDDVV
Sbjct  358   ADNCYRKLGDKASV-------------SLELRDGDRNGEMSDTSM-DSIAGLNISPDDVV  403

Query  1386  GIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGKPLKVS  1207
             G+IG K FW AR AI+NQQR+FA+Q+FELHRLIKVQKL+A SP+ LL D       +   
Sbjct  404   GVIGPKQFWTARTAIINQQRIFALQLFELHRLIKVQKLLAASPHLLLGDNHGSNSSMSEL  463

Query  1206  SAKRLLPPFEYIKAPQNVPKHKNDSEKPHLRMECSAENTVGKASLS----SVQNATQAPS  1039
               K L  P E+    Q + + ++D ++ +  ++C AE      S S      +   Q PS
Sbjct  464   PTKNL--PAEFNVELQPLTEQRDDIQEQNQNIKCPAEKRGVHTSPSPDGGLSKKLDQLPS  521

Query  1038  CKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPVMTPSEGLVYKPYPG-----PGFMS  874
             C+P  G P    V+ D+  GP CF  P+ +QWL+PVM+P+EGL+YKPY G      GFM+
Sbjct  522   CEPCSGKPSTVPVAPDNRTGPLCFQSPT-NQWLVPVMSPTEGLIYKPYTGFCPPTAGFMA  580

Query  873   P---GCGPPPVSTPVMGNFFAPPAYGLPTSQYHYQGMGDPFAPPIGHG----YFP-PYGM  718
             P    CGP P+   V+G+F     YG+P S       G PF     HG    YFP PYG+
Sbjct  581   PIYGSCGPLPLQ--VVGDFMN-QGYGVPASHQQLDMGGTPFR---SHGVPLNYFPAPYGL  634

Query  717   PVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRL  538
             PV+N  + TS VE + S TR     +            Q SCNM + +N +A    + +L
Sbjct  635   PVVNPLIPTSVVEHVRSMTRPMEHTEQYS---------QGSCNMLNLEN-EAFGGCSWKL  684

Query  537   HACKDNEIQASCASSPSVRAPG  472
             +  K  E+Q S ASSP  R  G
Sbjct  685   NVSKGCELQGSTASSPCERVQG  706



>ref|XP_006853900.1| hypothetical protein AMTR_s00036p00168840 [Amborella trichopoda]
 gb|ERN15367.1| hypothetical protein AMTR_s00036p00168840 [Amborella trichopoda]
Length=784

 Score =   305 bits (780),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 281/799 (35%), Positives = 373/799 (47%), Gaps = 146/799 (18%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  2158
              MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLS+P+Q+ +      N + +++++  S 
Sbjct  19    TMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSVPAQKSNSFSSLSNRDASNSVLSASS  78

Query  2157  SQGNGHERRMFLPMHLP-----------------------PSTYSAEKLHAHSSDSNTPL  2047
             SQ +GH+R  F P+ +P                       P  +    L  +S    TP+
Sbjct  79    SQVSGHDRSAFPPLRIPQTLAYSSENNNSCSSDVMNINAAPMEFDRRPLRNNS--YKTPI  136

Query  2046  T--------QFESRKKTD-----------EDDFRVPVFVNSNISQSIGKFYKNSEREKVS  1924
                      QF     +D           EDDF VP F NS     I         E+V+
Sbjct  137   VTGQLSSTNQFTPNDLSDSKASSGPKFGVEDDFMVPNFGNSGTLNHI---------ERVA  187

Query  1923  PSSPAFLGRSTKD-AKHTRGGNLRHQESSRQLPATRE--------QSVKASLSSRSTDKK  1771
             PS P + G ST+  A  T+ G      S  Q     E           K S       + 
Sbjct  188   PSYPLYPGCSTRTVANSTQNGATVSCNSPFQALNAPETPSKFFNLMKFKCSDPHNLESEN  247

Query  1770  EHCIKHTDTDFPLHSEQR----DGPANNSDL---SHKSGINLQPESIIDSKVGDANDDAV  1612
               C   +      H +Q     + P  N ++     K   N    S + +++    D+  
Sbjct  248   NRCAPKSSLPVNDHMQQSVCNMEVPEKNGEVPTKHMKETPNQDRSSGLLNRIEKVQDNTA  307

Query  1611  --VSGPIKGVEIGDSSVP--INCFQTEGQIINVGNDVESQENQTCRSP------------  1480
                + P  G E+  SS P   +       + N+G+    + N   RSP            
Sbjct  308   PGCTRPSAGNELRCSSRPEVRDSGDISWMMTNLGSGASPRSNN--RSPNGPENYREQSGD  365

Query  1479  ---QTQKVDRG---DNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFA  1318
                ++Q+++ G   D++SETSMV+ ISG++ISPDDVVG+IGQKHFWKARRAIVNQQR F+
Sbjct  366   NACESQQLEDGNRNDDASETSMVDSISGLEISPDDVVGVIGQKHFWKARRAIVNQQRAFS  425

Query  1317  VQVFELHRLIKVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKH-K  1141
             +QVFELHRLIKVQKLIA SP  LLED++YL KP   +  K+L    +Y   PQ V +  K
Sbjct  426   IQVFELHRLIKVQKLIAASPRLLLEDSSYLQKPPPKAPPKKLNS--DYAHKPQPVTRKPK  483

Query  1140  NDSEK-----PHLRMECSAENTVGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGP  976
              D++K     P    E     + G       Q ++  P  +     PP     ND  + P
Sbjct  484   EDAQKCNQNSPERPNENQPTPSGGLDQGILCQASSYGPFIQKQTAVPP----PNDGTVPP  539

Query  975   WCFHQPSGHQWLIPVMTPSEGLVYKPYPG----PGFMSPGCGPPPVSTPVMGNFFAPPAY  808
             W FH P+ +QWLIP+M+PSEGLVYKPY G      +++P  G  P++ P M   F   AY
Sbjct  540   WYFHLPTNNQWLIPIMSPSEGLVYKPYSGMCPPSAYIAPTYG-GPLALPPMAGDFTNQAY  598

Query  807   GLPTSQYHYQGMGDPFAPPIGHGYFP-PYGMPVMN--------------SAVSTSAVEQM  673
             GLPTS  H        A P    YFP P G+ VMN                V  +  E++
Sbjct  599   GLPTSHQHAGIQVFSGASP---SYFPAPNGLSVMNPVPRAPVHAAGVVQEVVGPTTQEEV  655

Query  672   NSF--TRTGSQAQVSGGGVNLNVQHQ---NSCNMPSQKNGDADVSDAHRLHACKDNEIQA  508
              S   +  G+Q           VQ        N  S    +A      ++   ++ EIQ 
Sbjct  656   ASRHDSPAGNQGTTRKRDPPAEVQQDREGGGFNTSSDYRSEAFSCSGWKVQGPRETEIQG  715

Query  507   SCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNAR  328
             S ASSP          G  E    LPLF      + VD   P +      VIRVVPHNAR
Sbjct  716   STASSP--------CEGGGERTDALPLFLMG---SAVDEETPQE--RRGVVIRVVPHNAR  762

Query  327   SASESAARIFQSIQKERKQ  271
             SA+ESAARIFQSIQ+ R+Q
Sbjct  763   SATESAARIFQSIQEGRQQ  781



>ref|XP_004969003.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Setaria 
italica]
Length=735

 Score =   301 bits (770),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 266/781 (34%), Positives = 376/781 (48%), Gaps = 158/781 (20%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGG-PRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPS  2161
             +MGP+FPRLHV+D  KGG PRAPPRNKMALYEQ ++PS RF            S +   S
Sbjct  18    VMGPLFPRLHVSDAGKGGGPRAPPRNKMALYEQFTVPSNRFSSSAASTRAAGGSLVTSTS  77

Query  2160  PSQGNGHERRMFLPMHLPPS--TYSAEKLHAHSSDSNTPLTQFESRK---KTDEDDFRVP  1996
              SQ   ++R +F P  +P +   +S+EK   +S +  +  T+ ES +   +T  +D    
Sbjct  78    ASQVYSYDRPLFQPFDVPSNGPAHSSEKFKGNSINGQSNSTRRESGRMPTQTKNNDVYAS  137

Query  1995  VFVNSNISQ-SIGKFYKNSEREKVSPSSPAFLGRSTKDAKHTRGGNLRH---QESSRQLP  1828
               +  + SQ  +G   KNS  +KV+ ++  F+  S    + +R     H   Q+ S  L 
Sbjct  138   KSIAESTSQHRVGNINKNSSGKKVA-NNDEFMVPSICSPRFSRYSTQEHAGVQDKSNPLS  196

Query  1827  ATREQSVKASLSSRSTDKKEHCIKHTDTDFPLHSEQRDGPANNSDLSHKSGINL-QPESI  1651
             AT      +++   S +    C    +     H E+ D     SD+   S   + + ES+
Sbjct  197   ATNPHKSPSAMPKSSAE----CYSAVNR----HLERID----ESDMRSMSSSKVKEKESV  244

Query  1650  IDSKVGDANDDAVVSGPIKGVEIGDSSVPINCFQTE--------GQIINVGNDVESQEN-  1498
               SK+               VE+ + S+P+  F+ +         Q+ +  N+++S +N 
Sbjct  245   QGSKI---------------VEVEEKSLPVQAFKEKFKNKDAKACQMRDNANNIDSYDNP  289

Query  1497  ----------------QTCRSPQTQK--------------------VDR-----------  1459
                                ++P T +                    +DR           
Sbjct  290   HFGNSRRQPTSMNGSSMEAKNPTTTRNTVSCKPCTDLNDCNKNSNLLDRSLREAGSKRKR  349

Query  1458  -------GDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFEL  1300
                     D+ S++S VECI G ++SPD++VG IG KHFWKAR+AI NQQRVFAVQVFEL
Sbjct  350   GHQDVEQNDDLSDSS-VECIPGWEVSPDEIVGAIGPKHFWKARKAIQNQQRVFAVQVFEL  408

Query  1299  HRLIKVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPH  1120
             H+LIKVQKLIA SP+ L+E    LG  L     K+   P   +K       +K+D +   
Sbjct  409   HKLIKVQKLIAASPHLLIEGDPVLGSAL---VGKKTKLPKGNLKVQTLSIANKDDIQPTP  465

Query  1119  LRMECSAENTVGKASLSSVQNAT------QAPSCKPSPGNPPLPVVSNDSNMGPWCFHQP  958
              + E S +NT G        +        QA + +    NPP+   + D+    WC + P
Sbjct  466   EQPELSKQNTEGNPPSPCRDDGLGGNGHDQAATNETFTSNPPVMPAAPDNKQNNWCMNPP  525

Query  957   SGHQWLIPVMTPSEGLVYKPYPGPGFMSPGCGPPPVSTPVMGNFFA--------PPAYGL  802
               +QWL+PVM+PSEGLVYKPY GP      C  PPV + ++  F+A           YG+
Sbjct  526   Q-NQWLVPVMSPSEGLVYKPYAGP------C--PPVGS-LLAPFYANCTPLKLPSTPYGV  575

Query  801   PTSQYHYQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGV  622
             P   +  Q M  P AP +   YFPP+ +PVMN     SAVEQ       GS A V     
Sbjct  576   PMP-HQPQHMAPPGAPAMHMNYFPPFSVPVMNPGAPASAVEQ-------GSHAAVPQPHG  627

Query  621   NLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGR  442
                 Q   SCNM       +  S   R HA +D+E QAS ASSP  R   + V G  +G 
Sbjct  628   RAEQQSLISCNM-------SHPSGIWRFHASRDSEPQASSASSPFDR---IQVQG--DGS  675

Query  441   SVLPLFPTSPVVNIVDASQP-PDTG---HPARVIRVVPHNARSASESAARIFQSIQKERK  274
               + +FP++P  N    +QP P +G       VIRVVPHNA++ASESAARIF+SIQ ER+
Sbjct  676   GPVSVFPSAPAQN----AQPQPSSGSRDQQNHVIRVVPHNAQTASESAARIFRSIQMERR  731

Query  273   Q  271
             Q
Sbjct  732   Q  732



>ref|NP_180164.1| protein EARLY FLOWERING 3 [Arabidopsis thaliana]
 sp|O82804.1|ELF3_ARATH RecName: Full=Protein EARLY FLOWERING 3; AltName: Full=Nematode-responsive 
protein [Arabidopsis thaliana]
 gb|AAC31242.1| unknown protein [Arabidopsis thaliana]
 gb|AAM15042.1| unknown protein [Arabidopsis thaliana]
 gb|AEC07774.1| protein EARLY FLOWERING 3 [Arabidopsis thaliana]
Length=695

 Score =   297 bits (761),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 271/745 (36%), Positives = 362/745 (49%), Gaps = 121/745 (16%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF-DHGVLPPNPNNASNLIPPS  2161
             I+ PMFPRLHVND +KGGPRAPPRNKMALYEQLSIPSQRF DHG +    NN S L+ P 
Sbjct  10    ILEPMFPRLHVNDADKGGPRAPPRNKMALYEQLSIPSQRFGDHGTMNSRSNNTSTLVHPG  69

Query  2160  PS-QGNGHERRMFLPMHLPPSTYSAEKLHAHSSDSNTPLTQFESRKKTDEDDFRVPVFVN  1984
             PS Q  G ER + +              H  SS +N    +F S+    E          
Sbjct  70    PSSQPCGVERNLSV-------------QHLDSSAANQATEKFVSQMSFME----------  106

Query  1983  SNISQSIGKFYKNSEREKVSPSSPAFLG-RSTKDAKHTRGGNLRHQESSRQLPATREQSV  1807
              N+  S     +   RE+   + P ++  R ++    T+ G  + + +    P++   S+
Sbjct  107   -NVRSSAQHDQRKMVREEEDFAVPVYINSRRSQSHGRTKSGIEKEKHTPMVAPSS-HHSI  164

Query  1806  KASLSSRSTDKKEHCI----KHTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESIIDSK  1639
             +    +++  K+  C+    K    D    + +  G   + D+S    I+L+  +    +
Sbjct  165   RFQEVNQTGSKQNVCLATCSKPEVRDQVKANARSGGFVISLDVSVTEEIDLEKSASSHDR  224

Query  1638  VGDANDDAVVSGP-----------IKGVEIG-DSSVPINCFQTEGQII--NVGNDVESQE  1501
             V D N                   +K  + G +S +       EG     ++ ND E  +
Sbjct  225   VNDYNASLRQESRNRLYRDGGKTRLKDTDNGAESHLATENHSQEGHGSPEDIDNDREYSK  284

Query  1500  NQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVF  1321
             ++ C S Q    +  D+ S+ SMV+ IS +D+SPDDVVGI+GQK FW+AR+AI NQQRVF
Sbjct  285   SRACASLQQINEEASDDVSDDSMVDSISSIDVSPDDVVGILGQKRFWRARKAIANQQRVF  344

Query  1320  AVQVFELHRLIKVQKLIAESPNFLLEDTAYLGK-PLKVSSAKRLLPPFEYIK--APQNVP  1150
             AVQ+FELHRLIKVQKLIA SP+ LL++ ++LGK   K    K+LLP    +K   P  V 
Sbjct  345   AVQLFELHRLIKVQKLIAASPDLLLDEISFLGKVSAKSYPVKKLLPSEFLVKPPLPHVVV  404

Query  1149  KHKNDSEKP-HLRMECSAENTVGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPW  973
             K + DSEK    +ME SAEN VG+    S Q   Q  +  P   NPP     N      +
Sbjct  405   KQRGDSEKTDQHKMESSAENVVGRL---SNQGHHQQSNYMPFANNPPASPAPNG-----Y  456

Query  972   CF---HQPSGH--QWLIPVMTPSEGLVYKPYPGPGFMSPGCGPPPVSTPVMGNFFAPPAY  808
             CF     PSG+  QWLIPVM+PSEGL+YKP+PG        G      P           
Sbjct  457   CFPPQPPPSGNHQQWLIPVMSPSEGLIYKPHPGMAHTGHYGGYYGHYMPT----------  506

Query  807   GLPTSQYHYQGMGDPFAPPIGHGYFPPYGM--PVMNSAVSTSAV------EQMNSFTRTG  652
              +   QYH  GMG    PP G+GYFPPYGM   +MN   S+         EQMN F   G
Sbjct  507   PMVMPQYH-PGMG---FPPPGNGYFPPYGMMPTIMNPYCSSQQQQQQQPNEQMNQFGHPG  562

Query  651   SQAQVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAP-  475
             +         N   Q Q S N P+ +          R    +    Q S  SSPS   P 
Sbjct  563   NLQ-------NTQQQQQRSDNEPAPQQQQQPTKSYPRARKSR----QGSTGSSPS--GPQ  609

Query  474   GVTVSGPMEGRSVLPLFPTSPVVNIVDASQPP-----------------DTGHPARVIRV  346
             G++ S     +S  P        NI +A +                   D G   RVI+V
Sbjct  610   GISGS-----KSFRPFAAVDEDSNINNAPEQTMTTTTTTTRTTVTQTTRDGGGVTRVIKV  664

Query  345   VPHNARSASESAARIFQSIQKERKQ  271
             VPHNA+ ASE+AARIFQSIQ+ERK+
Sbjct  665   VPHNAKLASENAARIFQSIQEERKR  689



>gb|KEH39954.1| EARLY flowering protein, putative [Medicago truncatula]
Length=618

 Score =   294 bits (753),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 258/706 (37%), Positives = 345/706 (49%), Gaps = 121/706 (17%)
 Frame = -3

Query  2334  MGPMFPRLHVNDT-EKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIP--P  2164
             +GPMFPRLHVNDT EKGGPRAPPRNKMALYEQ S+P QR    + P + +++SN IP   
Sbjct  12    VGPMFPRLHVNDTTEKGGPRAPPRNKMALYEQFSVPFQR----LNPNSHSSSSNSIPLTS  67

Query  2163  SPSQGNGHERRMFLPMHLP--PSTYSAEKLHAHSSDS---NTPLTQFESRKKTDEDDFRV  1999
             S + GN  ER    P+ LP     + A+   +H S+    +T  TQ E  KK D DD R 
Sbjct  68    SSTMGNDLERSNIFPVRLPSQADAHRAKSYISHQSNGANLDTLSTQLEQGKKVDGDDSRA  127

Query  1998  PVFVNSNISQSIGKFYKNSEREKVSPSSPAFLGRSTKDAKHTRGGNLRHQESSRQLPATR  1819
               + +S I QS  K   +   EK++   P                       SRQ     
Sbjct  128   --YDHSRIGQSNHKMTNSFNGEKITLVIP-----------------------SRQNTVI-  161

Query  1818  EQSVKASLSSRSTDKKEHCIKHTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESIIDSK  1639
               SVK++L+    D +    K      P   +Q    +N         IN  P+    ++
Sbjct  162   --SVKSALTGEIIDSRVRQGK----KIPDEEDQECSVSN---------INRFPQGDSCTR  206

Query  1638  VGDANDDAVVSGPIKGVEIGDSSVPINCFQTEGQIINVGNDVESQENQTCRSPQTQKVDR  1459
               ++ND     G +      D+    +       ++   ND E  +       Q    + 
Sbjct  207   -QESNDIEHSDGLLDTAMDMDNRNSFHSTVDRTMVLEAANDTEYHDANIDSPIQKGNSEG  265

Query  1458  GDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQ  1279
               + S  S +E +S + +SPD VV I+GQ+ FWKARR I NQQR FAVQVFELHRLIKVQ
Sbjct  266   SGDLSNISTIENLSSLKLSPDGVVQILGQQLFWKARRKITNQQRAFAVQVFELHRLIKVQ  325

Query  1278  KLIAESPNFLLEDTAYLGK-PLKVSSAKRLLPPFEYIKAPQNVP-KHKNDSEKPHLRMEC  1105
              LIA S N +L+  A L K PL+ S  K L    E +   Q    K ++ SE  + R++C
Sbjct  326   HLIAGSSNLMLDAAAILEKFPLQESIPKSL--SLEVVVESQTKNHKQQDHSESLNHRLDC  383

Query  1104  SAENTVGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPVMT  925
             SAE  V K S S  +  +   +  P  GN      S+ +N+G   F+Q  GHQWLIPVM+
Sbjct  384   SAEKGVEKTSCSYQKYGSHLSNYTPFSGN------SDQANVGSQYFNQSPGHQWLIPVMS  437

Query  924   PSEGLVYKPYPGPGFMSP--------GCGPPPVSTPVMGNFFAPPAYGLPTSQYHYQGMG  769
             PSEGLVYKPYPGPG+           G GPP V+       F  PAYG+P   +H     
Sbjct  438   PSEGLVYKPYPGPGYTGAVYGGYRPFGQGPPDVT-------FMNPAYGVP--DFHQAIAV  488

Query  768   DPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCN  589
              PF PP G+ YFPP+G+P M  + S SAVEQ N              G  L+V+      
Sbjct  489   PPFIPPGGYPYFPPHGVPAMYQSASVSAVEQKN--------------GATLHVR------  528

Query  588   MPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPV  409
                            +    ++ E++    SSP  +A  +      E R  L    T P+
Sbjct  529   ---------------KPQPSRERELE----SSPGEKAQEIIKEKSAEERDTLSSSFTVPI  569

Query  408   VNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
             V+  +  +  +T    +VIRVVPHN RSA+ SAARIFQSIQ+ERK+
Sbjct  570   VS-KEVLKSLETRQKPQVIRVVPHNPRSATVSAARIFQSIQEERKR  614



>ref|XP_010472622.1| PREDICTED: protein EARLY FLOWERING 3-like [Camelina sativa]
Length=714

 Score =   294 bits (753),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 274/760 (36%), Positives = 371/760 (49%), Gaps = 133/760 (18%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF-DHGVLPPNPNNA-SNLIPP  2164
             I+ PMFPRLHVND +KGGPRAPPRNKMALYEQLSIPSQRF DH  L  N  ++ + LI P
Sbjct  10    ILEPMFPRLHVNDADKGGPRAPPRNKMALYEQLSIPSQRFGDHASLSHNSRSSTTTLIHP  69

Query  2163  SPSQGNGHERRMFLPMHLPPSTYSAEKLHAHSS----DSNTPLTQFESRKKT-DEDDFRV  1999
               SQ  G ER +    HL  S  +    +  S     ++   L Q + RK   +E++F V
Sbjct  70    PGSQSCGVERNL-SSRHLDSSAANEATENCVSQMSFMENVRSLAQHDQRKIVREEEEFAV  128

Query  1998  PVFVNSNISQSIGKFYKNSEREK----VSPSSPAFLGRSTKDAKHTRGGNLRHQESSRQL  1831
             PVF+NS  SQ  G+     E+EK    V+PSS           +H+     + QE +R  
Sbjct  129   PVFINSRRSQGHGRTKSGIEKEKHTPLVAPSS-----------RHS----TQFQEVNR--  171

Query  1830  PATREQSVKASLSSRSTDKKEHCIKHTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESI  1651
             P +++    A+ S  + + +E    +T +          G   + DLS   G+NL+  + 
Sbjct  172   PGSKQNICLANFS--NLEGREQVKANTKS---------GGFVISLDLSVTEGMNLEKSAS  220

Query  1650  IDSKVGDANDDAVVSGPIKGVEIGDSSVPINC-------FQTEGQI-------INVGNDV  1513
                +V D N         +    G ++  ++          TE  +        ++    
Sbjct  221   SYDRVNDGNASLRQESKNRLYRDGGATRVMDTDNGAESHLATESHLEEDHGSPEDIDTGR  280

Query  1512  ESQENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQ  1333
             E   ++ C S Q    D  D+ S+ S+V+ IS +D++PDDVVG++GQK FW+AR+AI NQ
Sbjct  281   EYSRSRGCASLQQINEDASDDVSDDSIVDSISSVDVTPDDVVGVLGQKRFWRARKAIANQ  340

Query  1332  QRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAP---  1162
             QRVFAVQ+FELHRLIKVQKLIA SP+ LL++  +LGK    S   + L P E++  P   
Sbjct  341   QRVFAVQLFELHRLIKVQKLIAASPDILLDEINFLGKVSAKSYPVKKLVPSEFMVKPPLL  400

Query  1161  QNVPKHKNDSEKP-HLRMECSAENTVGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSN  985
               V K + DSEK    +ME SAEN VG+  LS+  +  Q  +  P P NPP    +N   
Sbjct  401   HVVVKQRGDSEKTDQHKMESSAENVVGR--LSNQGHHHQQSNYMPFPNNPPASPAANG--  456

Query  984   MGPWCF---HQPSGH-QWLIPVMTPSEGLVYKPYPGPGFMSPGCGPPPVSTPVMGNFFAP  817
                +CF     PSG+ QWLIPVM+PSEGL+YKP+PG G   PG           G+F  P
Sbjct  457   ---YCFPPQPPPSGNQQWLIPVMSPSEGLIYKPHPGMGH--PGG--------YYGHFMPP  503

Query  816   PAYGLPTSQYHYQGMGDPFAPPIGHGYFPPYG-MPVMNSAVSTSAV-----------EQM  673
             P   +   QYH  G+G  F P    GYFPPYG MP M +   +              + M
Sbjct  504   P---MVMPQYH-PGIG--FPPHPSSGYFPPYGIMPTMMNPYCSGQQQQHHQQQQPNEQHM  557

Query  672   NSFTRTGS----------QAQVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKD  523
             N F   G+            Q    G   N Q Q+S N  + +          R    + 
Sbjct  558   NQFGYPGNFQHQQQPNEHMNQFVYPGNLQNTQQQSSVNEAAPQEQQQLTKSYPRARKSR-  616

Query  522   NEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDASQ--------------  385
                Q S  SSPS       V G    +S  P        NI +  +              
Sbjct  617   ---QGSTGSSPS------GVEGIAGNKSFRPFSAIDDSNNINNEREDMMTTTTTTTRTTV  667

Query  384   --PPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
                   G   RVI+VVPHNA+ ASE AARIF+SIQ+ER++
Sbjct  668   TQTTRDGGVTRVIKVVPHNAKLASEKAARIFRSIQEERER  707



>ref|XP_002515898.1| hypothetical protein RCOM_1486170 [Ricinus communis]
 gb|EEF46318.1| hypothetical protein RCOM_1486170 [Ricinus communis]
Length=783

 Score =   296 bits (757),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 201/435 (46%), Positives = 254/435 (58%), Gaps = 33/435 (8%)
 Frame = -3

Query  1527  VGNDVESQENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARR  1348
             + N  ++ E++   S Q   V+R ++ SETS+V+ +S ++ISPDDVV IIG+K FWKARR
Sbjct  364   IENSRKNHEDKQNGSLQVGDVERHNDGSETSLVDSLSALEISPDDVVRIIGEKQFWKARR  423

Query  1347  AIVNQQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGKP-LKVSSAKRLLPPFEYI  1171
              IVNQQR F VQV ELHRLIKVQKLIA SP  LL+D  YLGK  LK S AK+ +P    I
Sbjct  424   IIVNQQRAFTVQVSELHRLIKVQKLIAGSPALLLKDKFYLGKAFLKASEAKK-VPSNYAI  482

Query  1170  KAPQNVPKHKNDSEKPHLRMECSAENTVGKASLSSVQN-------ATQAPSCKPSPGNPP  1012
             + P  + K K+ S+KPH   E + EN V K SLS+V N         Q+     S G+ P
Sbjct  483   EQPPPIVKPKDGSQKPHSSTEFAEENAVAKLSLSAVNNEVSKGLHTNQSNYGSDSGGHLP  542

Query  1011  LPVVSNDSNMGPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGP-----GFMSPGCGP-PPV  850
              PV +N S   PWCF  PS +QWL+PVM+PSEGLVYKPY GP     GFM+   G   PV
Sbjct  543   APVATN-SGPSPWCFPPPS-NQWLVPVMSPSEGLVYKPYTGPCPPTAGFMAQVYGNCAPV  600

Query  849   STPVMGNFFAPPAYGLPTSQYHYQGMGD-PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQM  673
             S       F   AYG+  S  H  G+G  P  PP+G  YFPPYGMPVM  ++S     Q+
Sbjct  601   SLDGEHGDFINGAYGVQAS--HQNGIGILPSDPPLGQNYFPPYGMPVMTPSISGLLFGQV  658

Query  672   NSFTRTGSQA-QVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCAS  496
             + F    S+  Q+S G +N     Q+SC++ S  +       A      K++++Q S AS
Sbjct  659   SPFNGPQSKGNQLSLGDMNFTFPQQSSCHISSSMSRVISCC-AENFQPSKESKVQGSTAS  717

Query  495   SPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASE  316
             SPS    G            LPLFP  P     D +   D     RVI+VVPHNARSA+E
Sbjct  718   SPSESLKG----------DALPLFPIEPTAQASDQNGQTD-AQWTRVIKVVPHNARSATE  766

Query  315   SAARIFQSIQKERKQ  271
             SAARIF+ IQ+ERKQ
Sbjct  767   SAARIFRFIQEERKQ  781


 Score = 99.8 bits (247),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 68/104 (65%), Gaps = 12/104 (12%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG---VLPPNPNNASNLIP  2167
             ++ PMFPRLHVNDTEKGGPRAPPRNKMALYEQL IPS++   G   +LP  PNN S  +P
Sbjct  11    MISPMFPRLHVNDTEKGGPRAPPRNKMALYEQLGIPSRKVSSGSASMLPLPPNNGSTFVP  70

Query  2166  P---------SPSQGNGHERRMFLPMHLPPSTYSAEKLHAHSSD  2062
                       S SQ +G+ER +F P    P+   +EK  ++SSD
Sbjct  71    KMLPSHVTSDSCSQVSGNERSVFTPFCNSPAPSHSEKSFSYSSD  114



>ref|XP_010062565.1| PREDICTED: protein EARLY FLOWERING 3-like [Eucalyptus grandis]
 ref|XP_010062566.1| PREDICTED: protein EARLY FLOWERING 3-like [Eucalyptus grandis]
 gb|KCW69700.1| hypothetical protein EUGRSUZ_F03094 [Eucalyptus grandis]
Length=717

 Score =   293 bits (749),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 252/755 (33%), Positives = 377/755 (50%), Gaps = 113/755 (15%)
 Frame = -3

Query  2328  PMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDH---GVLPPNPNNASNLIPPSP  2158
             PMFPR HVNDTEKGGPRAPPRNKMALYEQLSIPSQ F+     +LP   +   +L   +P
Sbjct  5     PMFPRFHVNDTEKGGPRAPPRNKMALYEQLSIPSQSFNSPMTSLLPLPLDQGGSLASSAP  64

Query  2157  SQ-GNGHERRMFLPMHLPPSTYSAEKLHAHSSDSNTPLTQFESR----------------  2029
                G  ++R    P+     T+ A K   H+S      +  E+R                
Sbjct  65    LLFGGANQRYALTPLCSSAVTHLARKAELHASAGVKLNSLMETREINLMQARGSLHFKRV  124

Query  2028  ---KKTDEDDFRVPVFVNSNIS-QSIGKFYKNSEREKVSPSSPAFLGRSTKDAKH-----  1876
                K  D DDF +P  V   ++  S  K  KN    K++P         +K ++      
Sbjct  125   APRKHRDADDFTIPALVKRVLTPHSDRKCNKNL---KLNPDLHMDDSSQSKSSREKQIDP  181

Query  1875  TRGGNLRHQESSRQLPATREQSVKASLSSRSTDKKEHCIKHTDTDFPLHSEQRDGPANNS  1696
             TR  ++  ++ +R  P    Q V ++   R       C ++TD  FP  S  +D  +  S
Sbjct  182   TRSTSMNSRQCARN-PLLDNQEVSSASHERPVTL---CRENTDASFPPSS--KDKISETS  235

Query  1695  DLSHKSGINLQPESIID------SKVGDA----NDDAVVSGPI-KGVEIGDSSVPINCFQ  1549
               SH S I     S +D      + +GD      D +VV G + + +  G++S   +  +
Sbjct  236   KGSHASIIGECRSSSVDGLACSNTSMGDGCHVQQDISVVRGEVLEELSKGNASRLRSRLR  295

Query  1548  TEGQIIN-----VGNDVESQENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVG  1384
             ++  I N      G   ++++++    P       G N  + S+ E  S + + PDDVVG
Sbjct  296   SKPLIENGKRGANGTKCDNKDHEDGEYPIQAAEGNGCNVLD-SLEESPSSLYLLPDDVVG  354

Query  1383  IIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGKPLKVSS  1204
             +IG+KH+W AR+AIVNQQR+FA QVFELHRLI+VQ+L++ SP+ LL  + Y G PL    
Sbjct  355   VIGEKHYWNARKAIVNQQRIFAAQVFELHRLIRVQRLLSRSPH-LLGSSLYFGNPLVEHH  413

Query  1203  AKRLLPPFEYIKAPQNVPKHKNDSEK----PHLRMEC------SAENTVGKASLSSVQNA  1054
             A + +P    I+A   +  +   +++    P +++         ++  +G+    S  + 
Sbjct  414   AIKSVPSECLIEATTLLKSNSLSTQERNPTPMVKLPLPPIDSDFSKKLIGERPEQSHYSE  473

Query  1053  TQAP-SCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPVMTPSEGLVYKPY-----P  892
             T  P +C+P+                  CF +  G+QWL+P+M+PSEGL+YK Y     P
Sbjct  474   TSNPAACEPT----------------LRCFPR-IGNQWLVPMMSPSEGLIYKSYSAVCPP  516

Query  891   GPGFMSP---GCGPPPVSTPVMGNFFAPPAYGLPTSQYHYQGMGDPFAPPIGHGYFPPYG  721
               G + P   GC   P+S   MGN      +G+P SQ    G+  P     G  +F P+G
Sbjct  517   RGGTVGPLYGGCA--PISFESMGNDVG-MTFGIPASQRQAMGI-LPRTSVAGQTFFLPWG  572

Query  720   MPVMNSAVSTSAVEQMNSFTRTGSQA-----QVSGGGVNLNVQHQNSCNMPSQKNGDADV  556
             +P+ N +V++SA+E M++    GSQ+     Q S G VN++  HQ+SCN+ +Q +     
Sbjct  573   IPLTNPSVASSAIEPMSNPFILGSQSNPQVNQRSTGEVNISRTHQSSCNVSTQVSRVISC  632

Query  555   SDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDASQPPD  376
              D  +    K+NE+Q S  S+PS +  G          + LPLFP  P  +     Q   
Sbjct  633   -DGLKSPTLKENELQGSTGSNPSEKLGG----------AALPLFPIDPTKSDQKV-QVHS  680

Query  375   TGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
             +    +VI+VVPHN RSA+ESAARIFQSIQ+ERK+
Sbjct  681   SNRLEKVIKVVPHNPRSAAESAARIFQSIQEERKR  715



>gb|AGT16064.1| hydroxyproline-rich glycoprotein family protein [Saccharum hybrid 
cultivar R570]
Length=751

 Score =   293 bits (749),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 270/788 (34%), Positives = 370/788 (47%), Gaps = 151/788 (19%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGG-PRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPS  2161
             +MGP+FPRLHV+D  KGG PRAPPRNKMALYEQL++PS RF           AS +   S
Sbjct  13    VMGPLFPRLHVSDAGKGGGPRAPPRNKMALYEQLTVPSNRFSCPAASARAAGASLVPSTS  72

Query  2160  PSQGNGHERRMFLPMHLPPS--TYSAEKLHAHSSDSNTPLTQFES---------------  2032
              +Q  G++R +F P  +P +    S+EK   +S +  +  T+ ES               
Sbjct  73    AAQVYGYDRTLFQPFDVPLNEPARSSEKFKGNSINGQSNSTRRESLRMSSQTKSKDVCAS  132

Query  2031  --------------------RKKTDEDDFRVPVFVNSNISQSIGKFYKNSEREKVSPS--  1918
                                 +K  ++D+F VP   +S       +FY+ S +E    S  
Sbjct  133   KSIAECTSQHRVGNTIKSSGKKVVNDDEFMVPSICSS-------RFYRYSTQEHADKSKP  185

Query  1917  --------SPAFLGRSTKDAKHTRGGNL-RHQESSRQL---PATREQSVKASLSSRSTDK  1774
                     SP+ + +S+     T   +L R  E+  +L   P  +E+           ++
Sbjct  186   QSATNPHRSPSAVSKSSAKCYSTVNKHLDRINEADMRLMNSPKVKEKEAGQGSKGVEVNE  245

Query  1773  KEHCIKHTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESIIDSKVGDANDDAVVSGPIK  1594
             K   I+ ++     +++  +     S+++     + QP S+ + K  +A +      P  
Sbjct  246   KNSSIQASEKFKDKYAKLCEMRNKVSNINRSDNNSRQPTSV-NGKSTEAKNPTATRNP--  302

Query  1593  GVEIGDSSVPINCFQTEGQIINVGNDVESQ--ENQTCRSPQTQKVDRGDNSSETSMVECI  1420
                   S  P  C   +    N  N +E +  E    R  +    ++ D+ S++S VECI
Sbjct  303   -----SSCKP--CTDVDSSNWN-SNLLERRPREGGAKRKREHHNGEQNDDLSDSS-VECI  353

Query  1419  SGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNFLLED  1240
              G ++SPD++VG IG KHFWKARRAI NQQRVFAVQVFELH+LIKVQKLIA SP+ L+E 
Sbjct  354   PGWELSPDEIVGAIGPKHFWKARRAIQNQQRVFAVQVFELHKLIKVQKLIAASPHLLIEG  413

Query  1239  TAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPHLRM-ECSAENTVGKASLSSV  1063
                LG  L     KR   P   +K  Q +     D  +P L   E S +NT G  S  S 
Sbjct  414   DPVLGNALM---GKRNKLPKGNLKV-QTLSITNKDDIQPTLEQPELSKQNTEGNPSHHSR  469

Query  1062  QNAT------QAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPVMTPSEGLVYK  901
              +        QA + +    NPP   V+ D+    WC + P  +QWL+PVM+PSEGLVYK
Sbjct  470   DDGLSDNHHDQAAANETFTSNPPAIPVAPDNKQNNWCMNPPQ-NQWLVPVMSPSEGLVYK  528

Query  900   PYPGPGFMSPGCGPPPVS---TPVMGNF----FAPPAYGLPTSQYHYQGMGDPFAPPIGH  742
             PY GP      C  PPV+   TP   N          YG+P   +  Q M  P AP +  
Sbjct  529   PYAGP------C--PPVANLLTPFYANCTPLRLPSTPYGVPMP-HQPQHMVPPGAPAMHM  579

Query  741   GYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNMPSQKNGDA  562
              YFPP+ MPVMN     SAVEQ       GS A       ++  Q   SCNM       +
Sbjct  580   NYFPPFSMPVMNPGTPASAVEQ-------GSHAAAPQPHGHMEQQSLISCNM-------S  625

Query  561   DVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNI------  400
               S   R  A +D+E QAS ASSP  R     +    +G   +  FPT+ V+N       
Sbjct  626   HPSGIWRFLASRDSEPQASSASSPFDR-----LQAQGDGSGPVSFFPTASVLNAQPQPSS  680

Query  399   ---------------------VDASQP-PDTG---HPARVIRVVPHNARSASESAARIFQ  295
                                  V  +QP P +G       VIRVVPHNA++ASESAARIF+
Sbjct  681   GGRDQQNHVIRVVPRNAQTASVPNAQPQPSSGGQDQQNHVIRVVPHNAQTASESAARIFR  740

Query  294   SIQKERKQ  271
             SIQ ERKQ
Sbjct  741   SIQMERKQ  748



>ref|XP_004969002.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Setaria 
italica]
Length=749

 Score =   292 bits (747),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 266/795 (33%), Positives = 377/795 (47%), Gaps = 172/795 (22%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGG-PRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPS  2161
             +MGP+FPRLHV+D  KGG PRAPPRNKMALYEQ ++PS RF            S +   S
Sbjct  18    VMGPLFPRLHVSDAGKGGGPRAPPRNKMALYEQFTVPSNRFSSSAASTRAAGGSLVTSTS  77

Query  2160  PSQGN--------------GHERRMFLPMHLPPS--TYSAEKLHAHSSDSNTPLTQFESR  2029
              SQ +               ++R +F P  +P +   +S+EK   +S +  +  T+ ES 
Sbjct  78    ASQVSRSLIFLLCFQDRVYSYDRPLFQPFDVPSNGPAHSSEKFKGNSINGQSNSTRRESG  137

Query  2028  K---KTDEDDFRVPVFVNSNISQ-SIGKFYKNSEREKVSPSSPAFLGRSTKDAKHTRGGN  1861
             +   +T  +D      +  + SQ  +G   KNS  +KV+ ++  F+  S    + +R   
Sbjct  138   RMPTQTKNNDVYASKSIAESTSQHRVGNINKNSSGKKVA-NNDEFMVPSICSPRFSRYST  196

Query  1860  LRH---QESSRQLPATREQSVKASLSSRSTDKKEHCIKHTDTDFPLHSEQRDGPANNSDL  1690
               H   Q+ S  L AT      +++   S +    C    +     H E+ D     SD+
Sbjct  197   QEHAGVQDKSNPLSATNPHKSPSAMPKSSAE----CYSAVNR----HLERID----ESDM  244

Query  1689  SHKSGINL-QPESIIDSKVGDANDDAVVSGPIKGVEIGDSSVPINCFQTE--------GQ  1537
                S   + + ES+  SK+               VE+ + S+P+  F+ +         Q
Sbjct  245   RSMSSSKVKEKESVQGSKI---------------VEVEEKSLPVQAFKEKFKNKDAKACQ  289

Query  1536  IINVGNDVESQEN-----------------QTCRSPQTQK--------------------  1468
             + +  N+++S +N                    ++P T +                    
Sbjct  290   MRDNANNIDSYDNPHFGNSRRQPTSMNGSSMEAKNPTTTRNTVSCKPCTDLNDCNKNSNL  349

Query  1467  VDR------------------GDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAI  1342
             +DR                   D+ S++S VECI G ++SPD++VG IG KHFWKAR+AI
Sbjct  350   LDRSLREAGSKRKRGHQDVEQNDDLSDSS-VECIPGWEVSPDEIVGAIGPKHFWKARKAI  408

Query  1341  VNQQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAP  1162
              NQQRVFAVQVFELH+LIKVQKLIA SP+ L+E    LG  L     K+   P   +K  
Sbjct  409   QNQQRVFAVQVFELHKLIKVQKLIAASPHLLIEGDPVLGSAL---VGKKTKLPKGNLKVQ  465

Query  1161  QNVPKHKNDSEKPHLRMECSAENTVGKASLSSVQNAT------QAPSCKPSPGNPPLPVV  1000
                  +K+D +    + E S +NT G        +        QA + +    NPP+   
Sbjct  466   TLSIANKDDIQPTPEQPELSKQNTEGNPPSPCRDDGLGGNGHDQAATNETFTSNPPVMPA  525

Query  999   SNDSNMGPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGPGFMSPGCGPPPVSTPVMGNFFA  820
             + D+    WC + P  +QWL+PVM+PSEGLVYKPY GP      C  PPV + ++  F+A
Sbjct  526   APDNKQNNWCMNPPQ-NQWLVPVMSPSEGLVYKPYAGP------C--PPVGS-LLAPFYA  575

Query  819   --------PPAYGLPTSQYHYQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSF  664
                        YG+P   +  Q M  P AP +   YFPP+ +PVMN     SAVEQ    
Sbjct  576   NCTPLKLPSTPYGVPMP-HQPQHMAPPGAPAMHMNYFPPFSVPVMNPGAPASAVEQ----  630

Query  663   TRTGSQAQVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSV  484
                GS A V         Q   SCNM       +  S   R HA +D+E QAS ASSP  
Sbjct  631   ---GSHAAVPQPHGRAEQQSLISCNM-------SHPSGIWRFHASRDSEPQASSASSPFD  680

Query  483   RAPGVTVSGPMEGRSVLPLFPTSPVVNIVDASQP-PDTG---HPARVIRVVPHNARSASE  316
             R   + V G  +G   + +FP++P  N    +QP P +G       VIRVVPHNA++ASE
Sbjct  681   R---IQVQG--DGSGPVSVFPSAPAQN----AQPQPSSGSRDQQNHVIRVVPHNAQTASE  731

Query  315   SAARIFQSIQKERKQ  271
             SAARIF+SIQ ER+Q
Sbjct  732   SAARIFRSIQMERRQ  746



>gb|AGT16850.1| hydroxyproline-rich glycoprotein family protein [Saccharum hybrid 
cultivar R570]
 gb|AGT16896.1| hydroxyproline-rich glycoprotein family protein [Saccharum hybrid 
cultivar R570]
Length=751

 Score =   291 bits (745),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 269/788 (34%), Positives = 370/788 (47%), Gaps = 151/788 (19%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGG-PRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPS  2161
             +MGP+FPRLHV+D  KGG PRAPPRNKMALYEQL++PS RF           AS +   S
Sbjct  13    VMGPLFPRLHVSDAGKGGGPRAPPRNKMALYEQLTVPSNRFSCPAASARAAGASLVPSTS  72

Query  2160  PSQGNGHERRMFLPMHLPPS--TYSAEKLHAHSSDSNTPLTQFES---------------  2032
              +Q  G++R +F P  +P +    S+EK   +S +  +  T+ ES               
Sbjct  73    AAQVYGYDRTLFQPFDVPLNEPARSSEKFKGNSINGQSNSTRRESLRMSSQTKSKDVCAS  132

Query  2031  --------------------RKKTDEDDFRVPVFVNSNISQSIGKFYKNSEREKVSPS--  1918
                                 +K  ++D+F VP   +S       +FY+ S +E    S  
Sbjct  133   KSIAECTSQHRVGNTIKSSGKKVVNDDEFMVPSICSS-------RFYRYSTQEHADKSKP  185

Query  1917  --------SPAFLGRSTKDAKHTRGGNL-RHQESSRQL---PATREQSVKASLSSRSTDK  1774
                     SP+ + +S+     T   +L R  E+  +L   P  +E+           ++
Sbjct  186   QSATNPHRSPSAVSKSSAKCYSTVNKHLDRINEADMRLMNSPKVKEKEAGQGSKGVEVNE  245

Query  1773  KEHCIKHTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESIIDSKVGDANDDAVVSGPIK  1594
             K   I+ ++     +++  +     S+++     + QP S+ + K  +A +      P  
Sbjct  246   KNSSIQASEKFKDKYAKLCEMRNKVSNINRSDNNSRQPTSV-NGKSTEAKNPTATRNP--  302

Query  1593  GVEIGDSSVPINCFQTEGQIINVGNDVESQ--ENQTCRSPQTQKVDRGDNSSETSMVECI  1420
                   S  P  C   +    N  N +E +  E    R  +    ++ D+ S++S VECI
Sbjct  303   -----SSCKP--CTDVDSSNWN-SNLLERRPREGGAKRKREHHNGEQNDDLSDSS-VECI  353

Query  1419  SGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNFLLED  1240
              G ++SPD++VG IG KHFWKARRAI NQQRVFAVQVFELH+LIKVQKLIA SP+ L+E 
Sbjct  354   PGWELSPDEIVGAIGPKHFWKARRAIQNQQRVFAVQVFELHKLIKVQKLIAASPHLLIEG  413

Query  1239  TAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPHLRM-ECSAENTVGKASLSSV  1063
                LG  L     KR   P   +K  Q +     D  +P L   E S +NT G  S  S 
Sbjct  414   DPVLGNALM---GKRNKLPKGNLKV-QTLSITNKDDIQPTLEQPELSKQNTEGNPSHHSR  469

Query  1062  QNAT------QAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPVMTPSEGLVYK  901
              +        QA + +    NPP   V+ D+    WC + P  +QWL+PVM+PSEGLVYK
Sbjct  470   DDGLSDNHHDQAAANETFTSNPPAIPVAPDNKQNNWCMNPPQ-NQWLVPVMSPSEGLVYK  528

Query  900   PYPGPGFMSPGCGPPPVS---TPVMGNF----FAPPAYGLPTSQYHYQGMGDPFAPPIGH  742
             PY GP      C  PPV+   TP   N          YG+P   +  Q M  P AP +  
Sbjct  529   PYAGP------C--PPVANLLTPFYANCTPLRLPSTPYGVPMP-HQPQHMVPPGAPAMHM  579

Query  741   GYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNMPSQKNGDA  562
              YFPP+ MPV+N     SAVEQ       GS A       ++  Q   SCNM       +
Sbjct  580   NYFPPFSMPVINPGTPASAVEQ-------GSHAAAPQPHGHMEQQSLISCNM-------S  625

Query  561   DVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNI------  400
               S   R  A +D+E QAS ASSP  R     +    +G   +  FPT+ V+N       
Sbjct  626   HPSGIWRFLASRDSEPQASSASSPFDR-----LQAQGDGSGPVSFFPTASVLNAQPQPSS  680

Query  399   ---------------------VDASQP-PDTG---HPARVIRVVPHNARSASESAARIFQ  295
                                  V  +QP P +G       VIRVVPHNA++ASESAARIF+
Sbjct  681   GGRDQQNHVIRVVPRNAQTASVPNAQPQPSSGGQDQQNHVIRVVPHNAQTASESAARIFR  740

Query  294   SIQKERKQ  271
             SIQ ERKQ
Sbjct  741   SIQMERKQ  748



>gb|AGT17012.1| hydroxyproline-rich glycoprotein family protein [Saccharum hybrid 
cultivar R570]
Length=751

 Score =   290 bits (743),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 269/788 (34%), Positives = 369/788 (47%), Gaps = 151/788 (19%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGG-PRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPS  2161
             +M P+FPRLHV+D  KGG PRAPPRNKMALYEQL++PS RF           AS +   S
Sbjct  13    VMSPLFPRLHVSDAGKGGGPRAPPRNKMALYEQLTVPSNRFSCPAASARAAGASLVPSTS  72

Query  2160  PSQGNGHERRMFLPMHLPPS--TYSAEKLHAHSSDSNTPLTQFES---------------  2032
              +Q  G++R +F P  +P +    S+EK   +S +  +  T+ ES               
Sbjct  73    AAQVYGYDRTLFQPFDVPLNEPARSSEKFKGNSINGQSNSTRRESLRMSSQTKSKDVCAS  132

Query  2031  --------------------RKKTDEDDFRVPVFVNSNISQSIGKFYKNSEREKVSPS--  1918
                                 +K  ++D+F VP   +S       +FY+ S +E    S  
Sbjct  133   KSIAECTSQHRVGNTIKSSGKKVVNDDEFMVPSICSS-------RFYRYSTQEHADKSKP  185

Query  1917  --------SPAFLGRSTKDAKHTRGGNL-RHQESSRQL---PATREQSVKASLSSRSTDK  1774
                     SP+ + +S+     T   +L R  E+  +L   P  +E+           ++
Sbjct  186   QSATNPHRSPSAVSKSSAKCYSTVNKHLDRINEADMRLMNSPKVKEKEAGQGSKGVEVNE  245

Query  1773  KEHCIKHTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESIIDSKVGDANDDAVVSGPIK  1594
             K   I+ ++     +++  +     S+++     + QP S+ + K  +A +      P  
Sbjct  246   KNSSIQASEKFKDKYAKLCEMRNKVSNINRSDNNSRQPTSV-NGKSTEAKNPTATRNP--  302

Query  1593  GVEIGDSSVPINCFQTEGQIINVGNDVESQ--ENQTCRSPQTQKVDRGDNSSETSMVECI  1420
                   S  P  C   +    N  N +E +  E    R  +    ++ D+ S++S VECI
Sbjct  303   -----SSCKP--CTDVDSSNWN-SNLLERRPREGGAKRKREHHNGEQNDDLSDSS-VECI  353

Query  1419  SGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNFLLED  1240
              G ++SPD++VG IG KHFWKARRAI NQQRVFAVQVFELH+LIKVQKLIA SP+ L+E 
Sbjct  354   PGWELSPDEIVGAIGPKHFWKARRAIQNQQRVFAVQVFELHKLIKVQKLIAASPHLLIEG  413

Query  1239  TAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPHLRM-ECSAENTVGKASLSSV  1063
                LG  L     KR   P   +K  Q +     D  +P L   E S +NT G  S  S 
Sbjct  414   DPVLGNALM---GKRNKLPKGNLKV-QTLSITNKDDIQPTLEQPELSKQNTEGNPSHHSR  469

Query  1062  QNAT------QAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPVMTPSEGLVYK  901
              +        QA + +    NPP   V+ D+    WC + P  +QWL+PVM+PSEGLVYK
Sbjct  470   DDGLSDNHHDQAAANETFTSNPPAIPVAPDNKQNNWCMNPPQ-NQWLVPVMSPSEGLVYK  528

Query  900   PYPGPGFMSPGCGPPPVS---TPVMGNF----FAPPAYGLPTSQYHYQGMGDPFAPPIGH  742
             PY GP      C  PPV+   TP   N          YG+P   +  Q M  P AP +  
Sbjct  529   PYAGP------C--PPVANLLTPFYANCTPLRLPSTPYGVPMP-HQPQHMVPPGAPAMHM  579

Query  741   GYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNMPSQKNGDA  562
              YFPP+ MPVMN     SAVEQ       GS A       ++  Q   SCNM       +
Sbjct  580   NYFPPFSMPVMNPGTPASAVEQ-------GSHAAAPQPHGHMEQQSLISCNM-------S  625

Query  561   DVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNI------  400
               S   R  A +D+E QAS ASSP  R     +    +G   +  FPT+ V+N       
Sbjct  626   HPSGIWRFLASRDSEPQASSASSPFDR-----LQAQGDGSGPVSFFPTASVLNAQPQPSS  680

Query  399   ---------------------VDASQP-PDTG---HPARVIRVVPHNARSASESAARIFQ  295
                                  V  +QP P +G       VIRVVPHNA++ASESAARIF+
Sbjct  681   GGRDQQNHVIRVVPRNAQTASVPNAQPQPSSGGQDQQNHVIRVVPHNAQTASESAARIFR  740

Query  294   SIQKERKQ  271
             SIQ ERKQ
Sbjct  741   SIQMERKQ  748



>ref|XP_011011714.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Populus 
euphratica]
Length=764

 Score =   285 bits (730),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 187/428 (44%), Positives = 249/428 (58%), Gaps = 41/428 (10%)
 Frame = -3

Query  1506  QENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQR  1327
             +E++   S +   ++R D+ +ETSMV+ ++ ++I+PDDVVG+IG+K FWKARRAIVNQQR
Sbjct  360   REDKQSGSLKAGDLERNDDDAETSMVDSVTALEITPDDVVGVIGEKQFWKARRAIVNQQR  419

Query  1326  VFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGKP-LKVSSAKRLLPPFEYIKAPQNVP  1150
             VFAVQVFELHRLIKVQKLIA SP+ LLED  Y+G+  LKVS   ++      I  P    
Sbjct  420   VFAVQVFELHRLIKVQKLIAGSPHLLLEDNFYVGRASLKVSQITKVPSKCAMIVKP----  475

Query  1149  KHKNDSEKPHLRMECSAENTVGKASLSSVQNATQ----APSCKPSPGNPPLPVVSNDSNM  982
                + S+K H   + + EN VGK  L S  + T     +     S   PP PV +  +  
Sbjct  476   --NDHSQKQHTSADFAGENVVGKLPLPSTNDETSKEHISQRSNYSGSAPPAPVAT-IAKP  532

Query  981   GPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGPG-----FMSP---GCGPPPVSTPVMGNF  826
              PW +  P G+QWL+PVM+PSEGLVYKPY GP      FM+P    CG  P+S    G  
Sbjct  533   SPWSY-PPPGNQWLVPVMSPSEGLVYKPYAGPCPPVTRFMAPVYGSCG--PISLAPGGGD  589

Query  825   FAPPAYGLPTSQYHYQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQ  646
             F   AY +  S +   G+  P  P  G  +F P+GMPVMN ++  SAVEQ++      S+
Sbjct  590   FLNAAYSVSASNHEEIGIL-PGNPHFGQTFFQPFGMPVMNPSICDSAVEQISPHNGPQSK  648

Query  645   -AQVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGV  469
               Q++ G  N N+  Q+SCNM +Q +              K++EIQ S A +     P +
Sbjct  649   DNQLAVGDTNFNIPLQSSCNMSNQMSRVISCC-VENFQGSKESEIQGSSAGN----LPKM  703

Query  468   TVSGPMEGRSVLPLFPTSPVVNIVDASQPPD--TGHPARVIRVVPHNARSASESAARIFQ  295
             + S      + LPLFP  P    + AS P        ARVI+VVPHN RSA+ESAARIFQ
Sbjct  704   SKS------NALPLFPMEPT---LQASYPNAQINEQQARVIKVVPHNPRSATESAARIFQ  754

Query  294   SIQKERKQ  271
             SIQ+ER+Q
Sbjct  755   SIQEERRQ  762


 Score = 99.0 bits (245),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 66/96 (69%), Gaps = 5/96 (5%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG---VLPPNP-NNASNLI  2170
             +M PMFPRLHVND EKGGPRAPPRNKMALYEQL IPSQRF  G   +LP  P N++S   
Sbjct  10    MMSPMFPRLHVNDAEKGGPRAPPRNKMALYEQLCIPSQRFSSGSGSMLPVLPKNDSSLAP  69

Query  2169  PPSPSQGNGHERRMFLPMHLPPS-TYSAEKLHAHSS  2065
               S S G GHER +F P+   P+  +  EKL  +SS
Sbjct  70    SISSSYGTGHERSVFTPVSNSPTPLHLTEKLFYYSS  105



>ref|XP_011011712.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Populus 
euphratica]
 ref|XP_011011713.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Populus 
euphratica]
Length=780

 Score =   285 bits (728),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 188/438 (43%), Positives = 252/438 (58%), Gaps = 45/438 (10%)
 Frame = -3

Query  1506  QENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQR  1327
             +E++   S +   ++R D+ +ETSMV+ ++ ++I+PDDVVG+IG+K FWKARRAIVNQQR
Sbjct  360   REDKQSGSLKAGDLERNDDDAETSMVDSVTALEITPDDVVGVIGEKQFWKARRAIVNQQR  419

Query  1326  VFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGKP-LKVSSAKRLLPPFEYIKAPQN--  1156
             VFAVQVFELHRLIKVQKLIA SP+ LLED  Y+G+  LKVS   ++      I  P +  
Sbjct  420   VFAVQVFELHRLIKVQKLIAGSPHLLLEDNFYVGRASLKVSQITKVPSKCAMIIKPNDHS  479

Query  1155  --------VPKHKNDSEKPHLRMECSAENTVGKASLSSVQNATQ----APSCKPSPGNPP  1012
                     + K  + S+K H   + + EN VGK  L S  + T     +     S   PP
Sbjct  480   QKQSKCALIVKPNDHSQKQHTSADFAGENVVGKLPLPSTNDETSKEHISQRSNYSGSAPP  539

Query  1011  LPVVSNDSNMGPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGPG-----FMSP---GCGPP  856
              PV +  +   PW +  P G+QWL+PVM+PSEGLVYKPY GP      FM+P    CG  
Sbjct  540   APVAT-IAKPSPWSY-PPPGNQWLVPVMSPSEGLVYKPYAGPCPPVTRFMAPVYGSCG--  595

Query  855   PVSTPVMGNFFAPPAYGLPTSQYHYQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQ  676
             P+S    G  F   AY +  S +   G+  P  P  G  +F P+GMPVMN ++  SAVEQ
Sbjct  596   PISLAPGGGDFLNAAYSVSASNHEEIGIL-PGNPHFGQTFFQPFGMPVMNPSICDSAVEQ  654

Query  675   MNSFTRTGSQ-AQVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCA  499
             ++      S+  Q++ G  N N+  Q+SCNM +Q +              K++EIQ S A
Sbjct  655   ISPHNGPQSKDNQLAVGDTNFNIPLQSSCNMSNQMSRVISCC-VENFQGSKESEIQGSSA  713

Query  498   SSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDASQPPD--TGHPARVIRVVPHNARS  325
              +     P ++ S      + LPLFP  P    + AS P        ARVI+VVPHN RS
Sbjct  714   GN----LPKMSKS------NALPLFPMEPT---LQASYPNAQINEQQARVIKVVPHNPRS  760

Query  324   ASESAARIFQSIQKERKQ  271
             A+ESAARIFQSIQ+ER+Q
Sbjct  761   ATESAARIFQSIQEERRQ  778


 Score = 98.6 bits (244),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 66/96 (69%), Gaps = 5/96 (5%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG---VLPPNP-NNASNLI  2170
             +M PMFPRLHVND EKGGPRAPPRNKMALYEQL IPSQRF  G   +LP  P N++S   
Sbjct  10    MMSPMFPRLHVNDAEKGGPRAPPRNKMALYEQLCIPSQRFSSGSGSMLPVLPKNDSSLAP  69

Query  2169  PPSPSQGNGHERRMFLPMHLPPS-TYSAEKLHAHSS  2065
               S S G GHER +F P+   P+  +  EKL  +SS
Sbjct  70    SISSSYGTGHERSVFTPVSNSPTPLHLTEKLFYYSS  105



>ref|XP_006293368.1| hypothetical protein CARUB_v10022728mg [Capsella rubella]
 gb|EOA26266.1| hypothetical protein CARUB_v10022728mg [Capsella rubella]
Length=722

 Score =   281 bits (720),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 222/574 (39%), Positives = 298/574 (52%), Gaps = 77/574 (13%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF-DHGVLPPNPNNASNLIPPS  2161
             I+ PMFPRLHVND +KGGPRAPPRNKMALYEQLSIPSQRF DHG L  N  +++  +   
Sbjct  10    ILEPMFPRLHVNDADKGGPRAPPRNKMALYEQLSIPSQRFGDHGGLSHNSRSSTTTLVHP  69

Query  2160  PSQGNGHERRMFLPMHLPPSTYSAEKLHAHSS----DSNTPLTQFESRKKT-DEDDFRVP  1996
              SQ  G ER +    HL  S  +    ++ S     ++   L   + RK   +E+DF VP
Sbjct  70    GSQSCGVERNL-SSQHLDTSAANQATENSVSQMSFMENVRSLAPHDQRKMVREEEDFAVP  128

Query  1995  VFVNSNISQSIGKFYKNSEREKVSPSSPAFLGRSTKDAKHTRGGNLRHQESSRQLPATRE  1816
             VF+NS  SQ  G+     E+EK +P     +  S++ +       +++QE +R   A  +
Sbjct  129   VFINSRRSQGHGRNKSGIEKEKQTP----LVAPSSRHS-------IQYQEVNR---AGAK  174

Query  1815  QSVKASLSSRSTDKKEHCIKHTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESIIDSKV  1636
             QS+  +  S+   + +         F +          + DLS    +N +  +    +V
Sbjct  175   QSICLATFSKPEVRDQVKANAKSGGFVI----------SLDLSVTGEMNPEKSASSYDRV  224

Query  1635  GDANDDAVVSGPIKGVEIGDSSVPINC-------FQTEGQIIN-------VGNDVESQEN  1498
              D N         +    G  +   +          TE Q+         + N  E   +
Sbjct  225   NDCNASLRQDSRKRLYRDGGETCMKDTDNGAESHLATESQVEEGHGSPEEIDNGREYSTS  284

Query  1497  QTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFA  1318
             + C S Q    +  D+ S+ SMV+ IS +D+SPDDVVG++GQK FW+AR+AI NQQRVFA
Sbjct  285   RGCASLQQINEEASDDVSDDSMVDSISSIDVSPDDVVGVLGQKRFWRARKAIANQQRVFA  344

Query  1317  VQVFELHRLIKVQKLIAESPNFLLEDTAYLGK-PLKVSSAKRLLPPFEYIK--APQNVPK  1147
             VQ+FELHRLIKVQKLIA SP+ LL++  +LGK   K    K+L+P    +K   P  V K
Sbjct  345   VQLFELHRLIKVQKLIAASPDILLDEINFLGKVSAKTYPVKKLVPSEFMVKPPLPHVVVK  404

Query  1146  HKNDSEKP-HLRMECSAENTVGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWC  970
              + DSEK    +ME SAEN VG+    S Q   Q  +  P   NPP    SN      +C
Sbjct  405   QRGDSEKTDQHKMESSAENVVGRL---SNQGHHQQSNYMPFANNPPASSASNG-----YC  456

Query  969   F------HQPSGHQWLIPVMTPSEGLVYKPYPGPGFMSPGCGPPPVSTPVMGNFFAPPAY  808
             F            QWLIPVM+PSEGL+YKP+PG G   P CG         G+F  PP  
Sbjct  457   FPPQPQPPPSGNQQWLIPVMSPSEGLIYKPHPGMGHPGPVCG------GFYGHFMPPP--  508

Query  807   GLPTSQYHYQGMGDPFAPPIGHGYFPPYG-MPVM  709
              +   QYH  GMG    PP G+GYFPPYG +P M
Sbjct  509   -MVMPQYH-PGMG---FPPPGNGYFPPYGIIPTM  537



>ref|XP_010097102.1| hypothetical protein L484_019541 [Morus notabilis]
 gb|EXB66903.1| hypothetical protein L484_019541 [Morus notabilis]
Length=376

 Score =   270 bits (689),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 179/363 (49%), Positives = 225/363 (62%), Gaps = 26/363 (7%)
 Frame = -3

Query  1335  QQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGK-PLKVSSAKRLLPPFEYIKAPQ  1159
             + R+FA+  +       VQ+LIA SP+ LLE  A+LGK  LK S  K+L+P F  +K   
Sbjct  28    KMRIFAICNY-------VQRLIAGSPHLLLEHGAFLGKSTLKSSPTKKLIPEF-VVKPLP  79

Query  1158  NVPKHKNDSEKPHLRMECSAENTVGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMG  979
              V   K D EKP+ +MECSAEN V K SLSS +  +Q+ S  P  GNP   V   D+ MG
Sbjct  80    RVANCKGDFEKPNEKMECSAENAVSKTSLSSAKTGSQSFSYPPYAGNPQPVVTRPDNKMG  139

Query  978   PWCFHQPSGHQWLIPVMTPSEGLVYKPYPGPGF---MSPGCGPPPVSTPVMGNFFAPPAY  808
             PWCFHQ  G QWL+PVM+PSEGLVYKPY GPG    +  G G P  STP+  NF   P  
Sbjct  140   PWCFHQSPGPQWLVPVMSPSEGLVYKPYLGPGLPGAVYGGHG-PFGSTPMPSNF---PNS  195

Query  807   GLPTSQYHYQGMG-DPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSG  631
                 S  H+QG+   P   P+GH Y PPYGMPV+N A+S SAVEQ+N F  T   + V G
Sbjct  196   DFGISASHHQGIEVFPGTSPVGHTYIPPYGMPVINPAMSCSAVEQVNQFAGT---SPVPG  252

Query  630   GGV-NLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGP  454
               V NLN + Q+SC++P+++NG    S   +  A K +E+Q S ASSP  RA GV +   
Sbjct  253   EMVANLNTEQQSSCSVPARENGSE--SQPRKFQASKGSELQGSTASSPGDRAQGVEIGHN  310

Query  453   MEGRSVLPLFPTSPVVNIVDASQPPD--TGHPARVIRVVPHNARSASESAARIFQSIQKE  280
              + R  L LFP +PVV   DASQP +     P +VI+VVPHN RSA+ESAARIF+ IQ+E
Sbjct  311   AKVRDPLLLFPRAPVVP-EDASQPHEAAAPPPPQVIKVVPHNPRSATESAARIFRFIQEE  369

Query  279   RKQ  271
             RKQ
Sbjct  370   RKQ  372



>ref|XP_009625226.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Nicotiana 
tomentosiformis]
Length=769

 Score =   280 bits (715),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 273/797 (34%), Positives = 373/797 (47%), Gaps = 151/797 (19%)
 Frame = -3

Query  2334  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQ--LSIPSQRF-----------DHGVLPPN  2194
             M P+FPRLH+ND +KGGPRAPPRNKMAL E   +++  QRF              +LP  
Sbjct  11    MDPLFPRLHINDADKGGPRAPPRNKMALCEHSSVTLSPQRFTSTSAPAPAPGSMSMLPLL  70

Query  2193  PNNASNLIPPSPS------------QGNGHERRMFLPMHLP-------------------  2107
             PN+++++  PS S              N  E   F+ +  P                   
Sbjct  71    PNSSNSIPAPSSSLVGCNKKSLFSLSHNSSESPHFIDILHPYSSGGANFTMGRPDVRPLK  130

Query  2106  -------------PSTYSAEKLHAHS---SDSNTPLTQFESRKKTDEDDFRVPVFVNSNI  1975
                          PST     L  HS   S+SN    +F       E DF  P    S  
Sbjct  131   PLNPQVSSLKGNLPSTSQCNLLQPHSLSYSNSNPSAKRF-----GRESDFCGPKLAASGK  185

Query  1974  SQSIGKFYKNSEREKVSPSS--PAFLG-RSTKDAKHT--RGGNL---RHQESSRQLPA--  1825
               + G   K++E+EK+  SS  P+  G    K  +H+  + G+L   + +E   +LPA  
Sbjct  186   PLNNGNIPKSAEKEKLVISSYKPSLTGGMQLKFREHSINQAGDLAQCQKRELCAKLPAPH  245

Query  1824  --TREQSVKASLSSRSTDKKEHCIKHTDTDFPLHSEQRDGPANNS----DLSHKSGINLQ  1663
               TR++SV    SS         + HT+ +  + S     P N      DL+  S  N +
Sbjct  246   LSTRDKSVVHRASS---------LVHTELN--IKSFVSSTPENRCGQVVDLNRCSDSNSE  294

Query  1662  P-ESIIDSKVGDANDDAVVSG-------PIKGVEIGDSSVPINCFQTEGQIINVGNDVES  1507
               E   D     A  D   S            +  G S   I   +       V +  + 
Sbjct  295   SDEDCWDLHKRKAAADVTYSKHEDDTTKRCASIMEGPSCSFIPREENHRSPKRVKSSSDC  354

Query  1506  QENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQR  1327
              E     +P+    DR +  SET  +       + PD+V+ +IGQ+ FWKARR IV+QQR
Sbjct  355   PEGHISGTPEVGDTDRSEGISETCSLNSRLVEKVCPDNVIALIGQELFWKARRTIVHQQR  414

Query  1326  VFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGKP-LKVSSAKRL-----LPPFEYIKA  1165
             +FA+Q+FELHRL KVQKLIA SP+ L +   YL +P +K SS K+L     L P      
Sbjct  415   IFAIQLFELHRLTKVQKLIARSPDILFKGNFYLHQPSIKFSSLKKLPCDNVLEPPALAVE  474

Query  1164  PQNVPKHKNDSEKPHLRMECSAENTVGKASL-----SSVQNATQAPSCKPSPGNPPLPVV  1000
             P+  PK  N+SE P       A+N   +  L     +  +   Q  S KP+ G P     
Sbjct  475   PKVSPK-LNNSEHP-------ADNNAYEKLLPLHKDNDKKLIPQHSSQKPNVGTPTSRSF  526

Query  999   SNDSNMGPWCFHQPSGHQWLIPVMTPSEGLVYKPYPG-----PGFMSP---GCGPPPVST  844
              +D  + P CF  P G+QWL+P+ +PSEGLVYKPY G     PGFM+P   GC P  +S 
Sbjct  527   VSDPKLPPRCFQPPPGYQWLVPIRSPSEGLVYKPYTGPSPPPPGFMAPVYGGCRPVTLS-  585

Query  843   PVMGNFFAPPAYGLPTSQYHYQGMGD-PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNS  667
             P+ G+F   P Y +PTS  H QG+G  P    +      PY MPV+  + S+SAVE+MN 
Sbjct  586   PISGDFSNVP-YSVPTS--HKQGVGIFPGTAILDQSCIQPYPMPVIKPSASSSAVEKMNP  642

Query  666   FTRTGSQAQV---SGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCAS  496
             F    S  +    S   VN+   H+ SCN+  QK+      D     A + +++Q S AS
Sbjct  643   FPGIRSSERENSPSMHDVNVVRPHKKSCNVSCQKSSGMSECDG-TFQADRGSDMQGSSAS  701

Query  495   SPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDASQPP---DTGHPARVIRVVPHNARS  325
             SPS R            R  L LFP +P  N +D  QP    +T    +VI+VVPHN +S
Sbjct  702   SPSERV----------QRDALSLFPITPTANCLD--QPVKDNNTEQRIQVIKVVPHNPKS  749

Query  324   ASESAARIFQSIQKERK  274
             ASESAARIF+SIQ+ERK
Sbjct  750   ASESAARIFRSIQEERK  766



>ref|XP_006357460.1| PREDICTED: protein EARLY FLOWERING 3-like [Solanum tuberosum]
Length=762

 Score =   277 bits (708),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 259/785 (33%), Positives = 362/785 (46%), Gaps = 134/785 (17%)
 Frame = -3

Query  2334  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG----VLPPNPNNASNLIP  2167
             M P+FPRLH+ND +KGGPRAPPRNKMAL EQ S  S           + P P N+ N IP
Sbjct  11    MDPLFPRLHINDADKGGPRAPPRNKMALCEQSSPQSFTSSSTPATMTILPLPPNSGNSIP  70

Query  2166  PSPSQGNGHERRMFL------PMHL--------------------PP-------------  2104
              + S   G  +R +         HL                    PP             
Sbjct  71    AASSSLVGCNKRNYFLQNSSESCHLVAIPPFSSGGMNFTMRHPDVPPVKSLNPQVLCLKG  130

Query  2103  ---STYSAEKLHAHSSDSNTPLTQFESR----KKTDEDDFRVPVFVNSNISQSIGKFYKN  1945
                +T     +H HS      L  + S+    K   E+DF  P FV S      G  +K+
Sbjct  131   NLRATSQLNPIHPHS------LPYYNSKPSANKLGRENDFCGPNFVTSGKPLYHGNIHKS  184

Query  1944  SEREKVSPSSPAFLGRSTKDAKHTRGGNLRHQESSRQLPATREQSVKASLSSRSTDKKEH  1765
             +++EK+   S  F     K  K T    L            RE S+  +       K+EH
Sbjct  185   ADKEKMVKPSLKFQSVFEKQYKDTDRMQLN----------CREHSISQAGDLAKYQKREH  234

Query  1764  CIK----HTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESIIDSKVGDAN---------  1624
             C+K    H  T       +  GP +      KS ++  PE+     VGD N         
Sbjct  235   CVKLPAPHLSTIETTMVHEAPGPGHGKLNISKSVVSSAPENRC-GLVGDLNRCSDSNSES  293

Query  1623  -DDAVV------SGPIKGVEIGDSSVPINCFQTEGQIIN-------------VGNDVESQ  1504
              +D+ +      +  +  V+  D+++       EG   +             V +  +  
Sbjct  294   DEDSWILHKRKAAEDVTDVKHDDATIKRCASIMEGPSCSFLPHGDSHQSPKRVKSSSDCP  353

Query  1503  ENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRV  1324
             E+Q   +P     DR +  SE S +       +S ++V+ +IGQ+ FWK RR I +QQRV
Sbjct  354   EDQISGAPGVAGEDRSEGISEASSLNSRLVEKMSSNNVIALIGQELFWKTRRTIAHQQRV  413

Query  1323  FAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGKP-LKVSSAKRLLPPFEYIKAPQNVPK  1147
             FAVQ+FELHRL KVQK++A SP+   +D  YL +P +K SS K L  P + +  P  V  
Sbjct  414   FAVQLFELHRLTKVQKMMARSPDIFFKDNFYLHQPSIKFSSLKNL--PCDDVLEPPVV--  469

Query  1146  HKNDSEKPHLRMECSAENT-VGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWC  970
              + +S KP+   E +A+N  +     +  +N  Q  S K + G P      +D  + P  
Sbjct  470   EQKNSTKPN-NFELTADNVYLPLRKDNDKKNIPQQSSQKLNVGTPTSRSFVSDPKLAPRS  528

Query  969   FHQPSGHQWLIPVMTPSEGLVYKPYPGP-----GFMSPGCGP--PPVSTPVMGNFFAPPA  811
             F  P G+QWL+P+ +PSEGLVYKPY GP     G ++P  G   P   +P +G  FA   
Sbjct  529   FQPPPGYQWLVPIRSPSEGLVYKPYTGPCPPPGGIIAPAYGSVRPVTLSPHIGGDFANVP  588

Query  810   YGLPTSQYHYQGMGDPFAPPIGH-GYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVS  634
             Y +PTS  H QG G    P +       PY MPV+  + S+SA+EQMN  +R  S  + +
Sbjct  589   YSVPTS--HKQGAGIFPGPALFDPSCIQPYSMPVIKPSASSSAIEQMNPISRIRSSEKEN  646

Query  633   GG---GVNLNVQHQNSCNMPSQKNGDADVSDAHR-LHACKDNEIQASCASSPSVRAPGVT  466
                   VNL   HQ SCN+   K+  A +SD  R + A + +++Q S ASSP  R     
Sbjct  647   SQFMHDVNLVRPHQKSCNISCLKS--AAMSDCDRIIQADRGSDMQGSTASSPPERV----  700

Query  465   VSGPMEGRSVLPLFPTSPVVNIVDA-SQPPDTGHPARVIRVVPHNARSASESAARIFQSI  289
                    +  L LFP +P     D   Q  DT    +VI+VVPHN +SASESAARIF+SI
Sbjct  701   ------QKGALSLFPVTPTAKGSDQPVQDNDTEQQIQVIKVVPHNPKSASESAARIFRSI  754

Query  288   QKERK  274
             Q+ERK
Sbjct  755   QEERK  759



>gb|AEA50867.1| elf3a [Populus tremula]
Length=350

 Score =   261 bits (668),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 170/358 (47%), Positives = 214/358 (60%), Gaps = 15/358 (4%)
 Frame = -3

Query  1335  QQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQN  1156
             QQRVF+VQVFELHRLIKVQ+LIA SP+ LLE+  +L KP    S  + LP    +  P +
Sbjct  1     QQRVFSVQVFELHRLIKVQQLIAGSPHLLLEEEVHLAKPPLKGSPCKNLPSECVVTPPVH  60

Query  1155  VPKHKNDSEKPHLRMECSAENTVGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGP  976
             V KHK++SE P  +MECSAEN V K   +SV N  Q P+ +P  G    P+ + D+ M P
Sbjct  61    VAKHKDNSENPDHKMECSAENAVEKTPFASVNNG-QPPNFRPHAGPTAGPMAA-DTKMAP  118

Query  975   WCFHQPSGHQWLIPVMTPSEGLVYKPYPG--PGFMSPGCGPPPVSTPVMGNFFAPPAYGL  802
             WCFH   G QWL+PVM+PSEGLVYKPY          G   P    P+ GNF    AY +
Sbjct  119   WCFHPSPGPQWLVPVMSPSEGLVYKPYTAPGFMGPGCGGCGPFGPIPLTGNFMT-SAYAV  177

Query  801   PTSQYHYQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGV  622
             P+S YH      P APP+G+  FPPYGMP MN A+S SA       T     AQ  GG +
Sbjct  178   PSSHYHQGIEVSPGAPPVGNACFPPYGMPGMNPAISGSAGSGSCGQT-----AQFPGGIL  232

Query  621   NLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGR  442
             + N+ HQ+SCN  +QK+    +    +L A K+  +Q S  SSPS R  GV      +GR
Sbjct  233   SSNMPHQSSCNERTQKS--EALLQGMKLQASKNTSVQGSTGSSPSGRVQGVGTVQAADGR  290

Query  441   SVLPLFP-TSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
             + LP FP T+P      A Q  +T   ++VI+VVPHN  SA+ESAARIFQSIQ+ RKQ
Sbjct  291   AALPPFPVTTPCPE--GAPQHQETDQLSKVIKVVPHNGISATESAARIFQSIQEGRKQ  346



>ref|NP_001169653.1| uncharacterized protein LOC100383534 [Zea mays]
 gb|ACN34402.1| unknown [Zea mays]
 tpg|DAA58596.1| TPA: hypothetical protein ZEAMMB73_752966 [Zea mays]
Length=756

 Score =   273 bits (697),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 263/799 (33%), Positives = 367/799 (46%), Gaps = 172/799 (22%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGG-PRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPS  2161
             +MGP+FPRLHV+D  KGG PRAPPRNKMALYEQ ++PS RF           AS +   +
Sbjct  17    VMGPLFPRLHVSDAGKGGGPRAPPRNKMALYEQFTVPSNRFSSPAASARAAGASLVPSTA  76

Query  2160  PSQGNGHERRMFLPMHLPPST--YSAEKLHAHSSDSNTPLTQFE----------------  2035
              +Q  G++R +F P  +P +    S+EK   ++ +  +  T+ E                
Sbjct  77    AAQVYGYDRTLFQPFDVPSNEPPRSSEKFKGNTINGQSNSTRREPLRMSSQTKNKDVCAS  136

Query  2034  -------------------SRKKTDEDDFRVPVFVNSNISQSIGKFYKNSEREKVSPSSP  1912
                                 +K   +D+F VP       S    +FY+ S ++    S P
Sbjct  137   KSIAKCTSQHRVGNTIMSSGKKVVSDDEFMVP-------SICYPRFYRQSTQDHADKSKP  189

Query  1911  A---------FLGRSTKDAKHTRGGNL-RHQESSRQL---PATREQSVKASLSSRSTDKK  1771
                        + +S+ +   T   +L +  E+ R+L   P  +E+  +A   S++ +  
Sbjct  190   QSTTNPHKSPAMSKSSVECYSTVNKHLDKINEADRRLMNSPKVKEK--EAVQGSKAVE--  245

Query  1770  EHCIKHTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESIIDSKVGDANDDAVVSGPIKG  1591
                +K   + F    + +D  A    + +K+           S +   +++      + G
Sbjct  246   ---VKEKSSSFQASEKFKDKYAKLCQMRNKA-----------SNINHCDNNGCQPASVNG  291

Query  1590  VEIGDSSVPINCFQTEGQIINVGNDVES---QENQTCRSPQT--QKVDRGDNSSET----  1438
                 ++  P     T         DV+S   + N   RSP+    K  RG ++ E     
Sbjct  292   -NFTEAKNPTAARNTSS--CKPCTDVDSSNRKSNLLERSPREVGAKRKRGHHNGEQNDDL  348

Query  1437  --SMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAE  1264
               S VECI G +ISPD++V  IG KHFWKARRAI NQQRVFAVQVFELH+LIKVQKLIA 
Sbjct  349   SDSSVECIPGGEISPDEIVAAIGPKHFWKARRAIQNQQRVFAVQVFELHKLIKVQKLIAA  408

Query  1263  SPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPHLRM-ECSAENTV  1087
             SP+ L+E    LG  L   + KR   P    K  Q +     D  +P L   E S ++T 
Sbjct  409   SPHLLIEGDPVLGNAL---TGKRNKLPKGNSKV-QTLSITNKDDIQPTLEQPELSKQDTE  464

Query  1086  GKASLSSVQNA------TQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPVMT  925
             G     S  +        QA + +    NPP   V+ D+    WC + P  +QWL+PVM+
Sbjct  465   GNLLAHSHDDGLGDNHHNQAATNETFTSNPPAMHVAPDNKQNNWCMNPPQ-NQWLVPVMS  523

Query  924   PSEGLVYKPYPGPGFMSPGCGPPPVSTPVMGNFFAPPA--------YGLPTSQYHYQGMG  769
             PSEGLVYKP+ GP      C  PPV   ++  F+A  A        YG+P   +  Q M 
Sbjct  524   PSEGLVYKPFAGP------C--PPVGN-LLTPFYANCAPSRLPSTPYGVPIP-HQPQHMV  573

Query  768   DPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCN  589
              P AP +   YFPP+ MPVMN     SAVEQ       GS A       +++ Q   SCN
Sbjct  574   PPGAPAMHMNYFPPFSMPVMNPGTPASAVEQ-------GSHAAAPQPHGHMDQQSLISCN  626

Query  588   MPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPV  409
             M       +  S   R  A +D+E QAS A+SP  R   + V G  +G + L  FPT+  
Sbjct  627   M-------SHPSGVWRFLASRDSEPQASSATSPFDR---LQVQG--DGSAPLSFFPTASA  674

Query  408   VNI-----------------------------VDASQP-PDTG---HPARVIRVVPHNAR  328
              N+                             V  +QP P +G       VIRVVPHNA+
Sbjct  675   PNVQPPPSSGGRDRDQQNHVIRVVPRNAQTASVPKAQPQPSSGGRDQKNHVIRVVPHNAQ  734

Query  327   SASESAARIFQSIQKERKQ  271
             +ASESAA IF+SIQ ER Q
Sbjct  735   TASESAAWIFRSIQMERNQ  753



>ref|XP_008462380.1| PREDICTED: protein EARLY FLOWERING 3 [Cucumis melo]
 ref|XP_008462381.1| PREDICTED: protein EARLY FLOWERING 3 [Cucumis melo]
 ref|XP_008462382.1| PREDICTED: protein EARLY FLOWERING 3 [Cucumis melo]
Length=694

 Score =   271 bits (692),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 172/417 (41%), Positives = 232/417 (56%), Gaps = 50/417 (12%)
 Frame = -3

Query  1437  SMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAESP  1258
             S+V+  S  +ISPD VV +IG+K FWKAR+AIV+QQR+FAVQVFELHRLI+VQKLIA SP
Sbjct  299   SLVDSTSAPNISPDVVVELIGEKQFWKARKAIVHQQRIFAVQVFELHRLIEVQKLIAGSP  358

Query  1257  NFLLEDTAYLGK-PLKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPHLRMECSAENTVGK  1081
             + LLED  YL   P  +S+ K  L  +    +P    K  ++     L  +C+ +N++ K
Sbjct  359   HILLED--YLDNPPSTLSAVKNKLTEYAQQLSPSTTVKENHEQANLVLNRKCADKNSLAK  416

Query  1080  ASLSSVQNATQAPSCKPSPGN--------PPLPVVSNDSNMGPWCFHQPS-GHQWLIPVM  928
                 S        +      N        P  P  +   +  PWC + P+ G+QWL+PVM
Sbjct  417   LPFPSFNKDNSKLALAQQTSNEVRVKDVQPQTPTAAAPKS-NPWCLNHPTPGNQWLVPVM  475

Query  927   TPSEGLVYKPYPGPGFMSPGCGPPP-VSTPVMGNF-------------FAPPAYGLPTSQ  790
             +PSEGL+YKPY GP      C P P   TP+ GNF             F PPAY +P S 
Sbjct  476   SPSEGLIYKPYSGP------CPPSPQFMTPMYGNFGTMSLNIGSGARDFYPPAYAVPAS-  528

Query  789   YHYQGMGD-PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQA---QVSGGGV  622
              H+QG G  P + P+   YF PYG+PV N ++S S  +Q++ +++  S+    Q+S G V
Sbjct  529   -HHQGFGYFPGSIPMNQAYFSPYGIPVTNKSMSGSVPDQVSLYSKFKSKEQENQISTGDV  587

Query  621   NLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGR  442
             N     +NSC MPSQ +      +  ++H  K++E+  S ASSPS R  G          
Sbjct  588   NCLTHQENSCEMPSQTSHSMPF-NVQKVHGSKESELLGSTASSPSERGNG----------  636

Query  441   SVLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
              VLPLFPT P         P    + +R I+VVPH+ RSA+ESAARIFQ IQ+ER Q
Sbjct  637   DVLPLFPTEPPAVEESNPNPEMNENKSRAIKVVPHHPRSATESAARIFQLIQEERNQ  693


 Score = 97.1 bits (240),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 63/93 (68%), Gaps = 2/93 (2%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASN-LIPPS  2161
             ++ PMFPRLHVNDTEKGGPRAPPRNKMALYEQL+IP+QRF  G     P  +S    P S
Sbjct  10    LLSPMFPRLHVNDTEKGGPRAPPRNKMALYEQLTIPTQRFSSGSASATPLPSSTPATPTS  69

Query  2160  PSQGNGHERRMF-LPMHLPPSTYSAEKLHAHSS  2065
             PS   G +R +F         ++ AEKLH++SS
Sbjct  70    PSHCAGQKRGIFSSSAKCSVQSHQAEKLHSYSS  102



>ref|XP_004242270.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Solanum 
lycopersicum]
Length=766

 Score =   272 bits (696),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 253/782 (32%), Positives = 369/782 (47%), Gaps = 124/782 (16%)
 Frame = -3

Query  2334  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPS-QRFDHGVLPPN----PNNASNLI  2170
             M P+FPRLH+NDT+KGGPRAPPRNKMAL EQ S  S Q F     P      PN+ +++ 
Sbjct  11    MDPLFPRLHINDTDKGGPRAPPRNKMALCEQSSSRSPQSFTSSSTPATMQMLPNSGNSIS  70

Query  2169  PPSPSQGNGHERRMFLP--------MHLPPSTYS----------------------AEKL  2080
               S +    ++R  FL         + +PP +                          K 
Sbjct  71    AASSTLVGCNKRNYFLHNSSESSHLVEIPPFSSGGINFTMRHPDVPPVKSLNPQVLCLKG  130

Query  2079  HAHSSDSNTPLTQFE---------SRKKTDEDDFRVPVFVNSNISQSIGKFYKNSEREK-  1930
             + H++    P+ Q           + K   E+DF  P FV S      G  +K++++EK 
Sbjct  131   NLHATSQLNPIQQHSLSYYNSNPSANKLGRENDFCGPNFVTSGKPLYHGNIHKSADKEKM  190

Query  1929  -VSPSSPAFLGRSTKDAKHTRGGNLRHQESSRQLPATREQSVKASLSSRSTDKKEHCIK-  1756
              ++ S P+   +S  + ++        +++ R     RE S   +       K+EHC+K 
Sbjct  191   VITNSKPSLKFQSVFEKQY--------KDTDRMQLNCREHSGSQAGDQAKYQKREHCVKL  242

Query  1755  ---HTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESIIDSKVGDAN----------DDA  1615
                H  T       +   P ++     KS ++  PE+     VGD N          +D+
Sbjct  243   PAPHLSTIETTVVHETPTPGHSKLNISKSFVSSAPENRC-GLVGDLNRCSDSNSESDEDS  301

Query  1614  VVSGPIKGVEI------GDSSVPINCFQTEG---QIINVGNDVESQ----------ENQT  1492
              +    K  E        D+S        EG     +  GN  +S           E+Q 
Sbjct  302   WILHKRKAAEDVTNAKHEDASTKRCASIMEGPSCSFLPHGNSHQSPKRAKSSSDCPEDQI  361

Query  1491  CRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQ  1312
               +P     +R +  SE S +       +S D+V+ +IGQ+ FWK RR I +QQR+FA+Q
Sbjct  362   SGAPDVAGEERSEGISEASSLNSRLVEKMSSDNVIALIGQEIFWKTRRTIAHQQRIFAIQ  421

Query  1311  VFELHRLIKVQKLIAESPNFLLEDTAYLGKP-LKVSSAKRLLPPFEYIKAPQNVPKHKND  1135
             +FELHRL +VQK+IA SP+   +D  YL +P +K SS K L    + +  P  V   +  
Sbjct  422   LFELHRLTQVQKMIARSPDIFFKDNFYLHQPSIKFSSLKNLA--CDDVLEPPVV--EQKI  477

Query  1134  SEKPHLRMECSAENT-VGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQP  958
             S KP+   E + +N  +     +  +N  Q  S K + G P      +D  + P  F  P
Sbjct  478   STKPN-NFELTTDNVYLPLRKDNDKKNIPQQSSQKLNVGTPTSRSFLSDPKLAPRSFQPP  536

Query  957   SGHQWLIPVMTPSEGLVYKPYPGP-----GFMSPG---CGPPPVSTPVMGNFFAPPAYGL  802
              G+Q+L+P+ +PSEGL+YKPY GP     G ++P    C P  +S P+ G+F   P Y +
Sbjct  537   PGYQYLVPIRSPSEGLIYKPYTGPCPPPGGIIAPAYGSCRPVTLSPPIGGDFANVP-YSV  595

Query  801   PTSQYHYQGMGDPFAPPIGH-GYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSG--  631
             PTS  H QG G    P +       PY MPV+  + S+SA+EQMN  +R  S  + +   
Sbjct  596   PTS--HKQGAGIFPGPALFDPSCIQPYSMPVIKPSASSSAIEQMNPLSRIRSSEKENSPL  653

Query  630   -GGVNLNVQHQNSCNMPSQKNGDADVSDAHR-LHACKDNEIQASCASSPSVRAPGVTVSG  457
                VNL   HQ SCN+  QK+  A +SD  R + A + +++Q S ASSP  R        
Sbjct  654   MHEVNLVRPHQKSCNISCQKS--AVMSDCDRIIQADRGSDMQGSTASSPPERV-------  704

Query  456   PMEGRSVLPLFPTSPVVNIVDA-SQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKE  280
                 +  L LFP +P     D   Q  DT    +VI+VVPHN +SASESAARIF+SIQ+E
Sbjct  705   ---QKGALSLFPVTPTAKGSDQPVQDNDTEQQIQVIKVVPHNPKSASESAARIFRSIQEE  761

Query  279   RK  274
             RK
Sbjct  762   RK  763



>gb|EEE54823.1| hypothetical protein OsJ_02258 [Oryza sativa Japonica Group]
Length=742

 Score =   271 bits (692),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 275/776 (35%), Positives = 365/776 (47%), Gaps = 140/776 (18%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGG-PRAPPRNKMALYEQLSIPSQRFDHG---VLPPNPNNASNLI  2170
             +MGP+FPRLHVND  KGG PRAPPRNKMALYEQ ++PS RF  G   +     + A +  
Sbjct  17    VMGPLFPRLHVNDAAKGGGPRAPPRNKMALYEQFTVPSHRFSGGGGALASARGSLARSTS  76

Query  2169  PPSPSQGNGHERRMFLPMHLPPST--YSAEKLHAHS---------SDSNTPLTQ------  2041
               S SQ  G +  +F P ++P +    S EK++++S          DS    TQ      
Sbjct  77    AASQSQVYGCDMPLFEPFNVPSNGPGQSVEKMNSNSVNRQINGSRKDSGMLSTQPKGIDK  136

Query  2040  ---------------------FESRKKTDEDDFRVPVFVNSNISQSIGKFYKNSEREK--  1930
                                     RK  D+D+F VP   ++   Q   K     + E   
Sbjct  137   YGSGSRAECAPQQRVEKGIKSSSGRKLADDDEFIVPSVFSARFPQYSTKERAGVQEESTP  196

Query  1929  ---VSP-SSPAFLGRSTKDAKHTRGGNLRH-----------QESSRQLPATREQSVKAS-  1798
                +SP  SP  + +S     +T   NL             Q+     PA   ++V+   
Sbjct  197   LVALSPHKSPPAVSKSPTKCYNTVSKNLERINVSDVKSRGSQKDKETGPAQTLKNVEVEH  256

Query  1797  LSSRSTDKKEHCIKHTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESIIDSKVGDAN--  1624
              SS    K     KH           + G  N+ D  H      Q  S   S V   N  
Sbjct  257   FSSFEASKDMFGSKHAKVC------PKTGTINDLDEPHLENSEHQATSRNGSSVKFQNPP  310

Query  1623  --DDAVVSGPIKGVEIGDSSVPINCFQTEGQIINVGND---VESQENQTCRSPQTQKVDR  1459
                + + + P  G+E  +     +C   +G +   G     +E+Q+N        +K+D 
Sbjct  311   VRRNTISAKPSPGIENTNG----HCNLPQGGLKEAGTKRKRLEAQDN-------AEKIDD  359

Query  1458  GDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQ  1279
               +SS    VECI+  +ISPD++VG IG KHFWKARRAI+NQQRVFA QVFELH+L+KVQ
Sbjct  360   LSDSS----VECITAWEISPDEIVGAIGAKHFWKARRAIINQQRVFAAQVFELHKLVKVQ  415

Query  1278  KLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKNDS-----EKPHLR  1114
             KLIA SP+ L+E    LG  L ++S K++    E +KA Q V    ND      ++P L 
Sbjct  416   KLIAASPHVLIEGDPCLGNAL-LASKKKMAE--ENLKA-QPVLVATNDDVQPSLQEPELS  471

Query  1113  MECSAENTVGKASLSSVQ-NATQAPSCKPSPGN-PPLPVVSNDSNMGPWCFHQPSGHQWL  940
              E S EN       + V  +  Q      S  N    PV S++         QP  +QWL
Sbjct  472   KENSEENPPSPRDTAPVSGHHDQTAKIGASKSNLRATPVASDNRQNNCGVQLQPPQNQWL  531

Query  939   IPVMTPSEGLVYKPYPGP-----GFMSP---GCGPPPVSTPVMGNFFAPPAYGLPTSQYH  784
             IPVM+PSEGLVYKPY GP       ++P    C   P+  P     F   AYG+P   + 
Sbjct  532   IPVMSPSEGLVYKPYSGPCPPAGSILAPFYANCT--PLRLPSTTGDFMNSAYGVPIP-HQ  588

Query  783   YQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQH  604
              Q MG P  P +   YFPP+ +PVMN     SAVEQ     R  S  Q  G   NL    
Sbjct  589   PQHMGAPGTPTMPMNYFPPFSVPVMNPVALASAVEQ----GRHPSMPQPYG---NLEQHS  641

Query  603   QNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLF  424
             + SCNM       +  S   R HA +D+E QAS ASSP  R      SGP+        F
Sbjct  642   RMSCNM-------SHPSGIWRFHASRDSEAQASSASSPFDRL-QCGGSGPVSA------F  687

Query  423   PTSPVVNIVDASQP-PDTG---HPARVIRVVPH-NARSASESAARIFQSIQKERKQ  271
             PT+   N    +QP P +G   +   VIRV+PH N+++ASESAARIF+SIQ ER+Q
Sbjct  688   PTASAQN----TQPQPSSGSRDNQTNVIRVIPHNNSQTASESAARIFRSIQMERQQ  739



>gb|AGW16337.1| Hd-q [Oryza sativa Japonica Group]
 gb|AGW16343.1| Hd-q [Oryza sativa Japonica Group]
Length=760

 Score =   270 bits (691),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 268/791 (34%), Positives = 368/791 (47%), Gaps = 153/791 (19%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGG-PRAPPRNKMALYEQLSIPSQRFDHGVLP------PNPNNAS  2179
             +MGP+FPRLHVND  KGG PRAPPRNKMALYEQ ++PS RF  G         P  + ++
Sbjct  19    VMGPLFPRLHVNDAAKGGGPRAPPRNKMALYEQFTVPSHRFSGGGGGGGVGGSPAHSTSA  78

Query  2178  NLIPPSPSQGNGHERRMFLPMHLPPST--YSAEKL-------------------------  2080
                  S SQ  G +  +F P ++P +   +S EK+                         
Sbjct  79    ASQSQSQSQVYGRDSSLFQPFNVPSNRPGHSTEKINSDKINKKISGSRKELGMLSSQTKG  138

Query  2079  ---HAHSSDSNTPLTQFES-------RKKTDEDDFRVPVFVNSNISQSIGKFYKNSEREK  1930
                +A  S +  P  + E+       ++  D+D+F VP   NS   Q     Y   E   
Sbjct  139   MDIYASRSTAEAPQRRAENTIKSSSGKRLADDDEFMVPSVFNSRFPQ-----YSTQENAG  193

Query  1929  VSP-----------SSPAFLGRSTKDAKHTRGGNLR--HQESSRQLPATREQSVKASLSS  1789
             V              SP+ + +S+    +T    L   H    +     +++ ++A+ +S
Sbjct  194   VQDQSTPLVAANPHKSPSTVSKSSTKCYNTVSKKLERIHVSDVKSRTPLKDKEMEAAQTS  253

Query  1788  RSTDKKEHCIKHTDTDF--PLHSE-----QRDGPANNSDLSHKSGINLQPESI-------  1651
             ++ + ++    H   D     H++      + G  N+SD  H      Q  S        
Sbjct  254   KNVEVEKSSSFHASKDMFESRHAKVYPKMDKTGIINDSDEPHGGNSGHQATSRNGGSMKF  313

Query  1650  ---------IDSKVGDANDDAVVSGPIKGVEIGDSSVPINCFQTEGQIINVGNDVESQEN  1498
                      I S     N D   + P  G+E            T+ + +   +D E  ++
Sbjct  314   QNPPMRRNEISSNPSSENTDRHYNLPQGGIEETG---------TKRKRLLEQHDAEKSDD  364

Query  1497  QTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFA  1318
                R  +    +  D+ S++S VECI+G +ISPD +VG IG KHFWKARRAI+NQQRVFA
Sbjct  365   -VSRLLEQHDAENIDDVSDSS-VECITGWEISPDKIVGAIGTKHFWKARRAIMNQQRVFA  422

Query  1317  VQVFELHRLIKVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKN  1138
             VQVFELH+L+KVQKLIA SP+ L+E    LG  L + S  +L+   E +KA   +    +
Sbjct  423   VQVFELHKLVKVQKLIAASPHVLIESDPCLGNAL-LGSKNKLVE--ENLKAQPLLVATID  479

Query  1137  DSEKPHLRMECSAENT---------VGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSN  985
             D E    + E S ENT          G  S    Q AT   S       P    V++D+ 
Sbjct  480   DVEPSLQQPEVSKENTEDSPPSPHDTGLGSGQRDQAATNGVSKSNRRATP----VASDNK  535

Query  984   MGPWCFH-QPSGHQWLIPVMTPSEGLVYKPYPGP-----GFMSP---GCGPPPVSTPVMG  832
                W    QP  +QWL+PVM+PSEGLVYKPY GP       ++P    C   P+S P   
Sbjct  536   QNNWGVQLQPPQNQWLVPVMSPSEGLVYKPYSGPCPPAGSILAPFYANCT--PLSLPSTA  593

Query  831   NFFAPPAYGLPTSQYHYQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTG  652
               F   AYG+P   +  Q MG P  P +   YFPP+ +PVMN       VEQ     R  
Sbjct  594   GDFMNSAYGVPMP-HQPQHMGAPGPPSMPMNYFPPFSIPVMNPTAPAPVVEQ----GRHP  648

Query  651   SQAQVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPG  472
             S  Q  G   N   Q   SCNM       +  S   R HA +D+E QAS ASSP  R   
Sbjct  649   SMPQPYG---NFEQQSWISCNM-------SHPSGIWRFHASRDSEAQASSASSPFDRF-Q  697

Query  471   VTVSGPMEGRSVLPLFPTSPVVNIVDASQP-PDTG---HPARVIRVVPHNARSASESAAR  304
              + SGP+        FPT+   N    +QP P  G   +   VI+VVPHN+R+ASESAAR
Sbjct  698   CSGSGPVSA------FPTASAQN----NQPQPSYGSRDNQTNVIKVVPHNSRTASESAAR  747

Query  303   IFQSIQKERKQ  271
             IF+SIQ ER++
Sbjct  748   IFRSIQMERQR  758



>dbj|BAL63008.1| Hd17 [Oryza sativa Japonica Group]
 dbj|BAM09630.1| ELF3-like protein [Oryza sativa Japonica Group]
Length=760

 Score =   270 bits (689),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 264/787 (34%), Positives = 362/787 (46%), Gaps = 145/787 (18%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGG-PRAPPRNKMALYEQLSIPSQRFDHGVLP------PNPNNAS  2179
             +MGP+FPRLHVND  KGG PRAPPRNKMALYEQ ++PS RF  G         P  + ++
Sbjct  19    VMGPLFPRLHVNDAAKGGGPRAPPRNKMALYEQFTVPSHRFSGGGGGGGVGGSPAHSTSA  78

Query  2178  NLIPPSPSQGNGHERRMFLPMHLPPST--YSAEKL-------------------------  2080
                  S SQ  G +  +F P ++P +   +S EK+                         
Sbjct  79    ASQSQSQSQVYGRDSSLFQPFNVPSNRPGHSTEKINSDKINKKISGSRKELGMLSSQTKG  138

Query  2079  ---HAHSSDSNTPLTQFES-------RKKTDEDDFRVPVFVNSNISQSIGKFYKNSEREK  1930
                +A  S +  P  + E+       ++  D+D+F VP   NS   Q     Y   E   
Sbjct  139   MDIYASRSTAEAPQRRAENTIKSSSGKRLADDDEFMVPSVFNSRFPQ-----YSTQENAG  193

Query  1929  VSP-----------SSPAFLGRSTKDAKHTRGGNLR--HQESSRQLPATREQSVKASLSS  1789
             V              SP+ + +S+    +T    L   H    +     +++ ++A+ +S
Sbjct  194   VQDQSTPLVAANPHKSPSTVSKSSTKCYNTVSKKLERIHVSDVKSRTPLKDKEMEAAQTS  253

Query  1788  RSTDKKEHCIKHTDTDF--PLHSE-----QRDGPANNSDLSHKSGINLQPESI-------  1651
             ++ + ++    H   D     H++      + G  N+SD  H      Q  S        
Sbjct  254   KNVEVEKSSSFHASKDMFESRHAKVYPKMDKTGIINDSDEPHGGNSGHQATSRNGGSMKF  313

Query  1650  ---------IDSKVGDANDDAVVSGPIKGVEIGDSSVPINCFQTEGQIINVGNDVESQEN  1498
                      I S     N D   + P  G+E            T+ + +   +D E  ++
Sbjct  314   QNPPMRRNEISSNPSSENTDRHYNLPQGGIEETG---------TKRKRLLEQHDAEKSDD  364

Query  1497  QTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFA  1318
                R  +    +  D+ S++S VECI+G +ISPD +VG IG KHFWKARRAI+NQQRVFA
Sbjct  365   -VSRLLEQHDAENIDDVSDSS-VECITGWEISPDKIVGAIGTKHFWKARRAIMNQQRVFA  422

Query  1317  VQVFELHRLIKVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKN  1138
             VQVFELH+L+KVQKLIA SP+ L+E    LG  L + S  +L+   E +KA   +    +
Sbjct  423   VQVFELHKLVKVQKLIAASPHVLIESDPCLGNAL-LGSKNKLVE--ENLKAQPLLVATID  479

Query  1137  DSEKPHLRMECSAENT---------VGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSN  985
             D E    + E S ENT          G  S    Q AT   S       P    V++D+ 
Sbjct  480   DVEPSLQQPEVSKENTEDSPPSPHDTGLGSGQRDQAATNGVSKSNRRATP----VASDNK  535

Query  984   MGPWCFH-QPSGHQWLIPVMTPSEGLVYKPYPGP-----GFMSP---GCGPPPVSTPVMG  832
                W    QP  +QWL+PVM+PSEGLVYKPY GP       ++P    C   P+S P   
Sbjct  536   QNNWGVQLQPPQNQWLVPVMSPSEGLVYKPYSGPCPPAGSILAPFYANCT--PLSLPSTA  593

Query  831   NFFAPPAYGLPTSQYHYQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTG  652
               F   AYG+P   +  Q MG P  P +   YFPP+ +PVMN       VEQ     R  
Sbjct  594   GDFMNSAYGVPMP-HQPQHMGAPGPPSMPMNYFPPFSIPVMNPTAPAPVVEQ----GRHP  648

Query  651   SQAQVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPG  472
             S  Q  G   N   Q   SCNM       +  S   R HA +D+E QAS ASSP  R   
Sbjct  649   SMPQPYG---NFEQQSWISCNM-------SHPSGIWRFHASRDSEAQASSASSPFDRF-Q  697

Query  471   VTVSGPMEGRSVLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQS  292
              + SGP+        FPT    N           +   VI+VVPHN+R+ASESAARIF+S
Sbjct  698   CSGSGPVSA------FPTVSAQNNQPQPSYSSRDNQTNVIKVVPHNSRTASESAARIFRS  751

Query  291   IQKERKQ  271
             IQ ER++
Sbjct  752   IQMERQR  758



>dbj|BAL45488.1| early flowering 3 [Fagopyrum esculentum]
Length=691

 Score =   268 bits (685),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 193/448 (43%), Positives = 247/448 (55%), Gaps = 71/448 (16%)
 Frame = -3

Query  1518  DVESQENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIV  1339
             D E++  Q   S     +DRG++ S T+ V  +S  D+SPD+VV  IG KHFWKARRAIV
Sbjct  277   DCENEGKQKGNSLLRANMDRGNDVSRTTTVVTVSDFDVSPDNVVEAIGLKHFWKARRAIV  336

Query  1338  NQQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGK-PLKVSSAKRLLPPFEY-IKA  1165
             NQQRVF+VQVFELHRLIKVQ+LIAESP  L++ +A++G+  +K S  K+   P EY +KA
Sbjct  337   NQQRVFSVQVFELHRLIKVQQLIAESPEVLIDASAFIGQSSIKASPLKKF--PAEYTMKA  394

Query  1164  PQNVPKHKNDSEKPHLRMECS--AENTVGKASLSSVQNATQAPSCKPSPGNPPLPVVSND  991
               +  K K D +KP+   E    AEN V K +++S       P  + S   P        
Sbjct  395   LADSNKPKGDFQKPNHNDETEDVAENAVAKETVAS-------PPTQRSSHLPFPTNPPGP  447

Query  990   SNMGPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGPGFMS-PGCG--PPPVSTPVMGNFFA  820
                 P    QP GHQWL+PVM+PSEGL+YKPYPGPGF + P CG   P  +TPV  +F  
Sbjct  448   IPTPPMAIPQPGGHQWLVPVMSPSEGLIYKPYPGPGFPAPPVCGGFGPHGTTPVPSHFMN  507

Query  819   PPAYGLPTSQYHYQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQM------NSFTR  658
              P YG+P S Y+      P   P   GYFPPYGM +MNSA+S S+V+Q+      N    
Sbjct  508   -PNYGVPPSHYY------PHPHP---GYFPPYGMSMMNSAMSGSSVDQIKLRSISNPNEE  557

Query  657   TGSQAQVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRA  478
             T    Q      N + Q Q SCN+PSQ++                +EI  S  SSPS RA
Sbjct  558   TAQTTQTVIRMPNFSGQQQGSCNIPSQRH----------------SEILGSTGSSPSERA  601

Query  477   PGVTVSGP-MEGRSVLPLFPTSPVVNIVDASQPPDTGHPARV------------------  355
               +    P    +  L  FP +PV     ASQP  T  P  V                  
Sbjct  602   QDIIRPRPTTTDKDALTFFPAAPVSG---ASQPRKTNQPTTVIKAVPHNARTAGDHQPTT  658

Query  354   -IRVVPHNARSASESAARIFQSIQKERK  274
              I+VVPHNAR+A+ESAARIF+SIQ+ER+
Sbjct  659   LIKVVPHNARTATESAARIFRSIQEERR  686


 Score =   114 bits (284),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 79/124 (64%), Gaps = 16/124 (13%)
 Frame = -3

Query  2334  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSPS  2155
             MGPMFPRLHVNDTE+GGPRAPPRNKMALYEQL+IPS R        NP N         S
Sbjct  11    MGPMFPRLHVNDTERGGPRAPPRNKMALYEQLTIPSNRH-------NPGNTRLNQHSGAS  63

Query  2154  QGNGHERRMFLPMHLPPST-----YSAEKLHAHSSDS---NTPLTQFESRKK-TDEDDFR  2002
             QG+ HER  + P + PP T     +SA++L   +SD     + ++Q E ++K  DEDDF 
Sbjct  64    QGSSHERITYFPSYQPPVTRPLASHSADRLQRQTSDVANLRSSVSQVEQKRKPEDEDDFS  123

Query  2001  VPVF  1990
             VP+F
Sbjct  124   VPIF  127



>gb|EEC70910.1| hypothetical protein OsI_02465 [Oryza sativa Indica Group]
Length=745

 Score =   270 bits (689),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 274/784 (35%), Positives = 365/784 (47%), Gaps = 152/784 (19%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGG-PRAPPRNKMALYEQLSIPSQRFD------------HGVLPP  2197
             +MGP+FPRLHVND  KGG PRAPPRNKMALYEQ ++PS RF              G L  
Sbjct  16    VMGPLFPRLHVNDAAKGGGPRAPPRNKMALYEQFTVPSHRFSGGGGGGGALASARGSLAA  75

Query  2196  NPNNASNLIPPSPSQGNGHERRMFLPMHLPPST--YSAEKLHAHSSDSN-----------  2056
                +A+     S SQ  G +  +F P ++P +   +S EK++++S +             
Sbjct  76    RSTSAA-----SQSQVYGCDMPLFEPFNVPSNGPGHSVEKMNSNSVNRQINGSRKDSGML  130

Query  2055  ------------------TPLTQFES-------RKKTDEDDFRVPVFVNSNISQSIGKFY  1951
                               TP  + E        RK  D+D+F VP   ++   Q   K  
Sbjct  131   STQPKGIDKYGSGSRAECTPQQRVEKGIKSSSGRKLADDDEFIVPSVFSARFPQYSTKER  190

Query  1950  KNSEREK-----VSP-SSPAFLGRSTKDAKHTRGGNLRH-----------QESSRQLPAT  1822
                + E      +SP  SP  + +S     +T   NL             Q+     PA 
Sbjct  191   AGVQEESTPLVALSPHKSPPAVSKSPTKCYNTVSKNLERINVSDVKSRGSQKDKETGPAQ  250

Query  1821  REQSVKAS-LSSRSTDKKEHCIKHTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESIID  1645
               ++V+    SS    K     KH           + G  N+ D  H      Q  S   
Sbjct  251   TLKNVEVEHFSSFEASKDMFGSKHAKVC------PKTGTINDLDEPHLENSEHQATSRNG  304

Query  1644  SKVGDAN----DDAVVSGPIKGVE--IGDSSVPINCFQTEGQIINVGNDVESQENQTCRS  1483
             S V   N     + + + P  G+E   G  ++P    +  G        +E+Q+N     
Sbjct  305   SSVKFQNPPVRRNTISAKPSPGIENTYGHCNLPQGGLKETG---TKRKRLEAQDN-----  356

Query  1482  PQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFE  1303
                +K+D   +SS    VECI+  +ISPD++VG IG KHFWKARRAI+NQQRVFA QVFE
Sbjct  357   --AEKIDDLSDSS----VECITAWEISPDEIVGAIGAKHFWKARRAIINQQRVFAAQVFE  410

Query  1302  LHRLIKVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKNDS---  1132
             LH+L+KVQKLIA SP+ L+E    LG  L ++S K++    E +KA Q V    ND    
Sbjct  411   LHKLVKVQKLIAASPHVLIEGDPCLGNAL-LASKKKMAE--ENLKA-QPVLVATNDDVQP  466

Query  1131  --EKPHLRMECSAENTVGKASLSSVQ-NATQAPSCKPSPGN-PPLPVVSNDSNMGPWCFH  964
               ++P L  E S EN       + V  +  Q      S  N    PV S++         
Sbjct  467   SLQEPELSKENSEENPPSPRDTAPVSGHHDQTAKIGASKSNLRATPVASDNRQNNCGVQL  526

Query  963   QPSGHQWLIPVMTPSEGLVYKPYPGP-----GFMSP---GCGPPPVSTPVMGNFFAPPAY  808
             QP  +QWLIPVM+PSEGLVYKPY GP       ++P    C   P+  P     F   AY
Sbjct  527   QPPQNQWLIPVMSPSEGLVYKPYSGPCPPAGSILAPFYANCT--PLRLPSTAGDFMNSAY  584

Query  807   GLPTSQYHYQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGG  628
             G+P   +  Q MG P  P +   YFPP+ +PVMN     SAVEQ     R  S  Q  G 
Sbjct  585   GVPIP-HQPQHMGAPGTPTMPMNYFPPFSVPVMNPVALASAVEQ----GRNPSMPQPYG-  638

Query  627   GVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPME  448
               N     + SCNM       +  S   R HA +D+E QAS ASSP  R      SGP+ 
Sbjct  639   --NFEQHSRMSCNM-------SHPSGIWRFHASRDSEAQASSASSPFDRL-QCGGSGPVS  688

Query  447   GRSVLPLFPTSPVVNIVDASQP-PDTG---HPARVIRVVPH-NARSASESAARIFQSIQK  283
                    FPT+   N    +QP P +G   +   VIRV+PH N+++ASESAARIF+SIQ 
Sbjct  689   A------FPTASAQN----TQPQPSSGSRDNQTNVIRVIPHNNSQTASESAARIFRSIQM  738

Query  282   ERKQ  271
             ER+Q
Sbjct  739   ERQQ  742



>ref|XP_010654568.1| PREDICTED: protein EARLY FLOWERING 3 isoform X2 [Vitis vinifera]
Length=540

 Score =   264 bits (675),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 205/567 (36%), Positives = 277/567 (49%), Gaps = 99/567 (17%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQ-RFDHGVLPPNPNNASNLIPPS  2161
             +M P+FPRLHVND EKGGPRAPPRNKMALYEQLS+P        +LP  PNN+ +L+P +
Sbjct  10    VMSPLFPRLHVNDAEKGGPRAPPRNKMALYEQLSVPKVPSRSTVILPLLPNNSGSLVPSA  69

Query  2160  PS-QGNGHERRMFLPM-HLPPSTYSAEKLHAHSS---DSNTPLTQFESRKKT--------  2020
             PS QG+GHER +  P  + P S +S E  H HSS   + +  LT  E +  T        
Sbjct  70    PSTQGSGHERNVVTPFCYTPTSAHSDENHHFHSSSGVNMSFELTNLEQKSGTFYHIPNVT  129

Query  2019  ------------------------DEDDFRVPVFVNSNISQSIGKFY---KNSEREKVSP  1921
                                      EDD  VP F  S I   I  +Y   +N  +E+ + 
Sbjct  130   GQLPLQANCSYSQPHSLSKLKNHRGEDDSEVPTFCQSGI---IPDYYNAPQNMNKERATC  186

Query  1920  SS-PAFLGRSTKDAKHTRGGNLRHQESSRQLPA-----TREQSVKASLSSRST---DKKE  1768
                 + +   +   KH R  N+ H   S    A     TR++  + S  +R++   + K 
Sbjct  187   LDLNSSVQLESACGKHQRNLNVSHSRESISATASSGLLTRDEIFEPSKRARTSLTKENKR  246

Query  1767  HCIKHTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESIIDSKVGDANDDAVVSGPIKGV  1588
             + +  T+    +H           D  H+  + L PE          N D  +  P K V
Sbjct  247   NVVVDTNRLEDIH-----------DSLHQGSMTL-PE----------NTD--LPNPSKAV  282

Query  1587  EIGDSSVPINCFQTEGQIINVGNDVESQENQTCRSPQTQKVDRGDNSSETSMVECISGMD  1408
               G  S        +G   + G + E +E +   S Q   +DR  + S  +MV  + G D
Sbjct  283   GGGYVSTSPKPSLLDGHRRSGGLEHELEEQKESESLQMGSIDRNCHVSNANMVGSMLGFD  342

Query  1407  ISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYL  1228
             ISPDDVVGIIG KHFWK R AIVNQQRVFAVQVFELHRLIKVQ+LIA SP   L++  YL
Sbjct  343   ISPDDVVGIIGHKHFWKTRNAIVNQQRVFAVQVFELHRLIKVQRLIAGSPEGQLDNNLYL  402

Query  1227  GKPLKVSSAKRL--------LPPFEYIKAPQNVPKHKNDSEKPHLRMECSAENTVGKASL  1072
              +P   SS K+L        LP     + P  +   KN S+K     E + ++ VG    
Sbjct  403   AEP--ASSTKKLPSESPTKKLPSESVQQLPSQIADPKNGSQKQDSNNEGAVKDAVGNPPF  460

Query  1071  SSVQN-----ATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPVMTPSEGLV  907
             +S  +     A Q  + +P    PP+ + + D+    WCFH   G+QWL+PVM+PSEGL+
Sbjct  461   ASPVDVDKIYAAQQTNQRPLENQPPVSMAT-DTQPTSWCFHPSQGNQWLVPVMSPSEGLI  519

Query  906   YKPYPGPGFMSPGCGPPPVSTPVMGNF  826
             YKPY G       C P P  +    N+
Sbjct  520   YKPYAG------QCSPTPRRSTQGDNY  540



>gb|EAY99610.1| hypothetical protein OsI_21588 [Oryza sativa Indica Group]
 gb|AGW16339.1| Hd-q [Oryza sativa Indica Group]
 gb|AGW16340.1| Hd-q [Oryza sativa Indica Group]
 gb|AGW16341.1| Hd-q [Oryza sativa Indica Group]
Length=760

 Score =   270 bits (689),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 268/788 (34%), Positives = 369/788 (47%), Gaps = 147/788 (19%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGG-PRAPPRNKMALYEQLSIPSQRFDHGVLP------PNPNNAS  2179
             +MGP+FPRLHVND  KGG PRAPPRNKMALYEQ ++PS RF  G         P  + ++
Sbjct  19    VMGPLFPRLHVNDAAKGGGPRAPPRNKMALYEQFTVPSHRFSGGGGGGGVGGSPAHSTSA  78

Query  2178  NLIPPSPSQGNGHERRMFLPMHLPPST--YSAEKL-------------------------  2080
                  S SQ  G +  +F P ++P +   +S EK+                         
Sbjct  79    ASQSQSQSQVYGRDSSLFQPFNVPSNRPGHSTEKINSDKINKKISGSRKELGMLSSQTKG  138

Query  2079  ---HAHSSDSNTPLTQFES-------RKKTDEDDFRVPVFVNSNISQSIGKFYKNSEREK  1930
                +A  S +  P  + E+       ++  D+D+F VP   NS   Q     Y   E   
Sbjct  139   MDIYASRSTAEAPQRRAENTIKSSSGKRLADDDEFMVPSVFNSRFPQ-----YSTQENAG  193

Query  1929  VSP-----------SSPAFLGRSTKDAKHTRGGNLR--HQESSRQLPATREQSVKASLSS  1789
             V              SP+ + +S+    +T    L   H    +     +++ ++A+ +S
Sbjct  194   VQDQSTPLVAANPHKSPSTVSKSSTKCYNTVSKKLERIHVSDVKSRTPLKDKEMEAAQTS  253

Query  1788  RSTDKKEHCIKHTDTDF--PLHSE-----QRDGPANNSDLSHKSGINLQPESIIDSKVGD  1630
             ++ + ++    H   D     H++      + G  N+SD  H      Q  S     +  
Sbjct  254   KNVEVEKSSSFHASKDMFESRHAKVYPKMDKTGIINDSDEPHGGNSGHQATSRNGGSMKF  313

Query  1629  ANDDAVVSGPIKGVEIGDSSVPINCFQ----TEGQIINVG---------NDVESQENQTC  1489
              N       P++  EI  +    N  +     +G I   G         +D E  ++   
Sbjct  314   QNP------PMRRNEISSNPSSENTDRHYNLLQGGIEETGTKRKRLLEQHDAEKSDD-VS  366

Query  1488  RSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQV  1309
             R  +    +  D+ S++S VECI+G +ISPD +VG IG KHFWKARRAI+NQQRVFAVQV
Sbjct  367   RLLEQHDAENIDDVSDSS-VECITGWEISPDKIVGAIGTKHFWKARRAIMNQQRVFAVQV  425

Query  1308  FELHRLIKVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKNDSE  1129
             FELH+L+KVQKLIA SP+ L+E    LG  L + S  +L+   E +KA   +    +D E
Sbjct  426   FELHKLVKVQKLIAASPHVLIEGDPCLGNAL-LGSKNKLVE--ENLKAQPLLVATIDDVE  482

Query  1128  KPHLRMECSAENT---------VGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGP  976
                 + E S ENT          G  S    Q AT   S       P    V++D+    
Sbjct  483   PSLQQPEVSKENTEDSPPSPHDTGLGSGQRDQAATNGVSKSNRRATP----VASDNKQNN  538

Query  975   WCFH-QPSGHQWLIPVMTPSEGLVYKPYPGP-----GFMSP---GCGPPPVSTPVMGNFF  823
             W    QP  +QWL+PVM+PSEGLVYKPY GP       ++P    C   P+S P     F
Sbjct  539   WGVQLQPPQNQWLVPVMSPSEGLVYKPYSGPCPPAGSILAPFYANCT--PLSLPSTAGDF  596

Query  822   APPAYGLPTSQYHYQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQA  643
                AYG+P   +  Q MG P  P +   YFPP+ +PVMN       VEQ     R  S  
Sbjct  597   MNSAYGVPMP-HQPQHMGAPGPPSMPMNYFPPFSIPVMNPTAPAPVVEQ----GRHPSMP  651

Query  642   QVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTV  463
             Q  G   N   Q   SCNM       +  S   R HA +D+E QAS ASSP  R    + 
Sbjct  652   QPYG---NFEQQSWISCNM-------SHPSGIWRFHASRDSEAQASSASSPFDRF-QCSG  700

Query  462   SGPMEGRSVLPLFPTSPVVNIVDASQP-PDTG---HPARVIRVVPHNARSASESAARIFQ  295
             SGP+        FPT+   N    +QP P  G   +   VI+VVPHN+R+ASESAARIF+
Sbjct  701   SGPVSA------FPTASAQN----NQPQPSYGSRDNQTNVIKVVPHNSRTASESAARIFR  750

Query  294   SIQKERKQ  271
             SIQ ER++
Sbjct  751   SIQMERQR  758



>dbj|BAL63009.1| Hd17 [Oryza sativa Indica Group]
Length=760

 Score =   269 bits (688),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 269/791 (34%), Positives = 366/791 (46%), Gaps = 153/791 (19%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGG-PRAPPRNKMALYEQLSIPSQRFDHGVLP------PNPNNAS  2179
             +MGP+FPRLHVND  KGG PRAPPRNKMALYEQ ++PS RF  G         P  + ++
Sbjct  19    VMGPLFPRLHVNDAAKGGGPRAPPRNKMALYEQFTVPSHRFSGGGGGGGVGGSPAHSTSA  78

Query  2178  NLIPPSPSQGNGHERRMFLPMHLPPST--YSAEKLHAHS-----SDSNTPLTQFESRKK-  2023
                  S SQ  G +  +F P ++P +   +S EK+++       S S   L    S+ K 
Sbjct  79    ASQSQSQSQVYGRDSSLFQPFNVPSNRPGHSTEKINSDKINKKISGSRKELGMLSSQTKG  138

Query  2022  -----------------------------TDEDDFRVPVFVNSNISQSIGKFYKNSEREK  1930
                                           D+D+F VP   NS   Q     Y   E   
Sbjct  139   MDIYASRSTAEAPQRIAENTIKSSSGKRLADDDEFMVPSVFNSRFPQ-----YSTQENAG  193

Query  1929  VSP-----------SSPAFLGRSTKDAKHTRGGNLR--HQESSRQLPATREQSVKASLSS  1789
             V              SP+ + +S+    +T    L   H    +     +++ ++A+ +S
Sbjct  194   VQDQSTPLVAANPHKSPSTVSKSSTKCYNTVSKKLERIHVSDVKSRTPLKDKEMEAAQTS  253

Query  1788  RSTDKKEHCIKHTDTDF--PLHSE-----QRDGPANNSDLSHKSGINLQPESI-------  1651
             ++ + ++    H   D     H++      + G  N+SD  H      Q  S        
Sbjct  254   KNVEVEKSSSFHASKDMFESRHAKVYPKMDKTGIINDSDEPHGGNSGHQATSRNGGSMKF  313

Query  1650  ---------IDSKVGDANDDAVVSGPIKGVEIGDSSVPINCFQTEGQIINVGNDVESQEN  1498
                      I S     N D   + P  G+E            T+ + +   +D E  ++
Sbjct  314   QNPPMRRNEISSNPSSENTDRHYNLPQGGIEETG---------TKRKRLLEQHDAEKSDD  364

Query  1497  QTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFA  1318
                R  +    +  D+ S++S VECI+G +ISPD +VG IG KHFWKARRAI+NQQRVFA
Sbjct  365   -VSRLLEQHDAENIDDVSDSS-VECITGWEISPDKIVGAIGTKHFWKARRAIMNQQRVFA  422

Query  1317  VQVFELHRLIKVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKN  1138
             VQVFELH+L+KVQKLIA SP+ L+E    LG  L + S  +L+   E +KA   +    +
Sbjct  423   VQVFELHKLVKVQKLIAASPHVLIEGDPCLGNAL-LGSKNKLVE--ENLKAQPLLVATID  479

Query  1137  DSEKPHLRMECSAENT---------VGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSN  985
             D E    + E S ENT          G  S    Q AT   S       P    V++D+ 
Sbjct  480   DVEPSLQQPEVSKENTEDSPPSPHDTGLGSGQRDQAATNGVSKSNRRATP----VASDNK  535

Query  984   MGPWCFH-QPSGHQWLIPVMTPSEGLVYKPYPGP-----GFMSP---GCGPPPVSTPVMG  832
                W    QP  +QWL+PVM+PSEGLVYKPY GP       ++P    C   P+S P   
Sbjct  536   QNNWGVQLQPPQNQWLVPVMSPSEGLVYKPYSGPCPPAGSILAPFYANCT--PLSLPSTA  593

Query  831   NFFAPPAYGLPTSQYHYQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTG  652
               F   AYG+P   +  Q MG P  P +   YFPP+ +PVMN       VEQ     R  
Sbjct  594   GDFMNSAYGVPMP-HQPQHMGAPGPPSMPMNYFPPFSIPVMNPTAPAPVVEQ----GRHP  648

Query  651   SQAQVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPG  472
             S  Q  G   N   Q   SCNM       +  S   R HA +D+E QAS ASSP  R   
Sbjct  649   SMPQPYG---NFEQQSWISCNM-------SHPSGIWRFHASRDSEAQASSASSPFDRF-Q  697

Query  471   VTVSGPMEGRSVLPLFPTSPVVNIVDASQP-PDTG---HPARVIRVVPHNARSASESAAR  304
              + SGP+        FPT+   N    +QP P  G   +   VI+VVPHN+R+ASESAAR
Sbjct  698   CSGSGPVSA------FPTASAQN----NQPQPSYGSRDNQTNVIKVVPHNSRTASESAAR  747

Query  303   IFQSIQKERKQ  271
             IF+SIQ ER++
Sbjct  748   IFRSIQMERQR  758



>dbj|BAA83571.1| putative early flowering 3 [Oryza sativa Japonica Group]
 gb|EAZ35794.1| hypothetical protein OsJ_20086 [Oryza sativa Japonica Group]
 dbj|BAL63007.1| Hd17 [Oryza sativa Japonica Group]
 gb|AGW16338.1| Hd-q [Oryza sativa Japonica Group]
 gb|AGW16342.1| Hd-q [Oryza sativa Indica Group]
Length=760

 Score =   267 bits (683),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 263/787 (33%), Positives = 361/787 (46%), Gaps = 145/787 (18%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGG-PRAPPRNKMALYEQLSIPSQRFDHGVLP------PNPNNAS  2179
             +MGP+FPRLHVND  KGG PRAPPRNKMALYEQ ++PS RF  G         P  + ++
Sbjct  19    VMGPLFPRLHVNDAAKGGGPRAPPRNKMALYEQFTVPSHRFSGGGGGGGVGGSPAHSTSA  78

Query  2178  NLIPPSPSQGNGHERRMFLPMHLPPST--YSAEKL-------------------------  2080
                  S SQ  G +  +F P ++P +   +S EK+                         
Sbjct  79    ASQSQSQSQVYGRDSSLFQPFNVPSNRPGHSTEKINSDKINKKISGSRKELGMLSSQTKG  138

Query  2079  ---HAHSSDSNTPLTQFES-------RKKTDEDDFRVPVFVNSNISQSIGKFYKNSEREK  1930
                +A  S +  P  + E+       ++  D+D+F VP   NS   Q     Y   E   
Sbjct  139   MDIYASRSTAEAPQRRAENTIKSSSGKRLADDDEFMVPSVFNSRFPQ-----YSTQENAG  193

Query  1929  VSP-----------SSPAFLGRSTKDAKHTRGGNLR--HQESSRQLPATREQSVKASLSS  1789
             V              SP+ + +S+    +T    L   H    +     +++ ++A+ +S
Sbjct  194   VQDQSTPLVAANPHKSPSTVSKSSTKCYNTVSKKLERIHVSDVKSRTPLKDKEMEAAQTS  253

Query  1788  RSTDKKEHCIKHTDTDF--PLHSE-----QRDGPANNSDLSHKSGINLQPESI-------  1651
             ++ + ++    H   D     H++      + G  N+SD  H      Q  S        
Sbjct  254   KNVEVEKSSSFHASKDMFESRHAKVYPKMDKTGIINDSDEPHGGNSGHQATSRNGGSMKF  313

Query  1650  ---------IDSKVGDANDDAVVSGPIKGVEIGDSSVPINCFQTEGQIINVGNDVESQEN  1498
                      I S     N D   + P  G+E            T+ + +   +D E  ++
Sbjct  314   QNPPMRRNEISSNPSSENTDRHYNLPQGGIEETG---------TKRKRLLEQHDAEKSDD  364

Query  1497  QTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFA  1318
                R  +    +  D+ S++S VECI+G +ISPD +VG IG KHFWKARRAI+NQQRVFA
Sbjct  365   -VSRLLEQHDAENIDDVSDSS-VECITGWEISPDKIVGAIGTKHFWKARRAIMNQQRVFA  422

Query  1317  VQVFELHRLIKVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKN  1138
             VQVFELH+L+KVQKLIA SP+ L+E    LG  L + S  +L+   E +KA   +    +
Sbjct  423   VQVFELHKLVKVQKLIAASPHVLIESDPCLGNAL-LGSKNKLVE--ENLKAQPLLVATID  479

Query  1137  DSEKPHLRMECSAENT---------VGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSN  985
             D E    + E S ENT          G  S    Q AT   S       P    V++D+ 
Sbjct  480   DVEPSLQQPEVSKENTEDSPPSPHDTGLGSGQRDQAATNGVSKSNRRATP----VASDNK  535

Query  984   MGPWCFH-QPSGHQWLIPVMTPSEGLVYKPYPGP-----GFMSP---GCGPPPVSTPVMG  832
                W    QP  +QWL+PVM+P EGLVYKPY GP       ++P    C   P+S P   
Sbjct  536   QNNWGVQLQPPQNQWLVPVMSPLEGLVYKPYSGPCPPAGSILAPFYANCT--PLSLPSTA  593

Query  831   NFFAPPAYGLPTSQYHYQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTG  652
               F   AYG+P   +  Q MG P  P +   YFPP+ +PVMN       VEQ     R  
Sbjct  594   GDFMNSAYGVPMP-HQPQHMGAPGPPSMPMNYFPPFSIPVMNPTAPAPVVEQ----GRHP  648

Query  651   SQAQVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPG  472
             S  Q  G   N   Q   SCNM       +  S   R HA +D+E QAS ASSP  R   
Sbjct  649   SMPQPYG---NFEQQSWISCNM-------SHPSGIWRFHASRDSEAQASSASSPFDRF-Q  697

Query  471   VTVSGPMEGRSVLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQS  292
              + SGP+        FPT    N           +   VI+VVPHN+R+ASESAARIF+S
Sbjct  698   CSGSGPVSA------FPTVSAQNNQPQPSYSSRDNQTNVIKVVPHNSRTASESAARIFRS  751

Query  291   IQKERKQ  271
             IQ ER++
Sbjct  752   IQMERQR  758



>gb|KEH39955.1| EARLY flowering protein, putative [Medicago truncatula]
Length=515

 Score =   259 bits (663),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 183/436 (42%), Positives = 239/436 (55%), Gaps = 39/436 (9%)
 Frame = -3

Query  1536  IINVGNDVESQENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWK  1357
             ++   ND E  +       Q    +   + S  S +E +S + +SPD VV I+GQ+ FWK
Sbjct  101   VLEAANDTEYHDANIDSPIQKGNSEGSGDLSNISTIENLSSLKLSPDGVVQILGQQLFWK  160

Query  1356  ARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGK-PLKVSSAKRLLPPF  1180
             ARR I NQQR FAVQVFELHRLIKVQ LIA S N +L+  A L K PL+ S  K L    
Sbjct  161   ARRKITNQQRAFAVQVFELHRLIKVQHLIAGSSNLMLDAAAILEKFPLQESIPKSL--SL  218

Query  1179  EYIKAPQNVP-KHKNDSEKPHLRMECSAENTVGKASLSSVQNATQAPSCKPSPGNPPLPV  1003
             E +   Q    K ++ SE  + R++CSAE  V K S S  +  +   +  P  GN     
Sbjct  219   EVVVESQTKNHKQQDHSESLNHRLDCSAEKGVEKTSCSYQKYGSHLSNYTPFSGN-----  273

Query  1002  VSNDSNMGPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGPGFMSP--------GCGPPPVS  847
              S+ +N+G   F+Q  GHQWLIPVM+PSEGLVYKPYPGPG+           G GPP V+
Sbjct  274   -SDQANVGSQYFNQSPGHQWLIPVMSPSEGLVYKPYPGPGYTGAVYGGYRPFGQGPPDVT  332

Query  846   TPVMGNFFAPPAYGLPTSQYHYQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNS  667
                    F  PAYG+P   +H      PF PP G+ YFPP+G+P M  + S SAVEQ+N 
Sbjct  333   -------FMNPAYGVP--DFHQAIAVPPFIPPGGYPYFPPHGVPAMYQSASVSAVEQVNQ  383

Query  666   FTRTGSQAQVSGGGV---NLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDN-EIQASCA  499
             F+  GS+ Q     +   N    +Q+SCN+ +QKNG         LH  K     +    
Sbjct  384   FSAHGSRNQNGTSSLEEANFYTHNQSSCNLTNQKNGAT-------LHVRKPQPSRERELE  436

Query  498   SSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSAS  319
             SSP  +A  +      E R  L    T P+V+  +  +  +T    +VIRVVPHN RSA+
Sbjct  437   SSPGEKAQEIIKEKSAEERDTLSSSFTVPIVS-KEVLKSLETRQKPQVIRVVPHNPRSAT  495

Query  318   ESAARIFQSIQKERKQ  271
              SAARIFQSIQ+ERK+
Sbjct  496   VSAARIFQSIQEERKR  511



>ref|XP_004141800.1| PREDICTED: uncharacterized protein LOC101208149 [Cucumis sativus]
 ref|XP_004155977.1| PREDICTED: uncharacterized LOC101208149 [Cucumis sativus]
 gb|KGN45548.1| hypothetical protein Csa_7G452030 [Cucumis sativus]
Length=694

 Score =   264 bits (674),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 176/417 (42%), Positives = 226/417 (54%), Gaps = 50/417 (12%)
 Frame = -3

Query  1437  SMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAESP  1258
             S+V+  S  +ISPD VV +IG+K FWKAR+AIV+QQR+FAVQVFELHRLI+VQKLIA SP
Sbjct  299   SLVDSTSAPNISPDVVVELIGEKQFWKARKAIVHQQRIFAVQVFELHRLIEVQKLIAGSP  358

Query  1257  NFLLEDTAYLGKPLKVSSA-KRLLPPFEYIKAPQNVPKHKNDSEKPHLRMECSAENTVGK  1081
             + LLED  YL  P    SA K  L       AP +  K  +      L  +C+ +N + K
Sbjct  359   HILLED--YLDNPPSTFSAVKNKLTECAQQLAPSSTVKENHQQANLVLNRKCADKNLLAK  416

Query  1080  ASLSSVQNATQAPSCKPSPGN--------PPLPVVSNDSNMGPWCFHQPS-GHQWLIPVM  928
                 S               N        P  P  +   +  PWC +QP+ G+QWL+PVM
Sbjct  417   LPFPSFNKDNSKLVLAQQTSNELRVKDVQPQTPTAAAPKS-NPWCLNQPTPGNQWLVPVM  475

Query  927   TPSEGLVYKPYPGPGFMSPGCGPPP-VSTPVMGNF-------------FAPPAYGLPTSQ  790
             +PSEGLVYKPY GP      C P     TP+ GNF             F PPAY +P S 
Sbjct  476   SPSEGLVYKPYSGP------CPPSAQFMTPMYGNFGTMSLNTGSGARDFYPPAYAVPAS-  528

Query  789   YHYQGMGD-PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQA---QVSGGGV  622
              H+QG G  P + P+   YF PYG+PV N ++S S  +Q++  ++  S+    Q+S G V
Sbjct  529   -HHQGFGYFPGSIPLNQPYFSPYGIPVTNKSMSGSVPDQVSLSSKVKSKEQENQISTGDV  587

Query  621   NLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGR  442
             N     +NSC MPSQ +      +  + H  K +E+  S ASSPS R  G          
Sbjct  588   NCLTHQENSCEMPSQTSHSMPF-NVEKFHGSKGSELLGSTASSPSERGNG----------  636

Query  441   SVLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
              VLPLFPT P      +  P    + +R IRVVPH+ RSA+ESAARIFQ IQ+ER Q
Sbjct  637   DVLPLFPTEPPAVEESSPNPEMNENKSRAIRVVPHHPRSATESAARIFQLIQEERNQ  693


 Score = 94.0 bits (232),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 62/93 (67%), Gaps = 2/93 (2%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPN-NASNLIPPS  2161
             ++ PMFPRLHVNDTEKGGPRAPPRNKMALYEQL+IP+QRF  G     P  + +   P S
Sbjct  10    LLSPMFPRLHVNDTEKGGPRAPPRNKMALYEQLTIPTQRFTSGSASATPLPSGTPATPTS  69

Query  2160  PSQGNGHERRMF-LPMHLPPSTYSAEKLHAHSS  2065
             PS   G +R +F         ++ AEKLH++ S
Sbjct  70    PSHFAGQKRGIFSSSSKCSVQSHQAEKLHSYGS  102



>ref|XP_002440379.1| hypothetical protein SORBIDRAFT_09g030700 [Sorghum bicolor]
 gb|EES18809.1| hypothetical protein SORBIDRAFT_09g030700 [Sorghum bicolor]
Length=745

 Score =   263 bits (673),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 195/421 (46%), Positives = 241/421 (57%), Gaps = 48/421 (11%)
 Frame = -3

Query  1467  VDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLI  1288
             V++ D+ S++S VE ++GM+ISPDDVVG IG KHFWKARRAIVNQQRVFAVQVFELHRLI
Sbjct  348   VEQNDDLSDSS-VEFLAGMEISPDDVVGAIGPKHFWKARRAIVNQQRVFAVQVFELHRLI  406

Query  1287  KVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKP--HLR  1114
             KVQKLIA SP+ L+E    LGK L  S  K      + +++ +N     ND  +P    +
Sbjct  407   KVQKLIAASPHLLIEGDPCLGKSLAASKKKLAGDVEKQLQSAKN-----NDEVQPTQQQQ  461

Query  1113  MECSAENTVG------KASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSG  952
             +E S ENT        +   + VQ+  QA        NPP     +D+    WC   P  
Sbjct  462   LEHSKENTEANQPSPSQDDAAGVQHNNQAAINGAVSSNPPSMPTPSDNKQNSWCIPPPPS  521

Query  951   HQWLIPVMTPSEGLVYKPY-----PGPGFMSP----GCGPPPVSTPVMGNFFAPPAYGLP  799
              QWL+PVM+PSEGLVYKPY     P   FM+P     CG  PVS P     F   AYG+ 
Sbjct  522   -QWLVPVMSPSEGLVYKPYSGHCPPAGSFMAPPFFASCG--PVSLPSTAGDFMNSAYGVA  578

Query  798   TSQYHYQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVN  619
                +  Q MG P  PP+   YFPP+ MPVMN AVS SAVEQ++    +     +      
Sbjct  579   MP-HQPQHMGVPGPPPMPPMYFPPFSMPVMNPAVSASAVEQVSHVAASQRNGHIE-----  632

Query  618   LNVQH-QNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGR  442
                QH +NSCN  S    +A  +   R+HA +D+E+Q S ASSP  R  G       EGR
Sbjct  633   ---QHTRNSCNA-SHLRSEAVSAGVWRVHASRDSELQGSSASSPFDRQQG-------EGR  681

Query  441   SVLPLFPTSPVVNIVDASQPPDTG----HPARVIRVVPHNARSASESAARIFQSIQKERK  274
                P FP S V N    +Q   +     +P+RVIRVVPH AR+ASESAARIFQSIQ ERK
Sbjct  682   GPAPPFPASSVGNRQAQAQAQASSGSRENPSRVIRVVPHTARTASESAARIFQSIQMERK  741

Query  273   Q  271
             Q
Sbjct  742   Q  742


 Score = 80.1 bits (196),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF  2218
             +MGP+FPRLHVNDT KGGPRAPPRNKMALYEQ S+PS R+
Sbjct  15    VMGPLFPRLHVNDTLKGGPRAPPRNKMALYEQFSVPSHRY  54



>ref|XP_004298565.1| PREDICTED: uncharacterized protein LOC101299956 [Fragaria vesca 
subsp. vesca]
Length=746

 Score =   259 bits (662),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 256/784 (33%), Positives = 355/784 (45%), Gaps = 148/784 (19%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  2158
             +M P+F RLHVN+TEKGG R PPR  MALY+Q S P       +LPP  NN+S+L+  + 
Sbjct  15    VMSPIFSRLHVNETEKGGLRGPPR-IMALYDQFSSPVCSIT--MLPPANNNSSSLVSSTS  71

Query  2157  SQGNGHERRMFLPMHLPPSTYS------AEKLHAHSSDS---NTPLTQFE----------  2035
                 G  +R  L     P  YS      +EK+ + SS      T +T +E          
Sbjct  72    WSDVGANQRSILT----PYCYSVVPSHPSEKIQSDSSTGPKLYTTMTDYERVSSKLNSQG  127

Query  2034  ------SRKKTDEDDFRVPVFVNSNISQSIGKFYKNSEREKVSPSSPAFLGRSTKDAKHT  1873
                   S    + D FR      SN+     K + N E E  SP S        +D+  +
Sbjct  128   FVSTGPSSSSANCDSFRSHTI--SNLRNFRSKKFGN-EDEFQSPISSQVTTLHCRDSLRS  184

Query  1872  RGGNLRHQES----------------------SRQ-LPATREQSVKA-------------  1801
             +G +  HQ S                      SRQ L    E+S KA             
Sbjct  185   KGKDNLHQSSYTLQLKGDYIEKMNGSSTVQLNSRQYLGNHNEESPKACQIIEDPVEKSIS  244

Query  1800  ----------SLSSRSTDKKEHCIKHTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESI  1651
                       ++SS  + + EH          +  E R     + +  H    +   E +
Sbjct  245   LTLARVREFENISSTPSQRVEHFESLKRKHESVSQESRSRSVTDFNKLHCPNAHFNTEHL  304

Query  1650  IDSKVGDANDDAVVSGPIKGVEIGDSSVP----INCFQTEGQIIN-VGNDVE-SQENQTC  1489
             +        DD+V+   I   E+    V      +  + E +  N + N  E SQEN   
Sbjct  305   LVHDREAIKDDSVMISRIAVAEVSSKRVKESYTRSFLEDETKFPNGIENSSETSQENCEV  364

Query  1488  RSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQV  1309
                 +    RGD  S+ +M E  + +DISPDDV+G+IG   F K R+AIVNQQRVFA+QV
Sbjct  365   VHVGSLNCRRGD-VSDMTMGESSTSLDISPDDVIGVIGDNQFCKTRKAIVNQQRVFAMQV  423

Query  1308  FELHRLIKVQKLIAESPNFLLEDTAYLGKP-LKVSSAKRLLPPFEYIKAPQ-NVPKHKND  1135
             FELHRLIKVQKLIA SP+   +    +  P +++S    +  P E  + P  ++ K K+ 
Sbjct  424   FELHRLIKVQKLIAGSPDLFFKGKPLIKNPAVEISVLNNV--PIERAQEPTPSIVKPKDY  481

Query  1134  SEKPHLRMECSAENTVGKASLSSVQNATQAP------------SCKPSPGNPPLPVVSND  991
              +KP+   EC  E+TVGK  L  V N   +             S K SP +      +  
Sbjct  482   PQKPYSNTECGEESTVGKFPLPFVYNDASSRGLVIQKSNNGQYSRKTSPASE-----ATY  536

Query  990   SNMGPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGPGFMSPGCGPPPVSTPVMGNF-FAPP  814
             S    WCF  P G+ WL+PVM+PSEGL Y+PY GP   + G  PP   +   GN  ++  
Sbjct  537   SKPASWCFQPPPGNMWLVPVMSPSEGLTYRPYRGPCPPTGGFMPPIYGSLDPGNKNYSNA  596

Query  813   AYGLPTSQYHYQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVS  634
             AYG+P +  + QGMG    PP+   YFP Y  PV+N                +  +  +S
Sbjct  597   AYGIPLT--YQQGMGIG-TPPLLQTYFPTYTPPVIN---------------HSSHENPLS  638

Query  633   GGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGP  454
              G  N  + HQ SCNM +Q          + + A   NE+Q S  +SPS +  G      
Sbjct  639   FGETNFTLPHQRSCNMSNQMREVMSYYMGN-IPAPIVNELQGSTPNSPSDKTKG------  691

Query  453   MEGRSVLPLFPTSP----VVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQ  286
                 +VLPLFPT+P       I   S+     H +R I+V+PH+ RSA+ESAARIF SIQ
Sbjct  692   ----NVLPLFPTAPQGEEFAEIEQMSE-----HQSRAIKVIPHSFRSATESAARIFLSIQ  742

Query  285   KERK  274
             +ERK
Sbjct  743   EERK  746



>ref|XP_002458017.1| hypothetical protein SORBIDRAFT_03g025560 [Sorghum bicolor]
 gb|EES03137.1| hypothetical protein SORBIDRAFT_03g025560 [Sorghum bicolor]
Length=782

 Score =   259 bits (663),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 262/807 (32%), Positives = 359/807 (44%), Gaps = 162/807 (20%)
 Frame = -3

Query  2328  PMFPRLHVNDTEKGG-PRAPPRNKMALYEQLSIPSQRFD--HGVLPPNPNNASNLIP-PS  2161
             P+FPRLHV+D  KGG PRAPPRNKMALYEQL++PS RF              ++L+P  S
Sbjct  14    PLFPRLHVSDAGKGGGPRAPPRNKMALYEQLTVPSNRFSSPAPAPARAAGAKASLVPSTS  73

Query  2160  PSQGNGHERRMFLPMHLPPS--TYSAEKLHAHSSDSNTPLTQFES---------------  2032
              +Q  G++R +F P ++P +    S+EK   +  +  +  T+ ES               
Sbjct  74    AAQVYGYDRTLFQPFNVPSNEPARSSEKFKGNCINGQSNSTRRESLRMSSQTKSKDVCAS  133

Query  2031  --------------------RKKTDEDDFRVPVFVNSNISQSIGKFYKNSEREKVSPSSP  1912
                                 +K  ++D+F VP   +  I       Y+ S +E    S P
Sbjct  134   KSIAGCTSQHRGGNTIKSSGKKVVNDDEFMVPSICSPRI-------YRYSTQEHADKSKP  186

Query  1911  AFLGRSTKDAKHTRGGNLRHQESSRQLPATREQSVKASLSSRSTDK------KEHCIKHT  1750
                    K    ++     +   ++ L    E  ++   S +  +K      K   +K  
Sbjct  187   QSTTNPHKSPSMSKSSAKCYSTVNKHLDRMNEADMRLMNSPKVKEKEAVQVPKGVEVKEK  246

Query  1749  DTDFPLHSEQRDGPANNSDLSHK-SGIN------LQPESIIDSKVGDANDDAVVSGPIKG  1591
             D+      + +D  A    + +K S IN       QP S+ + K  +A +      P   
Sbjct  247   DSSIQASEKFKDKYAKLCQMRNKVSNINRSDNNSCQPTSV-NGKSTEAKNPTATRNP---  302

Query  1590  VEIGDSSVPINCFQTEGQIINVGNDVES--QENQTCRSPQTQKVDRGDNSSETSMVECIS  1417
                  S  P  C   +    N  N +E   +E    R  Q    ++ D+ S+ S VECI 
Sbjct  303   ----SSCKP--CTDVDSSNWN-SNLLERSPREGGAKRKRQHHSGEQNDDLSDDS-VECIP  354

Query  1416  GMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNFLLEDT  1237
             G ++SPD++ G IG KHFWKARRAI NQQRVFAVQVFELH+LIKVQKLIA SP+ L+E  
Sbjct  355   GWELSPDEIAGAIGPKHFWKARRAIQNQQRVFAVQVFELHKLIKVQKLIAASPHLLIEGD  414

Query  1236  AYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPHLRM-ECSAENTVGKASLSSVQ  1060
               LG  L     KR   P   +K  Q +     D  +P L   E S +NT G  S  S  
Sbjct  415   PVLGNALM---GKRNKLPKGNLKV-QTLSITNKDDIQPTLEQPELSKQNTEGNPSHHSRD  470

Query  1059  NAT------QAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPVMTPSEGLVYKP  898
             +        QA + +    NPP   V+ D+    WC + P  +QWL+PVM+PSEGLVYKP
Sbjct  471   DGLDDNHHDQAAANETFTSNPPAIPVAPDNKQNNWCMNPPQ-NQWLVPVMSPSEGLVYKP  529

Query  897   YPGPGFMSPGCGPPPVS---TPVMGNF----FAPPAYGLPTSQYHYQGMGDPFAPPIGHG  739
             Y GP      C  PPV    TP   N          YG+P   +  Q M  P AP +   
Sbjct  530   YAGP------C--PPVGNLLTPFYANCTPLRLPSTPYGVPMP-HQPQQMVPPGAPAMHMN  580

Query  738   YFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNMP--------  583
             YFPP+ MPVMN     SAVEQ       GS A       ++  Q   SCNM         
Sbjct  581   YFPPFSMPVMNPGTPASAVEQ-------GSHAAAPQPQGHMEQQSLISCNMSHPSGIWRF  633

Query  582   -SQKNGDADVSDA----HRLHACKD----------------------------NEI----  514
              + ++ +   S A     RL A  D                            N +    
Sbjct  634   LASRDSEPQASSASSPFDRLEAQGDGSGPVSFFPKASVLNAQPQPSSGGRDQQNHVIRVV  693

Query  513   --QASCASSPSVRAPGVTVSGPMEGRSVLPLFP-TSPVVNIVDASQPPDTG---HPARVI  352
                A  AS P+ + P  +  G  +   V+ + P  +   ++ +A   P +G       VI
Sbjct  694   PRNAQTASVPNAQ-PQPSSGGRDQQNHVIRVVPRNAQTASVANAQTQPSSGGQDQWNHVI  752

Query  351   RVVPHNARSASESAARIFQSIQKERKQ  271
             RVVPHNA++ASESAARIF+SIQ ERKQ
Sbjct  753   RVVPHNAQTASESAARIFRSIQMERKQ  779



>ref|XP_011080316.1| PREDICTED: protein EARLY FLOWERING 3-like [Sesamum indicum]
 ref|XP_011080323.1| PREDICTED: protein EARLY FLOWERING 3-like [Sesamum indicum]
 ref|XP_011080331.1| PREDICTED: protein EARLY FLOWERING 3-like [Sesamum indicum]
 ref|XP_011080336.1| PREDICTED: protein EARLY FLOWERING 3-like [Sesamum indicum]
 ref|XP_011080344.1| PREDICTED: protein EARLY FLOWERING 3-like [Sesamum indicum]
Length=756

 Score =   259 bits (661),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 182/480 (38%), Positives = 260/480 (54%), Gaps = 59/480 (12%)
 Frame = -3

Query  1662  PESIIDSKVGDANDDAVVSGPIKGVEIGDSSVPINCFQTEGQIINVGNDVESQENQTCRS  1483
             PE+    +     DD+  S P     +GD + P     T+ ++IN     E  E++ C +
Sbjct  318   PETATRKRCASVMDDSSHSSP----RLGDCNEP-----TKIELIN-----EFSEDKDCLA  363

Query  1482  PQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFE  1303
              Q    D+  N+SETSM + + G+D++P+DV  +IGQ+ FWKAR+ IV+QQR+F++Q+FE
Sbjct  364   SQVGNADKKQNTSETSMEDSVPGLDLTPEDVASVIGQRLFWKARKTIVHQQRIFSLQIFE  423

Query  1302  LHRLIKVQKLIAESPNFLLEDTAYLGK-PLKVSSAKRLL--PPFEYIKAPQNVPKHKNDS  1132
             LHRLIKVQ++IA SP  L E+  +  K  ++     +LL   P + + A   V K K D+
Sbjct  424   LHRLIKVQRVIAGSPETLHENNFHPNKSSIQFPPINKLLYVTPLDPLPA---VAKPKADA  480

Query  1131  EKPHLRMECSAENTVGK----ASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFH  964
              K +L  +C AE   G      S++ +    Q    KP P   P+P    D+ + PW F 
Sbjct  481   LKSNLGKDCGAEAVSGMLPLPTSIAEIGRLPQQLIPKPLPTPAPIPT---DAKLAPWSFQ  537

Query  963   QPSGHQWLIPVMTPSEGLVYKPYPGP-----GFMSPGCG-PPPVSTPVMGNFFAPPAYGL  802
              P G+QWL+PV +PSEGL+YKPY GP     GFM+P  G   P+S  +MG       YG+
Sbjct  538   PPPGNQWLVPVKSPSEGLIYKPYTGPCFPPVGFMAPVYGNCTPISLSMMGGT----TYGV  593

Query  801   PTSQYHYQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTG---SQAQVSG  631
             P    + QG+G  +   +G  YF PY MP++N++ S   VEQM S  R          S 
Sbjct  594   PAP--NEQGIGHFYGTSLGQSYFQPYPMPLINASGSNPEVEQMISSARVQLAEPDKDSST  651

Query  630   GGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPM  451
                N  V  Q+ C   SQ++        + LH  K ++ Q S A+SP+ R         +
Sbjct  652   SNANFVVPCQSPCKASSQQSAVVSGCGGN-LHLHKGSDGQCSSATSPAER---------L  701

Query  450   EGRSVLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
             EG + L LFPT+P      +SQ        +VI+VVPHN +SA ESAARIFQSIQ+ERK+
Sbjct  702   EGEA-LSLFPTTP------SSQALRDQSKVKVIKVVPHNRKSAPESAARIFQSIQEERKK  754


 Score = 59.7 bits (143),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 40/64 (63%), Gaps = 10/64 (16%)
 Frame = -3

Query  2334  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSI--PSQRFDHGVLPPNPNNASNLIPPS  2161
             M P+FPRLH+ND +KGGPR PPRNKMAL EQ ++   S +   G +P        ++P  
Sbjct  11    MDPLFPRLHINDADKGGPRPPPRNKMALCEQYNVHPQSSKLRSGPIP--------MLPLP  62

Query  2160  PSQG  2149
             PS G
Sbjct  63    PSNG  66



>ref|XP_006583036.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X4 [Glycine 
max]
Length=679

 Score =   254 bits (648),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 250/727 (34%), Positives = 351/727 (48%), Gaps = 102/727 (14%)
 Frame = -3

Query  2334  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSPS  2155
             + PMFPRLHV D E+GGP+APPRNKMALYEQ S+PSQ F  G     P    N   P+ S
Sbjct  15    ISPMFPRLHVKDAERGGPKAPPRNKMALYEQFSLPSQNFAPGSASLFPLPLRNYTGPTSS  74

Query  2154  QGNGHERRMFLPMHLPPSTYSAEKLHAHSSDSNTPLTQFESRKKTDEDDFRVPVFVNSNI  1975
                   + +       PS   AEK   ++S   T LT+F       +DD     F+NS  
Sbjct  75    SHISSNQSIQFCTSSMPSIL-AEKSQTYNS-RKTNLTKFM------QDD-----FINS--  119

Query  1974  SQSIGKFYKNSEREKVSPSSPAFLGRSTKDAKHTRGGNLRHQESSRQLPATREQSVKASL  1795
                     KNS R         F+   +   K++    +++ +   +L      ++  SL
Sbjct  120   --------KNSLR--TLDGEDTFITCGSAHRKNSSCSIIQNFKDEDKL---SHSNLSGSL  166

Query  1794  SSRSTDKKEHCIKHTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESIIDSKV---GDAN  1624
              S ++ +K +     D    L S Q  G     D +  S    +PE ++   +   GD  
Sbjct  167   KSPNSFRKVNSPGAVD----LKSAQY-GKNRMEDHTEVSQNGQKPEEVLPHSLDGFGDMT  221

Query  1623  DDAVVSGPIKGVEIGDSSVPINCFQTEGQIIN------VGNDVE--SQENQTCRSPQTQK  1468
             D +++S  +KG  +  +   +  F+ +    +        NDV   + E +  R     K
Sbjct  222   DASLIS-LVKGSSV-RTHEELAVFEDQVNSRDHHIEKPTANDVHKCAGELEIGRRCFLDK  279

Query  1467  VDRGDNSSETSMVECIS--------GMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQ  1312
             VD  ++       + +S         MDISPD+VVG IG++ FWK RR I+NQQ++F  Q
Sbjct  280   VDMNEDEETYRHSDAVSKVNSECTLAMDISPDNVVGAIGEQQFWKVRRTIINQQKIFVKQ  339

Query  1311  VFELHRLIKVQKLIAESPNFLLEDTAYLGK-PLKVSSAKRLLPPFEYIKAPQNVPKHKND  1135
             VFELHRLIKVQ+LIA SP+ LLED   L K P K S++K+    F   K P +V K  N 
Sbjct  340   VFELHRLIKVQRLIAGSPHVLLEDNLLLNKPPPKTSTSKKFQSDFASQK-PSSVVKLDNK  398

Query  1134  SEKPHLRMECSAENTVGKASLSSVQNAT-----QAPSCKPSPGNPPLPVVSNDSNMGPWC  970
             S K +   E +  + VGK  +  + N T     Q P+     GNP L    ++S   P  
Sbjct  399   SVKVNT-AEKATNSAVGKIPIPCISNTTKGHANQLPNYGHHLGNPALASADSNSKQSPSY  457

Query  969   FHQPSGHQWLIPVMTPSEGLVYKPY-----PGPGFMSP---GCGPPPVSTPVMGNFFAPP  814
              + P G+QWL+PVM+PSEGLVYKP      P  GFM+P    CG   VS   +    +  
Sbjct  458   VYPPPGNQWLVPVMSPSEGLVYKPIIWPCPPNAGFMAPIYGSCG--TVSFNPLSKDASSD  515

Query  813   AYGLPTSQYHYQGMGDPFAPPIGHGYFPPYGMP--VMN--SAVSTSAVEQMNSFTRTGSQ  646
             A   P+S   +Q +G      I  G   P  +P   MN  S++S SAVEQM      G +
Sbjct  516   AALAPSS---HQKLG------ILSGSSLPQFLPPSFMNHPSSISASAVEQMGQ--SNGPE  564

Query  645   AQVSGGGVNLNVQHQNSCNMPSQKNGDA--DVSDAHRLHACKDNEIQASCASSPSVRAPG  472
                S G VN  +  Q+S NM S  +     ++S  H  H+ +D E+  S ASSPS R  G
Sbjct  565   NHHSWGEVNSAILFQSSSNMSSPTSQVMPRNISTYH--HSLQDKELHRSTASSPSKRVSG  622

Query  471   VTVSGPMEGRSVLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQS  292
                         LPLFP +P     + +       P RVI+ +PHN ++ASE+AA+IF+S
Sbjct  623   ----------EALPLFPLAPTCWQSEDTNTQVEQQP-RVIKAMPHNPKTASETAAKIFRS  671

Query  291   IQKERKQ  271
             IQ+ERK 
Sbjct  672   IQEERKH  678



>ref|XP_006585544.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Glycine 
max]
 ref|XP_006585545.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Glycine 
max]
 ref|XP_006585546.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X3 [Glycine 
max]
Length=707

 Score =   253 bits (647),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 258/761 (34%), Positives = 357/761 (47%), Gaps = 144/761 (19%)
 Frame = -3

Query  2334  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSPS  2155
             + PMFPRLHV D EK GP+APPRNKMALYEQ SIPSQ F  G     P    N   P+ S
Sbjct  15    ISPMFPRLHVKDAEKRGPKAPPRNKMALYEQFSIPSQNFAPGSTSLFPLPLRNYTGPTSS  74

Query  2154  QGNGHERRMFLPMHLPPSTYSAEKLHAHSSDSNTPLTQFESRKKTDEDDFRVPVFVNSNI  1975
                   + +       PS   AEK  A++S   T LT+F       +DD     F+NS  
Sbjct  75    SHISSNQSIQFCTSSMPSIL-AEKSQAYNS-RKTNLTKF------TQDD-----FINS--  119

Query  1974  SQSIGKFYKNSEREKVSPSSPAFLGRSTKDAKHTRGGNLRHQESSRQLPATREQSVKASL  1795
                     KNS   K      AF+   +   K++    +++ +   +L  +       +L
Sbjct  120   --------KNSL--KALDGEDAFISSGSAHRKNSYCSIIQNNKDEGKLSCS-------NL  162

Query  1794  SSRSTDKKEHCIKHTDT--DFPLHSEQRDGPANNSDLSHK--SGINLQPESIIDSKV---  1636
             S   + K+ + I+  ++     L SEQ +    N    H   S I  +PE ++   +   
Sbjct  163   SC--SHKRLNSIRKVNSPGAVDLMSEQYE---KNQIEEHTEVSQIGQKPEEVLPHSLDGF  217

Query  1635  GDANDDAVVSGPIKGVEIGDSSVPIN----CFQTEGQIINV-------GNDVESQENQTC  1489
             GD  D +++S     +E G +S  +N      + E + I+V       G+ V +QE    
Sbjct  218   GDMTDASLIS-----LEKGKNSKSMNKEHRSLKEENRSISVDSLKTLQGSSVRTQEELAA  272

Query  1488  RSPQTQ------------------------------KVDRGDNSSETSMV--------EC  1423
                Q +                              KV+R ++    S          EC
Sbjct  273   FRDQIKSRDHHIEKPAASELHKCSGELEIGRRCFLDKVNRNEDEETYSHYDAVNKYNSEC  332

Query  1422  ISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNFLLE  1243
              S MDISPD+VVG IG++ FWK RR I+NQQ++F  QV ELHRLIKVQ+LIA SP+ LLE
Sbjct  333   TSVMDISPDNVVGAIGEQQFWKVRRTIINQQKIFVKQVSELHRLIKVQRLIAGSPHILLE  392

Query  1242  DTAYLGK-PLKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPHLRMECSAENTVGKASLSS  1066
             D     K P K S+ ++    F   K P +V K  N S K +   E +  + VGK  +  
Sbjct  393   DNLLHNKPPQKTSTTQKFQSDFAG-KKPSSVVKLDNKSVKVNTD-EKATNSAVGKIPIPC  450

Query  1065  VQN-----ATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPVMTPSEGLVYK  901
             + N     A Q P+     GN  L    ++S   P   + P G+QWL+PVM+PSEGLVYK
Sbjct  451   ISNITKGHANQLPNYGHHLGNLALGSADSNSKQPPSYVYPPPGNQWLVPVMSPSEGLVYK  510

Query  900   PYPGP-----GFMSP---GCGPPPVSTPVMGNFFAPPAYGLPTSQYHYQGMGDPFAPPIG  745
             P  GP     GFM+P    CG   +S   +    +  A   P+S   +Q +G      + 
Sbjct  511   PIIGPCPPNAGFMAPIYGSCG--TMSFNPLSKDASSDATLAPSS---HQKLGIISGSSLS  565

Query  744   HGYFPPYGMPVMN--SAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNMPSQKN  571
                 P +    MN  S++S SA+EQM      G +   S G VN  + HQ+S NM S  +
Sbjct  566   Q--LPSF----MNHPSSLSASAIEQMGQ--SNGPENHHSCGEVNSAILHQSSSNMSSPTS  617

Query  570   G--DADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIV  397
                  ++S  H  H+ KD E+Q S ASSPS R  G            LPLFP +P     
Sbjct  618   QMMSRNISTYH--HSLKDKELQRSTASSPSKRMSG----------EALPLFPLAPTF-WQ  664

Query  396   DASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERK  274
                +     H  RVI+ +PHN ++ASESAARIF+SIQ+ERK
Sbjct  665   SEDRNTQVEHRPRVIKAMPHNPKTASESAARIFRSIQEERK  705



>ref|XP_009407571.1| PREDICTED: protein EARLY FLOWERING 3-like [Musa acuminata subsp. 
malaccensis]
Length=685

 Score =   252 bits (643),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 174/416 (42%), Positives = 237/416 (57%), Gaps = 37/416 (9%)
 Frame = -3

Query  1467  VDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLI  1288
             ++R D++SE  +V  +SG+ ISPDD+VG+IG KHFWKARRAI+NQQ+ FA+QVFELHR+I
Sbjct  287   LERKDDASEPLIVGTVSGLVISPDDIVGVIGSKHFWKARRAIINQQKDFAIQVFELHRVI  346

Query  1287  KVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPHLRME  1108
             KVQKLI+ SP+ LLE   YL K   V    + LP       P+   + K+  + P    E
Sbjct  347   KVQKLISASPHLLLEGNPYLSK-CSVKPPNKTLPRCNTNPRPEEF-RPKDGLQNPKKNKE  404

Query  1107  CSAENTVGKASLSSVQNAT------QAPSCKPSPGNP-PLPVVSNDSNMGPWCFHQPSGH  949
               A+N  G ++L + ++ +      Q P    + G P P+P+  +D +    CF  P G+
Sbjct  405   QPADNIAGVSALPACEDGSKGGPHGQVPKAGSNSGIPLPVPMAPDDKSR-LLCF-PPLGN  462

Query  948   QWLIPVMTPSEGLVYKPYPGP-----GFMSP--GCGPPPVSTPVMGNFFAPPAYGLPTSQ  790
             QWL+PVM PSEGLVYKPY GP     GFM+P  G G P  ++ V G+F   PA+G+  S 
Sbjct  463   QWLVPVMLPSEGLVYKPYTGPCPPTGGFMAPLYGRGTPLGASQVAGDFIN-PAFGVSASH  521

Query  789   YHYQGMGDPFAPPIGHGYFP-PYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLN  613
                     P    I   Y+P PYG    N  +STSAVEQ+++    GSQ     G     
Sbjct  522   QPPNLGILPGPSAIAPLYYPTPYGHQAWNPIISTSAVEQVSNL--AGSQPNGQTG-----  574

Query  612   VQH-QNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSV  436
              QH + SCNM      +A      +    K++E Q S  +SPS +A        +E R  
Sbjct  575   -QHSRRSCNMSPIPRKEAFPGHVGKFQVSKNSEFQGSTVNSPSEKA-------QLEERDQ  626

Query  435   LPLFPTSPVVNIVDAS-QPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
               LFPT+P  + ++ S Q   T    RVI+VVPHN+RSA+ESAARIF+SIQ+ R+Q
Sbjct  627   FLLFPTAPGASSLNCSLQSNGTDSQTRVIKVVPHNSRSATESAARIFRSIQEGRQQ  682



>ref|XP_009384215.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009384291.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009384371.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009384449.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=686

 Score =   250 bits (639),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 172/416 (41%), Positives = 235/416 (56%), Gaps = 37/416 (9%)
 Frame = -3

Query  1467  VDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLI  1288
             ++R D++SE  MV+ + G+ ISPDD+VG+IG KHFWKARRAI+NQQR FA+QVFELHR+I
Sbjct  288   LERKDDASEPLMVDTVPGLVISPDDIVGVIGSKHFWKARRAIINQQRDFAIQVFELHRVI  347

Query  1287  KVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPHLRME  1108
             KVQKLI+ SP+ LLE   YL K   V    + LP       P+   + K+  + P    E
Sbjct  348   KVQKLISASPHLLLEGNPYLSK-CSVKPPNKTLPQCNTNPQPEEF-RPKDGLQNPKQNKE  405

Query  1107  CSAENTVGKASLSSVQNAT------QAPSCKPSPGNP-PLPVVSNDSNMGPWCFHQPSGH  949
               A+N  G ++L + ++ +      Q P    + G P P+P+  +D +  P CF  P G+
Sbjct  406   QPADNIAGVSALPACEDGSKGGPHGQVPKAGSNSGIPSPVPMAPDDKSR-PLCF-PPLGN  463

Query  948   QWLIPVMTPSEGLVYKPYPGP-----GFMSP--GCGPPPVSTPVMGNFFAPPAYGLPTSQ  790
             QWL+PVM+PSEGLVYKPY GP     GFM+P  G G P  ++ V G+F    A+G   S 
Sbjct  464   QWLVPVMSPSEGLVYKPYTGPCPPTGGFMAPLYGRGTPLGASQVAGDFIN-SAFGFSASH  522

Query  789   YHYQGMGDPFAPPIGHGYFP-PYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLN  613
                     P    I   Y+P PYG+   N  +STSAV+Q+++    GSQ     G     
Sbjct  523   RPPNVGILPGPSAIAPLYYPTPYGLQAWNPIISTSAVKQVSNL--AGSQPSGQTG-----  575

Query  612   VQH-QNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSV  436
              QH + SCNM      +A    A +    K +E Q S  + PS +         +E R  
Sbjct  576   -QHSRRSCNMSPIPRKEAFPGHAGKFQVSKKSEFQGSTVNIPSEKT-------QLEERDQ  627

Query  435   LPLFPTSPVVNIVDAS-QPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
               LFPT+P  + ++   Q   T    RVI+VVPHN+RSA+ESAARIF+SIQ+ R+Q
Sbjct  628   FLLFPTAPGASSLNCPLQSNGTDSQTRVIKVVPHNSRSATESAARIFRSIQEGRQQ  683



>ref|XP_004969004.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X3 [Setaria 
italica]
 ref|XP_004969005.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X4 [Setaria 
italica]
Length=611

 Score =   247 bits (630),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 178/419 (42%), Positives = 232/419 (55%), Gaps = 56/419 (13%)
 Frame = -3

Query  1473  QKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHR  1294
             Q V++ D+ S++S VECI G ++SPD++VG IG KHFWKAR+AI NQQRVFAVQVFELH+
Sbjct  228   QDVEQNDDLSDSS-VECIPGWEVSPDEIVGAIGPKHFWKARKAIQNQQRVFAVQVFELHK  286

Query  1293  LIKVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPHLR  1114
             LIKVQKLIA SP+ L+E    LG  L     K+   P   +K       +K+D +    +
Sbjct  287   LIKVQKLIAASPHLLIEGDPVLGSAL---VGKKTKLPKGNLKVQTLSIANKDDIQPTPEQ  343

Query  1113  MECSAENTVGKASLSSVQNAT------QAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSG  952
              E S +NT G        +        QA + +    NPP+   + D+    WC + P  
Sbjct  344   PELSKQNTEGNPPSPCRDDGLGGNGHDQAATNETFTSNPPVMPAAPDNKQNNWCMNPPQ-  402

Query  951   HQWLIPVMTPSEGLVYKPYPGPGFMSPGCGPPPVSTPVMGNFFA--------PPAYGLPT  796
             +QWL+PVM+PSEGLVYKPY GP      C  PPV + ++  F+A           YG+P 
Sbjct  403   NQWLVPVMSPSEGLVYKPYAGP------C--PPVGS-LLAPFYANCTPLKLPSTPYGVPM  453

Query  795   SQYHYQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNL  616
               +  Q M  P AP +   YFPP+ +PVMN     SAVEQ       GS A V       
Sbjct  454   P-HQPQHMAPPGAPAMHMNYFPPFSVPVMNPGAPASAVEQ-------GSHAAVPQPHGRA  505

Query  615   NVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSV  436
               Q   SCNM       +  S   R HA +D+E QAS ASSP  R   + V G  +G   
Sbjct  506   EQQSLISCNM-------SHPSGIWRFHASRDSEPQASSASSPFDR---IQVQG--DGSGP  553

Query  435   LPLFPTSPVVNIVDASQP-PDTG---HPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
             + +FP++P  N    +QP P +G       VIRVVPHNA++ASESAARIF+SIQ ER+Q
Sbjct  554   VSVFPSAPAQN----AQPQPSSGSRDQQNHVIRVVPHNAQTASESAARIFRSIQMERRQ  608



>ref|XP_009625227.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Nicotiana 
tomentosiformis]
Length=649

 Score =   247 bits (631),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 178/430 (41%), Positives = 237/430 (55%), Gaps = 51/430 (12%)
 Frame = -3

Query  1485  SPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVF  1306
             +P+    DR +  SET  +       + PD+V+ +IGQ+ FWKARR IV+QQR+FA+Q+F
Sbjct  242   TPEVGDTDRSEGISETCSLNSRLVEKVCPDNVIALIGQELFWKARRTIVHQQRIFAIQLF  301

Query  1305  ELHRLIKVQKLIAESPNFLLEDTAYLGKP-LKVSSAKRL-----LPPFEYIKAPQNVPKH  1144
             ELHRL KVQKLIA SP+ L +   YL +P +K SS K+L     L P      P+  PK 
Sbjct  302   ELHRLTKVQKLIARSPDILFKGNFYLHQPSIKFSSLKKLPCDNVLEPPALAVEPKVSPK-  360

Query  1143  KNDSEKPHLRMECSAENTVGKASL-----SSVQNATQAPSCKPSPGNPPLPVVSNDSNMG  979
              N+SE P       A+N   +  L     +  +   Q  S KP+ G P      +D  + 
Sbjct  361   LNNSEHP-------ADNNAYEKLLPLHKDNDKKLIPQHSSQKPNVGTPTSRSFVSDPKLP  413

Query  978   PWCFHQPSGHQWLIPVMTPSEGLVYKPYPG-----PGFMSP---GCGPPPVSTPVMGNFF  823
             P CF  P G+QWL+P+ +PSEGLVYKPY G     PGFM+P   GC P  +S P+ G+F 
Sbjct  414   PRCFQPPPGYQWLVPIRSPSEGLVYKPYTGPSPPPPGFMAPVYGGCRPVTLS-PISGDFS  472

Query  822   APPAYGLPTSQYHYQGMGD-PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQ  646
               P Y +PTS  H QG+G  P    +      PY MPV+  + S+SAVE+MN F    S 
Sbjct  473   NVP-YSVPTS--HKQGVGIFPGTAILDQSCIQPYPMPVIKPSASSSAVEKMNPFPGIRSS  529

Query  645   AQV---SGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAP  475
              +    S   VN+   H+ SCN+  QK+      D     A + +++Q S ASSPS R  
Sbjct  530   ERENSPSMHDVNVVRPHKKSCNVSCQKSSGMSECDG-TFQADRGSDMQGSSASSPSERV-  587

Query  474   GVTVSGPMEGRSVLPLFPTSPVVNIVDASQPP---DTGHPARVIRVVPHNARSASESAAR  304
                       R  L LFP +P  N +D  QP    +T    +VI+VVPHN +SASESAAR
Sbjct  588   ---------QRDALSLFPITPTANCLD--QPVKDNNTEQRIQVIKVVPHNPKSASESAAR  636

Query  303   IFQSIQKERK  274
             IF+SIQ+ERK
Sbjct  637   IFRSIQEERK  646



>gb|KHN11326.1| Protein FAR1-RELATED SEQUENCE 11 [Glycine soja]
Length=1393

 Score =   254 bits (649),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 253/760 (33%), Positives = 357/760 (47%), Gaps = 140/760 (18%)
 Frame = -3

Query  2334  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSPS  2155
             + PMFPRLHV D EK GP+APPRNKMALYEQ SIPSQ F  G     P    N   P+ S
Sbjct  701   ISPMFPRLHVKDAEKRGPKAPPRNKMALYEQFSIPSQNFAPGSTSLFPLPLRNYTGPTSS  760

Query  2154  QGNGHERRMFLPMHLPPSTYSAEKLHAHSSDSNTPLTQFESRKKTDEDDFRVPVFVNSNI  1975
                   + +       PS   AEK  A++S   T LT+F       +DD     F+NS  
Sbjct  761   SHISSNQSIQFCTSSMPSIL-AEKSQAYNS-RKTNLTKF------TQDD-----FINS--  805

Query  1974  SQSIGKFYKNSEREKVSPSSPAFLGRSTKDAKHTRGGNLRHQESSRQLPATREQSVKASL  1795
                     KNS   K      AF+   +   K++    +++ +   +L  +       +L
Sbjct  806   --------KNSL--KALDGEDAFISSGSAHRKNSYCSIIQNNKDEGKLSCS-------NL  848

Query  1794  SSRSTDKKEHCIKHTDT--DFPLHSEQRDGPANNSDLSHKSGINLQPESIIDSKV---GD  1630
             S   + K+ + I+  ++     L SEQ +      + +  S I  +PE ++   +   GD
Sbjct  849   SC--SHKRLNSIRKVNSPGAVDLMSEQYE-KNQIEEHTEVSQIGQKPEEVLPHSLDGFGD  905

Query  1629  ANDDAVVSGPIKGVEIGDSSVPIN----CFQTEGQIINV-------GNDVESQENQTCRS  1483
               D +++S     +E G +S  +N      + E + I+V       G+ V +QE      
Sbjct  906   MTDASLIS-----LEKGKNSKSMNKEHRSLKEENRSISVDSLKTLQGSSVRTQEELAAFR  960

Query  1482  PQTQ------------------------------KVDRGDNSSETSMV--------ECIS  1417
              Q +                              KV+R ++    S          EC S
Sbjct  961   DQIKSRDHHIEKPAASELHKCSGELEIGRRCFLDKVNRNEDEETYSHYDAVNKYNSECTS  1020

Query  1416  GMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNFLLEDT  1237
              MDISPD+VVG IG++ FWK RR I+NQQ++F  QV ELHRLIKVQ+LIA SP+ LLED 
Sbjct  1021  VMDISPDNVVGAIGEQQFWKVRRTIINQQKIFVKQVSELHRLIKVQRLIAGSPHILLEDN  1080

Query  1236  AYLGK-PLKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPHLRMECSAENTVGKASLSSVQ  1060
                 K P K S+ ++    F   K P +V K  N S K +   E +  + VGK  +  + 
Sbjct  1081  LLHNKPPQKTSTTQKFQSDFAG-KKPSSVVKLDNKSVKVNTD-EKATNSAVGKIPIPCIS  1138

Query  1059  NAT-----QAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPVMTPSEGLVYKPY  895
             N T     Q P+     GN  L    ++S   P   + P G+QWL+PVM+PSEGLVYKP 
Sbjct  1139  NITKGHANQLPNYGHHLGNLALGSADSNSKQPPSYVYPPPGNQWLVPVMSPSEGLVYKPI  1198

Query  894   PGP-----GFMSP---GCGPPPVSTPVMGNFFAPPAYGLPTSQYHYQGMGDPFAPPIGHG  739
              GP     GFM+P    CG   +S   +    +  A   P+S   +Q +G      +   
Sbjct  1199  IGPCPPNAGFMAPIYGSCG--TMSFNPLSKDASSDATLAPSS---HQKLGIISGSSLSQ-  1252

Query  738   YFPPYGMPVMN--SAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQ--NSCNMPSQKN  571
               P +    MN  S++S SA+EQM      G +   S G VN  + HQ  ++ + P+ + 
Sbjct  1253  -LPSF----MNHPSSLSASAIEQMGQ--SNGPENHHSCGEVNSAILHQSSSNMSSPTSQM  1305

Query  570   GDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDA  391
                ++S  H  H+ KD E+Q S ASSPS R  G            LPLFP +P       
Sbjct  1306  MSRNISTYH--HSLKDKELQRSTASSPSKRMSG----------EALPLFPLAPTF-WQSE  1352

Query  390   SQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
              +     H  RVI+ +PHN ++ASESAARIF+SIQ+ERK 
Sbjct  1353  DRNTQVEHRPRVIKAMPHNPKTASESAARIFRSIQEERKH  1392



>gb|ABL11477.1| ELF3 protein [Triticum aestivum]
Length=769

 Score =   244 bits (622),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 176/415 (42%), Positives = 226/415 (54%), Gaps = 47/415 (11%)
 Frame = -3

Query  1431  VECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNF  1252
             VE +  ++ISPDDVVG IG KHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIA SP+ 
Sbjct  371   VESLPDLEISPDDVVGAIGPKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAASPHL  430

Query  1251  LLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPHLRMECSAENTVGKAS-  1075
             L+E    LG  L V+S K+        +      K  +D++    + E S +NT G  + 
Sbjct  431   LIEGDPCLGSAL-VTSKKKTAAANVEKQLLSAKSKDDDDAQLTLQQAEYSKDNTEGNQAS  489

Query  1074  ------LSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPVMTPSEG  913
                   +  V++  QA S      NPP      D+    WC   P  +QWL+PVM+PSEG
Sbjct  490   PSQGNDVVEVRHENQAASNGAVSSNPPAMPAPPDNKQNNWCAPPPQ-NQWLVPVMSPSEG  548

Query  912   LVYKPYPGP-----GFMSP---GCGPPPVSTPVMGNFFAPPAYGLPT-SQYHYQGMGDPF  760
              VYKPY GP       ++P    C   P+S P     F    YG+P   Q  + G+G P 
Sbjct  549   FVYKPYTGPCPPAGSILAPFYASCA--PLSLPSTAGEFMNSPYGIPMPHQPQHMGVGGPP  606

Query  759   A-PPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQH--QNSCN  589
             A PP+   YFPP+ +PVMN  VS+SAVEQ+         ++V+    N +V+H  ++SCN
Sbjct  607   AMPPM---YFPPFSVPVMNPVVSSSAVEQV---------SRVATARPNTHVEHHSRSSCN  654

Query  588   MPSQKNGDADVSDAHRLHACKDNEIQ-ASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSP  412
             M   +N         R H+ + +E+Q +S ASSP  R  G   +      +     PTS 
Sbjct  655   M---RNEAVSAGGVWRFHSSRGSELQGSSAASSPFDRQQGQGEARGPAAAAPAAPLPTSS  711

Query  411   VVNIVDASQPPD--------TGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
               N   A QP              ARVIRVVPH AR+ASESAARIF+SIQ ER+Q
Sbjct  712   AGNGNAAQQPQVSSSSQENPVAAAARVIRVVPHTARTASESAARIFRSIQMERQQ  766


 Score = 77.4 bits (189),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 2/42 (5%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDT--EKGGPRAPPRNKMALYEQLSIPSQRF  2218
             +MGP+FPRLHVNDT  + GGPRAPPRNKMALYEQ S+PSQRF
Sbjct  14    VMGPLFPRLHVNDTTLKGGGPRAPPRNKMALYEQFSVPSQRF  55



>emb|CAA72719.1| nematode responsive protein [Arabidopsis thaliana]
Length=702

 Score =   241 bits (614),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 254/751 (34%), Positives = 346/751 (46%), Gaps = 126/751 (17%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF-DHGVLPPNPNNASNLIPPS  2161
             I+ PMFPRLHVND +KGGPRAPPRNKMALYEQLSIPSQRF DHG      NN S L+ P 
Sbjct  10    ILEPMFPRLHVNDADKGGPRAPPRNKMALYEQLSIPSQRFGDHGTRNSRSNNTSTLVHPG  69

Query  2160  PS-QGNGHERRMFLPMHLPPSTYSAEKLHAHSSDSNTPLTQFESRKKTDEDDFRVPVFVN  1984
             PS Q  G ER + +              H  SS +N    +F S+    E          
Sbjct  70    PSSQPCGVERNLSVQ-------------HLDSSAANQATEKFVSQMSFME----------  106

Query  1983  SNISQSIGKFYKNSEREKVSPSSPAFLG-RSTKDAKHTRGGNLRHQESSRQLPATREQSV  1807
              N+  S     +   RE+   + P ++  R ++    T+ G  + + +    P++   S+
Sbjct  107   -NVRSSAQHDQRKMVREEEDFAVPVYINSRRSQSHGRTKSGIEKEKHTPMVAPSS-HHSI  164

Query  1806  KASLSSRSTDKKEHCI----KHTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESIIDSK  1639
             +    +++  K+  C+    K    D    + +  G   + D+S    I+L+  +    +
Sbjct  165   RFQEVNQTGSKQNVCLATCSKPEVRDQVKANRRSGGFVISLDVSVTEEIDLEKSASSHDR  224

Query  1638  VGDANDDAVVSGP-----------IKGVEIG-DSSVPINCFQTEGQII--NVGNDVESQE  1501
             V D N                   +K  + G +S +       EG     ++ ND E  +
Sbjct  225   VNDYNASLRQESRNRLYRDGGKTRLKDTDNGAESHLATENHSQEGHGSPEDIDNDREYSK  284

Query  1500  NQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVF  1321
             ++ C S Q    +  D+ S+ SMV+ IS +D+SPDDVVGI+GQK FW+AR+AI NQQRVF
Sbjct  285   SRACASLQQINEEASDDVSDDSMVDSISSIDVSPDDVVGILGQKRFWRARKAIANQQRVF  344

Query  1320  AVQVFELHRLIKVQKLIAESPNFLLEDTAYLGK-PLKVSSAKRLLPPFEYIK--APQNVP  1150
             AVQ+FELHRLIKVQKLIA SP+ LL++ ++LGK   K    K+LLP    +K   P  V 
Sbjct  345   AVQLFELHRLIKVQKLIAASPDLLLDEISFLGKVSAKSYPVKKLLPSEFLVKPPLPHVVV  404

Query  1149  KHKNDSEKP-HLRMECSAENTVGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPW  973
             K + DSEK    +ME SAEN VG+  LS+  +     +C        L  +  D      
Sbjct  405   KQRGDSEKTDQHKMESSAENVVGR--LSNQGHHQHPTTCLFQQTTHRLHRLQMD-----I  457

Query  972   CFHQPSGHQWLIPVMTP---SEGLV-YKPYPGPGFMSPGCGPPPVSTPVMGNFFAPPAYG  805
              F      Q +I    P   S G    +P+PG   M+            M      P Y 
Sbjct  458   AFLLSLLLQEIISNGDPCNVSLGRTDIQPHPG---MAHTGHYGGYYGHYMPTPMVMPQY-  513

Query  804   LPTSQYHYQGMGDPFAPPIGHGYFPPYGM--PVMNSAVSTSAV------EQMNSFTRTGS  649
                    + GMG    PP G+GYFPPYGM   +MN   S+         EQMN F   G+
Sbjct  514   -------HPGMG---FPPPGNGYFPPYGMMPTIMNPYCSSQQQQQQQPNEQMNQFGHPGN  563

Query  648   QAQVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAP-G  472
                      N   Q Q S N P+ +          R    +    Q S  SSPS   P G
Sbjct  564   LQ-------NTQQQQQRSDNEPAPQQQQQPTKSYPRARKSR----QGSTGSSPS--GPQG  610

Query  471   VTVSGPMEGRSVLPLFPTSPVVNIVDASQPP-----------------DTGHPARVIRVV  343
             ++ S     +S  P        NI +A +                   D G   RVI+VV
Sbjct  611   ISGS-----KSFGPFAAVDEDSNINNAPEQTMTTTTTTTRTTVTQTTRDGGGVTRVIKVV  665

Query  342   PHNARS-------ASESAARIFQSIQKERKQ  271
             PHNA+        ASE+AARIFQSIQ+ERK+
Sbjct  666   PHNAKVVPHNAKLASENAARIFQSIQEERKR  696



>dbj|BAJ96537.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|AEW48247.1| early flowering 3 [Hordeum vulgare subsp. vulgare]
 gb|AEW48249.1| early flowering 3 [Hordeum vulgare]
Length=765

 Score =   237 bits (605),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 178/420 (42%), Positives = 230/420 (55%), Gaps = 52/420 (12%)
 Frame = -3

Query  1431  VECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNF  1252
             VE +  ++ISPDDVVG IG KHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIA SP+ 
Sbjct  362   VESLPELEISPDDVVGAIGPKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAASPHL  421

Query  1251  LLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPHLRMECSAENTVGKAS-  1075
             L+E    LG  L V+S K+        +      K  +D++    ++E S +NT G  + 
Sbjct  422   LIEGDPCLGSAL-VTSKKKTAAANVEKQLLSAKSKDDDDAQLTLQQVEYSKDNTEGNQAS  480

Query  1074  ------LSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPVMTPSEG  913
                   L  V++  QA S      NPP      D+    WC   P  +QWL+PVM+PSEG
Sbjct  481   PSQDNDLVEVRHENQAASNGAVSSNPPAMPAPTDNKQNNWCAPPPQ-NQWLVPVMSPSEG  539

Query  912   LVYKPYPGP-----GFMSP---GCGPPPVSTPVMGNFFAPPAYGLPT-SQYHYQGMGDPF  760
             LVYKPY GP      F++P    C   P+S P     F    YG+P   Q  + G+G P 
Sbjct  540   LVYKPYTGPCPPAGSFLAPFYASCA--PLSLPSTAGEFMNSPYGIPMPHQPQHMGVGGPP  597

Query  759   A-PPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQH--QNSCN  589
             A PP+   YFPP+ +PVMN  VS+SAVEQ+         ++V+    N +++H  ++SCN
Sbjct  598   AMPPM---YFPPFSVPVMNPVVSSSAVEQV---------SRVAAARPNTHLEHHSRSSCN  645

Query  588   MPSQKNGDADVSDAHRLHACKDNEIQ-ASCASSPSVRAPGVTVSGPMEGRSVLPLFPTS-  415
             M   +N    V    R H+ + +E+Q +S ASSP  R  G   +      +     PTS 
Sbjct  646   M---RNEAVSVGGVWRFHSSRGSELQWSSAASSPFDRQQGQGEARGHAAAAPAAPLPTSS  702

Query  414   ------------PVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
                         P V+      P      ARVIRVVPH AR+ASESAARIF+SIQ ER+Q
Sbjct  703   SAGNGNGNAAQQPQVSSGSQENPVAAAAAARVIRVVPHTARTASESAARIFRSIQMERQQ  762



>dbj|BAJ94845.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=765

 Score =   236 bits (603),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 178/420 (42%), Positives = 230/420 (55%), Gaps = 52/420 (12%)
 Frame = -3

Query  1431  VECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNF  1252
             VE +  ++ISPDDVVG IG KHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIA SP+ 
Sbjct  362   VESLPELEISPDDVVGAIGPKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAASPHL  421

Query  1251  LLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPHLRMECSAENTVGKAS-  1075
             L+E    LG  L V+S K+        +      K  +D++    ++E S +NT G  + 
Sbjct  422   LIEGDPCLGSAL-VTSKKKTAAANVEKQLLSAKSKDDDDAQLTLQQVEYSKDNTEGNQAS  480

Query  1074  ------LSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPVMTPSEG  913
                   L  V++  QA S      NPP      D+    WC   P  +QWL+PVM+PSEG
Sbjct  481   PSQDNDLVVVRHENQAASNGAVSSNPPAMPAPTDNKQNNWCAPPPQ-NQWLVPVMSPSEG  539

Query  912   LVYKPYPGP-----GFMSP---GCGPPPVSTPVMGNFFAPPAYGLPT-SQYHYQGMGDPF  760
             LVYKPY GP      F++P    C   P+S P     F    YG+P   Q  + G+G P 
Sbjct  540   LVYKPYTGPCPPAGSFLAPFYASCA--PLSLPSTAGEFMNSPYGIPMPHQPQHMGVGGPP  597

Query  759   A-PPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQH--QNSCN  589
             A PP+   YFPP+ +PVMN  VS+SAVEQ+         ++V+    N +++H  ++SCN
Sbjct  598   AMPPM---YFPPFSVPVMNPVVSSSAVEQV---------SRVAAARPNTHLEHHSRSSCN  645

Query  588   MPSQKNGDADVSDAHRLHACKDNEIQ-ASCASSPSVRAPGVTVSGPMEGRSVLPLFPTS-  415
             M   +N    V    R H+ + +E+Q +S ASSP  R  G   +      +     PTS 
Sbjct  646   M---RNEAVSVGGVWRFHSSRGSELQWSSAASSPFDRQQGQGEARGHAAAAPAAPLPTSS  702

Query  414   ------------PVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
                         P V+      P      ARVIRVVPH AR+ASESAARIF+SIQ ER+Q
Sbjct  703   SAGNGNGNAAQQPQVSSGSQENPVAAAAAARVIRVVPHTARTASESAARIFRSIQMERQQ  762



>gb|KEH39953.1| EARLY flowering protein, putative [Medicago truncatula]
Length=479

 Score =   229 bits (584),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 171/432 (40%), Positives = 225/432 (52%), Gaps = 67/432 (16%)
 Frame = -3

Query  1536  IINVGNDVESQENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWK  1357
             ++   ND E  +       Q    +   + S  S +E +S + +SPD VV I+GQ+ FWK
Sbjct  101   VLEAANDTEYHDANIDSPIQKGNSEGSGDLSNISTIENLSSLKLSPDGVVQILGQQLFWK  160

Query  1356  ARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGK-PLKVSSAKRLLPPF  1180
             ARR I NQQR FAVQVFELHRLIKVQ LIA S N +L+  A L K PL+ S  K L    
Sbjct  161   ARRKITNQQRAFAVQVFELHRLIKVQHLIAGSSNLMLDAAAILEKFPLQESIPKSL--SL  218

Query  1179  EYIKAPQNVP-KHKNDSEKPHLRMECSAENTVGKASLSSVQNATQAPSCKPSPGNPPLPV  1003
             E +   Q    K ++ SE  + R++CSAE  V K S S  +  +   +  P  GN     
Sbjct  219   EVVVESQTKNHKQQDHSESLNHRLDCSAEKGVEKTSCSYQKYGSHLSNYTPFSGN-----  273

Query  1002  VSNDSNMGPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGPGFMSP--------GCGPPPVS  847
              S+ +N+G   F+Q  GHQWLIPVM+PSEGLVYKPYPGPG+           G GPP V+
Sbjct  274   -SDQANVGSQYFNQSPGHQWLIPVMSPSEGLVYKPYPGPGYTGAVYGGYRPFGQGPPDVT  332

Query  846   TPVMGNFFAPPAYGLPTSQYHYQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNS  667
                    F  PAYG+P   +H      PF PP G+ YFPP+G+P M  + S SAVEQ N 
Sbjct  333   -------FMNPAYGVP--DFHQAIAVPPFIPPGGYPYFPPHGVPAMYQSASVSAVEQKN-  382

Query  666   FTRTGSQAQVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPS  487
                          G  L+V+                     +    ++ E++    SSP 
Sbjct  383   -------------GATLHVR---------------------KPQPSRERELE----SSPG  404

Query  486   VRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAA  307
              +A  +      E R  L    T P+V+  +  +  +T    +VIRVVPHN RSA+ SAA
Sbjct  405   EKAQEIIKEKSAEERDTLSSSFTVPIVS-KEVLKSLETRQKPQVIRVVPHNPRSATVSAA  463

Query  306   RIFQSIQKERKQ  271
             RIFQSIQ+ERK+
Sbjct  464   RIFQSIQEERKR  475



>gb|AEZ53982.1| early flowering protein 3 [Hordeum vulgare subsp. vulgare]
Length=765

 Score =   234 bits (596),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 177/419 (42%), Positives = 227/419 (54%), Gaps = 51/419 (12%)
 Frame = -3

Query  1431  VECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNF  1252
             VE +  ++ISPDDVVG IG KHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIA SP+ 
Sbjct  363   VESLPELEISPDDVVGAIGPKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAASPHL  422

Query  1251  LLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPHLRMECSAENTVGKAS-  1075
             L+E    LG  L V+S K+        +      K  +D++    ++E S +NT G  + 
Sbjct  423   LIEGDPCLGSAL-VTSKKKTAAANVEKQLLSAKSKDDDDAQLTLQQVEYSKDNTEGNQAS  481

Query  1074  ------LSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPVMTPSEG  913
                   L  V++  QA S      NPP      D+    WC   P  +QWL+PVM+PSEG
Sbjct  482   PSQDNDLVEVRHENQAASNGAVSSNPPAMPAPTDNKQNNWCAPPPQ-NQWLVPVMSPSEG  540

Query  912   LVYKPYPGP-----GFMSP---GCGPPPVSTPVMGNFFAPPAYGLPT-SQYHYQGMGDPF  760
             LVYKPY GP      F++P    C   P+S P     F    YG+P   Q  + G+G P 
Sbjct  541   LVYKPYTGPCPPAGSFLAPFYASCA--PLSLPSTAGEFMNSPYGIPMPHQPQHMGVGGPP  598

Query  759   A-PPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQH-QNSCNM  586
             A PP+   YFPP+ +PVMN  VS+SAVEQ+         ++V+    N +  H ++SCNM
Sbjct  599   AMPPM---YFPPFSVPVMNPVVSSSAVEQV---------SRVAAARPNTHEHHSRSSCNM  646

Query  585   PSQKNGDADVSDAHRLHACKDNEIQ-ASCASSPSVRAPGVTVSGPMEGRSVLPLFPTS--  415
                +N    V    R H+ + +E+Q +S AS P  R  G   +      +     PTS  
Sbjct  647   ---RNEAVSVGGVWRFHSSRGSELQGSSAASGPFDRQQGQGEARGHAAAAPAAPLPTSSS  703

Query  414   -----------PVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
                        P V+      P      ARVIRVVPH AR+ASESAARIF+SIQ ER+Q
Sbjct  704   AGNGNGNAAQQPQVSSGSQENPVAAAAAARVIRVVPHTARTASESAARIFRSIQMERQQ  762



>ref|XP_010322854.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Solanum 
lycopersicum]
 ref|XP_010322855.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Solanum 
lycopersicum]
 ref|XP_010322856.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Solanum 
lycopersicum]
Length=657

 Score =   231 bits (590),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 209/632 (33%), Positives = 307/632 (49%), Gaps = 80/632 (13%)
 Frame = -3

Query  2016  EDDFRVPVFVNSNISQSIGKFYKNSEREK--VSPSSPAFLGRSTKDAKHTRGGNLRHQES  1843
             E+DF  P FV S      G  +K++++EK  ++ S P+   +S  + ++        +++
Sbjct  52    ENDFCGPNFVTSGKPLYHGNIHKSADKEKMVITNSKPSLKFQSVFEKQY--------KDT  103

Query  1842  SRQLPATREQSVKASLSSRSTDKKEHCIK----HTDTDFPLHSEQRDGPANNSDLSHKSG  1675
              R     RE S   +       K+EHC+K    H  T       +   P ++     KS 
Sbjct  104   DRMQLNCREHSGSQAGDQAKYQKREHCVKLPAPHLSTIETTVVHETPTPGHSKLNISKSF  163

Query  1674  INLQPESIIDSKVGDAN----------DDAVVSGPIKGVEI------GDSSVPINCFQTE  1543
             ++  PE+     VGD N          +D+ +    K  E        D+S        E
Sbjct  164   VSSAPENRC-GLVGDLNRCSDSNSESDEDSWILHKRKAAEDVTNAKHEDASTKRCASIME  222

Query  1542  G---QIINVGNDVESQ----------ENQTCRSPQTQKVDRGDNSSETSMVECISGMDIS  1402
             G     +  GN  +S           E+Q   +P     +R +  SE S +       +S
Sbjct  223   GPSCSFLPHGNSHQSPKRAKSSSDCPEDQISGAPDVAGEERSEGISEASSLNSRLVEKMS  282

Query  1401  PDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGK  1222
              D+V+ +IGQ+ FWK RR I +QQR+FA+Q+FELHRL +VQK+IA SP+   +D  YL +
Sbjct  283   SDNVIALIGQEIFWKTRRTIAHQQRIFAIQLFELHRLTQVQKMIARSPDIFFKDNFYLHQ  342

Query  1221  P-LKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPHLRMECSAENT-VGKASLSSVQNATQ  1048
             P +K SS K L    + +  P  V   +  S KP+   E + +N  +     +  +N  Q
Sbjct  343   PSIKFSSLKNLA--CDDVLEPPVV--EQKISTKPN-NFELTTDNVYLPLRKDNDKKNIPQ  397

Query  1047  APSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGP-----G  883
               S K + G P      +D  + P  F  P G+Q+L+P+ +PSEGL+YKPY GP     G
Sbjct  398   QSSQKLNVGTPTSRSFLSDPKLAPRSFQPPPGYQYLVPIRSPSEGLIYKPYTGPCPPPGG  457

Query  882   FMSPG---CGPPPVSTPVMGNFFAPPAYGLPTSQYHYQGMGDPFAPPIGH-GYFPPYGMP  715
              ++P    C P  +S P+ G+F   P Y +PTS  H QG G    P +       PY MP
Sbjct  458   IIAPAYGSCRPVTLSPPIGGDFANVP-YSVPTS--HKQGAGIFPGPALFDPSCIQPYSMP  514

Query  714   VMNSAVSTSAVEQMNSFTRTGSQAQVSG---GGVNLNVQHQNSCNMPSQKNGDADVSDAH  544
             V+  + S+SA+EQMN  +R  S  + +      VNL   HQ SCN+  QK+  A +SD  
Sbjct  515   VIKPSASSSAIEQMNPLSRIRSSEKENSPLMHEVNLVRPHQKSCNISCQKS--AVMSDCD  572

Query  543   R-LHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDA-SQPPDTG  370
             R + A + +++Q S ASSP  R            +  L LFP +P     D   Q  DT 
Sbjct  573   RIIQADRGSDMQGSTASSPPERV----------QKGALSLFPVTPTAKGSDQPVQDNDTE  622

Query  369   HPARVIRVVPHNARSASESAARIFQSIQKERK  274
                +VI+VVPHN +SASESAARIF+SIQ+ERK
Sbjct  623   QQIQVIKVVPHNPKSASESAARIFRSIQEERK  654



>gb|AEW48248.1| early flowering 3 [Hordeum vulgare subsp. vulgare]
Length=765

 Score =   232 bits (591),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 177/423 (42%), Positives = 228/423 (54%), Gaps = 58/423 (14%)
 Frame = -3

Query  1431  VECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNF  1252
             VE +  ++ISPDDVVG IG KHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIA SP+ 
Sbjct  362   VESLPELEISPDDVVGAIGPKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAASPHL  421

Query  1251  LLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPHLRMECSAENTVGKAS-  1075
             L+E    LG  L V+S K+        +      K  +D++    ++E S +NT G  + 
Sbjct  422   LIEGDPCLGSAL-VTSKKKTAAANVEKQLLSAKSKDDDDAQLTLQQVEYSKDNTEGNQAS  480

Query  1074  ------LSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPVMTPSEG  913
                   L  V++  QA S      NPP      D+    WC   P  +QWL+PVM+PSEG
Sbjct  481   PSQDNDLVEVRHENQAASNGAVSSNPPAMPAPTDNKQNNWCAPPPQ-NQWLVPVMSPSEG  539

Query  912   LVYKPYPGP-----GFMSP---GCGPPPVSTPVMGNFFAPPAYGLPT-SQYHYQGMGDPF  760
             LVYKPY GP      F++P    C   P+S P     F    YG+P   Q  + G+G P 
Sbjct  540   LVYKPYTGPCPPAGSFLAPFYASCA--PLSLPSTAGEFMNSPYGIPMPHQPQHMGVGGPP  597

Query  759   A-PPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQH--QNSCN  589
             A PP+   YFPP+ +PVMN  VS+SAVEQ+         ++V+    N +++H  ++SCN
Sbjct  598   AMPPM---YFPPFSVPVMNPVVSSSAVEQV---------SRVAAARPNTHLEHHSRSSCN  645

Query  588   MPSQKNGDADVSDAHRLHACKDNEIQ-ASCASSPSVRAPGVTVSGPMEGRSVLPLFPTS-  415
             M   +N    V    R H+ + +E+Q +S ASSP  R  G    G   G +         
Sbjct  646   M---RNEAVSVGGVWRFHSSRGSELQGSSAASSPFDRQQG---QGEARGHAAAAPAAPPP  699

Query  414   ---------------PVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKE  280
                            P V+      P      ARVIRVVPH AR+ASESAARIF+SIQ E
Sbjct  700   TSSSAGNGNGNAAQQPQVSSGSQENPVAAAAAARVIRVVPHTARTASESAARIFRSIQME  759

Query  279   RKQ  271
             R+Q
Sbjct  760   RQQ  762



>ref|XP_010322857.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X3 [Solanum 
lycopersicum]
Length=602

 Score =   229 bits (583),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 165/426 (39%), Positives = 232/426 (54%), Gaps = 36/426 (8%)
 Frame = -3

Query  1503  ENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRV  1324
             E+Q   +P     +R +  SE S +       +S D+V+ +IGQ+ FWK RR I +QQR+
Sbjct  194   EDQISGAPDVAGEERSEGISEASSLNSRLVEKMSSDNVIALIGQEIFWKTRRTIAHQQRI  253

Query  1323  FAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGKP-LKVSSAKRLLPPFEYIKAPQNVPK  1147
             FA+Q+FELHRL +VQK+IA SP+   +D  YL +P +K SS K L    + +  P  V  
Sbjct  254   FAIQLFELHRLTQVQKMIARSPDIFFKDNFYLHQPSIKFSSLKNLA--CDDVLEPPVV--  309

Query  1146  HKNDSEKPHLRMECSAENT-VGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWC  970
              +  S KP+   E + +N  +     +  +N  Q  S K + G P      +D  + P  
Sbjct  310   EQKISTKPN-NFELTTDNVYLPLRKDNDKKNIPQQSSQKLNVGTPTSRSFLSDPKLAPRS  368

Query  969   FHQPSGHQWLIPVMTPSEGLVYKPYPGP-----GFMSPG---CGPPPVSTPVMGNFFAPP  814
             F  P G+Q+L+P+ +PSEGL+YKPY GP     G ++P    C P  +S P+ G+F   P
Sbjct  369   FQPPPGYQYLVPIRSPSEGLIYKPYTGPCPPPGGIIAPAYGSCRPVTLSPPIGGDFANVP  428

Query  813   AYGLPTSQYHYQGMGDPFAPPIGH-GYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQV  637
              Y +PTS  H QG G    P +       PY MPV+  + S+SA+EQMN  +R  S  + 
Sbjct  429   -YSVPTS--HKQGAGIFPGPALFDPSCIQPYSMPVIKPSASSSAIEQMNPLSRIRSSEKE  485

Query  636   SG---GGVNLNVQHQNSCNMPSQKNGDADVSDAHR-LHACKDNEIQASCASSPSVRAPGV  469
             +      VNL   HQ SCN+  QK+  A +SD  R + A + +++Q S ASSP  R    
Sbjct  486   NSPLMHEVNLVRPHQKSCNISCQKS--AVMSDCDRIIQADRGSDMQGSTASSPPERV---  540

Query  468   TVSGPMEGRSVLPLFPTSPVVNIVDA-SQPPDTGHPARVIRVVPHNARSASESAARIFQS  292
                     +  L LFP +P     D   Q  DT    +VI+VVPHN +SASESAARIF+S
Sbjct  541   -------QKGALSLFPVTPTAKGSDQPVQDNDTEQQIQVIKVVPHNPKSASESAARIFRS  593

Query  291   IQKERK  274
             IQ+ERK
Sbjct  594   IQEERK  599



>dbj|BAM09631.1| ELF3-like protein [Oryza sativa Japonica Group]
Length=768

 Score =   231 bits (589),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 211/652 (32%), Positives = 297/652 (46%), Gaps = 124/652 (19%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGG-PRAPPRNKMALYEQLSIPSQRFDHGVLP------PNPNNAS  2179
             +MGP+FPRLHVND  KGG PRAPPRNKMALYEQ ++PS RF  G         P  + ++
Sbjct  19    VMGPLFPRLHVNDAAKGGGPRAPPRNKMALYEQFTVPSHRFSGGGGGGGVGGSPAHSTSA  78

Query  2178  NLIPPSPSQGNGHERRMFLPMHLPPST--YSAEKL-------------------------  2080
                  S SQ  G +  +F P ++P +   +S EK+                         
Sbjct  79    ASQSQSQSQVYGRDSSLFQPFNVPSNRPGHSTEKINSDKINKKISGSRKELGMLSSQTKG  138

Query  2079  ---HAHSSDSNTPLTQFES-------RKKTDEDDFRVPVFVNSNISQSIGKFYKNSEREK  1930
                +A  S +  P  + E+       ++  D+D+F VP   NS   Q     Y   E   
Sbjct  139   MDIYASRSTAEAPQRRAENTIKSSSGKRLADDDEFMVPSVFNSRFPQ-----YSTQENAG  193

Query  1929  VSP-----------SSPAFLGRSTKDAKHTRGGNLR--HQESSRQLPATREQSVKASLSS  1789
             V              SP+ + +S+    +T    L   H    +     +++ ++A+ +S
Sbjct  194   VQDQSTPLVAANPHKSPSTVSKSSTKCYNTVSKKLERIHVSDVKSRTPLKDKEMEAAQTS  253

Query  1788  RSTDKKEHCIKHTDTDF--PLHSE-----QRDGPANNSDLSHKSGINLQPESI-------  1651
             ++ + ++    H   D     H++      + G  N+SD  H      Q  S        
Sbjct  254   KNVEVEKSSSFHASKDMFESRHAKVYPKMDKTGIINDSDEPHGGNSGHQATSRNGGSMKF  313

Query  1650  ---------IDSKVGDANDDAVVSGPIKGVEIGDSSVPINCFQTEGQIINVGNDVESQEN  1498
                      I S     N D   + P  G+E            T+ + +   +D E  ++
Sbjct  314   QNPPMRRNEISSNPSSENTDRHYNLPQGGIEETG---------TKRKRLLEQHDAEKSDD  364

Query  1497  QTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFA  1318
                R  +    +  D+ S++S VECI+G +ISPD +VG IG KHFWKARRAI+NQQRVFA
Sbjct  365   -VSRLLEQHDAENIDDVSDSS-VECITGWEISPDKIVGAIGTKHFWKARRAIMNQQRVFA  422

Query  1317  VQVFELHRLIKVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKN  1138
             VQVFELH+L+KVQKLIA SP+ L+E    LG  L + S  +L+   E +KA   +    +
Sbjct  423   VQVFELHKLVKVQKLIAASPHVLIESDPCLGNAL-LGSKNKLVE--ENLKAQPLLVATID  479

Query  1137  DSEKPHLRMECSAENT---------VGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSN  985
             D E    + E S ENT          G  S    Q AT   S       P    V++D+ 
Sbjct  480   DVEPSLQQPEVSKENTEDSPPSPHDTGLGSGQRDQAATNGVSKSNRRATP----VASDNK  535

Query  984   MGPWCFH-QPSGHQWLIPVMTPSEGLVYKPYPGP-----GFMSP---GCGPPPVSTPVMG  832
                W    QP  +QWL+PVM+PSEGLVYKPY GP       ++P    C   P+S P   
Sbjct  536   QNNWGVQLQPPQNQWLVPVMSPSEGLVYKPYSGPCPPAGSILAPFYANCT--PLSLPSTA  593

Query  831   NFFAPPAYGLPTSQYHYQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQ  676
               F   AYG+P   +  Q MG P  P +   YFPP+ +PVMN       VEQ
Sbjct  594   GDFMNSAYGVPMP-HQPQHMGAPGPPSMPMNYFPPFSIPVMNPTAPAPVVEQ  644



>ref|XP_008673213.1| PREDICTED: uncharacterized protein LOC100383534 isoform X1 [Zea 
mays]
Length=633

 Score =   228 bits (580),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 180/446 (40%), Positives = 230/446 (52%), Gaps = 83/446 (19%)
 Frame = -3

Query  1464  DRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIK  1285
             ++ D+ S++S VECI G +ISPD++V  IG KHFWKARRAI NQQRVFAVQVFELH+LIK
Sbjct  220   EQNDDLSDSS-VECIPGGEISPDEIVAAIGPKHFWKARRAIQNQQRVFAVQVFELHKLIK  278

Query  1284  VQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPHLRM-E  1108
             VQKLIA SP+ L+E    LG  L   + KR   P    K  Q +     D  +P L   E
Sbjct  279   VQKLIAASPHLLIEGDPVLGNAL---TGKRNKLPKGNSKV-QTLSITNKDDIQPTLEQPE  334

Query  1107  CSAENTVGKASLSSVQNA------TQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQ  946
              S ++T G     S  +        QA + +    NPP   V+ D+    WC + P  +Q
Sbjct  335   LSKQDTEGNLLAHSHDDGLGDNHHNQAATNETFTSNPPAMHVAPDNKQNNWCMNPPQ-NQ  393

Query  945   WLIPVMTPSEGLVYKPYPGPGFMSPGCGPPPVSTPVMGNFFAPPA--------YGLPTSQ  790
             WL+PVM+PSEGLVYKP+ GP      C  PPV   ++  F+A  A        YG+P   
Sbjct  394   WLVPVMSPSEGLVYKPFAGP------C--PPVGN-LLTPFYANCAPSRLPSTPYGVPIP-  443

Query  789   YHYQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNV  610
             +  Q M  P AP +   YFPP+ MPVMN     SAVEQ       GS A       +++ 
Sbjct  444   HQPQHMVPPGAPAMHMNYFPPFSMPVMNPGTPASAVEQ-------GSHAAAPQPHGHMDQ  496

Query  609   QHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLP  430
             Q   SCNM       +  S   R  A +D+E QAS A+SP  R   + V G  +G + L 
Sbjct  497   QSLISCNM-------SHPSGVWRFLASRDSEPQASSATSPFDR---LQVQG--DGSAPLS  544

Query  429   LFPTSPVVNI-----------------------------VDASQP-PDTG---HPARVIR  349
              FPT+   N+                             V  +QP P +G       VIR
Sbjct  545   FFPTASAPNVQPPPSSGGRDRDQQNHVIRVVPRNAQTASVPKAQPQPSSGGRDQKNHVIR  604

Query  348   VVPHNARSASESAARIFQSIQKERKQ  271
             VVPHNA++ASESAA IF+SIQ ER Q
Sbjct  605   VVPHNAQTASESAAWIFRSIQMERNQ  630



>gb|AEA50868.1| elf3b [Populus tremula]
Length=348

 Score =   216 bits (551),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 161/373 (43%), Positives = 208/373 (56%), Gaps = 45/373 (12%)
 Frame = -3

Query  1335  QQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGKP-LKVSSAKRLLPPFEYIKAPQ  1159
             QQRVF+VQVFELHRLIKVQKLIA SP+ L ED+ Y+G+  +KVS   ++      I  P 
Sbjct  1     QQRVFSVQVFELHRLIKVQKLIAGSPHLLHEDSFYVGRASMKVSQINKVPSKCAMIVKP-  59

Query  1158  NVPKHKNDSEKPHLRMECSAENTVGKASLSSVQNATQ----APSCKPSPGNPPLPVVSND  991
                  K+ S+K H   + + EN VGK  L S  + T     +     S   PP PV +  
Sbjct  60    -----KDHSQKQHTSADFAGENVVGKLPLPSTNDETSKEPISQRSNYSVSAPPAPVATT-  113

Query  990   SNMGPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGPG-----FMSP---GCGPPPVSTPVM  835
             +   PW +  P G+QWL+PVM+PSEGLVYKPY GP      FM+P    CG  P+S    
Sbjct  114   TKPSPWSY-PPPGNQWLVPVMSPSEGLVYKPYAGPCPPVSRFMAPVYGSCG--PISLAPG  170

Query  834   GNFFAPPAYGLPTSQYHYQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRT  655
             G  F   AY +  S +   G+  P  P  G  +F P+GMPVMN ++  SAV Q++     
Sbjct  171   GGDFLNAAYSVSASNHEEIGI-LPGNPHFGQTFFQPFGMPVMNPSIRDSAVGQIS--PPI  227

Query  654   GSQA---QVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSV  484
             G Q+   Q++ G +N N+  Q+SCNM +Q +       A      K++EIQ S A S S 
Sbjct  228   GPQSKDNQLAVGDINSNIPLQSSCNMSNQMSRVISCC-AENFQGLKESEIQGSSAGSLS-  285

Query  483   RAPGVTVSGPMEGRSVLPLFPTSPVVNIVDASQP-PDTGHP-ARVIRVVPHNARSASESA  310
                       M   + LPLFP  P    + AS P   T  P ARVI+VVPHN+RSA+ESA
Sbjct  286   ---------KMPKANALPLFPMEPT---LQASYPIAQTNEPQARVIKVVPHNSRSATESA  333

Query  309   ARIFQSIQKERKQ  271
             ARIFQSIQ+ERKQ
Sbjct  334   ARIFQSIQEERKQ  346



>ref|XP_009778080.1| PREDICTED: protein EARLY FLOWERING 3-like [Nicotiana sylvestris]
Length=767

 Score =   223 bits (568),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 173/431 (40%), Positives = 233/431 (54%), Gaps = 41/431 (10%)
 Frame = -3

Query  1503  ENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRV  1324
             E Q   + +    DR +  SE S +       + PD+V+ +IGQ+ FWKARR IV+QQR+
Sbjct  354   EGQISGTQEVGDTDRSEGISEASSLNSRLVEKVCPDNVIALIGQELFWKARRTIVHQQRI  413

Query  1323  FAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGKP-LKVSSAKRLLPPFEYIKAPQNVPK  1147
             FA+Q+FELHRL KVQKLIA SP+ L +   YL +P +K SS K+L  P +    P  +  
Sbjct  414   FAIQLFELHRLTKVQKLIARSPDILFKGNFYLHQPSIKFSSLKKL--PCDNDLEPPALAV  471

Query  1146  HKNDSEKPHLRMECSAENTVGK-ASLSSVQNATQAP---SCKPSPGNPPLPVVSNDSNMG  979
              +  S +P+     +  NT  K   L    +    P   S KP+ G P      +D  + 
Sbjct  472   EQKISPEPNNFEHPTDNNTYEKLLPLRKDDDKKLIPQHSSQKPNVGTPTSRSFVSDPKLA  531

Query  978   PWCFHQPSGHQWLIPVMTPSEGLVYK-----PYPGPGFMSP---GCGPPPVSTPVMGNFF  823
             P CF  P G+QWL+P+ +PSEGLVYK       P PGFM+P    C P  +S P+ G+F 
Sbjct  532   PRCFQPPPGYQWLVPIRSPSEGLVYKPYSGPSPPPPGFMAPVYGNCRPVTLS-PISGDFS  590

Query  822   APPAYGLPTSQYHYQGMGDPFAPPI-GHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQ  646
               P Y +PTSQ   QG+G    P I       PY MPV+  + S+SA+EQMN F    S 
Sbjct  591   NVP-YSVPTSQ--KQGVGIFPGPAIFDQSCIQPYPMPVIKPSGSSSAIEQMNPFPGIRSS  647

Query  645   AQV---SGGGVNLNVQHQNSCNMPSQKNGDADVSDAHR-LHACKDNEIQASCASSPSVRA  478
              +    S   VNL   H+  CN+  QK+  A +S+  R   A + +++Q S ASSPS + 
Sbjct  648   ERENSPSMHDVNLVRPHKKPCNISCQKS--AAMSECDRTFQAGRGSDMQGSSASSPSEKM  705

Query  477   PGVTVSGPMEGRSVLPLFPTSPVVNIVDASQPP---DTGHPARVIRVVPHNARSASESAA  307
                        R  L LFP +P     D  QP    +T    +VI+VVPHN +SASESAA
Sbjct  706   ----------QRDALSLFPITPTTKCSD--QPVKDNNTEQRIQVIKVVPHNPKSASESAA  753

Query  306   RIFQSIQKERK  274
             RIF+SIQ+ERK
Sbjct  754   RIFRSIQEERK  764


 Score = 68.9 bits (167),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 62/102 (61%), Gaps = 12/102 (12%)
 Frame = -3

Query  2334  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQ--LSIPSQRF---------DHGVLPPNPN  2188
             M P+FPRLH+ND +KGGPRAPPRNKMAL EQ  +++  QRF            +LP  PN
Sbjct  11    MDPLFPRLHINDADKGGPRAPPRNKMALCEQSSITLSPQRFTSTSSPAPGSMSMLPLAPN  70

Query  2187  NASNLIPPSPSQGNGHERRMF-LPMHLPPSTYSAEKLHAHSS  2065
              ++++   S S+  G+++ +F L  +   S +  + LH +SS
Sbjct  71    GSNSIPAASSSRVGGNKKSLFSLSHNSSESPHFIDILHPYSS  112



>ref|XP_006646013.1| PREDICTED: protein EARLY FLOWERING 3-like [Oryza brachyantha]
Length=721

 Score =   219 bits (558),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 176/418 (42%), Positives = 224/418 (54%), Gaps = 54/418 (13%)
 Frame = -3

Query  1467  VDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLI  1288
              ++ D+ S++S VECI+G +ISPD +VG IG KHFWKAR AI+NQQRVFAVQVFELH+L+
Sbjct  333   AEKNDDVSDSS-VECITGWEISPDKIVGAIGTKHFWKARHAIMNQQRVFAVQVFELHKLV  391

Query  1287  KVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPHLRM-  1111
             KVQKLIA SP+ L+E    LG  L + S K+L    E     Q +    ND  +P ++  
Sbjct  392   KVQKLIAASPHVLIEGDPCLGNAL-LGSKKKLD---EENPKAQALLVVTNDDVEPSIQQP  447

Query  1110  ECSAENTVGK-------ASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFH-QPS  955
             E S EN+            L + Q+   A +          PV S++ N   W    QP 
Sbjct  448   ELSKENSEESPPSPPHDTGLVTGQHDQAATNGASKSNRRATPVASDNQNN--WGAQLQPI  505

Query  954   GHQWLIPVMTPSEGLVYKPYPGP-----GFMSP---GCGPPPVSTPVMGNFFAPPAYGLP  799
              +QWL+PVM+PSEGLVYKPY GP       ++P    C   P+S P     F   AYG+P
Sbjct  506   QNQWLVPVMSPSEGLVYKPYSGPCPPAGSLLAPFYTSCA--PLSLPSTAGDFMNSAYGVP  563

Query  798   TSQYHYQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVN  619
                +  Q MG P  P +   YFPP+ +PVMN     S  EQ     R  S  Q  G   N
Sbjct  564   IPHHQPQHMGAPGPPAMPMNYFPPFSIPVMNPGAPASMAEQ----GRHPSMPQPYG---N  616

Query  618   LNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRS  439
                    S NM       +  S   R HA +D+E QAS ASSP  R   +   G    R 
Sbjct  617   FEQHSWISGNM-------SHPSGIWRFHASRDSEAQASSASSPFDR---LQCGG---SRP  663

Query  438   VLPLFPTSPVVNIVDASQP-PDTG---HPARVIRVVPHNARSASESAARIFQSIQKER  277
             V   FPT+   N    +QP P +G   +   VIRVVPHN+R+ASESAARIF+SIQ+ER
Sbjct  664   VSAAFPTASAQN----TQPQPSSGSQDNQTIVIRVVPHNSRTASESAARIFRSIQRER  717


 Score = 76.3 bits (186),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 60/90 (67%), Gaps = 5/90 (6%)
 Frame = -3

Query  2334  MGPMFPRLHVNDTEKGG-PRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  2158
             MGP+FPRLHV+D  KGG PRAPPRNKMALYEQ ++PS R      P +   AS +   S 
Sbjct  1     MGPLFPRLHVSDAVKGGGPRAPPRNKMALYEQFTVPSHR--RFSAPASSPGASTVPSAST  58

Query  2157  SQGNGHERRMFLPMHLPPS--TYSAEKLHA  2074
             SQ  G +R +F P ++P +  ++S EK+++
Sbjct  59    SQVYGSDRSLFQPFNVPSNGPSHSTEKVNS  88



>ref|XP_006583033.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Glycine 
max]
 ref|XP_006583034.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Glycine 
max]
Length=709

 Score =   214 bits (546),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 166/405 (41%), Positives = 219/405 (54%), Gaps = 48/405 (12%)
 Frame = -3

Query  1428  ECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNFL  1249
             EC   MDISPD+VVG IG++ FWK RR I+NQQ++F  QVFELHRLIKVQ+LIA SP+ L
Sbjct  331   ECTLAMDISPDNVVGAIGEQQFWKVRRTIINQQKIFVKQVFELHRLIKVQRLIAGSPHVL  390

Query  1248  LEDTAYLGK-PLKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPHLRMECSAENTVGKASL  1072
             LED   L K P K S++K+    F   K P +V K  N S K +   E +  + VGK  +
Sbjct  391   LEDNLLLNKPPPKTSTSKKFQSDFASQK-PSSVVKLDNKSVKVNT-AEKATNSAVGKIPI  448

Query  1071  SSVQNAT-----QAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPVMTPSEGLV  907
               + N T     Q P+     GNP L    ++S   P   + P G+QWL+PVM+PSEGLV
Sbjct  449   PCISNTTKGHANQLPNYGHHLGNPALASADSNSKQSPSYVYPPPGNQWLVPVMSPSEGLV  508

Query  906   YKPY-----PGPGFMSP---GCGPPPVSTPVMGNFFAPPAYGLPTSQYHYQGMGDPFAPP  751
             YKP      P  GFM+P    CG   VS   +    +  A   P+S   +Q +G      
Sbjct  509   YKPIIWPCPPNAGFMAPIYGSCG--TVSFNPLSKDASSDAALAPSS---HQKLG------  557

Query  750   IGHGYFPPYGMP--VMN--SAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNMP  583
             I  G   P  +P   MN  S++S SAVEQM      G +   S G VN  +  Q+S NM 
Sbjct  558   ILSGSSLPQFLPPSFMNHPSSISASAVEQMGQ--SNGPENHHSWGEVNSAILFQSSSNMS  615

Query  582   SQKNGDA--DVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPV  409
             S  +     ++S  H  H+ +D E+  S ASSPS R  G            LPLFP +P 
Sbjct  616   SPTSQVMPRNISTYH--HSLQDKELHRSTASSPSKRVSG----------EALPLFPLAPT  663

Query  408   VNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERK  274
                 + +       P RVI+ +PHN ++ASE+AA+IF+SIQ+ERK
Sbjct  664   CWQSEDTNTQVEQQP-RVIKAMPHNPKTASETAAKIFRSIQEERK  707


 Score = 73.2 bits (178),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -3

Query  2334  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG  2209
             + PMFPRLHV D E+GGP+APPRNKMALYEQ S+PSQ F  G
Sbjct  15    ISPMFPRLHVKDAERGGPKAPPRNKMALYEQFSLPSQNFAPG  56



>ref|XP_006583035.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X3 [Glycine 
max]
Length=686

 Score =   214 bits (545),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 166/405 (41%), Positives = 219/405 (54%), Gaps = 48/405 (12%)
 Frame = -3

Query  1428  ECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNFL  1249
             EC   MDISPD+VVG IG++ FWK RR I+NQQ++F  QVFELHRLIKVQ+LIA SP+ L
Sbjct  308   ECTLAMDISPDNVVGAIGEQQFWKVRRTIINQQKIFVKQVFELHRLIKVQRLIAGSPHVL  367

Query  1248  LEDTAYLGK-PLKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPHLRMECSAENTVGKASL  1072
             LED   L K P K S++K+    F   K P +V K  N S K +   E +  + VGK  +
Sbjct  368   LEDNLLLNKPPPKTSTSKKFQSDFASQK-PSSVVKLDNKSVKVNT-AEKATNSAVGKIPI  425

Query  1071  SSVQNAT-----QAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPVMTPSEGLV  907
               + N T     Q P+     GNP L    ++S   P   + P G+QWL+PVM+PSEGLV
Sbjct  426   PCISNTTKGHANQLPNYGHHLGNPALASADSNSKQSPSYVYPPPGNQWLVPVMSPSEGLV  485

Query  906   YKPY-----PGPGFMSP---GCGPPPVSTPVMGNFFAPPAYGLPTSQYHYQGMGDPFAPP  751
             YKP      P  GFM+P    CG   VS   +    +  A   P+S   +Q +G      
Sbjct  486   YKPIIWPCPPNAGFMAPIYGSCG--TVSFNPLSKDASSDAALAPSS---HQKLG------  534

Query  750   IGHGYFPPYGMP--VMN--SAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNMP  583
             I  G   P  +P   MN  S++S SAVEQM      G +   S G VN  +  Q+S NM 
Sbjct  535   ILSGSSLPQFLPPSFMNHPSSISASAVEQMGQ--SNGPENHHSWGEVNSAILFQSSSNMS  592

Query  582   SQKNGDA--DVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPV  409
             S  +     ++S  H  H+ +D E+  S ASSPS R  G            LPLFP +P 
Sbjct  593   SPTSQVMPRNISTYH--HSLQDKELHRSTASSPSKRVSG----------EALPLFPLAPT  640

Query  408   VNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERK  274
                 + +       P RVI+ +PHN ++ASE+AA+IF+SIQ+ERK
Sbjct  641   CWQSEDTNTQVEQQP-RVIKAMPHNPKTASETAAKIFRSIQEERK  684



>gb|KEH18269.1| early flowering protein, putative [Medicago truncatula]
Length=730

 Score =   214 bits (545),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 167/452 (37%), Positives = 228/452 (50%), Gaps = 53/452 (12%)
 Frame = -3

Query  1554  FQTEGQIINVGNDVESQENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIG  1375
             FQ   + + +G      + +  +  +T K     N S +   +C  GMDISPDDVVG+IG
Sbjct  305   FQKCSRELEIGTRSSHGKRERSKDEETSKNYDALNKSSS---KCRFGMDISPDDVVGLIG  361

Query  1374  QKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGKP-LKVSSAK  1198
             +K FWK RR I+NQQR+F +QVFELHRLIKVQ+LIA SPN L ED   L KP ++ SS+ 
Sbjct  362   EKQFWKTRRTIINQQRIFFMQVFELHRLIKVQRLIAGSPNLLFEDKLLLNKPSVEASSSN  421

Query  1197  RLLPPFEYIKAPQNVPKHKNDSEKPHLRMECSAENTVGKASLSSVQNATQAPSCKPSPGN  1018
             +L   F   + P  V K  + SEK     E    N VGK SL  V N ++  +   + GN
Sbjct  422   KLQSDFISEQQP-TVFKLDSKSEKA-TTSEDVENNAVGKISLPFVNNISKENNQLSNYGN  479

Query  1017  PPLPVV--------SNDSNMGPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGP------GF  880
               L  +        SN  +     +  P  +QWL+PVM+PSEGLVYKP  GP      G 
Sbjct  480   HHLGNLALASADKSSNAKHSPNIVYPPPPPNQWLVPVMSPSEGLVYKPIIGPCPPNSGGI  539

Query  879   MSP---GCGPPPVSTPVMGNFFAPPAYGLPTSQYHYQGMGDPFAPPIGHGYFPPYGMPVM  709
             M+P   GC P   +         P    L TS +    +    + P      PP     M
Sbjct  540   MTPLYGGCSPMSFNQGSKDVVMDP---SLTTSFHQKIRLLSGSSLP---QLLPPCVPSFM  593

Query  708   NSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHAC  529
             + ++S S+VEQM      G +   S   +N  + +Q+  NM +Q        +     + 
Sbjct  594   HRSISASSVEQMAQ--SNGPKNHYSSAELNSTILYQSPSNMSTQI-SHVMARNFSPYQSL  650

Query  528   KDN-EIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVV------NIVDASQPPDTG  370
             +DN E+Q S A+SPS R            R  LPLFP +P        + +D  Q     
Sbjct  651   EDNKELQISIANSPSKRMK----------RDELPLFPLAPTFWSSPDRDSIDEHQE----  696

Query  369   HPARVIRVVPHNARSASESAARIFQSIQKERK  274
             H +RVI+ +PHN +SASESAA+IF+SIQ+ERK
Sbjct  697   HHSRVIKALPHNPKSASESAAKIFKSIQEERK  728



>emb|CDO97951.1| unnamed protein product [Coffea canephora]
Length=758

 Score =   213 bits (542),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 152/413 (37%), Positives = 218/413 (53%), Gaps = 49/413 (12%)
 Frame = -3

Query  1446  SETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIA  1267
             S+ S+++  SG+ +SPDDVVG+IG K FW ARR I +QQR+FA+Q+FELHRLIKVQ+LIA
Sbjct  372   SDNSVMDSKSGLHVSPDDVVGMIGPKFFWSARRTIAHQQRIFALQIFELHRLIKVQRLIA  431

Query  1266  ESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPHLR-MECSAENT  1090
              SP    ED+    KP    S+++      + + P    K K D+  P    ++  AE  
Sbjct  432   GSPEMFFEDSVIFTKPSIDRSSEKKFQLQSFPELPSLFLKPKVDALNPKPSCLDYVAEEA  491

Query  1089  VGKA--SLSSVQNATQAPS--CKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPVMTP  922
              GK        +N    P    KP  G  P+  ++ ++  GPWCF  P G+QWLIPV +P
Sbjct  492   HGKLPPPAYETENRYDTPKSPLKPYSGVTPM-TLAIEAKFGPWCFPAPPGNQWLIPVKSP  550

Query  921   SEGLVYKPYPGPGFMSPGCGPP---PVSTPVMGNFFAP----PAYGLPTSQYHYQGMGDP  763
             SEGLVYKPY GP   + GC  P     ST  +    A      AYG+PTS          
Sbjct  551   SEGLVYKPYAGPCPPTLGCIAPIYGGCSTMCLTRMDAEHVNCTAYGIPTS----------  600

Query  762   FAPPIGHG-YFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQA----QVSGGGVNLNVQHQN  598
                 +G    F P+ +PVMN+  S+SA EQ + F    S      +V+   +N  + +++
Sbjct  601   ----LGRSCCFQPHALPVMNTENSSSAAEQTSPFVTARSSRPDNHRVATYDINYIIPYRS  656

Query  597   SCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPT  418
                + S + G   ++D+ R+      ++  SC+  P   A  +      +  S+ P+ PT
Sbjct  657   LDAITSHRTG--IMTDSTRIM-----QVSKSCSDFPGSTASNLDERVQADELSLFPMTPT  709

Query  417   SPVVNIVDASQPP----DTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
                   V  S+ P    +     +VI+VVPHN +SASESAARIF+SIQ+E+KQ
Sbjct  710   ------VQRSKHPMQNNNNEQQIQVIKVVPHNPKSASESAARIFRSIQEEKKQ  756


 Score = 68.9 bits (167),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -3

Query  2334  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVL  2203
             M P+FPRLH+ND E  GPRAPPRNKMAL EQ++ PSQRF  G +
Sbjct  11    MDPLFPRLHINDAEGIGPRAPPRNKMALCEQVNAPSQRFSSGSM  54



>ref|XP_010106119.1| hypothetical protein L484_003122 [Morus notabilis]
 gb|EXC07678.1| hypothetical protein L484_003122 [Morus notabilis]
Length=789

 Score =   213 bits (541),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 177/458 (39%), Positives = 232/458 (51%), Gaps = 101/458 (22%)
 Frame = -3

Query  1527  VGNDVESQENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARR  1348
             +GN VE +E + C +     ++R D   + SMV  IS + + PD VVG+IG+K FWKARR
Sbjct  386   LGNGVECREERNCGT----LMNRHDGFLKISMVGAISALSVLPDAVVGVIGEKQFWKARR  441

Query  1347  AIVNQQRVFAVQVFELHRLI---------KVQKLIAESPNFLLEDTAYLGKPLKVSSAKR  1195
              I  QQR+FAVQVFELHRL+         +VQ+  A SP+ L E  A             
Sbjct  442   TITYQQRIFAVQVFELHRLMTRFRIHYSEQVQRSFAASPDLLHEPHA-------------  488

Query  1194  LLPPFEYIKAPQNVPKHKNDSEKPHLRMECSAENTVGKASLSSVQNAT-------QAPSC  1036
                         +V K K+ SE P+   E + EN V +  L SV N T       Q+   
Sbjct  489   ------------SVVKLKSKSETPNPSTERNQENLVMQLPLHSVNNNTSKGLIPNQSNYA  536

Query  1035  KPSPGNPPLPVVSNDSNMGPWCFHQ-PSGHQWLIPVMTPSEGLVYKPYPGP-----GFMS  874
             +    +P  P   N S   P  FH  P G+QWL+PVM+PSEGLVYK Y GP     G++ 
Sbjct  537   EHLRNSPSAPTSINKSVALP--FHSPPPGNQWLVPVMSPSEGLVYKAYTGPCPPSAGYVV  594

Query  873   P---GCGPPPVSTPVMGNFFAPPAYGLPTSQYHYQGM----GDPFAPPIGHGYF-PPYGM  718
             P    CG  P+S      +  P          + QG+    G P  PP G  YF PPYG+
Sbjct  595   PNYGSCG--PMSLNPERTYLGPAC--------NQQGIGVLPGTP--PPFGQAYFAPPYGL  642

Query  717   PVMNSAVSTSAVEQMNSF--TRTGSQA-QVSGGGVNLNVQHQNSCNMPSQKNGDADVSDA  547
             PVM+S V  SAVEQM+ F   R   Q  Q S   +N     Q+SCN+ SQ    + V  +
Sbjct  643   PVMSSFVPNSAVEQMSPFGIGRANDQEHQSSFEEMNFPKPRQSSCNISSQT---SRVKSS  699

Query  546   H-RLHACKDNEIQASCASSPSVRAPGVTVSGPMEGR--SVLPLFPTSPVVNIVDASQPPD  376
             H  + A K +E   S AS+          + P E R    LPLFP +P      A +P +
Sbjct  700   HGAVQASKRSEFYRSTAST----------NTPPERRRGDELPLFPVAPT-----AEEPDE  744

Query  375   ----TGHPARVIRVVPHNARSASESAARIFQSIQKERK  274
                 + +  RVI+VVPHN R+A+ESAARIFQSIQ+E+K
Sbjct  745   NVQISKNQTRVIKVVPHNPRTATESAARIFQSIQEEKK  782


 Score = 89.0 bits (219),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 63/103 (61%), Gaps = 8/103 (8%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG---VLPPNPNNASNLIP  2167
             +  PMFPRLHV+DTEKGGPRAPPRNKMALYEQLSIPSQRF  G    LP   N++ +++ 
Sbjct  77    VTSPMFPRLHVSDTEKGGPRAPPRNKMALYEQLSIPSQRFTSGSSSTLPHAQNSSGDMVS  136

Query  2166  PSPSQGNGHERRMFLPM---HLPPSTYSAEKLHAHSSDSNTPL  2047
                S      R MF P     +P  +Y +EKL   SS     L
Sbjct  137   SISSGQASAYRNMFPPFCNSSIP--SYISEKLQHPSSSGGVKL  177



>ref|XP_006646014.1| PREDICTED: protein EARLY FLOWERING 3-like [Oryza brachyantha]
Length=690

 Score =   211 bits (537),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 167/414 (40%), Positives = 216/414 (52%), Gaps = 43/414 (10%)
 Frame = -3

Query  1467  VDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLI  1288
              ++ D+ S++S VECI+  +ISPD++VG IG KHFWKARRAI+NQQRVFA QVFELH+L+
Sbjct  302   TEKNDDLSDSS-VECITAWEISPDEIVGAIGAKHFWKARRAIINQQRVFAAQVFELHKLV  360

Query  1287  KVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKNDS----EKPH  1120
             KVQKLIA  P+ L+E    LG  L +S  K      E +K   ++    +D     ++P 
Sbjct  361   KVQKLIAALPHVLIEGDPCLGDALLISKKKLAE---ENLKTQPSLVATNDDVQPSLQQPE  417

Query  1119  LRMECSAENTVGKASLS-SVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFH-QPSGHQ  946
             L  E S EN       +    +  Q      S  N     V++D     W    QP  +Q
Sbjct  418   LSKENSKENPPSPHDTAPGSGHHDQTAKSGASKSNLRATSVASDDRQNDWGVQLQPPQNQ  477

Query  945   WLIPVMTPSEGLVYKPYPGP-----GFMSP---GCGPPPVSTPVMGNFFAPPAYGLPTSQ  790
             WLIPVM+PSEGLVYKPY GP       ++P    C   P+  P     F   AYG+P   
Sbjct  478   WLIPVMSPSEGLVYKPYSGPCPPAGSILAPFYTNCT--PMRLPSTAGDFMNSAYGVPVP-  534

Query  789   YHYQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNV  610
             +  Q MG P  P +   YFPP+ +PVMN      AVEQ     R  S  Q  G   N   
Sbjct  535   HQPQFMGVPGTPTMPMNYFPPFSVPVMNPVALAPAVEQ----GRHPSMPQPYG---NFEQ  587

Query  609   QHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLP  430
               + SCNM       +  S   R HA +D+E QAS ASSP  R      SGP+       
Sbjct  588   HSRMSCNM-------SHPSGIWRFHASRDSEAQASSASSPFDRL-QCGGSGPVSS-----  634

Query  429   LFPTSPVVNIVDASQPPDTGHPARVIRVVPH-NARSASESAARIFQSIQKERKQ  271
              FPT+   N           +   VI+VVPH N+++ASESAARIF+SIQ ER++
Sbjct  635   -FPTASAQNAQPQLSSGSRDNQTNVIKVVPHDNSQTASESAARIFRSIQMERQR  687



>ref|XP_011072464.1| PREDICTED: protein EARLY FLOWERING 3-like [Sesamum indicum]
Length=581

 Score =   206 bits (525),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 208/703 (30%), Positives = 287/703 (41%), Gaps = 150/703 (21%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNP-NNASNLIPPS  2161
             +M P+FPRLH++D +KGGP+APPRNKMA+               LP  P N+ ++ +P +
Sbjct  10    LMDPLFPRLHIDDADKGGPKAPPRNKMAM---------------LPIQPTNDHTSSLPQA  54

Query  2160  PSQGNGHERRMFLPMHLPPSTYSAEKLHAHSSDS---NTPLTQFESRKKTDEDDFRVPVF  1990
              S   GH    F    LP S++ AE   ++ S +    TPL   E               
Sbjct  55    SSSQVGHRLATFC--GLPGSSHLAEIYQSYYSTAVNVKTPLGNSEP--------------  98

Query  1989  VNSNISQSIGKFYKNSEREKVSPSSPAFLGRSTKDAKHTRGGNLRHQESSRQLPATREQS  1810
                            SE E  +  +P   G S      T+  +LR            E  
Sbjct  99    ---------------SELESSNYQNPCVSGNS-----RTKSNSLR----PHGFDEVSEFD  134

Query  1809  VKASLSSRSTDKKEHCIKHTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESIIDSKVGD  1630
              KA + ++      H  KH+  D P    + +  A          I+  PE I+      
Sbjct  135   DKALVPAK------HHKKHSLVDEPCQDSRIESKAVTD------AISGMPERIMRRTCAP  182

Query  1629  ANDDAVVSGPIKGVEIGDSSVPINCFQTEGQIINVGNDVESQENQTCRSPQTQKVDRGDN  1450
             A DD++ S P      G              +I      E  +++ C   Q +   +   
Sbjct  183   AMDDSLSSFPTHRDGYG--------------LIGTATINECYKDEDCGPMQGEDAGKKQE  228

Query  1449  SSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLI  1270
             + +TS+ EC   +D++PDDVVGIIGQK FWKAR  IV QQR F +Q+FELHRLIKVQ+LI
Sbjct  229   TLDTSVAECTPVVDLTPDDVVGIIGQKLFWKARNIIVRQQRTFTMQIFELHRLIKVQRLI  288

Query  1269  AESPNFLLEDTAYLG-KP-LKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPHLRMECSAE  1096
             A S     E+   L  KP  K    K+LL       +P  V K K D+  P       AE
Sbjct  289   AGSLQVFSENIFNLNVKPSTKFPPTKKLLFTIPLNPSPV-VTKRKVDALNPGKHHRAEAE  347

Query  1095  NTVGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPVMTPSE  916
                 +                           + ++ + PWCFH P G+QWL P  +PSE
Sbjct  348   GDFAQQPTPKPSPTPPT---------------NYNAKVAPWCFH-PPGNQWLSPAESPSE  391

Query  915   GLVYKPY-----PGPGFMSPGCG-PPPVSTPVMGNFFAPPAYGLPTSQYHYQGMGDPFAP  754
             GL+++PY     P P  M P  G   PV+   MG       YG+P     +QG       
Sbjct  392   GLIHEPYKGLGPPTPSIMGPVFGHQQPVNISTMGK----TVYGVPA--VDFQGTRHFPGG  445

Query  753   PIGHGYFPPYGMPVMNSAVSTSAVEQMNSFT---RTGSQAQVSGGGVNLNVQHQNSCNMP  583
               G     PY MP++N       + Q   F      G+         N+ +  + SCNM 
Sbjct  446   AFGESCLRPYVMPLINPHSPVLDLNQTIPFAGAQSAGTDKVSLVFDANVAISCKTSCNMV  505

Query  582   SQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPM-EGRSVLPLFPTSPVV  406
             +Q                          SS  V   G  + GP  +      LFPT+  V
Sbjct  506   NQ--------------------------SSLVVLDSGEILHGPQADWWQEDALFPTTAAV  539

Query  405   NIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKER  277
                            +VI+VVPH+ +SA ESAARIFQSIQ+ER
Sbjct  540   ----LCSKDHYNQSLQVIKVVPHDPKSARESAARIFQSIQEER  578



>ref|XP_010267081.1| PREDICTED: protein EARLY FLOWERING 3-like [Nelumbo nucifera]
Length=468

 Score =   198 bits (503),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 160/454 (35%), Positives = 213/454 (47%), Gaps = 99/454 (22%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRN-KMALYEQLSIPSQRFDHGVLPPN---PNNASNLI  2170
             IMGP+FPRLHVNDTEKGG R PPR  KM LYEQL+I SQ  +  + P     P+NA   +
Sbjct  10    IMGPLFPRLHVNDTEKGGLREPPRRRKMTLYEQLNISSQGLNSSLAPTLSLLPDNACTSV  69

Query  2169  PP-SPSQGNGHERRMFLPMHLPPST--YSAEKLH---------------AHSSDSNT---  2053
             P  S SQG GHER +F P ++PP T  +S+EKLH                  S +NT   
Sbjct  70    PSISLSQGGGHERSVFSPFYVPPPTPTHSSEKLHPCFDGVNLSGAMAEFDRKSTTNTNNR  129

Query  2052  --------------------PLTQFESRKKTDEDDFRVPVFVNSNISQSIGKFYKNSERE  1933
                                  L+    +K  DEDD R P FV+S +S    K   N+ RE
Sbjct  130   PSNVTMGLLSTNDRNSCCSHALSNSRKQKPGDEDDLRAPAFVHSRVSLCSDKDLPNTSRE  189

Query  1932  KVSPSSPAFLGRST--------------------------KDAKHTRGGNLRHQESSRQL  1831
             + SP    + G ST                          K+ K TR  ++R +      
Sbjct  190   RFSPFISTYPGHSTVATDNSPLKTAAATCSSPMQPQNACDKNQKPTRTTDMRSKHVRNHF  249

Query  1830  PATREQSV----KASLSSRSTDKKEHCIK-----HTDTDFPLHSEQRDGPANNSDLS---  1687
                 +++V    +A  S+  +   E+ ++      T  +  L + Q D      D     
Sbjct  250   EENLKETVTSIHRAENSASVSSMGENIVEPLNNDKTSENQELQNSQVDDSRRLCDADEET  309

Query  1686  -HKSGINLQPESIIDSKVGDANDDAVVSGPIKGVEIG-------DSSVPINCFQTEGQII  1531
               K G  L PE     K G+ +   V S  ++   I          + P N  +   +  
Sbjct  310   HQKIGSTLFPE-----KYGNTDAHLVESIEVEKENISRERNEPCSEASPGNSHRNPERDE  364

Query  1530  NVGNDVESQENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKAR  1351
             N G   +  E     S Q   VDR  ++S+ SMV+ + GMDISP+DVVG+IG KHFW AR
Sbjct  365   NGG---KYHEEMVHESLQVGDVDRNSDASKCSMVDSVLGMDISPNDVVGVIGIKHFWNAR  421

Query  1350  RAIVNQQRVFAVQVFELHRLIKVQKLIAESPNFL  1249
             R IVNQQ+VFA QVFELHRLIKVQ+LIA SP+ +
Sbjct  422   RTIVNQQKVFAAQVFELHRLIKVQRLIAGSPHLV  455



>gb|KDO79981.1| hypothetical protein CISIN_1g004928mg [Citrus sinensis]
Length=388

 Score =   196 bits (497),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 149/368 (40%), Positives = 203/368 (55%), Gaps = 42/368 (11%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNN-ASNLIPPS  2161
             IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIP+QRF  GVLP NP+N +S + P S
Sbjct  10    IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPTQRFSTGVLPLNPSNSSSLVPPVS  69

Query  2160  PSQGNGHERRMFLPMHLPPS--TYSAEKLHAH---SSDSNTPLTQFE-SRKKTDEDDFRV  1999
              SQGNG ER +     + PS  T+  EK H+     +  NT L   E S+K ++EDDF V
Sbjct  70    SSQGNGLERNLLFAHSVHPSTPTHLDEKCHSDQPAGATLNTHLQHHEQSKKVSEEDDFAV  129

Query  1998  PVFVNSNISQSIGKFYKNSEREKVSPSSPAFLGRSTK----------------DAKHTRG  1867
             P+F  + + Q  GK   + ++  +SP +P+   +STK                 +   +G
Sbjct  130   PIFDQAGMGQCHGKSQSDVDKGNLSPFNPSNTRKSTKFQNACDKNPKRSSSSSISLRQQG  189

Query  1866  GNLRHQESSRQLPATREQSVKASLSSRSTDKKEHCIKHT----DTDFPLHSEQRDGPANN  1699
             G++  QE+ +   +      K+S++    +K +  +K      + ++   S       N+
Sbjct  190   GHV-CQENPKICISIGNFPAKSSVNLSIREKIDGIVKEVSASPNQEYREISGSDFSRIND  248

Query  1698  SDLSHK--SGINLQPESIIDSKVGDANDD---AVVSGPIKGVEIGDSSVPINCFQTEGQI  1534
             SD S +  SG  L P         D+  D    VV  P      GD+    +C    G  
Sbjct  249   SDASLRLESGAGLPPNGCCRYDDVDSTGDFQKEVVLQP-----RGDTHSTEDCGHRSG--  301

Query  1533  INVGNDVESQENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKA  1354
               + ND     ++TC S Q    D+ D+ SETSMV+ +SG+D+SPDDVVGIIG KHFWKA
Sbjct  302   --LHNDSRYHVDKTCGSLQLGSGDKSDDVSETSMVDSMSGVDMSPDDVVGIIGHKHFWKA  359

Query  1353  RRAIVNQQ  1330
             RRAIVN++
Sbjct  360   RRAIVNRE  367



>ref|XP_008650078.1| PREDICTED: protein EARLY FLOWERING 3-like [Zea mays]
 gb|AFW79357.1| hypothetical protein ZEAMMB73_525396 [Zea mays]
Length=647

 Score =   201 bits (511),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 171/420 (41%), Positives = 206/420 (49%), Gaps = 102/420 (24%)
 Frame = -3

Query  1506  QENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQR  1327
             +E    R      V++ D+ S++S VE + GM+ISPDDVV  IG KHFWKARRAIVNQQR
Sbjct  319   RETGVKRKRSHHDVEQNDDLSDSS-VESLPGMEISPDDVVSAIGPKHFWKARRAIVNQQR  377

Query  1326  VFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPK  1147
             VFAVQVFELHRLIKVQKLIA SP+ L+E    LGK L VS  KRL    E       +  
Sbjct  378   VFAVQVFELHRLIKVQKLIAASPHVLIEGDPCLGKSLAVSK-KRLAGDVE-----TQLES  431

Query  1146  HKNDSEKPHLRMECSAENT-VGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWC  970
              KND      ++E S E T   + S S  + A        S   P      +D+    WC
Sbjct  432   AKNDDGVRPTQLEHSKEKTEANQPSPSQDEQAATNGDVAASMHTP------SDNKQKSWC  485

Query  969   FHQPSGHQWLIPVMTPSEGLVYKPYPGPGFMSPGCGPPPVSTPVMGNFFAPPAYG-LPTS  793
                P   QWLIPVM+PSEGLVYKPY G       C  PPV     G+  APP +   PTS
Sbjct  486   IPAPPS-QWLIPVMSPSEGLVYKPYTG------HC--PPV-----GSLLAPPFFASYPTS  531

Query  792   QYHYQGMGDPFAPPIGHG------YFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSG  631
                  G GD  +   G        YFP + MP    AVS SAVEQ++             
Sbjct  532   SSSTAG-GDFMSSACGARLMSAPVYFPSFSMP----AVSGSAVEQVSH------------  574

Query  630   GGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPM  451
               V  +   +NSC              +  + A +D+E+Q S ASS              
Sbjct  575   --VAASQHKRNSC--------------SEAVLASRDSEVQGSSASS--------------  604

Query  450   EGRSVLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
                            +   A+QP       RVIRVVPH AR+ASESAARIF+SIQ ERKQ
Sbjct  605   -------------PASSETAAQP-------RVIRVVPHTARTASESAARIFRSIQMERKQ  644



>gb|KDO79982.1| hypothetical protein CISIN_1g004928mg [Citrus sinensis]
Length=435

 Score =   197 bits (500),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 149/368 (40%), Positives = 203/368 (55%), Gaps = 42/368 (11%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNN-ASNLIPPS  2161
             IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIP+QRF  GVLP NP+N +S + P S
Sbjct  10    IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPTQRFSTGVLPLNPSNSSSLVPPVS  69

Query  2160  PSQGNGHERRMFLPMHLPPS--TYSAEKLHAH---SSDSNTPLTQFE-SRKKTDEDDFRV  1999
              SQGNG ER +     + PS  T+  EK H+     +  NT L   E S+K ++EDDF V
Sbjct  70    SSQGNGLERNLLFAHSVHPSTPTHLDEKCHSDQPAGATLNTHLQHHEQSKKVSEEDDFAV  129

Query  1998  PVFVNSNISQSIGKFYKNSEREKVSPSSPAFLGRSTK----------------DAKHTRG  1867
             P+F  + + Q  GK   + ++  +SP +P+   +STK                 +   +G
Sbjct  130   PIFDQAGMGQCHGKSQSDVDKGNLSPFNPSNTRKSTKFQNACDKNPKRSSSSSISLRQQG  189

Query  1866  GNLRHQESSRQLPATREQSVKASLSSRSTDKKEHCIKHT----DTDFPLHSEQRDGPANN  1699
             G++  QE+ +   +      K+S++    +K +  +K      + ++   S       N+
Sbjct  190   GHV-CQENPKICISIGNFPAKSSVNLSIREKIDGIVKEVSASPNQEYREISGSDFSRIND  248

Query  1698  SDLSHK--SGINLQPESIIDSKVGDANDD---AVVSGPIKGVEIGDSSVPINCFQTEGQI  1534
             SD S +  SG  L P         D+  D    VV  P      GD+    +C    G  
Sbjct  249   SDASLRLESGAGLPPNGCCRYDDVDSTGDFQKEVVLQP-----RGDTHSTEDCGHRSG--  301

Query  1533  INVGNDVESQENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKA  1354
               + ND     ++TC S Q    D+ D+ SETSMV+ +SG+D+SPDDVVGIIG KHFWKA
Sbjct  302   --LHNDSRYHVDKTCGSLQLGSGDKSDDVSETSMVDSMSGVDMSPDDVVGIIGHKHFWKA  359

Query  1353  RRAIVNQQ  1330
             RRAIVN++
Sbjct  360   RRAIVNRE  367



>gb|KDO79980.1| hypothetical protein CISIN_1g004928mg [Citrus sinensis]
Length=368

 Score =   192 bits (489),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 148/367 (40%), Positives = 202/367 (55%), Gaps = 46/367 (13%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNN-ASNLIPPS  2161
             IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIP+QRF  GVLP NP+N +S + P S
Sbjct  10    IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPTQRFSTGVLPLNPSNSSSLVPPVS  69

Query  2160  PSQGNGHERRMFLPMHLPPS--TYSAEKLHAH---SSDSNTPLTQFE-SRKKTDEDDFRV  1999
              SQGNG ER +     + PS  T+  EK H+     +  NT L   E S+K ++EDDF V
Sbjct  70    SSQGNGLERNLLFAHSVHPSTPTHLDEKCHSDQPAGATLNTHLQHHEQSKKVSEEDDFAV  129

Query  1998  PVFVNSNISQSIGKFYKNSEREKVSPSSPAFLGRSTK----------------DAKHTRG  1867
             P+F  + + Q  GK   + ++  +SP +P+   +STK                 +   +G
Sbjct  130   PIFDQAGMGQCHGKSQSDVDKGNLSPFNPSNTRKSTKFQNACDKNPKRSSSSSISLRQQG  189

Query  1866  GNLRHQESSRQLPATREQSVKASLSSRSTDKKEHCIKHT----DTDFPLHSEQRDGPANN  1699
             G++  QE+ +   +      K+S++    +K +  +K      + ++   S       N+
Sbjct  190   GHV-CQENPKICISIGNFPAKSSVNLSIREKIDGIVKEVSASPNQEYREISGSDFSRIND  248

Query  1698  SDLSHK--SGINLQPESI-----IDSKVGDANDDAVVSGPIKGVEIGDSSVPINCFQTEG  1540
             SD S +  SG  L P        +DS  GD   + V+         GD+    +C    G
Sbjct  249   SDASLRLESGAGLPPNGCCRYDDVDS-TGDFQKEVVLQ------PRGDTHSTEDCGHRSG  301

Query  1539  QIINVGNDVESQENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFW  1360
                 + ND     ++TC S Q    D+ D+ SETSMV+ +SG+D+SPDDVVGIIG KHFW
Sbjct  302   ----LHNDSRYHVDKTCGSLQLGSGDKSDDVSETSMVDSMSGVDMSPDDVVGIIGHKHFW  357

Query  1359  KARRAIV  1339
             KARRAIV
Sbjct  358   KARRAIV  364



>gb|KDO79983.1| hypothetical protein CISIN_1g004928mg [Citrus sinensis]
 gb|KDO79984.1| hypothetical protein CISIN_1g004928mg [Citrus sinensis]
Length=365

 Score =   192 bits (488),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 148/367 (40%), Positives = 202/367 (55%), Gaps = 46/367 (13%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNN-ASNLIPPS  2161
             IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIP+QRF  GVLP NP+N +S + P S
Sbjct  10    IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPTQRFSTGVLPLNPSNSSSLVPPVS  69

Query  2160  PSQGNGHERRMFLPMHLPPS--TYSAEKLHAH---SSDSNTPLTQFE-SRKKTDEDDFRV  1999
              SQGNG ER +     + PS  T+  EK H+     +  NT L   E S+K ++EDDF V
Sbjct  70    SSQGNGLERNLLFAHSVHPSTPTHLDEKCHSDQPAGATLNTHLQHHEQSKKVSEEDDFAV  129

Query  1998  PVFVNSNISQSIGKFYKNSEREKVSPSSPAFLGRSTK----------------DAKHTRG  1867
             P+F  + + Q  GK   + ++  +SP +P+   +STK                 +   +G
Sbjct  130   PIFDQAGMGQCHGKSQSDVDKGNLSPFNPSNTRKSTKFQNACDKNPKRSSSSSISLRQQG  189

Query  1866  GNLRHQESSRQLPATREQSVKASLSSRSTDKKEHCIKHT----DTDFPLHSEQRDGPANN  1699
             G++  QE+ +   +      K+S++    +K +  +K      + ++   S       N+
Sbjct  190   GHV-CQENPKICISIGNFPAKSSVNLSIREKIDGIVKEVSASPNQEYREISGSDFSRIND  248

Query  1698  SDLSHK--SGINLQPESI-----IDSKVGDANDDAVVSGPIKGVEIGDSSVPINCFQTEG  1540
             SD S +  SG  L P        +DS  GD   + V+         GD+    +C    G
Sbjct  249   SDASLRLESGAGLPPNGCCRYDDVDS-TGDFQKEVVLQ------PRGDTHSTEDCGHRSG  301

Query  1539  QIINVGNDVESQENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFW  1360
                 + ND     ++TC S Q    D+ D+ SETSMV+ +SG+D+SPDDVVGIIG KHFW
Sbjct  302   ----LHNDSRYHVDKTCGSLQLGSGDKSDDVSETSMVDSMSGVDMSPDDVVGIIGHKHFW  357

Query  1359  KARRAIV  1339
             KARRAIV
Sbjct  358   KARRAIV  364



>emb|CAN79509.1| hypothetical protein VITISV_038336 [Vitis vinifera]
Length=333

 Score =   191 bits (486),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 144/342 (42%), Positives = 185/342 (54%), Gaps = 53/342 (15%)
 Frame = -3

Query  2334  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPP-SP  2158
             MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLS+PSQR + GV+P   NNASNL+PP S 
Sbjct  1     MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSVPSQRCNPGVMPLKSNNASNLVPPASS  60

Query  2157  SQGNGHERRMFLPMHLPPS--TYSAEKLHAHSSDS---NTPLTQFESRKKT-DEDDFRVP  1996
             SQG+GHER +F P H+ PS  T+  EKLHA  SD+   NTPL QFE RKK  DEDDFRVP
Sbjct  61    SQGSGHERGVFFPHHISPSTPTHLPEKLHARHSDAVILNTPLAQFEQRKKQGDEDDFRVP  120

Query  1995  VFVNSNISQSIGKFYKNSEREKVSPSSPAFLGRST-------KDAKHTRGGNLRHQESSR  1837
             +FV+S  ++  G+   + +RE ++PSS   LG S        K+ K T    L  ++  R
Sbjct  121   IFVHSG-TEFHGRNQNSIDREILTPSSSTCLGHSINLQNACEKELKRTSSNGLSVRQDMR  179

Query  1836  --------QLPATREQSVKASLSSRSTDKKEHCIKHTDTDFPLHSEQRD-GPANNSDLSH  1684
                        ++RE S K++ +  + +K +  +K  +   P   + RD   AN S L  
Sbjct  180   SQGDVNRKDYVSSREYSEKSASNLSTKEKIDESMKQVNK--PSSEDFRDQSSANFSSLHD  237

Query  1683  KSGINLQ----------PESIIDSKVGDAND----DAVVSGPIKGVEIGDSSVPINCFQT  1546
               G  LQ          P+ +    V  A D      V S    G  +G  S P      
Sbjct  238   TDGCLLQGNRAGTQLGEPDHVDCVSVETARDAWNPSRVRSSSYSGDGLGSPSEP------  291

Query  1545  EGQIINVGNDVESQENQTCRSPQTQKVDRGDNSSETSMVECI  1420
                     ND     ++TC + Q   VD  D+ SETSMV+ +
Sbjct  292   -------DNDGACHGDKTCGTLQKGNVDTNDDLSETSMVDSM  326



>ref|XP_004510333.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Cicer arietinum]
 ref|XP_004510334.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Cicer arietinum]
 ref|XP_004510335.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X3 [Cicer arietinum]
Length=702

 Score =   196 bits (498),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 154/403 (38%), Positives = 206/403 (51%), Gaps = 72/403 (18%)
 Frame = -3

Query  1416  GMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNFLLEDT  1237
             GMDISPDDVVG+IG K FW  R+ I+NQQR+F +QVFELHRLIKVQ+LIA SP+ L ED 
Sbjct  348   GMDISPDDVVGLIGDKQFWNTRKTIINQQRIFLMQVFELHRLIKVQRLIAGSPHLLFEDK  407

Query  1236  AYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPHLRMECSAENTVGKASLSSVQN  1057
             +    P+  SS K+L    E      ++   KN              N VG   L SV N
Sbjct  408   S----PIITSSPKKLDDKSEKAATSDDI---KN--------------NVVGNIHLPSVNN  446

Query  1056  ATQAPSCKPSPGN---PPLPVVSND-----SNMGPWCFH-QPSGHQWLIPVMTPSEGLVY  904
              T+  +  P+  N     L + SND     S   P   +  P  +QWL+PVM+PSEGLVY
Sbjct  447   ITKEHNHLPNYVNHHLGNLALASNDIKNSNSKQSPNIVYPPPPANQWLVPVMSPSEGLVY  506

Query  903   KPYPGPGFMSPGCGPPPVSTPVMGNFFAPPAYGLPTSQYHYQGMGDPFAPPIGH------  742
             KP  GP      C  PP S+ V       P +G  +S     G  D     +G       
Sbjct  507   KPIIGP------C--PPNSSLV------APLFGACSSLSLNPGNKDVLDQSLGTNCHQKV  552

Query  741   GYFPPYGMP------VMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQN-SCNMP  583
             G F    +P       M+ ++S SA+EQM   +  G++   S    N    +Q  S NM 
Sbjct  553   GIFSSSSLPQLLPTSFMHRSISASAIEQMEQ-SNYGTKNHQS----NAEFMYQTPSSNMS  607

Query  582   SQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVN  403
             +Q +     + ++      + E+Q S ASSPS R         M+G   LPLFP +P + 
Sbjct  608   TQISQVMSRNISNYQSYEDNKELQISRASSPSKR---------MKGVDELPLFPVAPTL-  657

Query  402   IVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERK  274
                + +     + +RVI+ +PHNA+SASESAARIF+SIQ+ERK
Sbjct  658   WPSSDRDTRVENQSRVIKALPHNAKSASESAARIFKSIQEERK  700


 Score = 69.7 bits (169),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -3

Query  2334  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIP  2230
             + PMFPRLHV D EKGGP+APPRNKMALYEQ SIP
Sbjct  11    ISPMFPRLHVKDAEKGGPKAPPRNKMALYEQFSIP  45



>ref|XP_009384525.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=578

 Score =   194 bits (492),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 123/286 (43%), Positives = 168/286 (59%), Gaps = 20/286 (7%)
 Frame = -3

Query  1473  QKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHR  1294
             + ++R D++SE  MV+ + G+ ISPDD+VG+IG KHFWKARRAI+NQQR FA+QVFELHR
Sbjct  286   RDLERKDDASEPLMVDTVPGLVISPDDIVGVIGSKHFWKARRAIINQQRDFAIQVFELHR  345

Query  1293  LIKVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPHLR  1114
             +IKVQKLI+ SP+ LLE   YL K   V    + LP       P+   + K+  + P   
Sbjct  346   VIKVQKLISASPHLLLEGNPYLSK-CSVKPPNKTLPQCNTNPQPEEF-RPKDGLQNPKQN  403

Query  1113  MECSAENTVGKASLSSVQNAT------QAPSCKPSPGNP-PLPVVSNDSNMGPWCFHQPS  955
              E  A+N  G ++L + ++ +      Q P    + G P P+P+  +D +  P CF  P 
Sbjct  404   KEQPADNIAGVSALPACEDGSKGGPHGQVPKAGSNSGIPSPVPMAPDDKSR-PLCF-PPL  461

Query  954   GHQWLIPVMTPSEGLVYKPYPGP-----GFMSP--GCGPPPVSTPVMGNFFAPPAYGLPT  796
             G+QWL+PVM+PSEGLVYKPY GP     GFM+P  G G P  ++ V G+F    A+G   
Sbjct  462   GNQWLVPVMSPSEGLVYKPYTGPCPPTGGFMAPLYGRGTPLGASQVAGDFIN-SAFGFSA  520

Query  795   SQYHYQGMGDPFAPPIGHGYFP-PYGMPVMNSAVSTSAVEQMNSFT  661
             S         P    I   Y+P PYG+   N  +STSAV+Q  S +
Sbjct  521   SHRPPNVGILPGPSAIAPLYYPTPYGLQAWNPIISTSAVKQEGSIS  566



>gb|EMT17013.1| Protein EARLY FLOWERING 3 [Aegilops tauschii]
Length=640

 Score =   193 bits (490),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 125/269 (46%), Positives = 155/269 (58%), Gaps = 24/269 (9%)
 Frame = -3

Query  1431  VECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNF  1252
             VE +  ++ISPDDVVG IG KHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIA SP+ 
Sbjct  371   VESLPDLEISPDDVVGAIGPKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAASPHL  430

Query  1251  LLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPHLRMECSAENTVGKASL  1072
             L+E    LG  L V+S K+        +      K  +D++    + E S +NT G  + 
Sbjct  431   LIEGDPCLGSAL-VTSKKKTAAANVEKQLLSAKSKDDDDAQLTLQQAEYSKDNTEGNQAS  489

Query  1071  SS-------VQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPVMTPSEG  913
              S       V++  QA S      NPP      D+    WC   P  +QWL+PVM+PSEG
Sbjct  490   RSQDNDVVEVRHENQAASNGAVSSNPPAMPAPPDNKQNNWCA-PPPQNQWLVPVMSPSEG  548

Query  912   LVYKPYPGP-----GFMSP---GCGPPPVSTPVMGNFFAPPAYGLPT-SQYHYQGMGDPF  760
              VYKPY GP       ++P    C   P+S P     F    YG+P   Q H+ G+G P 
Sbjct  549   FVYKPYTGPCPPAGSILAPFYASCA--PLSLPSTAGEFMNSPYGIPMPHQPHHMGVGGPP  606

Query  759   A-PPIGHGYFPPYGMPVMNSAVSTSAVEQ  676
             A PP+   YFPP+ +PVMN  VS+SAVEQ
Sbjct  607   AMPPM---YFPPFSVPVMNPVVSSSAVEQ  632



>ref|XP_007135598.1| hypothetical protein PHAVU_010G142900g [Phaseolus vulgaris]
 ref|XP_007135600.1| hypothetical protein PHAVU_010G142900g [Phaseolus vulgaris]
 ref|XP_007135601.1| hypothetical protein PHAVU_010G142900g [Phaseolus vulgaris]
 gb|ESW07592.1| hypothetical protein PHAVU_010G142900g [Phaseolus vulgaris]
 gb|ESW07594.1| hypothetical protein PHAVU_010G142900g [Phaseolus vulgaris]
 gb|ESW07595.1| hypothetical protein PHAVU_010G142900g [Phaseolus vulgaris]
Length=655

 Score =   190 bits (483),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 166/414 (40%), Positives = 222/414 (54%), Gaps = 44/414 (11%)
 Frame = -3

Query  1467  VDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLI  1288
             +D+G  + +    E  S M ISPD+VVG IG++ FWKARR IVNQQ++F +QVFELHRLI
Sbjct  268   LDKGAGNED----EETSAMHISPDNVVGAIGEQQFWKARRTIVNQQKIFVMQVFELHRLI  323

Query  1287  KVQKLIAESPNFLLEDTAYLGK-PLKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPHLRM  1111
             KVQ+LIA SP+ LL D   L K P K S+ K+    F   K P +V K  + S K     
Sbjct  324   KVQRLIAGSPHILLIDNLLLNKPPPKTSTTKKFQSDFVGEK-PSSVVKLDSKSVKAPT-A  381

Query  1110  ECSAENTVGKASLSSVQNATQAPSCK-PSPGN--PPLPVVSNDSN--MGPWCFHQPSGHQ  946
             E +  + V K  +    N T+  + + P+ G+    LP+ S+D+N    P   + P G+Q
Sbjct  382   EHATNSAVEKIPIPCFNNITKGHTNQPPNFGHHLAKLPIASSDTNSKQSPSYVYPPPGNQ  441

Query  945   WLIPVMTPSEGLVYKPYPGP-----GFMSP---GCGPPPVSTPVMGNFFAPPAYGLPTSQ  790
             WL+PVM+PSEGLVYKP  GP     GFM+P    CG   VS   +    +  A   P+S 
Sbjct  442   WLVPVMSPSEGLVYKPVLGPCPPNAGFMAPIYGTCG--SVSFNPLSKDVSSEAALAPSSH  499

Query  789   YHYQGMGDPFAPPIGHGYFPPYGMPVMN--SAVSTSAVEQMNSFTRTGSQAQVSGGGVNL  616
               +  +     P     + PP   P ++  S++S SAVEQM      G +   S G VN 
Sbjct  500   QKFGILSGSSLP----QFLPP---PFIHNPSSISASAVEQMGQ--SNGPENHNSCGEVNS  550

Query  615   NVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSV  436
              + +Q+S N+ S         +    H+ KD E Q S ASSPS R         M    V
Sbjct  551   AIIYQSSSNI-SSPTSQVMSRNISTHHSPKDKEPQRSTASSPSKR---------MSAAEV  600

Query  435   LPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERK  274
             LPLFP +P     +         P RVI+ +PHN +SASESAARIF+SIQ+ERK
Sbjct  601   LPLFPLAPTFWQTEDRNTQVELQP-RVIKAMPHNPKSASESAARIFRSIQEERK  653


 Score = 74.7 bits (182),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -3

Query  2334  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG  2209
             + PMFPRLHV D EKGGP+APPRNKMALYEQ SIPSQ F  G
Sbjct  14    ISPMFPRLHVKDAEKGGPKAPPRNKMALYEQFSIPSQSFAPG  55



>gb|EMS61286.1| hypothetical protein TRIUR3_19149 [Triticum urartu]
Length=639

 Score =   190 bits (482),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 123/270 (46%), Positives = 155/270 (57%), Gaps = 24/270 (9%)
 Frame = -3

Query  1431  VECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNF  1252
             VE +  ++ISPDDVVG IG KHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIA SP+ 
Sbjct  377   VESLPDLEISPDDVVGAIGPKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAASPHL  436

Query  1251  LLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPHLRMECSAENTVGKAS-  1075
             L+E    LG  L V+S K+        +      K  +D++    + E S +NT G  + 
Sbjct  437   LIEGDPCLGSAL-VTSKKKTAAANVEKQLLSAKSKDDDDAQLTLQQAEYSKDNTEGNQAS  495

Query  1074  ------LSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPVMTPSEG  913
                   +  V++  QA S      NPP      D+    WC   P  +QWL+PVM+PSEG
Sbjct  496   PSQDNDVVEVRHENQAASNGAVSSNPPAMPAPPDNKQNNWC-APPPQNQWLVPVMSPSEG  554

Query  912   LVYKPYPGP-----GFMSP---GCGPPPVSTPVMGNFFAPPAYGLPT-SQYHYQGMGDPF  760
              VYKPY GP       ++P    C   P+S P     F    YG+P   Q  + G+G P 
Sbjct  555   FVYKPYTGPCPPAGSILAPFYASCA--PLSLPSTAGEFMNSPYGIPMPHQPQHMGVGGPP  612

Query  759   A-PPIGHGYFPPYGMPVMNSAVSTSAVEQM  673
             A PP+   YFPP+ +PVMN  VS+SAVEQ+
Sbjct  613   AMPPM---YFPPFSVPVMNPVVSSSAVEQL  639



>ref|XP_007135599.1| hypothetical protein PHAVU_010G142900g [Phaseolus vulgaris]
 ref|XP_007135602.1| hypothetical protein PHAVU_010G142900g [Phaseolus vulgaris]
 ref|XP_007135603.1| hypothetical protein PHAVU_010G142900g [Phaseolus vulgaris]
 gb|ESW07593.1| hypothetical protein PHAVU_010G142900g [Phaseolus vulgaris]
 gb|ESW07596.1| hypothetical protein PHAVU_010G142900g [Phaseolus vulgaris]
 gb|ESW07597.1| hypothetical protein PHAVU_010G142900g [Phaseolus vulgaris]
Length=662

 Score =   190 bits (483),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 166/414 (40%), Positives = 222/414 (54%), Gaps = 44/414 (11%)
 Frame = -3

Query  1467  VDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLI  1288
             +D+G  + +    E  S M ISPD+VVG IG++ FWKARR IVNQQ++F +QVFELHRLI
Sbjct  275   LDKGAGNED----EETSAMHISPDNVVGAIGEQQFWKARRTIVNQQKIFVMQVFELHRLI  330

Query  1287  KVQKLIAESPNFLLEDTAYLGK-PLKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPHLRM  1111
             KVQ+LIA SP+ LL D   L K P K S+ K+    F   K P +V K  + S K     
Sbjct  331   KVQRLIAGSPHILLIDNLLLNKPPPKTSTTKKFQSDFVGEK-PSSVVKLDSKSVKAPT-A  388

Query  1110  ECSAENTVGKASLSSVQNATQAPSCK-PSPGN--PPLPVVSNDSN--MGPWCFHQPSGHQ  946
             E +  + V K  +    N T+  + + P+ G+    LP+ S+D+N    P   + P G+Q
Sbjct  389   EHATNSAVEKIPIPCFNNITKGHTNQPPNFGHHLAKLPIASSDTNSKQSPSYVYPPPGNQ  448

Query  945   WLIPVMTPSEGLVYKPYPGP-----GFMSP---GCGPPPVSTPVMGNFFAPPAYGLPTSQ  790
             WL+PVM+PSEGLVYKP  GP     GFM+P    CG   VS   +    +  A   P+S 
Sbjct  449   WLVPVMSPSEGLVYKPVLGPCPPNAGFMAPIYGTCG--SVSFNPLSKDVSSEAALAPSSH  506

Query  789   YHYQGMGDPFAPPIGHGYFPPYGMPVMN--SAVSTSAVEQMNSFTRTGSQAQVSGGGVNL  616
               +  +     P     + PP   P ++  S++S SAVEQM      G +   S G VN 
Sbjct  507   QKFGILSGSSLP----QFLPP---PFIHNPSSISASAVEQMGQ--SNGPENHNSCGEVNS  557

Query  615   NVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSV  436
              + +Q+S N+ S         +    H+ KD E Q S ASSPS R         M    V
Sbjct  558   AIIYQSSSNI-SSPTSQVMSRNISTHHSPKDKEPQRSTASSPSKR---------MSAAEV  607

Query  435   LPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERK  274
             LPLFP +P     +         P RVI+ +PHN +SASESAARIF+SIQ+ERK
Sbjct  608   LPLFPLAPTFWQTEDRNTQVELQP-RVIKAMPHNPKSASESAARIFRSIQEERK  660


 Score = 74.7 bits (182),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -3

Query  2334  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG  2209
             + PMFPRLHV D EKGGP+APPRNKMALYEQ SIPSQ F  G
Sbjct  14    ISPMFPRLHVKDAEKGGPKAPPRNKMALYEQFSIPSQSFAPG  55



>ref|XP_010097103.1| hypothetical protein L484_019542 [Morus notabilis]
 gb|EXB66904.1| hypothetical protein L484_019542 [Morus notabilis]
Length=464

 Score =   186 bits (471),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 150/364 (41%), Positives = 200/364 (55%), Gaps = 34/364 (9%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDH--GVLPPNPN-NASNLIP  2167
             I GPMFPRLHVN  +KGGPRAPPRNKMALYEQLSIPSQR +   GV+P NP  +A+++  
Sbjct  10    IAGPMFPRLHVNYADKGGPRAPPRNKMALYEQLSIPSQRGNSASGVVPLNPKFSANSVPS  69

Query  2166  PSPSQGNGHERRMFLPMHLPPST--YSAEKLHAHSSD---SNTPLTQFESRKKT-DEDDF  2005
              SPSQG+G ER +F P HLPPST  + +EK HAH SD    N    + E RKK  D+DDF
Sbjct  70    SSPSQGSGFERNLFFPRHLPPSTPTHWSEKCHAHHSDVRNGNNMEARLEQRKKVGDKDDF  129

Query  2004  RVPVFVNSNISQSIGKFYKNSEREKVSPSSPAFLGR-------STKDAKHTRGGNLRHQE  1846
              VPVFV + + +S  K     +RE VS  S    G+       S KD K      +  ++
Sbjct  130   MVPVFVQARVGKSSDKTQNTIDRESVSSMSSPCSGQPVERQNISKKDPKQDNSVAVNFRQ  189

Query  1845  SSRQLPATREQSVKA------SLSSRSTDKKEHCIKHTDTDFPLHSEQ--RDGPANNSDL  1690
               R   + R++++K       ++ S +       I     +    S Q  R    +N   
Sbjct  190   EMR---SERKENMKGCDRSGNTVISATDQSNREMIDGAMKEAKTSSNQAHRGRAVSNLSR  246

Query  1689  SHKSGINLQPESIIDSKVGDA--NDDAVVSG-PIKGVEIGDSSVPINCFQTEG---QIIN  1528
             SH   +    +S + +++  +  +DD V S   I+G     S     C +  G   +  N
Sbjct  247   SHDGDVCSNQDSRVGARLYSSRQDDDRVDSTRDIEGANTSQSRSVSLCREDHGRPGETEN  306

Query  1527  VGNDVESQENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARR  1348
             V     S  N+TC S Q +  D+GD+ SETS+V+ IS   ISPDD+VGIIGQ HFWKARR
Sbjct  307   VSKQ-NSNSNRTCISLQLENADKGDDLSETSVVDSISDFHISPDDIVGIIGQNHFWKARR  365

Query  1347  AIVN  1336
             AIV+
Sbjct  366   AIVD  369



>emb|CDY35321.1| BnaA04g15260D [Brassica napus]
Length=599

 Score =   184 bits (467),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 162/410 (40%), Positives = 200/410 (49%), Gaps = 92/410 (22%)
 Frame = -3

Query  1401  PDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGK  1222
             PD+VVG+IGQK FW+AR+AI NQQR+FAVQ+FELHRLIKVQ+LIA S + LL++ +YLG 
Sbjct  239   PDEVVGVIGQKRFWRARKAIANQQRIFAVQLFELHRLIKVQRLIASSSDVLLDEISYLGN  298

Query  1221  PLKVSSAKRLLPPFEYIKAPQNVP---KHKN-DSEKP-HLRMECSAENTVGKASLSSVQN  1057
                    K+LLP  E+I  P  +P   KH+  DSEK    +MECSAEN VGK+S    Q+
Sbjct  299   ----VPVKKLLPS-EFIVKPPPLPQVTKHRRGDSEKTDQDKMECSAENVVGKSSNQGQQH  353

Query  1056  ATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQP----SGHQWLIPVMTPSEGLVYKPYPG  889
               Q  +  P   NPP  V          C++ P       QWLIPVM+PSEGL+YK    
Sbjct  354   --QPSNYMPFASNPPTAVNG--------CYYPPPPSGGNQQWLIPVMSPSEGLIYK----  399

Query  888   PGFMSPGCGPPPVSTPVMGNFFAPPAYGLPTSQYHYQGMGDPFAPPIGHGYFPPYGMPVM  709
                       PPV     G+F   P                   P +G+GYFPPYGM  M
Sbjct  400   ----PHPGPGPPVCGGYYGHFMPAPMMMGSFMGGGPPPF----HPGVGNGYFPPYGM--M  449

Query  708   NSAVSTSAV-----EQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNMP-SQKNGDADVSDA  547
             N   S         EQMN F               +N Q Q+S N   SQ+        A
Sbjct  450   NPYGSGHQQQQQPSEQMNQFVHP------------VNTQQQSSVNEAISQQQPTKSYPRA  497

Query  546   HRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDASQPP----  379
              +         Q S  SSP  R P        EG S    F    VV+  D ++P     
Sbjct  498   RKSR-------QRSTGSSP--RGP--------EGISDTNSFRPFSVVDDDDNNEPEQMMT  540

Query  378   ---------------DTGHPARVIRVVPHNARSASESAARIFQSIQKERK  274
                            D G   RVI+VVPHNA+ ASE+AARIF+SIQ+ERK
Sbjct  541   TTTTTTRTTVTQTTRDGGAVTRVIKVVPHNAKLASENAARIFRSIQEERK  590


 Score = 76.3 bits (186),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 72/137 (53%), Gaps = 7/137 (5%)
 Frame = -3

Query  2328  PMFPRLHVNDTEKGG-PRAPPRNKMALYEQLSIPSQRF-DHGVLPPNPNNA--SNLIPPS  2161
             PMFPRLHVND +KGG PRAPPRNKMALYE L+IPS RF DH    P   N       P  
Sbjct  14    PMFPRLHVNDADKGGGPRAPPRNKMALYEHLTIPSHRFTDHHSSSPRHTNTLFPPPPPVP  73

Query  2160  PSQGNGHERRMFLPMHLPPSTYSAEKLHAHSSDSNTPLTQFESRKKT--DEDDFRVPVFV  1987
              +Q  G ER +    HL  S        +      T   +   ++KT  +EDDF VPV+ 
Sbjct  74    SNQPCGVERNL-TSQHLDSSASGHVTQMSSMEYVTTSAHRRRDQRKTLREEDDFAVPVYD  132

Query  1986  NSNISQSIGKFYKNSER  1936
             N + ++      +N E+
Sbjct  133   NDSSTRFQSPGRRNGEK  149



>emb|CDX76735.1| BnaC08g33210D [Brassica napus]
Length=586

 Score =   180 bits (457),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 115/262 (44%), Positives = 150/262 (57%), Gaps = 27/262 (10%)
 Frame = -3

Query  1449  SSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLI  1270
             S + SMV+ +S +D+SPDDVVG++GQK FW+AR+AI NQQRVFAVQ+FELHRLIKVQ+LI
Sbjct  201   SDDNSMVDSVSSLDVSPDDVVGVLGQKRFWRARKAIANQQRVFAVQLFELHRLIKVQRLI  260

Query  1269  AESPNFLLEDTAYLGK-PLKVSSAKRLLPPFEYIKAP--QNVPKHK--NDSEKP-HLRME  1108
             A SP+ L++D +Y+GK   K    K L  P  +I  P    V KH+  +DS+K    +ME
Sbjct  261   AASPDVLVDDMSYVGKVTAKSYPVKELHLPSGFIVKPPLPQVIKHRSSSDSDKTDQHKME  320

Query  1107  CSAENTVGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQP------SGHQ  946
             CSAEN VG+       +  Q PS      N  +P  +N  +    C++ P         Q
Sbjct  321   CSAENVVGRLPNQGQGHHHQQPS------NYMMPFATNQPSPN-GCYYPPQPPPSGGNQQ  373

Query  945   WLIPVMTPSEGLVYKPYPG--PGFMSPGCGPPPVSTPVMGNFFAPPAYGLPTSQYHYQGM  772
             WLIPVM+PSEGL+YKP+PG  PG   P CG         G+F   P +            
Sbjct  374   WLIPVMSPSEGLIYKPHPGPDPGHTGPVCG------GYYGHFMPAPMFMGGGGGQPPPFH  427

Query  771   GDPFAPPIGHGYFPPYGMPVMN  706
                     G+GYFPPYG  +MN
Sbjct  428   PGMGFLSHGNGYFPPYGGIMMN  449


 Score = 99.4 bits (246),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 74/125 (59%), Gaps = 18/125 (14%)
 Frame = -3

Query  2334  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDH----GVLPPNPNNASNLIP  2167
             + PMFPRLHV D EKGGPRAPPRNKMALYEQLSIPSQRF      G LP   N +S L+P
Sbjct  11    LEPMFPRLHVKDAEKGGPRAPPRNKMALYEQLSIPSQRFTSSDRAGSLP--RNTSSPLLP  68

Query  2166  PSPSQGNGHERRMFLPMHLPPSTYSAEKLHAHSSDSNTPLTQFESRKKTDEDDFRVPVFV  1987
             P PS   G +       H+P      E + A S+  +      + +   +EDDF VPVF+
Sbjct  69    PGPSSNQGTDN---FVSHMP----FMENVRASSAHHD-----HQRKIAREEDDFAVPVFI  116

Query  1986  NSNIS  1972
             NS  S
Sbjct  117   NSRCS  121



>ref|XP_009140718.1| PREDICTED: protein EARLY FLOWERING 3 [Brassica rapa]
Length=602

 Score =   180 bits (457),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 161/411 (39%), Positives = 200/411 (49%), Gaps = 94/411 (23%)
 Frame = -3

Query  1401  PDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGK  1222
             PD+VVG+IGQK FW+AR+AI NQQR+FAVQ+FELHRLIKVQ+LIA S + LL++ +YLG 
Sbjct  242   PDEVVGVIGQKRFWRARKAIANQQRIFAVQLFELHRLIKVQRLIASSSDVLLDEISYLGN  301

Query  1221  PLKVSSAKRLLPPFEYIKAPQNVP---KHKN-DSEKP-HLRMECSAENTVGKASLSSVQN  1057
                    K+LLP  E+I  P  +P   KH+  D EK    +MECSAEN VGK S    Q+
Sbjct  302   ----VPVKKLLPS-EFIVKPPPLPHATKHRRGDPEKTDQDKMECSAENVVGKLSNQGQQH  356

Query  1056  ATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQP----SGHQWLIPVMTPSEGLVYKPYPG  889
               Q  +  P   NPP  V          C++ P       QWLIPVM+PSEGL+YK    
Sbjct  357   --QPSNYMPFASNPPTAVNG--------CYYPPPPSGGNQQWLIPVMSPSEGLIYK----  402

Query  888   PGFMSPGCGPPPVSTPVMGNFFAPPAYGLPTSQYHYQGMGDPFAPPIGHGYFPPYGMPVM  709
                       PPV     G+F   P                   P +G+GYFPPYGM  M
Sbjct  403   ----PHPGPGPPVCGGYYGHFMPAPMMMGSFMGGGPPPF----HPGVGNGYFPPYGM--M  452

Query  708   NSAVSTSAV-----EQMNSFTR-TGSQAQVSGGGVNLNV-QHQNSCNMPSQKNGDADVSD  550
             N   S         EQMN F     +Q Q+S   VN  + Q Q + + P  +        
Sbjct  453   NPYGSGHQQQQQPSEQMNQFVHPVNTQQQIS---VNEAISQQQPTKSYPRARKSR-----  504

Query  549   AHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDASQPP---  379
                         Q S  SSP  R P        EG S    F    VV+  D ++P    
Sbjct  505   ------------QRSTGSSP--RGP--------EGISDTNSFRPLSVVDDDDNNEPEQMM  542

Query  378   ----------------DTGHPARVIRVVPHNARSASESAARIFQSIQKERK  274
                             D G   RVI+VVPHNA+ ASE+AARIF+SIQ+ERK
Sbjct  543   TTTTTTTRTTVTQTTRDGGAVTRVIKVVPHNAKLASENAARIFRSIQEERK  593


 Score = 75.9 bits (185),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 73/138 (53%), Gaps = 8/138 (6%)
 Frame = -3

Query  2328  PMFPRLHVNDTEKGG-PRAPPRNKMALYEQLSIPSQRF-DHGVLPPNPNNASNLIPPSPS  2155
             PMFPRLHVND +KGG PRAPPRNKMALYE L+IPS RF DH    P   N     PP P 
Sbjct  15    PMFPRLHVNDADKGGGPRAPPRNKMALYEHLTIPSHRFTDHHSSSPRHTNTLFPPPPPPG  74

Query  2154  QGN---GHERRMFLPMHLPPSTYSAEKLHAHSSDSNTPLTQFESRKKT--DEDDFRVPVF  1990
               N   G ER +    HL  S        +      T   +   ++KT  +EDDF VPV+
Sbjct  75    PSNQPCGVERNL-TSQHLDSSASGHVTQMSSMEYVTTSAHRRRDQRKTLREEDDFAVPVY  133

Query  1989  VNSNISQSIGKFYKNSER  1936
              N + ++      +N E+
Sbjct  134   DNDSSTRFQSPGRRNGEK  151



>emb|CDY66493.1| BnaCnng51090D [Brassica napus]
Length=553

 Score =   176 bits (447),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 109/240 (45%), Positives = 140/240 (58%), Gaps = 37/240 (15%)
 Frame = -3

Query  1401  PDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGK  1222
             PD+VVG++GQK FW+AR+AI NQQR+FAVQ+FELHRLIKVQ+LIA S + LL++ +YLG 
Sbjct  202   PDEVVGVLGQKRFWRARKAIANQQRIFAVQLFELHRLIKVQRLIASSSDVLLDEISYLGN  261

Query  1221  PLKVSSAKRLLPPFEYIKAPQNVP---KHK-NDSEKP-HLRMECSAENTVGKASLSSVQN  1057
                    K+LLP  E+I  P  +P   KH+ +DSEK    +ME SAEN VGK+S    Q+
Sbjct  262   ----VPVKKLLPS-EFILKPPPLPQVTKHRSSDSEKTDQNKMESSAENVVGKSSNQGQQH  316

Query  1056  ATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQP-------SGHQWLIPVMTPSEGLVYKP  898
               Q  +  P   NPP             C++ P          QWLIPVM+PSEGL+YKP
Sbjct  317   --QPSNYMPFASNPP---------AANGCYYPPQHPPPSGGNQQWLIPVMSPSEGLIYKP  365

Query  897   YPGPGFMSPGCGPPPVSTPVMGNFFAPPAYGLPTSQYHYQGMGDPFAPPIGHGYFPPYGM  718
             +PGPG            +PV G ++      L        G   PF P +G+GYFPPYGM
Sbjct  366   HPGPGH---------TGSPVCGGYYGHFMPALMIMGSFMDGGPPPFHPGVGNGYFPPYGM  416


 Score = 78.6 bits (192),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 70/122 (57%), Gaps = 7/122 (6%)
 Frame = -3

Query  2334  MGPMFPRLHVNDTEKGG-PRAPPRNKMALYEQLSIPSQRF-DHGVLPPNPNNASNLIPPS  2161
             + PMFPRLHVND +KGG PRAPPRNKMALYE L+ PS RF DH   P + N      P  
Sbjct  13    LEPMFPRLHVNDADKGGGPRAPPRNKMALYEHLTTPSHRFTDHSSSPRHTNTLFPPPPGP  72

Query  2160  PSQGNGHERRMFLPMHLPPSTYSAEKLHAHSSDSNTPLTQFES-RKKT--DEDDFRVPVF  1990
              +Q  G ER +    HL  S+ S       S ++ T L      ++KT  +EDDF VPV+
Sbjct  73    SNQPCGVERNL-TSQHL-DSSASGHVTQMSSMENVTTLAHRRGDQRKTLREEDDFAVPVY  130

Query  1989  VN  1984
              N
Sbjct  131   DN  132



>ref|XP_006297383.1| hypothetical protein CARUB_v10013409mg [Capsella rubella]
 gb|EOA30281.1| hypothetical protein CARUB_v10013409mg [Capsella rubella]
Length=538

 Score =   176 bits (445),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 135/415 (33%), Positives = 188/415 (45%), Gaps = 93/415 (22%)
 Frame = -3

Query  1500  NQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVF  1321
             N+T + P+T    R  ++S+ S ++ +SGM  S  D+  +IG+K FWK R  ++NQQ++F
Sbjct  206   NETQKKPKTLP-RREQDASDCSAIDSLSGMSASSYDIARVIGEKRFWKMRTYMINQQKIF  264

Query  1320  AVQVFELHRLIKVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHK  1141
             A QVFELHRLI VQK++A+SPN LLE     GK   + S+ +L      IK P    +  
Sbjct  265   AGQVFELHRLIMVQKMVAKSPNLLLESKLDGGKHTTMRSSHQLEMAASKIKKPNTENQKP  324

Query  1140  NDSEKP-HLRMECSAENTVGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFH  964
                E P H++ +                               PLP +S +  M P    
Sbjct  325   VTEEYPEHMKPKL------------------------------PLPSISKEL-MAPIWSQ  353

Query  963   Q---PSGHQWLIPVMTPSEGLVYKPYPGPGFMSPGCGPPPVSTPVMGNFFAPPAYGLPTS  793
             Q   P G+QWL+PVM+PSEGLVYKPY GP      C PP          F  P YG  + 
Sbjct  354   QLLPPPGNQWLVPVMSPSEGLVYKPYAGP------CPPPSA--------FMVPVYGQDSL  399

Query  792   QYHYQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLN  613
                ++    P +    H YFPP      NS  +         + R  S +      +  +
Sbjct  400   DSAFRF---PVSSQFSHSYFPP-----PNSRTTVDHANTFGQYQRWSSTSSHMTQAIPFS  451

Query  612   VQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVL  433
             ++     N                     D+E+  S ASSP  +              VL
Sbjct  452   LKKSQESN---------------------DSEVHGSTASSPPEK----------HKFEVL  480

Query  432   PLFPTSPVVNIVDASQPPDTGHP-ARVIRVVPHNARSASESAARIFQSIQKERKQ  271
             PLFPT P     +  Q      P  R I+ +PHN+ SASESAARIF+SIQ+ER++
Sbjct  481   PLFPTEPTHQTDECKQ---KQQPLLRAIKAIPHNSTSASESAARIFRSIQEERRE  532



>ref|XP_006406284.1| hypothetical protein EUTSA_v10020453mg [Eutrema salsugineum]
 gb|ESQ47737.1| hypothetical protein EUTSA_v10020453mg [Eutrema salsugineum]
Length=547

 Score =   171 bits (433),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 155/506 (31%), Positives = 215/506 (42%), Gaps = 124/506 (25%)
 Frame = -3

Query  1737  PLHSEQRDGPANNSDLSHKSGINLQPESIIDSKVGDANDDAVVSGPIKGVEIGDSSVPIN  1558
             P+       P  N+DLS      LQ  +   SK G   + A     +  + I    +P  
Sbjct  141   PVVRRSETDPKANTDLS------LQFCTSTSSKAG--GEAAGSKAALNNLHIRKHILP-E  191

Query  1557  CFQTEGQ-IINV---------GNDVESQENQTCRSPQTQKVDRGDNSSETSMVECISGMD  1408
             C + E Q ++           G ++E+Q+     SP+ Q V      S+ S+++ +S M 
Sbjct  192   CLEDESQNVVKTQLYRRRALDGFNIETQKKPKTVSPREQDV------SDCSVIDSLSAMS  245

Query  1407  ISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYL  1228
              S +DV  +IG K FWK R  ++NQQ++FA QVFE+HRLI VQK+IA+SPN +LE     
Sbjct  246   ASSNDVAKVIGDKRFWKMRTYMINQQKIFAAQVFEMHRLIMVQKMIAKSPNLVLES----  301

Query  1227  GKPLKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPHLRMECSAENTVGKASLSSVQNATQ  1048
                                       KH N  ++   R     E    K   S+ +N  Q
Sbjct  302   --------------------------KH-NGVKRGTTRSSHLLEIVTSKVKKSNTENHKQ  334

Query  1047  APSCKPSPGNP--PLPVVSND--SNMGPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGPGF  880
                  P    P  PLP +S D  + + P     P G+QWL+PVM+PSEGLVYKPY GP  
Sbjct  335   VTEDYPEHMKPKLPLPSISKDLVTPIWPQQLLPPPGNQWLVPVMSPSEGLVYKPYAGP--  392

Query  879   MSPGCGPPPVSTPVMGNFFAPPAYG---LPTSQYHYQGMGDPFAPPIGHGYFPPYGMPVM  709
                 C PPP S       F  P YG   L T+         P +    H YFP       
Sbjct  393   ----C-PPPSSA------FMVPIYGQDSLDTASRF------PVSTQFSHNYFP-------  428

Query  708   NSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHAC  529
             N   +         F R  S +      +  +++     N                    
Sbjct  429   NVRTTLEQTNPFGQFQRWSSSSSHMTQAIPFSLKKSQESN--------------------  468

Query  528   KDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDASQPPDTGHPA-RVI  352
              D+E+  S ASSP  +              VLPLFPT P  +  +     +   P  R I
Sbjct  469   -DSEVHGSTASSPPEK----------HKFEVLPLFPTEPTHHTDEYK---EKQQPLFRAI  514

Query  351   RVVPHNARSASESAARIFQSIQKERK  274
             + +PHN+ SASESAARIF+SIQ+ER+
Sbjct  515   KAIPHNSTSASESAARIFRSIQEERR  540



>ref|XP_006385404.1| hypothetical protein POPTR_0003s04030g [Populus trichocarpa]
 gb|ERP63201.1| hypothetical protein POPTR_0003s04030g [Populus trichocarpa]
Length=384

 Score =   166 bits (421),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 129/312 (41%), Positives = 164/312 (53%), Gaps = 38/312 (12%)
 Frame = -3

Query  1155  VPKHKNDSEKPHLRMECSAENTVGKASLSSVQNATQ----APSCKPSPGNPPLPVVSNDS  988
             V K K+ S+K H   + + EN VGK  L S  + T     +     S   PP PV +  +
Sbjct  2     VDKPKDHSQKQHTSADFAGENVVGKLPLPSTNDETSKEPISQRSNYSGSAPPAPVATT-A  60

Query  987   NMGPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGP-----GFMSP---GCGPPPVSTPVMG  832
                P C+  P G+QWL+PVM+PSEGLVYKPY GP      FM P    CGP  +S    G
Sbjct  61    KPSPRCY-PPPGNQWLVPVMSPSEGLVYKPYAGPCPPVSRFMEPVYGSCGP--ISLAPGG  117

Query  831   NFFAPPAYGLPTSQYHYQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTG  652
               F   AY +  S +   G+  P  P  G  +F P+GMPVMN ++  SAVEQ+    R G
Sbjct  118   GDFLNAAYSVSASNHEEIGI-LPGNPHFGQTFFQPFGMPVMNPSICDSAVEQIR--PRIG  174

Query  651   SQA---QVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVR  481
              Q+   Q++ G VN N+  Q+SCNM +Q +              K++EIQ S A S S  
Sbjct  175   PQSKDNQLAVGDVNFNIPLQSSCNMSNQMSRVISCC-VENFQGLKESEIQGSSAGSLSK-  232

Query  480   APGVTVSGPMEGRSVLPLFPTSPVVNIVDASQP--PDTGHPARVIRVVPHNARSASESAA  307
                      M   + LPLFP  P +    AS P        ARVI+VVPHN RSA+ESAA
Sbjct  233   ---------MPKANALPLFPMEPTL---QASYPNAQTNEQQARVIKVVPHNRRSATESAA  280

Query  306   RIFQSIQKERKQ  271
             RIFQSIQ+ERKQ
Sbjct  281   RIFQSIQEERKQ  292



>ref|XP_010466369.1| PREDICTED: protein EARLY FLOWERING 3-like [Camelina sativa]
 ref|XP_010466370.1| PREDICTED: protein EARLY FLOWERING 3-like [Camelina sativa]
Length=533

 Score =   168 bits (425),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 146/475 (31%), Positives = 208/475 (44%), Gaps = 106/475 (22%)
 Frame = -3

Query  1662  PESIIDSKVGDANDDAVVSGPIKGVEIGDSSVPINCFQTEGQ--IINVGNDVESQENQTC  1489
             P++  D  +     D+  +G   G  +G   +  +C + E Q   +NV      + +   
Sbjct  144   PQANTDLSLQFCTSDSSKAG---GEAVGSKILLSDCLEDESQNGSVNVMKTQLYRRSFAD  200

Query  1488  RSPQTQKVDRG--DNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAV  1315
              + +TQK  +    + S+ S ++ +SG+  S  DV  +IG+K FWK R  ++NQQ++FA 
Sbjct  201   FNNETQKKLKTLPQDVSDCSAIDSLSGLSASSYDVARVIGEKRFWKMRTFMINQQKIFAG  260

Query  1314  QVFELHRLIKVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKND  1135
             QVFELHRLIKVQK++A+SPN LLE                            NV KH   
Sbjct  261   QVFELHRLIKVQKMVAKSPNLLLESKV-------------------------NVDKHGT-  294

Query  1134  SEKPHLRMECSAENTVGKASLSSVQNATQAPSCKPSPG----NPPLPVVSND--SNMGPW  973
                    M  S +  +  + +       Q P  +  P     N PLP +S +  + + P 
Sbjct  295   -------MRSSHQQAMAASKIKKPNTENQKPVTEEYPEYMKPNLPLPSISKELMAPIWPQ  347

Query  972   CFHQPSGHQWLIPVMTPSEGLVYKPYPGPGFMSPGC-GPPPVSTPVMGNFFAPPAYGLPT  796
                 P G+QWL+PV+T SEGLVYKPY GP      C  P  +  PV G         L T
Sbjct  348   QLLPPPGNQWLVPVVTHSEGLVYKPYAGP------CPSPSALMVPVYGQ------DSLDT  395

Query  795   SQYHYQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNL  616
             + + +     P +    H YFPP          + + V+Q N F                
Sbjct  396   AAFRF-----PVSSQFSHSYFPPPN--------ARTTVDQTNPFG---------------  427

Query  615   NVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSV  436
               Q+Q   +  S        S   + H   D+E+  S ASSP  +              V
Sbjct  428   --QYQRWSSTSSHMTQAIPFS-LKKSHESNDSEVHGSTASSPPEK----------HKFEV  474

Query  435   LPLFPTSPV--VNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKER  277
             L LFPT P    +     Q P    P R I+ +PHN+ SASESAARIF+SIQ+ER
Sbjct  475   LQLFPTEPTHQTDEYKEKQQP----PLRAIKAIPHNSTSASESAARIFRSIQEER  525



>ref|XP_010536214.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010536215.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Tarenaya 
hassleriana]
Length=406

 Score =   164 bits (415),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 146/406 (36%), Positives = 187/406 (46%), Gaps = 89/406 (22%)
 Frame = -3

Query  1446  SETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIA  1267
             S+ S+V+   G +I  DDVVG IGQK FW+A+ AI  QQR+FA QVFELHRL+KVQ+LIA
Sbjct  75    SDVSLVDSGLGREIPLDDVVGSIGQKRFWRAKHAISKQQRLFAKQVFELHRLVKVQRLIA  134

Query  1266  ESPNFLLEDTAYLGKPLKVSSAKRLLP-PFEYIKAPQNVPKHKNDSEKPHLRMECSAENT  1090
              SP+ + +D A   KP   S  K  LP P   +K     P   +D   P    E SAENT
Sbjct  135   HSPHLVFDDAAIKVKP---SQKKEKLPKPCSVVK-----PWDNDDERDP----EGSAENT  182

Query  1089  VGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPVMTPSEGL  910
              G+        A   PS +      P+      +N+G     Q SGH WLIPVM+PSEGL
Sbjct  183   PGRFPSLPQMKAHNLPSNQLYLRGIPMA-----ANLG-RSIQQSSGHHWLIPVMSPSEGL  236

Query  909   VYKPYPGPGFMSPGCGPPPVSTPVMGNFFAPPAYGLPTSQYHYQGMGDPFAPPIGH---G  739
             +YKP P P     G G          NF  PP    P      Q  G  F+ P+ H    
Sbjct  237   IYKPCPAPSSFG-GWG-------RFSNFAFPPFGFPPPPPLLCQQKG-AFSLPVAHPMVN  287

Query  738   YFPPYGMPVMN-SAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNMPSQKNGDA  562
             +FPPY MPV+  ++     ++Q     R+GS            V+ Q+SCNM    NG  
Sbjct  288   HFPPYNMPVIYPTSFPGMHMDQRTHSNRSGS-----------TVRDQDSCNMLGPVNG--  334

Query  561   DVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDASQP  382
                                  + P V    V +                P   + DAS+ 
Sbjct  335   --------------------TTPPQVTRDNVRL---------------EPRQQVEDASRR  359

Query  381   P---------DTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
             P         +   P RV+R VP N R A ESAARIF+SIQ+ER +
Sbjct  360   PSNLGDSDETNMVQPGRVVRAVPCNPRLAPESAARIFRSIQEERTR  405



>gb|AAX23847.1| hypothetical protein At3g21320 [Arabidopsis thaliana]
Length=348

 Score =   162 bits (410),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 136/413 (33%), Positives = 183/413 (44%), Gaps = 90/413 (22%)
 Frame = -3

Query  1500  NQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVF  1321
             N+T + P+T    R   +S  S +E +SG+  S  D+  +IG+K FWK R  ++NQQ++F
Sbjct  15    NETQKKPKTLP-RREQVASNCSAIESLSGISASSYDIARVIGEKRFWKMRTYMINQQKIF  73

Query  1320  AVQVFELHRLIKVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHK  1141
             A QVFELHRLI VQK++A+SPN  LE                            N  KH 
Sbjct  74    AGQVFELHRLIMVQKMVAKSPNLFLESKL-------------------------NGVKHG  108

Query  1140  NDSEKPHLRMECSAENTVGKASLSSVQNATQAPSCKPSPGNP--PLPVVSND--SNMGPW  973
                    L M  S      K    + +N    P   P    P  PLP +S +  + + P 
Sbjct  109   TMRSSHQLAMAAS------KVRKPNTENHKPVPEEYPEHMKPKLPLPSISKELVTPIWPQ  162

Query  972   CFHQPSGHQWLIPVMTPSEGLVYKPYPGPGFMSPGCGPPPVSTPVMGNFFAPPAYGLPTS  793
                 P G+QWL+PV+T S+GLVYKP+PGP      C  PP S+  M      P YG  + 
Sbjct  163   QLLPPPGNQWLVPVITDSDGLVYKPFPGP------C--PPSSSAFMV-----PVYGQDSL  209

Query  792   QYHYQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLN  613
             +  ++    P + P  H YFPP          + + V+Q N F                 
Sbjct  210   ETPFRF---PVSSPFSHSYFPPPN--------ARTTVDQTNPFG----------------  242

Query  612   VQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVL  433
              Q Q   N  S        S   +     D++I  S ASSP  +              VL
Sbjct  243   -QFQRWSNTSSHMTQAIPFS-LKKSQESNDSDIHGSTASSPPEK----------HKLEVL  290

Query  432   PLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERK  274
             PLFPT P     +  Q        R I+ VPHN+ SASESAARIF+ IQ+ER+
Sbjct  291   PLFPTEPTHQTDEYKQKQQPM--LRAIKAVPHNSTSASESAARIFRFIQEERR  341



>gb|KHN39274.1| Protein EARLY FLOWERING 3 [Glycine soja]
Length=685

 Score =   166 bits (421),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 150/404 (37%), Positives = 199/404 (49%), Gaps = 68/404 (17%)
 Frame = -3

Query  1428  ECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNFL  1249
             EC   MDISPD+VVG IG++ FWK                        VQ+LIA SP+ L
Sbjct  331   ECTLAMDISPDNVVGAIGEQQFWK------------------------VQRLIAGSPHVL  366

Query  1248  LEDTAYLGKPL-KVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPHLRMECSAENTVGKASL  1072
             LED   L KP  K S+ K+    F   K P +V K  N S K +   E +  + VGK  +
Sbjct  367   LEDNLLLNKPPPKTSTTKKFQSDFASQK-PSSVVKLDNKSVKVNT-AEKATNSAVGKIPI  424

Query  1071  SSVQNAT-----QAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPVMTPSEGLV  907
               + N T     Q P+     GNP L    ++S   P   + P G+QWL+PVM+PSEGLV
Sbjct  425   PCISNTTKGHANQLPNYGHHLGNPALASADSNSKQSPSYVYPPPGNQWLVPVMSPSEGLV  484

Query  906   YKPY-----PGPGFMSP---GCGPPPVSTPVMGNFFAPPAYGLPTSQYHYQGMGDPFAPP  751
             YKP      P  GFM+P    CG   VS   +    +  A   P+S   +Q +G      
Sbjct  485   YKPIIWPCPPNAGFMAPIYGSCG--TVSFNPLSKDASSDAALAPSS---HQKLGILSGSS  539

Query  750   IGHGYFPPYGMPVMN--SAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNMPSQ  577
             + H + PP     MN  S++S SAVEQM      G +   S G VN  +  Q+S NM S 
Sbjct  540   LPH-FLPP---SFMNHPSSISASAVEQMGQ--SNGPENHHSWGEVNSAILFQSSSNMSSP  593

Query  576   KNGDA--DVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVN  403
              +     ++S  H  H+ KD E+Q S ASSPS R  G            LPLFP +P   
Sbjct  594   TSQVMPRNISTYH--HSLKDKELQRSTASSPSKRVSG----------EALPLFPLAPTFW  641

Query  402   IVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
               + +       P RVI+ +PHN ++ASE+AA+IF+SIQ+ERK 
Sbjct  642   QSEDTNTQVEQQP-RVIKAMPHNPKTASETAAKIFRSIQEERKH  684


 Score = 73.9 bits (180),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -3

Query  2334  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG  2209
             + PMFPRLHV D E+GGP+APPRNKMALYEQ SIPSQ F  G
Sbjct  15    ISPMFPRLHVKDAERGGPKAPPRNKMALYEQFSIPSQNFAPG  56



>ref|XP_010536213.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Tarenaya 
hassleriana]
Length=497

 Score =   163 bits (413),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 146/406 (36%), Positives = 187/406 (46%), Gaps = 89/406 (22%)
 Frame = -3

Query  1446  SETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIA  1267
             S+ S+V+   G +I  DDVVG IGQK FW+A+ AI  QQR+FA QVFELHRL+KVQ+LIA
Sbjct  166   SDVSLVDSGLGREIPLDDVVGSIGQKRFWRAKHAISKQQRLFAKQVFELHRLVKVQRLIA  225

Query  1266  ESPNFLLEDTAYLGKPLKVSSAKRLLP-PFEYIKAPQNVPKHKNDSEKPHLRMECSAENT  1090
              SP+ + +D A   KP   S  K  LP P   +K     P   +D   P    E SAENT
Sbjct  226   HSPHLVFDDAAIKVKP---SQKKEKLPKPCSVVK-----PWDNDDERDP----EGSAENT  273

Query  1089  VGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPVMTPSEGL  910
              G+        A   PS +      P+      +N+G     Q SGH WLIPVM+PSEGL
Sbjct  274   PGRFPSLPQMKAHNLPSNQLYLRGIPMA-----ANLG-RSIQQSSGHHWLIPVMSPSEGL  327

Query  909   VYKPYPGPGFMSPGCGPPPVSTPVMGNFFAPPAYGLPTSQYHYQGMGDPFAPPIGH---G  739
             +YKP P P     G G          NF  PP    P      Q  G  F+ P+ H    
Sbjct  328   IYKPCPAPSSFG-GWG-------RFSNFAFPPFGFPPPPPLLCQQKG-AFSLPVAHPMVN  378

Query  738   YFPPYGMPVMN-SAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNMPSQKNGDA  562
             +FPPY MPV+  ++     ++Q     R+GS            V+ Q+SCNM    NG  
Sbjct  379   HFPPYNMPVIYPTSFPGMHMDQRTHSNRSGS-----------TVRDQDSCNMLGPVNG--  425

Query  561   DVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDASQP  382
                                  + P V    V +                P   + DAS+ 
Sbjct  426   --------------------TTPPQVTRDNVRL---------------EPRQQVEDASRR  450

Query  381   P---------DTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
             P         +   P RV+R VP N R A ESAARIF+SIQ+ER +
Sbjct  451   PSNLGDSDETNMVQPGRVVRAVPCNPRLAPESAARIFRSIQEERTR  496


 Score = 57.4 bits (137),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDH  2212
             ++ P+FPR+H+ DTEKG  RAPPRNKMALYE+ +I   + +H
Sbjct  11    LVKPLFPRVHLRDTEKGSYRAPPRNKMALYERFTISPPKSNH  52



>emb|CDY48882.1| BnaA03g36210D [Brassica napus]
Length=490

 Score =   162 bits (411),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 150/475 (32%), Positives = 222/475 (47%), Gaps = 106/475 (22%)
 Frame = -3

Query  1680  SGINLQPESIIDSKV---GDANDDAVVSGPIKGVEIGDSSVPINCFQTEGQIINVGNDVE  1510
             S  N +P SI  ++      AN D++ +  +  + I +  +P  CF+ E Q  ++ N ++
Sbjct  107   SVTNTKPSSIKQNEYHFKSLANLDSLKAA-LNNLHIPELLLP-QCFEDESQNESL-NVMK  163

Query  1509  SQENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQ  1330
             +Q+      P  Q V      S+ S ++ +SG+  S +D   +IG K FWK R  ++NQQ
Sbjct  164   TQKKPKTVPPCEQDV------SDCSEIDSLSGISASSNDAARVIGDKRFWKMRTYMINQQ  217

Query  1329  RVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNV-  1153
             ++F  QVFELHRLI VQK++A SPN +L+ + + G  +++S +   LP     K  + + 
Sbjct  218   KIFEAQVFELHRLIMVQKMVARSPNLVLK-SRFNGDTMRLSHSH--LPEMAASKVKKTIT  274

Query  1152  PKHKNDSEK--PHLRMECSAENTVGKASLSSVQNATQAPSCKPSPGNPPLPVVSND--SN  985
              KHK  +E+   H++ +                               PLP ++ D  + 
Sbjct  275   KKHKPVTEEYPDHMKPKV------------------------------PLPSINKDLMTP  304

Query  984   MGPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGPGFMSPGCGPPPVSTPVMGNFFAPPAYG  805
             M P     P G+QWL+PVMTPSEGLVYKPY GP        PPP S       F  P YG
Sbjct  305   MWPQQLVPPPGNQWLVPVMTPSEGLVYKPYAGP-------SPPPSSA------FMVPFYG  351

Query  804   LPTSQYHYQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGG  625
               +       +G P +  + H YFP        S   T+   Q+  ++ T S        
Sbjct  352   QDSLN---PTLGFPVSTQLSHNYFPQPN--ARTSLDQTNPFGQLQRWSNTSSHM---TQA  403

Query  624   VNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEG  445
             V  +++        SQ++ D+DV                S ASSP           P + 
Sbjct  404   VPFSLKK-------SQESNDSDV--------------HGSTASSP-----------PEKH  431

Query  444   RS-VLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQK  283
             +S VLPLFPT P  +  +  Q        R IR +PHN+ SASESAARIF+SIQ+
Sbjct  432   KSDVLPLFPTEPTHHTDEYEQKQKPMR--RAIRAIPHNSTSASESAARIFRSIQE  484



>ref|NP_188769.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAV68859.1| hypothetical protein AT3G21320 [Arabidopsis thaliana]
 gb|AEE76492.1| uncharacterized protein AT3G21320 [Arabidopsis thaliana]
Length=540

 Score =   163 bits (413),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 137/414 (33%), Positives = 184/414 (44%), Gaps = 92/414 (22%)
 Frame = -3

Query  1500  NQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVF  1321
             N+T + P+T    R   +S  S +E +SG+  S  D+  +IG+K FWK R  ++NQQ++F
Sbjct  207   NETQKKPKTLP-RREQVASNCSAIESLSGISASSYDIARVIGEKRFWKMRTYMINQQKIF  265

Query  1320  AVQVFELHRLIKVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHK  1141
             A QVFELHRLI VQK++A+SPN  LE                            N  KH 
Sbjct  266   AGQVFELHRLIMVQKMVAKSPNLFLESKL-------------------------NGVKHG  300

Query  1140  NDSEKPHLRMECSAENTVGKASLSSVQNATQAPSCKPSPGNP--PLPVVSND--SNMGPW  973
                    L M  S      K    + +N    P   P    P  PLP +S +  + + P 
Sbjct  301   TMRSSHQLAMAAS------KVRKPNTENHKPVPEEYPEHMKPKLPLPSISKELVTPIWPQ  354

Query  972   CFHQPSGHQWLIPVMTPSEGLVYKPYPGPGFMSPGCGPPPVSTPVMGNFFAPPAYGLPTS  793
                 P G+QWL+PV+T S+GLVYKP+PGP      C  PP S+  M      P YG  + 
Sbjct  355   QLLPPPGNQWLVPVITDSDGLVYKPFPGP------C--PPSSSAFMV-----PVYGQDSL  401

Query  792   QYHYQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLN  613
             +  ++    P + P  H YFPP          + + V+Q N F                 
Sbjct  402   ETPFRF---PVSSPFSHSYFPPPN--------ARTTVDQTNPFG----------------  434

Query  612   VQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVL  433
              Q Q   N  S        S   +     D++I  S ASSP  +              VL
Sbjct  435   -QFQRWSNTSSHMTQAIPFS-LKKSQESNDSDIHGSTASSPPEK----------HKLEVL  482

Query  432   PLFPTSPVVNIVDASQPPDTGHPA-RVIRVVPHNARSASESAARIFQSIQKERK  274
             PLFPT P     +  Q      P  R I+ VPHN+ SASESAARIF+ IQ+ER+
Sbjct  483   PLFPTEPTHQTDEYKQ---KQQPMLRAIKAVPHNSTSASESAARIFRFIQEERR  533



>emb|CDY56915.1| BnaCnng31360D [Brassica napus]
Length=538

 Score =   160 bits (406),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 163/540 (30%), Positives = 236/540 (44%), Gaps = 127/540 (24%)
 Frame = -3

Query  1830  PATREQSVKASLSSRSTDKKEHCIKHTDTD---FPLHSEQRDGPANNSDLSHKSGINLQP  1660
             P+ R  SV  + SS     + H    T+ D    PL       P  N+DLS +       
Sbjct  98    PSARGSSVTNTKSSSIIQNEYHFKNLTNLDSLKVPLVRRSETNPQANTDLSLQF---CNS  154

Query  1659  ESIIDSKVGDANDDAVVSGP--IKGVEIGDSSV--PINCFQTE---GQIINVGNDVESQE  1501
              S ID   G A    V      I+ + + D S    +N  +T+    + ++V N +E+Q+
Sbjct  155   SSCIDGGGGVAAGSKVALNNLHIRELLLQDESKRGSLNMMKTQLYRRRALDVFN-IETQK  213

Query  1500  NQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVF  1321
                   P+ Q V      S++S ++ +SG+  S +DV  +IG K FWK R  ++NQQ++F
Sbjct  214   KLKTVPPREQDV------SDSSAIDSLSGIGASSNDVARVIGDKMFWKMRTYMINQQKIF  267

Query  1320  AVQVFELHRLIKVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHK  1141
             A QVFELHRLI VQK++A+SPN +LE         K++  +R       +K P N   HK
Sbjct  268   AAQVFELHRLIMVQKMVAKSPNLVLES--------KLNGLRRGTMVASKVKKP-NTENHK  318

Query  1140  NDSEK--PHLRMECSAENTVGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCF  967
               +E+   H++ +                               PLP ++N+  M P   
Sbjct  319   PVTEEYPEHMKPKL------------------------------PLPSITNEL-MKPIWQ  347

Query  966   HQ---PSGHQWLIPVMTPSEGLVYKPYPGPGFMSPGCGPPPVSTPVMGNFFAPPAYGLP-  799
              Q   P G+QWL+PVM+PSEGLVYKPY GP    P               F  P YG   
Sbjct  348   QQLLPPPGNQWLVPVMSPSEGLVYKPYAGPCPPPPSA-------------FMVPIYGQDS  394

Query  798   --TSQYHYQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSF---TRTGSQAQVS  634
               TS + +     P +    H YFP            T+ ++Q N F    R  S +   
Sbjct  395   PNTSAFKF-----PVSTQFSHNYFP-------QPNARTAVLDQTNPFGQLQRWSSTSSHM  442

Query  633   GGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGP  454
                +  +++        SQ++ D+DV                S ASSP  +         
Sbjct  443   TQAIPFSLKK-------SQESNDSDV--------------HGSTASSPPEKP--------  473

Query  453   MEGRSVLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERK  274
                  VLPLFPT P  +  +           R I+ +PHN+ SASESAARIF+SIQ+ER+
Sbjct  474   --KFDVLPLFPTEPTHHNDEHEHEQKQQPLHRAIKAIPHNSTSASESAARIFRSIQEERR  531



>emb|CDY32422.1| BnaC03g42060D [Brassica napus]
Length=491

 Score =   159 bits (402),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 152/478 (32%), Positives = 212/478 (44%), Gaps = 112/478 (23%)
 Frame = -3

Query  1680  SGINLQPESIIDSKV---GDANDDAVVSGPIKGVEIGDSSVPINCFQTEGQ--IINVGND  1516
             S  N +P SI  ++      AN D++ +  +  + I +  +P  CF+ E Q   +NV   
Sbjct  108   SVTNTKPSSIKQNEYHFKSLANLDSLKAA-LNNLHIPELLLP-QCFEEESQNESLNVM--  163

Query  1515  VESQENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVN  1336
                   +T + P+T      D  S+ S ++ +SG+  S +DV  +IG+K FWK R  ++N
Sbjct  164   ------KTQKKPKTVPTCEQD-VSDCSAIDSLSGISASSNDVARVIGEKRFWKMRTYMIN  216

Query  1335  QQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQN  1156
             QQ++F  QVFELHRLI VQK++A+SPN +LE         K++  KR L  F        
Sbjct  217   QQKIFETQVFELHRLIMVQKMVAKSPNLVLES--------KLNGGKRGLSHF--------  260

Query  1155  VPKHKNDSEKPHLRMECSAENTVGKASLSSVQNATQAPS-CKPSPGNPPLPVVSNDSNMG  979
                        HL +E +A   +   +        + P   KP     PLP ++ D  M 
Sbjct  261   -----------HL-LEMAASKVIKPITKKHKHVTEEYPEHMKP---KVPLPSINKDL-MT  304

Query  978   PWCFHQPS---GHQWLIPVMTPSEGLVYKPYPGPGFMSPGCGPPPVSTPVMGNFFAPPAY  808
             P    QP    G+QWL+PVM+PSEGLVYKPY GP    P         P  G     P  
Sbjct  305   PMWPQQPLPPPGNQWLVPVMSPSEGLVYKPYTGPSPPPPSAS----MVPFYGQDSLNPTL  360

Query  807   GLPTSQYHYQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQA-QVSG  631
             G P S              + H YFPP       S   T+   Q+  ++ T S   Q S 
Sbjct  361   GFPVSTQ------------LNHSYFPPTN--ARTSLDQTNPFGQLQRWSNTSSHVTQASP  406

Query  630   GGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPM  451
               +             SQ++ D+DV                S ASSP  +          
Sbjct  407   FSLK-----------KSQESNDSDV--------------HGSTASSPPEK----------  431

Query  450   EGRSVLPLFPTSPV--VNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQK  283
                 VLPLFPT P    N  +  + P      R I+ +PHN+ SASESAARIF+SIQ+
Sbjct  432   HKLDVLPLFPTKPTHHTNEYEEKEKPL----RRAIKAIPHNSTSASESAARIFRSIQE  485



>gb|ABP81864.1| EARLY FLOWERING 3 [Pisum sativum]
Length=339

 Score =   155 bits (393),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 129/349 (37%), Positives = 181/349 (52%), Gaps = 30/349 (9%)
 Frame = -3

Query  2289  GGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSPSQ-GNGHERRMFLPMH  2113
             GGPRAPPRNKMALYEQ SIPSQRF+   LP +PN ++N +PP   + G+   R    P H
Sbjct  1     GGPRAPPRNKMALYEQFSIPSQRFN---LPLHPNTSNNSVPPGFLEPGDCPRRNYVFPGH  57

Query  2112  LPP-STYSAEKLHAHS----SDSNTPLTQFESRKKTDEDDFRVPVFVNSNISQSIGKFYK  1948
             L P +TYS+    + S    ++ N  L Q E RKK DEDDFRVPV+V SNI QS  K  +
Sbjct  58    LTPGNTYSSGWETSFSPNKRANLNASLAQIEHRKKVDEDDFRVPVYVRSNIGQSNEKRIE  117

Query  1947  NSEREKVSPSSPAFLGRSTKDAKHTRGGNLRHQESSRQLPATREQS-------VKASLSS  1789
             + + ++   +   + G   K  K  R  + R   S+     T  ++       V  +   
Sbjct  118   SFDGKRPPSTGSRYFG-FLKPGKSDRERDPRQHGSAVVNAVTDVRNDIDGPPQVSPNKEH  176

Query  1788  RSTDKKEHCI-KHTDTDFPL-----HSEQRDGPANNSDLSHKSGINLQPESIIDSKV-GD  1630
              S+  ++  I +H+DT   L     + E +D          +    L+ +   +S+  G 
Sbjct  177   PSSSARDGSIGEHSDTLVRLGKVTANQEVQDRRVFKLSSLRQGDARLRQDCRAESQSNGH  236

Query  1629  ANDDAVVSGPIKGVEIGDSSVPINCFQTEGQIINVGNDVESQENQTCRSPQTQKVDRGDN  1450
                D+++       E+  S+ PI    +  Q IN     E  +  T    Q    ++ D+
Sbjct  237   GQSDSLLEST---REVDKSNGPIVNQTSPTQAIN---GTEYHDTGTGSPKQLGNSNKNDS  290

Query  1449  SSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFE  1303
              S+ S VE +S + ISPDDVV +IGQKHFWKAR+ I NQQRVFAVQVFE
Sbjct  291   ISKISRVEDLSTVKISPDDVVAVIGQKHFWKARKEIANQQRVFAVQVFE  339



>emb|CDY51450.1| BnaA05g36670D [Brassica napus]
Length=536

 Score =   159 bits (402),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 143/444 (32%), Positives = 200/444 (45%), Gaps = 119/444 (27%)
 Frame = -3

Query  1563  INCFQTE---GQIINVGNDVESQENQTCRSPQTQKV-DRGDNSSETSMVECISGMDISPD  1396
             +N  +T+    + ++V N VE+Q+      P+ Q V DR       S ++ +SGM  S +
Sbjct  191   LNMMKTQLYRRRAVDVSN-VETQKKLKTVPPREQDVLDR-------SAIDSLSGMSASSN  242

Query  1395  DVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGKPL  1216
             DV  +IG K FWK R  ++NQQ++FA QVFELHRLI VQK++A+SPN +LE      +  
Sbjct  243   DVARVIGDKMFWKMRTYMINQQKIFAAQVFELHRLIMVQKMVAKSPNLVLESKLNGLRSG  302

Query  1215  KVSSAKRLLPPFEYIK-APQNVPKHKNDSEKPHLRMECSAENTVGKASLSSVQNATQAPS  1039
              + ++K   P  E  K   +  P+H     KP L                          
Sbjct  303   SMVASKVKKPNTENHKPVTEEYPEHM----KPKL--------------------------  332

Query  1038  CKPSPGNPPLPVVSNDSNMGPWCFHQ---PSGHQWLIPVMTPSEGLVYKPYPGPGFMSPG  868
                     PLP ++ +  M P    Q   P G+QWL+PVM+PSEGLVYKPY GP    P 
Sbjct  333   --------PLPAITKEL-MKPIWQQQLLPPPGNQWLVPVMSPSEGLVYKPYAGPCPPPPS  383

Query  867   CGPPPVSTPVMGNFFAPPAYG---LPTSQYHYQGMGDPFAPPIGHGYFPPYGMPVMNSAV  697
                           F  P YG   L TS + +     P +    H YFP           
Sbjct  384   A-------------FMVPIYGQDSLDTSAFKF-----PVSTQFSHNYFP-------QPNA  418

Query  696   STSAVEQMNSF---TRTGSQAQVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACK  526
              T+ ++Q N F    R  S +      +  +++        SQ++ D+DV          
Sbjct  419   RTTVLDQTNPFGQLQRWSSTSSHMTQAIPFSLKK-------SQESNDSDV----------  461

Query  525   DNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDASQPPDTGHPARVIRV  346
                   S ASSP  +              VLPLFPT P  +  +  Q     H  R I+ 
Sbjct  462   ----HGSTASSPPEK----------HKFDVLPLFPTEPTHHNDEHEQKQQPLH--RAIKA  505

Query  345   VPHNARSASESAARIFQSIQKERK  274
             +PHN+ SASESAARIF+SIQ+ER+
Sbjct  506   IPHNSTSASESAARIFRSIQEERR  529



>ref|XP_009145486.1| PREDICTED: protein EARLY FLOWERING 3 [Brassica rapa]
Length=536

 Score =   159 bits (402),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 143/444 (32%), Positives = 200/444 (45%), Gaps = 119/444 (27%)
 Frame = -3

Query  1563  INCFQTE---GQIINVGNDVESQENQTCRSPQTQKV-DRGDNSSETSMVECISGMDISPD  1396
             +N  +T+    + ++V N VE+Q+      P+ Q V DR       S ++ +SGM  S +
Sbjct  191   LNMMKTQLYRRRAVDVSN-VETQKKLKTVPPREQDVLDR-------SAIDSLSGMSASSN  242

Query  1395  DVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGKPL  1216
             DV  +IG K FWK R  ++NQQ++FA QVFELHRLI VQK++A+SPN +LE      +  
Sbjct  243   DVARVIGDKMFWKMRTYMINQQKIFAAQVFELHRLIMVQKMVAKSPNLVLESKLNGLRSG  302

Query  1215  KVSSAKRLLPPFEYIK-APQNVPKHKNDSEKPHLRMECSAENTVGKASLSSVQNATQAPS  1039
              + ++K   P  E  K   +  P+H     KP L                          
Sbjct  303   SMVASKVKKPNTENHKPVTEEYPEHM----KPKL--------------------------  332

Query  1038  CKPSPGNPPLPVVSNDSNMGPWCFHQ---PSGHQWLIPVMTPSEGLVYKPYPGPGFMSPG  868
                     PLP ++ +  M P    Q   P G+QWL+PVM+PSEGLVYKPY GP    P 
Sbjct  333   --------PLPAITKEL-MKPIWQQQLLPPPGNQWLVPVMSPSEGLVYKPYAGPCPPPPS  383

Query  867   CGPPPVSTPVMGNFFAPPAYG---LPTSQYHYQGMGDPFAPPIGHGYFPPYGMPVMNSAV  697
                           F  P YG   L TS + +     P +    H YFP           
Sbjct  384   A-------------FMVPIYGQDSLDTSAFKF-----PVSTQFSHNYFP-------QPNA  418

Query  696   STSAVEQMNSF---TRTGSQAQVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACK  526
              T+ ++Q N F    R  S +      +  +++        SQ++ D+DV          
Sbjct  419   RTTVLDQTNPFGQLQRWSSTSSHMTQAIPFSLKK-------SQESNDSDV----------  461

Query  525   DNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDASQPPDTGHPARVIRV  346
                   S ASSP  +              VLPLFPT P  +  +  Q     H  R I+ 
Sbjct  462   ----HGSTASSPPEK----------HKFDVLPLFPTEPTHHNDEHEQKQQPLH--RAIKA  505

Query  345   VPHNARSASESAARIFQSIQKERK  274
             +PHN+ SASESAARIF+SIQ+ER+
Sbjct  506   IPHNSTSASESAARIFRSIQEERR  529



>ref|XP_009117036.1| PREDICTED: protein EARLY FLOWERING 3 [Brassica rapa]
Length=628

 Score =   160 bits (404),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 114/299 (38%), Positives = 151/299 (51%), Gaps = 60/299 (20%)
 Frame = -3

Query  1455  DNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAI----------------------  1342
             + S + SMV+ +S +D+SPD+VVG++GQK FW+AR+AI                      
Sbjct  200   EASDDNSMVDSVSSLDVSPDEVVGVLGQKRFWRARKAIAKEGHSYIVQGACRDSLWILYC  259

Query  1341  --------------VNQQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGK-PLKVS  1207
                           V QQRVFAVQ+FELHRLIKVQ+LIA SP+ L++D +Y+GK   K  
Sbjct  260   VFLASACWNMSPVSVCQQRVFAVQLFELHRLIKVQRLIAASPDVLVDDMSYVGKVAAKSY  319

Query  1206  SAKRLLPPFEYIKAP--QNVPKHKND--SEKP-HLRMECSAENTVGKASLSSVQNATQAP  1042
               K+L  P  ++  P    V KH++   SEK    +MECSAEN VG+       +  Q P
Sbjct  320   PVKKLHLPSGFLVKPPLPQVIKHRSSDYSEKTDQHKMECSAENVVGRLPNQGQGHHHQQP  379

Query  1041  SCKPSPGNPPLPVVSNDSNMGPWCFHQP-------SGHQWLIPVMTPSEGLVYKPYPGPG  883
             S      N  +P  +N  N    C++ P          QWLIPVM+PSEGL+YKP+PGPG
Sbjct  380   S------NYMMPFATNQPNAN-GCYYPPQPPPPSGGNQQWLIPVMSPSEGLIYKPHPGPG  432

Query  882   FMSPGCGPPPVSTPVMGNFFAPPAYGLPTSQYHYQGMGDPFAPPIGHGYFPPYGMPVMN  706
                 G     V     G+F   P +                 P  G+GYFPPYG  +MN
Sbjct  433   PGHTGL----VCGGYYGHFMPAPMFMGGGGGQPPPFHPGMGFPSHGNGYFPPYGGIMMN  487


 Score = 98.2 bits (243),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 71/124 (57%), Gaps = 22/124 (18%)
 Frame = -3

Query  2334  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDH-----GVLPPNPNNASNLI  2170
             + PMFPRLHV D EKGGPRAPPRNKMALYEQLSIPSQRF       G LPP   N S L+
Sbjct  11    LEPMFPRLHVKDAEKGGPRAPPRNKMALYEQLSIPSQRFTSSDRVGGSLPP---NTSPLL  67

Query  2169  PPSPSQGNGHERRMF-LPMHLPPSTYSAEKLHAHSSDSNTPLTQFESRKKTDEDDFRVPV  1993
             PP PS   G +  +  +P+     T SA+  H             + +   + DDF VP 
Sbjct  68    PPGPSSNQGTDNFVTQMPLMENVRTTSAQHDH-------------QRKIAREADDFAVPA  114

Query  1992  FVNS  1981
             F+NS
Sbjct  115   FINS  118



>ref|XP_002885435.1| hypothetical protein ARALYDRAFT_342282 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61694.1| hypothetical protein ARALYDRAFT_342282 [Arabidopsis lyrata subsp. 
lyrata]
Length=534

 Score =   159 bits (401),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 136/414 (33%), Positives = 191/414 (46%), Gaps = 96/414 (23%)
 Frame = -3

Query  1500  NQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVF  1321
             ++T + P+T    R  ++S+ S ++ +SG+  S  +V  +IG++ FWK R     QQ++F
Sbjct  205   SETLKKPKTLP-RREQDASDCSAIDSMSGISASSYNVARVIGERRFWKMR----TQQKIF  259

Query  1320  AVQVFELHRLIKVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHK  1141
             A QVFELHRLI VQK+IA+SPN LLE     GK   + S+ +L      IK P N+  HK
Sbjct  260   AGQVFELHRLIMVQKMIAKSPNLLLESKLNGGKHGTMRSSHQLTMAASKIKKP-NIENHK  318

Query  1140  NDSEK--PHLRMECSAENTVGKASLSSVQNATQAPSCKPSPGNPPLPVVSND--SNMGPW  973
                E+   H++ +                               PLP +S +  + + P 
Sbjct  319   PVPEEYPEHMKPKL------------------------------PLPSISKELVTPIWPQ  348

Query  972   CFHQPSGHQWLIPVMTPSEGLVYKPYPGPGFMSPGCGPPPVSTPVMGNFFAPPAYGLPTS  793
                 P G+QWL+PV++PSEGLVYKPY GP      C PPP S       F  P YG  + 
Sbjct  349   QLLPPPGNQWLVPVISPSEGLVYKPYAGP------C-PPPSSA------FMVPVYGQDSI  395

Query  792   QYHYQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLN  613
             +  ++    P +    H YFPP          + + V+Q N F                 
Sbjct  396   ETAFRF---PVSSQFSHSYFPPPN--------ARTTVDQTNPFG----------------  428

Query  612   VQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVL  433
              Q+Q   N  S        S   +     D++I  S ASSP  +              VL
Sbjct  429   -QYQRWSNTSSHMTQAIPFS-LKKSQESNDSDIHGSTASSPPEK----------HKFEVL  476

Query  432   PLFPTSPVVNIVDASQPPDTGHPA-RVIRVVPHNARSASESAARIFQSIQKERK  274
             PLFPT P     +     +   P  R I+ VPH + SASESAARIF+SIQ+ER+
Sbjct  477   PLFPTEPTHQTDEYK---EKQQPVLRAIKAVPHTSTSASESAARIFRSIQEERR  527



>ref|NP_001288828.1| protein EARLY FLOWERING 3 [Brassica rapa]
 gb|AEB33726.1| EARLY FLOWERING 3 [Brassica rapa]
Length=628

 Score =   160 bits (404),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 114/299 (38%), Positives = 151/299 (51%), Gaps = 60/299 (20%)
 Frame = -3

Query  1455  DNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAI----------------------  1342
             + S + SMV+ +S +D+SPD+VVG++GQK FW+AR+AI                      
Sbjct  200   EASDDNSMVDSVSSLDVSPDEVVGVLGQKRFWRARKAIAKEGHSYIVQGACRDSLWILYC  259

Query  1341  --------------VNQQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGK-PLKVS  1207
                           V QQRVFAVQ+FELHRLIKVQ+LIA SP+ L++D +Y+GK   K  
Sbjct  260   VFLASACWNMSPVSVCQQRVFAVQLFELHRLIKVQRLIAASPDVLVDDMSYVGKVAAKSY  319

Query  1206  SAKRLLPPFEYIKAP--QNVPKHKND--SEKP-HLRMECSAENTVGKASLSSVQNATQAP  1042
               K+L  P  ++  P    V KH++   SEK    +MECSAEN VG+       +  Q P
Sbjct  320   PVKKLHLPSGFLVKPPLPQVIKHRSSDYSEKTDQHKMECSAENVVGRLPNQGQGHHHQQP  379

Query  1041  SCKPSPGNPPLPVVSNDSNMGPWCFHQP-------SGHQWLIPVMTPSEGLVYKPYPGPG  883
             S      N  +P  +N  N    C++ P          QWLIPVM+PSEGL+YKP+PGPG
Sbjct  380   S------NYMMPFATNQPNAN-GCYYPPQPPPPSGGNQQWLIPVMSPSEGLIYKPHPGPG  432

Query  882   FMSPGCGPPPVSTPVMGNFFAPPAYGLPTSQYHYQGMGDPFAPPIGHGYFPPYGMPVMN  706
                 G     V     G+F   P +                 P  G+GYFPPYG  +MN
Sbjct  433   PGHTGL----VCGGYYGHFMPAPMFMGGGGGQPPPFHPGMGFPSHGNGYFPPYGGIMMN  487


 Score =   102 bits (253),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 73/124 (59%), Gaps = 22/124 (18%)
 Frame = -3

Query  2334  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDH-----GVLPPNPNNASNLI  2170
             + PMFPRLHV D EKGGPRAPPRNKMALYEQLSIPSQRF       G LPP   N S L+
Sbjct  11    LEPMFPRLHVKDAEKGGPRAPPRNKMALYEQLSIPSQRFTSSDRVGGSLPP---NTSPLL  67

Query  2169  PPSPSQGNGHERRMF-LPMHLPPSTYSAEKLHAHSSDSNTPLTQFESRKKTDEDDFRVPV  1993
             PP PS   G +  +  +P+     T SA+  H             + +   +EDDF VPV
Sbjct  68    PPGPSSNQGTDNFVTQMPLMENVRTTSAQHDH-------------QRKIAREEDDFAVPV  114

Query  1992  FVNS  1981
             F+NS
Sbjct  115   FINS  118



>ref|XP_009109647.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Brassica 
rapa]
Length=517

 Score =   158 bits (399),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 157/529 (30%), Positives = 226/529 (43%), Gaps = 135/529 (26%)
 Frame = -3

Query  1830  PATREQSVKASLSSRSTDKKEHCIKHTDT-DFPLHSEQRDGPANNSDLSHKSGINLQPES  1654
             P+ R  SVK S    S  + E+ + + D+   P+       P  N+DLS      LQ  S
Sbjct  107   PSPRGSSVKPS----SIKQNEYNLTNLDSLKVPVFRLPETDPKANTDLS------LQFHS  156

Query  1653  IIDSKV-GDANDDAVVSGPIKGVEIGDSSVPINCFQTEGQIINVGNDVESQENQTCRSPQ  1477
                SK  G+A   A     +  ++I +  +P+ C + E    N    V   +    R+P+
Sbjct  157   SCTSKSRGEA---AGFKPLLNNLDIRELLLPLQCLEDESN--NGSLSVMKTQLYRRRTPK  211

Query  1476  TQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELH  1297
             T    R   +S+ S ++ +SGM  + +DV  +IG+K FWK R  +++QQ++FA QVFELH
Sbjct  212   TVP-PREQEASDCSAIDSLSGMSAASNDVARVIGEKRFWKMRAYMISQQKIFATQVFELH  270

Query  1296  RLIKVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPHL  1117
             RLI VQK++A+SPN +L+     G   K  + +   P  E        P+H     KP +
Sbjct  271   RLIMVQKMVAKSPNLVLKSKINGGSKFKRPNTENQKPVTE------AYPEHM----KPKI  320

Query  1116  RMECSAENTVGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWC--FHQPSGHQW  943
                                               PLP +S +     W      P G+QW
Sbjct  321   ----------------------------------PLPFISKELMTPIWQQQLLPPQGNQW  346

Query  942   LIPVMTPSEGLVYKPYPGPGFMSPGCGPPPVSTPVMGNFFAPPAYG--LPTSQYHYQGMG  769
             L+PVM+PSEGLVYKPY GP    P               F  P YG  LP+         
Sbjct  347   LVPVMSPSEGLVYKPYAGPCPPPPSA-------------FMVPIYGQDLPSRL-------  386

Query  768   DPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSF---TRTGSQAQVSGGGVNLNVQHQN  598
              P +    H  FPP           T+ ++Q N F    R  S +      +  +++   
Sbjct  387   -PASTQFSHNCFPP----------RTTVLDQTNPFGQLQRWSSTSSHMTQAIPFSLKKSQ  435

Query  597   SCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPT  418
               N                     D+E+  S ASSP  +              VLPLFPT
Sbjct  436   ESN---------------------DSEVHGSTASSPPEK----------HKFDVLPLFPT  464

Query  417   SPVVNIVDASQPPDTGHP-ARVIRVVPHNARSASESAARIFQSIQKERK  274
              P  +  +  Q      P +R I+ +PHN+ SASESAARIF+SIQ+ER+
Sbjct  465   EPTHHTDEYEQ---KQQPMSRAIKAIPHNSTSASESAARIFRSIQEERR  510



>ref|XP_009109631.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Brassica 
rapa]
 ref|XP_009109639.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Brassica 
rapa]
Length=518

 Score =   158 bits (399),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 157/529 (30%), Positives = 226/529 (43%), Gaps = 135/529 (26%)
 Frame = -3

Query  1830  PATREQSVKASLSSRSTDKKEHCIKHTDT-DFPLHSEQRDGPANNSDLSHKSGINLQPES  1654
             P+ R  SVK S    S  + E+ + + D+   P+       P  N+DLS      LQ  S
Sbjct  108   PSPRGSSVKPS----SIKQNEYNLTNLDSLKVPVFRLPETDPKANTDLS------LQFHS  157

Query  1653  IIDSKV-GDANDDAVVSGPIKGVEIGDSSVPINCFQTEGQIINVGNDVESQENQTCRSPQ  1477
                SK  G+A   A     +  ++I +  +P+ C + E    N    V   +    R+P+
Sbjct  158   SCTSKSRGEA---AGFKPLLNNLDIRELLLPLQCLEDESN--NGSLSVMKTQLYRRRTPK  212

Query  1476  TQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELH  1297
             T    R   +S+ S ++ +SGM  + +DV  +IG+K FWK R  +++QQ++FA QVFELH
Sbjct  213   TVP-PREQEASDCSAIDSLSGMSAASNDVARVIGEKRFWKMRAYMISQQKIFATQVFELH  271

Query  1296  RLIKVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPHL  1117
             RLI VQK++A+SPN +L+     G   K  + +   P  E        P+H     KP +
Sbjct  272   RLIMVQKMVAKSPNLVLKSKINGGSKFKRPNTENQKPVTE------AYPEHM----KPKI  321

Query  1116  RMECSAENTVGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWC--FHQPSGHQW  943
                                               PLP +S +     W      P G+QW
Sbjct  322   ----------------------------------PLPFISKELMTPIWQQQLLPPQGNQW  347

Query  942   LIPVMTPSEGLVYKPYPGPGFMSPGCGPPPVSTPVMGNFFAPPAYG--LPTSQYHYQGMG  769
             L+PVM+PSEGLVYKPY GP    P               F  P YG  LP+         
Sbjct  348   LVPVMSPSEGLVYKPYAGPCPPPPSA-------------FMVPIYGQDLPSRL-------  387

Query  768   DPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSF---TRTGSQAQVSGGGVNLNVQHQN  598
              P +    H  FPP           T+ ++Q N F    R  S +      +  +++   
Sbjct  388   -PASTQFSHNCFPP----------RTTVLDQTNPFGQLQRWSSTSSHMTQAIPFSLKKSQ  436

Query  597   SCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPT  418
               N                     D+E+  S ASSP  +              VLPLFPT
Sbjct  437   ESN---------------------DSEVHGSTASSPPEK----------HKFDVLPLFPT  465

Query  417   SPVVNIVDASQPPDTGHP-ARVIRVVPHNARSASESAARIFQSIQKERK  274
              P  +  +  Q      P +R I+ +PHN+ SASESAARIF+SIQ+ER+
Sbjct  466   EPTHHTDEYEQ---KQQPMSRAIKAIPHNSTSASESAARIFRSIQEERR  511



>ref|XP_010510094.1| PREDICTED: protein EARLY FLOWERING 3-like [Camelina sativa]
 ref|XP_010510102.1| PREDICTED: protein EARLY FLOWERING 3-like [Camelina sativa]
Length=533

 Score =   153 bits (386),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 126/402 (31%), Positives = 178/402 (44%), Gaps = 101/402 (25%)
 Frame = -3

Query  1452  NSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKL  1273
             ++S+ S +E +SG+  S  D   +IG+K FWK R  ++NQQ++FA QVFELHRLIKVQK+
Sbjct  215   DASDCSAIESLSGLSASSYDA-RVIGEKRFWKMRTFMINQQKIFAGQVFELHRLIKVQKM  273

Query  1272  IAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPHLRMECSAEN  1093
             +A+SPN LL+++       KVS  K                         H  M  S + 
Sbjct  274   VAKSPNLLLDES-------KVSVDK-------------------------HGTMRSSHQQ  301

Query  1092  TVGKASLSSVQNATQAPSCKPSPG----NPPLPVVSND--SNMGPWCFHQPSGHQWLIPV  931
              +  + +       Q P  +  P       PLP +S +  + + P       G+QWL+PV
Sbjct  302   ALAASKIKKPNTENQKPVTEEYPEYMKPKLPLPSISKELMAPIWPQQLLPAPGNQWLVPV  361

Query  930   MTPSEGLVYKPYPGPGFMSPGC-GPPPVSTPVMGNFFAPPAYGLPTSQYHYQGMGDPFAP  754
             +T SEGLVYKPY G       C  P  +  PV G         L T+ + +     P + 
Sbjct  362   VTHSEGLVYKPYAG------TCPSPSALMVPVYGQ------DSLDTAAFRF-----PVSS  404

Query  753   PIGHGYFPPYGMPVMNSAVSTSAVEQMNSF---TRTGSQAQVSGGGVNLNVQHQNSCNMP  583
                H YFPP          + + V+Q N F    R  S +      +  +++     N  
Sbjct  405   QFSHSYFPP--------PYARTTVDQTNPFGQYQRWSSTSSHMTQAIPFSLKKSQESN--  454

Query  582   SQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVN  403
                                D+E+  S ASSP  +              VL LFPT P   
Sbjct  455   -------------------DSEVHGSTASSPPEK----------HKFEVLQLFPTEPTHQ  485

Query  402   IVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKER  277
               +  Q      P R I+ +PHN+ SASESAARIF+SIQ+ER
Sbjct  486   TDEYKQ--KQQPPLRAIKAIPHNSTSASESAARIFRSIQEER  525



>ref|XP_009135744.1| PREDICTED: protein EARLY FLOWERING 3-like [Brassica rapa]
Length=522

 Score =   150 bits (379),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 136/439 (31%), Positives = 199/439 (45%), Gaps = 118/439 (27%)
 Frame = -3

Query  1557  CFQTEGQIINVGNDVESQENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGII  1378
             CF+ E Q  ++ N +++Q+      P  Q V      S+ S ++ +SG+  S +D   +I
Sbjct  182   CFEDESQNESL-NVMKTQKKPKTVPPCEQDV------SDCSAIDSLSGISASSNDAARVI  234

Query  1377  GQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGKPLKVSSAK  1198
             G K FWK R  ++NQQ++F  QVFELHRLI VQK++A SPN +L+ + + G  +++S + 
Sbjct  235   GDKRFWKMRTYMINQQKIFEAQVFELHRLIMVQKMVARSPNLVLK-SKFNGDTMRLSPSH  293

Query  1197  RLLPPFEYIKAPQNV-PKHKNDSEK--PHLRMECSAENTVGKASLSSVQNATQAPSCKPS  1027
               LP     K  + +  KHK  +E+   H++ +                           
Sbjct  294   --LPEMAASKVKKTITKKHKPVTEEYPEHMKPKL--------------------------  325

Query  1026  PGNPPLPVVSND--SNMGPWCFHQPSGHQWLIPVMTPSEGLVYKPYPG------PGFMSP  871
                 PLP ++ D  + M P     P G+QWL+PVMTPSEGLVYKPY G        FM P
Sbjct  326   ----PLPSINKDLMTPMWPQQLVPPPGNQWLVPVMTPSEGLVYKPYTGPSPPPPSAFMVP  381

Query  870   GCGPPPVSTPVMGNFFAPPAYGLPTSQYHYQGMGDPFAPPIGHGYFPPYGMPVMNSAVST  691
               G   ++T +          G P +Q             + H YFP        S    
Sbjct  382   FYGQDSLNTTL----------GFPVTQ-------------LSHNYFPQPN--ARTSLDQK  416

Query  690   SAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQ  511
             S   Q+  ++ T S        V  ++          +K+ +++ SD H           
Sbjct  417   SPFGQLQRWSNTSSHM---TQAVPFSL----------KKSQESNESDVH-----------  452

Query  510   ASCASSPSVRAPGVTVSGPMEGRS-VLPLFPTSPV--VNIVDASQPPDTGHPARVIRVVP  340
              S ASSP           P + +S VLPLFPT P    +  +  Q P      R IR +P
Sbjct  453   GSTASSP-----------PEKHKSDVLPLFPTKPTHHTDEYEQKQKPM----CRAIRAIP  497

Query  339   HNARSASESAARIFQSIQK  283
             HN+ SASESAAR F+SIQ+
Sbjct  498   HNSTSASESAARSFRSIQE  516



>ref|XP_010545644.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Tarenaya 
hassleriana]
Length=532

 Score =   149 bits (375),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 135/410 (33%), Positives = 186/410 (45%), Gaps = 95/410 (23%)
 Frame = -3

Query  1479  QTQKVDRGDNSSET----SMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQ  1312
             Q  +V  GDNS E     S+++  SG + SP+  V  IG K F K R A++  QR+FA Q
Sbjct  199   QKDRVMGGDNSHENVSGCSVIDSASGWNASPEKFVKAIGNKRFQKMRTAMIRHQRIFAGQ  258

Query  1311  VFELHRLIKVQKLIAESPNFLLEDTAYLGKP--LKVSSAKRLLPPFEYIKAPQNVPKHKN  1138
             VFELHRL+ VQK +A SPN  LE      KP  LK SS+  L          +  PK K 
Sbjct  259   VFELHRLVSVQKRLARSPNLFLEGNCNPRKPATLKKSSSNLL----------EIAPKVKP  308

Query  1137  DSEKPHLRMECSAENTVGKASLSSV-QNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQ  961
             ++EK +   E   + T+ K  L S+ +       C        +   +  S+  PW F  
Sbjct  309   NTEKLNPETESPEKGTIPKFPLPSITKELISTKRCN------SMVATTRSSSSSPWWFSA  362

Query  960   PSGHQWLIPVMTPSEGLVYKPYPGPGFMSPGCGPPPVSTPVMGNFFAPPAYGLPTSQYHY  781
             P G QWL+PV++PSEGLVYKPY GP         PP S       F  P Y   + +   
Sbjct  363   P-GRQWLVPVVSPSEGLVYKPYTGPS--------PPTSG------FMLPFYSNDSIE---  404

Query  780   QGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQ  601
               +G P + P+ H     +  P       +S   +++               V  ++Q+ 
Sbjct  405   DALGFPLSHPLQH-----HENPFSQMQSLSSLSSRVSK-------------AVPFSLQN-  445

Query  600   NSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFP  421
                   S+++ D+DV              Q S ASSP  R            R VLPLFP
Sbjct  446   ------SRESKDSDV--------------QGSTASSPPER----------HKRQVLPLFP  475

Query  420   TSPVVNIV--DASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKER  277
             T P    +  D     +  HP   I+  P+ + SASESAARIF++IQ+ER
Sbjct  476   TEPTRQNLETDVHGQQEPLHP---IKTTPYTSTSASESAARIFRTIQEER  522



>ref|XP_010545643.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Tarenaya 
hassleriana]
Length=600

 Score =   148 bits (374),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 137/412 (33%), Positives = 187/412 (45%), Gaps = 99/412 (24%)
 Frame = -3

Query  1479  QTQKVDRGDNSSET----SMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQ  1312
             Q  +V  GDNS E     S+++  SG + SP+  V  IG K F K R A++  QR+FA Q
Sbjct  267   QKDRVMGGDNSHENVSGCSVIDSASGWNASPEKFVKAIGNKRFQKMRTAMIRHQRIFAGQ  326

Query  1311  VFELHRLIKVQKLIAESPNFLLEDTAYLGKP--LKVSSAKRLLPPFEYIKAPQNVPKHKN  1138
             VFELHRL+ VQK +A SPN  LE      KP  LK SS+  L          +  PK K 
Sbjct  327   VFELHRLVSVQKRLARSPNLFLEGNCNPRKPATLKKSSSNLL----------EIAPKVKP  376

Query  1137  DSEKPHLRMECSAENTVGKASLSSV-QNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQ  961
             ++EK +   E   + T+ K  L S+ +       C        +   +  S+  PW F  
Sbjct  377   NTEKLNPETESPEKGTIPKFPLPSITKELISTKRCN------SMVATTRSSSSSPWWFSA  430

Query  960   PSGHQWLIPVMTPSEGLVYKPYPGPGFMSPGCGPPPVSTPVMGNFFAPPAYGLPTSQYHY  781
             P G QWL+PV++PSEGLVYKPY GP         PP S       F  P Y   + +   
Sbjct  431   P-GRQWLVPVVSPSEGLVYKPYTGPS--------PPTSG------FMLPFYSNDSIE---  472

Query  780   QGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQ  601
               +G P + P+ H     +  P       +S   +++               V  ++Q+ 
Sbjct  473   DALGFPLSHPLQH-----HENPFSQMQSLSSLSSRVSK-------------AVPFSLQN-  513

Query  600   NSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFP  421
                   S+++ D+DV              Q S ASSP  R            R VLPLFP
Sbjct  514   ------SRESKDSDV--------------QGSTASSPPER----------HKRQVLPLFP  543

Query  420   TSP----VVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKER  277
             T P    +   V   Q P   HP   I+  P+ + SASESAARIF++IQ+ER
Sbjct  544   TEPTRQNLETDVHGQQEP--LHP---IKTTPYTSTSASESAARIFRTIQEER  590



>ref|XP_010488144.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Camelina 
sativa]
Length=530

 Score =   147 bits (371),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 138/446 (31%), Positives = 193/446 (43%), Gaps = 94/446 (21%)
 Frame = -3

Query  1593  GVEIGDSSVPINCFQTEGQ--IINVGNDVESQENQTCRSPQTQKVDRG--DNSSETSMVE  1426
             G  +G   +  +C + E Q   +NV      + +    + +TQ+  +    ++S+ S +E
Sbjct  164   GEAVGSKILLSDCLEDESQNGSVNVMKTQLYRRSFAEFNNETQQKLKTLPQDASDCSAIE  223

Query  1425  CISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNFLL  1246
              +SG+  S  DV  +IG+K FWK R  ++NQQ++FA QVFELHRLIK   ++A+SPN LL
Sbjct  224   SLSGLSASSYDVARVIGEKRFWKMRTYMINQQKIFAGQVFELHRLIK---MVAKSPNLLL  280

Query  1245  EDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPHLRMECSAENTVGKASLSS  1066
             E    + K   V S+ +       IK P        +++KP    E   E    K  L S
Sbjct  281   ESKVNVDKHGTVRSSHQQAMAASKIKKPNT------ENQKP--VTEEYPEYMKPKLPLPS  332

Query  1065  VQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGP  886
             +     AP                   + P     P G+QWL PV+T SEGLVYKPY GP
Sbjct  333   ISKELMAP-------------------IWPQQLLPPPGNQWLAPVVTHSEGLVYKPYAGP  373

Query  885   GFMSPGC-GPPPVSTPVMGNFFAPPAYGLPTSQYHYQGMGDPFAPPIGHGYFPPYGMPVM  709
                   C  P  +  PV G         L T+ + +     P +    H YFP       
Sbjct  374   ------CPSPSALMVPVYGQ------ESLDTAAFRF-----PVSSQFSHSYFP-------  409

Query  708   NSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHAC  529
              S  + + V+Q N F                  Q+Q   +  S        S   +    
Sbjct  410   -SPNARTTVDQTNPFG-----------------QYQRWSSTSSHMTQAIPFS-LKKSQES  450

Query  528   KDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPV--VNIVDASQPPDTGHPARV  355
              D+E+  S ASSP                 VL LFPT P    +     Q P    P R 
Sbjct  451   NDSEVHGSTASSPPEN----------HKFEVLQLFPTEPTHHTDEYKEKQQP----PLRA  496

Query  354   IRVVPHNARSASESAARIFQSIQKER  277
             I+ +PHN+ S SESAARIF+SIQ+ER
Sbjct  497   IKAIPHNSTSVSESAARIFRSIQEER  522



>dbj|BAB01726.1| unnamed protein product [Arabidopsis thaliana]
Length=623

 Score =   145 bits (365),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 135/442 (31%), Positives = 183/442 (41%), Gaps = 119/442 (27%)
 Frame = -3

Query  1500  NQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIV------  1339
             N+T + P+T    R   +S  S +E +SG+  S  D+  +IG+K FWK R  ++      
Sbjct  261   NETQKKPKTLP-RREQVASNCSAIESLSGISASSYDIARVIGEKRFWKMRTYMIKFVSSS  319

Query  1338  -----------------------NQQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYL  1228
                                    +QQ++FA QVFELHRLI VQK++A+SPN  LE     
Sbjct  320   HFSYDPNFITLPYFLLFFIVDIFSQQKIFAGQVFELHRLIMVQKMVAKSPNLFLESKL--  377

Query  1227  GKPLKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPHLRMECSAENTVGKASLSSVQNATQ  1048
                                    N  KH        L M  S      K    + +N   
Sbjct  378   -----------------------NGVKHGTMRSSHQLAMAAS------KVRKPNTENHKP  408

Query  1047  APSCKPSPGNP--PLPVVSND--SNMGPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGPGF  880
              P   P    P  PLP +S +  + + P     P G+QWL+PV+T S+GLVYKP+PGP  
Sbjct  409   VPEEYPEHMKPKLPLPSISKELVTPIWPQQLLPPPGNQWLVPVITDSDGLVYKPFPGP--  466

Query  879   MSPGCGPPPVSTPVMGNFFAPPAYGLPTSQYHYQGMGDPFAPPIGHGYFPPYGMPVMNSA  700
                 C  PP S+  M      P YG  + +  ++    P + P  H YFPP         
Sbjct  467   ----C--PPSSSAFMV-----PVYGQDSLETPFRF---PVSSPFSHSYFPPPN-------  505

Query  699   VSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDN  520
              + + V+Q N F                  Q Q   N  S        S   +     D+
Sbjct  506   -ARTTVDQTNPFG-----------------QFQRWSNTSSHMTQAIPFS-LKKSQESNDS  546

Query  519   EIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDASQPPDTGHPARVIRVVP  340
             +I  S ASSP  +              VLPLFPT P     +  Q        R I+ VP
Sbjct  547   DIHGSTASSPPEK----------HKLEVLPLFPTEPTHQTDEYKQKQQPM--LRAIKAVP  594

Query  339   HNARSASESAARIFQSIQKERK  274
             HN+ SASESAARIF+ IQ+ER+
Sbjct  595   HNSTSASESAARIFRFIQEERR  616



>gb|ACU18593.1| unknown [Glycine max]
Length=152

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 88/130 (68%), Gaps = 10/130 (8%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  2158
             + GPMFPRLHVND EKGGPRAPPRNKMALYEQ SIPSQ+F+  +LP  PN++SN++PP P
Sbjct  10    LGGPMFPRLHVNDAEKGGPRAPPRNKMALYEQFSIPSQKFNPRLLPRKPNSSSNIVPP-P  68

Query  2157  SQGNGHERRMFLPMHLPPS--TYSAEKLHAHSSD----SNTPLTQFESRKKTDEDDFRVP  1996
             +QGNGHER    P+       T+ AE   +  SD    SNT L Q E RKK D+D   + 
Sbjct  69    TQGNGHERSYVYPVRFSSQTPTHRAESYISRQSDDGSRSNTSLVQLERRKKVDDD---IH  125

Query  1995  VFVNSNISQS  1966
             V+  S I QS
Sbjct  126   VYTCSGIDQS  135



>ref|XP_010488142.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Camelina 
sativa]
 ref|XP_010488143.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Camelina 
sativa]
Length=533

 Score =   133 bits (334),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 128/429 (30%), Positives = 182/429 (42%), Gaps = 93/429 (22%)
 Frame = -3

Query  1593  GVEIGDSSVPINCFQTEGQ--IINVGNDVESQENQTCRSPQTQKVDRG--DNSSETSMVE  1426
             G  +G   +  +C + E Q   +NV      + +    + +TQ+  +    ++S+ S +E
Sbjct  164   GEAVGSKILLSDCLEDESQNGSVNVMKTQLYRRSFAEFNNETQQKLKTLPQDASDCSAIE  223

Query  1425  CISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNFLL  1246
              +SG+  S  DV  +IG+K FWK R  ++NQQ++FA QVFELHRLIKVQK++A+SPN LL
Sbjct  224   SLSGLSASSYDVARVIGEKRFWKMRTYMINQQKIFAGQVFELHRLIKVQKMVAKSPNLLL  283

Query  1245  EDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPHLRMECSAENTVGKASLSS  1066
             E    + K   V S+ +       IK P        +++KP    E   E    K  L S
Sbjct  284   ESKVNVDKHGTVRSSHQQAMAASKIKKPN------TENQKP--VTEEYPEYMKPKLPLPS  335

Query  1065  VQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGP  886
             +     AP                   + P     P G+QWL PV+T SEGLVYKPY GP
Sbjct  336   ISKELMAP-------------------IWPQQLLPPPGNQWLAPVVTHSEGLVYKPYAGP  376

Query  885   GFMSPGC-GPPPVSTPVMGNFFAPPAYGLPTSQYHYQGMGDPFAPPIGHGYFPPYGMPVM  709
                   C  P  +  PV G         L T+ + +     P +    H YFP       
Sbjct  377   ------CPSPSALMVPVYGQ------ESLDTAAFRF-----PVSSQFSHSYFP-------  412

Query  708   NSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHAC  529
              S  + + V+Q N F                  Q+Q   +  S        S   +    
Sbjct  413   -SPNARTTVDQTNPFG-----------------QYQRWSSTSSHMTQAIPFS-LKKSQES  453

Query  528   KDNEIQASCASSPSVRAPGVTVSGPMEGR-SVLPLFPTSPV--VNIVDASQPPDTGHPAR  358
              D+E+  S ASSP           P   +  VL LFPT P    +     Q P    P R
Sbjct  454   NDSEVHGSTASSP-----------PENHKFEVLQLFPTEPTHHTDEYKEKQQP----PLR  498

Query  357   VIRVVPHNA  331
              I+ +PHN+
Sbjct  499   AIKAIPHNS  507



>dbj|BAD97868.1| ELF3 homologue [Lemna paucicostata]
Length=492

 Score =   128 bits (321),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 87/220 (40%), Positives = 122/220 (55%), Gaps = 29/220 (13%)
 Frame = -3

Query  1455  DNSSETSMVECISGMD-ISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQ  1279
             D++SE  +V+     D  +PD++VG+IG KHFWKARRAI++QQRV A+QVFELHRL+ +Q
Sbjct  214   DDASERLLVDSREAADAYNPDNLVGLIGLKHFWKARRAIISQQRVLALQVFELHRLMNIQ  273

Query  1278  KLIAESPNFLLED-TAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPHLRMECS  1102
             KL+AESP  LLED +++ G P   S ++ +    + I    N       + +P  R E  
Sbjct  274   KLLAESPQLLLEDASSFHGSPAAPSKSQPVDTSVKPIDPTVN-------ATQPADRKEVL  326

Query  1101  AENTVGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPVMTP  922
             A            +  T+     P P  P  P +S D   GP    Q +G+ WL PVM+P
Sbjct  327   AP-----------EEETRGGEVVP-PALPAGPAMS-DGKSGPLPI-QVAGNHWLFPVMSP  372

Query  921   SEGLVYKPYPGPGFMS----PGCGPPPVSTPVM--GNFFA  820
             +EGL+YKP+  P  M     P C   PVS   +  G+FF+
Sbjct  373   TEGLIYKPFYKPENMVLLPPPYCVSQPVSGSAVDQGSFFS  412


 Score = 86.7 bits (213),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 67/175 (38%), Positives = 95/175 (54%), Gaps = 15/175 (9%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNP----NNASNLI  2170
             I  P+FPRLHVND +KGGPRAPPRNKMALYEQ SIPSQRF     P  P      ++++ 
Sbjct  10    ISSPLFPRLHVNDADKGGPRAPPRNKMALYEQFSIPSQRFTSSSSPSMPFPSHRGSNSVP  69

Query  2169  PPSPSQGNGHERRMFLPMHLP---PSTYSAEKLHAHSSDSNTPLTQF--ESRKKTDEDDF  2005
               S SQG   ER     +++    P + + EK  A +++S   +T    +S  +  ++DF
Sbjct  70    SISSSQGCVQERSASSSLYMRSQIPHSLTTEKSQASTTESMPRVTSTVRQSPAEKSDEDF  129

Query  2004  RVPVFVNSN-----ISQSIGKFYKNSEREKVSPSSPAFLGRSTKDAKHTRGGNLR  1855
             RVPV+V S+     ++    + +K S+R     SS   L  ++    H    NLR
Sbjct  130   RVPVYVQSSNRDGHVADCKTRSFKKSDRIHEDLSSTVTLQDASSGQDHD-DDNLR  183



>gb|AEK05757.1| early flowering 3 [Populus balsamifera]
Length=261

 Score =   124 bits (310),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 98/265 (37%), Positives = 133/265 (50%), Gaps = 33/265 (12%)
 Frame = -3

Query  1155  VPKHKNDSEKPHLRMECSAENTVGKASLSSVQNATQ----APSCKPSPGNPPLPVVSNDS  988
             V K K+ S+K H   + + EN VGK  L S  + T     +     S   PP P+ +  +
Sbjct  2     VDKPKDHSQKQHTSADFAGENVVGKLPLPSTNDETSKEPISQRSNYSGSAPPAPLATT-A  60

Query  987   NMGPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGP-----GFMSP---GCGPPPVSTPVMG  832
                PWC+  P G+QWL+PVM+PSEGLVYKPY GP      FM P    CG  P+S    G
Sbjct  61    KXSPWCY-PPPGNQWLVPVMSPSEGLVYKPYAGPCPPVSRFMEPVYGSCG--PISLAPGG  117

Query  831   NFFAPPAYGLPTSQYHYQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTG  652
               F   AY +  S +   G+  P  P  G  +F P+GMPVMN ++  SAVEQ++   R G
Sbjct  118   GDFLNAAYSVSASNHGESGI-LPGNPHFGQTFFQPFGMPVMNPSICDSAVEQIS--PRIG  174

Query  651   SQA---QVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVR  481
              Q+   Q++ G +N N+  Q+SCNM +Q +              K++EIQ S A S S  
Sbjct  175   PQSKDNQLAVGDINFNIPLQSSCNMSNQMSRVISCC-VENFQGLKESEIQRSSAGSLSK-  232

Query  480   APGVTVSGPMEGRSVLPLFPTSPVV  406
                      M   + LPLFP  P +
Sbjct  233   ---------MPKANALPLFPMEPTL  248



>dbj|BAD97872.1| ELF3 homologue [Lemna gibba]
Length=470

 Score =   127 bits (318),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 77/186 (41%), Positives = 102/186 (55%), Gaps = 30/186 (16%)
 Frame = -3

Query  1416  GMD-ISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNFLLED  1240
             GMD  +PD++VG+IG KHFWKARRA+VNQQRVFA+QVFELHRL+ VQKL+AESP+ LLED
Sbjct  211   GMDACNPDNLVGLIGLKHFWKARRAMVNQQRVFALQVFELHRLMNVQKLLAESPHLLLED  270

Query  1239  TAYL----GKPLKVSSAKRLLPPFE-YIKAPQNVPKHKNDSEKPHLRMECSAENTVGKAS  1075
              +        P+K      L+   +  +K  Q V ++K    +       +A        
Sbjct  271   ASSFHGSSNAPVKSQPVDSLVKHIDPEVKETQPVERNKTPPPEEEREGGEAAPPVPPPPW  330

Query  1074  LSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPVMTPSEGLVYKPY  895
              +                        +DS  GPW  H  +G+QWL PVM+P+EGLVYKP+
Sbjct  331   PA-----------------------MSDSKAGPWPVHV-AGNQWLFPVMSPTEGLVYKPF  366

Query  894   PGPGFM  877
               P  M
Sbjct  367   YKPQNM  372


 Score = 88.2 bits (217),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 66/185 (36%), Positives = 93/185 (50%), Gaps = 28/185 (15%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIP----SQRFDHGVLPPNPNNASNLI  2170
             + GP+FPRLHVND ++GGPRAPPRNKMALYEQ SIP    S      +   +   +S+  
Sbjct  10    VFGPLFPRLHVNDADQGGPRAPPRNKMALYEQFSIPSQRFSSSSSSTLTFSSRRGSSSAP  69

Query  2169  PPSPSQGNGHER----RMFLPMHLPPSTYSAEKLHAHSSDSNTPLTQFESRKKTDEDDFR  2002
               S  QG G ER      ++   +PPS  S E+  A          +  S +K++E+DFR
Sbjct  70    SISSHQGCGQERSSSTSFYMRPQIPPS-LSRERPDA--------TARKPSMEKSEEEDFR  120

Query  2001  VPVFVNSNISQSIG-----------KFYKNSEREKVSPSSPAFLGRSTKDAKHTRGGNLR  1855
             VP++V S+I   +            + +K + R+   PS    +G  T   +    GNLR
Sbjct  121   VPIYVQSSIKDCLAAERKTTPGSDSRNFKKNGRDPGDPSEDVVVGTDTSSDQDHDDGNLR  180

Query  1854  HQESS  1840
                SS
Sbjct  181   SSGSS  185



>ref|XP_009771094.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X3 [Nicotiana 
sylvestris]
Length=339

 Score =   125 bits (313),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 89/220 (40%), Positives = 120/220 (55%), Gaps = 22/220 (10%)
 Frame = -3

Query  1464  DRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIK  1285
             D G     +     +S +++SPD+V+ +IG K F  ARR IV+QQR+ A+QVFELHRLIK
Sbjct  70    DAGRREGISGTSNSLSFVEVSPDNVMELIGPKLFCIARRTIVHQQRILAIQVFELHRLIK  129

Query  1284  VQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVP-KHKNDSEKPHLRME  1108
             VQKLIA SP+ L E+  YL +P   SS K+LL     ++    VP K K D  KP +  E
Sbjct  130   VQKLIAASPDILFENNFYLTQPSIRSSVKKLLS--NNVRESSAVPVKAKVDPTKP-ITFE  186

Query  1107  CSAENTVGKASLS-----SVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQW  943
              SA+N   +  L+       ++  Q P+     G P    V++D  + P       G+Q 
Sbjct  187   HSADNNAPEKLLTLDNENDRRHIPQQPTQNSYVGTPISRSVTSDPKL-PL-----PGNQC  240

Query  942   LIPVMTPSEGLVYKPYPGPGFMSPGCGPPP-VSTPVMGNF  826
             L+P+ +PSEGLVYK Y GP      C PPP       GNF
Sbjct  241   LVPIRSPSEGLVYKNYTGP------CPPPPGFVASTYGNF  274



>gb|AEK05758.1| early flowering 3 [Populus balsamifera]
 gb|AEK05759.1| early flowering 3 [Populus balsamifera]
 gb|AEK05760.1| early flowering 3 [Populus balsamifera]
 gb|AEK05761.1| early flowering 3 [Populus balsamifera]
 gb|AEK05762.1| early flowering 3 [Populus balsamifera]
 gb|AEK05764.1| early flowering 3 [Populus balsamifera]
 gb|AEK05765.1| early flowering 3 [Populus balsamifera]
 gb|AEK05766.1| early flowering 3 [Populus balsamifera]
 gb|AEK05767.1| early flowering 3 [Populus balsamifera]
 gb|AEK05768.1| early flowering 3 [Populus balsamifera]
 gb|AEK05769.1| early flowering 3 [Populus balsamifera]
 gb|AEK05770.1| early flowering 3 [Populus balsamifera]
 gb|AEK05771.1| early flowering 3 [Populus balsamifera]
 gb|AEK05772.1| early flowering 3 [Populus balsamifera]
 gb|AEK05773.1| early flowering 3 [Populus balsamifera]
 gb|AEK05774.1| early flowering 3 [Populus balsamifera]
Length=261

 Score =   122 bits (307),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 98/265 (37%), Positives = 133/265 (50%), Gaps = 33/265 (12%)
 Frame = -3

Query  1155  VPKHKNDSEKPHLRMECSAENTVGKASLSSVQNATQ----APSCKPSPGNPPLPVVSNDS  988
             V K K+ S+K H   + + EN VGK  L S  + T     +     S   PP P+ +  +
Sbjct  2     VDKPKDHSQKQHTSADFAGENVVGKLPLPSTNDETSKEPISQRSNYSGSAPPAPLATT-A  60

Query  987   NMGPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGP-----GFMSP---GCGPPPVSTPVMG  832
                PWC+  P G+QWL+PVM+PSEGLVYKPY GP      FM P    CG  P+S    G
Sbjct  61    KPSPWCY-PPPGNQWLVPVMSPSEGLVYKPYAGPCPPVSRFMEPVYGSCG--PISLAPGG  117

Query  831   NFFAPPAYGLPTSQYHYQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTG  652
               F   AY +  S +   G+  P  P  G  +F P+GMPVMN ++  SAVEQ++   R G
Sbjct  118   GDFLNAAYSVSASNHGESGI-LPGNPHFGQTFFQPFGMPVMNPSICDSAVEQIS--PRIG  174

Query  651   SQA---QVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVR  481
              Q+   Q++ G +N N+  Q+SCNM +Q +              K++EIQ S A S S  
Sbjct  175   PQSKDNQLAVGDINFNIPLQSSCNMSNQMSRVISCC-VENFQGLKESEIQRSSAGSLSK-  232

Query  480   APGVTVSGPMEGRSVLPLFPTSPVV  406
                      M   + LPLFP  P +
Sbjct  233   ---------MPKANALPLFPMEPTL  248



>ref|XP_009771093.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Nicotiana 
sylvestris]
Length=373

 Score =   124 bits (312),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 87/206 (42%), Positives = 117/206 (57%), Gaps = 22/206 (11%)
 Frame = -3

Query  1422  ISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNFLLE  1243
             +S +++SPD+V+ +IG K F  ARR IV+QQR+ A+QVFELHRLIKVQKLIA SP+ L E
Sbjct  118   LSFVEVSPDNVMELIGPKLFCIARRTIVHQQRILAIQVFELHRLIKVQKLIAASPDILFE  177

Query  1242  DTAYLGKPLKVSSAKRLLPPFEYIKAPQNVP-KHKNDSEKPHLRMECSAENTVGKASLS-  1069
             +  YL +P   SS K+LL     ++    VP K K D  KP +  E SA+N   +  L+ 
Sbjct  178   NNFYLTQPSIRSSVKKLLS--NNVRESSAVPVKAKVDPTKP-ITFEHSADNNAPEKLLTL  234

Query  1068  ----SVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPVMTPSEGLVYK  901
                   ++  Q P+     G P    V++D  + P       G+Q L+P+ +PSEGLVYK
Sbjct  235   DNENDRRHIPQQPTQNSYVGTPISRSVTSDPKL-PL-----PGNQCLVPIRSPSEGLVYK  288

Query  900   PYPGPGFMSPGCGPPP-VSTPVMGNF  826
              Y GP      C PPP       GNF
Sbjct  289   NYTGP------CPPPPGFVASTYGNF  308



>ref|XP_009771092.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Nicotiana 
sylvestris]
Length=427

 Score =   125 bits (313),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 87/206 (42%), Positives = 117/206 (57%), Gaps = 22/206 (11%)
 Frame = -3

Query  1422  ISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNFLLE  1243
             +S +++SPD+V+ +IG K F  ARR IV+QQR+ A+QVFELHRLIKVQKLIA SP+ L E
Sbjct  172   LSFVEVSPDNVMELIGPKLFCIARRTIVHQQRILAIQVFELHRLIKVQKLIAASPDILFE  231

Query  1242  DTAYLGKPLKVSSAKRLLPPFEYIKAPQNVP-KHKNDSEKPHLRMECSAENTVGKASLS-  1069
             +  YL +P   SS K+LL     ++    VP K K D  KP +  E SA+N   +  L+ 
Sbjct  232   NNFYLTQPSIRSSVKKLLS--NNVRESSAVPVKAKVDPTKP-ITFEHSADNNAPEKLLTL  288

Query  1068  ----SVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPVMTPSEGLVYK  901
                   ++  Q P+     G P    V++D  + P       G+Q L+P+ +PSEGLVYK
Sbjct  289   DNENDRRHIPQQPTQNSYVGTPISRSVTSDPKL-PL-----PGNQCLVPIRSPSEGLVYK  342

Query  900   PYPGPGFMSPGCGPPP-VSTPVMGNF  826
              Y GP      C PPP       GNF
Sbjct  343   NYTGP------CPPPPGFVASTYGNF  362



>gb|AAM97051.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15504.1| unknown protein [Arabidopsis thaliana]
Length=339

 Score =   123 bits (308),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 93/146 (64%), Gaps = 8/146 (5%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF-DHGVLPPNPNNASNLIPPS  2161
             I+ PMFPRLHVND +KGGPRAPPRNKMALYEQLSIPSQRF DHG +    NN S L+ P 
Sbjct  10    ILEPMFPRLHVNDADKGGPRAPPRNKMALYEQLSIPSQRFGDHGTMNSRSNNTSTLVHPG  69

Query  2160  P-SQGNGHERRMFLPMHLPPST--YSAEKLHAHSS--DSNTPLTQFESRKKT-DEDDFRV  1999
             P SQ  G ER + +  HL  S    + EK  +  S  ++     Q + RK   +E+DF V
Sbjct  70    PSSQPCGVERNLSV-QHLDSSAANQATEKFVSQMSFMENVRSSAQHDQRKMVREEEDFAV  128

Query  1998  PVFVNSNISQSIGKFYKNSEREKVSP  1921
             PV++NS  SQS G+     E+EK +P
Sbjct  129   PVYINSRRSQSHGRTKSGIEKEKHTP  154


 Score = 56.6 bits (135),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -3

Query  1530  NVGNDVESQENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKAR  1351
             ++ ND E  +++ C S Q    +  D+ S+ SMV+ IS +D+SPDDVVGI+GQK FW+AR
Sbjct  275   DIDNDREYSKSRACASLQQINEEASDDVSDDSMVDSISSIDVSPDDVVGILGQKRFWRAR  334

Query  1350  RAIV  1339
             +AI 
Sbjct  335   KAIA  338



>ref|XP_009109656.1| PREDICTED: uncharacterized protein LOC103835244 isoform X3 [Brassica 
rapa]
Length=492

 Score =   122 bits (307),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 109/352 (31%), Positives = 156/352 (44%), Gaps = 73/352 (21%)
 Frame = -3

Query  1830  PATREQSVKASLSSRSTDKKEHCIKHTDT-DFPLHSEQRDGPANNSDLSHKSGINLQPES  1654
             P+ R  SVK S    S  + E+ + + D+   P+       P  N+DLS      LQ  S
Sbjct  108   PSPRGSSVKPS----SIKQNEYNLTNLDSLKVPVFRLPETDPKANTDLS------LQFHS  157

Query  1653  IIDSKVGDANDDAVVSGPIKGVEIGDSSVPINCFQTEGQIINVGNDVESQENQTCRSPQT  1474
                SK     + A     +  ++I +  +P+ C + E    N    V   +    R+P+T
Sbjct  158   SCTSK--SRGEAAGFKPLLNNLDIRELLLPLQCLEDESN--NGSLSVMKTQLYRRRTPKT  213

Query  1473  QKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHR  1294
                 R   +S+ S ++ +SGM  + +DV  +IG+K FWK R  +++QQ++FA QVFELHR
Sbjct  214   VP-PREQEASDCSAIDSLSGMSAASNDVARVIGEKRFWKMRAYMISQQKIFATQVFELHR  272

Query  1293  LIKVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPHLR  1114
             LI VQK++A+SPN +L+     G   K  + +   P  E        P+H     KP + 
Sbjct  273   LIMVQKMVAKSPNLVLKSKINGGSKFKRPNTENQKPVTE------AYPEHM----KPKI-  321

Query  1113  MECSAENTVGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPW--CFHQPSGHQWL  940
                                              PLP +S +     W      P G+QWL
Sbjct  322   ---------------------------------PLPFISKELMTPIWQQQLLPPQGNQWL  348

Query  939   IPVMTPSEGLVYKPYPGP------GFMSPGCGPP-----PVSTPVMGNFFAP  817
             +PVM+PSEGLVYKPY GP       FM P  G       P ST    N F P
Sbjct  349   VPVMSPSEGLVYKPYAGPCPPPPSAFMVPIYGQDLPSRLPASTQFSHNCFPP  400



>gb|AEK05763.1| early flowering 3 [Populus balsamifera]
Length=261

 Score =   117 bits (294),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 98/264 (37%), Positives = 132/264 (50%), Gaps = 31/264 (12%)
 Frame = -3

Query  1155  VPKHKNDSEKPHLRMECSAENTVGKASLSSVQNAT-QAPSCKPS--PGNPPLPVVSNDSN  985
             V K K+ S+K H   + + EN VGK  L S  + T + P  + S   G+ P    +  + 
Sbjct  2     VDKPKDHSQKQHTSADFAGENVVGKLPLPSTNDETSKEPISQRSNYSGSAPPAPXATTAK  61

Query  984   MGPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGP-----GFMSP---GCGPPPVSTPVMGN  829
               PWC+  P G+QWL+PVM+PSEGLVYKPY GP      FM P    CG  P+S    G 
Sbjct  62    PSPWCY-PPPGNQWLVPVMSPSEGLVYKPYAGPCPPVSRFMEPVYGSCG--PISLAPGGG  118

Query  828   FFAPPAYGLPTSQYHYQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGS  649
              F   AY +  S +   G+  P  P  G  +F P+GMPVMN ++  SAVEQ+    R G 
Sbjct  119   DFLNAAYSVSASNHXEXGI-LPGNPHFGQTFFQPFGMPVMNPSICDSAVEQIX--PRIGP  175

Query  648   QA---QVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRA  478
             Q+   Q++ G  N N+  Q+SCNM +Q +              K++EIQ S A S S   
Sbjct  176   QSKDNQLAVGDXNFNIPLQSSCNMSNQMSRVISCC-VENFQGLKESEIQXSSAGSLSK--  232

Query  477   PGVTVSGPMEGRSVLPLFPTSPVV  406
                     M   + LPLFP  P +
Sbjct  233   --------MPKANALPLFPMEPTL  248



>gb|AEK26570.1| early flowering 3 [Populus tremula]
Length=261

 Score =   114 bits (285),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 95/261 (36%), Positives = 130/261 (50%), Gaps = 29/261 (11%)
 Frame = -3

Query  1149  KHKNDSEKPHLRMECSAENTVGKASLSSVQNATQ----APSCKPSPGNPPLPVVSNDSNM  982
             K K+ S+K H   + + EN VGK  L S  + T     +     S   PP PV +  +  
Sbjct  4     KPKDHSQKQHTSADFAGENVVGKLPLPSTNDETSKEPISQRSNYSVSAPPAPVATT-TKP  62

Query  981   GPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGP-----GFMSP---GCGPPPVSTPVMGNF  826
              PW +  P G+QWL+PVM+PSEGLVYKPY GP      FM+P    CG  P+S    G  
Sbjct  63    SPWSY-PPPGNQWLVPVMSPSEGLVYKPYAGPCPPVSRFMAPVYGSCG--PISLAPGGGD  119

Query  825   FAPPAYGLPTSQYHYQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQ  646
             F   AY +  S +   G+  P  P  G  +F P+GMPVMN ++  SAV Q++      S+
Sbjct  120   FLNAAYSVSASNHEEIGI-LPGNPHFGQTFFQPFGMPVMNPSIRDSAVGQISPPIGPQSK  178

Query  645   -AQVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGV  469
               Q++ G +N N+  Q+SCNM +Q +       A      K++EIQ S A S S      
Sbjct  179   DNQLAVGDINSNIPLQSSCNMSNQMSRVISCC-AENFQGLKESEIQGSSAGSLSK-----  232

Query  468   TVSGPMEGRSVLPLFPTSPVV  406
                  M   + LPLFP  P +
Sbjct  233   -----MPKANALPLFPMEPTL  248



>ref|XP_010535272.1| PREDICTED: uncharacterized protein LOC104810626 [Tarenaya hassleriana]
Length=435

 Score =   115 bits (288),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 84/244 (34%), Positives = 119/244 (49%), Gaps = 45/244 (18%)
 Frame = -3

Query  1455  DNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQK  1276
             D+ S++S +E  SG+  SP+ +V +I  K + + R  ++ QQR+FA QVFELHRLI VQK
Sbjct  198   DDVSDSSGMESASGLSASPNHLVKVIRDKQYSRMRTTMIEQQRIFAAQVFELHRLITVQK  257

Query  1275  LIAESPNFLLED---TAYLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPHLR--M  1111
              +A SP+ +LE    T  LG   K+S+  ++ P                   KP L+   
Sbjct  258   RLARSPSTILERKGITGKLGTMKKLSNVLKMAP-----------------GVKPELKPTT  300

Query  1110  ECSAENTVGKASLSSVQNATQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPV  931
             E   ++ + K  L S+          P+        V+N++   PW F   SG+ WL+PV
Sbjct  301   EYLEKSVIPKLPLPSLSKDLITHKTHPA--------VTNENPSNPWWFSS-SGNHWLVPV  351

Query  930   MTPSEGLVYKPYPGPGFMSPGCGPPPVS---TPVMGNFFAPPAYGLPTSQ----YHYQGM  772
             M+PSEGLVYKPY        G  PPP S     V G+     A G P S     + + G 
Sbjct  352   MSPSEGLVYKPY-------SGLCPPPASGFVVSVFGDDSFETALGFPVSHQTNPFGHIGQ  404

Query  771   GDPF  760
             G  F
Sbjct  405   GMSF  408



>ref|NP_001043361.1| Os01g0566100 [Oryza sativa Japonica Group]
 dbj|BAD45081.1| nematode responsive protein-like [Oryza sativa Japonica Group]
 dbj|BAF05275.1| Os01g0566100 [Oryza sativa Japonica Group]
Length=396

 Score =   110 bits (275),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 121/400 (30%), Positives = 171/400 (43%), Gaps = 88/400 (22%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGG-PRAPPRNKMALYEQLSIPSQRFDHG---VLPPNPNNASNLI  2170
             +MGP+FPRLHVND  KGG PRAPPRNKMALYEQ ++PS RF  G   +     + A +  
Sbjct  17    VMGPLFPRLHVNDAAKGGGPRAPPRNKMALYEQFTVPSHRFSGGGGALASARGSLARSTS  76

Query  2169  PPSPSQGNGHERRMFLPMHLPPS--TYSAEKLHAHS---------SDSNTPLTQ------  2041
               S SQ  G +  +F P ++P +    S EK++++S          DS    TQ      
Sbjct  77    AASQSQVYGCDMPLFEPFNVPSNGPGQSVEKMNSNSVNRQINGSRKDSGMLSTQPKGIDK  136

Query  2040  ---------------------FESRKKTDEDDFRVPVFVNSNISQSIGKFYKNSEREK--  1930
                                     RK  D+D+F VP   ++   Q   K     + E   
Sbjct  137   YGSGSRAECAPQQRVEKGIKSSSGRKLADDDEFIVPSVFSARFPQYSTKERAGVQEESTP  196

Query  1929  ---VSP-SSPAFLGRSTKDAKHTRGGNLRH-----------QESSRQLPATREQSVKAS-  1798
                +SP  SP  + +S     +T   NL             Q+     PA   ++V+   
Sbjct  197   LVALSPHKSPPAVSKSPTKCYNTVSKNLERINVSDVKSRGSQKDKETGPAQTLKNVEVEH  256

Query  1797  LSSRSTDKKEHCIKHTDTDFPLHSEQRDGPANNSDLSHKSGINLQPESIIDSKVGDAN--  1624
              SS    K     KH     P     + G  N+ D  H      Q  S   S V   N  
Sbjct  257   FSSFEASKDMFGSKHAKV-CP-----KTGTINDLDEPHLENSEHQATSRNGSSVKFQNPP  310

Query  1623  --DDAVVSGPIKGVEIGDSSVPINCFQTEGQIINVGND---VESQENQTCRSPQTQKVDR  1459
                + + + P  G+E  +     +C   +G +   G     +E+Q+N        +K+D 
Sbjct  311   VRRNTISAKPSPGIENTNG----HCNLPQGGLKEAGTKRKRLEAQDN-------AEKIDD  359

Query  1458  GDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIV  1339
               +SS    VECI+  +ISPD++VG IG KHFWKARRAI+
Sbjct  360   LSDSS----VECITAWEISPDEIVGAIGAKHFWKARRAII  395



>gb|EPS62660.1| hypothetical protein M569_12130, partial [Genlisea aurea]
Length=248

 Score =   105 bits (263),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 79/128 (62%), Gaps = 10/128 (8%)
 Frame = -3

Query  2334  MGPMFPRLHVNDTEKGG-PRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  2158
             M PMFP+LHVND +KGG PRAPPRNKMALYEQL+IPSQR+ +   P   ++ASN++ P P
Sbjct  11    MVPMFPKLHVNDADKGGGPRAPPRNKMALYEQLNIPSQRYSNSAQPKPHSSASNVV-PRP  69

Query  2157  SQGNGHERRMFLPMHLPPSTYSAEKLHAHSSDSNTPLTQFESRKKTDEDDFRVPVFVNSN  1978
             SQ        F+P  +P   +  +    H     +P+ Q   +K  DEDD+RVP F NS 
Sbjct  70    SQ------VTFVP-KVPQRHHHEKHFDKHMDFMASPM-QITQKKNFDEDDYRVPTFFNSA  121

Query  1977  ISQSIGKF  1954
              SQS  K 
Sbjct  122   SSQSFNKI  129



>gb|EYU20385.1| hypothetical protein MIMGU_mgv1a014747mg [Erythranthe guttata]
Length=179

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 93/221 (42%), Positives = 112/221 (51%), Gaps = 47/221 (21%)
 Frame = -3

Query  930  MTPSEGLVYKPYPGPGFMSPGCGPPPVSTPVMGNFFAPPAYGLPTSQYHYQGMGDPFAPP  751
            M+PSEGLVYKPYP       G   PP S P +GNF  PP       QYH+      F P 
Sbjct  1    MSPSEGLVYKPYPFVSQPCGGGCGPPGSNPTVGNFSTPPP-----PQYHHLPSFPQFPP-  54

Query  750  IGHGYFPPYGMPVMN-SAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNMPSQK  574
              HGYFPPY +P+M+ SA S    EQ      T      +G  V              QK
Sbjct  55   --HGYFPPYCVPIMDTSAFSGPPPEQ------TIRAPAAAGPAV--------------QK  92

Query  573  NGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVD  394
            +G A            D E+Q S ASSPS R    +     E R++LPLFPT+P    VD
Sbjct  93   SGPA----------LWDVEMQGSTASSPSGRRKRGSNGVEFERRNMLPLFPTTPAA--VD  140

Query  393  ASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
            A +P       RVI+VVP N  SASESAARIF++IQ+ER+Q
Sbjct  141  ALKP------TRVIKVVPRNGLSASESAARIFRTIQEEREQ  175



>ref|XP_002303218.2| hypothetical protein POPTR_0003s04040g [Populus trichocarpa]
 gb|EEE78197.2| hypothetical protein POPTR_0003s04040g [Populus trichocarpa]
Length=417

 Score =   100 bits (249),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 64/96 (67%), Gaps = 5/96 (5%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG---VLPPNPNNA-SNLI  2170
             +  PMFPRLHVND EKGGPRAPPRNKMALYEQL IPSQRF  G   +LP  PNN  S   
Sbjct  10    MTSPMFPRLHVNDAEKGGPRAPPRNKMALYEQLCIPSQRFSSGSGSMLPVLPNNGSSLAP  69

Query  2169  PPSPSQGNGHERRMFLPMHLPPS-TYSAEKLHAHSS  2065
               S S G GHER +F P+   P+  +  EKL  +SS
Sbjct  70    SISSSHGTGHERSVFTPVSNSPTPLHLTEKLFYYSS  105


 Score = 67.0 bits (162),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -3

Query  1506  QENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIV  1339
             +E++   S +   ++R D+++ETSMV+ ++ ++I+PDDVVG+IG+K FWKAR AIV
Sbjct  361   REDKQSGSLKAGDLERNDDAAETSMVDSVTALEITPDDVVGVIGEKQFWKARTAIV  416



>emb|CDY11505.1| BnaA09g40710D [Brassica napus]
Length=592

 Score = 98.6 bits (244),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 69/120 (58%), Gaps = 14/120 (12%)
 Frame = -3

Query  2334  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG--VLPPNPNNASNLIPPS  2161
             + PMFPRLHV D EKGGPRAPPRNKMALYEQLSIPSQRF     V    P N S L+PP 
Sbjct  11    LEPMFPRLHVKDAEKGGPRAPPRNKMALYEQLSIPSQRFTSSDRVGGSLPRNTSPLLPPG  70

Query  2160  PSQGNGHERRMFLPMHLPPSTYSAEKLHAHSSDSNTPLTQFESRKKTDEDDFRVPVFVNS  1981
             PS   G +      M L  +  ++   H H           + +   +EDDF VPVF+NS
Sbjct  71    PSSNQGTD-NFVTQMPLMENVRTSPAQHDH-----------QRKIAREEDDFAVPVFINS  118



>gb|AFR60581.1| early flowering 3/high response [Pisum sativum subsp. sativum]
Length=85

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 50/58 (86%), Gaps = 3/58 (5%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPP  2164
             +MGP+FPRLHV DTEKGGPRAPPRNKMALYEQ SIPSQRF+   LP +PN ++N +PP
Sbjct  10    MMGPLFPRLHVGDTEKGGPRAPPRNKMALYEQFSIPSQRFN---LPLHPNTSNNSVPP  64



>ref|XP_001766802.1| predicted protein [Physcomitrella patens]
 gb|EDQ68433.1| predicted protein [Physcomitrella patens]
Length=1796

 Score = 96.7 bits (239),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 104/415 (25%), Positives = 175/415 (42%), Gaps = 64/415 (15%)
 Frame = -3

Query  2325  MFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG--VLPPNPNNA---SNLIP--  2167
             +FPRLHV +T+K GPR PPRNKMAL EQL+IPS +F      LP +  N    S   P  
Sbjct  1005  LFPRLHVAETKKAGPRGPPRNKMALSEQLTIPSHKFKPSPIALPSSGRNTKYPSMCTPTY  1064

Query  2166  -PSPSQGNGHERRMFLPMH-----LPPSTYSAEKLHA--HSSDSNTPLTQFE--------  2035
              P    G+      F+PM+     + P+      +++  +S DS + L            
Sbjct  1065  LPQVQTGSYDSMYSFVPMNYMNSGIIPTMACVPMMNSGLYSVDSRSSLNTCSSKSTVVDG  1124

Query  2034  -------------------------SRKKTDEDDFRVPVFVNSNISQSIGKFYKNSEREK  1930
                                      S+K + +D+F VP   +S    S+ +  ++S  E+
Sbjct  1125  SSEPSVGGAVTQPPKSFNHSKQHSPSKKGSRDDEFAVPAH-SSGTPSSLLQTQQDSREEQ  1183

Query  1929  VSPSSPAFLGRSTKDAKHTRGGNLRHQESSRQLPATREQSVKASLSSRSTDKKEHCIKHT  1750
             + P    F+      A   +   +  ++S       R+       +S             
Sbjct  1184  LPPGCKNFVMEKRTSACVNQVRRIVTEKSIEVTSRKRKDDASWHTASEECTTVSAIDNDV  1243

Query  1749  DTDFPLHSEQRDGPANNSDLSHKSGINLQPESIIDSKVGDANDDAVVSGPIKGVEIGDSS  1570
             D+    H+E    P  +      S   ++ E   D ++         +G  K  E   ++
Sbjct  1244  DSQEFRHTELDRVPVGHRGHVKPSSCKIRQE---DVRIHGNEVRKSFAGLAKITETHPTT  1300

Query  1569  VPINCFQT-----EGQII-NVGNDVESQENQTCRSPQTQKVDRGDNSSETS-MVECISGM  1411
               I+   T     E  II N+ ++ +S+E       +  +  RG ++   S M+E +   
Sbjct  1301  ARISSMHTLIAPSEQDIISNISSENQSEEIS-----ELYQQKRGSSARTGSLMLENVPTD  1355

Query  1410  DISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNFLL  1246
              +   DVV I GQ+ FWK ++ I+ QQR+F+ Q+F+LHR+++VQ L+A+   F +
Sbjct  1356  FVQLRDVVNIFGQQGFWKTQKVIIRQQRIFSKQLFDLHRIMEVQHLLAKELCFSI  1410


 Score = 76.3 bits (186),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 61/88 (69%), Gaps = 1/88 (1%)
 Frame = -3

Query  1512  ESQENQTCRSPQTQKVDRGDNS-SETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVN  1336
             +S EN++  + +  +  RG ++ +E+SM+E +    I   DVV   GQ+ FWK+++ I+ 
Sbjct  367   QSSENRSGEASEFSQRKRGGSAETESSMLENLPPGSICFRDVVDAFGQQEFWKSQKTIMR  426

Query  1335  QQRVFAVQVFELHRLIKVQKLIAESPNF  1252
             QQ++F+ QVFELHRLI+VQ L+A+SP+ 
Sbjct  427   QQKLFSRQVFELHRLIEVQHLLAKSPSL  454


 Score = 65.1 bits (157),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 47/77 (61%), Gaps = 7/77 (9%)
 Frame = -3

Query  2325  MFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPN-------PNNASNLIP  2167
             +FPRLHV +T+K GPR PPRNKMALYEQL++PS+     +L P+       P+  +++  
Sbjct  37    LFPRLHVAETKKAGPRGPPRNKMALYEQLAVPSRYKQSPMLLPSSGRMVTTPSMTTSIFQ  96

Query  2166  PSPSQGNGHERRMFLPM  2116
             P     +   R  ++PM
Sbjct  97    PQAQASSYDSRYSYMPM  113



>dbj|BAL49857.1| self-incompatibility locus early-flowering 3 [Fagopyrum esculentum]
Length=373

 Score = 92.8 bits (229),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 71/103 (69%), Gaps = 3/103 (3%)
 Frame = -3

Query  1467  VDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLI  1288
             V R ++ S T  V  ++ + ISPDDVV  IGQ++FWK RR +V QQR+F++QVFELHRL 
Sbjct  187   VHRNEDGSGTRKVGYVTSVRISPDDVVLKIGQEYFWKIRRILVKQQRIFSIQVFELHRL-  245

Query  1287  KVQKLIAESPNFLLEDTAYLGKPL-KVSSAKRLLPPFEYIKAP  1162
              VQK +A S +  ++D+ YL + L +VSS +  LPP  +++ P
Sbjct  246   -VQKSLAGSSHHYIKDSIYLQERLDEVSSKEESLPPQLHLQTP  287



>gb|EYU21410.1| hypothetical protein MIMGU_mgv1a006681mg [Erythranthe guttata]
Length=435

 Score = 93.2 bits (230),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 67/202 (33%), Positives = 94/202 (47%), Gaps = 50/202 (25%)
 Frame = -3

Query  1413  MDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTA  1234
             + I+P+DV+G+ G++ F +AR  I++ QR+F++Q+ ELHRLIKVQ+LIAESP  L E   
Sbjct  193   LRITPNDVIGLFGERPFIEARNKILHHQRIFSMQLSELHRLIKVQRLIAESPELLHEKNF  252

Query  1233  YLGKPLKVSSAKRLLPPFEYIKAPQNVPKHKNDSEKPHLRMECSAENTVGKASLSSVQNA  1054
              + KP   SS      P        +    K   E  +    C AE+ + K         
Sbjct  253   DVTKPSSESSQTN--NPLYTSSLDPSPHATKRKFETLNSDKNCGAESVMNKL--------  302

Query  1053  TQAPSCKPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGPGFMS  874
                         PP           PW  H PS +QWL+P  +PSEGL+YKP        
Sbjct  303   ------------PP-----------PWYSHSPS-NQWLVPAKSPSEGLIYKPI-------  331

Query  873   PGCGPPPVSTPVMGNFFAPPAY  808
                    +  PV GN+   P+Y
Sbjct  332   -------IVGPVFGNYV--PSY  344



>gb|EPS65488.1| hypothetical protein M569_09288, partial [Genlisea aurea]
Length=70

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIP  2167
             ++GPMFPRLHVND +KGGPRAPPRNKMALYEQ SI SQRF +  L    + A+N  P
Sbjct  10    MVGPMFPRLHVNDVDKGGPRAPPRNKMALYEQFSISSQRFSNSALSQTSSTAANSFP  66



>dbj|BAL49854.1| arabidopsis ELF3 homolog, partial [Fagopyrum esculentum subsp. 
esculentum]
 dbj|BAL49862.1| self-incompatibility locus early-flowering 3 [Fagopyrum esculentum 
subsp. esculentum]
 dbj|BAL49864.1| self-incompatibility locus early-flowering 3 [Fagopyrum esculentum 
subsp. esculentum]
 dbj|BAL49866.1| self-incompatibility locus early-flowering 3 [Fagopyrum esculentum 
subsp. esculentum]
Length=661

 Score = 92.8 bits (229),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 71/103 (69%), Gaps = 3/103 (3%)
 Frame = -3

Query  1467  VDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLI  1288
             V R ++ S T  V  ++ + ISPDDVV  IGQ++FWK RR +V QQR+F++QVFELHRL 
Sbjct  187   VHRNEDGSGTRKVGYVTSVRISPDDVVLKIGQENFWKIRRILVKQQRIFSIQVFELHRL-  245

Query  1287  KVQKLIAESPNFLLEDTAYLGKPL-KVSSAKRLLPPFEYIKAP  1162
              VQK +A S +  ++D+ YL + L +VSS +  LPP  +++ P
Sbjct  246   -VQKSLAGSSHHYIKDSIYLQERLDEVSSKEESLPPQLHLQTP  287



>dbj|BAL49863.1| self-incompatibility locus early-flowering 3 [Fagopyrum esculentum 
subsp. esculentum]
Length=661

 Score = 92.8 bits (229),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 71/103 (69%), Gaps = 3/103 (3%)
 Frame = -3

Query  1467  VDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLI  1288
             V R ++ S T  V  ++ + ISPDDVV  IGQ++FWK RR +V QQR+F++QVFELHRL 
Sbjct  187   VHRNEDGSGTRKVGYVTSVRISPDDVVLKIGQENFWKIRRILVKQQRIFSIQVFELHRL-  245

Query  1287  KVQKLIAESPNFLLEDTAYLGKPL-KVSSAKRLLPPFEYIKAP  1162
              VQK +A S +  ++D+ YL + L +VSS +  LPP  +++ P
Sbjct  246   -VQKSLAGSSHHYIKDSIYLQERLDEVSSKEESLPPQLHLQTP  287


 Score = 54.3 bits (129),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 48/84 (57%), Gaps = 5/84 (6%)
 Frame = -3

Query  2316  RLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIP----PSPSQG  2149
             RLH+  TEKGGP+ PPRNKMA++E+    S RF +G +   P +    +P     S  Q 
Sbjct  2     RLHLKTTEKGGPKPPPRNKMAVHEEPIASSSRFSNGSITMMPLHPIGGVPISQVGSSQQV  61

Query  2148  NGHERRMFLPMH-LPPSTYSAEKL  2080
             NG ER+     + LP ST+ A ++
Sbjct  62    NGPERKTLSAFYSLPASTHRAPRI  85



>dbj|BAL49865.1| self-incompatibility locus early-flowering 3 [Fagopyrum esculentum 
subsp. esculentum]
Length=662

 Score = 92.8 bits (229),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 71/103 (69%), Gaps = 3/103 (3%)
 Frame = -3

Query  1467  VDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLI  1288
             V R ++ S T  V  ++ + ISPDDVV  IGQ++FWK RR +V QQR+F++QVFELHRL 
Sbjct  187   VHRNEDGSGTRKVGYVTSVRISPDDVVLKIGQENFWKIRRILVKQQRIFSIQVFELHRL-  245

Query  1287  KVQKLIAESPNFLLEDTAYLGKPL-KVSSAKRLLPPFEYIKAP  1162
              VQK +A S +  ++D+ YL + L +VSS +  LPP  +++ P
Sbjct  246   -VQKSLAGSSHHYIKDSIYLQERLDEVSSKEESLPPQLHLQTP  287


 Score = 54.7 bits (130),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 48/84 (57%), Gaps = 5/84 (6%)
 Frame = -3

Query  2316  RLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIP----PSPSQG  2149
             RLH+  TEKGGP+ PPRNKMA++E+    S RF +G +   P +    +P     S  Q 
Sbjct  2     RLHLKTTEKGGPKPPPRNKMAVHEEPIASSSRFSNGSITMMPLHPIGGVPISQVGSSQQV  61

Query  2148  NGHERRMFLPMH-LPPSTYSAEKL  2080
             NG ER+     + LP ST+ A ++
Sbjct  62    NGIERKTLSAFYSLPASTHRAPRI  85



>dbj|BAL49860.1| self-incompatibility locus early-flowering 3 [Fagopyrum esculentum 
subsp. esculentum]
Length=662

 Score = 92.8 bits (229),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 71/103 (69%), Gaps = 3/103 (3%)
 Frame = -3

Query  1467  VDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLI  1288
             V R ++ S T  V  ++ + ISPDDVV  IGQ++FWK RR +V QQR+F++QVFELHRL 
Sbjct  187   VHRNEDGSGTRKVGYVTSVRISPDDVVLKIGQENFWKIRRILVKQQRIFSIQVFELHRL-  245

Query  1287  KVQKLIAESPNFLLEDTAYLGKPL-KVSSAKRLLPPFEYIKAP  1162
              VQK +A S +  ++D+ YL + L +VSS +  LPP  +++ P
Sbjct  246   -VQKSLAGSSHHYIKDSIYLQERLDEVSSKEESLPPQLHLQTP  287


 Score = 54.7 bits (130),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 48/84 (57%), Gaps = 5/84 (6%)
 Frame = -3

Query  2316  RLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIP----PSPSQG  2149
             RLH+  TEKGGP+ PPRNKMA++E+    S RF +G +   P +    +P     S  Q 
Sbjct  2     RLHLKTTEKGGPKPPPRNKMAVHEEPIASSSRFSNGSITMMPLHPIGGVPISQVGSSQQV  61

Query  2148  NGHERRMFLPMH-LPPSTYSAEKL  2080
             NG ER+     + LP ST+ A ++
Sbjct  62    NGIERKTLSAFYSLPASTHRAPRI  85



>dbj|BAL49861.1| self-incompatibility locus early-flowering 3 [Fagopyrum esculentum 
subsp. esculentum]
Length=662

 Score = 92.8 bits (229),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 71/103 (69%), Gaps = 3/103 (3%)
 Frame = -3

Query  1467  VDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLI  1288
             V R ++ S T  V  ++ + ISPDDVV  IGQ++FWK RR +V QQR+F++QVFELHRL 
Sbjct  187   VHRNEDGSGTRKVGYVTSVRISPDDVVLKIGQENFWKIRRILVKQQRIFSIQVFELHRL-  245

Query  1287  KVQKLIAESPNFLLEDTAYLGKPL-KVSSAKRLLPPFEYIKAP  1162
              VQK +A S +  ++D+ YL + L +VSS +  LPP  +++ P
Sbjct  246   -VQKSLAGSSHHYIKDSIYLQERLDEVSSKEESLPPQLHLQTP  287


 Score = 54.7 bits (130),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 48/84 (57%), Gaps = 5/84 (6%)
 Frame = -3

Query  2316  RLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIP----PSPSQG  2149
             RLH+  TEKGGP+ PPRNKMA++E+    S RF +G +   P +    +P     S  Q 
Sbjct  2     RLHLKTTEKGGPKPPPRNKMAVHEEPIASSSRFSNGSITMMPLHPIGGVPISQVGSSQQV  61

Query  2148  NGHERRMFLPMH-LPPSTYSAEKL  2080
             NG ER+     + LP ST+ A ++
Sbjct  62    NGIERKTLSAFYSLPASTHRAPRI  85



>dbj|BAL49859.1| self-incompatibility locus early-flowering 3 [Fagopyrum esculentum 
subsp. esculentum]
Length=662

 Score = 92.4 bits (228),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 71/103 (69%), Gaps = 3/103 (3%)
 Frame = -3

Query  1467  VDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLI  1288
             V R ++ S T  V  ++ + ISPDDVV  IGQ++FWK RR +V QQR+F++QVFELHRL 
Sbjct  187   VHRNEDGSGTRKVGYVTSVRISPDDVVLKIGQENFWKIRRILVKQQRIFSIQVFELHRL-  245

Query  1287  KVQKLIAESPNFLLEDTAYLGKPL-KVSSAKRLLPPFEYIKAP  1162
              VQK +A S +  ++D+ YL + L +VSS +  LPP  +++ P
Sbjct  246   -VQKSLAGSSHHYIKDSIYLQERLDEVSSKEESLPPQLHLQTP  287


 Score = 54.7 bits (130),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 48/84 (57%), Gaps = 5/84 (6%)
 Frame = -3

Query  2316  RLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIP----PSPSQG  2149
             RLH+  TEKGGP+ PPRNKMA++E+    S RF +G +   P +    +P     S  Q 
Sbjct  2     RLHLKTTEKGGPKPPPRNKMAVHEEPIASSSRFSNGSITMMPLHPIGGVPISQVGSSQQV  61

Query  2148  NGHERRMFLPMH-LPPSTYSAEKL  2080
             NG ER+     + LP ST+ A ++
Sbjct  62    NGIERKTLSAFYSLPASTHRAPRI  85



>gb|AFK35699.1| unknown [Medicago truncatula]
Length=183

 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 84/228 (37%), Positives = 111/228 (49%), Gaps = 57/228 (25%)
 Frame = -3

Query  930  MTPSEGLVYKPYPGPGFMSP--------GCGPPPVSTPVMGNFFAPPAYGLPTSQYHYQG  775
            M+PSEGLVYKPYPGPG+           G GPP V+       F  PAYG+P   +H   
Sbjct  1    MSPSEGLVYKPYPGPGYTGAVYGGYRPFGQGPPDVT-------FMNPAYGVP--DFHQAI  51

Query  774  MGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNS  595
               PF PP G+ YFPP+G+P M  + S SAVEQ N              G  L+V+    
Sbjct  52   AVPPFIPPGGYPYFPPHGVPAMYQSASVSAVEQKN--------------GATLHVR----  93

Query  594  CNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTS  415
                             +    ++ E++    SSP  +A  +      E R  L    T 
Sbjct  94   -----------------KPQPFRERELE----SSPGEKAQEIIKEKFAEERDTLFFSFTV  132

Query  414  PVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  271
            P+V+  +  +  +T    +VIRVVPHN R A+ SAARIFQSIQ+ERK+
Sbjct  133  PIVS-KEVLKSLETRQKPQVIRVVPHNPRFATVSAARIFQSIQEERKR  179



>ref|XP_002978467.1| hypothetical protein SELMODRAFT_443909 [Selaginella moellendorffii]
 gb|EFJ20453.1| hypothetical protein SELMODRAFT_443909 [Selaginella moellendorffii]
Length=766

 Score = 90.9 bits (224),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 60/87 (69%), Gaps = 5/87 (6%)
 Frame = -3

Query  1458  GDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQ  1279
             GD  S  S+V+      I+  DVVG +G+K FWK R+ I+ QQR+F  QVFELHR++KVQ
Sbjct  365   GDGDSNASIVDPFG--KIAARDVVGAVGEKEFWKTRKTILRQQRIFETQVFELHRVVKVQ  422

Query  1278  KLIAESPNFLLE-DTA--YLGKPLKVS  1207
              L+AESP  LLE D A  +L +PL+++
Sbjct  423   HLLAESPKLLLEPDHARFHLAQPLRIT  449


 Score = 68.9 bits (167),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 69/136 (51%), Gaps = 27/136 (20%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF-----DHGVLPP-NPNNASN  2176
             +  P+FPR+HV+DT + GP+APPRNKMALYEQL++PSQ F        V PP NP  AS 
Sbjct  34    VAEPLFPRVHVSDT-RNGPKAPPRNKMALYEQLTVPSQHFLQRQASGSVWPPMNPAYASQ  92

Query  2175  LIPPSPSQGNGHERRMFLPMHLPPSTYSAEKLHAHSSDSNT-------PLTQFESR---K  2026
               P             F P  +PP    +   HA S+D  T       PL   +S     
Sbjct  93    YAP--------FASNCFTPCFVPPGL--SFHHHASSTDGGTASQSMGAPLGSQKSMVMDS  142

Query  2025  KTDEDDFRVPVFVNSN  1978
             + D++  RVP  V+ N
Sbjct  143   EVDKELQRVPRVVDEN  158



>gb|AEK05745.1| early flowering 3 [Populus balsamifera]
Length=399

 Score = 86.3 bits (212),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 57/87 (66%), Gaps = 5/87 (6%)
 Frame = -3

Query  2310  HVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG---VLPPNPNNA-SNLIPPSPSQGNG  2143
             HVND EKGGPRAPPRNKMALYEQL IPSQRF  G   +LP  PNN  S     S S G G
Sbjct  1     HVNDAEKGGPRAPPRNKMALYEQLCIPSQRFSSGSGSMLPVLPNNGSSLAPSISSSHGTG  60

Query  2142  HERRMFLPMHLPPS-TYSAEKLHAHSS  2065
             HER +F P+   P+  +  EKL  +SS
Sbjct  61    HERSVFTPVXNSPTPLHLTEKLFYYSS  87


 Score = 67.0 bits (162),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -3

Query  1506  QENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIV  1339
             +E++   S +   ++R D+++ETSMV+ ++ ++I+PDDVVG+IG+K FWKAR AIV
Sbjct  343   REDKQSGSLKAGDLERNDDAAETSMVDSVTALEITPDDVVGVIGEKQFWKARTAIV  398



>gb|AEK05755.1| early flowering 3 [Populus balsamifera]
 gb|AEK05756.1| early flowering 3 [Populus balsamifera]
Length=399

 Score = 86.3 bits (212),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 57/87 (66%), Gaps = 5/87 (6%)
 Frame = -3

Query  2310  HVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG---VLPPNPNNA-SNLIPPSPSQGNG  2143
             HVND EKGGPRAPPRNKMALYEQL IPSQRF  G   +LP  PNN  S     S S G G
Sbjct  1     HVNDAEKGGPRAPPRNKMALYEQLCIPSQRFSSGSGSMLPVLPNNGSSLAPSISSSHGTG  60

Query  2142  HERRMFLPMHLPPS-TYSAEKLHAHSS  2065
             HER +F P+   P+  +  EKL  +SS
Sbjct  61    HERSVFTPVSNSPTPLHLTEKLFYYSS  87


 Score = 66.6 bits (161),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -3

Query  1506  QENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIV  1339
             +E++   S +   ++R D+++ETSMV+ ++ ++I+PDDVVG+IG+K FWKAR AIV
Sbjct  343   REDKQSGSLKAGDLERNDDAAETSMVDSVTALEITPDDVVGVIGEKQFWKARTAIV  398



>gb|AEK05746.1| early flowering 3 [Populus balsamifera]
Length=399

 Score = 85.9 bits (211),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 57/87 (66%), Gaps = 5/87 (6%)
 Frame = -3

Query  2310  HVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG---VLPPNPNNA-SNLIPPSPSQGNG  2143
             HVND EKGGPRAPPRNKMALYEQL IPSQRF  G   +LP  PNN  S     S S G G
Sbjct  1     HVNDAEKGGPRAPPRNKMALYEQLCIPSQRFSSGSGSMLPVLPNNGSSLAPSISSSHGTG  60

Query  2142  HERRMFLPMHLPPS-TYSAEKLHAHSS  2065
             HER +F P+   P+  +  EKL  +SS
Sbjct  61    HERSVFTPVXNSPTPLHLTEKLFYYSS  87


 Score = 66.6 bits (161),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -3

Query  1506  QENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIV  1339
             +E++   S +   ++R D+++ETSMV+ ++ ++I+PDDVVG+IG+K FWKAR AIV
Sbjct  343   REDKQSGSLKAGDLERNDDAAETSMVDSVTALEITPDDVVGVIGEKQFWKARTAIV  398



>gb|AEK05742.1| early flowering 3 [Populus balsamifera]
Length=399

 Score = 85.5 bits (210),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 57/87 (66%), Gaps = 5/87 (6%)
 Frame = -3

Query  2310  HVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG---VLPPNPNNA-SNLIPPSPSQGNG  2143
             HVND EKGGPRAPPRNKMALYEQL IPSQRF  G   +LP  PNN  S     S S G G
Sbjct  1     HVNDAEKGGPRAPPRNKMALYEQLCIPSQRFSSGSGSMLPVLPNNGSSLAPSISSSHGTG  60

Query  2142  HERRMFLPMHLPPS-TYSAEKLHAHSS  2065
             HER +F P+   P+  +  EKL  +SS
Sbjct  61    HERSVFTPVCNSPTPLHLTEKLFYYSS  87


 Score = 66.6 bits (161),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -3

Query  1506  QENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIV  1339
             +E++   S +   ++R D+++ETSMV+ ++ ++I+PDDVVG+IG+K FWKAR AIV
Sbjct  343   REDKQSGSLKAGDLERNDDAAETSMVDSVTALEITPDDVVGVIGEKQFWKARTAIV  398



>gb|AEK05754.1| early flowering 3 [Populus balsamifera]
Length=399

 Score = 85.5 bits (210),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 57/87 (66%), Gaps = 5/87 (6%)
 Frame = -3

Query  2310  HVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG---VLPPNPNNA-SNLIPPSPSQGNG  2143
             HVND EKGGPRAPPRNKMALYEQL IPSQRF  G   +LP  PNN  S     S S G G
Sbjct  1     HVNDAEKGGPRAPPRNKMALYEQLCIPSQRFSSGSGSMLPVLPNNGSSLAPSISSSHGAG  60

Query  2142  HERRMFLPMHLPPS-TYSAEKLHAHSS  2065
             HER +F P+   P+  +  EKL  +SS
Sbjct  61    HERSVFTPVSNSPTPLHLTEKLFYYSS  87


 Score = 67.0 bits (162),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -3

Query  1506  QENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIV  1339
             +E++   S +   ++R D+++ETSMV+ ++ ++I+PDDVVG+IG+K FWKAR AIV
Sbjct  343   REDKQSGSLKAGDLERNDDAAETSMVDSVTALEITPDDVVGVIGEKQFWKARTAIV  398



>gb|AEK05739.1| early flowering 3 [Populus balsamifera]
 gb|AEK05740.1| early flowering 3 [Populus balsamifera]
 gb|AEK05741.1| early flowering 3 [Populus balsamifera]
 gb|AEK05747.1| early flowering 3 [Populus balsamifera]
 gb|AEK05748.1| early flowering 3 [Populus balsamifera]
 gb|AEK05749.1| early flowering 3 [Populus balsamifera]
 gb|AEK05750.1| early flowering 3 [Populus balsamifera]
 gb|AEK05751.1| early flowering 3 [Populus balsamifera]
 gb|AEK05753.1| early flowering 3 [Populus balsamifera]
Length=399

 Score = 85.5 bits (210),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 57/87 (66%), Gaps = 5/87 (6%)
 Frame = -3

Query  2310  HVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG---VLPPNPNNA-SNLIPPSPSQGNG  2143
             HVND EKGGPRAPPRNKMALYEQL IPSQRF  G   +LP  PNN  S     S S G G
Sbjct  1     HVNDAEKGGPRAPPRNKMALYEQLCIPSQRFSSGSGSMLPVLPNNGSSLAPSISSSHGTG  60

Query  2142  HERRMFLPMHLPPS-TYSAEKLHAHSS  2065
             HER +F P+   P+  +  EKL  +SS
Sbjct  61    HERSVFTPVCNSPTPLHLTEKLFYYSS  87


 Score = 66.6 bits (161),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -3

Query  1506  QENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIV  1339
             +E++   S +   ++R D+++ETSMV+ ++ ++I+PDDVVG+IG+K FWKAR AIV
Sbjct  343   REDKQSGSLKAGDLERNDDAAETSMVDSVTALEITPDDVVGVIGEKQFWKARTAIV  398



>emb|CDY62750.1| BnaC01g43670D [Brassica napus]
Length=489

 Score = 85.1 bits (209),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 79/255 (31%), Positives = 109/255 (43%), Gaps = 73/255 (29%)
 Frame = -3

Query  1014  PLPVVSNDSNMGPWC--FHQPSGHQWLIPVMTPSEGLVYKPYPGPGFMSPGCGPPPVSTP  841
             PLP +S +  +  W      P  +QWL+PVM+PSEGLVYKPY GP    P          
Sbjct  293   PLPFISKELMIPIWQQQLLPPQENQWLVPVMSPSEGLVYKPYAGPCPPPPSA--------  344

Query  840   VMGNFFAPPAYGLPT-SQYHYQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSF  664
                  F  P YG  + S++       P +    H  FPP           T+ ++Q N F
Sbjct  345   -----FMVPIYGQDSPSRF-------PASTQFSHNCFPP----------RTTVLDQTNPF  382

Query  663   ---TRTGSQAQVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASS  493
                 R  S +      +  +++     N                     D+E+  S ASS
Sbjct  383   GQLQRWSSTSSHMTQAIPFSLKKSQESN---------------------DSEVHGSTASS  421

Query  492   PSVRAPGVTVSGPMEGRSVLPLFPTSPV--VNIVDASQPPDTGHPARVIRVVPHNARSAS  319
             P  +              VLPLFPT P    +  +  Q P +G     I+ +PHN+ SAS
Sbjct  422   PPEK----------HKFDVLPLFPTEPTHHTDEYEQKQQPFSG----AIKAIPHNSTSAS  467

Query  318   ESAARIFQSIQKERK  274
             ESAARIF+SIQ+ER+
Sbjct  468   ESAARIFRSIQEERR  482


 Score = 81.6 bits (200),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 60/192 (31%), Positives = 97/192 (51%), Gaps = 18/192 (9%)
 Frame = -3

Query  1830  PATREQSVKASLSSRSTDKKEHCIKHTDT-DFPLHSEQRDGPANNSDLSHKSGINLQPES  1654
             P+ R  SVK S    S  + E+ + + D+   P+       P  N+DLS      LQ   
Sbjct  108   PSPRGSSVKPS----SIKQNEYNLTNLDSLKVPVFRLPETDPKANTDLS------LQ---  154

Query  1653  IIDSKVGDANDDAVVSGPI-KGVEIGDSSVPINCFQTEGQIINVGNDVESQENQTCRSPQ  1477
               +S    +  +A    P+   ++I +  +P+ C + E    N    V   +    R+P+
Sbjct  155   FHNSSTSKSRGEAAGFKPLLNNLDIRELLLPLQCLEDESN--NGSLSVMKTQLYRRRTPK  212

Query  1476  TQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIVNQQRVFAVQVFELH  1297
             T    R   +S+ S ++ +SGM  + +DV  +IG+K FWK R  +++QQ++FA QVFELH
Sbjct  213   TVP-PREQEASDCSAIDSLSGMSAASNDVARVIGEKRFWKMRAYMISQQKIFATQVFELH  271

Query  1296  RLIKVQKLIAES  1261
             RLI  QK + E+
Sbjct  272   RLIMNQKPVTEA  283



>gb|AEK05743.1| early flowering 3 [Populus balsamifera]
 gb|AEK05744.1| early flowering 3 [Populus balsamifera]
 gb|AEK05752.1| early flowering 3 [Populus balsamifera]
Length=399

 Score = 82.8 bits (203),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 56/87 (64%), Gaps = 5/87 (6%)
 Frame = -3

Query  2310  HVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG---VLPPNPNNA-SNLIPPSPSQGNG  2143
             HVND EK GPRAPPRNKMALYEQL IPSQRF  G   +LP  PNN  S     S S G G
Sbjct  1     HVNDAEKXGPRAPPRNKMALYEQLCIPSQRFSSGSGSMLPVLPNNGSSLAPSISSSHGTG  60

Query  2142  HERRMFLPMHLPPS-TYSAEKLHAHSS  2065
             HER +F P+   P+  +  EKL  +SS
Sbjct  61    HERSVFTPVCNSPTPLHLTEKLFYYSS  87


 Score = 66.6 bits (161),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -3

Query  1506  QENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHFWKARRAIV  1339
             +E++   S +   ++R D+++ETSMV+ ++ ++I+PDDVVG+IG+K FWKAR AIV
Sbjct  343   REDKQSGSLKAGDLERNDDAAETSMVDSVTALEITPDDVVGVIGEKQFWKARTAIV  398



>dbj|BAL49855.1| self-incompatibility locus early-flowering 3 [Fagopyrum cymosum]
Length=670

 Score = 83.6 bits (205),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 63/173 (36%), Positives = 95/173 (55%), Gaps = 20/173 (12%)
 Frame = -3

Query  1542  GQIINVGNDVESQENQTC-----RSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGII  1378
             G +I+  N+  +  N  C      S   + V R ++ S T  V  ++   ISPDDVV  I
Sbjct  163   GLLISPDNNDGTGSNSRCLESEDYSMHARIVHRNEDGSGTRKVGYVTS-RISPDDVVLKI  221

Query  1377  GQKHFWKARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGKPL-KVSSA  1201
             GQ++FWK RR +V QQR+F++QVFELH+L  VQK +A S    +ED+  L +   +VSS 
Sbjct  222   GQENFWKIRRILVKQQRIFSIQVFELHQL--VQKSLAGSSYHFIEDSICLHEHFHEVSSK  279

Query  1200  KRLL----PPFEYIKAP---QNVPKHKNDSEKPHLRMECSAENTVGKASLSSV  1063
             + LL    PP  +++ P    ++  H   SE P +    +A+N++ K    SV
Sbjct  280   EELLQPLQPPHLHLQTPPPLSSLRTHVQPSECPKI----AADNSLVKTPFPSV  328


 Score = 64.7 bits (156),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 58/91 (64%), Gaps = 6/91 (7%)
 Frame = -3

Query  2334  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG---VLPPNPNNASNLIPP  2164
             M P+FPRL++  TEKGGP+ PPRNKMA++E+   PS RF +G   +LP +P+    LI  
Sbjct  1     MEPLFPRLYLKTTEKGGPKPPPRNKMAVHEEPIAPSSRFTNGSITMLPLHPSGGLPLISQ  60

Query  2163  SPS--QGNGHERRMFLPMH-LPPSTYSAEKL  2080
             + S  Q NG E++     + LP ST+ A ++
Sbjct  61    AGSSRQVNGSEKKTPSAFYSLPASTHMAPRI  91



>gb|AEZ53983.1| early flowering protein 3 mutant eam8.k [Hordeum vulgare]
Length=144

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 39/48 (81%), Gaps = 2/48 (4%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDT--EKGGPRAPPRNKMALYEQLSIPSQRFDHGVLP  2200
             +MGP+FPRLHVNDT  + GGPRAPPRNKMALYEQ S+PSQRF     P
Sbjct  17    VMGPLFPRLHVNDTTLKGGGPRAPPRNKMALYEQFSVPSQRFAANTAP  64



>gb|AEW48250.1| early flowering 3 [Hordeum vulgare]
Length=335

 Score = 79.3 bits (194),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 39/48 (81%), Gaps = 2/48 (4%)
 Frame = -3

Query  2337  IMGPMFPRLHVNDT--EKGGPRAPPRNKMALYEQLSIPSQRFDHGVLP  2200
             +MGP+FPRLHVNDT  + GGPRAPPRNKMALYEQ S+PSQRF     P
Sbjct  18    VMGPLFPRLHVNDTTLKGGGPRAPPRNKMALYEQFSVPSQRFAANTAP  65



>dbj|BAL49856.1| arabidopsis ELF3 homolog [Fagopyrum urophyllum]
Length=666

 Score = 80.5 bits (197),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 63/184 (34%), Positives = 101/184 (55%), Gaps = 27/184 (15%)
 Frame = -3

Query  1542  GQIINVGNDVESQENQTCRSPQTQKVDRGDNSSETSMVECISGMDISPDDVVGIIGQKHF  1363
             G +IN     ES  N   R    + V R ++ S T+ V  ++ + ISPDDV+  +GQ++F
Sbjct  164   GMLINTN---ESGNNSVHR----RIVHRYEDVSPTTEVNYVTSVVISPDDVILKLGQQNF  216

Query  1362  WKARRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGKPL-KVSSAKRLLP  1186
              K RR +V QQR+F++QVFELHRL  VQK +A S +  +E++  L   L +VS+ + +LP
Sbjct  217   CKIRRILVRQQRIFSIQVFELHRL--VQKSLAGSSHHSVENSLCLQNRLDEVSNKEGILP  274

Query  1185  P---FEYIKAPQ---------NVPKHKNDSEKPHLRMECSAENTVGKAS-LSSVQNATQA  1045
             P      +  PQ         ++P H   ++ P    + SA+N++ K   L  + N+ + 
Sbjct  275   PPPNLPSVLLPQHPLAPPPLSSLPTHVQPNDPP----KTSADNSLVKIPFLPILYNSVKG  330

Query  1044  PSCK  1033
             P C+
Sbjct  331   PICR  334


 Score = 76.6 bits (187),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 95/328 (29%), Positives = 133/328 (41%), Gaps = 68/328 (21%)
 Frame = -3

Query  1200  KRLLPPFEYIKAPQNVPKHKNDSEKPHLRMECSAENTVGKASLSS-----VQNATQAPSC  1036
             K LLPP     +  ++  H+  S+     +      T    SL++      Q++   P  
Sbjct  388   KHLLPPLSSNSSKLSLSGHRQSSKSTATSVGTDKSITPCSYSLTTPPLPLTQSSVSCPKT  447

Query  1035  KPSPGNPPLPVVSNDSNMGPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGP------GF--  880
                PG+      S  + +   CFH     QWL+P+M+ SEGLVYKPYPGP      GF  
Sbjct  448   ATPPGH------SLGTMLQTTCFHPLPEKQWLVPLMS-SEGLVYKPYPGPCPPNAAGFTA  500

Query  879   -MSPGCGPPPVSTPVMGNFFAPPAYGLPTSQYHYQGMGDPFAPPIGHGYFPPYGMPVMN-  706
              +   CG   +  P  G+++   AYG+P +    QG G     PI   Y  P G    N 
Sbjct  501   HLLGTCGSVNIP-PGGGSYYLNAAYGMPDAT--QQGKGMVAGIPITMPYLDPCGFSSANL  557

Query  705   SAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACK  526
                  +A++ M+S     S  Q         V   N   +P    GD             
Sbjct  558   PPRDEAAIKDMSSCLPCFSSRQ--------KVGFWNGSTVPGSIEGDR------------  597

Query  525   DNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDASQPPDTGHPA----R  358
                 Q S  SS   RA           R  LPLFP  P      A+Q  ++G  +    +
Sbjct  598   ----QGSTGSSSVERA----------SREALPLFPLEPF-----AAQELESGFDSEKLTQ  638

Query  357   VIRVVPHNARSASESAARIFQSIQKERK  274
              I+ +P +   AS+ A RIFQSIQ+ERK
Sbjct  639   AIKAMPCDGGLASKYAKRIFQSIQEERK  666


 Score = 67.8 bits (164),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 58/99 (59%), Gaps = 7/99 (7%)
 Frame = -3

Query  2334  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG---VLPPNPNNASNL---  2173
             M P+ PRLHV DTEKGG + PPRNKMA+YE+L  PS RF +G   + P  PN AS +   
Sbjct  1     MEPLLPRLHVKDTEKGGAKPPPRNKMAVYEELITPSSRFINGSTIMQPLQPNGASPIHYA  60

Query  2172  IPPSPSQGNGHERRMFLPMHLPPSTYSAEKLHAHSSDSN  2056
                S  Q    +R +     LP ST+ A +L   SS+S+
Sbjct  61    SSGSSRQVGESDRTLSAVYSLPASTHWAPRL-VRSSESD  98



>ref|XP_010546508.1| PREDICTED: uncharacterized protein LOC104818577 [Tarenaya hassleriana]
Length=118

 Score = 74.7 bits (182),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  2334  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDH  2212
             M P+FPRLH+ND  +GGPRAPPRNKMALYE+LS PS RF+H
Sbjct  1     MEPLFPRLHMNDAVRGGPRAPPRNKMALYEELSAPSPRFNH  41



>ref|XP_001766717.1| predicted protein [Physcomitrella patens]
 gb|EDQ68570.1| predicted protein [Physcomitrella patens]
Length=766

 Score = 79.3 bits (194),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 132/505 (26%), Positives = 195/505 (39%), Gaps = 110/505 (22%)
 Frame = -3

Query  1521  NDVESQ--ENQTCRSPQTQKVDRGDNSSET--SMVECISGMDISPDDVVGIIGQKHFWKA  1354
             ND  +Q  ENQ     +  ++ R D+S ET  SM+E +    I   DVV   GQ+ FWK 
Sbjct  284   NDFSNQTSENQRGEGSKPSRLRR-DSSMETGSSMLENVVMGSIEFRDVVDAFGQQEFWKV  342

Query  1353  RRAIVNQQRVFAVQVFELHRLIKVQKLIAESPNFLLEDTAYLGKPLKVSSAKRLLPPFEY  1174
             +  I+ QQ++FA+QVFELHR I+VQ+L+A++  F L        P KV +  R   P   
Sbjct  343   QMMIIRQQKLFALQVFELHRAIEVQQLLAKALCFSLHVDEV---PQKVDNILRPSSPVAE  399

Query  1173  I-KAPQ--NVPKHKNDSEKPHLRMECSAENTVGKASLSSVQNATQAPSCKPSPGNP-PLP  1006
             + + P+   +PK     E P    E S      K      +N+   P     P  P PLP
Sbjct  400   VPETPEALEIPKATEIPEVP----EVSERRFETKVCKDLNENSRSVPESVSQPLYPLPLP  455

Query  1005  VVSNDSNMGPWCFHQPSGHQWLIPVMTPSEGLVYKPYPGPGFMSPGCGPPPVSTPVMGNF  826
                  ++   W     + +     +M+P    +Y PY GP    PG G  P+    M  F
Sbjct  456   FQQGFNSGSAWPAGPYAANPCATRMMSP---YMYVPYSGP--CPPGYGAYPMMDAPMPRF  510

Query  825   FAP--------PAYGLPTSQYHYQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMN  670
               P        P +  P+    +  +    A    +G      +P  N+ V++ A     
Sbjct  511   GYPGVMQTVRFPTWSQPSMPQTWTSLNAAAAAAAWYGQHVSAAVPTANTGVASPA-RNSQ  569

Query  669   SFTRTGS--------QAQV-SGGGVNL----------------------------NVQHQ  601
                 +GS        QA V S  GVNL                            N Q++
Sbjct  570   RLISSGSGQSVENTQQAGVGSDVGVNLVNKVGPLDDRGWAKGWGSSERQRASGEGNPQNK  629

Query  600   NSCNMPSQKNGDADVSDAHR-------LHAC------KDNEIQASC-ASSPSVRAPG---  472
              S       NG+   S+ HR       +  C       +++    C   S   R P    
Sbjct  630   TSFAGLRGDNGNCQNSEDHRYGETERDVSGCGVRQRTNEDDRGVECDVDSREYREPDSEK  689

Query  471   -----VTVSGPMEGRSVLPL------------FPT-SPVVNIVDASQPPDTGHPARVIRV  346
                   + +GP++GRS+  +            FPT SP   ++             VI+V
Sbjct  690   SWPAETSHAGPLQGRSLKHMRSESLEPSASRWFPTLSPAKRVMHKY--------GGVIKV  741

Query  345   VPHNARSASESAARIFQSIQKERKQ  271
             VP    +  ES A I  SIQ ER++
Sbjct  742   VPRAVSATQESTASILLSIQTERRR  766



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 9164102283996