BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7729_g1_i2 len=1037 path=[1:0-266 268:267-1036]

Length=1037
                                                                      Score     E

dbj|BAA59332.1|  dihydroflavonol 4-reductase                            533   0.0      Ipomoea nil [qian niu]
gb|ABY25282.1|  dihydroflavonol 4-reductase A                           519   0.0      Turbina oblongata
dbj|BAA36405.1|  dihydroflavonol 4-reductase                            509   8e-178   Ipomoea purpurea
gb|ABY25280.1|  dihydroflavonol 4-reductase A                           474   5e-164   Merremia dissecta
dbj|BAD05176.1|  dihydroflavonol 4-reductase                            434   5e-150   Ipomoea batatas [batate]
gb|ABY25281.1|  dihydroflavonol 4-reductase A                           429   2e-146   Convolvulus arvensis
gb|ABY25283.1|  dihydroflavonol 4-reductase B                           414   1e-139   Turbina oblongata
dbj|BAD05164.1|  dihydroflavonol 4-reductase                            414   1e-139   Ipomoea batatas [batate]
gb|ABL74479.1|  dihydroflavonol 4-reductase                             412   4e-139   Ipomoea batatas [batate]
dbj|BAA34637.1|  dihydroflavonol 4-reductase                            412   5e-139   Ipomoea batatas [batate]
gb|ACS87954.1|  dihydroflavonol 4-reductase                             412   1e-138   Ipomoea horsfalliae [Kuhio-vine]
gb|ABY25285.1|  dihydroflavonol 4-reductase B                           410   4e-138   Merremia dissecta
gb|ACB42445.1|  dihydroflavonol 4-reductase                             409   6e-138   
dbj|BAA36406.1|  dihydroflavonol 4-reductase                            408   2e-137   Ipomoea purpurea
gb|AAB50009.1|  dihydroflavonol 4-reductase                             396   2e-133   Ipomoea purpurea
gb|ABY25284.1|  dihydroflavonol 4-reductase B                           398   2e-133   Convolvulus arvensis
gb|ABY25290.1|  dihydroflavonol 4-reductase                             395   4e-133   Evolvulus glomeratus
gb|ABY25286.1|  dihydroflavonol 4-reductase B                           396   4e-133   Petunia x hybrida [garden petunia]
gb|ABW69681.1|  dihydroflavonol 4-reductase                             396   7e-133   Ipomoea purpurea
dbj|BAA22072.1|  dihydroflavonol 4-reductase                            397   8e-133   Ipomoea nil [qian niu]
gb|AEN83503.1|  dihydroflavonol 4-reductase                             396   9e-133   
gb|ABY25287.1|  dihydroflavonol 4-reductase C                           394   1e-132   Turbina oblongata
gb|AFO59586.1|  diihydroflavonol 4-reductase                            395   2e-132   
gb|AFO59585.1|  diihydroflavonol 4-reductase                            395   2e-132   
gb|ABW69680.1|  dihydroflavonol 4-reductase                             395   2e-132   Ipomoea purpurea
gb|AFQ98276.1|  dihydroflavonol 4-reductase                             394   4e-132   
ref|NP_001274988.1|  dihydroflavonol 4-reductase                        394   4e-132   
gb|AGI96401.1|  dihydroflavonol 4-reductase                             393   9e-132   
dbj|BAA74700.1|  dihydroflavonol 4-reductase                            394   1e-131   Ipomoea purpurea
gb|AAB84048.1|  dihydroflavonol 4-reductase                             393   1e-131   Ipomoea purpurea
emb|CAA33544.1|  unnamed protein product                                392   2e-131   Petunia x hybrida [garden petunia]
gb|AFO59587.1|  diihydroflavonol 4-reductase                            392   3e-131   
gb|ADV03181.1|  dihydroflavonol reductase                               392   4e-131   
sp|P14720.2|DFRA_PETHY  RecName: Full=Dihydroflavonol-4-reductase...    392   4e-131   Petunia x hybrida [garden petunia]
gb|AEQ04697.1|  dihydroflavonol 4-reductase                             391   7e-131   
gb|AFO59579.1|  diihydroflavonol 4-reductase                            390   2e-130   
ref|XP_010315879.1|  PREDICTED: dihydroflavonol-4-reductase isofo...    390   2e-130   
gb|AAM73809.1|AF449422_1  dihydroflavonol-4-reductase                   390   2e-130   Solanum tuberosum [potatoes]
gb|AFD28990.1|  dihydroflavonol 4-reductase                             390   2e-130   
gb|AFO59581.1|  diihydroflavonol 4-reductase                            390   3e-130   
dbj|BAF64707.1|  dihydroflavonol 4-reductase                            391   3e-130   Ipomoea tricolor [campanilla]
dbj|BAA22076.1|  dihydroflavonol 4-reductase                            389   3e-130   Ipomoea nil [qian niu]
gb|AFO59580.1|  diihydroflavonol 4-reductase                            389   3e-130   
gb|AAF60298.1|AF233639_1  dihydroflavonol-4-reductase                   389   4e-130   Petunia x hybrida [garden petunia]
gb|AEX88625.1|  dihydroflavonol 4-reductase                             389   5e-130   
gb|AGI96400.1|  dihydroflavonol 4-reductase                             389   7e-130   
ref|NP_001275409.1|  dihydroflavonol-4-reductase-like                   388   1e-129   
gb|AAZ57436.1|  dihydroflavonol reductase                               388   1e-129   Solanum tuberosum [potatoes]
gb|AAX63400.1|  dihydroflavonol 4-reductase                             388   1e-129   Solanum pinnatisectum
gb|AFO59584.1|  diihydroflavonol 4-reductase                            388   1e-129   
gb|AFL48186.1|  DFR protein                                             388   1e-129   
gb|AGP50169.1|  dihydroflavonol-4-reductase                             387   3e-129   
gb|AFO59589.1|  diihydroflavonol 4-reductase                            387   4e-129   
gb|AFO59582.1|  diihydroflavonol 4-reductase                            386   5e-129   
ref|NP_001289451.1|  dihydroflavonol-4-reductase                        386   7e-129   
gb|ADV03180.1|  dihydroflavonol reductase                               386   8e-129   
dbj|BAM37961.1|  dihydroflavonol-4-reductase                            385   9e-129   
gb|AFO59583.1|  diihydroflavonol 4-reductase                            385   2e-128   
dbj|BAC10993.1|  dihydroflavonol 4-reductase                            384   2e-128   Nierembergia sp. NB17
gb|ABN80436.1|  dihydroflavonol 4-reductase                             385   2e-128   Nicotiana tabacum [American tobacco]
gb|ABN80438.1|  dihydroflavonol 4-reductase                             385   2e-128   Nicotiana benthamiana
gb|AFO59588.1|  diihydroflavonol 4-reductase                            382   1e-127   
dbj|BAA36407.1|  dihydroflavonol 4-reductase                            381   3e-127   Ipomoea purpurea
gb|ACS12834.1|  dihydroflavonol 4-reductase                             381   8e-127   Nicotiana alata [flowering tobacco]
gb|AAS46256.1|  dihydroflavonol reductase                               382   8e-127   Ipomoea quamoclit
gb|ACS12835.1|  dihydroflavonol 4-reductase                             380   9e-127   Nicotiana langsdorffii [fumo-bravo]
ref|XP_009759956.1|  PREDICTED: dihydroflavonol-4-reductase             378   7e-126   
gb|ABY25289.1|  dihydroflavonol 4-reductase C                           377   8e-126   Merremia umbellata
gb|ABN80437.1|  dihydroflavonol 4-reductase                             378   8e-126   Nicotiana tabacum [American tobacco]
ref|NP_001234408.1|  dihydroflavonol-4-reductase                        376   5e-125   
gb|AIY22763.1|  dihydroflavonol 4-reductase                             371   4e-123   
gb|ABY61976.1|  dihydroflavonol 4-reductase                             372   6e-123   Ipomoea batatas [batate]
gb|AGV53048.1|  dihydroflavonol 4-reductase                             369   7e-123   
gb|AHM27144.1|  dihydroflavonol 4-reductase                             370   5e-122   
gb|AGO64770.1|  dihydroflavonol 4-reductase                             365   5e-122   
gb|AIR09398.1|  dihydroflavonol 4-reductase                             370   8e-122   
gb|ABY25288.1|  dihydroflavonol 4-reductase C                           367   1e-121   Convolvulus arvensis
dbj|BAM42669.1|  dihydroflavonol 4-reductase                            366   2e-121   
gb|AHK23093.1|  dihydroflavonol 4-reductase                             365   2e-121   
emb|CAC88859.1|  dihydroflavonol reductase                              363   2e-120   Rhododendron simsii
gb|AAX12420.1|  dihydroflavonol 4-reductase                             363   3e-120   
dbj|BAA84939.1|  dihydroflavonol 4-reductase                            362   5e-120   Camellia sinensis [black tea]
gb|AAT84073.1|  dihydroflavonol 4-reductase                             362   6e-120   Camellia sinensis [black tea]
gb|AFC37249.1|  dihydroflavonol4-reductase                              360   3e-119   
gb|AIY51701.1|  dihydroflavonol 4-reductase                             361   4e-119   
dbj|BAA19658.1|  dihydroflavonol 4-reductase                            363   6e-119   Perilla frutescens [beefsteak-mint]
gb|ABS84871.1|  dihydroflavonol-4-reductase                             362   7e-119   Linaria sp. JA-2007
emb|CAA70345.1|  dihydroflavonol reductase                              360   7e-119   Forsythia x intermedia [cultivated forsythia]
ref|XP_011083203.1|  PREDICTED: LOW QUALITY PROTEIN: dihydroflavo...    360   1e-118   
gb|AIY51700.1|  dihydroflavonol 4-reductase                             360   1e-118   
gb|AAD56578.1|AF184271_1  dihydroflavonol 4-reductase                   358   3e-118   Daucus carota [carrots]
gb|ACK57789.1|  dihydroflavonol reductase                               356   8e-118   Centaurea maculosa
gb|AAT66505.1|  dihydroflavonol 4-reductase                             356   1e-117   Camellia sinensis [black tea]
gb|AAR01565.1|  dihydroflavonol/flavonone-4-reductase like protein      356   2e-117   Sinningia cardinalis
gb|AHJ80979.1|  dihydroflavanone reductase                              358   5e-117   
gb|ABP57077.1|  dihydroflavonol 4-reductase                             355   7e-117   Solenostemon scutellarioides
gb|AER40962.1|  dihydroflavonol 4-reductase                             351   7e-116   
gb|ABU93477.1|  dihydroflavonol 4-reductase                             352   9e-116   Helianthus annuus
sp|P51103.1|DFRA_CALCH  RecName: Full=Dihydroflavonol-4-reductase...    352   1e-115   Callistephus chinensis [Chinese aster]
gb|ABQ97018.1|  dihydroflavonol 4-reductase                             350   3e-115   Saussurea medusa
sp|P51105.1|DFRA_GERHY  RecName: Full=Dihydroflavonol-4-reductase...    351   3e-115   Gerbera hybrid cultivar
dbj|BAA12736.1|  dihydroflavonol-4-reductase                            350   3e-115   Gentiana triflora
emb|CDP01993.1|  unnamed protein product                                350   3e-115   
gb|AHF58605.1|  dihydroflavonol 4-reductase                             350   4e-115   
dbj|BAF49318.1|  dihydroflavonol 4-reductase                            348   1e-114   Lobelia erinus
dbj|BAJ08042.1|  dihydroflavonol 4-reductase                            348   1e-114   
dbj|BAF96943.1|  dihydroflavonol 4-reductase                            345   2e-114   Rhododendron x pulchrum
gb|AEN69001.1|  dihydroflavonol 4-reductase                             348   2e-114   
gb|EYU31196.1|  hypothetical protein MIMGU_mgv1a006799mg                350   3e-114   
dbj|BAB20075.1|  dihydroflavonol 4-reductase                            347   3e-114   Torenia hybrid cultivar
gb|ACA04005.1|  dihydroflavonol-4-reductase                             351   6e-114   Diplacus aurantiacus
sp|P14721.1|DFRA_ANTMA  RecName: Full=Dihydroflavonol-4-reductase...    350   6e-114   Antirrhinum majus [garden snapdragon]
gb|ACA04004.1|  dihydroflavonol-4-reductase                             350   1e-113   Diplacus aurantiacus
dbj|BAJ08043.1|  dihydroflavonol 4-reductase                            344   3e-113   
dbj|BAJ21535.1|  dihydroflavonol 4-reductase                            344   3e-113   
gb|ABK88311.2|  dihydroflavonol 4-reductase                             345   7e-113   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ACO50430.1|  dihydroflavonol 4-reductase                             344   8e-113   
dbj|BAJ17657.1|  dihydroflavonol reductase                              344   8e-113   
gb|ADC96612.1|  dihydroflavonol 4-reductase                             344   1e-112   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ABK88310.2|  dihydroflavonol 4-reductase                             344   2e-112   Chrysanthemum x morifolium [florist's chrysanthemum]
dbj|BAD34461.1|  dihydroflavonol 4-reductase                            342   5e-112   Eustoma exaltatum subsp. russellianum [bluebells]
gb|ACB56920.1|  dihydroflavonol-4-reductase                             342   8e-112   Pilosella officinarum [mouse-ear hawkweed]
gb|AAL89715.1|AF483836_1  dihydroflavonol-4-reductase                   338   2e-110   Vaccinium macrocarpon [American cranberry]
gb|AGJ70142.1|  dihydroflavonol-4-reductase                             334   2e-109   
dbj|BAH24302.1|  dihydroflavonol 4-reductase                            333   1e-108   Rosa hybrid cultivar
gb|AAL89714.1|AF483835_1  dihydroflavonol-4-reductase                   332   2e-108   Vaccinium macrocarpon [American cranberry]
dbj|BAA12723.1|  dihydroflavonol 4-reductase                            332   2e-108   Rosa hybrid cultivar
gb|AEN69002.1|  dihydroflavonol 4-reductase                             332   3e-108   
gb|AAX12422.1|  dihydroflavonol 4-reductase                             332   5e-108   
gb|AIU34714.1|  dihydroflavonol 4-reductase 1                           330   1e-107   
dbj|BAD05177.1|  dihydroflavonol 4-reductase                            327   2e-107   Ipomoea batatas [batate]
gb|AHF58604.1|  dihydroflavonol 4-reductase                             330   2e-107   
dbj|BAI78343.1|  dihydroflavonol reductase                              328   6e-107   Pelargonium zonale
dbj|BAF49325.1|  dihydroflavonol 4-reductase                            328   7e-107   Delphinium belladonna
gb|AFG28176.1|  putative dihydroflavonol 4-reductase                    328   7e-107   
gb|ABF21084.1|  dihydroflavonol 4-reductase                             326   8e-107   Pericallis cruenta
emb|CAN61338.1|  hypothetical protein VITISV_011895                     327   2e-106   Vitis vinifera
gb|AGO02174.1|  dihydroflavonol 4-reductase                             327   2e-106   
ref|NP_001268144.1|  dihydroflavonol-4-reductase                        327   2e-106   
gb|AHK10250.1|  dihydroflavonol 4-reductase                             327   3e-106   
gb|AFI71899.1|  dihydroflavonol 4-reductase                             327   3e-106   
gb|AHL46451.1|  dihydroflavonol 4-reductase                             327   4e-106   
gb|ACV72642.1|  dihydroflavonol 4-reductase                             326   4e-106   Gossypium hirsutum [American cotton]
gb|ABM64800.1|  dihydroflavonol 4-reductase                             327   4e-106   Gossypium hirsutum [American cotton]
gb|ACN82380.1|  dihydroflavonol 4-reductase                             326   6e-106   Vitis amurensis
gb|AIU98514.1|  dihydroflavonol 4-reductase                             326   8e-106   
gb|AAV71171.1|  dihydroflavonol reductase                               325   9e-106   Lotus corniculatus
ref|XP_004291858.1|  PREDICTED: bifunctional dihydroflavonol 4-re...    325   2e-105   
ref|XP_011007452.1|  PREDICTED: dihydroflavonol-4-reductase             326   2e-105   
sp|P51110.1|DFRA_VITVI  RecName: Full=Dihydroflavonol-4-reductase...    324   2e-105   Vitis vinifera
gb|AFF60412.1|  dihydroflavonol reductase                               324   4e-105   
ref|XP_009365091.1|  PREDICTED: bifunctional dihydroflavonol 4-re...    324   4e-105   
gb|AFK35141.1|  unknown                                                 323   4e-105   
ref|XP_007017586.1|  Dihydroflavonol-4-reductase                        324   4e-105   
gb|AGZ15302.1|  dihydroflavonol 4-reductase                             324   5e-105   
gb|AAO39816.1|  dihydroflavonol 4-reductase                             323   6e-105   Malus domestica [apple tree]
ref|NP_001280868.1|  bifunctional dihydroflavonol 4-reductase/fla...    323   7e-105   
gb|AAF23884.2|AF117263_1  dihydroflavanol reductase 3                   323   7e-105   Lotus corniculatus
gb|AGZ15301.1|  dihydroflavonol 4-reductase                             323   8e-105   
gb|AAO39818.1|  dihydroflavonol 4-reductase                             323   8e-105   Pyrus communis
gb|AAX16491.1|  dihydroflavonol 4-reductase                             323   9e-105   Crataegus monogyna
dbj|BAE19950.1|  dihydroflavonol 4-reductase                            323   1e-104   Lotus japonicus
gb|AHL46450.1|  dihydroflavonol 4-reductase                             323   1e-104   
sp|Q84KP0.1|DFRA_PYRCO  RecName: Full=Bifunctional dihydroflavono...    323   1e-104   Pyrus communis
gb|AHZ30596.1|  dihydroflavonol reductase                               322   1e-104   
ref|XP_011028872.1|  PREDICTED: dihydroflavonol-4-reductase-like ...    322   2e-104   
gb|AEN71545.1|  dihydroflavonol 4-reductase                             323   2e-104   
gb|AHL46445.1|  dihydroflavonol 4-reductase                             322   2e-104   
dbj|BAF49294.1|  dihydroflavanol 4-reductase                            322   3e-104   Clitoria ternatea
ref|XP_002307667.2|  dihydroflavonol reductase family protein           322   3e-104   Populus trichocarpa [western balsam poplar]
gb|ACP30362.1|  dihydroflavonol-4-reductase protein                     322   3e-104   Malus hybrid cultivar
ref|XP_007222317.1|  hypothetical protein PRUPE_ppa008069mg             321   4e-104   
ref|XP_009336072.1|  PREDICTED: bifunctional dihydroflavonol 4-re...    321   5e-104   
gb|AJA79073.1|  dihydroflavonol 4-reductase                             321   5e-104   
gb|AHL46448.1|  dihydroflavonol 4-reductase                             320   1e-103   
gb|AEO79982.1|  dihydroflavonol 4-reductase                             320   1e-103   
ref|XP_007160735.1|  hypothetical protein PHAVU_001G012800g             320   2e-103   
gb|AHL45016.1|  dihydroflavonol 4-reductase                             320   2e-103   
gb|AAP13055.1|  dihydroflavonol 4-reductase                             320   2e-103   Gypsophila elegans [annual baby's-breath]
dbj|BAE19953.1|  dihydroflavonol 4-reductase                            318   4e-103   Lotus japonicus
ref|XP_006383711.1|  hypothetical protein POPTR_0005s25110g             319   7e-103   
gb|AAN63056.1|  dihydroflavonol reductase                               318   9e-103   Populus tremuloides
ref|XP_002300759.1|  dihydroflavonol reductase family protein           318   1e-102   Populus trichocarpa [western balsam poplar]
gb|AIB06741.1|  dihydroflavonol 4-reductase                             317   1e-102   
ref|XP_010673251.1|  PREDICTED: dihydroflavonol-4-reductase             317   2e-102   
gb|AET74075.2|  dihydroflavonol 4-reductase                             317   2e-102   
gb|KHN20964.1|  Bifunctional dihydroflavonol 4-reductase/flavanon...    317   2e-102   
gb|AEX07281.1|  DFR                                                     317   3e-102   
ref|NP_001238612.1|  dihydroflavonol-4-reductase DFR1                   317   4e-102   
ref|XP_004499176.1|  PREDICTED: bifunctional dihydroflavonol 4-re...    316   5e-102   
ref|XP_002510417.1|  cinnamoyl-CoA reductase, putative                  316   6e-102   Ricinus communis
gb|ADZ54784.1|  dihydrokaempferol 4-reductase                           316   6e-102   
gb|AAX12421.1|  dihydroflavonol 4-reductase                             315   6e-102   
gb|ADP09380.1|  dihydroflavonol reductase                               313   7e-102   
gb|AAU12364.1|  dihydroflavonol 4-reductase                             315   7e-102   Fragaria x ananassa
gb|AAS89833.1|  dihydroflavonol 4-reductase                             315   8e-102   Fragaria x ananassa
gb|AEF14420.1|  dihydroflavonol 4-reductase                             315   8e-102   
gb|AHZ97873.1|  dihydroflavonol 4-reductase                             315   2e-101   
gb|AAU12363.1|  dihydroflavonol 4-reductase                             315   2e-101   Fragaria x ananassa
ref|XP_010523603.1|  PREDICTED: dihydroflavonol-4-reductase             316   2e-101   
ref|XP_006601319.1|  PREDICTED: bifunctional dihydroflavonol 4-re...    314   2e-101   
ref|XP_007160734.1|  hypothetical protein PHAVU_001G012700g             315   2e-101   
ref|XP_003550388.1|  PREDICTED: bifunctional dihydroflavonol 4-re...    315   2e-101   
gb|ACU28803.1|  dihydroflavonol reductase                               315   2e-101   Rhizophora mangle
dbj|BAO53727.1|  dihydroflavonol 4-reducatase 2                         315   2e-101   
dbj|BAO53730.1|  dihydroflavonol 4-reducatase 2                         315   3e-101   
gb|AHL46438.1|  dihydroflavonol 4-reductase                             314   3e-101   
gb|AII26023.1|  dihydroflavanol 4-reductase                             314   3e-101   
dbj|BAB92999.1|  dihydroflavonol reductase                              312   5e-101   Malus domestica [apple tree]
dbj|BAE19948.1|  dihydroflavonol 4-reductase                            313   6e-101   Lotus japonicus
gb|KDP38534.1|  hypothetical protein JCGZ_04459                         313   6e-101   
ref|XP_003638261.1|  Dihydroflavonol reductase                          313   7e-101   
gb|AAR27014.1|  dihydroflavanol-4-reductase 1                           313   8e-101   Medicago truncatula
gb|AHL46442.1|  dihydroflavonol 4-reductase                             312   8e-101   
dbj|BAF45153.1|  dihydroflavonol 4-reductase                            313   1e-100   Humulus lupulus [common hop]
ref|XP_010060970.1|  PREDICTED: dihydroflavonol-4-reductase             312   2e-100   
ref|XP_008377381.1|  PREDICTED: bifunctional dihydroflavonol 4-re...    311   3e-100   
gb|AAC25960.1|  dihydroflavonol 4-reductase                             311   3e-100   Fragaria x ananassa
gb|AHL46440.1|  dihydroflavonol 4-reductase                             311   3e-100   
dbj|BAE17125.1|  dihydroflavonol 4-reductase                            310   1e-99    Fragaria x ananassa
ref|XP_009394236.1|  PREDICTED: dihydroflavonol-4-reductase-like        310   1e-99    
ref|NP_001275860.1|  dihydroflavonol-4-reductase                        310   1e-99    
ref|XP_010906334.1|  PREDICTED: bifunctional dihydroflavonol 4-re...    309   1e-99    
gb|AFU90827.1|  dihydroflavonol 4-reductase                             310   1e-99    
ref|XP_010263613.1|  PREDICTED: LOW QUALITY PROTEIN: bifunctional...    309   2e-99    
emb|CBI19727.3|  unnamed protein product                                326   2e-99    
gb|AAR27015.1|  dihydroflavonal-4-reductase 2                           309   2e-99    Medicago truncatula
ref|XP_006473894.1|  PREDICTED: dihydroflavonol-4-reductase             309   2e-99    
gb|AHZ31751.1|  dihydroflavonol 4-reductase                             308   6e-99    
dbj|BAD67185.1|  dihydroflavonol 4-reductase                            308   6e-99    Spinacia oleracea
gb|AEI59122.1|  dihydroflavonol 4-reductase                             308   7e-99    
ref|XP_006281803.1|  hypothetical protein CARUB_v10027976mg             307   1e-98    
gb|ACJ84553.1|  unknown                                                 307   1e-98    Medicago truncatula
gb|KDO84613.1|  hypothetical protein CISIN_1g040253mg                   307   1e-98    
ref|XP_010926084.1|  PREDICTED: dihydroflavonol-4-reductase-like        307   2e-98    
ref|XP_010442115.1|  PREDICTED: dihydroflavonol-4-reductase             308   2e-98    
gb|AIM48930.1|  dihydroflavonol 4-reductase                             308   2e-98    
gb|ABY89686.1|  dihydroflavonol-4-reductase 2 protein                   306   3e-98    
gb|ABG76202.1|  dihydroflavonol reductase                               308   3e-98    Brassica napus [oilseed rape]
emb|CAP08818.1|  dihydroflavonol reductase                              307   4e-98    Arabidopsis thaliana [mouse-ear cress]
emb|CAP08805.1|  dihydroflavonol reductase                              307   4e-98    Arabidopsis thaliana [mouse-ear cress]
gb|AFK35813.1|  unknown                                                 306   4e-98    
ref|XP_009114035.1|  PREDICTED: dihydroflavonol-4-reductase             307   4e-98    
gb|AGU42192.1|  dihydroflavonol 4-reductase                             307   4e-98    
ref|XP_008797532.1|  PREDICTED: dihydroflavonol-4-reductase             306   4e-98    
gb|AAV80210.1|  dihydroflavonol-4-reductase                             307   5e-98    Brassica rapa subsp. pekinensis [bai cai]
gb|ADB45307.1|  dihydroflavonol 4-reductase                             307   5e-98    Brassica juncea var. napiformis [jie cai ge da]
gb|ACZ48697.1|  dihydroflavonol-4-reductase                             305   6e-98    Fagopyrum tataricum [Kangra buckwheat]
ref|XP_002862988.1|  dihydroflavonol reductase                          307   6e-98    
gb|AAX53571.1|  dihydroflavonol 4-reductase                             306   7e-98    Brassica rapa
emb|CAP08822.1|  dihydroflavonol reductase                              306   8e-98    Arabidopsis thaliana [mouse-ear cress]
dbj|BAD95233.1|  dihydroflavonol 4-reductase                            306   9e-98    Arabidopsis thaliana [mouse-ear cress]
ref|NP_199094.1|  dihydroflavonol-4-reductase                           306   1e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010494237.1|  PREDICTED: dihydroflavonol-4-reductase-like        306   1e-97    
gb|AAA32783.1|  dihydroflavonol 4-reductase                             306   1e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009396003.1|  PREDICTED: dihydroflavonol-4-reductase-like        305   1e-97    
emb|CAP08819.1|  dihydroflavonol reductase                              306   2e-97    Arabidopsis thaliana [mouse-ear cress]
gb|AIC33029.1|  dihydroflavonol 4-reductase                             305   2e-97    
emb|CAP08813.1|  dihydroflavonol reductase                              306   2e-97    Arabidopsis thaliana [mouse-ear cress]
gb|ADY02644.1|  dihydroflavonol 4-reductase                             305   2e-97    
emb|CDX95155.1|  BnaC09g17150D                                          305   2e-97    
gb|AIC33028.1|  dihydroflavonol 4-reductase                             305   3e-97    
emb|CAP08825.1|  dihydroflavonol reductase                              305   3e-97    Arabidopsis lyrata [lyrate rockcress]
gb|AHI49023.1|  dihydroflavonol 4-reductase                             302   3e-97    
gb|KFK31813.1|  hypothetical protein AALP_AA6G162000                    305   4e-97    
ref|XP_010110052.1|  Bifunctional dihydroflavonol 4-reductase/fla...    303   4e-97    
gb|ACZ48698.1|  dihydroflavonol-4-reductase                             303   6e-97    Fagopyrum esculentum
gb|AGI16384.1|  dihydroflavonol 4-reductase                             304   6e-97    
ref|XP_010481941.1|  PREDICTED: dihydroflavonol-4-reductase-like        304   6e-97    
dbj|BAD67186.1|  dihydroflavonol 4-reductase                            303   8e-97    Phytolacca americana [common pokeberry]
gb|AAO73442.1|  dihydroflavonol 4-reductase                             304   1e-96    Brassica oleracea
dbj|BAH36918.1|  dihydroflavonol-4-reductase                            303   1e-96    Aegilops tauschii
gb|ADY02643.1|  dihydroflavonol 4-reductase                             303   2e-96    
dbj|BAH36916.1|  dihydroflavonol-4-reductase                            302   2e-96    Aegilops tauschii x Triticum turgidum [synthetic wheat]
gb|ADY02645.1|  dihydroflavonol 4-reductase                             303   2e-96    
gb|AIS35914.1|  dihydroflavonol 4-reductase                             302   3e-96    
emb|CDM83481.1|  unnamed protein product                                301   4e-96    
gb|AAV83987.1|  dihydroflavonol 4-reductase 5                           301   4e-96    Triticum aestivum [Canadian hard winter wheat]
ref|XP_009398122.1|  PREDICTED: dihydroflavonol-4-reductase-like        301   4e-96    
dbj|BAH36913.1|  dihydroflavonol-4-reductase                            301   4e-96    
gb|AAO53552.1|  dihydroflavonol 4-reductase                             301   4e-96    
dbj|BAH36906.1|  dihydroflavonol-4-reductase                            301   4e-96    
gb|AHY35315.1|  dihydroflavonol reductase                               300   5e-96    
gb|ADY02647.1|  dihydroflavonol 4-reductase                             301   5e-96    
gb|AAV83983.1|  dihydroflavonol 4-reductase 1                           301   6e-96    
dbj|BAD11018.1|  dihydroflavonol-4-reductase                            300   8e-96    
dbj|BAD11019.1|  dihydroflavonol-4-reductase                            300   1e-95    
dbj|BAH36911.1|  dihydroflavonol-4-reductase                            300   1e-95    
sp|P51104.1|DFRA_DIACA  RecName: Full=Dihydroflavonol-4-reductase...    300   1e-95    
gb|AFS60083.1|  dihydroflavonol 4-reductase                             300   2e-95    
dbj|BAH36914.1|  dihydroflavonol-4-reductase                            299   2e-95    
dbj|BAH36905.1|  dihydroflavonol-4-reductase                            299   3e-95    
gb|AAG01030.1|  dihydroflavonol 4-reductase                             299   3e-95    
gb|EMS68193.1|  Dihydroflavonol-4-reductase                             299   4e-95    
ref|NP_001140905.1|  anthocyaninless4                                   299   5e-95    
dbj|BAH36912.1|  dihydroflavonol-4-reductase                            298   5e-95    
gb|ABP57067.1|  dihydroflavonol 4-reductase                             298   7e-95    
gb|AAO60212.1|  dihydroflavonol 4-reductase                             298   8e-95    
gb|AAQ77347.1|  dihydroflavonol 4-reductase                             299   8e-95    
ref|XP_002456015.1|  hypothetical protein SORBIDRAFT_03g028880          298   8e-95    
gb|ADK62520.1|  dihydroflavonol 4-reductase                             298   8e-95    
gb|AAF81742.1|AF267172_1  dihydroflavonol 4-reductase                   294   9e-95    
ref|XP_002863734.1|  dihydroflavonol reductase                          299   9e-95    
gb|AAB62873.1|  dihydroflavonol 4-reductase                             297   1e-94    
gb|AAF78071.1|  dihydroflavonol-4-reductase                             294   1e-94    
ref|XP_006403345.1|  hypothetical protein EUTSA_v10003227mg             298   1e-94    
dbj|BAH36909.1|  dihydroflavonol-4-reductase                            297   2e-94    
gb|AAV83985.1|  dihydroflavonol 4-reductase 3                           296   3e-94    
gb|KHG12457.1|  Dihydroflavonol-4-reductase                             294   3e-94    
gb|AHA36975.1|  dihydroflavonol 4-reductase                             297   3e-94    
gb|ADY02646.1|  dihydroflavonol 4-reductase                             296   5e-94    
gb|AAO60214.1|  dihydroflavonol 4-reductase                             296   6e-94    
gb|AAO50084.1|  dihydroflavonol 4-reductase                             295   8e-94    
gb|ACM62744.1|  dihydroflavonol-4-reductase                             294   9e-94    
ref|XP_006878526.1|  hypothetical protein AMTR_s00011p00221520          295   1e-93    
dbj|BAH36921.1|  dihydroflavonol-4-reductase                            295   1e-93    
dbj|BAH36922.1|  dihydroflavonol-4-reductase                            295   1e-93    
gb|AHH28214.1|  dihydroflavonol 4-reducatse                             295   1e-93    
dbj|BAH36901.1|  dihydroflavonol-4-reductase                            295   1e-93    
dbj|BAH36919.1|  dihydroflavonol-4-reductase                            295   1e-93    
ref|NP_001239696.1|  uncharacterized protein LOC100778253               294   1e-93    
dbj|BAH36903.1|  dihydroflavonol-4-reductase                            295   1e-93    
dbj|BAH36910.1|  dihydroflavonol-4-reductase                            294   2e-93    
gb|AAS57870.1|  DFR-2                                                   294   3e-93    
gb|AFP58815.1|  dihydroflavonol-4-reductase                             294   3e-93    
emb|CAA75996.1|  dihydroflavonol4-reductase                             293   4e-93    
gb|AAY32602.1|  dihydroflavonol 4-reductase                             293   4e-93    
dbj|BAF93856.1|  dihydroflavonol 4-reductase                            293   4e-93    
dbj|BAF93896.1|  dihydroflavonol 4-reductase                            293   5e-93    
emb|CAA75998.1|  dihydroflavonol4-reductase                             293   6e-93    
gb|AAW66345.1|  NADPH-dependent reductase                               293   6e-93    
sp|P51106.1|DFRA_HORVU  RecName: Full=Dihydroflavonol-4-reductase...    293   6e-93    
gb|AAY32601.1|  dihydroflavonol 4-reductase                             292   7e-93    
ref|XP_003569417.2|  PREDICTED: dihydroflavonol-4-reductase-like ...    293   8e-93    
dbj|BAH36899.1|  dihydroflavonol-4-reductase                            293   8e-93    
ref|XP_006403346.1|  hypothetical protein EUTSA_v10003227mg             293   9e-93    
ref|XP_004969260.1|  PREDICTED: dihydroflavonol-4-reductase-like        293   1e-92    
ref|NP_001152467.1|  dihydroflavonol-4-reductase                        292   1e-92    
sp|P51108.1|DFRA_MAIZE  RecName: Full=Dihydroflavonol-4-reductase...    292   1e-92    
gb|AAY32600.1|  dihydroflavonol 4-reductase                             292   1e-92    
ref|XP_007145529.1|  hypothetical protein PHAVU_007G246200g             291   2e-92    
gb|ABB29303.1|  NADPH-dependent reductase                               292   2e-92    
emb|CAA75997.1|  dihydroflavonol4-reductase                             292   2e-92    
dbj|BAD11017.1|  dihydroflavonol-4-reductase                            291   2e-92    
gb|AGT17256.1|  dihydroflavonol4-reductase                              293   2e-92    
ref|XP_010232065.1|  PREDICTED: dihydroflavonol-4-reductase-like ...    293   3e-92    
dbj|BAL15045.1|  dihydroflavonol-4-reductase                            291   4e-92    
dbj|BAH36900.1|  dihydroflavonol-4-reductase                            290   7e-92    
gb|AFU90826.1|  dihydroflavonol 4-reductase                             290   8e-92    
dbj|BAH36920.1|  dihydroflavonol-4-reductase                            290   8e-92    
gb|AAQ83576.1|  dihydroflavonol 4-reductase                             291   9e-92    
dbj|BAM28974.1|  dihydroflavonol 4-reductase                            290   9e-92    
dbj|BAE79202.1|  dihydroflavonol 4-reductase                            291   9e-92    
prf||1804328A  dihydroflavonol reductase                                290   1e-91 
ref|XP_002440593.1|  hypothetical protein SORBIDRAFT_09g003710          290   1e-91    
dbj|BAN62761.1|  dihydroflavonol 4-reductase                            290   1e-91    
gb|ABB29305.1|  NADPH-dependent reductase                               289   2e-91    
gb|AAV83986.1|  dihydroflavonol 4-reductase 4                           289   2e-91    
gb|AIZ74402.1|  dihydroflavonol 4-reductase                             288   3e-91    
gb|KDP38532.1|  hypothetical protein JCGZ_04457                         288   3e-91    
gb|ABC94578.1|  dihydroflavonol 4-reductase                             288   3e-91    
dbj|BAH36904.1|  dihydroflavonol-4-reductase                            289   3e-91    
gb|AEF58500.1|  dihydroflavonol-4-reductase                             288   4e-91    
gb|AAP20866.1|  putative dihydroflavonol 4-reductase                    288   5e-91    
gb|AEB96144.1|  dihydroflavinol reductase                               288   5e-91    
gb|AAU93766.1|  putative dihyroflavonol 4-reductase                     288   6e-91    
emb|CAR64530.1|  dihydroflavonol-4-reductase                            288   6e-91    
gb|AAO63026.1|  dihydroflavonol 4-reductase                             289   6e-91    
dbj|BAH36915.1|  dihydroflavonol-4-reductase                            288   8e-91    
gb|AAD49343.1|AF169801_1  dihydroflavonol-4-reductase                   288   1e-90    
ref|XP_010245914.1|  PREDICTED: bifunctional dihydroflavonol 4-re...    286   1e-90    
gb|ABA86595.1|  putative dihydroflavonol 4-reductase                    284   2e-90    
gb|ABE01414.1|  dihydroflavonol 4-reductase                             286   2e-90    
gb|AHW45701.1|  mutant dihydroflavonol 4-reductase                      287   2e-90    
ref|XP_010245913.1|  PREDICTED: dihydroflavonol-4-reductase-like ...    285   2e-90    
gb|AGJ50590.1|  DFR1                                                    288   3e-90    
gb|AHW45697.1|  dihydroflavonol 4-reductase                             287   3e-90    
gb|AHW45698.1|  dihydroflavonol 4-reductase                             287   3e-90    
emb|CAR64529.1|  dihydroflavonol-4-reductase                            286   4e-90    
gb|AHW45706.1|  mutant dihydroflavonol 4-reductase                      287   4e-90    
gb|AHW45699.1|  dihydroflavonol 4-reductase                             286   5e-90    
gb|AGY46123.1|  dihydroflavonol 4-reductase                             285   6e-90    
dbj|BAB40789.1|  dihydroflavonol 4-reductase                            286   6e-90    
dbj|BAH98155.1|  dihydroflavonol 4-reductase                            287   7e-90    
dbj|BAM28975.1|  dihydroflavonol 4-reductase                            285   8e-90    
gb|AAC17843.1|  dihydroflavonol-4-reductase                             285   1e-89    
ref|XP_010245912.1|  PREDICTED: dihydroflavonol-4-reductase-like ...    283   2e-89    
ref|XP_010649291.1|  PREDICTED: LOW QUALITY PROTEIN: dihydroflavo...    280   4e-89    
dbj|BAE78769.1|  dihydroflavonol 4-reductase                            283   7e-89    
gb|AGA82783.1|  dihydroflavonol reductase 2                             281   8e-89    
tpg|DAA58432.1|  TPA: anthocyaninless1                                  283   8e-89    
gb|AHW45705.1|  mutant dihydroflavonol 4-reductase                      282   2e-88    
ref|XP_002451586.1|  hypothetical protein SORBIDRAFT_04g004290          281   3e-88    
ref|XP_002456016.1|  hypothetical protein SORBIDRAFT_03g028890          282   4e-88    
dbj|BAH36902.1|  dihydroflavonol-4-reductase                            280   7e-88    
gb|AFO65508.1|  dihydroflavonol 4-reductase                             278   2e-87    
gb|AAB94015.1|  NADPH-dependent reductase A1-b                          280   2e-87    
gb|AHB19302.1|  dihydroflavonol-4-reductase                             278   2e-87    
gb|AFO65510.1|  dihydroflavonol 4-reductase                             278   2e-87    
dbj|BAI66081.1|  dihydroflavonol 4-reductase                            273   3e-87    
gb|AFO65509.1|  dihydroflavonol 4-reductase                             276   7e-87    
gb|AAY45747.1|  dihydroflavonol-4-reductase                             273   1e-86    
emb|CAB94914.1|  dihydroflavonol 4-reductase                            272   2e-86    
emb|CAF34418.1|  dihydroflavonol 4-reductase                            272   3e-86    
ref|XP_008220831.1|  PREDICTED: LOW QUALITY PROTEIN: bifunctional...    276   3e-86    
gb|AHI49022.1|  dihydroflavonol 4-reductase                             273   3e-86    
gb|AAL35830.1|AF434703_1  dihydroflavonol-4-reductase                   274   2e-85    
gb|EAZ12808.1|  hypothetical protein OsJ_02728                          271   1e-84    
dbj|BAD68895.1|  putative dihydrokaempferol 4-reductase                 271   1e-84    
emb|CAA69253.1|  Dihydroflavonol reductase                              272   2e-84    
gb|AAF21888.1|AF101045_3  putative NADPH-dependent reductase A1         271   2e-84    
ref|XP_010247640.1|  PREDICTED: bifunctional dihydroflavonol 4-re...    270   3e-84    
gb|ACN40030.1|  unknown                                                 270   5e-84    
gb|ABR17584.1|  unknown                                                 270   5e-84    
gb|ABK22120.1|  unknown                                                 270   5e-84    
gb|ABK24604.1|  unknown                                                 270   3e-83    
ref|XP_004499177.1|  PREDICTED: bifunctional dihydroflavonol 4-re...    267   3e-83    
gb|AGR34043.1|  dihydroflavonol-4-reductase                             267   6e-83    
gb|AAD10522.2|  NADPH-dependent reductase                               263   6e-82    
ref|XP_007017587.1|  Dihydroflavonol-4-reductase                        260   3e-81    
gb|AAV83984.1|  dihydroflavonol 4-reductase 2                           259   2e-80    
ref|XP_011028873.1|  PREDICTED: bifunctional dihydroflavonol 4-re...    252   4e-78    
ref|XP_004499178.1|  PREDICTED: bifunctional dihydroflavonol 4-re...    251   1e-77    
ref|XP_004499179.1|  PREDICTED: bifunctional dihydroflavonol 4-re...    249   5e-77    
gb|AHW45702.1|  mutant dihydroflavonol 4-reductase                      246   8e-76    
dbj|BAE19952.1|  dihydroflavonol 4-reductase                            246   1e-75    
dbj|BAE19951.1|  dihydroflavonol 4-reductase                            246   2e-75    
gb|ADN03368.1|  dihydroflavonol 4-reductase                             245   3e-75    
ref|XP_010097631.1|  Bifunctional dihydroflavonol 4-reductase/fla...    243   5e-75    
gb|ACR38744.1|  unknown                                                 241   3e-74    
gb|ACU19265.1|  unknown                                                 240   2e-73    
gb|KDP38533.1|  hypothetical protein JCGZ_04458                         236   1e-71    
gb|AGA82779.1|  dihydroflavonol reductase 2                             232   5e-71    
gb|AGM48563.1|  dihydroflavonol 4-reductase 1                           230   1e-70    
gb|AGM48591.1|  dihydroflavonol 4-reductase 1                           230   1e-70    
gb|AHJ80870.1|  dihydroflavonol 4-reductase 1                           230   2e-70    
gb|AGM48590.1|  dihydroflavonol 4-reductase 1                           229   3e-70    
gb|AGA82770.1|  dihydroflavonol reductase 2                             230   3e-70    
gb|AGM48562.1|  dihydroflavonol 4-reductase 1                           229   3e-70    
gb|AGM48601.1|  dihydroflavonol 4-reductase 1                           229   4e-70    
gb|AHJ80868.1|  dihydroflavonol 4-reductase 1                           228   6e-70    
gb|AHJ80866.1|  dihydroflavonol 4-reductase 1                           228   6e-70    
gb|AGM48602.1|  dihydroflavonol 4-reductase 1                           228   6e-70    
gb|AHJ80883.1|  dihydroflavonol 4-reductase 1                           228   1e-69    
gb|AGA82775.1|  dihydroflavonol reductase 2                             229   1e-69    
gb|AHJ80854.1|  dihydroflavonol 4-reductase 1                           227   2e-69    
gb|AHJ80862.1|  dihydroflavonol 4-reductase 1                           226   4e-69    
gb|ADO16088.1|  DFRB                                                    224   1e-68    
gb|ADO16086.1|  DFRB                                                    224   1e-68    
gb|ADO16079.1|  DFRB                                                    223   2e-68    
gb|ADO16091.1|  DFRB                                                    223   3e-68    
gb|ADO16093.1|  DFRB                                                    223   3e-68    
gb|ADO16081.1|  DFRB                                                    223   3e-68    
gb|ADO16075.1|  DFRB                                                    223   3e-68    
dbj|BAF96595.1|  dihydroflavonol 4-reductase                            224   4e-68    
gb|ADO16083.1|  DFRB                                                    222   6e-68    
gb|ACN60404.1|  dihydroflavonol-4-reductase                             225   9e-68    
gb|ADO16078.1|  DFRB                                                    221   1e-67    
gb|ADO16084.1|  DFRB                                                    221   1e-67    
gb|ADO16076.1|  DFRB                                                    221   2e-67    
gb|ADO16082.1|  DFRB                                                    221   2e-67    
gb|ADO16080.1|  DFRB                                                    221   2e-67    
gb|ADO16089.1|  DFRB                                                    220   2e-67    
gb|ADO16092.1|  DFRB                                                    220   4e-67    
gb|ADO16074.1|  DFRB                                                    218   2e-66    
gb|ADO16087.1|  DFRB                                                    217   4e-66    
gb|ADX68822.1|  dihydroflavonol 4-reductase                             217   1e-65    
ref|XP_007046878.1|  Dihydroflavonol-4-reductase, putative              220   2e-65    
gb|EPS71346.1|  dihydroflavonol-4-reductase                             215   4e-65    
gb|ADO16090.1|  DFRB                                                    213   2e-64    
gb|AGA82786.1|  dihydroflavonol reductase 1                             216   3e-64    
gb|ADX68821.1|  dihydroflavonol 4-reductase                             213   4e-64    
gb|AHW45704.1|  mutant dihydroflavonol 4-reductase                      216   5e-64    
gb|ADX68820.1|  dihydroflavonol 4-reductase                             212   1e-63    
gb|ADX68818.1|  dihydroflavonol 4-reductase                             212   1e-63    
gb|AGA82802.1|  dihydroflavonol reductase 1                             213   2e-63    
gb|ABK24620.1|  unknown                                                 213   3e-62    
ref|XP_010664947.1|  PREDICTED: dihydroflavonol-4-reductase-like        212   1e-61    
gb|ABK26123.1|  unknown                                                 209   7e-61    
emb|CBI19728.3|  unnamed protein product                                212   1e-60    
gb|ADO16077.1|  DFRB                                                    202   1e-60    
gb|ABR18365.1|  unknown                                                 208   3e-60    
dbj|BAF03077.1|  dihydroflavonol 4-reductase                            203   5e-60    
ref|NP_001280930.1|  anthocyanidin reductase                            204   1e-58    
gb|AEL79860.1|  anthocyanidin reductase                                 203   2e-58    
gb|AEF14421.1|  anthocyanidin reductase                                 203   2e-58    
dbj|BAC98343.1|  dihydroflavonol reductase                              199   3e-58    
gb|AFZ93012.1|  anthocyanidin reductase                                 203   3e-58    
ref|XP_009368377.1|  PREDICTED: anthocyanidin reductase-like            203   3e-58    
sp|P51109.1|DFRA_MEDSA  RecName: Full=Dihydroflavonol-4-reductase...    198   5e-58    
gb|AAY40272.1|  NADPH-dependent reductase                               197   7e-58    
gb|AAZ79363.1|  anthocyanidin reductase                                 202   7e-58    
gb|AAZ17408.1|  anthocyanidin reductase                                 202   7e-58    
gb|AAX12184.1|  putative anthocyanidin reductase                        202   8e-58    
gb|AFZ93006.1|  anthocyanidin reductase                                 202   8e-58    
gb|ABB77695.1|  anthocyanidin reductase                                 201   1e-57    
ref|XP_009368282.1|  PREDICTED: anthocyanidin reductase-like            200   3e-57    
ref|XP_007213813.1|  hypothetical protein PRUPE_ppa008295mg             200   4e-57    
gb|AGL81352.1|  anthocyanidin reductase                                 199   5e-57    
ref|XP_010052463.1|  PREDICTED: anthocyanidin reductase-like            199   7e-57    



>dbj|BAA59332.1| dihydroflavonol 4-reductase [Ipomoea nil]
Length=354

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/278 (99%), Positives = 275/278 (99%), Gaps = 3/278 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV
Sbjct  80   EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  139

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLAEKEAWKAAKEKQIEFISIIPPL
Sbjct  140  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLAEKEAWKAAKEKQIEFISIIPPL  199

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            VIGPFLIPTFPLSLVTALSPIM   GNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG
Sbjct  200  VIGPFLIPTFPLSLVTALSPIM---GNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  256

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE
Sbjct  257  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  316

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQHSGKEPKS  835
            DMYKGAIETLRKKGLLPYSTKEPADIEQEQHSGKEPKS
Sbjct  317  DMYKGAIETLRKKGLLPYSTKEPADIEQEQHSGKEPKS  354



>gb|ABY25282.1| dihydroflavonol 4-reductase A [Turbina oblongata]
Length=341

 Score =   519 bits (1336),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/278 (94%), Positives = 270/278 (97%), Gaps = 0/278 (0%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            +AIAGCEGVFHVAA VNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV
Sbjct  64   DAIAGCEGVFHVAAVVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  123

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            HIKETQ+L YDESSWSDLDFIYA KMGGWMYFASKTLAEKEAWKAAKEKQIEFISIIPPL
Sbjct  124  HIKETQELAYDESSWSDLDFIYAKKMGGWMYFASKTLAEKEAWKAAKEKQIEFISIIPPL  183

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLY+HPKA G
Sbjct  184  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYEHPKAQG  243

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFICSSHH TIHDVAKMIR NWPEYYVPSEFKGIEK+LP+VSFSSKKL+EMGF FKYTLE
Sbjct  244  RFICSSHHTTIHDVAKMIRQNWPEYYVPSEFKGIEKDLPVVSFSSKKLEEMGFHFKYTLE  303

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQHSGKEPKS  835
            DMY+GAIETLRKKGLLPYSTK+PA IEQEQHSGKEPKS
Sbjct  304  DMYRGAIETLRKKGLLPYSTKQPAAIEQEQHSGKEPKS  341



>dbj|BAA36405.1| dihydroflavonol 4-reductase [Ipomoea purpurea]
Length=348

 Score =   509 bits (1311),  Expect = 8e-178, Method: Compositional matrix adjust.
 Identities = 264/272 (97%), Positives = 265/272 (97%), Gaps = 3/272 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV
Sbjct  80   EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  139

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            HIKETQQL YDESSWSDLDFIYANKMGGWMYFASKTLAEKEAWKAAKEKQIEFISIIPPL
Sbjct  140  HIKETQQLVYDESSWSDLDFIYANKMGGWMYFASKTLAEKEAWKAAKEKQIEFISIIPPL  199

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            VIGPFLIPTFPLSLVTALSPIM   GNGLHHNIIKQGKFVHLDDLCEAQIFLYQHP+AGG
Sbjct  200  VIGPFLIPTFPLSLVTALSPIM---GNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPEAGG  256

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE
Sbjct  257  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  316

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQHS  817
            DMYKGAIETLRKKGLLPYSTKEPA IEQE  S
Sbjct  317  DMYKGAIETLRKKGLLPYSTKEPAGIEQEPKS  348



>gb|ABY25280.1| dihydroflavonol 4-reductase A [Merremia dissecta]
Length=356

 Score =   474 bits (1221),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 239/271 (88%), Positives = 252/271 (93%), Gaps = 0/271 (0%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAIAGCEGVFHVA  VNFASKDPENEVIKPAVKGILSIINSCAKAKTVK+LVFTSS AAV
Sbjct  64   EAIAGCEGVFHVATPVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKRLVFTSSAAAV  123

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             I+E Q+L YDESSWSDLDFIYA KM GWMY ASKTLAEKEAWKAAKEKQI+FISIIPPL
Sbjct  124  QIEENQKLVYDESSWSDLDFIYAKKMAGWMYLASKTLAEKEAWKAAKEKQIDFISIIPPL  183

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            VIGPF+ PTFPLSLVTALSPIMDP+GNGLHHNIIKQG FVH+DDLCEAQIFLY++PKA G
Sbjct  184  VIGPFITPTFPLSLVTALSPIMDPIGNGLHHNIIKQGNFVHVDDLCEAQIFLYENPKAQG  243

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFICSSH  TIHDVAKMIR NWPEYYVPSEFKGIEKELP+VS SSKKLQEMGFQFKYTL 
Sbjct  244  RFICSSHDNTIHDVAKMIRENWPEYYVPSEFKGIEKELPVVSLSSKKLQEMGFQFKYTLV  303

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQH  814
            DMY+GAIETLR+KGLLP+STKEPA IEQEQ 
Sbjct  304  DMYRGAIETLREKGLLPFSTKEPAAIEQEQQ  334



>dbj|BAD05176.1| dihydroflavonol 4-reductase [Ipomoea batatas]
Length=230

 Score =   434 bits (1116),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 220/230 (96%), Positives = 226/230 (98%), Gaps = 0/230 (0%)
 Frame = +2

Query  146  KKLVFTSSTAAVHIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaake  325
            K+LVFTSSTAAVHIK+TQQL YDESSWSDLDFIYANKMGGWM+FASKTLAEKEAWKAAKE
Sbjct  1    KRLVFTSSTAAVHIKQTQQLVYDESSWSDLDFIYANKMGGWMHFASKTLAEKEAWKAAKE  60

Query  326  kQIEFISIIPPLVIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEA  505
            K+IEFISIIPPLVIGPFLIPTFPLSLVTALSPIMDPVGNG HHNIIKQGKFVHLDDLCEA
Sbjct  61   KEIEFISIIPPLVIGPFLIPTFPLSLVTALSPIMDPVGNGFHHNIIKQGKFVHLDDLCEA  120

Query  506  QIFLYQHPKAGGRFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKL  685
            QIFLYQHPKA GRFICSSHHATIHDVA MIRHNWPEYYVPSEFKGIEKELPIVSFSSKKL
Sbjct  121  QIFLYQHPKAQGRFICSSHHATIHDVANMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKL  180

Query  686  QEMGFQFKYTLEDMYKGAIETLRKKGLLPYSTKEPADIEQEQHSGKEPKS  835
            QEMGF+FKYTLEDMY+GAIETLRKKGLLPYSTKEPADIEQEQHSGKEPKS
Sbjct  181  QEMGFEFKYTLEDMYRGAIETLRKKGLLPYSTKEPADIEQEQHSGKEPKS  230



>gb|ABY25281.1| dihydroflavonol 4-reductase A [Convolvulus arvensis]
Length=344

 Score =   429 bits (1104),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 217/270 (80%), Positives = 240/270 (89%), Gaps = 2/270 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAIAGCEGVFHVA  V+ ASKDPENEVIKPAV GILSIINSCAKAKTVK+LVFTSSTA +
Sbjct  75   EAIAGCEGVFHVATPVDLASKDPENEVIKPAVDGILSIINSCAKAKTVKRLVFTSSTATI  134

Query  182  HIKETQQLEYDESSWSDLDFIYANK--MGGWMYFASKTLaekeawkaakekQIEFISIIP  355
              +E ++L YDES WSDLDFIYANK  M GW YFASKTLAEKEAWKAAKEKQI+FIS+IP
Sbjct  135  DFQENKKLVYDESCWSDLDFIYANKIIMPGWAYFASKTLAEKEAWKAAKEKQIDFISVIP  194

Query  356  PLVIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKA  535
            P+++GPFLIPTFP SL TALSPI+DP G G HHNIIKQG FVHLDDLC+A IFLY+HPKA
Sbjct  195  PVIVGPFLIPTFPPSLFTALSPILDPEGKGFHHNIIKQGHFVHLDDLCQAHIFLYEHPKA  254

Query  536  GGRFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYT  715
             GR++CSSH  TI D+AKMIR NWPEYYVPSEFKGIEKEL +V FSSKKLQ+MGF+FKYT
Sbjct  255  EGRYLCSSHDTTIQDLAKMIRQNWPEYYVPSEFKGIEKELSVVPFSSKKLQDMGFEFKYT  314

Query  716  LEDMYKGAIETLRKKGLLPYSTKEPADIEQ  805
            LEDMY+GAIETLRKKGLLPYS K+P DIE+
Sbjct  315  LEDMYRGAIETLRKKGLLPYSIKDPCDIEE  344



>gb|ABY25283.1| dihydroflavonol 4-reductase B [Turbina oblongata]
Length=399

 Score =   414 bits (1064),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 208/272 (76%), Positives = 237/272 (87%), Gaps = 3/272 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAIAGCEGVFHVA  ++F SKDPENEVIKPA+ G+L+IINSCAKAKTVK+LVFTSS   +
Sbjct  85   EAIAGCEGVFHVATPMDFESKDPENEVIKPAINGVLNIINSCAKAKTVKRLVFTSSAGTL  144

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++  Q+  YDES WSDLDFIYA KM GWMYFASK LAEKEAWKA KEKQI+FISIIPPL
Sbjct  145  NVQPQQKPLYDESCWSDLDFIYAKKMTGWMYFASKILAEKEAWKATKEKQIDFISIIPPL  204

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP SL+TALS I    GN  H++IIKQG++VHLDDLCEA IFLY+HPKA G
Sbjct  205  VVGPFITPTFPPSLITALSLI---TGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKAEG  261

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFICSSHH TIH +A MIR NWPEYYVPSEF GIEK+LP+V FSSKKLQ+MGFQFKY+LE
Sbjct  262  RFICSSHHTTIHGLADMIRENWPEYYVPSEFXGIEKDLPVVIFSSKKLQDMGFQFKYSLE  321

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQHS  817
            DMY+GAIETLRKKGLLPYSTKEPA IE++Q +
Sbjct  322  DMYRGAIETLRKKGLLPYSTKEPAAIEEKQET  353



>dbj|BAD05164.1| dihydroflavonol 4-reductase [Ipomoea batatas]
 dbj|BAD05178.1| dihydroflavonol 4-reductase [Ipomoea batatas]
Length=394

 Score =   414 bits (1063),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 206/273 (75%), Positives = 238/273 (87%), Gaps = 3/273 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAIAGCEGVFHVA  ++F SKDPENEVIKPA+ G+L+IINSC KAKTVK+LVFTSS   +
Sbjct  75   EAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTSSAGTL  134

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++  Q+  YDES WSDLDFIYA KM GWMYFASK LAEKEAWKA KEK+I+FISIIPPL
Sbjct  135  NVQPQQKPVYDESCWSDLDFIYAKKMTGWMYFASKILAEKEAWKATKEKKIDFISIIPPL  194

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP SL+TALS I    GN  H++IIKQG++VHLDDLCEA IFLY+HPKA G
Sbjct  195  VVGPFITPTFPPSLITALSLI---TGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKAEG  251

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFICSSHH TIH +A+MI+ NWPEYY+PSEFKGIEK+LP+V FSSKKLQ+MGFQFKY+LE
Sbjct  252  RFICSSHHTTIHGLAEMIKQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYSLE  311

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQHSG  820
            DMY+GAIETLRKKGLLPYSTKEPA IE+EQ + 
Sbjct  312  DMYRGAIETLRKKGLLPYSTKEPAAIEEEQETA  344



>gb|ABL74479.1| dihydroflavonol 4-reductase [Ipomoea batatas]
Length=394

 Score =   412 bits (1060),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 205/272 (75%), Positives = 237/272 (87%), Gaps = 3/272 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAIAGCEGVFHVA  ++F SKDPENEVIKPA+ G+L+IINSC KAKTVK+LVFTSS   +
Sbjct  75   EAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTSSAGTL  134

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++  Q+  YDES WSDLDFIYA KM GWMYFASK LAEKEAWKA KEK+I+FISIIPPL
Sbjct  135  NVQPQQKPVYDESCWSDLDFIYAKKMTGWMYFASKILAEKEAWKATKEKKIDFISIIPPL  194

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP SL+TALS I    GN  H++IIKQG++VHLDDLCEA IFLY+HPKA G
Sbjct  195  VVGPFITPTFPPSLITALSLI---TGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKAEG  251

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFICSSHH TIH + +MIR NWPEYY+PS+FKGIEK+LP+V FSSKKLQ+MGFQFKY+LE
Sbjct  252  RFICSSHHTTIHGLGEMIRQNWPEYYIPSQFKGIEKDLPVVYFSSKKLQDMGFQFKYSLE  311

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQHS  817
            DMY+GAIETLRKKGLLPYSTKEPA IE+EQ +
Sbjct  312  DMYRGAIETLRKKGLLPYSTKEPAAIEEEQET  343



>dbj|BAA34637.1| dihydroflavonol 4-reductase [Ipomoea batatas]
 gb|AEQ92209.1| dihydroflavonol 4-reductase [Ipomoea batatas]
Length=394

 Score =   412 bits (1060),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 205/272 (75%), Positives = 237/272 (87%), Gaps = 3/272 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAIAGCEGVFHVA  ++F SKDPENEVIKPA+ G+L+IINSC KAKTVK+LVFTSS   +
Sbjct  75   EAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTSSAGTL  134

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++  Q+  YDES WSDLDFIYA KM GWMYFASK LAEKEAWKA KEK+I+FISIIPPL
Sbjct  135  NVQPQQKPVYDESCWSDLDFIYAKKMTGWMYFASKILAEKEAWKATKEKKIDFISIIPPL  194

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP SL+TALS I    GN  H++IIKQG++VHLDDLCEA IFLY+HPKA G
Sbjct  195  VVGPFITPTFPPSLITALSLI---TGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKAEG  251

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFICSSHH TIH + +MIR NWPEYY+PS+FKGIEK+LP+V FSSKKLQ+MGFQFKY+LE
Sbjct  252  RFICSSHHTTIHGLGEMIRQNWPEYYIPSQFKGIEKDLPVVYFSSKKLQDMGFQFKYSLE  311

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQHS  817
            DMY+GAIETLRKKGLLPYSTKEPA IE+EQ +
Sbjct  312  DMYRGAIETLRKKGLLPYSTKEPAAIEEEQET  343



>gb|ACS87954.1| dihydroflavonol 4-reductase [Ipomoea horsfalliae]
Length=414

 Score =   412 bits (1060),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 207/272 (76%), Positives = 237/272 (87%), Gaps = 3/272 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAIAGCEGVFHVA   +F SKDPENEVIKPA+ G+L+IINSC KAKTVK+LVFTSS  A+
Sbjct  81   EAIAGCEGVFHVATPTDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTSSAGAL  140

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++  Q+   DES WSDLDFIYA KM GWMYFASK LAEKEAWKA KEK+I+FISIIPPL
Sbjct  141  NVQPQQKPVCDESCWSDLDFIYAKKMTGWMYFASKILAEKEAWKATKEKKIDFISIIPPL  200

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP SL+TALS I    GN  H++IIKQG++VHLDDLCEA IFLY+HPKA G
Sbjct  201  VVGPFISPTFPPSLITALSLI---TGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKAEG  257

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFICSSHH TIH +A+MIR NWPEYY+PSEFKGIEK+LP+V FSSKKLQ+MGFQFKY+LE
Sbjct  258  RFICSSHHTTIHGLAEMIRQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYSLE  317

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQHS  817
            DMY+GAIETLRKKGLLPYSTKEPA IE+EQ +
Sbjct  318  DMYRGAIETLRKKGLLPYSTKEPAAIEEEQET  349



>gb|ABY25285.1| dihydroflavonol 4-reductase B [Merremia dissecta]
Length=388

 Score =   410 bits (1053),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 209/275 (76%), Positives = 238/275 (87%), Gaps = 7/275 (3%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EA+AGCEGVFHVA  ++F SKDPENEVIKPA+ G+L+IINSCAKAKTVK+LVFTSS   +
Sbjct  64   EAVAGCEGVFHVATPMDFESKDPENEVIKPAINGVLNIINSCAKAKTVKRLVFTSSAGTL  123

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++  Q+  YDESSWSDLDFIYA KM GWMYFASK LAEKEAWKA KEKQI+FISIIPPL
Sbjct  124  NVQPEQKPVYDESSWSDLDFIYAKKMTGWMYFASKILAEKEAWKATKEKQIDFISIIPPL  183

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP SL+TALS I    GN LH++IIKQG++VHLDDLCEA IFLY+HPKA G
Sbjct  184  VVGPFITPTFPPSLITALSLI---TGNELHYSIIKQGQYVHLDDLCEAHIFLYEHPKAEG  240

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFICSSHH TIHD+AKMI  NWPEYYVPSEFKGIEK+LP+V FSSKKLQ+MGFQF Y+LE
Sbjct  241  RFICSSHHTTIHDLAKMITQNWPEYYVPSEFKGIEKDLPVVYFSSKKLQDMGFQFNYSLE  300

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQHSGKE  826
            +MY+GAIETLRKKGLLPYS KE A IE+    GKE
Sbjct  301  EMYRGAIETLRKKGLLPYSIKEHAAIEE----GKE  331



>gb|ACB42445.1| dihydroflavonol 4-reductase [Ipomoea batatas]
Length=395

 Score =   409 bits (1052),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 207/273 (76%), Positives = 237/273 (87%), Gaps = 4/273 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAIAGCEGVFHVA  ++F SKDPENEVIKPA+ G+L+IINSC KAKTVK+LVFTSS   +
Sbjct  75   EAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTSSAGTL  134

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++  Q+  YDES WSDLDFIYA KM GWMYFASK LAEKEAWKA KEK+I+FISIIPPL
Sbjct  135  NVQPQQKPVYDESCWSDLDFIYAKKMTGWMYFASKILAEKEAWKATKEKKIDFISIIPPL  194

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP SL+TALS I    GN  H++IIKQG++VHLDDLCEA IFLY+HPKA G
Sbjct  195  VVGPFITPTFPPSLITALSLI---TGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKAEG  251

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFICSSHH TIH +A+MIR NWPEYY+PSEFKGIEK+LP+V FSSKKLQEMGFQFKY+LE
Sbjct  252  RFICSSHHTTIHGLAEMIRQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQEMGFQFKYSLE  311

Query  722  DMYKGAIETLRKKGLLPYSTKE-PADIEQEQHS  817
            DMY+GAIE LRKKGLLPYSTKE PA IE+EQ +
Sbjct  312  DMYRGAIEILRKKGLLPYSTKELPAAIEEEQET  344



>dbj|BAA36406.1| dihydroflavonol 4-reductase [Ipomoea purpurea]
 dbj|BAA74699.1| dihydroflavonol 4-reductase [Ipomoea purpurea]
Length=386

 Score =   408 bits (1049),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 204/272 (75%), Positives = 235/272 (86%), Gaps = 3/272 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAIAGCEGVFHVA  ++F SKDPENEVIKP + G+L+IINSC KAKTVK+LVFTSS   +
Sbjct  78   EAIAGCEGVFHVATPMDFDSKDPENEVIKPTINGVLNIINSCVKAKTVKRLVFTSSAGTL  137

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++  Q+  YDE+ WSDLDFIYA KM GWMYFASK LAEKEAWKA KEKQI+FISIIPPL
Sbjct  138  NVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKATKEKQIDFISIIPPL  197

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP SL+TALS I    GN  H++IIKQG++VHLDDLCEA IFLY+HPKA G
Sbjct  198  VVGPFITPTFPPSLITALSLI---TGNEAHYSIIKQGQYVHLDDLCEAHIFLYEHPKAEG  254

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFICSSHH TIH +A MI HNWPEYY+PS+FKGIEKELP+V FSSKKLQ+MGFQFKY+LE
Sbjct  255  RFICSSHHTTIHGLADMITHNWPEYYIPSQFKGIEKELPVVYFSSKKLQDMGFQFKYSLE  314

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQHS  817
            DMY+G+IETLRKKGLLPYSTKE A IE+EQ +
Sbjct  315  DMYRGSIETLRKKGLLPYSTKETAAIEEEQET  346



>gb|AAB50009.1| dihydroflavonol 4-reductase [Ipomoea purpurea]
Length=333

 Score =   396 bits (1017),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 203/289 (70%), Positives = 234/289 (81%), Gaps = 20/289 (7%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAIAGCEGVFHVA  ++F SKDPENEVIKP + G+L+IINSC KAKTVK+LVFTSS   +
Sbjct  26   EAIAGCEGVFHVATPMDFDSKDPENEVIKPTINGVLNIINSCVKAKTVKRLVFTSSAGTL  85

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++  Q+  YDE+ WSDLDFIYA KM GWMYFASK LAEKEAWKA KEK+I+FISIIPPL
Sbjct  86   NVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKATKEKKIDFISIIPPL  145

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP SL+TALS I    GN  H++IIKQG++VHLDDLCEA IFLY+HPKA G
Sbjct  146  VVGPFITPTFPPSLITALSLI---TGNEAHYSIIKQGQYVHLDDLCEAHIFLYEHPKAEG  202

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFICSSHH TIH +A MI HNWPEYY+PS+FKGIEKEL +V FSSKKLQ+MGFQFKY+LE
Sbjct  203  RFICSSHHTTIHGLADMITHNWPEYYIPSQFKGIEKELAVVYFSSKKLQDMGFQFKYSLE  262

Query  722  DMYKGAIETLRKKGLLPYSTK-----------------EPADIEQEQHS  817
            DMY+GAIETLRKKGLLPYSTK                 EP  IEQ+Q +
Sbjct  263  DMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVPLKVEEPTAIEQKQET  311



>gb|ABY25284.1| dihydroflavonol 4-reductase B [Convolvulus arvensis]
Length=398

 Score =   398 bits (1023),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 199/271 (73%), Positives = 235/271 (87%), Gaps = 3/271 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAIAGCEGVFHVA  ++F SKDPENEVIKPA+ G+L+IINSCAKA TVK+LVFTSS   +
Sbjct  84   EAIAGCEGVFHVATPMDFESKDPENEVIKPAINGVLNIINSCAKANTVKRLVFTSSAGTL  143

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            ++++ Q+  YDE+SWSDLDFIY+ KM GWMYFASK  AEKEAWKA KEKQI+FISIIPPL
Sbjct  144  NVQQIQKPVYDETSWSDLDFIYSKKMTGWMYFASKIQAEKEAWKATKEKQIDFISIIPPL  203

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP SL+TALS I    GN  H++IIKQ ++VHLDDLC+A IFLY+HPKA G
Sbjct  204  VVGPFITPTFPPSLITALSLI---TGNEPHYSIIKQVQYVHLDDLCQAHIFLYEHPKAEG  260

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSS+  TI+D+AKMIR NWPEYYVPSEFKGIEK+L +VSFSSKKLQ+MGF+FKYTLE
Sbjct  261  RYICSSYDTTIYDLAKMIRQNWPEYYVPSEFKGIEKDLGVVSFSSKKLQDMGFEFKYTLE  320

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQH  814
            DMY+GAIETLRKKGLLPYS K+P  IE++Q 
Sbjct  321  DMYRGAIETLRKKGLLPYSIKDPCAIEEKQE  351



>gb|ABY25290.1| dihydroflavonol 4-reductase [Evolvulus glomeratus]
Length=350

 Score =   395 bits (1016),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 198/264 (75%), Positives = 227/264 (86%), Gaps = 3/264 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GCEGVFHVA  ++F S+DPENEVIKP VKGIL II+SCAK+K+VK++VFTSS   V
Sbjct  79   EAIEGCEGVFHVATPMDFDSEDPENEVIKPTVKGILGIIDSCAKSKSVKRIVFTSSAGTV  138

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             I+E Q+  YDE+ WSDLDFIYA KM GWMYFASK LAEKEAWK+ KEKQI+FISIIPP+
Sbjct  139  DIQENQKSLYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKSTKEKQIDFISIIPPV  198

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP SL+TALSPIM   GN  H   IKQG+FVH+DDLCEA +FLY+HPKA G
Sbjct  199  VVGPFITPTFPPSLITALSPIM---GNESHCRHIKQGQFVHIDDLCEALMFLYEHPKAQG  255

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFICSSHH TIHD+AKMIRHNWPEY VP+EFKGIEK++ +VSFSSKKL +MGFQFKYTLE
Sbjct  256  RFICSSHHTTIHDIAKMIRHNWPEYNVPNEFKGIEKDIEVVSFSSKKLLDMGFQFKYTLE  315

Query  722  DMYKGAIETLRKKGLLPYSTKEPA  793
            DMY+GAIET R KGLLPYS K+PA
Sbjct  316  DMYRGAIETSRNKGLLPYSIKDPA  339



>gb|ABY25286.1| dihydroflavonol 4-reductase B [Petunia x hybrida]
Length=361

 Score =   396 bits (1017),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 194/270 (72%), Positives = 227/270 (84%), Gaps = 3/270 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC+GVFHVA  ++F SKDPENEVIKP V+G+LSII SCAKA TVK+LVFTSS   +
Sbjct  64   EAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGMLSIIESCAKANTVKRLVFTSSAGTL  123

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E Q+L YD++SWSDLDFIYA KM GWMYFASK LAEK A + AK+K I+FISIIPPL
Sbjct  124  DVQEQQKLFYDQTSWSDLDFIYAKKMTGWMYFASKILAEKAAMEEAKKKNIDFISIIPPL  183

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP SL+TALS I    GN  H+ IIKQG++VHLDDLCEA IFLY+HPKA G
Sbjct  184  VVGPFITPTFPPSLITALSLI---TGNEAHYCIIKQGQYVHLDDLCEAHIFLYEHPKAEG  240

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFICSSHHA I+DVAKM+R  WPEYYVP+EFKGI+K+LP+VSFSSKKL +MGFQFKYTLE
Sbjct  241  RFICSSHHAIIYDVAKMVREKWPEYYVPTEFKGIDKDLPVVSFSSKKLTDMGFQFKYTLE  300

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQ  811
            DMYKGAIET R+K LLP+ST+  AD E  +
Sbjct  301  DMYKGAIETCRQKQLLPFSTRSAADNEHNR  330



>gb|ABW69681.1| dihydroflavonol 4-reductase [Ipomoea purpurea]
Length=386

 Score =   396 bits (1018),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 204/289 (71%), Positives = 234/289 (81%), Gaps = 20/289 (7%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAIAGCEGVFHVA  ++F SKDPENEVIKP + G+L+IINSC KAKTVK+LVFTSS   +
Sbjct  78   EAIAGCEGVFHVATPMDFDSKDPENEVIKPTINGVLNIINSCVKAKTVKRLVFTSSAGTL  137

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++  Q+  YDE+ WSDLDFIYA KM GWMYFASK LAEKEAWKA KEKQI+FISIIPPL
Sbjct  138  NVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKATKEKQIDFISIIPPL  197

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP SL+TALS I    GN  H++IIKQG++VHLDDLCEA IFLY+HPKA G
Sbjct  198  VVGPFITPTFPPSLITALSLI---TGNEAHYSIIKQGQYVHLDDLCEAHIFLYEHPKAEG  254

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFICSSHH TIH +A MI HNWPEYY+PS+FKGIEKEL +V FSSKKLQ+MGFQFKY+LE
Sbjct  255  RFICSSHHTTIHGLADMITHNWPEYYIPSQFKGIEKELAVVYFSSKKLQDMGFQFKYSLE  314

Query  722  DMYKGAIETLRKKGLLPYSTK-----------------EPADIEQEQHS  817
            DMY+GAIETLRKKGLLPYSTK                 EP  IEQ+Q +
Sbjct  315  DMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVPLKVEEPTAIEQKQET  363



>dbj|BAA22072.1| dihydroflavonol 4-reductase [Ipomoea nil]
 dbj|BAA59333.1| dihydroflavonol 4-reductase [Ipomoea nil]
Length=403

 Score =   397 bits (1019),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 203/293 (69%), Positives = 235/293 (80%), Gaps = 20/293 (7%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAIAGCEGVFHVA  ++F SKDPENEVIKPA+ G+L+IINSC KAKTVK+LVFTSS   +
Sbjct  78   EAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTSSAGTL  137

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++  Q+  YDE+ WSDLDFIYA KM GWMYFASK LAEKEAWK  KEK+I+FISIIPPL
Sbjct  138  NVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFISIIPPL  197

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP SL+TALS I    GN  H++IIKQG++VHLDDLCEA IFLY+HPKA G
Sbjct  198  VVGPFITPTFPPSLITALSLI---TGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKAEG  254

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFICSSHH TIH +A MI  NWPEYY+PSEFKGIEK+LP+V FSSKKLQ+MGFQFKY+LE
Sbjct  255  RFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYSLE  314

Query  722  DMYKGAIETLRKKGLLPYSTK-----------------EPADIEQEQHSGKEP  829
            DMY+GAIETLRKKGLLPYSTK                 +P  IEQ+Q +   P
Sbjct  315  DMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEKPTAIEQKQEAKTVP  367



>gb|AEN83503.1| dihydroflavonol 4-reductase [Solanum tuberosum]
Length=382

 Score =   396 bits (1017),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 194/265 (73%), Positives = 223/265 (84%), Gaps = 3/265 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC+GVFHVA  ++F SKDPENEVIKP V+G+LSII SCAKAKTVK+LVFTSS   +
Sbjct  85   EAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGMLSIIESCAKAKTVKRLVFTSSAGTL  144

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E Q+L YDE+SWSDLDFIYA KM GWMYF SK LAEK A + AK+  I FISIIPPL
Sbjct  145  DVQEDQKLFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAMEEAKKNNINFISIIPPL  204

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP SL+TALS I    GN  H+ IIKQG++VHLDDLCEA IFLY+HPKA G
Sbjct  205  VVGPFITPTFPPSLITALSLI---TGNEAHYGIIKQGQYVHLDDLCEAHIFLYEHPKAEG  261

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFICSSHHA I+DVAKM+R  WPEYYVP+EFKGI+K+LPIVSFSSKKL +MGFQFKYTLE
Sbjct  262  RFICSSHHAIIYDVAKMVRQKWPEYYVPTEFKGIDKDLPIVSFSSKKLMDMGFQFKYTLE  321

Query  722  DMYKGAIETLRKKGLLPYSTKEPAD  796
            DMYKGAIET R+K LLP+ST+  AD
Sbjct  322  DMYKGAIETCRQKQLLPFSTRSTAD  346



>gb|ABY25287.1| dihydroflavonol 4-reductase C [Turbina oblongata]
Length=338

 Score =   394 bits (1012),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 207/274 (76%), Positives = 233/274 (85%), Gaps = 5/274 (2%)
 Frame = +2

Query  5    AIAGCEGVFHVAAA-VNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            AIAGCEGVFHVA   V+F S DPENE+I+PAVKGI SIINSCAKAKTVK+LVFTSS   +
Sbjct  65   AIAGCEGVFHVAGTPVDFVSNDPENEIIRPAVKGIQSIINSCAKAKTVKRLVFTSSAVTL  124

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E  +  YDESSWSDLD IYANKM GWMYFASKT AEKEAWKAAKEKQI+FISIIPPL
Sbjct  125  IVQEYPKPVYDESSWSDLDLIYANKMPGWMYFASKTQAEKEAWKAAKEKQIDFISIIPPL  184

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            +IGP ++PT PLSL  ALSP+    GN  H+ +IKQG++VHLDDLCEAQIFL++HPKA G
Sbjct  185  IIGPSILPTVPLSLSIALSPV---TGNEAHYFVIKQGQYVHLDDLCEAQIFLFEHPKAEG  241

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFICSSH ATIHD+AKMIR NWPEYYVPSEFKGIEK+LP+VS SSKKL +MGFQFKYTLE
Sbjct  242  RFICSSHDATIHDLAKMIRQNWPEYYVPSEFKGIEKDLPVVSLSSKKLLDMGFQFKYTLE  301

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQHSGK  823
            DMY+  IETLRKK +LPYSTK PA  EQE  +GK
Sbjct  302  DMYRETIETLRKKRVLPYSTK-PAPKEQEWENGK  334



>gb|AFO59586.1| diihydroflavonol 4-reductase [Dunalia brachyacantha]
Length=381

 Score =   395 bits (1015),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 194/272 (71%), Positives = 226/272 (83%), Gaps = 3/272 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC+GVFHVA  ++F SKDPENEVIKP V+G+LSII SCAKA TVK+LVFTSS   +
Sbjct  84   EAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGMLSIIESCAKANTVKRLVFTSSAGTL  143

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E Q+L YDE+SWSDLDFIYA KM GWMYF SK LAEK A + AK+  I+FISIIPPL
Sbjct  144  DVQEHQKLFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAMEEAKKNNIDFISIIPPL  203

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP SL+TALS I    GN  H+ IIKQG++VHLDDLCEA IFLY+HPKA G
Sbjct  204  VVGPFITPTFPPSLITALSII---TGNEAHYCIIKQGQYVHLDDLCEAHIFLYEHPKAEG  260

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFICSSHHA I+DVAKM+R  WPEYYVP+EFKGI+K+LPIVSFSSKKL +MGFQFKYTLE
Sbjct  261  RFICSSHHAIIYDVAKMVREKWPEYYVPTEFKGIDKDLPIVSFSSKKLMDMGFQFKYTLE  320

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQHS  817
            DMYKGAIET R+K LLP+ST+  AD  Q + +
Sbjct  321  DMYKGAIETCRQKQLLPFSTRSTADNGQNKEA  352



>gb|AFO59585.1| diihydroflavonol 4-reductase [Iochroma parvifolium]
Length=381

 Score =   395 bits (1015),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 194/272 (71%), Positives = 226/272 (83%), Gaps = 3/272 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC+GVFHVA  ++F SKDPENEVIKP V+G+LSII SCAKA TVK+LVFTSS   +
Sbjct  84   EAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGMLSIIESCAKANTVKRLVFTSSAGTL  143

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E Q+L YDE+SWSDLDFIYA KM GWMYF SK LAEK A + AK+  I+FISIIPPL
Sbjct  144  DVQEHQKLFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAMEEAKKNNIDFISIIPPL  203

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP SL+TALS I    GN  H+ IIKQG++VHLDDLCEA IFLY+HPKA G
Sbjct  204  VVGPFITPTFPPSLITALSII---TGNEAHYCIIKQGQYVHLDDLCEAHIFLYEHPKAEG  260

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFICSSHHA I+DVAKM+R  WPEYYVP+EFKGI+K+LPIVSFSSKKL +MGFQFKYTLE
Sbjct  261  RFICSSHHAIIYDVAKMVREKWPEYYVPTEFKGIDKDLPIVSFSSKKLMDMGFQFKYTLE  320

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQHS  817
            DMYKGAIET R+K LLP+ST+  AD  Q + +
Sbjct  321  DMYKGAIETCRQKQLLPFSTRSTADNGQNKEA  352



>gb|ABW69680.1| dihydroflavonol 4-reductase [Ipomoea purpurea]
Length=386

 Score =   395 bits (1014),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 203/289 (70%), Positives = 234/289 (81%), Gaps = 20/289 (7%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAIAGCEGVFHVA  ++F SKDPENEVIKP + G+L+IINSC KAKTVK+LVFTSS   +
Sbjct  78   EAIAGCEGVFHVATPMDFDSKDPENEVIKPTINGVLNIINSCVKAKTVKRLVFTSSAGTL  137

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++  Q+  YDE+ WSDLDFIYA KM GWMYFASK LAEKEAWKA KEKQI+FISIIPPL
Sbjct  138  NVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKATKEKQIDFISIIPPL  197

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP SL+TALS I    GN  H++IIKQG++VHLDDLCEA IFLY+HPKA G
Sbjct  198  VVGPFITPTFPPSLITALSLI---TGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKAEG  254

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFICSSHH TIH +A MI HNWPEYY+PS+FKGIEKELP+V FSSKKLQ+MGFQFKY+LE
Sbjct  255  RFICSSHHTTIHGLADMITHNWPEYYIPSQFKGIEKELPVVYFSSKKLQDMGFQFKYSLE  314

Query  722  DMYKGAIETLRKKGLLPYSTK-----------------EPADIEQEQHS  817
            DMY+G+IETLRKKGLL YSTK                 EP  IEQ+Q +
Sbjct  315  DMYRGSIETLRKKGLLLYSTKEAAAIEEEQETVPLKVEEPTAIEQKQET  363



>gb|AFQ98276.1| dihydroflavonol 4-reductase [Solanum tuberosum]
Length=382

 Score =   394 bits (1013),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 194/272 (71%), Positives = 226/272 (83%), Gaps = 3/272 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC+GVFHVA  ++F SKDPENEVIKP V+G+LSII SCAKAKTVK+LVFTSS   +
Sbjct  85   EAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGMLSIIESCAKAKTVKRLVFTSSAGTL  144

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E Q+L YDE+SWSDLDFIYA KM GWMYF SK LAEK A + AK+  I FISIIPPL
Sbjct  145  DVQEDQKLFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAMEEAKKNNINFISIIPPL  204

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP SL+TALS I    GN  H+ IIKQG++VHLDDLCEA IFLY+HPKA G
Sbjct  205  VVGPFITPTFPPSLITALSLI---TGNEAHYGIIKQGQYVHLDDLCEAHIFLYEHPKAEG  261

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFICSSHHA I+DVAKM+R  WPEYYVP+EFKGI+K+LPIVSFSSKKL  MGFQFKYTLE
Sbjct  262  RFICSSHHAIIYDVAKMVRQKWPEYYVPTEFKGIDKDLPIVSFSSKKLMGMGFQFKYTLE  321

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQHS  817
            DMYKGAIET R+K LLP+ST+  AD  +++ +
Sbjct  322  DMYKGAIETCRQKQLLPFSTRSTADNGKDKEA  353



>ref|NP_001274988.1| dihydroflavonol 4-reductase [Solanum tuberosum]
 gb|AAQ54579.1| dihydroflavonol 4-reductase [Solanum tuberosum]
 gb|AAQ54581.1| dihydroflavonol 4-reductase [Solanum tuberosum]
Length=382

 Score =   394 bits (1013),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 194/272 (71%), Positives = 226/272 (83%), Gaps = 3/272 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC+GVFHVA  ++F SKDPENEVIKP V+G+LSII SCAKA TVK+LVFTSS   +
Sbjct  85   EAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGMLSIIESCAKANTVKRLVFTSSAGTL  144

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E Q+L YDE+SWSDLDFIYA KM GWMYF SK LAEK A K AK+  I FISIIPPL
Sbjct  145  DVQEDQKLFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAMKEAKKNNINFISIIPPL  204

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP SL+TALS I    GN  H+ IIKQG++VHLDDLCEA IFLY+HPKA G
Sbjct  205  VVGPFITPTFPPSLITALSLI---TGNEAHYGIIKQGQYVHLDDLCEAHIFLYEHPKAEG  261

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFICSSHHA I+DVAKM+R  WPEYYVP+EFKGI+K+LPIVSFSSKKL +MGFQFKYTLE
Sbjct  262  RFICSSHHAIIYDVAKMVRQKWPEYYVPTEFKGIDKDLPIVSFSSKKLMDMGFQFKYTLE  321

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQHS  817
            DMYKGAIET R+K LLP+ST+  AD  +++ +
Sbjct  322  DMYKGAIETCRQKQLLPFSTRSSADNGKDKEA  353



>gb|AGI96401.1| dihydroflavonol 4-reductase [Petunia x hybrida]
Length=380

 Score =   393 bits (1010),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 191/265 (72%), Positives = 223/265 (84%), Gaps = 3/265 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC+GVFHVA  ++F SKDPENEVIKP V+G+LSII SCAKA TVK+LVFTSS   +
Sbjct  83   EAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGMLSIIESCAKANTVKRLVFTSSAGTL  142

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E Q+L YD++SWSDLDFIYA KM GWMYF SK LAEK A +  K+K I+FISIIPPL
Sbjct  143  DVQEQQKLFYDQTSWSDLDFIYAKKMTGWMYFVSKILAEKSAMEETKKKNIDFISIIPPL  202

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP SL+TALS I    GN  H+ IIKQG++VHLDDLCEA IFLY+HPKA G
Sbjct  203  VVGPFITPTFPPSLITALSLI---TGNEAHYCIIKQGQYVHLDDLCEAHIFLYEHPKADG  259

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFICSSHHA I+DVAKM+R  WPEYYVP+EFKGI+K+LP+VSFSSKKL +MGFQFKYTLE
Sbjct  260  RFICSSHHAIIYDVAKMVREKWPEYYVPTEFKGIDKDLPVVSFSSKKLTDMGFQFKYTLE  319

Query  722  DMYKGAIETLRKKGLLPYSTKEPAD  796
            DMYKGAIET R+K LLP+ST+  AD
Sbjct  320  DMYKGAIETCRQKQLLPFSTRSAAD  344



>dbj|BAA74700.1| dihydroflavonol 4-reductase [Ipomoea purpurea]
Length=386

 Score =   394 bits (1011),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 202/289 (70%), Positives = 234/289 (81%), Gaps = 20/289 (7%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAIAGCEGVFHVA  ++F SKDPENEVIKP + G+L+IINSC KAKTVK+LVFTSS   +
Sbjct  78   EAIAGCEGVFHVATPMDFDSKDPENEVIKPTINGVLNIINSCVKAKTVKRLVFTSSAGTL  137

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++  Q+  YDE+ WSDLDFIYA KM GWMYFASK LAEKEAWKA KEK+I+FISIIPPL
Sbjct  138  NVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKATKEKKIDFISIIPPL  197

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP SL+TALS I    GN  H++IIKQG++VHLDDLCEA IFLY+HPKA G
Sbjct  198  VVGPFITPTFPPSLITALSLI---TGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKAEG  254

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFICSSHH TIH +A+MI  NWPEYY+PS+FKGIEKEL +V FSSKKLQ+MGFQFKY+LE
Sbjct  255  RFICSSHHTTIHGLAEMITQNWPEYYIPSQFKGIEKELAVVYFSSKKLQDMGFQFKYSLE  314

Query  722  DMYKGAIETLRKKGLLPYSTK-----------------EPADIEQEQHS  817
            DMY+GAIETLRKKGLLPYSTK                 EP  IEQ+Q +
Sbjct  315  DMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVPLKVEEPTAIEQKQET  363



>gb|AAB84048.1| dihydroflavonol 4-reductase [Ipomoea purpurea]
Length=386

 Score =   393 bits (1010),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 202/289 (70%), Positives = 234/289 (81%), Gaps = 20/289 (7%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAIAGCEGVFHVA  ++F SKDPENEVIKP + G+L+IINSC KAKTVK+LVFTSS   +
Sbjct  78   EAIAGCEGVFHVATPMDFDSKDPENEVIKPTINGVLNIINSCVKAKTVKRLVFTSSAGTL  137

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++  Q+  YDE+ WSDLDFIYA KM GWMYFASK LAEKEAWKA KEK+I+FISIIPPL
Sbjct  138  NVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKATKEKKIDFISIIPPL  197

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP SL+TALS I    GN  H++IIKQG++VHLDDLCEA IFLY+HPKA G
Sbjct  198  VVGPFITPTFPPSLITALSLI---TGNEAHYSIIKQGQYVHLDDLCEAHIFLYEHPKAEG  254

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFICSSHH TIH +A+MI  NWPEYY+PS+FKGIEKEL +V FSSKKLQ+MGFQFKY+LE
Sbjct  255  RFICSSHHTTIHGLAEMITQNWPEYYIPSQFKGIEKELAVVYFSSKKLQDMGFQFKYSLE  314

Query  722  DMYKGAIETLRKKGLLPYSTK-----------------EPADIEQEQHS  817
            DMY+GAIETLRKKGLLPYSTK                 EP  IEQ+Q +
Sbjct  315  DMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVPLKVEEPTAIEQKQET  363



>emb|CAA33544.1| unnamed protein product [Petunia x hybrida]
Length=373

 Score =   392 bits (1007),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 191/265 (72%), Positives = 224/265 (85%), Gaps = 3/265 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC+GVFHVA  ++F SKDPENEVIKP V+G+LSII SCAKA TVK+LVFTSS   +
Sbjct  76   EAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGMLSIIESCAKANTVKRLVFTSSAGTL  135

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E Q+L YD++SWSDLDFIYA KM GWMYFASK LAEK A + AK+K I+FISIIPPL
Sbjct  136  DVQEQQKLFYDQTSWSDLDFIYAKKMTGWMYFASKILAEKAAMEEAKKKNIDFISIIPPL  195

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP SL+TALS I    GN  H+ IIKQG++VHLDDLCEA IFLY+HPKA G
Sbjct  196  VVGPFITPTFPPSLITALSLI---TGNEAHYCIIKQGQYVHLDDLCEAHIFLYEHPKADG  252

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFICSSHHA I+DVAKM+R  WPEYYVP+EFKGI+K+LP+VSFSSKKL +MGFQFKYTLE
Sbjct  253  RFICSSHHAIIYDVAKMVREKWPEYYVPTEFKGIDKDLPVVSFSSKKLTDMGFQFKYTLE  312

Query  722  DMYKGAIETLRKKGLLPYSTKEPAD  796
            DMYKGAI+T R+K LLP+ST+   D
Sbjct  313  DMYKGAIDTCRQKQLLPFSTRSAED  337



>gb|AFO59587.1| diihydroflavonol 4-reductase [Dunalia solanacea]
Length=381

 Score =   392 bits (1006),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 193/272 (71%), Positives = 225/272 (83%), Gaps = 3/272 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC+GVFHVA  ++F SKDPENEVIKP V G+LSII SCAKA TVK+LVFTSS   +
Sbjct  84   EAIQGCQGVFHVATPMDFESKDPENEVIKPTVGGMLSIIESCAKANTVKRLVFTSSAGTL  143

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E Q+L YDE+SWSDLDFIYA KM GWMYF SK LAEK A + AK+  I+FISIIPPL
Sbjct  144  DVQEHQKLFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAMEEAKKNNIDFISIIPPL  203

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP SL+TALS I    GN  H+ IIKQG++VHLDDLCEA IFLY+HPKA G
Sbjct  204  VVGPFITPTFPPSLITALSII---TGNEAHYCIIKQGQYVHLDDLCEAHIFLYEHPKAEG  260

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFICSSHHA I+DVAK++R  WPEYYVP+EFKGI+K+LPIVSFSSKKL +MGFQFKYTLE
Sbjct  261  RFICSSHHAIIYDVAKLVREKWPEYYVPTEFKGIDKDLPIVSFSSKKLMDMGFQFKYTLE  320

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQHS  817
            DMYKGAIET R+K LLP+ST+  AD  Q + +
Sbjct  321  DMYKGAIETCRQKQLLPFSTRSTADKGQNKEA  352



>gb|ADV03181.1| dihydroflavonol reductase [Iochroma cyaneum]
Length=381

 Score =   392 bits (1006),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 192/272 (71%), Positives = 225/272 (83%), Gaps = 3/272 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC+GVFHVA  ++F S DPENEVIKP ++G+LSII SCAKA TVK+LVFTSS   +
Sbjct  84   EAIQGCQGVFHVATPMDFESNDPENEVIKPTLRGMLSIIESCAKANTVKRLVFTSSAGTL  143

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E Q+L YDE+SWSDLDFIYA KM GWMYF SK LAEK A + AK+  I+FISIIPPL
Sbjct  144  DVQEHQKLFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAMEEAKKNNIDFISIIPPL  203

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP SL+TALS I    GN  H+ IIKQG++VHLDDLCEA IFLY+HPKA G
Sbjct  204  VVGPFVTPTFPPSLITALSII---TGNEAHYCIIKQGQYVHLDDLCEAHIFLYEHPKAEG  260

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFICSSHHA I+DVAKM+R  WPEYYVP+EFKGI+K+LPIVSFSSKKL +MGFQFKYTLE
Sbjct  261  RFICSSHHAIIYDVAKMVREKWPEYYVPTEFKGIDKDLPIVSFSSKKLMDMGFQFKYTLE  320

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQHS  817
            DMYKGAIET R+K LLP+ST+  AD  Q + +
Sbjct  321  DMYKGAIETCRQKQLLPFSTRSTADNGQNKEA  352



>sp|P14720.2|DFRA_PETHY RecName: Full=Dihydroflavonol-4-reductase; Short=DFR; AltName: 
Full=Dihydrokaempferol 4-reductase [Petunia x hybrida]
 emb|CAA56160.1| dfrA [Petunia x hybrida]
 gb|AGI96402.1| dihydroflavonol 4-reductase [Petunia x hybrida]
 gb|AGP50170.1| dihydroflavonol-4-reductase [Petunia x hybrida]
Length=380

 Score =   392 bits (1006),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 191/265 (72%), Positives = 224/265 (85%), Gaps = 3/265 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC+GVFHVA  ++F SKDPENEVIKP V+G+LSII SCAKA TVK+LVFTSS   +
Sbjct  83   EAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGMLSIIESCAKANTVKRLVFTSSAGTL  142

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E Q+L YD++SWSDLDFIYA KM GWMYFASK LAEK A + AK+K I+FISIIPPL
Sbjct  143  DVQEQQKLFYDQTSWSDLDFIYAKKMTGWMYFASKILAEKAAMEEAKKKNIDFISIIPPL  202

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP SL+TALS I    GN  H+ IIKQG++VHLDDLCEA IFLY+HPKA G
Sbjct  203  VVGPFITPTFPPSLITALSLI---TGNEAHYCIIKQGQYVHLDDLCEAHIFLYEHPKADG  259

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFICSSHHA I+DVAKM+R  WPEYYVP+EFKGI+K+LP+VSFSSKKL +MGFQFKYTLE
Sbjct  260  RFICSSHHAIIYDVAKMVREKWPEYYVPTEFKGIDKDLPVVSFSSKKLTDMGFQFKYTLE  319

Query  722  DMYKGAIETLRKKGLLPYSTKEPAD  796
            DMYKGAI+T R+K LLP+ST+   D
Sbjct  320  DMYKGAIDTCRQKQLLPFSTRSAED  344



>gb|AEQ04697.1| dihydroflavonol 4-reductase [Lycium barbarum]
Length=372

 Score =   391 bits (1004),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 190/272 (70%), Positives = 225/272 (83%), Gaps = 3/272 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC+GVFHVA  ++F SKDPENEVIKP V+G+LSII SC KA TV++LVFTSS   +
Sbjct  82   EAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGMLSIIESCVKANTVRRLVFTSSAGTL  141

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E Q+L YDE+SWSDLDFIYA KM GWMYF SK LAEK A + AK+  I+FISIIPPL
Sbjct  142  DVQEHQKLFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAMEEAKKNNIDFISIIPPL  201

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP SL+TALS I    GN  H+ IIKQG++VHLDDLCEA IFLY+HPKA G
Sbjct  202  VVGPFITPTFPPSLITALSLI---TGNEAHYCIIKQGQYVHLDDLCEAHIFLYEHPKAEG  258

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSHHA I+DVAKM+R  WPEYYVP+EFKGI+K+LPI+SFSSKKL +MGFQFKYTLE
Sbjct  259  RYICSSHHAIIYDVAKMVRQKWPEYYVPTEFKGIDKDLPIISFSSKKLMDMGFQFKYTLE  318

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQHS  817
            DMYKGAIET R+K LLP ST+  AD  Q++ +
Sbjct  319  DMYKGAIETCRQKQLLPLSTRSTADNGQDKEA  350



>gb|AFO59579.1| diihydroflavonol 4-reductase [Iochroma loxense]
Length=381

 Score =   390 bits (1002),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 191/272 (70%), Positives = 223/272 (82%), Gaps = 3/272 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC+GVFHVA  ++F S DPENEVIKP V+G+LSII SCAKA TVK+LVFTSS   V
Sbjct  84   EAIQGCQGVFHVATPMDFESNDPENEVIKPTVRGMLSIIESCAKANTVKRLVFTSSAGTV  143

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E Q+L YDE+SWSDLDFIYA KM GWMYF SK LAEK A + A++  I+FISIIPPL
Sbjct  144  DVQEHQKLFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAMEEARKNNIDFISIIPPL  203

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP SL+TALS I    GN  H+ IIKQG++VHLDDLCEA IFLY+H KA G
Sbjct  204  VVGPFITPTFPPSLITALSII---TGNEAHYCIIKQGQYVHLDDLCEAHIFLYEHTKAEG  260

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFICSSHHA I+DVAKM+R  WPEYYVP+EFKGI+K+LPIVSFSSKKL +MGFQFKYTLE
Sbjct  261  RFICSSHHAIIYDVAKMVREKWPEYYVPTEFKGIDKDLPIVSFSSKKLMDMGFQFKYTLE  320

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQHS  817
            DMYKGAIET R+K LLP+ST+   D  Q + +
Sbjct  321  DMYKGAIETSRQKQLLPFSTRSTTDNGQNKEA  352



>ref|XP_010315879.1| PREDICTED: dihydroflavonol-4-reductase isoform X1 [Solanum lycopersicum]
Length=382

 Score =   390 bits (1001),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 189/265 (71%), Positives = 222/265 (84%), Gaps = 3/265 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC+GVFHVA  ++F SKDPENEVIKP V+G+LSII SCAKA TVK+LVFTSS   +
Sbjct  85   EAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGMLSIIESCAKANTVKRLVFTSSAGTL  144

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E Q+L YDE+SWSDLDFIYA KM GWMYF SK LAEK A + A++  I+FISIIPPL
Sbjct  145  DVQEDQKLFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAMEEARKNNIDFISIIPPL  204

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+  TFP SL+TALS I    GN  H+ IIKQG++VHLDDLCEA IFLY+HPKA G
Sbjct  205  VVGPFITSTFPPSLITALSLI---TGNEAHYGIIKQGQYVHLDDLCEAHIFLYEHPKAEG  261

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFICSSHHA I+DVAKM+R  WPEYYVP+EFKGI+K+LP+VSFSSKKL +MGFQFK+TLE
Sbjct  262  RFICSSHHAIIYDVAKMVRQKWPEYYVPTEFKGIDKDLPVVSFSSKKLMDMGFQFKHTLE  321

Query  722  DMYKGAIETLRKKGLLPYSTKEPAD  796
            DMYKGAIET R+K LLP+ST+  AD
Sbjct  322  DMYKGAIETCRQKQLLPFSTRSTAD  346



>gb|AAM73809.1|AF449422_1 dihydroflavonol-4-reductase [Solanum tuberosum]
Length=382

 Score =   390 bits (1001),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 191/264 (72%), Positives = 221/264 (84%), Gaps = 3/264 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC+GVFHVA  ++F SKDPENEVI+P V+G+LSII SCAKAKTVK+LVFTSS   +
Sbjct  85   EAIKGCQGVFHVATPMDFESKDPENEVIQPTVRGMLSIIESCAKAKTVKRLVFTSSAGTL  144

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E Q+L YDE+SWSDLDFIYA KM GWMYF SK LAEK A + AK+  I FISIIPPL
Sbjct  145  DVQEDQKLFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAMEEAKKNNINFISIIPPL  204

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP SL+TALS I    GN  H+ IIKQG++VHLDDLCEA IFLY+HPKA G
Sbjct  205  VVGPFITPTFPPSLITALSLI---TGNEAHYGIIKQGQYVHLDDLCEAHIFLYEHPKAEG  261

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFICSSHHA I+DVAKM+R  WPEYYVP+EFKGI+K+LPIVSFSSKKL +MGFQFKYTLE
Sbjct  262  RFICSSHHAIIYDVAKMVRQKWPEYYVPTEFKGIDKDLPIVSFSSKKLMDMGFQFKYTLE  321

Query  722  DMYKGAIETLRKKGLLPYSTKEPA  793
            DMYKGAIET R+K LLP+ T+  A
Sbjct  322  DMYKGAIETCRQKQLLPFHTRSTA  345



>gb|AFD28990.1| dihydroflavonol 4-reductase, partial [Nicotiana attenuata]
Length=396

 Score =   390 bits (1002),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 192/272 (71%), Positives = 227/272 (83%), Gaps = 3/272 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC+GVFHVA  ++F SKDPENEVIKP V+G+LSII SCAKA TVK+LVFTSS   +
Sbjct  99   EAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGMLSIIESCAKANTVKRLVFTSSAGTL  158

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E Q+L YDE+SWSDLDFIYA KM GWMYF SK LAEK A +AAK+  I+FISIIPPL
Sbjct  159  DVQEHQKLFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAMEAAKKNNIDFISIIPPL  218

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPFL P FP SL+TALS I    GN  H+ IIKQG++VHLDDLCEA IFLY+HPKA G
Sbjct  219  VVGPFLTPAFPPSLITALSLI---TGNEAHYCIIKQGQYVHLDDLCEAHIFLYEHPKAEG  275

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFIC+SHHA I+DVAKM+R  WPEYYVP+EFKGI+K+LP+V FSSKKL +MGFQFKYTLE
Sbjct  276  RFICASHHAIIYDVAKMVREKWPEYYVPTEFKGIDKDLPVVYFSSKKLTDMGFQFKYTLE  335

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQHS  817
            DMYKGAIET R+K LLP+ST+  AD E+++ +
Sbjct  336  DMYKGAIETCRQKQLLPFSTRSTADNERDKEA  367



>gb|AFO59581.1| diihydroflavonol 4-reductase [Iochroma calycinum]
Length=381

 Score =   390 bits (1001),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 193/272 (71%), Positives = 223/272 (82%), Gaps = 3/272 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC+GVFHVA  ++F S DPENEVIKP V+G+LSII SCAKA TVK+LVFTSS   V
Sbjct  84   EAIQGCQGVFHVATPMDFESNDPENEVIKPTVRGMLSIIESCAKANTVKRLVFTSSAGTV  143

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E Q+L YDE+SWSDLDFIYA KM GWMYF SK LAEK A + AK+  I+FISIIPPL
Sbjct  144  DVQEHQKLFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAMEEAKKNNIDFISIIPPL  203

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP SL+TALS I    GN  H+ IIKQG++VHLDDLCEA IFLY+H KA G
Sbjct  204  VVGPFITPTFPPSLITALSII---TGNEAHYCIIKQGQYVHLDDLCEAHIFLYEHTKAEG  260

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFICSSHHA I+DVAKM+R  WPEYYVP+EFKGI+K+LPIVSFSSKKL +MGFQFKYTLE
Sbjct  261  RFICSSHHAIIYDVAKMVREKWPEYYVPTEFKGIDKDLPIVSFSSKKLMDMGFQFKYTLE  320

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQHS  817
            DMYKGAIET R+K LLP+ST   AD  Q + +
Sbjct  321  DMYKGAIETCRQKQLLPFSTGSTADNGQNKEA  352



>dbj|BAF64707.1| dihydroflavonol 4-reductase [Ipomoea tricolor]
 dbj|BAF64708.1| dihydroflavonol 4-reductase [Ipomoea tricolor]
 dbj|BAF64709.1| dihydroflavonol 4-reductase [Ipomoea tricolor]
Length=421

 Score =   391 bits (1004),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 196/261 (75%), Positives = 227/261 (87%), Gaps = 3/261 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAIAGCEGVFHVA  ++F SKDPENEVIKPA+ G+L+IINSCAKAKTVK+LVFTSS   +
Sbjct  79   EAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCAKAKTVKRLVFTSSAGTL  138

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++  Q+  Y E+ WSDLDFIYA KM GWMYFASK LAEKEAWKA KEK+I+FISIIPPL
Sbjct  139  NVQPQQKPVYHENCWSDLDFIYAKKMTGWMYFASKILAEKEAWKATKEKKIDFISIIPPL  198

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP SL+TALS I    GN  H++IIKQG++VHLDDLCEA IFLY+HPKA G
Sbjct  199  VVGPFITPTFPPSLITALSLI---TGNEAHYSIIKQGQYVHLDDLCEAHIFLYEHPKAEG  255

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFICSSHH TIH +A+MI  NWPEYY+PS+FKGIEK+L +V FSSKKLQ+MGFQFKY+LE
Sbjct  256  RFICSSHHTTIHGLAEMITQNWPEYYIPSQFKGIEKDLAVVYFSSKKLQDMGFQFKYSLE  315

Query  722  DMYKGAIETLRKKGLLPYSTK  784
            DMY+GAIETLRKKGLLPYSTK
Sbjct  316  DMYRGAIETLRKKGLLPYSTK  336



>dbj|BAA22076.1| dihydroflavonol 4-reductase [Ipomoea nil]
Length=356

 Score =   389 bits (998),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 204/275 (74%), Positives = 230/275 (84%), Gaps = 5/275 (2%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAA-VNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAA  178
            +AIAGCEGVFHVAA  V+F S DPENE+I+PAVKGILSIINSCAKAKTVK+LVFTSS   
Sbjct  82   DAIAGCEGVFHVAATPVDFVSDDPENEIIRPAVKGILSIINSCAKAKTVKRLVFTSSAVT  141

Query  179  VHIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPP  358
            + ++E  +  YDESSWSDLD IYA KM GWMYFASKT AEKEAWKAAKEKQI+FISIIPP
Sbjct  142  LIVQENPKPVYDESSWSDLDLIYAKKMPGWMYFASKTQAEKEAWKAAKEKQIDFISIIPP  201

Query  359  LVIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAG  538
            LVIG  ++PT PLS   ALSP+    GN  H+ +IKQG++VHLDDLCEAQIFL++HPKA 
Sbjct  202  LVIGASIVPTVPLSFTIALSPV---TGNEAHYFVIKQGQYVHLDDLCEAQIFLFEHPKAE  258

Query  539  GRFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTL  718
            GRFICSSH ATIHD+AKMIR NWPEYYVPSEFKGIEK+LP+VS SSKKL +MGFQFKYTL
Sbjct  259  GRFICSSHDATIHDLAKMIRQNWPEYYVPSEFKGIEKDLPVVSLSSKKLLDMGFQFKYTL  318

Query  719  EDMYKGAIETLRKKGLLPYSTKEPADIEQEQHSGK  823
            EDMY+  IETLR K +LPYS K P   EQE  +GK
Sbjct  319  EDMYREVIETLRNKCVLPYSIKPPPK-EQEWENGK  352



>gb|AFO59580.1| diihydroflavonol 4-reductase [Iochroma loxense]
Length=381

 Score =   389 bits (1000),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 192/272 (71%), Positives = 223/272 (82%), Gaps = 3/272 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC+GVFHVA  ++F S DPENEVIKP V+G+LSII SCAKA TVK+LVFTSS   V
Sbjct  84   EAIHGCQGVFHVATPMDFESNDPENEVIKPTVRGMLSIIESCAKANTVKRLVFTSSAGTV  143

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E Q+L YDE+SWSDLDFIYA KM GWMYF SK LAEK A + AK+  I+FISIIPPL
Sbjct  144  DVQEHQKLFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAMEEAKKNNIDFISIIPPL  203

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP SL+TALS I    GN  H+ IIKQG++VHLDDLCEA IFLY+H KA G
Sbjct  204  VVGPFITPTFPPSLITALSII---TGNEAHYCIIKQGQYVHLDDLCEAHIFLYEHTKAEG  260

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFICSSHHA I+DVAKM+R  WPEYYVP+EFKGI+K+LPIVSFSSKKL +MGFQFKYTLE
Sbjct  261  RFICSSHHAIIYDVAKMVREKWPEYYVPTEFKGIDKDLPIVSFSSKKLMDMGFQFKYTLE  320

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQHS  817
            DMYKGAIET R+K LLP+ST+   D  Q + +
Sbjct  321  DMYKGAIETSRQKQLLPFSTRSTTDNGQNKEA  352



>gb|AAF60298.1|AF233639_1 dihydroflavonol-4-reductase [Petunia x hybrida]
Length=373

 Score =   389 bits (999),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 190/265 (72%), Positives = 223/265 (84%), Gaps = 3/265 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC+GVFHVA  ++F SKDPENEVIKP V+G+LSII SCAKA TVK+LVFTSS   +
Sbjct  76   EAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGMLSIIESCAKANTVKRLVFTSSAGTL  135

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E Q+L YD++SWSDLDFIYA KM GWMYFASK LAEK A + AK+K I+FISIIPPL
Sbjct  136  DVQEQQKLFYDQTSWSDLDFIYAKKMTGWMYFASKILAEKAAMEEAKKKNIDFISIIPPL  195

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP SL+TALS I    GN  H+ IIKQG++VHLDDLCEA IFLY+HPKA G
Sbjct  196  VVGPFITPTFPPSLITALSLI---TGNEAHYCIIKQGQYVHLDDLCEAHIFLYEHPKADG  252

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFICSSHHA I+DVAKM+R  WPEYYVP+EFKGI+K+LP+VSFSSKKL +MGFQFKYTLE
Sbjct  253  RFICSSHHAIIYDVAKMVREKWPEYYVPTEFKGIDKDLPVVSFSSKKLTDMGFQFKYTLE  312

Query  722  DMYKGAIETLRKKGLLPYSTKEPAD  796
            DMYKGAI+T R+K LLP+S +   D
Sbjct  313  DMYKGAIDTCRQKQLLPFSPRSAED  337



>gb|AEX88625.1| dihydroflavonol 4-reductase [Lycium ruthenicum]
Length=379

 Score =   389 bits (999),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 189/272 (69%), Positives = 225/272 (83%), Gaps = 3/272 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC+GVFHVA  ++F SKDPENEVIKP V+G+LSII SC KA TV++LVFTSS   +
Sbjct  82   EAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGVLSIIESCVKANTVRRLVFTSSAGTL  141

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E Q+L YDE+SWSDLDFIYA KM GWMYF SK LAEK A + AK+  I+FISIIPPL
Sbjct  142  DVQEHQKLFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAMEEAKKNNIDFISIIPPL  201

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP SL+TALS I    GN  H+ IIKQG++VHLDDLCEA IFLY+HPKA G
Sbjct  202  VVGPFITPTFPPSLITALSLI---TGNEAHYCIIKQGQYVHLDDLCEAHIFLYEHPKAEG  258

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSHHA I+DVAK++R  WPEYYVP+EFKGI+K+LPI+SFSSKKL +MGFQFKYTLE
Sbjct  259  RYICSSHHAIIYDVAKIVRQKWPEYYVPTEFKGIDKDLPIISFSSKKLMDMGFQFKYTLE  318

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQHS  817
            DMYKGAIET R+K LLP ST+  AD  Q++ +
Sbjct  319  DMYKGAIETCRQKQLLPLSTRSTADNGQDKEA  350



>gb|AGI96400.1| dihydroflavonol 4-reductase [Petunia x hybrida]
Length=380

 Score =   389 bits (998),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 190/265 (72%), Positives = 223/265 (84%), Gaps = 3/265 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC+GVFHVA  ++F SKDPENEVIKP V+G+LSII SCAKA TVK+LVFTSS   +
Sbjct  83   EAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGMLSIIESCAKANTVKRLVFTSSAGTL  142

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E Q+L YD++SWSDLDFIYA KM GWMYFASK  AEK A + AK+K I+FISIIPPL
Sbjct  143  DVQEQQKLFYDQTSWSDLDFIYAKKMTGWMYFASKIPAEKAAMEEAKKKNIDFISIIPPL  202

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP SL+TALS I    GN  H+ IIKQG++VHLDDLCEA IFLY+HPKA G
Sbjct  203  VVGPFITPTFPPSLITALSLI---TGNEAHYCIIKQGQYVHLDDLCEAHIFLYEHPKADG  259

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFICSSHHA I+DVAKM+R  WPEYYVP+EFKGI+K+LP+VSFSSKKL +MGFQFKYTLE
Sbjct  260  RFICSSHHAIIYDVAKMVREKWPEYYVPTEFKGIDKDLPVVSFSSKKLTDMGFQFKYTLE  319

Query  722  DMYKGAIETLRKKGLLPYSTKEPAD  796
            DMYKGAI+T R+K LLP+ST+   D
Sbjct  320  DMYKGAIDTCRQKQLLPFSTRSAED  344



>ref|NP_001275409.1| dihydroflavonol-4-reductase-like [Solanum tuberosum]
 gb|AAQ54578.1| dihydroflavonol 4-reductase [Solanum tuberosum]
 gb|AAQ54580.1| dihydroflavonol 4-reductase [Solanum tuberosum]
 gb|AEG64707.1| dihydroflavonol 4-reductase [Solanum tuberosum]
Length=382

 Score =   388 bits (997),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 191/272 (70%), Positives = 225/272 (83%), Gaps = 3/272 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC+GVFHVA  ++F SKDPENEVIKP V+G+LSII SCAKA TVK+LVFTSS  A+
Sbjct  85   EAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGVLSIIESCAKANTVKRLVFTSSAGAL  144

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E Q+L  DE+SWSDLDFIYA KM GWMYF SK LAEK A + AK+  I+ ISIIPPL
Sbjct  145  DVQEDQKLFCDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAMEEAKKNNIDLISIIPPL  204

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP SL+TALS I    GN  H+ IIKQG++VHLDDLCEA IFLY+HPKA G
Sbjct  205  VVGPFITPTFPPSLITALSLI---TGNEAHYGIIKQGQYVHLDDLCEAHIFLYEHPKAEG  261

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFICSSHHA I+DVAKM+R  WPEYYVP+EFKGI+K+LPIVSFSSKKL +MGF FKYTLE
Sbjct  262  RFICSSHHAIIYDVAKMVRQKWPEYYVPTEFKGIDKDLPIVSFSSKKLMDMGFLFKYTLE  321

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQHS  817
            DMYKGAIET R+K LLP+ST+  AD  +++ +
Sbjct  322  DMYKGAIETCRQKQLLPFSTQSTADNGRDKEA  353



>gb|AAZ57436.1| dihydroflavonol reductase [Solanum tuberosum]
Length=382

 Score =   388 bits (996),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 190/272 (70%), Positives = 224/272 (82%), Gaps = 3/272 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC+GVFHVA  ++F SKDPENEVIKP V+G+LSII SCAKA TVK+LVFTSS   +
Sbjct  85   EAIKGCQGVFHVATPMDFESKDPENEVIKPTVRGMLSIIESCAKANTVKRLVFTSSAGTL  144

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E Q+L Y+E+SWSDLDFIYA KM GWMYF SK LAEK A + AK+  I FISIIPPL
Sbjct  145  DVQEDQKLFYNETSWSDLDFIYAKKMTGWMYFVSKILAEKAAMEEAKKNNINFISIIPPL  204

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
             +GPF+ PTFP SL+TALS I    GN  H+ IIKQG++VHLDDLCEA IFLY+HPKA G
Sbjct  205  AVGPFITPTFPPSLITALSLI---TGNEDHYGIIKQGQYVHLDDLCEAHIFLYEHPKAEG  261

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFICSSHHA I+DVAKM+R  WPEYYVP+E KGI+K+LPIVSFSSKKL +MGFQFKYTLE
Sbjct  262  RFICSSHHAIIYDVAKMVRQKWPEYYVPTELKGIDKDLPIVSFSSKKLMDMGFQFKYTLE  321

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQHS  817
            DMYKGAIET R+K LLP+ST+  AD  +++ +
Sbjct  322  DMYKGAIETCRQKQLLPFSTRSTADNGKDKEA  353



>gb|AAX63400.1| dihydroflavonol 4-reductase [Solanum pinnatisectum]
 gb|AAX63404.1| dihydroflavonol 4-reductase [Solanum pinnatisectum]
Length=382

 Score =   388 bits (996),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 190/272 (70%), Positives = 226/272 (83%), Gaps = 3/272 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC+GVFHVA  ++F SKDPENEVIKP V+G+LSII SCAKA TVK+LVFTSS   +
Sbjct  85   EAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGMLSIIESCAKANTVKRLVFTSSAGTL  144

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E Q+L YDE+SWSDLDFIYA KM GWMYF SK LAEK A + AK+  I+FISIIPPL
Sbjct  145  DVQEDQKLFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAMEEAKKNNIDFISIIPPL  204

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP SL+TALS I    GN  H+ IIKQG++VHLDDLCEA IFLY++PKA G
Sbjct  205  VVGPFITPTFPPSLITALSLI---TGNEAHYGIIKQGQYVHLDDLCEAHIFLYEYPKAEG  261

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFICSSHHA I+DVAK++R  WPEYYVP+EFKGI+K+LPIV FSSKKL +MGFQFKYTLE
Sbjct  262  RFICSSHHAIIYDVAKIVRQKWPEYYVPTEFKGIDKDLPIVFFSSKKLMDMGFQFKYTLE  321

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQHS  817
            DMYKGAIET R+K LLP+ST+  AD  +++ +
Sbjct  322  DMYKGAIETCRQKQLLPFSTRSTADNGKDKEA  353



>gb|AFO59584.1| diihydroflavonol 4-reductase [Iochroma baumii]
Length=381

 Score =   388 bits (996),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 192/272 (71%), Positives = 223/272 (82%), Gaps = 3/272 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC+GVFHVA  ++F S DPENEVIKP V+G+LSII SCAKA TVK+LVFTSS   +
Sbjct  84   EAIQGCQGVFHVATPMDFESYDPENEVIKPTVRGMLSIIESCAKANTVKRLVFTSSAGTL  143

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E Q+L YDE+SWSDLDFIYA KM GWMYF SK LAEK A + AK+  I+FISIIPPL
Sbjct  144  DVQEHQKLFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAMEEAKKNNIDFISIIPPL  203

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP SL+TALS I    GN  H+ IIKQG++VHLDDLCEA IFLY+H KA G
Sbjct  204  VVGPFITPTFPPSLITALSII---TGNEAHYCIIKQGQYVHLDDLCEAHIFLYEHTKAEG  260

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFICSSHHA I+DVAKM+R  WPEYYVP+EFKGI+K+LPIVSFSSKKL +MGFQFKYTLE
Sbjct  261  RFICSSHHAIIYDVAKMVREKWPEYYVPTEFKGIDKDLPIVSFSSKKLMDMGFQFKYTLE  320

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQHS  817
            DMYKGAIET R+K LLP+ST   AD  Q + +
Sbjct  321  DMYKGAIETCRQKQLLPFSTGSTADNGQNKEA  352



>gb|AFL48186.1| DFR protein [Capsicum annuum]
Length=382

 Score =   388 bits (996),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 190/265 (72%), Positives = 222/265 (84%), Gaps = 3/265 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC+GVFHVA  ++F SKDPENEVIKP V+G+LSII SCAKA TVK+LVFTSS   +
Sbjct  85   EAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGMLSIIESCAKANTVKRLVFTSSAGTL  144

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E Q++ YDE+SWSDLDFIYA KM GWMYF SK LAEK A + AK+  I+FISIIPPL
Sbjct  145  DVQEHQKIFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAMEEAKKNNIDFISIIPPL  204

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP SL+TALS I    GN  H+ IIKQG++VHLDDLCEA IFLY+HPKA G
Sbjct  205  VVGPFITPTFPPSLITALSLI---TGNEAHYCIIKQGQYVHLDDLCEAHIFLYEHPKAEG  261

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFICSSHHA I+DVAKM+R  WPEY VP+EFKGI+K+LPIVSFSSKKL +MGFQFKY+LE
Sbjct  262  RFICSSHHAIIYDVAKMVRQKWPEYNVPTEFKGIDKDLPIVSFSSKKLMDMGFQFKYSLE  321

Query  722  DMYKGAIETLRKKGLLPYSTKEPAD  796
            DMYKGAIET R+K LLP+ST+  AD
Sbjct  322  DMYKGAIETCRQKQLLPFSTRSTAD  346



>gb|AGP50169.1| dihydroflavonol-4-reductase [Calibrachoa sp. YC-2013]
Length=383

 Score =   387 bits (994),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 190/265 (72%), Positives = 224/265 (85%), Gaps = 3/265 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC+GVFHVA  ++F SKDPENEVIKP V G+LSII SCAKAKTVK+LVFTSS   +
Sbjct  86   EAIQGCQGVFHVATPMDFESKDPENEVIKPTVNGMLSIIESCAKAKTVKRLVFTSSAGTL  145

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E Q+L Y+E++WSDLDFIYA KM GWMYF SK LAEK A +AAK+  I+FISIIPP+
Sbjct  146  DVQEQQKLFYEETTWSDLDFIYAKKMTGWMYFVSKILAEKAAMEAAKKNNIDFISIIPPV  205

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP SL+TALS I    GN  H+ IIKQG++VHLDDLCEA IFLY+HPKA G
Sbjct  206  VVGPFITPTFPPSLITALSLI---TGNEAHYCIIKQGQYVHLDDLCEAHIFLYEHPKAEG  262

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFICSSHHA I+DVAKM+R  WPEYYVP+EFKGI+K+LP+VSFSSKKL +MGFQFKY+LE
Sbjct  263  RFICSSHHAIIYDVAKMVREKWPEYYVPTEFKGIDKDLPVVSFSSKKLTDMGFQFKYSLE  322

Query  722  DMYKGAIETLRKKGLLPYSTKEPAD  796
            DMYKGAIET R+K LLP+ST+  AD
Sbjct  323  DMYKGAIETCRQKQLLPFSTQSAAD  347



>gb|AFO59589.1| diihydroflavonol 4-reductase [Iochroma umbellatum]
Length=381

 Score =   387 bits (993),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 190/272 (70%), Positives = 224/272 (82%), Gaps = 3/272 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC+GVFHVA  ++F S DPENEVIKP V+G+LSII SCAKA TVK+LVFTSS   +
Sbjct  84   EAIQGCQGVFHVATPMDFESNDPENEVIKPTVRGMLSIIESCAKANTVKRLVFTSSAGTL  143

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E Q+L YDE+SWSDLDFIYA KM GWMYF SK LAEK A + AK+  I+FISIIPPL
Sbjct  144  DVQEHQKLFYDETSWSDLDFIYAKKMTGWMYFGSKILAEKAAMEEAKKNNIDFISIIPPL  203

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP SL+TALS I    GN  H+ IIKQG++VHLDDL +A IFLY+HPKA G
Sbjct  204  VVGPFITPTFPPSLITALSII---TGNEAHYCIIKQGQYVHLDDLSKAHIFLYEHPKAEG  260

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFICSSHHA I+DVAKM+R  WPEYYVP+EFKGI+K+LPIVSFSSKKL +MGFQFKYTLE
Sbjct  261  RFICSSHHAIIYDVAKMVREKWPEYYVPTEFKGIDKDLPIVSFSSKKLMDMGFQFKYTLE  320

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQHS  817
            DMYKGAIET R+K L+P+ST+  AD  Q + +
Sbjct  321  DMYKGAIETCRQKQLIPFSTRSTADNGQNKEA  352



>gb|AFO59582.1| diihydroflavonol 4-reductase [Iochroma fuchsioides]
Length=381

 Score =   386 bits (992),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 191/272 (70%), Positives = 222/272 (82%), Gaps = 3/272 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC+GVFHVA  ++F S DPENEVIKP V+G+LSII SCAKA TVK+LVFTSS   +
Sbjct  84   EAIQGCQGVFHVATPMDFESNDPENEVIKPTVRGMLSIIESCAKANTVKRLVFTSSAGTL  143

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E Q+L YDE+SWSDLDFIYA KM GWMYF SK LAEK A + AK+  I+FISIIPPL
Sbjct  144  DVQEHQKLFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAMEEAKKNNIDFISIIPPL  203

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP S +TALS I    GN  H+ IIKQGK+VHLDDLCEA IFLY+H KA G
Sbjct  204  VVGPFITPTFPPSFITALSII---TGNEAHYCIIKQGKYVHLDDLCEAHIFLYEHTKAEG  260

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFICSSH+A I+DVAKM+R  WPEYYVP+EFKGI+K+LPIVSFSSKKL +MGFQFKYTLE
Sbjct  261  RFICSSHYAIIYDVAKMVREKWPEYYVPTEFKGIDKDLPIVSFSSKKLMDMGFQFKYTLE  320

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQHS  817
            DMYKGAIET R+K LLP+ST   AD  Q + +
Sbjct  321  DMYKGAIETCRQKQLLPFSTGSTADNGQNKEA  352



>ref|NP_001289451.1| dihydroflavonol-4-reductase [Nicotiana tomentosiformis]
 gb|ACS12833.1| dihydroflavonol 4-reductase [Nicotiana tomentosiformis]
Length=382

 Score =   386 bits (991),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 192/265 (72%), Positives = 224/265 (85%), Gaps = 3/265 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC+GVFHVA  ++F S+DPENEVIKP V+G+LSII SCAKA TVK+LVFTSS   V
Sbjct  85   EAIQGCQGVFHVATPMDFESEDPENEVIKPTVRGMLSIIESCAKANTVKRLVFTSSAGTV  144

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E Q+L YDE+SWSDLDFIYA KM GWMYF SK LAEK A +AAK+K I+FISIIPPL
Sbjct  145  DVQEHQKLLYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAMEAAKKKNIDFISIIPPL  204

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPFL PTFP SL+TALS I    GN  H++IIKQGK+VHLDDLCEA IFLY+HPKA G
Sbjct  205  VVGPFLAPTFPPSLITALSLI---TGNEAHYSIIKQGKYVHLDDLCEAHIFLYEHPKAEG  261

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFIC+SHHA I+DVAKM++  WPEYYVP+EFKGI+K+L +V FSSKKL +MGFQFKYTLE
Sbjct  262  RFICASHHAIIYDVAKMVQEKWPEYYVPTEFKGIDKDLSVVYFSSKKLTDMGFQFKYTLE  321

Query  722  DMYKGAIETLRKKGLLPYSTKEPAD  796
            DMYKGAIET R+K LLP+ST+  AD
Sbjct  322  DMYKGAIETCRQKQLLPFSTRSTAD  346



>gb|ADV03180.1| dihydroflavonol reductase [Iochroma gesnerioides]
Length=381

 Score =   386 bits (991),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 192/270 (71%), Positives = 221/270 (82%), Gaps = 3/270 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC+GVFHVA  ++F S DPENEVIKP V+G+LSII SCAKA TVK+LVFTSS   +
Sbjct  84   EAIQGCQGVFHVATPMDFESNDPENEVIKPTVRGMLSIIESCAKANTVKRLVFTSSAGTL  143

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             I+E Q+L YDE+SWSDLDFIYA KM GWMYF SK LAEK A + AK+  I+FISIIPPL
Sbjct  144  DIQEHQKLFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAMEEAKKNNIDFISIIPPL  203

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP S +TALS I    GN  H+ IIKQGK+VHLDDLCEA IFLY+H KA G
Sbjct  204  VVGPFITPTFPPSFITALSII---TGNEAHYCIIKQGKYVHLDDLCEAHIFLYEHTKAEG  260

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFICSSH+A I+DVAKM+R  WPEYYVP+EFKGI+K+LPIVSFSSKKL +MGFQFKYTLE
Sbjct  261  RFICSSHYAIIYDVAKMVREKWPEYYVPTEFKGIDKDLPIVSFSSKKLMDMGFQFKYTLE  320

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQ  811
            DMYKGAIET R+K LLP+ST   AD  Q +
Sbjct  321  DMYKGAIETCRQKQLLPFSTGSTADNGQNK  350



>dbj|BAM37961.1| dihydroflavonol-4-reductase [Nicotiana tabacum]
 dbj|BAM37966.1| dihydroflavonol 4-reductase [Nicotiana tomentosiformis]
Length=382

 Score =   385 bits (990),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 192/265 (72%), Positives = 224/265 (85%), Gaps = 3/265 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC+GVFHVA  ++F S+DPENEVIKP V+G+LSII SCAKA TVK+LVFTSS   V
Sbjct  85   EAIQGCQGVFHVATPMDFESEDPENEVIKPTVRGMLSIIESCAKANTVKRLVFTSSAGTV  144

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E Q+L YDE+SWSDLDFIYA KM GWMYF SK LAEK A +AAK+K I+FISIIPPL
Sbjct  145  DVQEHQKLLYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAMEAAKKKNIDFISIIPPL  204

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPFL PTFP SL+TALS I    GN  H++IIKQGK+VHLDDLCEA IFLY+HPKA G
Sbjct  205  VVGPFLAPTFPPSLITALSLI---TGNEAHYSIIKQGKYVHLDDLCEAHIFLYEHPKAEG  261

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFIC+SHHA I+DVAKM++  WPEYYVP+EFKGI+K+L +V FSSKKL +MGFQFKYTLE
Sbjct  262  RFICASHHAIIYDVAKMVQEKWPEYYVPTEFKGIDKDLSVVYFSSKKLTDMGFQFKYTLE  321

Query  722  DMYKGAIETLRKKGLLPYSTKEPAD  796
            DMYKGAIET R+K LLP+ST+  AD
Sbjct  322  DMYKGAIETCRQKQLLPFSTRSTAD  346



>gb|AFO59583.1| diihydroflavonol 4-reductase [Iochroma fuchsioides]
Length=381

 Score =   385 bits (988),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 191/270 (71%), Positives = 221/270 (82%), Gaps = 3/270 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC+GVFHVA  ++F S DPENEVIKP V+G+LSII SCAKA TVK+LVFTSS   +
Sbjct  84   EAIQGCQGVFHVATPMDFESNDPENEVIKPTVRGMLSIIESCAKANTVKRLVFTSSAGTL  143

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E Q+L YDE+SWSDLDFIYA KM GWMYF SK LAEK A + AK+  I+FISIIPPL
Sbjct  144  DVQEHQKLFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAMEEAKKNNIDFISIIPPL  203

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP S +TALS I    GN  H+ IIKQGK+VHLDDLCEA IFLY+H KA G
Sbjct  204  VVGPFITPTFPPSFITALSII---TGNEAHYCIIKQGKYVHLDDLCEAHIFLYEHTKAEG  260

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFICSSH+A I+DVAKM+R  WPEYYVP+EFKGI+K+LPIVSFSSKKL +MGFQFKYTLE
Sbjct  261  RFICSSHYAIIYDVAKMVREKWPEYYVPTEFKGIDKDLPIVSFSSKKLVDMGFQFKYTLE  320

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQ  811
            DMYKGAIET R+K LLP+ST   AD  Q +
Sbjct  321  DMYKGAIETCRQKQLLPFSTGSTADNGQNK  350



>dbj|BAC10993.1| dihydroflavonol 4-reductase [Nierembergia sp. NB17]
Length=374

 Score =   384 bits (987),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 188/265 (71%), Positives = 220/265 (83%), Gaps = 3/265 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC+GVFHVA  ++F SKDPENEVIKP V+G+LSII SC KA TVK+LVFTSS   +
Sbjct  77   EAIKGCQGVFHVATPMDFESKDPENEVIKPTVQGMLSIIESCVKANTVKRLVFTSSAGTL  136

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E Q+L YDE+SWSDLDFI A KM GWMYF SK LAEK A + AK+  I+FISIIPPL
Sbjct  137  DVQEQQKLFYDETSWSDLDFINAKKMTGWMYFVSKILAEKAAMEEAKKNNIDFISIIPPL  196

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ P+FP SL+TALS I    GN  H+ IIKQG++VHLDDLCEA IFLY+HPKA G
Sbjct  197  VVGPFITPSFPPSLITALSLI---TGNEAHYCIIKQGQYVHLDDLCEAYIFLYEHPKAEG  253

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFICSSHHA I+DVAKMIR  WPEYYVP+EFKGI K+LP+V+FSSKKL +MGFQFKYTLE
Sbjct  254  RFICSSHHAIIYDVAKMIREKWPEYYVPTEFKGIAKDLPVVAFSSKKLTDMGFQFKYTLE  313

Query  722  DMYKGAIETLRKKGLLPYSTKEPAD  796
            DMYKGAIET R+K LLP+ST  P++
Sbjct  314  DMYKGAIETCRQKQLLPFSTNRPSE  338



>gb|ABN80436.1| dihydroflavonol 4-reductase [Nicotiana tabacum]
Length=382

 Score =   385 bits (988),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 191/265 (72%), Positives = 224/265 (85%), Gaps = 3/265 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC+GVFHVA  ++F S+DPENEVIKP V+G+LSII SCAKA TVK+LVFTSS   V
Sbjct  85   EAIQGCQGVFHVATPMDFESEDPENEVIKPTVRGMLSIIESCAKANTVKRLVFTSSAGTV  144

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E Q+L YDE+SWSDLDFIYA KM GWMYF S+ LAEK A +AAK+K I+FISIIPPL
Sbjct  145  DVQEHQKLLYDETSWSDLDFIYAKKMTGWMYFVSQILAEKAAMEAAKKKNIDFISIIPPL  204

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPFL PTFP SL+TALS I    GN  H++IIKQGK+VHLDDLCEA IFLY+HPKA G
Sbjct  205  VVGPFLAPTFPPSLITALSLI---TGNEAHYSIIKQGKYVHLDDLCEAHIFLYEHPKAEG  261

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFIC+SHHA I+DVAKM++  WPEYYVP+EFKGI+K+L +V FSSKKL +MGFQFKYTLE
Sbjct  262  RFICASHHAIIYDVAKMVQEKWPEYYVPTEFKGIDKDLSVVYFSSKKLTDMGFQFKYTLE  321

Query  722  DMYKGAIETLRKKGLLPYSTKEPAD  796
            DMYKGAIET R+K LLP+ST+  AD
Sbjct  322  DMYKGAIETCRQKQLLPFSTRSTAD  346



>gb|ABN80438.1| dihydroflavonol 4-reductase [Nicotiana benthamiana]
Length=382

 Score =   385 bits (988),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 189/261 (72%), Positives = 221/261 (85%), Gaps = 3/261 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC+GVFHVA  ++F SKDPENEVIKP V+G+LSII SCAKA TVK+LVFTSS   +
Sbjct  85   EAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGMLSIIESCAKANTVKRLVFTSSAGTL  144

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E Q+L YDE+SWSDLDFIYA KM GWMYF SK LAEK A +AAK+  I+FISIIPPL
Sbjct  145  DVQEHQKLFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAMEAAKQNNIDFISIIPPL  204

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPFL PTFP SL+TALS I    GN  H+ IIKQG++VHLDDLCEA IFLY+HPKA G
Sbjct  205  VVGPFLTPTFPPSLITALSLI---TGNETHYCIIKQGQYVHLDDLCEAHIFLYEHPKAEG  261

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFIC+SHHA I+DVAKM+R  WPEYY+P+EFKGI+K+LP+V FSSKKL +MGFQFKYTLE
Sbjct  262  RFICASHHAIIYDVAKMVREKWPEYYIPTEFKGIDKDLPVVYFSSKKLMDMGFQFKYTLE  321

Query  722  DMYKGAIETLRKKGLLPYSTK  784
            DMYKGAIET R+K LLP+ST+
Sbjct  322  DMYKGAIETCRQKQLLPFSTQ  342



>gb|AFO59588.1| diihydroflavonol 4-reductase [Iochroma umbellatum]
Length=381

 Score =   382 bits (982),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 188/272 (69%), Positives = 222/272 (82%), Gaps = 3/272 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC+GVFHVA  ++F S DPENE+IKP V+G+LSII SCAKA TVK+LVFTSS   +
Sbjct  84   EAIQGCQGVFHVATPMDFESNDPENEIIKPTVRGMLSIIESCAKANTVKRLVFTSSAGTL  143

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E Q+L YDE+SWSDLDFI A KM GWMYF SK LAEK A + AK+  I+FISIIPPL
Sbjct  144  DVQEHQKLFYDETSWSDLDFIXAKKMTGWMYFGSKILAEKAAMEEAKKNNIDFISIIPPL  203

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP SL+TALS I    GN  H+ IIKQG++VHLDDL EA IFLY+HPKA G
Sbjct  204  VVGPFITPTFPPSLITALSII---TGNEAHYCIIKQGQYVHLDDLSEAHIFLYEHPKAEG  260

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFICSSHHA I+DVAKM+R  WPEYYVP+EFKGI+K+LPIVSFSSKKL +MGFQFKYTLE
Sbjct  261  RFICSSHHAIIYDVAKMVREKWPEYYVPTEFKGIDKDLPIVSFSSKKLMDMGFQFKYTLE  320

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQHS  817
            DMYKGAIET R+K L+P+ T+  AD  Q + +
Sbjct  321  DMYKGAIETCRQKQLIPFPTRSTADNGQNKEA  352



>dbj|BAA36407.1| dihydroflavonol 4-reductase [Ipomoea purpurea]
Length=356

 Score =   381 bits (978),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 201/275 (73%), Positives = 229/275 (83%), Gaps = 5/275 (2%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAA-VNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAA  178
            +AIAGCEGVFHVAA  V+F S DP+NE+I+PAVKGILSIINSCAKAKTVK+LVFTSS   
Sbjct  82   DAIAGCEGVFHVAATPVDFVSDDPQNEIIRPAVKGILSIINSCAKAKTVKRLVFTSSAVT  141

Query  179  VHIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPP  358
            + ++   +  YDESSWSDLD IYA KM GWMYFASKT AEKEAWKAAKEKQI+FISIIPP
Sbjct  142  LIVQGNPKPVYDESSWSDLDLIYAKKMPGWMYFASKTQAEKEAWKAAKEKQIDFISIIPP  201

Query  359  LVIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAG  538
            LVIG  ++PT PLS   ALSP+    GN  H+ +IKQG++VHLDDLCEAQIFL++HPKA 
Sbjct  202  LVIGTSIVPTVPLSFTIALSPV---TGNEAHYFVIKQGQYVHLDDLCEAQIFLFEHPKAE  258

Query  539  GRFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTL  718
            GRFICSSH ATIHD+AKMIR NWPEYYVPSEFKGIEK+L +VS SSKKL +MGFQFKYTL
Sbjct  259  GRFICSSHDATIHDLAKMIRQNWPEYYVPSEFKGIEKDLQVVSLSSKKLLDMGFQFKYTL  318

Query  719  EDMYKGAIETLRKKGLLPYSTKEPADIEQEQHSGK  823
            EDMY+  IETLR K +LPYS K P + EQE  +GK
Sbjct  319  EDMYREVIETLRNKCVLPYSIKPPPN-EQEWENGK  352



>gb|ACS12834.1| dihydroflavonol 4-reductase [Nicotiana alata]
Length=382

 Score =   381 bits (978),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 190/265 (72%), Positives = 221/265 (83%), Gaps = 3/265 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC+GVFHVA  ++F SKDPENEVIKP V+G+LSII SCAKA TVK+LVFTSS   +
Sbjct  85   EAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGMLSIIESCAKANTVKRLVFTSSAGTL  144

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E Q+L YDE+SWSDLDFIYA KM GWMYF SK LAEK A +AAK+K I+FISIIPPL
Sbjct  145  DVQEHQKLFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAMEAAKKKNIDFISIIPPL  204

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPFL PTFP SL+TALS I    GN  H+ IIKQG++VHLDDLCEA IFLY+ P A G
Sbjct  205  VVGPFLTPTFPPSLITALSLI---TGNEAHYCIIKQGQYVHLDDLCEAHIFLYEQPTAEG  261

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFIC+SHHA I+DVAKM+R  WPEY VP+EFKGI+K+LP+V FSSKKL +MGFQFKYTLE
Sbjct  262  RFICASHHAIIYDVAKMVREKWPEYCVPTEFKGIDKDLPVVYFSSKKLTDMGFQFKYTLE  321

Query  722  DMYKGAIETLRKKGLLPYSTKEPAD  796
            DMYKGAIET R+K LLP+ST+  AD
Sbjct  322  DMYKGAIETCRQKQLLPFSTRSTAD  346



>gb|AAS46256.1| dihydroflavonol reductase [Ipomoea quamoclit]
Length=408

 Score =   382 bits (980),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 191/261 (73%), Positives = 223/261 (85%), Gaps = 3/261 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAIAGCEGV HVA  ++F SKDP+NE+IKPA+ G+L+II SC KAKTVK+LVFTSS   +
Sbjct  83   EAIAGCEGVSHVATPMDFHSKDPDNELIKPAINGVLNIIKSCVKAKTVKRLVFTSSAGTL  142

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            ++   Q+   DE+ WSDLDFIYA KM GWMYFASK LA+KEAWKA KEKQI+FISIIPPL
Sbjct  143  NVHPQQKPVCDETCWSDLDFIYAKKMTGWMYFASKILADKEAWKATKEKQIDFISIIPPL  202

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP SL+TALS I    GN  H++IIKQG++VHLDDLCEA IFLY+HPKA G
Sbjct  203  VVGPFITPTFPPSLITALSLI---TGNEAHYSIIKQGQYVHLDDLCEAHIFLYEHPKAEG  259

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R ICSSHH TIH +A+MI  NWPEYY+PS+FKGIEK+LP+V FSSKKLQ+MGFQFKY+LE
Sbjct  260  RLICSSHHTTIHGLAEMITQNWPEYYIPSQFKGIEKDLPVVYFSSKKLQDMGFQFKYSLE  319

Query  722  DMYKGAIETLRKKGLLPYSTK  784
            DM+KGAIETLRKKGLLPYSTK
Sbjct  320  DMFKGAIETLRKKGLLPYSTK  340



>gb|ACS12835.1| dihydroflavonol 4-reductase [Nicotiana langsdorffii]
Length=382

 Score =   380 bits (977),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 189/265 (71%), Positives = 221/265 (83%), Gaps = 3/265 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC+GVFHVA  ++F SKDPENEVIKP V+G+LSII SCAKA TVK+LVFTSS   +
Sbjct  85   EAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGMLSIIESCAKANTVKRLVFTSSAGTL  144

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E Q+L YDE+SWSDLDFIYA KM GWMYF SK LAEK A +AAK+  I+FISIIPPL
Sbjct  145  DVQEHQKLFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAMEAAKKNNIDFISIIPPL  204

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPFL PTFP SL+TALS I    GN  H+ IIKQG++VHLDDLCEA IFLY+ PKA G
Sbjct  205  VVGPFLTPTFPPSLITALSLI---TGNEAHYCIIKQGQYVHLDDLCEAHIFLYEQPKAEG  261

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFIC+SHHA I+DVAKM+R  WPEY VP+EFKGI+K+LP+V FSSKKL ++GFQFKYTLE
Sbjct  262  RFICASHHAIIYDVAKMVREKWPEYCVPTEFKGIDKDLPVVYFSSKKLTDIGFQFKYTLE  321

Query  722  DMYKGAIETLRKKGLLPYSTKEPAD  796
            DMYKGAIET R+K LLP+ST+  AD
Sbjct  322  DMYKGAIETCRQKQLLPFSTRSTAD  346



>ref|XP_009759956.1| PREDICTED: dihydroflavonol-4-reductase [Nicotiana sylvestris]
 dbj|BAM37967.1| dihydroflavonol 4-reductase [Nicotiana sylvestris]
Length=381

 Score =   378 bits (971),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 189/272 (69%), Positives = 224/272 (82%), Gaps = 3/272 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC+GVFHVA  ++F S+DPENEVIKP V+G+LSII SCAKA TVK+LVFTSS   +
Sbjct  84   EAIQGCQGVFHVATPMDFESEDPENEVIKPTVRGMLSIIESCAKANTVKRLVFTSSAGTL  143

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
              +E Q+L YDE+SWSDLDFIYA KM GWMYF SK LAEK A +AAK+K  +FISIIPPL
Sbjct  144  DAQEHQKLFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAMEAAKKKNFDFISIIPPL  203

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPFL PTFP SL+TALS I    GN  H+ IIKQG++VHLDDLCEA IFLY+ PKA G
Sbjct  204  VVGPFLTPTFPPSLITALSLI---TGNEAHYCIIKQGQYVHLDDLCEAHIFLYEQPKAEG  260

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFIC+SHHA I+DVAKM+R  WPEYYVP+EFKGI+K+LP+V FS KKL +MGFQFKYTLE
Sbjct  261  RFICASHHAIIYDVAKMVREKWPEYYVPTEFKGIDKDLPVVYFSPKKLTDMGFQFKYTLE  320

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQHS  817
            DMYKGAIET R+K LLP+ST+  AD  +++ +
Sbjct  321  DMYKGAIETCRQKQLLPFSTQSTADNGRDKET  352



>gb|ABY25289.1| dihydroflavonol 4-reductase C [Merremia umbellata]
Length=344

 Score =   377 bits (967),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 200/276 (72%), Positives = 233/276 (84%), Gaps = 5/276 (2%)
 Frame = +2

Query  2    EAIAGCEGVFHVAA-AVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAA  178
            EAIAGCEGVFHVAA  V+  S DPENE+I+PA+KG+L+IINSCAKAKTVK+LV+TSS   
Sbjct  64   EAIAGCEGVFHVAATGVDIVSDDPENELIRPAIKGVLNIINSCAKAKTVKRLVYTSSAVT  123

Query  179  VHIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPP  358
            + ++   +  YDESSWSDLD +YA KM GW+YFASKTLAEKEAWKAAKEK+I+FISI+PP
Sbjct  124  LIVQGNPKPVYDESSWSDLDLMYAVKMPGWIYFASKTLAEKEAWKAAKEKKIDFISILPP  183

Query  359  LVIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAG  538
            LVIGP ++PTFPLSL  ALS +    GN  ++  IKQG+FVHLDDLCEAQIFL +HP+A 
Sbjct  184  LVIGPSIMPTFPLSLNMALSLV---TGNEDYYFSIKQGQFVHLDDLCEAQIFLLEHPQAE  240

Query  539  GRFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTL  718
            GRFICSSH ATIHD+AK+IR NWPEYYVPSEFKGI+K+LPIVS SSKK+Q +GFQFKYTL
Sbjct  241  GRFICSSHDATIHDLAKIIRENWPEYYVPSEFKGIDKDLPIVSLSSKKIQGLGFQFKYTL  300

Query  719  EDMYKGAIETLRKKGLLPYSTKEPADIEQEQHSGKE  826
            EDMY+ AIETLRKK LLPYSTK PA  EQ   +GKE
Sbjct  301  EDMYRDAIETLRKKRLLPYSTK-PASKEQGWETGKE  335



>gb|ABN80437.1| dihydroflavonol 4-reductase [Nicotiana tabacum]
 dbj|BAF96936.1| dihydroflavonol 4-reductase [Nicotiana tabacum]
Length=381

 Score =   378 bits (971),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 189/272 (69%), Positives = 224/272 (82%), Gaps = 3/272 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC+GVFHVA  ++F S+DPENEVIKP V+G+LSII SCAKA TVK+LVFTSS   +
Sbjct  84   EAIQGCQGVFHVATPMDFESEDPENEVIKPTVRGMLSIIESCAKANTVKRLVFTSSAGTL  143

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
              +E Q+L YDE+SWSDLDFIYA KM GWMYF SK LAEK A +AAK+K  +FISIIPPL
Sbjct  144  DAQEHQKLFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAMEAAKKKNFDFISIIPPL  203

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPFL PTFP SL+TALS I    GN  H+ IIKQG++VHLDDLCEA IFLY+ PKA G
Sbjct  204  VVGPFLTPTFPPSLITALSLI---TGNEAHYCIIKQGQYVHLDDLCEAHIFLYEQPKAEG  260

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFIC+SHHA I+DVAKM+R  WPEYYVP+EFKGI+K+LP+V FS KKL +MGFQFKYTLE
Sbjct  261  RFICASHHAIIYDVAKMVREKWPEYYVPTEFKGIDKDLPVVYFSPKKLTDMGFQFKYTLE  320

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQHS  817
            DMYKGAIET R+K LLP+ST+  AD  +++ +
Sbjct  321  DMYKGAIETCRQKQLLPFSTQSTADNGRDKET  352



>ref|NP_001234408.1| dihydroflavonol-4-reductase [Solanum lycopersicum]
 sp|P51107.1|DFRA_SOLLC RecName: Full=Dihydroflavonol-4-reductase; Short=DFR; AltName: 
Full=Dihydrokaempferol 4-reductase [Solanum lycopersicum]
 emb|CAA79154.1| dihydroflavonol 4-reductase [Solanum lycopersicum]
 prf||2006279A dihydroflavonol 4-reductase
Length=379

 Score =   376 bits (966),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 184/265 (69%), Positives = 218/265 (82%), Gaps = 6/265 (2%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC+GVFHVA  ++F SKDPENEVIKP V+G+LSII SCAKA TVK+LVFTSS   +
Sbjct  85   EAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGMLSIIESCAKANTVKRLVFTSSAGTL  144

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E Q+L YDE+SWSDLDFIYA KM GWMYF SK LAEK A + A++  I+FISIIPPL
Sbjct  145  DVQEDQKLFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAMEEARKNNIDFISIIPPL  204

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+  TFP SL+TALS I        H+ IIKQG++VHLDDLCEA IFLY+HPKA G
Sbjct  205  VVGPFITSTFPPSLITALSLIT------AHYGIIKQGQYVHLDDLCEAHIFLYEHPKAEG  258

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFICSSHHA I+DVAKM+R  WPEYYVP+EFKGI+K+L +VSFSSKKL ++ FQFK+TLE
Sbjct  259  RFICSSHHAIIYDVAKMVRQKWPEYYVPTEFKGIDKDLALVSFSSKKLMDIKFQFKHTLE  318

Query  722  DMYKGAIETLRKKGLLPYSTKEPAD  796
            DMYKGAIET R+K LLP+ST+  AD
Sbjct  319  DMYKGAIETCRQKQLLPFSTRSTAD  343



>gb|AIY22763.1| dihydroflavonol 4-reductase [Iochroma calycinum]
Length=370

 Score =   371 bits (952),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 185/272 (68%), Positives = 215/272 (79%), Gaps = 14/272 (5%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC+GVFHVA  ++F S DPENEVIKP V+G+LSII SCAKA TVK+LVFTSS   +
Sbjct  84   EAIQGCQGVFHVATPMDFESNDPENEVIKPTVRGMLSIIESCAKANTVKRLVFTSSAGTL  143

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E Q+L YDE+SWSDLDFIYA KM GWMYF SK LAEK A + AK+  I+FISIIPPL
Sbjct  144  DVQEHQKLFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAMEEAKKNNIDFISIIPPL  203

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP SL+TALS              I  G++VHLDDLCEA IFLY+H KA G
Sbjct  204  VVGPFITPTFPPSLITALS--------------IITGQYVHLDDLCEAHIFLYEHTKAEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFICSSHHA I+DVAKM+R  WPEYYVP+EFKGI+K+LPIVSFSSKKL +MGFQFKYTLE
Sbjct  250  RFICSSHHAIIYDVAKMVREKWPEYYVPTEFKGIDKDLPIVSFSSKKLMDMGFQFKYTLE  309

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQHS  817
            DMYKGAIET R+K LLP+ST   AD  Q + +
Sbjct  310  DMYKGAIETCRQKQLLPFSTGSTADNGQNKEA  341



>gb|ABY61976.1| dihydroflavonol 4-reductase [Ipomoea batatas]
Length=398

 Score =   372 bits (954),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 191/271 (70%), Positives = 221/271 (82%), Gaps = 4/271 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAIAGCEGVFHVA  ++F SKDPENEVIKPA+ G+L+IINSC KAKTVK+LVFTSS   +
Sbjct  78   EAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTSSAGTL  137

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++  Q+  YDES WSDLDFIYA KM GWMYFASK LAEKEAWKA KEK+I+FISIIPPL
Sbjct  138  NVQPQQKPVYDESCWSDLDFIYAKKMTGWMYFASKILAEKEAWKATKEKKIDFISIIPPL  197

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP SL+TALS I    GN  H++IIKQG++VHLDDLCEA IFLY+HPKA G
Sbjct  198  VVGPFITPTFPPSLITALSLI---TGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKAEG  254

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            RFICSSHH TIH + +MIR NWPEYY  SEFKG EK+LP+V FSSKKLQEMGF+ KY  E
Sbjct  255  RFICSSHHTTIHGLCEMIRQNWPEYYFLSEFKGSEKDLPVVYFSSKKLQEMGFRLKYCFE  314

Query  722  DMYKGAIETLRKKGLLPYSTKE-PADIEQEQ  811
            D Y+G I T R KGL+PY  KE P  I++E 
Sbjct  315  DNYRGEIVTSRMKGLIPYCNKEWPGAIDEEH  345



>gb|AGV53048.1| dihydroflavonol 4-reductase [Actinidia chinensis]
Length=345

 Score =   369 bits (948),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 184/265 (69%), Positives = 220/265 (83%), Gaps = 3/265 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+LSII SC KAKTVK+LVFTSS   V
Sbjct  77   EAIQGCSGVFHVATPMDFESKDPENEVIKPTINGVLSIIRSCTKAKTVKRLVFTSSAGTV  136

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E QQ  YDE++WSDLDFIYA KM GWMYF SKTLAEK AW+AAKE  I+FISIIP L
Sbjct  137  NVQEHQQPRYDENNWSDLDFIYAKKMTGWMYFVSKTLAEKAAWEAAKENNIDFISIIPTL  196

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF++PTFP SL+TALSPI    GN  H++IIKQG+FVHLDDLCE+ IFLY++PKA G
Sbjct  197  VVGPFIMPTFPPSLITALSPI---TGNEPHYSIIKQGQFVHLDDLCESHIFLYENPKAEG  253

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATI D+AKM+R  WPEY VPSEFKG ++ LP VSFSS+KL  MGF+FKY+LE
Sbjct  254  RYICSSHDATIFDLAKMMREKWPEYNVPSEFKGFDENLPNVSFSSEKLIGMGFKFKYSLE  313

Query  722  DMYKGAIETLRKKGLLPYSTKEPAD  796
            DM++GAI+T R+KGLLPYS + P +
Sbjct  314  DMFRGAIDTCREKGLLPYSNETPPN  338



>gb|AHM27144.1| dihydroflavonol 4-reductase [Angelonia angustifolia]
Length=437

 Score =   370 bits (951),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 177/272 (65%), Positives = 225/272 (83%), Gaps = 3/272 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC+GVFH+A  + F SKDPENEVIKP ++G++SII SCAKAKTV+K++FT+S   +
Sbjct  86   EAIEGCQGVFHLATPMEFDSKDPENEVIKPTIEGMMSIIRSCAKAKTVEKVIFTTSAGTL  145

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E Q+  YDE+SWSDLDFIY+ KM GWMYF SK LAEK+A +AAK   IEFISIIPP+
Sbjct  146  NVEEHQKPFYDETSWSDLDFIYSKKMTGWMYFVSKYLAEKQAVEAAKLNNIEFISIIPPV  205

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ P FP SLVTALSPI    GN  H+ I+KQG+FVHLDD+CEA IFL++HPKA G
Sbjct  206  VVGPFINPAFPPSLVTALSPI---TGNEAHYTIMKQGQFVHLDDICEAHIFLFEHPKADG  262

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATI+D+A++IR  WPEY VP EFKGI+K++P+V FSSKKL  MGF+FKY+LE
Sbjct  263  RYICSSHDATIYDIARLIRDKWPEYNVPMEFKGIDKDIPVVRFSSKKLTSMGFKFKYSLE  322

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQHS  817
            DMY+GAIET R+KGLLPYST   ++ E+++ +
Sbjct  323  DMYRGAIETCREKGLLPYSTHNQSNGEKKEST  354



>gb|AGO64770.1| dihydroflavonol 4-reductase, partial [Lycium barbarum]
Length=298

 Score =   365 bits (938),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 178/246 (72%), Positives = 207/246 (84%), Gaps = 3/246 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC+GVFHVA  ++F SKDPENEVIKP V+G+LSII SC KA TV++LVFTSS   +
Sbjct  56   EAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGMLSIIESCVKANTVRRLVFTSSAGTL  115

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E Q+L YDESSWSDLDFIYA KM GWMYF SK LAEK A + AK+  I+FISIIPPL
Sbjct  116  DVQEHQKLFYDESSWSDLDFIYAKKMTGWMYFVSKILAEKAAMEEAKKNNIDFISIIPPL  175

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP SL+TALS I    GN  H+ IIKQG++VHLDDLCEA IFLY+HPKA G
Sbjct  176  VVGPFITPTFPPSLITALSLI---TGNEAHYCIIKQGQYVHLDDLCEAHIFLYEHPKAEG  232

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSHHA I+DVAKM+R  WPEYYVP+EFKGI+K+LPI+SFSSKKL +MGFQFKYTLE
Sbjct  233  RYICSSHHAIIYDVAKMVRQKWPEYYVPTEFKGIDKDLPIISFSSKKLMDMGFQFKYTLE  292

Query  722  DMYKGA  739
            DMYKGA
Sbjct  293  DMYKGA  298



>gb|AIR09398.1| dihydroflavonol 4-reductase [Angelonia angustifolia]
Length=438

 Score =   370 bits (950),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 177/272 (65%), Positives = 225/272 (83%), Gaps = 3/272 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC+GVFH+A  + F SKDPENEVIKP ++G++SII SCAKAKTV+K++FT+S   +
Sbjct  87   EAIEGCQGVFHLATPMEFDSKDPENEVIKPTIEGMMSIIRSCAKAKTVEKVIFTTSAGTL  146

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E Q+  YDE+SWSDLDFIY+ KM GWMYF SK LAEK+A +AAK   IEFISIIPP+
Sbjct  147  NVEEHQKPFYDETSWSDLDFIYSKKMTGWMYFVSKYLAEKQAVEAAKLNNIEFISIIPPV  206

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ P FP SLVTALSPI    GN  H+ I+KQG+FVHLDD+CEA IFL++HPKA G
Sbjct  207  VVGPFINPAFPPSLVTALSPI---TGNEAHYTIMKQGQFVHLDDICEAHIFLFEHPKADG  263

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATI+D+A++IR  WPEY VP EFKGI+K++P+V FSSKKL  MGF+FKY+LE
Sbjct  264  RYICSSHDATIYDIARLIRDKWPEYNVPMEFKGIDKDIPVVRFSSKKLTSMGFKFKYSLE  323

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQHS  817
            DMY+GAIET R+KGLLPYST   ++ E+++ +
Sbjct  324  DMYRGAIETCREKGLLPYSTHNQSNGEKKEST  355



>gb|ABY25288.1| dihydroflavonol 4-reductase C [Convolvulus arvensis]
Length=354

 Score =   367 bits (941),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 207/275 (75%), Positives = 229/275 (83%), Gaps = 5/275 (2%)
 Frame = +2

Query  2    EAIAGCEGVFHVAA-AVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAA  178
            EAIAGCEGVFHVAA AV+  S DPENE+I+PAVKGILSIINSCAKAKTVK+LV+TSS   
Sbjct  80   EAIAGCEGVFHVAATAVDVVSDDPENEIIRPAVKGILSIINSCAKAKTVKRLVYTSSAVT  139

Query  179  VHIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPP  358
            +  +E Q+  YDES+WSDLD IYA KM GWMYFASKTLAEKEAWKAAK KQI+FISIIPP
Sbjct  140  LIFQENQKPVYDESNWSDLDLIYAVKMPGWMYFASKTLAEKEAWKAAKAKQIDFISIIPP  199

Query  359  LVIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAG  538
            LVIGP +IPT PLSL  ALSPI    GN   +  IKQG+FVHLDDLCEAQIFL +HPKA 
Sbjct  200  LVIGPSIIPTLPLSLSLALSPI---TGNEAQYFPIKQGQFVHLDDLCEAQIFLLEHPKAE  256

Query  539  GRFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTL  718
            GRFICSSH ATIHD+AKMIR NWPEY VPSEFKGIEK+LP+VS SSKKLQ+MGFQFKYTL
Sbjct  257  GRFICSSHDATIHDLAKMIRQNWPEYNVPSEFKGIEKDLPVVSLSSKKLQDMGFQFKYTL  316

Query  719  EDMYKGAIETLRKKGLLPYSTKEPADIEQEQHSGK  823
            EDMY+ +IETLR+KGL PYS K     EQE  + K
Sbjct  317  EDMYRESIETLREKGLPPYSIKS-TPTEQEWENXK  350



>dbj|BAM42669.1| dihydroflavonol 4-reductase [Vaccinium ashei]
Length=345

 Score =   366 bits (939),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 183/265 (69%), Positives = 221/265 (83%), Gaps = 3/265 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+LSII SC KAKTVK+LVFTSS   V
Sbjct  77   EAIEGCVGVFHVATPMDFESKDPENEVIKPTINGVLSIIKSCTKAKTVKRLVFTSSAGTV  136

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E QQ  YDE++WSDLDF+Y  KM GWMYF SKTLAEK AW+AAKE  I+FISIIP L
Sbjct  137  NVQEHQQPVYDENNWSDLDFVYKIKMTGWMYFVSKTLAEKAAWEAAKENNIDFISIIPTL  196

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF++PTFP SL+TALSPI    GN  H++IIKQG+FVHLDDLCE+ I+L++HP+A G
Sbjct  197  VVGPFIMPTFPPSLITALSPI---TGNEPHYSIIKQGQFVHLDDLCESHIYLFEHPEAEG  253

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATI+D+AKM+R  WPEY VP+EFKGI K+LP VSFSSKKL  MGFQFKY+LE
Sbjct  254  RYICSSHDATIYDLAKMMREKWPEYNVPTEFKGIPKDLPNVSFSSKKLIGMGFQFKYSLE  313

Query  722  DMYKGAIETLRKKGLLPYSTKEPAD  796
            DM++GAI+T R+KGLLPYS +  A+
Sbjct  314  DMFRGAIDTCREKGLLPYSNETTAN  338



>gb|AHK23093.1| dihydroflavonol 4-reductase [Vaccinium corymbosum]
Length=345

 Score =   365 bits (938),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 183/265 (69%), Positives = 221/265 (83%), Gaps = 3/265 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+LSII SC KAKTVK+LVFTSS   V
Sbjct  77   EAIEGCVGVFHVATPMDFESKDPENEVIKPTINGVLSIIKSCTKAKTVKRLVFTSSAGTV  136

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E QQ  YDE++WSDLDF+Y  KM GWMYF SKTLAEK AW+AAKE  I+FISIIP L
Sbjct  137  NVQEHQQPVYDENNWSDLDFVYKIKMTGWMYFVSKTLAEKAAWEAAKENNIDFISIIPTL  196

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF++PTFP SL+TALSPI    GN  H++IIKQG+FVHLDDLCE+ I+L++HP+A G
Sbjct  197  VVGPFIMPTFPPSLITALSPI---TGNEPHYSIIKQGQFVHLDDLCESHIYLFEHPEAEG  253

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATI+D+AKM+R  WPEY VP+EFKGI K+LP VSFSSKKL  MGFQFKY+LE
Sbjct  254  RYICSSHDATIYDLAKMMREKWPEYNVPTEFKGIPKDLPNVSFSSKKLIGMGFQFKYSLE  313

Query  722  DMYKGAIETLRKKGLLPYSTKEPAD  796
            DM++GAI+T R+KGLLPYS +  A+
Sbjct  314  DMFRGAIDTCREKGLLPYSNETTAN  338



>emb|CAC88859.1| dihydroflavonol reductase [Rhododendron simsii]
Length=344

 Score =   363 bits (932),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 182/265 (69%), Positives = 219/265 (83%), Gaps = 3/265 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+LSII SC KAKTVK+LVFTSS   V
Sbjct  77   EAIEGCFGVFHVATPMDFESKDPENEVIKPTINGVLSIIKSCTKAKTVKRLVFTSSAGTV  136

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E QQ  YDE++WSDLDFI   KM GWMYF SKTLAEK AW AAKE  I+FISIIP L
Sbjct  137  NVQEHQQPVYDENNWSDLDFINEKKMTGWMYFVSKTLAEKAAWDAAKENNIDFISIIPVL  196

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF++PTFP SLVTALSPI    GN  H++IIKQG+FVHLDDLCE+ IFL++HP+A G
Sbjct  197  VVGPFIMPTFPPSLVTALSPI---TGNEPHYSIIKQGQFVHLDDLCESHIFLFEHPEAEG  253

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATI+D+AKM+R  WPEY VP+EFKGI+K++P VSFSS+KL  MGF+FKY+LE
Sbjct  254  RYICSSHDATIYDLAKMMREKWPEYNVPTEFKGIDKDIPKVSFSSEKLIGMGFKFKYSLE  313

Query  722  DMYKGAIETLRKKGLLPYSTKEPAD  796
            DM++GAI+T R+KGLLPYS    A+
Sbjct  314  DMFRGAIDTCREKGLLPYSNATTAN  338



>gb|AAX12420.1| dihydroflavonol 4-reductase [Vaccinium macrocarpon]
Length=353

 Score =   363 bits (932),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 182/264 (69%), Positives = 220/264 (83%), Gaps = 3/264 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+LSII SC KAKTVK+LVFTSS   V
Sbjct  77   EAIEGCVGVFHVATPMDFESKDPENEVIKPTINGVLSIIKSCTKAKTVKRLVFTSSAGTV  136

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E QQ  +DE++WSDLDFIY  KM GWMYF SKTLAEK AW+AAKE  I+FISIIP L
Sbjct  137  NVQEHQQPTFDENNWSDLDFIYKIKMTGWMYFVSKTLAEKAAWEAAKENNIDFISIIPTL  196

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF++PTFP SL+TALSPI    GN  H++IIKQG+FVHLDDLCE+ I+L++HP+A G
Sbjct  197  VVGPFIMPTFPPSLITALSPI---TGNEPHYSIIKQGQFVHLDDLCESHIYLFEHPEAEG  253

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATI+D+AK++R  WPEY VP+EFKGI K+LP VSFSSKKL  MGFQFKY+LE
Sbjct  254  RYICSSHDATIYDLAKIMREKWPEYNVPTEFKGIPKDLPNVSFSSKKLIGMGFQFKYSLE  313

Query  722  DMYKGAIETLRKKGLLPYSTKEPA  793
            DM++GAI+T R+KGLLPYS +  A
Sbjct  314  DMFRGAIDTCREKGLLPYSNETTA  337



>dbj|BAA84939.1| dihydroflavonol 4-reductase [Camellia sinensis]
 dbj|BAA84940.1| dihydroflavonol 4-reductase [Camellia sinensis]
Length=347

 Score =   362 bits (929),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 180/262 (69%), Positives = 218/262 (83%), Gaps = 3/262 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+LSII SC KAKTVK+LVFTSS   V
Sbjct  81   EAIEGCSGVFHVATPMDFESKDPENEVIKPTINGVLSIIRSCTKAKTVKRLVFTSSAGTV  140

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E QQ  +DE++WSDLDFI   KM GWMYF SKTLAEK AW+AAKE  I+FISIIP L
Sbjct  141  NVQEHQQPVFDENNWSDLDFINKKKMTGWMYFVSKTLAEKAAWEAAKENNIDFISIIPTL  200

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF++PTFP SL+TALSPI    G   H++IIKQG+FVHLDDLCE+ IFLY+ P+A G
Sbjct  201  VVGPFIMPTFPPSLITALSPITRNEG---HYSIIKQGQFVHLDDLCESHIFLYERPQAEG  257

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATIHD+AK++R  WPEY VP+EFKGI+K+LP+VSFSSKKL  MGF+FKY+LE
Sbjct  258  RYICSSHDATIHDLAKLMREKWPEYNVPTEFKGIDKDLPVVSFSSKKLIGMGFEFKYSLE  317

Query  722  DMYKGAIETLRKKGLLPYSTKE  787
            DM++GAI+T R+KGLLP+S  E
Sbjct  318  DMFRGAIDTCREKGLLPHSFAE  339



>gb|AAT84073.1| dihydroflavonol 4-reductase [Camellia sinensis]
Length=347

 Score =   362 bits (929),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 180/262 (69%), Positives = 218/262 (83%), Gaps = 3/262 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+LSII SC KAKTVK+LVFTSS   V
Sbjct  81   EAIEGCSGVFHVATPMDFKSKDPENEVIKPTINGVLSIIRSCTKAKTVKRLVFTSSAGTV  140

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E QQ  +DE++WSDLDFI   KM GWMYF SKTLAEK AW+AAKE  I+FISIIP L
Sbjct  141  NVQEHQQPVFDENNWSDLDFINKKKMTGWMYFVSKTLAEKAAWEAAKENNIDFISIIPTL  200

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF++PTFP SL+TALSPI    G   H++IIKQG+FVHLDDLCE+ IFLY+ P+A G
Sbjct  201  VVGPFIMPTFPPSLITALSPITRNEG---HYSIIKQGQFVHLDDLCESHIFLYERPQAEG  257

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATIHD+AK++R  WPEY VP+EFKGI+K+LP+VSFSSKKL  MGF+FKY+LE
Sbjct  258  RYICSSHDATIHDLAKLMREKWPEYNVPTEFKGIDKDLPVVSFSSKKLIGMGFEFKYSLE  317

Query  722  DMYKGAIETLRKKGLLPYSTKE  787
            DM++GAI+T R+KGLLP+S  E
Sbjct  318  DMFRGAIDTCREKGLLPHSFAE  339



>gb|AFC37249.1| dihydroflavonol4-reductase [Camellia chekiangoleosa]
Length=347

 Score =   360 bits (924),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 180/262 (69%), Positives = 217/262 (83%), Gaps = 3/262 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+LSII SC KAKTVK+LVFTSS   V
Sbjct  81   EAIEGCSGVFHVATPMDFESKDPENEVIKPTINGVLSIIRSCTKAKTVKRLVFTSSAGTV  140

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E QQ  +DE++WSDLDFI   KM GWMYF SKTLAEK AW+AAKE  I+FISIIP L
Sbjct  141  NVQEHQQPIFDENNWSDLDFINEKKMTGWMYFVSKTLAEKAAWEAAKENNIDFISIIPTL  200

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF++PTFP SL+TALSPI    G   H++IIKQG+FVHLDDLCE+ IFLY+HP+A G
Sbjct  201  VVGPFIMPTFPPSLITALSPITRNEG---HYSIIKQGQFVHLDDLCESHIFLYEHPQAEG  257

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATIHD+AK++R  WPEY VP+EFKGI+K+LP+VSFSSKKL  MGF+FKY+LE
Sbjct  258  RYICSSHDATIHDLAKLMREKWPEYNVPTEFKGIDKDLPVVSFSSKKLIGMGFEFKYSLE  317

Query  722  DMYKGAIETLRKKGLLPYSTKE  787
            DM++ AI+T R+KGLLP S  E
Sbjct  318  DMFREAIDTCREKGLLPQSFAE  339



>gb|AIY51701.1| dihydroflavonol 4-reductase [Penstemon barbatus]
Length=383

 Score =   361 bits (927),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 173/275 (63%), Positives = 223/275 (81%), Gaps = 4/275 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GCEGVFH+A  + F S DPENEVIKP + G+LSII SC KAKTVK+L+FT+S   +
Sbjct  77   EAIQGCEGVFHLATPMEFDSPDPENEVIKPTIDGMLSIIRSCVKAKTVKRLIFTTSAGTL  136

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E Q+ EYDE+SWSDLDF+Y+ KM GWMYF SK LAEK A   AKE  IEFISIIPP+
Sbjct  137  NVEEHQKPEYDETSWSDLDFMYSKKMTGWMYFVSKILAEKAALGPAKENNIEFISIIPPV  196

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKA-G  538
            V+GP + PTFP SL+TALSPI    GN  H++IIKQG+FVHLDD+ EA IFL+++PKA G
Sbjct  197  VVGPSITPTFPPSLITALSPI---TGNEAHYSIIKQGQFVHLDDISEAHIFLFEYPKAEG  253

Query  539  GRFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTL  718
            GR+ICSSH ATI+D+A +I+  WPEYY+P+EF+GI+K++P+V FSSKKL +MGF+FKYTL
Sbjct  254  GRYICSSHDATIYDIANLIKEKWPEYYIPTEFEGIDKDIPVVRFSSKKLMDMGFKFKYTL  313

Query  719  EDMYKGAIETLRKKGLLPYSTKEPADIEQEQHSGK  823
            EDM++ AIE+ R+KGL PYST+  ++ E+++   K
Sbjct  314  EDMFREAIESCREKGLFPYSTQNRSNGEEKETDSK  348



>dbj|BAA19658.1| dihydroflavonol 4-reductase [Perilla frutescens]
Length=456

 Score =   363 bits (932),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 181/280 (65%), Positives = 224/280 (80%), Gaps = 11/280 (4%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EA+ GCE VFH+A  ++F S DPENEVIKP V G+LSI+ SC KAKTVKKL+FT+S   +
Sbjct  80   EAVQGCECVFHMATPMDFESDDPENEVIKPTVDGMLSIMRSCTKAKTVKKLIFTNSAGTL  139

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E Q+  Y+E++WSDLDFIY+ KM GWMYF SK LAEKEA KAAKE  I FISIIPP+
Sbjct  140  NVEEHQKPVYNEANWSDLDFIYSKKMTGWMYFVSKILAEKEAMKAAKESNINFISIIPPV  199

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF +PTFP SL+TALSPI    GN  H++IIKQG+FVH+DDLCEA IFL++HP A G
Sbjct  200  VVGPFFMPTFPPSLITALSPI---TGNEAHYSIIKQGQFVHVDDLCEAHIFLFEHPAAEG  256

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATI+D+AKMI  NWPEY+VP+EF+GI K++ +VSFSSKKL +MGF FKYTLE
Sbjct  257  RYICSSHDATIYDIAKMIGENWPEYHVPTEFEGIHKDIAVVSFSSKKLVDMGFSFKYTLE  316

Query  722  DMYKGAIETLRKKGLLPYST--------KEPADIEQEQHS  817
            DMY+GAIE+ R+KG+LP+ST        KE     QE+HS
Sbjct  317  DMYRGAIESCREKGMLPFSTQIHTNGENKESLSNSQEKHS  356



>gb|ABS84871.1| dihydroflavonol-4-reductase [Linaria sp. JA-2007]
Length=413

 Score =   362 bits (928),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 175/269 (65%), Positives = 219/269 (81%), Gaps = 3/269 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GCEGVFH+A ++ F S DPENEVIKP ++G+L+II SC KAKTVKK +FT+S   V
Sbjct  97   EAIQGCEGVFHLATSMEFESLDPENEVIKPTIEGMLNIIRSCVKAKTVKKFIFTTSGGTV  156

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E Q+  YDE+  SDLDFIY+ KM GWMYF SK LAEK+  +AAK   I+FISIIPPL
Sbjct  157  NVEEHQKPVYDETDSSDLDFIYSKKMTGWMYFVSKILAEKDGMEAAKASNIDFISIIPPL  216

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF++PTFP SL+TALSPI    GN  H++IIKQG+FVHLDDLCE  IFL+++PKA G
Sbjct  217  VVGPFIMPTFPPSLITALSPI---TGNEAHYSIIKQGQFVHLDDLCEGHIFLFEYPKAEG  273

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATI+D+A++IR NWPEY +P EF+GI+K +P+VSFSSKK+  MGF+FKYTL 
Sbjct  274  RYICSSHDATIYDLARLIRENWPEYQIPDEFEGIDKNIPVVSFSSKKMLGMGFKFKYTLL  333

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQE  808
            DM+KGAI+T R+KGLLPYSTK     E+E
Sbjct  334  DMFKGAIDTCREKGLLPYSTKSNMGEEKE  362



>emb|CAA70345.1| dihydroflavonol reductase [Forsythia x intermedia]
Length=371

 Score =   360 bits (924),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 180/265 (68%), Positives = 219/265 (83%), Gaps = 3/265 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GCEGVFHVA  ++F SKDPENEVIKP ++G LS+I SC KAKTVK++VFTSS   V
Sbjct  78   EAIQGCEGVFHVATPMDFESKDPENEVIKPTIEGFLSLIRSCTKAKTVKRIVFTSSAGTV  137

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E Q+  YDE+ +SDL+FIY+ KM GWMYFASK LAEK AW+AAKE  I FISIIP L
Sbjct  138  NVEEHQKSVYDETDYSDLNFIYSKKMTGWMYFASKILAEKVAWEAAKENSIGFISIIPTL  197

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF++PTFP SL+TALSPI    GN  H++II Q ++VHLDDLCEA IFLY++P A G
Sbjct  198  VVGPFIMPTFPPSLITALSPI---TGNEAHYSIIDQCQYVHLDDLCEAHIFLYEYPNAEG  254

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATI+DVAKMIR  WP+Y +P+EF+GI K++P+VSFSSKKL  MGF FKYTLE
Sbjct  255  RYICSSHDATIYDVAKMIRDKWPKYDIPTEFEGIGKDIPVVSFSSKKLIGMGFTFKYTLE  314

Query  722  DMYKGAIETLRKKGLLPYSTKEPAD  796
            DMY+GAIET R+KGLLPYST+  A+
Sbjct  315  DMYRGAIETCREKGLLPYSTRNQAN  339



>ref|XP_011083203.1| PREDICTED: LOW QUALITY PROTEIN: dihydroflavonol-4-reductase-like 
[Sesamum indicum]
Length=381

 Score =   360 bits (924),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 177/261 (68%), Positives = 217/261 (83%), Gaps = 3/261 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GCEGVFH+A  ++F S DPENEVIKP V+G+LSII SCAKAKTVKKL+FT+S   +
Sbjct  80   EAIQGCEGVFHLATPMDFESNDPENEVIKPTVEGMLSIIRSCAKAKTVKKLIFTNSAGTL  139

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E Q+  Y ES+WSDLDFI + KM GWMYF SK LAEK A +AAKE  I FISIIPP+
Sbjct  140  NVEEHQKPVYYESNWSDLDFINSKKMTGWMYFVSKILAEKAAIEAAKENNINFISIIPPV  199

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF +PTFP SL+TALSPI    GN  H++IIKQG+FVH+DDLCEA IFL++HP A G
Sbjct  200  VVGPFTMPTFPPSLITALSPI---TGNEAHYSIIKQGQFVHVDDLCEAHIFLFEHPTAEG  256

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATI+ +A MIR  WPEY++P+EF+GI+K++P+VSFSSKKL EMGF FKYTLE
Sbjct  257  RYICSSHDATIYGLANMIREKWPEYHIPTEFEGIDKDIPVVSFSSKKLMEMGFMFKYTLE  316

Query  722  DMYKGAIETLRKKGLLPYSTK  784
            DM++ AIET R+KGLLPYST+
Sbjct  317  DMFREAIETCREKGLLPYSTQ  337



>gb|AIY51700.1| dihydroflavonol 4-reductase [Penstemon neomexicanus]
Length=383

 Score =   360 bits (924),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 175/275 (64%), Positives = 224/275 (81%), Gaps = 4/275 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GCEGVFH+A  + F S DPENEVIKP + G+LSII SC KAKTVKKL+FT+S   +
Sbjct  77   EAIQGCEGVFHLATPMEFDSLDPENEVIKPTIDGMLSIIRSCVKAKTVKKLIFTTSAGTL  136

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E ++ EYDE+SWSDLDFIY+ KM GWMYF SK LAEK A   AKE  IEFISIIPP+
Sbjct  137  NVEEHKKPEYDETSWSDLDFIYSKKMTGWMYFVSKFLAEKAASGPAKENNIEFISIIPPV  196

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKA-G  538
            V+GP +  TFP SL+TALSPI    GN  H++IIKQG+FVHLDD+ EA IFL+++PKA G
Sbjct  197  VVGPSITQTFPPSLITALSPI---TGNEAHYSIIKQGQFVHLDDISEAHIFLFEYPKAEG  253

Query  539  GRFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTL  718
            GR+ICSSH ATI+D+AK+I+  WPEYY+P+EF+GI+K++P+V FSSKKL +MGF+FKYTL
Sbjct  254  GRYICSSHDATIYDIAKLIKEKWPEYYIPTEFEGIDKDIPVVRFSSKKLMDMGFKFKYTL  313

Query  719  EDMYKGAIETLRKKGLLPYSTKEPADIEQEQHSGK  823
            EDM++ AIE+ R+KGLLPYST+  ++ E+++   K
Sbjct  314  EDMFREAIESCREKGLLPYSTQNRSNGEEKETDSK  348



>gb|AAD56578.1|AF184271_1 dihydroflavonol 4-reductase [Daucus carota]
Length=380

 Score =   358 bits (920),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 181/296 (61%), Positives = 228/296 (77%), Gaps = 12/296 (4%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            +A+ GC  VFH+A  ++  S+DPENEVIKP V+G+L II +CAKAKTVKKL++TSS   V
Sbjct  73   DAVKGCHAVFHMATPMDIESQDPENEVIKPTVQGVLDIITACAKAKTVKKLIYTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E Q   YDES+WSD+DFIY+ KM  WMYF SK+LAEK AW+AA+E  I+FISIIP L
Sbjct  133  NVREHQLPVYDESNWSDMDFIYSTKMTAWMYFVSKSLAEKAAWQAAEENNIQFISIIPTL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP SL+TALSP+    GN  H++IIKQ ++VHLDDLCE+QIFLY+HP A G
Sbjct  193  VVGPFISPTFPPSLITALSPL---TGNEAHYSIIKQCQYVHLDDLCESQIFLYEHPTAQG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATIHDV K+IR  WPEY VP+EFKGIEK+LP++SFSSKKL +MGF FKY LE
Sbjct  250  RYICSSHDATIHDVVKLIREKWPEYNVPTEFKGIEKDLPVISFSSKKLTDMGFTFKYNLE  309

Query  722  DMYKGAIETLRKKGLLPYSTK-EPADIEQ--------EQHSGKEPKS*HEWIGRES  862
            DM+KGAIET R+KGLLP ST  +  D E+        + H+G E    H  I +++
Sbjct  310  DMFKGAIETCREKGLLPNSTTLQENDQEKKYLFSATDDHHNGHEKDLFHHSIDKDA  365



>gb|ACK57789.1| dihydroflavonol reductase [Centaurea maculosa]
Length=344

 Score =   356 bits (914),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 175/260 (67%), Positives = 214/260 (82%), Gaps = 3/260 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EA+ GC GVFHVA  ++F SKDPENE+IKP ++G+LSII SC KAKTVKKLV+TSS   V
Sbjct  74   EAVEGCHGVFHVATPMDFESKDPENEIIKPTIQGVLSIIRSCVKAKTVKKLVYTSSAGTV  133

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E Q   YDES+WSDLDFIY+ KM  WMYF SKTLAEK AWKA  E  I+FISIIP L
Sbjct  134  NVEEHQLPVYDESNWSDLDFIYSKKMTAWMYFVSKTLAEKAAWKATTENNIDFISIIPTL  193

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ P+FP SL+TALS I    G   H++IIKQG++VHLDDLCE+ I+LY+HPKA G
Sbjct  194  VVGPFITPSFPPSLITALSLIN---GAESHYSIIKQGQYVHLDDLCESHIYLYEHPKATG  250

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATIH +AKM++  WPEY++P++F GI+KE PIVSFSSKKL EMGF+FKY LE
Sbjct  251  RYICSSHDATIHQLAKMLKEKWPEYHIPNQFPGIDKEPPIVSFSSKKLTEMGFEFKYNLE  310

Query  722  DMYKGAIETLRKKGLLPYST  781
            DM+KGAI++ R+KGLLPYST
Sbjct  311  DMFKGAIDSCREKGLLPYST  330



>gb|AAT66505.1| dihydroflavonol 4-reductase [Camellia sinensis]
Length=347

 Score =   356 bits (913),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 179/262 (68%), Positives = 216/262 (82%), Gaps = 3/262 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+LSII SC KAKTVK+LVFTSS   V
Sbjct  81   EAIEGCSGVFHVATPMDFESKDPENEVIKPTINGVLSIIRSCTKAKTVKRLVFTSSAGTV  140

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E QQ  +DE++WSDL FI   KM GWMYF SKTLAEK AW+AAKE  I+FISIIP L
Sbjct  141  NVQEHQQPVFDENNWSDLHFINKKKMTGWMYFVSKTLAEKAAWEAAKENNIDFISIIPTL  200

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V GPF++PTFP SL+TALSPI    G   H++IIKQG+FVHLDDLCE+ IFLY+ P+A G
Sbjct  201  VGGPFIMPTFPPSLITALSPITRNEG---HYSIIKQGQFVHLDDLCESHIFLYERPQAEG  257

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATIHD+AK++R  WPEY VP+EFKGI+K+LP+VSFSSKKL  MGF+FKY+LE
Sbjct  258  RYICSSHDATIHDLAKLMREKWPEYNVPTEFKGIDKDLPVVSFSSKKLIGMGFEFKYSLE  317

Query  722  DMYKGAIETLRKKGLLPYSTKE  787
            DM++GAI+T R+KGLLP+S  E
Sbjct  318  DMFRGAIDTCREKGLLPHSFAE  339



>gb|AAR01565.1| dihydroflavonol/flavonone-4-reductase like protein [Sinningia 
cardinalis]
Length=358

 Score =   356 bits (913),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 174/269 (65%), Positives = 221/269 (82%), Gaps = 3/269 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC+GVFHVA  ++F  KDPEN+VIKP ++G+LSII +CAKAKTV++LVFTS+  A+
Sbjct  78   EAIQGCQGVFHVATPMDFQCKDPENDVIKPTIEGVLSIIRTCAKAKTVRRLVFTSTAGAL  137

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            ++ E ++  YDE++WSDLDFIY+ KM GWMYFASK LAEK AW+AAKE  I+ +SIIP L
Sbjct  138  NVAEQRKSVYDENNWSDLDFIYSKKMTGWMYFASKVLAEKAAWEAAKEYNIDLVSIIPTL  197

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+G F  PTFP SL+TAL+PI    GN  H+ IIKQG++VHLDDLCEA IFL++ PKA G
Sbjct  198  VVGQFNTPTFPPSLITALAPI---TGNESHYWIIKQGQYVHLDDLCEAHIFLFEEPKAEG  254

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATI+D+A MIR  WPEY +P+EF+GI+K++P+V FSSKKL EMGF FKYT E
Sbjct  255  RYICSSHDATIYDLANMIRDKWPEYNIPTEFEGIDKDIPLVRFSSKKLVEMGFTFKYTFE  314

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQE  808
            DMY+GAIET R+KG+LPYST+  ++ +QE
Sbjct  315  DMYRGAIETCREKGMLPYSTQICSNGDQE  343



>gb|AHJ80979.1| dihydroflavanone reductase [Erythranthe lewisii]
Length=463

 Score =   358 bits (920),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 173/261 (66%), Positives = 217/261 (83%), Gaps = 3/261 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EA+ GCE VFH+A  ++F S+DPENEVIKP ++G++SII SCAKAKTVKKL+FT+S   +
Sbjct  80   EAVQGCECVFHMATPMDFESEDPENEVIKPTIEGMMSIIRSCAKAKTVKKLIFTNSAGTL  139

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++  Q+  YDE++WSDLDFI + KM GWMYF SK LAEKEA KAAKE  I FISIIPP+
Sbjct  140  NVEPNQKPVYDETNWSDLDFILSTKMTGWMYFVSKILAEKEAMKAAKESNINFISIIPPV  199

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF++PT P SL+TALSPI    GN  H++IIKQG+FVH+DDLCEA IFL++ P A G
Sbjct  200  VVGPFIMPTMPPSLITALSPI---TGNEAHYSIIKQGQFVHVDDLCEAHIFLFEDPTAQG  256

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATI+D+A MIR  WPEY +P+EF+GI+K++P+VSFSSKKL EMGF FKYTLE
Sbjct  257  RYICSSHDATIYDIANMIRDKWPEYSIPTEFEGIDKDIPVVSFSSKKLTEMGFSFKYTLE  316

Query  722  DMYKGAIETLRKKGLLPYSTK  784
            DM++ AIET R+KGLLPYST+
Sbjct  317  DMFREAIETCREKGLLPYSTQ  337



>gb|ABP57077.1| dihydroflavonol 4-reductase [Solenostemon scutellarioides]
 gb|ABP57078.1| dihydroflavonol 4-reductase [Solenostemon scutellarioides]
Length=366

 Score =   355 bits (910),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 172/281 (61%), Positives = 222/281 (79%), Gaps = 11/281 (4%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EA+ GC GVFH+A  ++F S DPENEVIKP V G++SI+ SCAKAKTVKKL+FT+S   +
Sbjct  76   EAVQGCIGVFHMATPMDFESDDPENEVIKPTVDGMMSIMRSCAKAKTVKKLIFTNSAGTL  135

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E Q+  YDE++WSDLDFIY+ KM GWMYF SK LAEK A +AAK+  I FISIIPP+
Sbjct  136  NVEEHQKPVYDETNWSDLDFIYSKKMTGWMYFVSKILAEKAAMEAAKQDNINFISIIPPV  195

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF +PTFP SL+TALSPI    GN  H++IIKQG+FVH+DDLCEA IFL++HPKA G
Sbjct  196  VVGPFFMPTFPPSLITALSPI---TGNDAHYSIIKQGQFVHVDDLCEAHIFLFEHPKAEG  252

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATI+D+A M+R  WPEY++P++F+GI+K++P+V FSSKKL EMGF FKY+LE
Sbjct  253  RYICSSHDATIYDIADMLREKWPEYHIPTQFEGIDKDIPVVRFSSKKLVEMGFSFKYSLE  312

Query  722  DMYKGAIETLRKKGLLPYST--------KEPADIEQEQHSG  820
            DM++ AI++ R+KG LP+ T        KE     QE+HS 
Sbjct  313  DMFREAIDSCREKGFLPFDTQIHNNGENKESILSSQEKHSN  353



>gb|AER40962.1| dihydroflavonol 4-reductase [Saussurea involucrata]
Length=342

 Score =   351 bits (901),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 174/260 (67%), Positives = 213/260 (82%), Gaps = 3/260 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EA+ GC GVFHVA  ++F SKDPENE+IKP ++G+LSII SC KAKTVKKLVFTSS   V
Sbjct  74   EAVEGCHGVFHVATPMDFESKDPENEIIKPTIQGVLSIIRSCVKAKTVKKLVFTSSAGTV  133

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E Q   Y+ES WSDLDFIY+ KM  WMYF SKTLAEK AW+A KE  IEFISIIP L
Sbjct  134  NVQEHQLPVYNESDWSDLDFIYSKKMTAWMYFVSKTLAEKAAWEATKENNIEFISIIPTL  193

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ P+FP SL+TALS I    G   H++IIKQG++VHLDDLCE  I+LY++P+A G
Sbjct  194  VVGPFITPSFPPSLITALSLIN---GAESHYSIIKQGQYVHLDDLCECHIYLYENPRAKG  250

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATIH +A+M++  WPEY+VP++F GI+KE PIVSFSSKKL EMGF+FKY LE
Sbjct  251  RYICSSHDATIHQLARMMKKKWPEYHVPNQFPGIDKEPPIVSFSSKKLTEMGFEFKYDLE  310

Query  722  DMYKGAIETLRKKGLLPYST  781
            DM+KGAI++ R+KGLLPYST
Sbjct  311  DMFKGAIDSCREKGLLPYST  330



>gb|ABU93477.1| dihydroflavonol 4-reductase [Helianthus annuus]
Length=355

 Score =   352 bits (902),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 175/264 (66%), Positives = 215/264 (81%), Gaps = 7/264 (3%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENE+IKP V+G+LSI+ SCAKAKTVKKLVFTSS   V
Sbjct  74   EAIEGCHGVFHVATPMDFESKDPENEIIKPTVQGVLSIVRSCAKAKTVKKLVFTSSAGTV  133

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E Q   YDES WSDLDFI + KM  WMYF SKTLAE+ AWKAA E  I+FISIIP L
Sbjct  134  NVQEKQLPVYDESHWSDLDFINSQKMTAWMYFVSKTLAERAAWKAAIENNIDFISIIPTL  193

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGL--HHNIIKQGKFVHLDDLCEAQIFLYQHPKA  535
            V+GPF+ P FP SL+TALS I     NG+  H++IIKQG+FVHLDDLCE  IFLY++P+A
Sbjct  194  VVGPFITPIFPPSLITALSLI-----NGMESHYSIIKQGQFVHLDDLCECHIFLYENPEA  248

Query  536  GGRFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYT  715
             GR+ICSSH ATIH +A+MI+  WPEY+VP++F GI++++P+VSFSSKKL +MGF+FKY 
Sbjct  249  KGRYICSSHDATIHQLARMIKEKWPEYHVPTQFVGIDEDIPVVSFSSKKLTDMGFEFKYN  308

Query  716  LEDMYKGAIETLRKKGLLPYSTKE  787
            LE+M+KGAI+  R+KGLLPYST E
Sbjct  309  LEEMFKGAIDCCREKGLLPYSTNE  332



>sp|P51103.1|DFRA_CALCH RecName: Full=Dihydroflavonol-4-reductase; Short=DFR; AltName: 
Full=Dihydrokaempferol 4-reductase [Callistephus chinensis]
 emb|CAA91922.1| dihydroflavonol 4-reductase [Callistephus chinensis]
Length=364

 Score =   352 bits (902),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 175/262 (67%), Positives = 214/262 (82%), Gaps = 3/262 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENE+IKP ++GILSII SCAKAKTVKKLV+TSS   V
Sbjct  74   EAIEGCHGVFHVATPMDFESKDPENEIIKPTIEGILSIIRSCAKAKTVKKLVYTSSAGTV  133

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++ETQ   YDES WSDLDFIY+ KM  WMYF SKTLAEK A +AAKE  I+F+SIIPPL
Sbjct  134  NVQETQLPVYDESHWSDLDFIYSKKMTAWMYFVSKTLAEKAAMEAAKENNIDFVSIIPPL  193

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP SL+TALS I    G   H++IIKQG++VHLDDLCE  IFLY++P+A G
Sbjct  194  VVGPFINPTFPPSLITALSLIN---GAESHYSIIKQGQYVHLDDLCECHIFLYENPEAKG  250

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICS   ATIH +A+MI+  WPEY+VP++F GI++ELP VSFSSKKL +MGF+FKY LE
Sbjct  251  RYICSKQDATIHQLARMIKQKWPEYHVPTQFAGIDEELPTVSFSSKKLIDMGFKFKYDLE  310

Query  722  DMYKGAIETLRKKGLLPYSTKE  787
            DM+KGAI++ ++KG LPYST E
Sbjct  311  DMFKGAIDSCKEKGFLPYSTNE  332



>gb|ABQ97018.1| dihydroflavonol 4-reductase [Saussurea medusa]
 gb|ABS11263.1| dihydroflavonol 4-reductase [Saussurea medusa]
Length=342

 Score =   350 bits (897),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 175/260 (67%), Positives = 212/260 (82%), Gaps = 3/260 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENE+IKP ++G+LSII SC KAKTVKKLVFTSS   V
Sbjct  74   EAIEGCHGVFHVATPMDFESKDPENEIIKPTIEGVLSIIRSCVKAKTVKKLVFTSSAGTV  133

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E Q   Y+E  WSDLDFIY+ KM  WMYF SKTLAEK AW+A KE  IEFISIIP L
Sbjct  134  NVQEHQLPVYNELDWSDLDFIYSKKMTAWMYFVSKTLAEKAAWEATKENNIEFISIIPTL  193

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ P+FP SL+TALS I    G   H++IIKQG++VHLDDLCE  I+LY++PKA G
Sbjct  194  VVGPFITPSFPPSLITALSLIN---GAESHYSIIKQGQYVHLDDLCECHIYLYENPKAKG  250

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATIH +A+M++  WPEY+VP++F GI+KE PIVSFSSKKL EMGF+FKY LE
Sbjct  251  RYICSSHDATIHQLARMMKKKWPEYHVPNQFPGIDKEPPIVSFSSKKLTEMGFEFKYDLE  310

Query  722  DMYKGAIETLRKKGLLPYST  781
            DM+KGAI++ R+KGLLPYST
Sbjct  311  DMFKGAIDSCREKGLLPYST  330



>sp|P51105.1|DFRA_GERHY RecName: Full=Dihydroflavonol-4-reductase; Short=DFR; AltName: 
Full=Dihydrokaempferol 4-reductase [Gerbera hybrid cultivar]
 emb|CAA78930.1| dihydroflavonol-4-reductase [Gerbera hybrid cultivar]
Length=366

 Score =   351 bits (900),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 176/260 (68%), Positives = 209/260 (80%), Gaps = 3/260 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFH+A  ++F SKDPENE+IKP ++G+LSII SC KAKTVKKLVFTSS   V
Sbjct  74   EAIQGCHGVFHLATPMDFESKDPENEIIKPTIEGVLSIIRSCVKAKTVKKLVFTSSAGTV  133

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            + +E Q   YDES WSDLDFIY+ KM  WMYF SKTLAEK AW A K   I FISIIP L
Sbjct  134  NGQEKQLHVYDESHWSDLDFIYSKKMTAWMYFVSKTLAEKAAWDATKGNNISFISIIPTL  193

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+  TFP SLVTALS I    GN  H++IIKQG++VHLDDLCE  I+LY++PKA G
Sbjct  194  VVGPFITSTFPPSLVTALSLI---TGNEAHYSIIKQGQYVHLDDLCECHIYLYENPKAKG  250

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATIH +AK+I+  WPEYY+P++F GI++ELPIVSFSSKKL + GF+FKY LE
Sbjct  251  RYICSSHDATIHQLAKIIKDKWPEYYIPTKFPGIDEELPIVSFSSKKLIDTGFEFKYNLE  310

Query  722  DMYKGAIETLRKKGLLPYST  781
            DM+KGAI+T R+KGLLPYST
Sbjct  311  DMFKGAIDTCREKGLLPYST  330



>dbj|BAA12736.1| dihydroflavonol-4-reductase [Gentiana triflora]
Length=359

 Score =   350 bits (898),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 174/273 (64%), Positives = 212/273 (78%), Gaps = 6/273 (2%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDP+NEVIKP + G LSII SC KAKTVKKLVFTSS   V
Sbjct  77   EAIHGCHGVFHVATPMDFESKDPKNEVIKPTIDGFLSIIRSCVKAKTVKKLVFTSSAGTV  136

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E Q+  YDE+ WSDLDFI + KM GWMYF SK LAEK AW+  K   I FISIIP L
Sbjct  137  DVQEQQKPVYDENDWSDLDFINSTKMTGWMYFVSKILAEKAAWEVTKANDIGFISIIPTL  196

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+  TFP SL+TALS I    GN  H+ IIKQG+FVHLDDLCEA IFLY+HP+A G
Sbjct  197  VVGPFITTTFPPSLITALSLI---TGNEAHYGIIKQGQFVHLDDLCEAHIFLYEHPEAEG  253

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH  TIHD+AKMIR NWPEYY+P++ KGI++++P+VSFSS KL ++GFQ+KYTLE
Sbjct  254  RYICSSHDTTIHDLAKMIRQNWPEYYIPTKLKGIDEDIPVVSFSSNKLIDLGFQYKYTLE  313

Query  722  DMYKGAIETLRKKGLLPYS---TKEPADIEQEQ  811
            DM++GAI+T ++K +LP S    KE  D E ++
Sbjct  314  DMFRGAIDTCKEKRMLPLSIGHQKESTDPEVDE  346



>emb|CDP01993.1| unnamed protein product [Coffea canephora]
Length=369

 Score =   350 bits (899),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 177/283 (63%), Positives = 222/283 (78%), Gaps = 13/283 (5%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EA  GCEGVFHVA  ++F SKDPENE+IKP + G L+II SC KAKTVK+LV+TSS   V
Sbjct  80   EATQGCEGVFHVATPMDFDSKDPENEIIKPTINGALNIIRSCVKAKTVKRLVYTSSAGTV  139

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E QQ  YDE++WSDLDFIY+ KM GWMYF SK LAEKEAW+ +K+  I+FISIIP L
Sbjct  140  NVQEHQQPVYDETNWSDLDFIYSTKMTGWMYFVSKLLAEKEAWEVSKQSNIDFISIIPTL  199

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF++PTFP SL+TALS I    GN  H++II+QG+FVH+DDLCEA IFLY+ P A G
Sbjct  200  VVGPFIMPTFPPSLITALSLI---TGNEAHYSIIRQGQFVHVDDLCEAHIFLYEDPTAEG  256

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATIHD+AK+I   WPEY +P E KG++K++P+VSFSSKKL   GFQ+KYTLE
Sbjct  257  RYICSSHDATIHDLAKLIAEKWPEYSIP-ELKGVDKDIPVVSFSSKKLVGKGFQYKYTLE  315

Query  722  DMYKGAIETLRKKGLLPYST--------KEPADI-EQEQHSGK  823
            DM++ AI+T R+KGLLPYST        KEP  +  ++Q SG+
Sbjct  316  DMFRAAIDTCREKGLLPYSTQGHENGKEKEPLPVANKDQASGQ  358



>gb|AHF58605.1| dihydroflavonol 4-reductase [Gerbera jamesonii]
Length=366

 Score =   350 bits (899),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 176/260 (68%), Positives = 210/260 (81%), Gaps = 3/260 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENE+IKP ++G+LSII SC KAKTVKKLVFTSS   V
Sbjct  74   EAIQGCHGVFHVATPMDFESKDPENEIIKPTIEGVLSIIRSCVKAKTVKKLVFTSSAXTV  133

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E Q   YDES WSDLDFIY+ KM  WMYF SKTLAEK AW A KE  I F+SIIP L
Sbjct  134  NVQEKQLHVYDESHWSDLDFIYSKKMTAWMYFVSKTLAEKAAWDATKENNISFLSIIPTL  193

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+  TFP SLVTALS I    GN  H++IIKQG++VHLDDLCE  I+LY++PKA G
Sbjct  194  VVGPFITSTFPPSLVTALSLI---TGNEAHYSIIKQGQYVHLDDLCECHIYLYENPKAKG  250

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATIH +AK+I+  WPEYY+P++F GI++E+PIVSFSSKKL + GF+FKY LE
Sbjct  251  RYICSSHDATIHQLAKIIKDKWPEYYIPTKFPGIDEEVPIVSFSSKKLIDTGFEFKYNLE  310

Query  722  DMYKGAIETLRKKGLLPYST  781
            DM KGAI+T R+KGLLPYST
Sbjct  311  DMXKGAIDTCREKGLLPYST  330



>dbj|BAF49318.1| dihydroflavonol 4-reductase [Lobelia erinus]
Length=330

 Score =   348 bits (892),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 173/260 (67%), Positives = 212/260 (82%), Gaps = 3/260 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENE+IKP V G+L II SCAKA TVK+L+FTSS   V
Sbjct  73   EAIEGCHGVFHVATPMDFESKDPENEIIKPTVAGVLGIIKSCAKANTVKRLIFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E Q   YDES+WSDLDFIY+ KM  WMYF SKTLAEK AW+AAKE  I+FISIIP L
Sbjct  133  NVQENQLPVYDESNWSDLDFIYSKKMTAWMYFVSKTLAEKAAWEAAKENNIDFISIIPTL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP SL+TALS I+   G   H++II+QG+FVH+DDLCE+ IFLY+ PKA G
Sbjct  193  VVGPFINPTFPPSLITALSLIL---GKEAHYSIIEQGQFVHIDDLCESHIFLYEDPKAEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATI+ +AKMI+  WPEY +P+E KGI+KELP++ FSSKKL  +GF+FKY+LE
Sbjct  250  RYICSSHDATIYQLAKMIKEKWPEYNIPTELKGIDKELPVICFSSKKLMGLGFKFKYSLE  309

Query  722  DMYKGAIETLRKKGLLPYST  781
            DM++GAIET R+KGLLP ST
Sbjct  310  DMFRGAIETCREKGLLPLST  329



>dbj|BAJ08042.1| dihydroflavonol 4-reductase [Cyclamen graecum]
Length=344

 Score =   348 bits (893),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 176/266 (66%), Positives = 216/266 (81%), Gaps = 3/266 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+LSII+SC KAK VKKLVFTSS   V
Sbjct  75   EAIQGCSGVFHVATPMDFESKDPENEVIKPTINGVLSIISSCVKAKIVKKLVFTSSAGTV  134

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             + E  + EY+ES WSDL+FI   KM GWMYF SKTLAEK AW+AAKE  IEFISIIP L
Sbjct  135  DVCEHGKPEYNESDWSDLEFINKIKMTGWMYFVSKTLAEKAAWEAAKENNIEFISIIPTL  194

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF++ +FP SL+TALSPI    GN  H+ IIKQG+FVHLDDLCE+ I+LY+HPKA G
Sbjct  195  VVGPFIMQSFPPSLITALSPI---TGNEGHYGIIKQGQFVHLDDLCESHIYLYEHPKAEG  251

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATI+++AKM++  WPEY +P+EFKGI++ LP V FSS+KL+ MGF+FKY+LE
Sbjct  252  RYICSSHEATIYELAKMLKEKWPEYNIPTEFKGIDENLPNVRFSSEKLKGMGFEFKYSLE  311

Query  722  DMYKGAIETLRKKGLLPYSTKEPADI  799
            DM++GAI+T R+KGLLP S++ PA I
Sbjct  312  DMFRGAIDTCREKGLLPCSSETPAAI  337



>dbj|BAF96943.1| dihydroflavonol 4-reductase [Rhododendron x pulchrum]
Length=265

 Score =   345 bits (885),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 174/249 (70%), Positives = 208/249 (84%), Gaps = 3/249 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+LSII SC KAKTVK+LVFTSS   V
Sbjct  20   EAIEGCFGVFHVATPMDFESKDPENEVIKPTINGVLSIIKSCTKAKTVKRLVFTSSAGTV  79

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E QQ  YDE++WSDLDFI   KM GWMYF SKTLAEK AW AAKE  I+FISIIP L
Sbjct  80   NVQEHQQPVYDENNWSDLDFINEKKMTGWMYFVSKTLAEKAAWDAAKENNIDFISIIPVL  139

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF++PTFP SLVTALSPI    GN  H++IIKQG+FVHLDDLCE+ IFL++HP+A G
Sbjct  140  VVGPFIMPTFPPSLVTALSPI---TGNEPHYSIIKQGQFVHLDDLCESHIFLFEHPEAEG  196

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATI+D+AKM+R  WPEY VP+EFKGI+K++P VSFSSKKL  MGF+FKY+LE
Sbjct  197  RYICSSHDATIYDLAKMMREKWPEYNVPTEFKGIDKDIPNVSFSSKKLIGMGFKFKYSLE  256

Query  722  DMYKGAIET  748
            DM++GAI+T
Sbjct  257  DMFRGAIDT  265



>gb|AEN69001.1| dihydroflavonol 4-reductase [Chrysanthemum x morifolium]
Length=374

 Score =   348 bits (894),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 174/262 (66%), Positives = 214/262 (82%), Gaps = 3/262 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENE+IKP + G+LSII SCAKAKTVKKLVFTSS   V
Sbjct  74   EAIEGCHGVFHVATPMDFESKDPENEIIKPTIDGVLSIIRSCAKAKTVKKLVFTSSAGTV  133

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            ++++ Q   YDES WSDLDFIY+ KM  WMYF SKTLAEK AWKA KE  I+FISIIP L
Sbjct  134  NVQKQQVPVYDESHWSDLDFIYSKKMTAWMYFVSKTLAEKAAWKATKENNIDFISIIPTL  193

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ P+FP SL+TALS I    G   H++IIKQ ++VHLDDLCE+ I+LY++PKA G
Sbjct  194  VVGPFISPSFPPSLMTALSLI---TGAESHYSIIKQCQYVHLDDLCESHIYLYENPKAAG  250

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATIH +AKMI+  WPEY VP++F+GI+ E+PIVSFSSKKL +MGF+FKY LE
Sbjct  251  RYICSSHDATIHQLAKMIKEKWPEYQVPTKFEGIDDEIPIVSFSSKKLTDMGFKFKYDLE  310

Query  722  DMYKGAIETLRKKGLLPYSTKE  787
            +M++GAI++ ++KGLLPYST E
Sbjct  311  EMFRGAIKSCKEKGLLPYSTNE  332



>gb|EYU31196.1| hypothetical protein MIMGU_mgv1a006799mg [Erythranthe guttata]
Length=431

 Score =   350 bits (899),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 167/261 (64%), Positives = 216/261 (83%), Gaps = 3/261 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EA+ GC+ VFH+A  ++F S+DPENEVIKP ++G++SII SCA+AKTVKKL+FT+S   +
Sbjct  81   EAVQGCQCVFHMATPMDFESEDPENEVIKPTIEGMMSIIESCARAKTVKKLIFTNSAGTL  140

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++  Q+  YDE++WSDLDFI + KM GWMYF SK LAEKEA +AAKE  I FISIIPP+
Sbjct  141  NVEPHQKPVYDETNWSDLDFILSTKMTGWMYFVSKILAEKEAMEAAKESNINFISIIPPV  200

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF++PT P SL+TALSPI    GN  H++IIKQG+FVH+DDLCEA IFL+++P A G
Sbjct  201  VVGPFIMPTMPPSLITALSPI---TGNEPHYSIIKQGQFVHVDDLCEAHIFLFENPNAHG  257

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R++CSSH ATI+D+A MIR NWPEY++P+EF+GI+K +P+V F SKKL  MGF FKYTLE
Sbjct  258  RYVCSSHDATIYDIANMIRDNWPEYHIPTEFEGIDKNIPVVRFLSKKLTGMGFSFKYTLE  317

Query  722  DMYKGAIETLRKKGLLPYSTK  784
            DM++ AIET R+KGLLPYST+
Sbjct  318  DMFREAIETCREKGLLPYSTQ  338



>dbj|BAB20075.1| dihydroflavonol 4-reductase [Torenia hybrid cultivar]
Length=349

 Score =   347 bits (891),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 170/260 (65%), Positives = 209/260 (80%), Gaps = 3/260 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EA+  CE VFH+A  ++F S DPENEVIKP V G+LSII SCAKA+TVK+L+FT+S   +
Sbjct  81   EAVGSCECVFHMATPMDFESDDPENEVIKPTVDGMLSIIRSCAKAQTVKRLIFTNSAGTL  140

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E Q+  YDES+WSDLDFIY+ KM GWMYF SK LAEK A KA KE  I+FISIIPP+
Sbjct  141  NVEEHQKPVYDESNWSDLDFIYSTKMTGWMYFVSKVLAEKAAIKACKENNIDFISIIPPV  200

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+I  +P SL+TALSPI    GN  H++IIKQG+FVH+DDLCEA IFL +HPK   
Sbjct  201  VVGPFIIDNWPPSLITALSPI---TGNEAHYSIIKQGQFVHVDDLCEAHIFLSEHPKTEE  257

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATI+D+A MIR  WPEY VP+EF+GI+K++P+V FSSKKL  MGF FKYTLE
Sbjct  258  RYICSSHDATIYDIANMIREKWPEYDVPTEFEGIDKDIPVVRFSSKKLMGMGFTFKYTLE  317

Query  722  DMYKGAIETLRKKGLLPYST  781
            DM++ AIET R KGLLPYS+
Sbjct  318  DMFREAIETCRDKGLLPYSS  337



>gb|ACA04005.1| dihydroflavonol-4-reductase [Diplacus aurantiacus]
Length=470

 Score =   351 bits (900),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 168/261 (64%), Positives = 213/261 (82%), Gaps = 3/261 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EA+ GCEGVFH+A  ++F S DPENEVIKP ++G++SII SCAKAKTVKKL+FT+S   +
Sbjct  81   EAVKGCEGVFHMATPMDFESDDPENEVIKPTIEGMMSIIRSCAKAKTVKKLIFTNSAGTL  140

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            ++++ Q+  YDE++WSDLDFI + KM GWMYF SK LAEK A +AAKE  I FISIIPP+
Sbjct  141  NVEQHQKPVYDETNWSDLDFILSTKMTGWMYFVSKILAEKAAIEAAKENNINFISIIPPV  200

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF++PTFP SL+TALSPI    GN  H++II+QG++VH+DDLCEA IFL++ P A G
Sbjct  201  VVGPFIMPTFPPSLITALSPI---TGNEAHYSIIRQGQYVHVDDLCEAHIFLFEDPTAEG  257

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH  TI+ +A MIR  WPEY +P+EF+GI+K++P+V FSSKKL  MGF +KYTLE
Sbjct  258  RYICSSHDETIYGIANMIREKWPEYQIPTEFEGIDKDIPVVRFSSKKLIGMGFSYKYTLE  317

Query  722  DMYKGAIETLRKKGLLPYSTK  784
            DM+ GAIET R KGLLPYSTK
Sbjct  318  DMFTGAIETCRAKGLLPYSTK  338



>sp|P14721.1|DFRA_ANTMA RecName: Full=Dihydroflavonol-4-reductase; Short=DFR; AltName: 
Full=Dihydrokaempferol 4-reductase [Antirrhinum majus]
 emb|CAA33543.1| unnamed protein product [Antirrhinum majus]
Length=446

 Score =   350 bits (898),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 170/269 (63%), Positives = 216/269 (80%), Gaps = 3/269 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GCEGVFH+A ++ F S DPENEVIKP + G+L+II SC +AKTVKK +FT+S   V
Sbjct  85   EAIQGCEGVFHLATSMEFDSVDPENEVIKPTIDGMLNIIKSCVQAKTVKKFIFTTSGGTV  144

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E Q+  YDE+  SD+DFI + KM GWMYF SK LAEK   +AAKE  I+FISIIPPL
Sbjct  145  NVEEHQKPVYDETDSSDMDFINSKKMTGWMYFVSKILAEKAGMEAAKENNIDFISIIPPL  204

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF++PTFP SL+TALSPI    GN  H++IIKQ ++VHLDDLCE  IFL+++PKA G
Sbjct  205  VVGPFIMPTFPPSLITALSPI---TGNEAHYSIIKQCQYVHLDDLCEGHIFLFEYPKAEG  261

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATI+D+AK+I  NWPEY++P EF+GI+K++P+VSFSSKK+  MGF FKYTLE
Sbjct  262  RYICSSHDATIYDIAKLITENWPEYHIPDEFEGIDKDIPVVSFSSKKMIGMGFIFKYTLE  321

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQE  808
            DM +GAI+T R+KG+LPYSTK     E+E
Sbjct  322  DMVRGAIDTCREKGMLPYSTKNNKGDEKE  350



>gb|ACA04004.1| dihydroflavonol-4-reductase [Diplacus aurantiacus]
Length=470

 Score =   350 bits (898),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 168/261 (64%), Positives = 213/261 (82%), Gaps = 3/261 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EA+ GCEGVFH+A  ++F S DPENEVIKP ++G++SII SCAKAKTVKKL+FT+S   +
Sbjct  81   EAVKGCEGVFHMATPMDFESDDPENEVIKPTIEGMMSIIRSCAKAKTVKKLIFTNSAGTL  140

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            ++++ Q+  YDE++WSDLDFI + KM GWMYF SK LAEK A +AAKE  I FISIIPP+
Sbjct  141  NVEQHQKPVYDETNWSDLDFILSTKMTGWMYFVSKILAEKAAIEAAKENNINFISIIPPV  200

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF++P+FP SL+TALSPI    GN  H++IIKQG++VH+DDLCEA IFL++ P A G
Sbjct  201  VVGPFIMPSFPPSLITALSPI---TGNEAHYSIIKQGQYVHVDDLCEAHIFLFEDPTAEG  257

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH  TI+ +A MIR  WPEY +P+EF+GI+K++P+V FSSKKL  MGF +KYTLE
Sbjct  258  RYICSSHDETIYGIANMIREKWPEYQIPTEFEGIDKDIPVVRFSSKKLIGMGFSYKYTLE  317

Query  722  DMYKGAIETLRKKGLLPYSTK  784
            DM+ GAIET R KGLLPYSTK
Sbjct  318  DMFTGAIETCRAKGLLPYSTK  338



>dbj|BAJ08043.1| dihydroflavonol 4-reductase [Cyclamen graecum]
Length=331

 Score =   344 bits (883),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 172/259 (66%), Positives = 205/259 (79%), Gaps = 3/259 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F S+DPE EVIKP + G+LSII SCAKAKTVKKLVFTSS   V
Sbjct  75   EAIQGCSGVFHVATPMDFESQDPEKEVIKPTIDGVLSIIKSCAKAKTVKKLVFTSSAGTV  134

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++ TQ+  YDES WSDLDFI A KM  WMYF SKTLAE  A +AAKE  I FISIIP L
Sbjct  135  NVQATQKSVYDESDWSDLDFIVAKKMTAWMYFVSKTLAELAAVEAAKENNINFISIIPTL  194

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF++PTFP SL+TALSPI    GN  H++IIKQG+FVHLDDLCEA IFLY+HP   G
Sbjct  195  VVGPFIMPTFPPSLITALSPI---TGNEAHYSIIKQGQFVHLDDLCEAHIFLYEHPMGEG  251

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH  TI+ +A M+R  WPEY VP+EF+GI+K+L  V FSS KL  +GF+FK +LE
Sbjct  252  RYICSSHDTTIYGLANMMREKWPEYNVPTEFEGIDKDLKSVCFSSNKLTGLGFEFKNSLE  311

Query  722  DMYKGAIETLRKKGLLPYS  778
            DM++GAI+T R+KGLLPYS
Sbjct  312  DMFRGAIDTCREKGLLPYS  330



>dbj|BAJ21535.1| dihydroflavonol 4-reductase [Dahlia pinnata]
Length=336

 Score =   344 bits (883),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 172/264 (65%), Positives = 213/264 (81%), Gaps = 7/264 (3%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENE+IKP ++GIL I+ SCAKAKTVKKLVFTSS   V
Sbjct  51   EAIEGCHGVFHVATPMDFESKDPENEIIKPTIEGILGIVRSCAKAKTVKKLVFTSSAGTV  110

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            + +E Q   YDES WSDLDFIY+ KM  WMYF SKTLAEK AWKA  E  I+FISIIP L
Sbjct  111  NAQEKQLPVYDESHWSDLDFIYSIKMTAWMYFVSKTLAEKAAWKATTEDNIDFISIIPTL  170

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGL--HHNIIKQGKFVHLDDLCEAQIFLYQHPKA  535
            V+GPF+ P+FP SL+TALS I     NG+  H++IIKQ ++VHLDDLCE  IFLY++P+A
Sbjct  171  VVGPFITPSFPPSLITALSLI-----NGMESHYSIIKQCQYVHLDDLCECHIFLYENPEA  225

Query  536  GGRFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYT  715
             GR+ICSSH ATIH +A+MI+  WPEY+VP++F GI+++L +VSFSSKKL +MGF+FKY 
Sbjct  226  KGRYICSSHDATIHQLARMIKEKWPEYHVPTQFVGIDEDLSVVSFSSKKLTDMGFEFKYD  285

Query  716  LEDMYKGAIETLRKKGLLPYSTKE  787
            LE+M+KGAI++ R+KGLLPYST +
Sbjct  286  LEEMFKGAIDSCREKGLLPYSTDD  309



>gb|ABK88311.2| dihydroflavonol 4-reductase [Chrysanthemum x morifolium]
Length=374

 Score =   345 bits (884),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 169/262 (65%), Positives = 214/262 (82%), Gaps = 3/262 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC+GVFHVA  ++F SKDPENE+IKP ++G+LSII SC KAKTVKKLVFTSS   V
Sbjct  74   EAIEGCQGVFHVATPMDFESKDPENEIIKPTIEGVLSIIRSCVKAKTVKKLVFTSSAGTV  133

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            ++++ Q   YDES WSDLDFIY+ KM  WMYF SK LAEK AWKA KE  I+F+SI+P L
Sbjct  134  NVQKQQAPVYDESHWSDLDFIYSKKMTAWMYFVSKILAEKAAWKATKENNIDFVSIVPTL  193

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ P+FP SL+TALS I    G   H++IIKQ ++VHLDDLCE+ I+LY++PKA G
Sbjct  194  VVGPFISPSFPPSLLTALSLI---TGAESHYSIIKQCQYVHLDDLCESHIYLYENPKAEG  250

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATIH +AKMI+  WPEY +P++F+GI+ E+PIVSFSSKKL +MGF+FKY LE
Sbjct  251  RYICSSHDATIHQLAKMIKEKWPEYQIPTKFEGIDDEIPIVSFSSKKLTDMGFKFKYDLE  310

Query  722  DMYKGAIETLRKKGLLPYSTKE  787
            +M++GAI++ ++KGLLPYST E
Sbjct  311  EMFRGAIKSCKEKGLLPYSTNE  332



>gb|ACO50430.1| dihydroflavonol 4-reductase [Dahlia pinnata]
Length=359

 Score =   344 bits (882),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 172/264 (65%), Positives = 213/264 (81%), Gaps = 7/264 (3%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENE+IKP ++GIL I+ SCAKAKTVKKLVFTSS   V
Sbjct  74   EAIEGCHGVFHVATPMDFESKDPENEIIKPTIEGILGIVRSCAKAKTVKKLVFTSSAGTV  133

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            + +E Q   YDES WSDLDFIY+ KM  WMYF SKTLAEK AWKA  E  I+FISIIP L
Sbjct  134  NAQEKQLPVYDESHWSDLDFIYSIKMTAWMYFVSKTLAEKAAWKATTEDNIDFISIIPTL  193

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGL--HHNIIKQGKFVHLDDLCEAQIFLYQHPKA  535
            V+GPF+ P+FP SL+TALS I     NG+  H++IIKQ ++VHLDDLCE  IFLY++P+A
Sbjct  194  VVGPFITPSFPPSLITALSLI-----NGMESHYSIIKQCQYVHLDDLCECHIFLYENPEA  248

Query  536  GGRFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYT  715
             GR+ICSSH ATIH +A+MI+  WPEY+VP++F GI+++L +VSFSSKKL +MGF+FKY 
Sbjct  249  KGRYICSSHDATIHQLARMIKEKWPEYHVPTQFVGIDEDLSVVSFSSKKLTDMGFEFKYD  308

Query  716  LEDMYKGAIETLRKKGLLPYSTKE  787
            LE+M+KGAI++ R+KGLLPYST +
Sbjct  309  LEEMFKGAIDSCREKGLLPYSTDD  332



>dbj|BAJ17657.1| dihydroflavonol reductase [Gynura bicolor]
Length=351

 Score =   344 bits (882),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 169/262 (65%), Positives = 213/262 (81%), Gaps = 3/262 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F +KDPENE+IKP ++G+LSII SC KAKTVKKLVFTSS   V
Sbjct  74   EAIKGCHGVFHVATPMDFETKDPENEMIKPTIEGVLSIIRSCVKAKTVKKLVFTSSAGTV  133

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++ETQ   YDES WSDLDFIY+ KM  WMYF SKTLAE+ AW+A KE  I+FISIIP  
Sbjct  134  NVQETQLPVYDESHWSDLDFIYSKKMTAWMYFVSKTLAERAAWEATKENNIDFISIIPTF  193

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ P+FP SL+TALS I +      H++IIKQG++VHLDDLCE+ I+LY++PKA G
Sbjct  194  VVGPFISPSFPPSLITALSLINEMES---HYSIIKQGQYVHLDDLCESHIYLYENPKAEG  250

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATIH +AKMI   WPEY+VP++F GI++E+PIVSFSSKKL + GF+FKY LE
Sbjct  251  RYICSSHDATIHQLAKMINEKWPEYHVPTQFVGIDEEVPIVSFSSKKLTDTGFKFKYDLE  310

Query  722  DMYKGAIETLRKKGLLPYSTKE  787
            +M+KGAI++ ++KG LPYST +
Sbjct  311  EMFKGAIDSCKEKGFLPYSTNK  332



>gb|ADC96612.1| dihydroflavonol 4-reductase [Chrysanthemum x morifolium]
Length=374

 Score =   344 bits (883),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 172/262 (66%), Positives = 211/262 (81%), Gaps = 3/262 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENE+IKP + G+LSII SC KAKTVKKLVFTSS   V
Sbjct  74   EAIEGCHGVFHVATPMDFESKDPENEIIKPTIDGVLSIIRSCVKAKTVKKLVFTSSAGTV  133

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            ++++ Q   YDES WSDLDFIY+ KM  WMYF SKTLAEK AWKA KE  I+FISIIP L
Sbjct  134  NVQKQQVPVYDESHWSDLDFIYSKKMTAWMYFVSKTLAEKAAWKATKENNIDFISIIPTL  193

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ P+FP SL+TALS I    G   H++I KQ ++VHLDDLCE+ I+LY+ PKA G
Sbjct  194  VVGPFISPSFPPSLMTALSLI---TGAESHYSITKQCQYVHLDDLCESHIYLYEQPKAEG  250

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATIH +AKMI+  WPEY VP++F+GI+ E+PIVSFSSKKL +MGF+FKY LE
Sbjct  251  RYICSSHDATIHQLAKMIKEKWPEYQVPAKFEGIDDEIPIVSFSSKKLTDMGFKFKYDLE  310

Query  722  DMYKGAIETLRKKGLLPYSTKE  787
            +M++GAI++ ++KGLLPYST E
Sbjct  311  EMFRGAIKSCKEKGLLPYSTNE  332



>gb|ABK88310.2| dihydroflavonol 4-reductase [Chrysanthemum x morifolium]
Length=374

 Score =   344 bits (882),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 172/262 (66%), Positives = 213/262 (81%), Gaps = 3/262 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENE+IKP ++G+LSII SC KAKTVKKLVFTSS   V
Sbjct  74   EAIEGCHGVFHVATPMDFESKDPENEIIKPTIEGVLSIIRSCVKAKTVKKLVFTSSAGTV  133

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            ++++ Q   YDES WSDLDFIY+ KM  WMYF S+TLAEK AWKA KE  I+FISIIP L
Sbjct  134  NVQKQQVPVYDESHWSDLDFIYSKKMTAWMYFVSETLAEKAAWKATKENNIDFISIIPTL  193

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ P+FP SL+TALS I    G   H++IIKQ + VHLDDLCE+ I+LY++PKA G
Sbjct  194  VVGPFISPSFPPSLMTALSLI---TGAESHYSIIKQCQCVHLDDLCESHIYLYENPKAAG  250

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATIH +AKMI+  WPEY VP++F+GI+ E+PIVSFSSKKL +MGF+FKY LE
Sbjct  251  RYICSSHDATIHQLAKMIKEKWPEYQVPAKFEGIDDEIPIVSFSSKKLTDMGFKFKYDLE  310

Query  722  DMYKGAIETLRKKGLLPYSTKE  787
            +M++GAI++ ++KGLLPYST E
Sbjct  311  EMFRGAIKSCKEKGLLPYSTNE  332



>dbj|BAD34461.1| dihydroflavonol 4-reductase [Eustoma grandiflorum]
Length=347

 Score =   342 bits (876),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 172/275 (63%), Positives = 215/275 (78%), Gaps = 4/275 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFH+A  + F SK+PENEVIKP + G+LS+I S  KAKTVKK+VFTSS   V
Sbjct  76   EAIQGCHGVFHMATPMEFESKNPENEVIKPTIDGVLSVIRSSVKAKTVKKIVFTSSAGTV  135

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             +++ Q+  YDE+  SDLDFIY+ KM GWMYF SK LAEK AW+AAK   I FISIIP +
Sbjct  136  DVQKEQKSVYDENDQSDLDFIYSKKMTGWMYFVSKILAEKAAWEAAKANNIGFISIIPTV  195

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+  TFP SL+TALS +    GN  H++IIKQG+FVHLDDLCEA IFLY+HP+A G
Sbjct  196  VVGPFITCTFPPSLITALSLL---TGNEAHYSIIKQGQFVHLDDLCEAHIFLYEHPEAEG  252

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH  TI+D+AKMIRH WPEY VP+  KGI++++P+ SFS KKL  MGFQ+KYTLE
Sbjct  253  RYICSSHDTTINDLAKMIRHRWPEYNVPTNLKGIDEDIPLASFSFKKLTGMGFQYKYTLE  312

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQHSGKE  826
            DM++GAIET R+KGLLP+S +    ++Q +H GK+
Sbjct  313  DMFRGAIETCREKGLLPHSNENHVIMQQTEH-GKD  346



>gb|ACB56920.1| dihydroflavonol-4-reductase [Pilosella officinarum]
Length=354

 Score =   342 bits (876),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 173/261 (66%), Positives = 212/261 (81%), Gaps = 4/261 (2%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GCEGVFHVA  ++F SKDPENE+IKP ++G+LSII SCAKAKTVK+LVFTSS   V
Sbjct  75   EAIEGCEGVFHVATPMDFESKDPENEIIKPTIEGVLSIIRSCAKAKTVKRLVFTSSAGTV  134

Query  182  HIKETQQLE-YDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPP  358
            ++ +  QL  YDES WSDLDFI + KM  WMYF SK LAEKEAWKA KE  I+FISIIP 
Sbjct  135  NVHDGSQLPVYDESHWSDLDFINSKKMTAWMYFVSKILAEKEAWKATKENNIDFISIIPT  194

Query  359  LVIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAG  538
            LV+GPF+ P FP SL+TALS I   +G   H++IIKQG++VHLDDLCE+ I+LY++P+A 
Sbjct  195  LVVGPFINPAFPPSLITALSLI---IGEESHYSIIKQGQYVHLDDLCESHIYLYENPEAN  251

Query  539  GRFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTL  718
            GR+ICSSH ATIH +A MI+  WPEY +P++F GI+ ELP VSFSSKKL +MGF+FKY L
Sbjct  252  GRYICSSHDATIHQLANMIKEKWPEYDIPTKFPGIDDELPTVSFSSKKLIDMGFKFKYNL  311

Query  719  EDMYKGAIETLRKKGLLPYST  781
            E+M+KGAI++ R+KGLLPYST
Sbjct  312  EEMFKGAIDSCREKGLLPYST  332



>gb|AAL89715.1|AF483836_1 dihydroflavonol-4-reductase [Vaccinium macrocarpon]
Length=354

 Score =   338 bits (866),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 172/265 (65%), Positives = 211/265 (80%), Gaps = 4/265 (2%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+LSII SC KAKTVK+LVFTSS  AV
Sbjct  77   EAIEGCVGVFHVATPMDFESKDPENEVIKPTINGVLSIIKSCTKAKTVKRLVFTSSAGAV  136

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
              +E Q L +DE++WSD+DF+Y  KM GW YF SKTLAE+ A +AAKE  I+FISIIP L
Sbjct  137  VDQEHQPLVFDENNWSDVDFLYDKKMTGWTYFVSKTLAERAAMEAAKEISIDFISIIPTL  196

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP SL+T LSPI    GN  H++IIKQG+FVHLDDLCE+ I+L++HP+A G
Sbjct  197  VVGPFISPTFPPSLITVLSPI---TGNDPHYSIIKQGQFVHLDDLCESHIYLFEHPEAEG  253

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATI+D+AK++R N P    P+EFKGI K+LP VSF SKKL  MGFQFKY+LE
Sbjct  254  RYICSSHDATIYDLAKIMRRNAPSTMSPTEFKGIPKDLPNVSFPSKKLIGMGFQFKYSLE  313

Query  722  DMYKGAIETLRK-KGLLPYSTKEPA  793
            DM++GAI+T ++ KGLLPYS +  A
Sbjct  314  DMFRGAIDTCQETKGLLPYSNETTA  338



>gb|AGJ70142.1| dihydroflavonol-4-reductase [Vitis rotundifolia]
Length=337

 Score =   334 bits (857),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 164/265 (62%), Positives = 211/265 (80%), Gaps = 3/265 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP ++G+L I+ SCA AKTV++LVFTSS   V
Sbjct  73   EAIKGCNGVFHVATPMDFESKDPENEVIKPTIEGLLGIMKSCAAAKTVRRLVFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +I+E Q   YDES WSD++F  A KM GWMYF SKTLAE+ AWK AKE  I+FISIIPPL
Sbjct  133  NIQEHQLPVYDESCWSDMEFCRAKKMTGWMYFVSKTLAEQAAWKYAKENNIDFISIIPPL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF++ + P SL+TALSPI    GN  H++II+QG+F+HLDDLC+A IFL+++PKA G
Sbjct  193  VVGPFIMSSMPPSLITALSPI---TGNEAHYSIIRQGQFIHLDDLCKAHIFLFENPKAEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSS+  TI D+AKM+R  +PEY +P+EFKG+++ L  V FSSKKL ++GF+FKY+LE
Sbjct  250  RYICSSNDCTILDLAKMLREKYPEYNIPTEFKGVDENLKSVCFSSKKLTDLGFEFKYSLE  309

Query  722  DMYKGAIETLRKKGLLPYSTKEPAD  796
            DM+ GA++T R KGLLP S ++P D
Sbjct  310  DMFTGAVDTCRAKGLLPPSHEKPVD  334



>dbj|BAH24302.1| dihydroflavonol 4-reductase [Rosa hybrid cultivar]
Length=349

 Score =   333 bits (854),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 165/272 (61%), Positives = 215/272 (79%), Gaps = 3/272 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+L I+ +C KAKTV++LVFTSS  +V
Sbjct  73   EAIKGCTGVFHVATPMDFESKDPENEVIKPTINGVLDIMQACLKAKTVRRLVFTSSAGSV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++ETQ+  Y+ES+WSD++F    KM GWMYFASKTLAE+EAWK AKE  I+FI+IIP L
Sbjct  133  NVEETQKPVYNESNWSDVEFCRRVKMTGWMYFASKTLAEQEAWKFAKENNIDFITIIPTL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            VIGPFL+P+ P SL+T LSP+    GN  H++IIKQG+F+HLDDLC++ I+LY+HPKA G
Sbjct  193  VIGPFLMPSMPPSLITGLSPV---TGNESHYSIIKQGQFIHLDDLCQSHIYLYEHPKAEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATIH++AK+++  +PEY VP+ FKGIE+ LP V FSSKKL E GF+FKY+LE
Sbjct  250  RYICSSHDATIHEIAKLLKEKYPEYNVPTTFKGIEENLPKVHFSSKKLLETGFEFKYSLE  309

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQHS  817
            DM+ GA++  + KGLLP  T+     E ++ S
Sbjct  310  DMFVGAVDACKAKGLLPPPTERVEKQEVDESS  341



>gb|AAL89714.1|AF483835_1 dihydroflavonol-4-reductase [Vaccinium macrocarpon]
Length=342

 Score =   332 bits (852),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 170/264 (64%), Positives = 209/264 (79%), Gaps = 4/264 (2%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+LSII SC KAKTVK+LVFTSS  AV
Sbjct  77   EAIEGCVGVFHVATPMDFESKDPENEVIKPTINGVLSIIKSCTKAKTVKRLVFTSSAGAV  136

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
              +E Q L +DE++WSD+DF+Y  KM GW YF SKTLAE+ A +AAKE  I+FISIIP L
Sbjct  137  VDQEHQPLVFDENNWSDVDFLYDKKMTGWTYFVSKTLAERAAMEAAKEISIDFISIIPTL  196

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PTFP SL+T LSPI    GN  H++IIKQ ++VHLDDLC+  +FL +HP+A G
Sbjct  197  VVGPFISPTFPPSLITVLSPI---TGNEAHYSIIKQCQYVHLDDLCKYLMFLLEHPEAEG  253

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATI+D+AKM+R N P    P+EFKGI+KELPI+SFSSKKL  +GF+FKY LE
Sbjct  254  RYICSSHDATIYDLAKMMRRNGPGTMSPNEFKGIDKELPIMSFSSKKLLVIGFKFKYNLE  313

Query  722  DMYKGAIETLRK-KGLLPYSTKEP  790
            DM++GAI+T ++ KGLLPYS   P
Sbjct  314  DMFRGAIDTWQETKGLLPYSNATP  337



>dbj|BAA12723.1| dihydroflavonol 4-reductase [Rosa hybrid cultivar]
Length=349

 Score =   332 bits (852),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 165/272 (61%), Positives = 216/272 (79%), Gaps = 3/272 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+L I+ +C KAKTV++LVFTSS  +V
Sbjct  73   EAIKGCTGVFHVATPMDFESKDPENEVIKPTINGVLDIMQACLKAKTVRRLVFTSSAGSV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++ETQ+  Y+ES+WSD++F    KM GWMYFASKTLAE+EAWK AKE  I+FI+IIP L
Sbjct  133  NVEETQKPVYNESNWSDVEFCRRVKMTGWMYFASKTLAEQEAWKFAKENNIDFITIIPTL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            VIGPFL+P+ P SL+T LSP+    GN  H++IIKQG+F+HLDDLC++ I+LY+HPKA G
Sbjct  193  VIGPFLMPSMPPSLITGLSPL---TGNESHYSIIKQGQFIHLDDLCQSHIYLYEHPKAEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATIH++AK+++  +PEY VP+ FKGIE+ LP V FSSKKL E GF+FKY+LE
Sbjct  250  RYICSSHDATIHEIAKLLKGKYPEYNVPTTFKGIEENLPKVHFSSKKLLETGFEFKYSLE  309

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQHS  817
            DM+ GA++  ++KGLLP  T+     E ++ S
Sbjct  310  DMFVGAVDACKEKGLLPPPTERVEKQEVDESS  341



>gb|AEN69002.1| dihydroflavonol 4-reductase [Chrysanthemum x morifolium]
Length=357

 Score =   332 bits (852),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 167/256 (65%), Positives = 208/256 (81%), Gaps = 3/256 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENE+IKP ++G+LSII SC KAKTVKKLVFTSS   V
Sbjct  74   EAIEGCHGVFHVATPMDFESKDPENEIIKPTIEGVLSIIRSCVKAKTVKKLVFTSSAGTV  133

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            ++++ Q   YDES WSDLDFIY+ KM  WMYF SKTLAEK AWKA KE  I+FISIIP L
Sbjct  134  NVQKQQVPVYDESHWSDLDFIYSKKMTAWMYFVSKTLAEKAAWKATKENNIDFISIIPTL  193

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ P+FP SL+TALS I    G   H++IIKQ ++VHLDDLCE+ I+LY++PKA G
Sbjct  194  VVGPFISPSFPPSLMTALSLI---TGAESHYSIIKQCQYVHLDDLCESHIYLYENPKAAG  250

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATIH +AKMI+  WPEY VP++F+ I+ E+PIVSFSSKKL +MGF+FKY LE
Sbjct  251  RYICSSHDATIHQLAKMIKEKWPEYQVPTKFEVIDDEIPIVSFSSKKLTDMGFKFKYDLE  310

Query  722  DMYKGAIETLRKKGLL  769
            +M++GAI++ ++KGLL
Sbjct  311  EMFRGAIKSCKEKGLL  326



>gb|AAX12422.1| dihydroflavonol 4-reductase [Rosa hybrid cultivar]
Length=349

 Score =   332 bits (850),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 164/272 (60%), Positives = 213/272 (78%), Gaps = 3/272 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKPA+ G+L I+ +C KAKTV++LVFTSS  +V
Sbjct  73   EAIKGCTGVFHVATPMDFESKDPENEVIKPAINGVLDIMQACLKAKTVRRLVFTSSAGSV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++ETQ+  Y+ES+WSD++F    KM GWMYF SKTLAE+EAWK AKE  I+FI+IIP L
Sbjct  133  NVEETQKPVYNESNWSDIEFCRRVKMTGWMYFVSKTLAEQEAWKFAKENNIDFITIIPTL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPFL+P  P SL+T LSP+    GN  H++IIKQG+F+HLDDLC++ I+LY+HPKA G
Sbjct  193  VVGPFLMPAMPPSLITGLSPL---TGNESHYSIIKQGQFIHLDDLCQSHIYLYEHPKAEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATIH++AK++R  +PEY VP+ FKGIE+ LP V FSS KL E GF+FKY+LE
Sbjct  250  RYICSSHDATIHEIAKLLREKYPEYNVPTTFKGIEENLPKVHFSSNKLLETGFEFKYSLE  309

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQHS  817
            DM+ GA++  + KGLLP  T+     E ++ S
Sbjct  310  DMFVGAVDACKAKGLLPPPTERVEKQEVDESS  341



>gb|AIU34714.1| dihydroflavonol 4-reductase 1 [Rosa rugosa]
Length=349

 Score =   330 bits (847),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 164/272 (60%), Positives = 213/272 (78%), Gaps = 3/272 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+L I+ +C KAKTV++LVFT+S  +V
Sbjct  73   EAIKGCTGVFHVATPMDFESKDPENEVIKPTINGVLDIMKACLKAKTVRRLVFTASAGSV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++ETQ+  Y+ES+WSD++F    KM GWMYF SKTLAE+EAWK AKE  I+FI+IIP L
Sbjct  133  NVEETQKPVYNESNWSDVEFCRRVKMTGWMYFVSKTLAEQEAWKFAKENNIDFITIIPTL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            VIGPFL+P  P SL+T LSP+    GN  H++IIKQG+F+HLDDLC++ I+LY+HPKA G
Sbjct  193  VIGPFLMPAMPPSLITGLSPL---TGNESHYSIIKQGQFIHLDDLCQSHIYLYEHPKAEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATIH++AK++R  +PEY VP+ FKGIE+ LP V FSSKKL E GF+FKY+LE
Sbjct  250  RYICSSHDATIHEIAKLLREKYPEYNVPTTFKGIEENLPKVHFSSKKLLETGFEFKYSLE  309

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQHS  817
            DM+ GA++  + KGLLP  T+     E ++ S
Sbjct  310  DMFVGAVDACKAKGLLPPPTERVEKQEVDESS  341



>dbj|BAD05177.1| dihydroflavonol 4-reductase [Ipomoea batatas]
Length=273

 Score =   327 bits (839),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 167/225 (74%), Positives = 194/225 (86%), Gaps = 4/225 (2%)
 Frame = +2

Query  146  KKLVFTSSTAAVHIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaake  325
            KKLVFTSS   ++++  Q+  YDES WSDLDFIYA KM GWMYFASK LAEKEAWKA KE
Sbjct  1    KKLVFTSSAGTLNVQPQQKPVYDESCWSDLDFIYAKKMTGWMYFASKILAEKEAWKATKE  60

Query  326  kQIEFISIIPPLVIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEA  505
            K+I+FISIIPPLV+GPF+ PTFP SL+TALS I +   N  H++IIKQG++VHLDDLCEA
Sbjct  61   KKIDFISIIPPLVVGPFITPTFPPSLITALSLITE---NQAHYSIIKQGQYVHLDDLCEA  117

Query  506  QIFLYQHPKAGGRFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKL  685
             IFLY+HPKA GRFICSSHH TIH + +MIR NWPEYY+PS+FKGIEK+LP+V FSSKKL
Sbjct  118  HIFLYEHPKAEGRFICSSHHTTIHGLGEMIRQNWPEYYIPSQFKGIEKDLPVVYFSSKKL  177

Query  686  QEMGFQFKYTLEDMYKGAIETLRKKGLLPYSTKE-PADIEQEQHS  817
            Q+MGFQFKY+LEDMY+GAIETLRKKGLLPYSTKE PA IE+EQ +
Sbjct  178  QDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKELPAAIEEEQET  222



>gb|AHF58604.1| dihydroflavonol 4-reductase [Rosa chinensis]
Length=349

 Score =   330 bits (846),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 164/272 (60%), Positives = 212/272 (78%), Gaps = 3/272 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEV KP + G+L I+ +C KAKTV++LVFTSS   V
Sbjct  73   EAIKGCTGVFHVATPMDFESKDPENEVTKPTINGLLDIVKACLKAKTVRRLVFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++ETQ+  Y+ES+WSD++F    KM GWMYF SKTLAE+EAWK AKE  I+FI+IIP L
Sbjct  133  NVEETQKPVYNESNWSDVEFCRRVKMTGWMYFVSKTLAEQEAWKFAKENNIDFITIIPTL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            VIGPFL+P+ P SL+T LSP+    GN  H++IIKQG+F+HLDDLC++ I+LY+HPKA G
Sbjct  193  VIGPFLMPSMPPSLITGLSPL---TGNEGHYSIIKQGQFIHLDDLCQSHIYLYEHPKAEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATIH++AK++R  +PEY VP+ FKGIE+ LP V FSSKKL E GF+FKY+LE
Sbjct  250  RYICSSHDATIHEIAKLLREKYPEYNVPTTFKGIEENLPKVHFSSKKLLETGFEFKYSLE  309

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQHS  817
            DM+ GA++  + KGLLP  T+     E ++ S
Sbjct  310  DMFVGAVDACKAKGLLPPPTERVEKQEVDESS  341



>dbj|BAI78343.1| dihydroflavonol reductase [Pelargonium zonale]
Length=340

 Score =   328 bits (842),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 166/260 (64%), Positives = 207/260 (80%), Gaps = 4/260 (2%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            E I GC GVFHVA  ++F SKDPENEVIKP + G+LSI+ +C KAK V++LVFTSS   V
Sbjct  76   EPIQGCTGVFHVATPMDFESKDPENEVIKPTIDGMLSIMKACEKAK-VRRLVFTSSAGTV  134

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E Q  EYDE  WSDL+F+ + KM GWMYF SKTLAE+EAWK AKE  IEFISIIP L
Sbjct  135  DVREQQMSEYDEECWSDLEFMLSKKMTGWMYFVSKTLAEQEAWKYAKENNIEFISIIPTL  194

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPFL+P+ P SL+TALSPI    GN  H++IIKQG FVHLDDLC A I+L+++PKA G
Sbjct  195  VVGPFLMPSMPPSLITALSPI---TGNESHYSIIKQGHFVHLDDLCIAHIYLFENPKAQG  251

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATI ++AK++R  +PEY VP+EFK +++ L  VSFSSKKL+E+GF+FKY+LE
Sbjct  252  RYICSSHDATILELAKLLRQKFPEYNVPTEFKDVDENLKSVSFSSKKLKELGFEFKYSLE  311

Query  722  DMYKGAIETLRKKGLLPYST  781
            DM+ GA+ET R+KGLLP S 
Sbjct  312  DMFAGAVETCREKGLLPLSN  331



>dbj|BAF49325.1| dihydroflavonol 4-reductase [Delphinium x belladonna]
Length=337

 Score =   328 bits (841),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 152/261 (58%), Positives = 208/261 (80%), Gaps = 3/261 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            +AI GC GVFHVA  ++F SKDPENEVIKP ++G+L I+ SC KAK+V++LVFTSS  +V
Sbjct  71   DAIKGCTGVFHVATPMDFESKDPENEVIKPTIEGMLGIMKSCVKAKSVRRLVFTSSAGSV  130

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E QQ EYDE+SW+D++F    KM GWMYF SKTLAEK AW+ A++  I+FISIIP L
Sbjct  131  NVEERQQAEYDENSWTDVEFCRTRKMTGWMYFVSKTLAEKAAWEFAQQNNIDFISIIPTL  190

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPFL+P+ P SL+TALSPI    GN  H++I+KQ + VHLDDLC A I+L++HP++ G
Sbjct  191  VVGPFLMPSMPPSLITALSPI---TGNQSHYSILKQIQLVHLDDLCNAHIYLFEHPESNG  247

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATI DVA ++RH +PEY VP++F G+++ L  V FSSK+L+++GF +KYT+E
Sbjct  248  RYICSSHDATITDVANLLRHKFPEYNVPTKFMGVDENLKAVVFSSKRLKDLGFNYKYTME  307

Query  722  DMYKGAIETLRKKGLLPYSTK  784
            DM+ GA+ T R+ G+LP++ K
Sbjct  308  DMFVGAVTTCRRNGILPFTNK  328



>gb|AFG28176.1| putative dihydroflavonol 4-reductase [Vitis bellula]
Length=337

 Score =   328 bits (841),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 162/265 (61%), Positives = 208/265 (78%), Gaps = 3/265 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP ++G+L I+ SCA AKTV++LVFTSS   V
Sbjct  73   EAIKGCTGVFHVATPMDFESKDPENEVIKPTIEGMLGIMKSCAAAKTVRRLVFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +I+E Q   YDES WSD++F  A KM GWMYF SKTLAE+ AWK AKE  I+FISIIP L
Sbjct  133  NIQEHQLPVYDESCWSDMEFCRAKKMTGWMYFVSKTLAEQAAWKYAKENNIDFISIIPTL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF++ + P SL+TALSPI    GN  H++II+QG+FVHLDDLC A I+L+++PKA G
Sbjct  193  VVGPFIMSSMPPSLITALSPI---TGNEAHYSIIRQGQFVHLDDLCNAHIYLFENPKAEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSS+   I D+AKM+R  +PEY +P+EFKG+++ L  V FSSKKL ++GF+FKY+LE
Sbjct  250  RYICSSNDCIILDLAKMLREKYPEYNIPTEFKGVDENLKSVCFSSKKLTDLGFEFKYSLE  309

Query  722  DMYKGAIETLRKKGLLPYSTKEPAD  796
            DM+ GA++T R KGLLP S ++P D
Sbjct  310  DMFTGAVDTCRAKGLLPPSHEKPVD  334



>gb|ABF21084.1| dihydroflavonol 4-reductase [Pericallis cruenta]
Length=280

 Score =   326 bits (835),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 164/253 (65%), Positives = 206/253 (81%), Gaps = 7/253 (3%)
 Frame = +2

Query  35   VAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAVHIKETQQLEYD  214
            VA  ++F +KDPENE+IKP ++G+LSII SC KAKTV+KLVFTSS   V+++ETQ   YD
Sbjct  1    VATPMDFETKDPENEMIKPTIEGVLSIIRSCVKAKTVEKLVFTSSAGTVNVQETQLSVYD  60

Query  215  ESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPLVIGPFLIPTFP  394
            ES WSDLDFIY+ KM  WMYF SKTLAE+ AW+AAKE  I+FISIIP LV+GPF+ P+FP
Sbjct  61   ESHWSDLDFIYSKKMTAWMYFVSKTLAERAAWEAAKENNIDFISIIPTLVVGPFITPSFP  120

Query  395  LSLVTALSPIMDPVGNGL--HHNIIKQGKFVHLDDLCEAQIFLYQHPKAGGRFICSSHHA  568
             SL+TALS I     NGL  H++IIKQG++VHLDDLCE+ I LY++PKA GR+ICSSH A
Sbjct  121  PSLITALSLI-----NGLESHYSIIKQGQYVHLDDLCESHISLYENPKAEGRYICSSHDA  175

Query  569  TIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLEDMYKGAIET  748
            TIH +AKMI   WPEY+VP++F GI++++PIVSFSSKKL + GF+FKY LEDM+KGAI+ 
Sbjct  176  TIHQLAKMINEKWPEYHVPTQFAGIDEDVPIVSFSSKKLTDTGFKFKYDLEDMFKGAIDG  235

Query  749  LRKKGLLPYSTKE  787
             ++KG LPYST +
Sbjct  236  CKEKGFLPYSTNK  248



>emb|CAN61338.1| hypothetical protein VITISV_011895 [Vitis vinifera]
Length=320

 Score =   327 bits (837),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 161/265 (61%), Positives = 207/265 (78%), Gaps = 3/265 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP ++G+L I+ SCA AKTV++LVFTSS   V
Sbjct  56   EAIKGCTGVFHVATPMDFESKDPENEVIKPTIEGMLGIMKSCAAAKTVRRLVFTSSAGTV  115

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +I+E Q   YDES WSD++F  A KM  WMYF SKTLAE+ AWK AKE  I+FI+IIP L
Sbjct  116  NIQEHQLPVYDESCWSDMEFCRAKKMTAWMYFVSKTLAEQAAWKYAKENNIDFITIIPTL  175

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF++ + P SL+TALSPI    GN  H++II+QG+FVHLDDLC A I+L+++PKA G
Sbjct  176  VVGPFIMSSMPPSLITALSPI---TGNEAHYSIIRQGQFVHLDDLCNAHIYLFENPKAEG  232

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH   I D+AKM+R  +PEY +P+EFKG+++ L  V FSSKKL ++GF+FKY+LE
Sbjct  233  RYICSSHDCIILDLAKMLREKYPEYNIPTEFKGVDENLKSVCFSSKKLTDLGFEFKYSLE  292

Query  722  DMYKGAIETLRKKGLLPYSTKEPAD  796
            DM+ GA++T R KGLLP S ++P D
Sbjct  293  DMFTGAVDTCRAKGLLPPSHEKPVD  317



>gb|AGO02174.1| dihydroflavonol 4-reductase [Ampelopsis grossedentata]
Length=337

 Score =   327 bits (838),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 161/265 (61%), Positives = 207/265 (78%), Gaps = 3/265 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP ++G+L I+ SCA AKTV++LVFTSS   V
Sbjct  73   EAIKGCTGVFHVATPMDFESKDPENEVIKPTIEGMLGIMKSCAAAKTVRRLVFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +I+E QQ  YDE+ WSD++F  A KM GWMYF SKTLAE+ AWK AKE  I+FISIIP L
Sbjct  133  NIQERQQPVYDENCWSDMEFCRAKKMTGWMYFVSKTLAEQAAWKYAKENNIDFISIIPTL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF++ + P SL+TA SPI    GN  H++II+QG+FVHLDDLC A I+L+++PKA G
Sbjct  193  VVGPFIMSSMPPSLITAPSPI---TGNEAHYSIIRQGQFVHLDDLCNAHIYLFENPKAEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH   I D+AKM++  +PEY +P+EFKG+++ L  V F SKKL ++GF+FKY+LE
Sbjct  250  RYICSSHDCIILDLAKMLKEKYPEYNIPTEFKGVDENLKSVRFCSKKLTDLGFEFKYSLE  309

Query  722  DMYKGAIETLRKKGLLPYSTKEPAD  796
            DM+ GA+ET R KGLLP S ++P D
Sbjct  310  DMFTGAVETCRAKGLLPPSHEKPVD  334



>ref|NP_001268144.1| dihydroflavonol-4-reductase [Vitis vinifera]
 pdb|2C29|D Chain D, Structure Of Dihydroflavonol Reductase From Vitis Vinifera 
At 1.8 A.
 pdb|2C29|F Chain F, Structure Of Dihydroflavonol Reductase From Vitis Vinifera 
At 1.8 A.
 pdb|2IOD|A Chain A, Binding Of Two Substrate Analogue Molecules To Dihydroflavonol-4-Reductase 
Alters The Functional Geometry Of The 
Catalytic Site
 pdb|2IOD|B Chain B, Binding Of Two Substrate Analogue Molecules To Dihydroflavonol-4-Reductase 
Alters The Functional Geometry Of The 
Catalytic Site
 pdb|2IOD|C Chain C, Binding Of Two Substrate Analogue Molecules To Dihydroflavonol-4-Reductase 
Alters The Functional Geometry Of The 
Catalytic Site
 pdb|2IOD|D Chain D, Binding Of Two Substrate Analogue Molecules To Dihydroflavonol-4-Reductase 
Alters The Functional Geometry Of The 
Catalytic Site
 pdb|2NNL|D Chain D, Binding Of Two Substrate Analogue Molecules To Dihydroflavonol-4-Reductase 
Alters The Functional Geometry Of The 
Catalytic Site
 pdb|2NNL|F Chain F, Binding Of Two Substrate Analogue Molecules To Dihydroflavonol-4-Reductase 
Alters The Functional Geometry Of The 
Catalytic Site
 pdb|3C1T|A Chain A, Binding Of Two Substrate Analogue Molecules To Dihydroflavonol 
4-Reductase Alters The Functional Geometry Of The 
Catalytic Site
 pdb|3C1T|B Chain B, Binding Of Two Substrate Analogue Molecules To Dihydroflavonol 
4-Reductase Alters The Functional Geometry Of The 
Catalytic Site
 pdb|3C1T|C Chain C, Binding Of Two Substrate Analogue Molecules To Dihydroflavonol 
4-Reductase Alters The Functional Geometry Of The 
Catalytic Site
 pdb|3C1T|D Chain D, Binding Of Two Substrate Analogue Molecules To Dihydroflavonol 
4-Reductase Alters The Functional Geometry Of The 
Catalytic Site
 pdb|3BXX|A Chain A, Binding Of Two Substrate Analogue Molecules To Dihydroflavonol 
4-Reductase Alters The Functional Geometry Of The 
Catalytic Site
 pdb|3BXX|B Chain B, Binding Of Two Substrate Analogue Molecules To Dihydroflavonol 
4-Reductase Alters The Functional Geometry Of The 
Catalytic Site
 pdb|3BXX|C Chain C, Binding Of Two Substrate Analogue Molecules To Dihydroflavonol 
4-Reductase Alters The Functional Geometry Of The 
Catalytic Site
 pdb|3BXX|D Chain D, Binding Of Two Substrate Analogue Molecules To Dihydroflavonol 
4-Reductase Alters The Functional Geometry Of The 
Catalytic Site
 pdb|3BXX|E Chain E, Binding Of Two Substrate Analogue Molecules To Dihydroflavonol 
4-Reductase Alters The Functional Geometry Of The 
Catalytic Site
 pdb|3BXX|F Chain F, Binding Of Two Substrate Analogue Molecules To Dihydroflavonol 
4-Reductase Alters The Functional Geometry Of The 
Catalytic Site
 emb|CAA72420.1| dihydroflavonol 4-reductase [Vitis vinifera]
 gb|AAX12423.1| dihydroflavonol 4-reductase [Vitis vinifera]
Length=337

 Score =   327 bits (838),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 161/265 (61%), Positives = 207/265 (78%), Gaps = 3/265 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP ++G+L I+ SCA AKTV++LVFTSS   V
Sbjct  73   EAIKGCTGVFHVATPMDFESKDPENEVIKPTIEGMLGIMKSCAAAKTVRRLVFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +I+E Q   YDES WSD++F  A KM  WMYF SKTLAE+ AWK AKE  I+FI+IIP L
Sbjct  133  NIQEHQLPVYDESCWSDMEFCRAKKMTAWMYFVSKTLAEQAAWKYAKENNIDFITIIPTL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF++ + P SL+TALSPI    GN  H++II+QG+FVHLDDLC A I+L+++PKA G
Sbjct  193  VVGPFIMSSMPPSLITALSPI---TGNEAHYSIIRQGQFVHLDDLCNAHIYLFENPKAEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH   I D+AKM+R  +PEY +P+EFKG+++ L  V FSSKKL ++GF+FKY+LE
Sbjct  250  RYICSSHDCIILDLAKMLREKYPEYNIPTEFKGVDENLKSVCFSSKKLTDLGFEFKYSLE  309

Query  722  DMYKGAIETLRKKGLLPYSTKEPAD  796
            DM+ GA++T R KGLLP S ++P D
Sbjct  310  DMFTGAVDTCRAKGLLPPSHEKPVD  334



>gb|AHK10250.1| dihydroflavonol 4-reductase [Vitis davidii]
Length=337

 Score =   327 bits (837),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 162/265 (61%), Positives = 207/265 (78%), Gaps = 3/265 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP ++G+L I+ SCA AKTV++LVFTSS   V
Sbjct  73   EAIKGCTGVFHVATPMDFESKDPENEVIKPTIEGMLGIMKSCAAAKTVRRLVFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +I+E Q   YDES WSDL+F  A KM  WMYF SKTLAE+ AWK AKE  I+FISIIP L
Sbjct  133  NIQEHQLPVYDESCWSDLEFCRAKKMTAWMYFVSKTLAEQAAWKYAKENNIDFISIIPTL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF++ + P SL+TALSPI    GN  H++II+QG+FVHLDDLC A I+L+++PKA G
Sbjct  193  VVGPFIMSSMPPSLITALSPI---TGNEAHYSIIRQGQFVHLDDLCNAHIYLFENPKAEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSS+   I D+AKM+R  +PEY +P+EFKG+++ L  V FSSKKL ++GF+FKY+LE
Sbjct  250  RYICSSNDCIILDLAKMLREKYPEYNIPTEFKGVDENLKSVCFSSKKLTDLGFEFKYSLE  309

Query  722  DMYKGAIETLRKKGLLPYSTKEPAD  796
            DM+ GA++T R KGLLP S ++P D
Sbjct  310  DMFTGAVDTCRAKGLLPPSHEKPVD  334



>gb|AFI71899.1| dihydroflavonol 4-reductase [Paeonia lactiflora]
Length=364

 Score =   327 bits (839),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 165/257 (64%), Positives = 204/257 (79%), Gaps = 3/257 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+LSI+ +CAKAKTV+++VFTSS   +
Sbjct  77   EAIKGCTGVFHVATPMDFESKDPENEVIKPTIDGMLSIMRACAKAKTVRRVVFTSSAGTI  136

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E QQ  YDE+  SD++FI   KM GWMYF SK LAE+ AWK AKE  I+FISIIP L
Sbjct  137  NVEEHQQSVYDETCSSDMEFIQTKKMTGWMYFVSKILAEQAAWKFAKENNIDFISIIPTL  196

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPFL+P+ P SLVTALSPI    GN  H++IIKQG+FVHLDDLC A I+L++HPKA G
Sbjct  197  VVGPFLMPSMPPSLVTALSPI---TGNEAHYSIIKQGQFVHLDDLCNAHIYLFEHPKAEG  253

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSS  ATI  +AKM+R  +PEY VP+EFKG+++ L IVSFSSKKL + GF+FKY LE
Sbjct  254  RYICSSRDATIISLAKMLREKYPEYNVPTEFKGVDESLKIVSFSSKKLMDSGFEFKYNLE  313

Query  722  DMYKGAIETLRKKGLLP  772
            DM+  AIET R+KGLLP
Sbjct  314  DMFVEAIETCREKGLLP  330



>gb|AHL46451.1| dihydroflavonol 4-reductase [Fragaria x ananassa]
Length=349

 Score =   327 bits (837),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 164/273 (60%), Positives = 213/273 (78%), Gaps = 7/273 (3%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+L I+ +C KAKTV++LVFT+S  +V
Sbjct  73   EAIKGCSGVFHVATPMDFESKDPENEVIKPTINGVLDIMKACLKAKTVRRLVFTASAGSV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++ETQ+  Y+ES+WSD++F    KM GWMYF SKTLAE+EAWK AKE  I+FI+IIP L
Sbjct  133  NVEETQKPVYNESNWSDVEFCRRVKMTGWMYFVSKTLAEQEAWKFAKENNIDFITIIPTL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            VIGPFL+P  P SL+T LSP+    GN  H++IIKQG+FVHLDDLC++ I+LY+HPKA G
Sbjct  193  VIGPFLMPAMPPSLITGLSPLF---GNEGHYSIIKQGQFVHLDDLCQSHIYLYEHPKAEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATIH++AK++R  +PEY VP++FKGIE  L  V FSSKKL E GF+FKY+LE
Sbjct  250  RYICSSHDATIHEIAKLLREKYPEYNVPTKFKGIEDNLTKVHFSSKKLLETGFEFKYSLE  309

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQHSG  820
            DM+ GA++  + KGLLP     P +  ++Q +G
Sbjct  310  DMFVGAVDACKAKGLLP----PPTERVEKQEAG  338



>gb|ACV72642.1| dihydroflavonol 4-reductase [Gossypium hirsutum]
Length=340

 Score =   326 bits (836),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 159/262 (61%), Positives = 208/262 (79%), Gaps = 3/262 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            +AI  C GVFHVA  ++F S+DPENEVIKP + G+LSI+ +CAKAKTV++LVFTSS   +
Sbjct  76   DAIQACTGVFHVATPMDFESEDPENEVIKPTINGVLSIMKACAKAKTVRRLVFTSSAGTI  135

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             + E Q+  YDE+ WSDL+FI A KM GWMYF SKT+AE+ AWK AKE  I+F+SIIPPL
Sbjct  136  DVAEQQKPCYDETCWSDLEFIQAKKMTGWMYFVSKTMAEQAAWKFAKENNIDFVSIIPPL  195

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF++ + P SL+TALSPI    GN  H++IIKQG+F+HLDDLC A IFL+++PKA G
Sbjct  196  VVGPFIMQSMPPSLITALSPI---TGNEAHYSIIKQGQFIHLDDLCRAHIFLFENPKAEG  252

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R IC+SHHATI D+AKM+   +PEY VP++FK +++ L  V FSSKKL ++GF+FKY+LE
Sbjct  253  RHICASHHATIIDLAKMLSEKYPEYNVPTKFKDVDENLKSVEFSSKKLLDLGFEFKYSLE  312

Query  722  DMYKGAIETLRKKGLLPYSTKE  787
            DM+ GA+ET R+KGLLP S ++
Sbjct  313  DMFVGAVETCREKGLLPLSNEK  334



>gb|ABM64800.1| dihydroflavonol 4-reductase [Gossypium hirsutum]
 gb|AHG97389.1| dihydroflavonol 4-reductase [Gossypium hirsutum]
Length=355

 Score =   327 bits (837),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 159/262 (61%), Positives = 208/262 (79%), Gaps = 3/262 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            +AI  C GVFHVA  ++F S+DPENEVIKP + G+LSI+ +CAKAKTV++LVFTSS   +
Sbjct  91   DAIQACTGVFHVATPMDFESEDPENEVIKPTINGVLSIMKACAKAKTVRRLVFTSSAGTI  150

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             + E Q+  YDE+ WSDL+FI A KM GWMYF SKT+AE+ AWK AKE  I+F+SIIPPL
Sbjct  151  DVAEQQKPCYDETCWSDLEFIQAKKMTGWMYFVSKTMAEQAAWKFAKENNIDFVSIIPPL  210

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF++ + P SL+TALSPI    GN  H++IIKQG+F+HLDDLC A IFL+++PKA G
Sbjct  211  VVGPFIMQSMPPSLITALSPI---TGNEAHYSIIKQGQFIHLDDLCRAHIFLFENPKAEG  267

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R IC+SHHATI D+AKM+   +PEY VP++FK +++ L  V FSSKKL ++GF+FKY+LE
Sbjct  268  RHICASHHATIIDLAKMLSEKYPEYNVPTKFKDVDENLKSVEFSSKKLLDLGFEFKYSLE  327

Query  722  DMYKGAIETLRKKGLLPYSTKE  787
            DM+ GA+ET R+KGLLP S ++
Sbjct  328  DMFVGAVETCREKGLLPLSNEK  349



>gb|ACN82380.1| dihydroflavonol 4-reductase [Vitis amurensis]
Length=337

 Score =   326 bits (835),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 162/265 (61%), Positives = 207/265 (78%), Gaps = 3/265 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDP NEVIKP ++G+L I+ SCA AKTV+KLVFTSS   V
Sbjct  73   EAIKGCTGVFHVATPMDFESKDPGNEVIKPTIEGMLGIMKSCAAAKTVRKLVFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +I+E Q   YDES WSD++F  A KM GWMYF SKTLAE+ AWK AKE  I+FISIIP L
Sbjct  133  NIQEHQLPVYDESCWSDMEFCRAKKMTGWMYFVSKTLAEQAAWKYAKENNIDFISIIPTL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF++ + P SL+TALSPI    GN  H++II+QG+FVHLDDLC A I+L+++PKA G
Sbjct  193  VVGPFIMSSMPPSLITALSPI---TGNEAHYSIIRQGQFVHLDDLCNAHIYLFENPKAEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSS+   I D+AKM+R  +PEY +P+EFKG+++ L  V FSSKKL ++GF+FKY+LE
Sbjct  250  RYICSSNDCIILDLAKMLREKYPEYNIPTEFKGVDENLKSVCFSSKKLTDLGFEFKYSLE  309

Query  722  DMYKGAIETLRKKGLLPYSTKEPAD  796
            DM+ GA++T R KGLLP S ++P D
Sbjct  310  DMFTGAVDTCRAKGLLPPSHEKPVD  334



>gb|AIU98514.1| dihydroflavonol 4-reductase [Paeonia suffruticosa]
Length=364

 Score =   326 bits (836),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 163/257 (63%), Positives = 202/257 (79%), Gaps = 3/257 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            E I GC GVFHVA  ++F SKDPENEVIKP + G+LSI+ +CAKAKTV+++VFTSS   +
Sbjct  77   ETIKGCTGVFHVATPMDFDSKDPENEVIKPTINGMLSIMRACAKAKTVRRVVFTSSAGTI  136

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E QQ  YDE+ WSD++FI   KM GWMYF SK LAE+ AWK AKE  I+FISIIP L
Sbjct  137  NVEEHQQSVYDETCWSDMEFIQTKKMTGWMYFVSKILAEQAAWKFAKENSIDFISIIPTL  196

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPFL+P+ P SLVTALS I    GN  H++IIKQG+FVHLDDLC A I+L++HPK  G
Sbjct  197  VVGPFLMPSMPPSLVTALSLI---TGNEAHYSIIKQGQFVHLDDLCNAHIYLFEHPKVEG  253

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATI  +AKM+R  +PEY VP+EFK +++ L  VSFSSKKL + GF+FKY LE
Sbjct  254  RYICSSHDATILSLAKMLRDKYPEYNVPTEFKDVDESLKSVSFSSKKLMDSGFEFKYNLE  313

Query  722  DMYKGAIETLRKKGLLP  772
            DM+ GAIET R+KGLLP
Sbjct  314  DMFVGAIETCREKGLLP  330



>gb|AAV71171.1| dihydroflavonol reductase [Lotus corniculatus]
 dbj|BAE19949.1| dihydroflavonol 4-reductase [Lotus japonicus]
Length=336

 Score =   325 bits (833),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 160/265 (60%), Positives = 210/265 (79%), Gaps = 3/265 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+L I+ +C KAKTV++LVFTSS   +
Sbjct  73   EAIKGCTGVFHVATPMDFESKDPENEVIKPTINGVLDIMKACQKAKTVRRLVFTSSAGTL  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            ++ E Q+  +DES WSD++F    KM GWMYF SKTLAE+EAWK AKE  I+FI+IIPPL
Sbjct  133  NVIEHQKQMFDESCWSDVEFCRRVKMTGWMYFVSKTLAEQEAWKFAKEHGIDFITIIPPL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+G FL+PT P SL+TALSPI    GN  H++IIKQG++VHLDDLC A IFL++HP++ G
Sbjct  193  VVGSFLMPTMPPSLITALSPI---TGNEAHYSIIKQGQYVHLDDLCLAHIFLFEHPESEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICS+  ATIHD+AK+I   +PEY +P++FK I  EL +V FSSKK+++MGF+FKY+LE
Sbjct  250  RYICSASEATIHDIAKLINSKYPEYNIPTKFKNIPDELELVRFSSKKIKDMGFEFKYSLE  309

Query  722  DMYKGAIETLRKKGLLPYSTKEPAD  796
            DMY GAI+T ++KGLLP + + P++
Sbjct  310  DMYTGAIDTCKEKGLLPKAAENPSN  334



>ref|XP_004291858.1| PREDICTED: bifunctional dihydroflavonol 4-reductase/flavanone 
4-reductase-like [Fragaria vesca subsp. vesca]
 gb|AHL46446.1| dihydroflavonol 4-reductase [Fragaria vesca]
 gb|AHL46447.1| dihydroflavonol 4-reductase [Fragaria vesca]
Length=349

 Score =   325 bits (833),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 163/273 (60%), Positives = 212/273 (78%), Gaps = 7/273 (3%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+L I+ +C KAKTV++LVFT+S  +V
Sbjct  73   EAIKGCTGVFHVATPMDFESKDPENEVIKPTINGVLDIMKACLKAKTVRRLVFTASAGSV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++ETQ+  Y+ES+WSD++F    KM GWMYF SKTLAE+EAWK AKE  I+FI+IIP L
Sbjct  133  NVEETQKPVYNESNWSDVEFCRRVKMTGWMYFVSKTLAEQEAWKFAKENNIDFITIIPTL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            VIGPFL+P  P SL+T LSP+    GN  H++IIKQG+FVHLDDLC++ I+LY+HPKA G
Sbjct  193  VIGPFLMPAMPPSLITGLSPLF---GNEGHYSIIKQGQFVHLDDLCQSHIYLYEHPKAEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATIH++ K++R  +PEY VP++FKGIE  L  V FSSKKL E GF+FKY+LE
Sbjct  250  RYICSSHDATIHEIGKLLREKYPEYNVPTKFKGIEDNLTKVHFSSKKLLETGFEFKYSLE  309

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQHSG  820
            DM+ GA++  + KGLLP     P +  ++Q +G
Sbjct  310  DMFVGAVDACKAKGLLP----PPTERVEKQENG  338



>ref|XP_011007452.1| PREDICTED: dihydroflavonol-4-reductase [Populus euphratica]
Length=373

 Score =   326 bits (835),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 157/264 (59%), Positives = 209/264 (79%), Gaps = 3/264 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EA+ GC GVFHVA  ++F SKDPENEVIKP + G+L I+ +CAKAKTV+++VFTSS   V
Sbjct  73   EAVQGCTGVFHVATPMDFESKDPENEVIKPTINGVLDIMKACAKAKTVRRVVFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E ++  YDE+ WSDL+F+   KM GWMYF SKTLAE+ AWK AKE  ++FIS+IPPL
Sbjct  133  DVEEHKKTVYDETCWSDLEFVQTVKMTGWMYFVSKTLAEQAAWKYAKENNLDFISVIPPL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF++P+ P SL+TALS I    GN  H+ IIKQG +VHLDDLC A I L+++PKA G
Sbjct  193  VVGPFIMPSMPPSLITALSLI---TGNEAHYGIIKQGNYVHLDDLCRAHIVLFENPKAEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATIHD+AK++R  +PEY VP++FK I+++L  V FSSKKL ++GF+FKY+LE
Sbjct  250  RYICSSHEATIHDLAKLLREKYPEYNVPAKFKDIDEDLASVVFSSKKLMDLGFEFKYSLE  309

Query  722  DMYKGAIETLRKKGLLPYSTKEPA  793
            +M+ GA+ET R+KGL+P S ++ A
Sbjct  310  EMFAGAVETCREKGLIPLSHEKQA  333



>sp|P51110.1|DFRA_VITVI RecName: Full=Dihydroflavonol-4-reductase; Short=DFR; AltName: 
Full=Dihydrokaempferol 4-reductase [Vitis vinifera]
 emb|CAA53578.1| dihydroflavonol reductase [Vitis vinifera]
Length=337

 Score =   324 bits (831),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 160/265 (60%), Positives = 206/265 (78%), Gaps = 3/265 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP ++G+L I+ SCA AKTV++LVFTSS   V
Sbjct  73   EAIKGCTGVFHVATPMDFESKDPENEVIKPTIEGMLGIMKSCAAAKTVRRLVFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +I+E Q   YDES WSD++F  A KM  WMYF SKTLAE+ AWK AKE  I+FI+IIP L
Sbjct  133  NIQEHQLPVYDESCWSDMEFCRAKKMTAWMYFVSKTLAEQAAWKYAKENNIDFITIIPTL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF++ + P SL+TALSPI    GN  H++II+QG+FVHLDDLC A I+L+++PKA G
Sbjct  193  VVGPFIMSSMPPSLITALSPI---TGNEAHYSIIRQGQFVHLDDLCNAHIYLFENPKAEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH   I D+AKM+R  +PEY +P+EFKG+++ L  V FSSKKL ++GF+FKY+LE
Sbjct  250  RYICSSHDCIILDLAKMLREKYPEYNIPTEFKGVDENLKSVCFSSKKLTDLGFEFKYSLE  309

Query  722  DMYKGAIETLRKKGLLPYSTKEPAD  796
            DM+ GA++T R KGLL  S ++P D
Sbjct  310  DMFTGAVDTCRAKGLLRPSHEKPVD  334



>gb|AFF60412.1| dihydroflavonol reductase [Pyrus pyrifolia]
Length=347

 Score =   324 bits (831),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 159/257 (62%), Positives = 204/257 (79%), Gaps = 3/257 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+L I+ +C KAKTV+KLVFTSS   V
Sbjct  73   EAIQGCSGVFHVATPMDFESKDPENEVIKPTINGLLDILKACQKAKTVRKLVFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E Q+  YDES+WSD++F  + KM GWMYF SKTLAE+ AWK AKE  I+FI+IIP L
Sbjct  133  NVEEHQKPVYDESNWSDVEFCRSVKMTGWMYFVSKTLAEQAAWKYAKENNIDFITIIPTL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            VIGPFL+P+ P SL+T LSPI+    N  H+ IIKQG++VHLDDLC + I+LY+HPKA G
Sbjct  193  VIGPFLMPSMPPSLITGLSPILR---NESHYGIIKQGQYVHLDDLCLSHIYLYEHPKAEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATIH++ KM+R  +PEY +P++FKGI+  L  V FSSKKL+E+GF+FKY+LE
Sbjct  250  RYICSSHDATIHELVKMLREKYPEYNIPTKFKGIDDNLEPVHFSSKKLREIGFEFKYSLE  309

Query  722  DMYKGAIETLRKKGLLP  772
            DM+ GA++  R KGL+P
Sbjct  310  DMFVGAVDACRAKGLIP  326



>ref|XP_009365091.1| PREDICTED: bifunctional dihydroflavonol 4-reductase/flavanone 
4-reductase [Pyrus x bretschneideri]
Length=347

 Score =   324 bits (830),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 159/257 (62%), Positives = 204/257 (79%), Gaps = 3/257 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+L I+ +C KAKTV+KLVFTSS   V
Sbjct  73   EAIQGCSGVFHVATPMDFESKDPENEVIKPTINGLLDILKACQKAKTVRKLVFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E Q+  YDES+WSD++F  + KM GWMYF SKTLAE+ AWK AKE  I+FI+IIP L
Sbjct  133  NVEEHQKPVYDESNWSDVEFCRSVKMTGWMYFVSKTLAEQAAWKYAKENNIDFITIIPTL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            VIGPFL+P+ P SL+T LSPI+    N  H+ IIKQG++VHLDDLC + I+LY+HPKA G
Sbjct  193  VIGPFLMPSMPPSLITGLSPILR---NESHYGIIKQGQYVHLDDLCLSHIYLYEHPKAEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATIH++ KM+R  +PEY +P++FKGI+  L  V FSSKKL+E+GF+FKY+LE
Sbjct  250  RYICSSHDATIHELVKMLREKYPEYNIPTKFKGIDDNLEPVHFSSKKLREIGFEFKYSLE  309

Query  722  DMYKGAIETLRKKGLLP  772
            DM+ GA++  R KGL+P
Sbjct  310  DMFVGAVDACRAKGLIP  326



>gb|AFK35141.1| unknown [Lotus japonicus]
Length=336

 Score =   323 bits (829),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 159/265 (60%), Positives = 210/265 (79%), Gaps = 3/265 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+L I+ +C KAKTV++LVFTSS   +
Sbjct  73   EAIKGCTGVFHVATPMDFESKDPENEVIKPTINGVLDIMKACQKAKTVRRLVFTSSAGTL  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            ++ E Q+  +DES WSD++F    KM GWMYF SKTLAE+EAWK AKE  I+FI+IIPPL
Sbjct  133  NVIEHQKQMFDESCWSDVEFCRRVKMTGWMYFVSKTLAEQEAWKFAKEHGIDFITIIPPL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+G FL+PT P SL+TALSPI    GN  H++IIKQG++VHLDDLC A IFL++HP++ G
Sbjct  193  VVGSFLMPTMPPSLITALSPI---TGNEAHYSIIKQGQYVHLDDLCLAHIFLFEHPESEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICS+  ATIHD+AK+I   +PEY +P++FK I  EL +V FSSKK++++GF+FKY+LE
Sbjct  250  RYICSASEATIHDIAKLINSKYPEYNIPTKFKNIPDELELVRFSSKKIKDIGFEFKYSLE  309

Query  722  DMYKGAIETLRKKGLLPYSTKEPAD  796
            DMY GAI+T ++KGLLP + + P++
Sbjct  310  DMYTGAIDTCKEKGLLPKAAENPSN  334



>ref|XP_007017586.1| Dihydroflavonol-4-reductase [Theobroma cacao]
 gb|EOY14811.1| Dihydroflavonol-4-reductase [Theobroma cacao]
Length=345

 Score =   324 bits (830),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 161/263 (61%), Positives = 206/263 (78%), Gaps = 3/263 (1%)
 Frame = +2

Query  5    AIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAVH  184
            AI GC GVFHVA  ++F SKDPENEVIKP + G+L I+ +C KAKTVKKLVFTSS   V+
Sbjct  74   AIQGCTGVFHVATPMDFESKDPENEVIKPTINGVLDIMKACVKAKTVKKLVFTSSAGTVN  133

Query  185  IKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPLV  364
            ++E Q+  YDES+WSDL+F+YA KM GWMYF SKTLAE+ AWK AKE  ++FI+IIP LV
Sbjct  134  VEERQKPVYDESNWSDLEFVYAKKMTGWMYFVSKTLAEQAAWKFAKENNLDFITIIPTLV  193

Query  365  IGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGGR  544
            IGPFL+ + P SL+T LSPI    GN  H+ II+QG+FVHLDDLC A IFL+++PKA GR
Sbjct  194  IGPFLMSSMPPSLITGLSPI---TGNEAHYTIIRQGQFVHLDDLCMAHIFLFENPKAEGR  250

Query  545  FICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLED  724
            +ICSSH ATI ++AKM+R  +P+Y +P++FK  ++ L  V FSSKKL ++GFQFKY+LED
Sbjct  251  YICSSHEATIVELAKMLREKYPDYNIPTKFKDADENLANVVFSSKKLLDLGFQFKYSLED  310

Query  725  MYKGAIETLRKKGLLPYSTKEPA  793
            M+  A+ET R+KGL+P   K+ A
Sbjct  311  MFTEAVETCREKGLIPAPIKKDA  333



>gb|AGZ15302.1| dihydroflavonol 4-reductase [Pyrus x bretschneideri]
Length=347

 Score =   324 bits (830),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 159/257 (62%), Positives = 204/257 (79%), Gaps = 3/257 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+L I+ +C KAKTV+KLVFTSS   V
Sbjct  73   EAIQGCSGVFHVATPMDFESKDPENEVIKPTINGLLDILKACQKAKTVRKLVFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E Q+  YDES+WSD++F  + KM GWMYF SKTLAE+ AWK AKE  I+FI+IIP L
Sbjct  133  NVEEHQKPVYDESNWSDVEFCRSVKMTGWMYFVSKTLAEQAAWKYAKENNIDFITIIPTL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            VIGPFL+P+ P SL+T LSPI+    N  H+ IIKQG++VHLDDLC + I+LY+HPKA G
Sbjct  193  VIGPFLMPSMPPSLITGLSPILR---NESHYGIIKQGQYVHLDDLCLSHIYLYEHPKAEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATIH++ KM+R  +PEY +P++FKGI+  L  V FSSKKL+E+GF+FKY+LE
Sbjct  250  RYICSSHDATIHELVKMLREKYPEYNIPTKFKGIDDNLEPVHFSSKKLREIGFEFKYSLE  309

Query  722  DMYKGAIETLRKKGLLP  772
            DM+ GA++  R KGL+P
Sbjct  310  DMFVGAVDACRAKGLIP  326



>gb|AAO39816.1| dihydroflavonol 4-reductase [Malus domestica]
Length=348

 Score =   323 bits (829),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 159/257 (62%), Positives = 204/257 (79%), Gaps = 3/257 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+L I+ +C KAKTV+KLVFTSS   V
Sbjct  73   EAIQGCSGVFHVATPMDFESKDPENEVIKPTINGLLDILKACQKAKTVRKLVFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E Q+  YDES+WSD++F  + KM GWMYF SKTLAE+ AWK AKE  I+FI+IIP L
Sbjct  133  NVEEHQKPVYDESNWSDVEFCRSVKMTGWMYFVSKTLAEQAAWKYAKENNIDFITIIPTL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            VIGPFL+P+ P SL+T LSPI+    N  H+ IIKQG++VHLDDLC + I+LY+HPKA G
Sbjct  193  VIGPFLMPSMPPSLITGLSPILR---NESHYGIIKQGQYVHLDDLCLSHIYLYEHPKAEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATIH++ KM+R  +PEY +P++FKGI+  L  V FSSKKL+E+GF+FKY+LE
Sbjct  250  RYICSSHDATIHELVKMLREKYPEYNIPTKFKGIDDNLEPVHFSSKKLREIGFEFKYSLE  309

Query  722  DMYKGAIETLRKKGLLP  772
            DM+ GA++  R KGL+P
Sbjct  310  DMFVGAVDACRAKGLIP  326



>ref|NP_001280868.1| bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase 
[Malus domestica]
 sp|Q9XES5.1|DFRA_MALDO RecName: Full=Bifunctional dihydroflavonol 4-reductase/flavanone 
4-reductase; AltName: Full=Dihydroflavonol 4-reductase; 
Short=DFR; AltName: Full=Dihydrokaempferol 4-reductase; AltName: 
Full=Flavanone 4-reductase; Short=FNR [Malus domestica]
 gb|AAD26204.1|AF117268_1 dihydroflavonol reductase [Malus domestica]
 gb|AAO39817.1| dihydroflavonol 4-reductase [Malus domestica]
Length=348

 Score =   323 bits (829),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 159/257 (62%), Positives = 204/257 (79%), Gaps = 3/257 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+L I+ +C KAKTV+KLVFTSS   V
Sbjct  73   EAIQGCSGVFHVATPMDFESKDPENEVIKPTINGLLDILKACQKAKTVRKLVFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E Q+  YDES+WSD++F  + KM GWMYF SKTLAE+ AWK AKE  I+FI+IIP L
Sbjct  133  NVEEHQKPVYDESNWSDVEFCRSVKMTGWMYFVSKTLAEQAAWKYAKENNIDFITIIPTL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            VIGPFL+P+ P SL+T LSPI+    N  H+ IIKQG++VHLDDLC + I+LY+HPKA G
Sbjct  193  VIGPFLMPSMPPSLITGLSPILR---NESHYGIIKQGQYVHLDDLCLSHIYLYEHPKAEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATIH++ KM+R  +PEY +P++FKGI+  L  V FSSKKL+E+GF+FKY+LE
Sbjct  250  RYICSSHDATIHELVKMLREKYPEYNIPTKFKGIDDNLEPVHFSSKKLREIGFEFKYSLE  309

Query  722  DMYKGAIETLRKKGLLP  772
            DM+ GA++  R KGL+P
Sbjct  310  DMFVGAVDACRAKGLIP  326



>gb|AAF23884.2|AF117263_1 dihydroflavanol reductase 3 [Lotus corniculatus]
Length=336

 Score =   323 bits (828),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 159/265 (60%), Positives = 210/265 (79%), Gaps = 3/265 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SK+PENEVIKP + G+L I+ +C KAKTV++LVFTSS   +
Sbjct  73   EAIKGCTGVFHVATPMDFESKNPENEVIKPTINGVLDIMKACQKAKTVRRLVFTSSAGTL  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            ++ E Q+  +DES WSD++F    KM GWMYF SKTLAE+EAWK AKE  I+FI+IIPPL
Sbjct  133  NVIEHQKQMFDESCWSDVEFCRRVKMTGWMYFVSKTLAEQEAWKFAKEHGIDFITIIPPL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+G FL+PT P SL+TALSPI    GN  H++IIKQG++VHLDDLC A IFL++HP++ G
Sbjct  193  VVGSFLMPTMPPSLITALSPI---TGNEAHYSIIKQGQYVHLDDLCLAHIFLFEHPESEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICS+  ATIHD+AK+I   +PEY +P++FK I  EL +V FSSKK+++MGF+FKY+LE
Sbjct  250  RYICSASEATIHDIAKLINSKYPEYNIPTKFKNIPDELELVRFSSKKIKDMGFEFKYSLE  309

Query  722  DMYKGAIETLRKKGLLPYSTKEPAD  796
            DMY GAI+T ++KGLLP + + P++
Sbjct  310  DMYTGAIDTCKEKGLLPKAAENPSN  334



>gb|AGZ15301.1| dihydroflavonol 4-reductase [Pyrus x bretschneideri]
Length=347

 Score =   323 bits (828),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 159/257 (62%), Positives = 204/257 (79%), Gaps = 3/257 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+L I+ +C KAKTV+KLVFTSS   V
Sbjct  73   EAIQGCSGVFHVATPMDFESKDPENEVIKPTINGLLDILKACQKAKTVRKLVFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E Q+  YDES+WSD++F  + KM GWMYF SKTLAE+ AWK AKE  I+FI+IIP L
Sbjct  133  NVEEHQKPVYDESNWSDVEFCRSVKMTGWMYFVSKTLAEQAAWKYAKENNIDFITIIPTL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            VIGPFL+P+ P SL+T LSPI+    N  H+ IIKQG++VHLDDLC + I+LY+HPKA G
Sbjct  193  VIGPFLMPSMPPSLITGLSPILR---NESHYGIIKQGQYVHLDDLCLSHIYLYKHPKAEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATIH++ KM+R  +PEY +P++FKGI+  L  V FSSKKL+E+GF+FKY+LE
Sbjct  250  RYICSSHDATIHELVKMLREKYPEYNIPTKFKGIDDNLEPVHFSSKKLREIGFEFKYSLE  309

Query  722  DMYKGAIETLRKKGLLP  772
            DM+ GA++  R KGL+P
Sbjct  310  DMFVGAVDACRAKGLIP  326



>gb|AAO39818.1| dihydroflavonol 4-reductase [Pyrus communis]
 gb|AAO39819.1| dihydroflavonol 4-reductase [Pyrus communis]
 gb|AGL50917.1| dihydroflavonol 4-reductase [Pyrus communis]
 gb|AGL81349.1| dihydroflavonol 4-reductase 1 [Pyrus communis]
 gb|AGL81350.1| dihydroflavonol 4-reductase 2 [Pyrus communis]
Length=347

 Score =   323 bits (828),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 159/257 (62%), Positives = 204/257 (79%), Gaps = 3/257 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+L I+ +C KAKTV+KLVFTSS   V
Sbjct  73   EAIQGCSGVFHVATPMDFESKDPENEVIKPTINGLLDILKACQKAKTVRKLVFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E Q+  YDES+WSD++F  + KM GWMYF SKTLAE+ AWK AKE  I+FI+IIP L
Sbjct  133  NVEEHQKPVYDESNWSDVEFCRSVKMTGWMYFVSKTLAEQAAWKYAKENNIDFITIIPTL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            VIGPFL+P+ P SL+T LSPI+    N  H+ IIKQG++VHLDDLC + I+LY+HPKA G
Sbjct  193  VIGPFLMPSMPPSLITGLSPILR---NESHYGIIKQGQYVHLDDLCLSHIYLYKHPKAEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATIH++ KM+R  +PEY +P++FKGI+  L  V FSSKKL+E+GF+FKY+LE
Sbjct  250  RYICSSHDATIHELVKMLREKYPEYNIPTKFKGIDDNLEPVHFSSKKLREIGFEFKYSLE  309

Query  722  DMYKGAIETLRKKGLLP  772
            DM+ GA++  R KGL+P
Sbjct  310  DMFVGAVDACRAKGLIP  326



>gb|AAX16491.1| dihydroflavonol 4-reductase [Crataegus monogyna]
Length=347

 Score =   323 bits (828),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 159/257 (62%), Positives = 204/257 (79%), Gaps = 3/257 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+L I+ +C KAKTV+KLVFTSS   V
Sbjct  73   EAIQGCSGVFHVATPMDFESKDPENEVIKPTINGLLDILKACQKAKTVRKLVFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E Q+  YDES+WSD++F  + KM GWMYF SKTLAE+ AWK AKE  I+FI+IIP L
Sbjct  133  NVEEHQKPVYDESNWSDVEFCRSVKMTGWMYFVSKTLAEQAAWKYAKENNIDFITIIPTL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            VIGPFL+P+ P SL+T LSPI+    N  H+ IIKQG++VHLDDLC + I+LY+HPKA G
Sbjct  193  VIGPFLMPSMPPSLITGLSPILR---NESHYGIIKQGQYVHLDDLCLSHIYLYKHPKAEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATIH++ KM+R  +PEY +P++FKGI+  L  V FSSKKL+E+GF+FKY+LE
Sbjct  250  RYICSSHDATIHELVKMLREKYPEYNIPTKFKGIDDNLEPVHFSSKKLREIGFEFKYSLE  309

Query  722  DMYKGAIETLRKKGLLP  772
            DM+ GA++  R KGL+P
Sbjct  310  DMFVGAVDACRAKGLIP  326



>dbj|BAE19950.1| dihydroflavonol 4-reductase [Lotus japonicus]
Length=340

 Score =   323 bits (827),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/265 (60%), Positives = 208/265 (78%), Gaps = 3/265 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA+ ++F SKDPENEVIKP++ G+L I+ +C KAKTV++LVFTSS   +
Sbjct  74   EAINGCSGVFHVASPMDFNSKDPENEVIKPSINGVLDIMKACQKAKTVRRLVFTSSAGTL  133

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +  E Q+   DES WSD++F    KM GWMYF SKTLAE+EAWK A+E  I+FI+IIP L
Sbjct  134  NAVEHQKQMCDESCWSDVEFCRRVKMTGWMYFVSKTLAEQEAWKFAQEHDIDFITIIPSL  193

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+G FL+PT P SL TALSPI    GN  H++IIKQG++VHLDDLC A IFL++HPK+ G
Sbjct  194  VVGSFLMPTLPPSLTTALSPI---TGNEAHYSIIKQGQYVHLDDLCLAHIFLFEHPKSEG  250

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICS+  ATIHD+AK+I   +PEY VP++FK I  EL +V FSSKK+++MGF+FKY+LE
Sbjct  251  RYICSASEATIHDIAKLINSKYPEYNVPTKFKNIPDELELVRFSSKKIKDMGFEFKYSLE  310

Query  722  DMYKGAIETLRKKGLLPYSTKEPAD  796
            DMY GAI+T ++KGLLP + + P++
Sbjct  311  DMYTGAIDTCKEKGLLPKAAENPSN  335



>gb|AHL46450.1| dihydroflavonol 4-reductase [Fragaria x ananassa]
Length=349

 Score =   323 bits (828),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 161/273 (59%), Positives = 210/273 (77%), Gaps = 7/273 (3%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+L I+ +C KAKTV++LVFT+S  +V
Sbjct  73   EAIKGCTGVFHVATPMDFESKDPENEVIKPTINGVLDIMKACLKAKTVRRLVFTASAGSV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++ETQ+  Y+ES+WSD++F    KM GWMYF SKTLAE+EAWK AK   I+ I+IIP L
Sbjct  133  NVEETQKPVYNESNWSDVEFCRRVKMTGWMYFVSKTLAEQEAWKFAKGNNIDLITIIPTL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            VIGPFL+P  P SL+T LSP+    GN  H++IIKQG+FVHLDDLC++ I+LY+HPKA G
Sbjct  193  VIGPFLMPAMPPSLITGLSPLF---GNEGHYSIIKQGQFVHLDDLCQSHIYLYEHPKAEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATIH++ K++R  +PEY VP++FKGIE  L  V FSSKKL E GF+FKY+LE
Sbjct  250  RYICSSHDATIHEIGKLLREKYPEYNVPTKFKGIEDNLTKVHFSSKKLLETGFEFKYSLE  309

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQHSG  820
            DM+ GA++  + KGLLP     P +  ++Q +G
Sbjct  310  DMFVGAVDACKAKGLLP----PPTERVEKQENG  338



>sp|Q84KP0.1|DFRA_PYRCO RecName: Full=Bifunctional dihydroflavonol 4-reductase/flavanone 
4-reductase; AltName: Full=Dihydroflavonol 4-reductase; 
Short=DFR; AltName: Full=Flavanone 4-reductase; Short=FNR [Pyrus 
communis]
 gb|AAO39820.1| putative dihydroflavonol 4-reductase [Pyrus communis]
Length=347

 Score =   323 bits (827),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 158/257 (61%), Positives = 204/257 (79%), Gaps = 3/257 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F S+DPENEVIKP + G+L I+ +C KAKTV+KLVFTSS   V
Sbjct  73   EAIQGCSGVFHVATPMDFESRDPENEVIKPTINGLLDILKACQKAKTVRKLVFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E Q+  YDES+WSD++F  + KM GWMYF SKTLAE+ AWK AKE  I+FI+IIP L
Sbjct  133  NVEEHQKPVYDESNWSDVEFCRSVKMTGWMYFVSKTLAEQAAWKYAKENNIDFITIIPTL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            VIGPFL+P+ P SL+T LSPI+    N  H+ IIKQG++VHLDDLC + I+LY+HPKA G
Sbjct  193  VIGPFLMPSMPPSLITGLSPILR---NESHYGIIKQGQYVHLDDLCLSHIYLYKHPKAEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATIH++ KM+R  +PEY +P++FKGI+  L  V FSSKKL+E+GF+FKY+LE
Sbjct  250  RYICSSHDATIHELVKMLREKYPEYNIPTKFKGIDDNLEPVHFSSKKLREIGFEFKYSLE  309

Query  722  DMYKGAIETLRKKGLLP  772
            DM+ GA++  R KGL+P
Sbjct  310  DMFVGAVDACRAKGLIP  326



>gb|AHZ30596.1| dihydroflavonol reductase, partial [Prunus domestica]
Length=340

 Score =   322 bits (826),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 156/262 (60%), Positives = 206/262 (79%), Gaps = 3/262 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+L I+ +C KAKTV++LVFTSS   V
Sbjct  67   EAIQGCTGVFHVATPMDFESKDPENEVIKPTINGVLDILKACLKAKTVRRLVFTSSAGTV  126

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +I+E Q+  YDE++WSD++F  + KM GWMYF SKTLAE+ AWK AKE  I+FI+IIP L
Sbjct  127  NIEENQKSFYDETNWSDVEFCRSVKMTGWMYFVSKTLAEQAAWKFAKENNIDFITIIPTL  186

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            VIGPFL+P+ P SL+T LSP+    GN  H++IIK+G+FVHLDDLC + I+LY+HPKA G
Sbjct  187  VIGPFLMPSMPPSLITGLSPL---TGNTSHYSIIKRGQFVHLDDLCLSHIYLYEHPKAEG  243

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATI+D+AK++R  +PEY +P++F  IE+ L  + FSSKKL + GF+FKY L+
Sbjct  244  RYICSSHDATIYDIAKLLREKYPEYNIPTKFDNIEENLTNIHFSSKKLTDQGFEFKYNLD  303

Query  722  DMYKGAIETLRKKGLLPYSTKE  787
            DM+ GA++T R KGL+P S ++
Sbjct  304  DMFVGAVDTCRAKGLIPISAEK  325



>ref|XP_011028872.1| PREDICTED: dihydroflavonol-4-reductase-like isoform X1 [Populus 
euphratica]
Length=346

 Score =   322 bits (826),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 161/273 (59%), Positives = 210/273 (77%), Gaps = 3/273 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+L I+ +CAK+KTV+K++FTSS   V
Sbjct  73   EAIQGCTGVFHVATPMDFESKDPENEVIKPTINGVLDIMRACAKSKTVRKIIFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E ++  YDES WSDLDF+   KM GWMYF SKTLAE+ AWK AKE  ++FISIIP L
Sbjct  133  DVEEKRKPVYDESCWSDLDFVQRIKMTGWMYFVSKTLAEQAAWKFAKENNLDFISIIPTL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF++ + P SL+TALS I    GN  H+ IIKQG +VHLDDLC + IFLY++PKA G
Sbjct  193  VVGPFIMQSMPPSLLTALSLI---TGNEAHYGIIKQGHYVHLDDLCMSHIFLYENPKAEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+IC+S  A IHD+AK++R  +PEY VP+ FK I++ LP V+FSSKKL ++GF+FKY+LE
Sbjct  250  RYICNSDDANIHDLAKLLREKYPEYNVPAMFKDIDENLPCVAFSSKKLTDLGFEFKYSLE  309

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQHSG  820
            DM  GA+ET R+KGL+P S K+ A  E +++ G
Sbjct  310  DMVVGAVETCREKGLIPLSHKKQAVEECKENEG  342



>gb|AEN71545.1| dihydroflavonol 4-reductase [Paeonia suffruticosa]
Length=364

 Score =   323 bits (827),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 163/257 (63%), Positives = 202/257 (79%), Gaps = 3/257 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+LSI+ + AKAKTV+++VFTSS   V
Sbjct  77   EAIKGCTGVFHVATPMDFESKDPENEVIKPTIDGMLSIMRAWAKAKTVRRVVFTSSAGTV  136

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            ++++ QQ  YDE+ WSD++FI   KM GWMYF SK LAE+ AWK AKE  I+FISIIP L
Sbjct  137  NVQQHQQSVYDETCWSDMEFIQTKKMTGWMYFVSKILAEQAAWKFAKENSIDFISIIPTL  196

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPFL+P+ P SLVTALS I    GN  H++IIKQG+FVHLDDLC A I+L++HPK  G
Sbjct  197  VVGPFLMPSMPPSLVTALSLI---TGNEAHYSIIKQGQFVHLDDLCNAHIYLFEHPKVEG  253

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATI  +AKM+R  +PEY VP+EFK +++ L  VSFSSKKL + GF+FKY LE
Sbjct  254  RYICSSHDATIFSLAKMLRDKYPEYNVPTEFKDVDESLKSVSFSSKKLMDSGFEFKYNLE  313

Query  722  DMYKGAIETLRKKGLLP  772
            DM+ GAIET R+KGLLP
Sbjct  314  DMFVGAIETCREKGLLP  330



>gb|AHL46445.1| dihydroflavonol 4-reductase [Fragaria vesca]
 gb|AHL46449.1| dihydroflavonol 4-reductase [Fragaria vesca]
Length=349

 Score =   322 bits (825),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 162/273 (59%), Positives = 211/273 (77%), Gaps = 7/273 (3%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+L I+ +C KAKTV++LVFT+S  +V
Sbjct  73   EAIKGCTGVFHVATPMDFESKDPENEVIKPTINGVLDIMKACLKAKTVRRLVFTASAGSV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++ETQ+  Y+ES+WSD++F    KM GWMYF SKTLAE+EAWK AKE  I+FI+IIP L
Sbjct  133  NVEETQKPVYNESNWSDVEFCRRVKMTGWMYFVSKTLAEQEAWKFAKENNIDFITIIPTL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            VIGPFL+P  P SL+T L P+    GN  H++IIKQG+FVHLDDLC++ I+LY+HPKA G
Sbjct  193  VIGPFLMPAMPPSLITGLLPLF---GNEGHYSIIKQGQFVHLDDLCQSHIYLYEHPKAEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATIH++ K++R  +PEY VP++FKGIE  L  V FSSKKL E GF+FKY+LE
Sbjct  250  RYICSSHDATIHEIGKLLREKYPEYNVPTKFKGIEDNLTKVHFSSKKLLETGFEFKYSLE  309

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQHSG  820
            DM+ GA++  + KGLLP     P +  ++Q +G
Sbjct  310  DMFVGAVDACKAKGLLP----PPTERVEKQENG  338



>dbj|BAF49294.1| dihydroflavanol 4-reductase [Clitoria ternatea]
Length=339

 Score =   322 bits (824),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 158/265 (60%), Positives = 204/265 (77%), Gaps = 3/265 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPE EVIKP + G+L I+ +C KAK+V++LVFTSS   V
Sbjct  73   EAIKGCNGVFHVATPMDFESKDPEKEVIKPTIDGLLDIMRACKKAKSVRRLVFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             + E  +  +DE+ WSD+DF    +M GWMYF SKTLAE+EAW  AKE+ I+FIS+IPPL
Sbjct  133  DVSENSKDVFDENCWSDVDFCRRVQMTGWMYFVSKTLAEQEAWNFAKEQNIDFISVIPPL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPFL+PT P SL+TALS I    GN  H+ IIKQG+FVHLDDLC A IFL+QHP+A G
Sbjct  193  VVGPFLLPTMPPSLITALSLI---TGNEAHYPIIKQGQFVHLDDLCLAHIFLFQHPQAQG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+IC SH ATIHD+AK++   +P+Y+VP++FK I  EL I+ FSSKK+ +MGF+FKY+LE
Sbjct  250  RYICCSHEATIHDIAKLLNQIYPDYHVPTKFKNIPVELEIIRFSSKKIMDMGFKFKYSLE  309

Query  722  DMYKGAIETLRKKGLLPYSTKEPAD  796
            DM+ GA+ET R+KGL+P   + P +
Sbjct  310  DMFTGAVETCREKGLIPKPEETPLN  334



>ref|XP_002307667.2| dihydroflavonol reductase family protein [Populus trichocarpa]
 gb|EEE94663.2| dihydroflavonol reductase family protein [Populus trichocarpa]
Length=350

 Score =   322 bits (825),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 159/276 (58%), Positives = 214/276 (78%), Gaps = 4/276 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EA+ GC GVFHVA  ++F SKDPENEVIKP + G+L I+ +CAKAKTV+++VFTSS   V
Sbjct  73   EAVQGCTGVFHVATPMDFESKDPENEVIKPTINGVLDIMKACAKAKTVRRIVFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E ++  YDES WSDL+F+   KM GWMYF SKTLAE+ AWK AKE  ++FIS+IPPL
Sbjct  133  DVEEHKKPVYDESCWSDLEFVQTVKMTGWMYFVSKTLAEQAAWKYAKENNLDFISVIPPL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF++ + P SL+TALS I    GN  H+ IIKQG +VHLDDLC A I L+++PKA G
Sbjct  193  VVGPFIMHSMPPSLITALSLI---TGNEAHYGIIKQGNYVHLDDLCRAHIVLFENPKAEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATIHD+AK++R  +P+Y VP++FK I+++L  V FSSKKL ++GF+FKY+LE
Sbjct  250  RYICSSHEATIHDLAKLLREKYPKYNVPAKFKDIDEDLASVVFSSKKLLDLGFEFKYSLE  309

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQHSGKEP  829
            +M+ GA+ET R+KGL+P S ++ A  E  + +G+ P
Sbjct  310  EMFAGAVETCREKGLIPLSHEKQA-AEDNKENGRVP  344



>gb|ACP30362.1| dihydroflavonol-4-reductase protein [Malus hybrid cultivar]
Length=348

 Score =   322 bits (825),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 158/257 (61%), Positives = 203/257 (79%), Gaps = 3/257 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+L I+ +C KAKTV+KLVFTSS   V
Sbjct  73   EAIQGCSGVFHVATPMDFESKDPENEVIKPTINGLLDILKACQKAKTVRKLVFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E Q+  YDES+WSD++F  + KM GWMYF SKTLAE+ AWK AKE  I+FI+IIP L
Sbjct  133  NVEEHQKPVYDESNWSDVEFCRSVKMTGWMYFVSKTLAEQAAWKYAKENNIDFITIIPTL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            VIGPFL+P+ P SL+T LSPI+    N  H+ IIKQG++VHLDDLC +  +LY+HPKA G
Sbjct  193  VIGPFLMPSMPPSLITGLSPILR---NESHYGIIKQGQYVHLDDLCLSHTYLYEHPKAEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATIH++ KM+R  +PEY +P++FKGI+  L  V FSSKKL+E+GF+FKY+LE
Sbjct  250  RYICSSHDATIHELVKMLREKYPEYNIPTKFKGIDDNLEPVHFSSKKLREIGFEFKYSLE  309

Query  722  DMYKGAIETLRKKGLLP  772
            DM+ GA++  R KGL+P
Sbjct  310  DMFVGAVDACRAKGLIP  326



>ref|XP_007222317.1| hypothetical protein PRUPE_ppa008069mg [Prunus persica]
 gb|AEJ88220.1| dihydroflavonol 4-reductase [Prunus persica]
 gb|EMJ23516.1| hypothetical protein PRUPE_ppa008069mg [Prunus persica]
Length=346

 Score =   321 bits (823),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 155/257 (60%), Positives = 204/257 (79%), Gaps = 3/257 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+L I+ +C KAKTV++LVFTSS   V
Sbjct  73   EAIQGCTGVFHVATPMDFESKDPENEVIKPTINGVLDILKACLKAKTVRRLVFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E Q+  YDE+ WSD++F  + KM GWMYFASKTLAE+ AWK AKE  I+FI+IIP L
Sbjct  133  NVEEHQKSYYDETDWSDVEFCRSVKMTGWMYFASKTLAEQAAWKFAKENNIDFITIIPTL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            VIGPFL+P+ P SL+T LSP+    GN  H++IIK+G+FVHLDDLC + I+LY+HPKA G
Sbjct  193  VIGPFLMPSMPPSLITGLSPL---TGNTSHYSIIKRGQFVHLDDLCLSHIYLYEHPKAEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATI+D+AK++R  +PEY +P++F  IE+ L  + FSSKKL + GF+FKY+LE
Sbjct  250  RYICSSHDATIYDIAKLLREKYPEYNIPTKFDNIEENLTNIHFSSKKLTDHGFEFKYSLE  309

Query  722  DMYKGAIETLRKKGLLP  772
            DM+ GA++T R +GL+P
Sbjct  310  DMFVGAVDTCRARGLIP  326



>ref|XP_009336072.1| PREDICTED: bifunctional dihydroflavonol 4-reductase/flavanone 
4-reductase-like [Pyrus x bretschneideri]
Length=347

 Score =   321 bits (823),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 157/257 (61%), Positives = 203/257 (79%), Gaps = 3/257 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+L I+ +C KAKTV++LVFTSS   V
Sbjct  73   EAIQGCSGVFHVATPMDFESKDPENEVIKPTINGLLDILKACQKAKTVRQLVFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E Q+  YDES+WSD++F  + KM GWMYF SKTLAE+ AWK AKE  I+FI+IIP L
Sbjct  133  NVEEHQKPVYDESNWSDVEFCRSVKMTGWMYFVSKTLAEQAAWKYAKENNIDFITIIPTL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            VIGPFL+P+ P SL+T LSPI+    N  H+ IIKQG++VHLDDLC + I+LY+HPKA G
Sbjct  193  VIGPFLMPSMPPSLITGLSPILR---NESHYGIIKQGQYVHLDDLCLSHIYLYEHPKAEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH  TIH++ KM+R  +PEY +P++FKGI+  L  V FSSKKL+E+GF+FKY+LE
Sbjct  250  RYICSSHDTTIHELVKMLREKYPEYNIPTKFKGIDDNLEPVHFSSKKLREIGFEFKYSLE  309

Query  722  DMYKGAIETLRKKGLLP  772
            DM+ GA++  R KGL+P
Sbjct  310  DMFVGAVDACRAKGLIP  326



>gb|AJA79073.1| dihydroflavonol 4-reductase [Prunus persica]
 gb|AJA79078.1| dihydroflavonol 4-reductase [Prunus persica]
Length=346

 Score =   321 bits (823),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 155/257 (60%), Positives = 204/257 (79%), Gaps = 3/257 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+L I+ +C KAKTV++LVFTSS   V
Sbjct  73   EAIQGCTGVFHVATPMDFESKDPENEVIKPTINGVLDILKACLKAKTVRRLVFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E Q+  YDE+ WSD++F  + KM GWMYFASKTLAE+ AWK AKE  I+FI+IIP L
Sbjct  133  NVEEHQKSYYDETDWSDVEFCRSVKMTGWMYFASKTLAEQAAWKFAKENNIDFITIIPTL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            VIGPFL+P+ P SL+T LSP+    GN  H++IIK+G+FVHLDDLC + I+LY+HPKA G
Sbjct  193  VIGPFLMPSMPPSLITGLSPL---TGNTSHYSIIKRGQFVHLDDLCLSHIYLYEHPKAEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATI+D+AK++R  +PEY +P++F  IE+ L  + FSSKKL + GF+FKY+LE
Sbjct  250  RYICSSHDATIYDIAKLLREKYPEYNIPTKFDNIEENLTNIHFSSKKLTDHGFEFKYSLE  309

Query  722  DMYKGAIETLRKKGLLP  772
            DM+ GA++T R +GL+P
Sbjct  310  DMFVGAVDTCRARGLIP  326



>gb|AHL46448.1| dihydroflavonol 4-reductase [Fragaria vesca]
Length=349

 Score =   320 bits (821),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 161/273 (59%), Positives = 210/273 (77%), Gaps = 7/273 (3%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+L I+ +C KAKTV++LVFT+S  +V
Sbjct  73   EAIKGCSGVFHVATPMDFESKDPENEVIKPTINGVLDIMKACLKAKTVRRLVFTASAGSV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E Q+  Y+ES+WSD++F    KM GWMYF SKTLAE+EAWK AKE  I+FI+IIP L
Sbjct  133  NVEENQKPVYNESNWSDVEFCRRVKMTGWMYFVSKTLAEQEAWKFAKENNIDFITIIPTL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            VIGPFL+P  P SL+T LSP+    GN  H++IIKQG+FVHLDDLC++ I+LY+HPKA G
Sbjct  193  VIGPFLMPAMPPSLITGLSPLF---GNEGHYSIIKQGQFVHLDDLCQSHIYLYEHPKAEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATIH++AK++R  +PEY VP++FKGIE  L  V FSS KL E GF+FKY+LE
Sbjct  250  RYICSSHDATIHEIAKLLREKYPEYNVPTKFKGIEDNLTKVHFSSNKLLETGFEFKYSLE  309

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQHSG  820
             M+ GA++  + KGLLP     P +  ++Q +G
Sbjct  310  GMFVGAVDACKAKGLLP----PPTERVEKQEAG  338



>gb|AEO79982.1| dihydroflavonol 4-reductase [Prunus avium]
Length=346

 Score =   320 bits (820),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 155/257 (60%), Positives = 203/257 (79%), Gaps = 3/257 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+L I+ +C KAKTV++LVFTSS   V
Sbjct  73   EAIQGCTGVFHVATPMDFESKDPENEVIKPTINGVLDIMKACLKAKTVRRLVFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E Q+  YDE++WSD++F  + KM GWMYF SKTLAE+ AWK AKE  I+FI+IIP L
Sbjct  133  NVEEHQRPSYDETNWSDVEFCRSVKMTGWMYFVSKTLAEQAAWKLAKENNIDFITIIPTL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            VIGPFL+ + P SL+T LSP+    GN  H++IIK+G+FVHLDDLC + I+LY+HPKA G
Sbjct  193  VIGPFLMSSMPPSLITGLSPL---TGNTSHYSIIKRGQFVHLDDLCLSHIYLYEHPKAEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATI+D+AK++R  +PEY +P++F  IE+ L  V FSSKKL + GF+FKY+LE
Sbjct  250  RYICSSHDATIYDIAKLLREKYPEYNIPTKFDNIEENLTKVHFSSKKLTDQGFEFKYSLE  309

Query  722  DMYKGAIETLRKKGLLP  772
            DM+ GA++T R KGL+P
Sbjct  310  DMFVGAVDTCRAKGLIP  326



>ref|XP_007160735.1| hypothetical protein PHAVU_001G012800g [Phaseolus vulgaris]
 gb|ESW32729.1| hypothetical protein PHAVU_001G012800g [Phaseolus vulgaris]
Length=339

 Score =   320 bits (819),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 159/265 (60%), Positives = 205/265 (77%), Gaps = 3/265 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP +KG++ I+ +C KAK+V+++VFTSS   V
Sbjct  73   EAIKGCTGVFHVATPMDFESKDPENEVIKPTIKGLVDIMKACVKAKSVRRIVFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             + E  +  YDE+ WSD++F    KM GWMYF SKTLAEKEAWK AKE  I+F+SIIPPL
Sbjct  133  DVAEKSKPFYDENCWSDVEFCRRVKMTGWMYFVSKTLAEKEAWKFAKEHNIDFVSIIPPL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPFL+PT P SL+TALS I    GN  H++IIKQG+FVHLDDLC A IFL+++PKA G
Sbjct  193  VVGPFLMPTMPPSLITALSLI---TGNEGHYHIIKQGQFVHLDDLCLAHIFLFENPKAEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+IC SH ATIHD+AK++   +P Y +P++FK I  EL I+ FSSKK+ +MGF+F+Y+LE
Sbjct  250  RYICCSHEATIHDIAKLLNQKYPHYNIPTKFKDIPDELEIIRFSSKKITDMGFKFEYSLE  309

Query  722  DMYKGAIETLRKKGLLPYSTKEPAD  796
            DM+ GA+ET R+KGLLP   + P +
Sbjct  310  DMFAGAVETCREKGLLPQPAQTPVN  334



>gb|AHL45016.1| dihydroflavonol 4-reductase [Prunus avium]
Length=346

 Score =   320 bits (819),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 155/257 (60%), Positives = 203/257 (79%), Gaps = 3/257 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+L I+ +C KAKTV++LVFTSS   V
Sbjct  73   EAIQGCTGVFHVATPMDFESKDPENEVIKPTINGVLDIMKACLKAKTVRRLVFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E Q+  YDE++WSD++F  + KM GWMYF SKTLAE+ AWK AKE  I+FI+IIP L
Sbjct  133  NVEEHQRPSYDETNWSDVEFCRSVKMTGWMYFVSKTLAEQAAWKFAKENNIDFITIIPTL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            VIGPFL+ + P SL+T LSP+    GN  H++IIK+G+FVHLDDLC + I+LY+HPKA G
Sbjct  193  VIGPFLMSSMPPSLITGLSPL---TGNTSHYSIIKRGQFVHLDDLCLSHIYLYEHPKAEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATI+D+AK++R  +PEY +P++F  IE+ L  V FSSKKL + GF+FKY+LE
Sbjct  250  RYICSSHDATIYDIAKLLREKYPEYNIPTKFDNIEENLTKVHFSSKKLTDQGFEFKYSLE  309

Query  722  DMYKGAIETLRKKGLLP  772
            DM+ GA++T R KGL+P
Sbjct  310  DMFVGAVDTCRAKGLIP  326



>gb|AAP13055.1| dihydroflavonol 4-reductase [Gypsophila elegans]
Length=353

 Score =   320 bits (820),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 158/259 (61%), Positives = 204/259 (79%), Gaps = 4/259 (2%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            +A+ GC GVFH+A  ++F SKDPENE+IKP + G+L I+ SCAKAK VK++VFTSS   V
Sbjct  90   KAVDGCSGVFHIATPMDFESKDPENEMIKPTINGMLDIMKSCAKAK-VKRVVFTSSGGTV  148

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++ETQ+ EYDE+ WSDLDFI + KM GWMYF SK LAE+ AWK A E  ++FISIIPPL
Sbjct  149  NVEETQKAEYDETCWSDLDFIRSVKMTGWMYFVSKILAEQAAWKYAAENNLDFISIIPPL  208

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF++P+ P SL+TALSPI        H+ IIKQG+FVHLDDLC A IFLY++PKA G
Sbjct  209  VVGPFIMPSMPPSLITALSPITRTES---HYTIIKQGQFVHLDDLCMAHIFLYENPKAQG  265

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+I S+  ATI+D+AKM+R  +PEY VP++FK  ++++ +V FSSKKL E+GF+FKY L+
Sbjct  266  RYIASACDATIYDIAKMLREEYPEYNVPTKFKDYKEDMDLVHFSSKKLTELGFEFKYGLK  325

Query  722  DMYKGAIETLRKKGLLPYS  778
            DMY GA+ET R KGLLP S
Sbjct  326  DMYTGAVETCRAKGLLPLS  344



>dbj|BAE19953.1| dihydroflavonol 4-reductase [Lotus japonicus]
Length=340

 Score =   318 bits (816),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 158/264 (60%), Positives = 205/264 (78%), Gaps = 3/264 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+L I+ +C KAKTV++LVFTSS   V
Sbjct  73   EAIRGCTGVFHVATPMDFESKDPENEVIKPTINGLLDILKACEKAKTVRRLVFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             + E  +   DE+ WSD++F    KM GWMYF SKT AE+EAWK AKE  I+F+S+IPPL
Sbjct  133  DVTEHPKPVIDETCWSDIEFCLRVKMTGWMYFVSKTRAEQEAWKYAKEHNIDFVSVIPPL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPFL+PT P SL+TALS I    GN  H++IIKQG++VHLDDLC A IFL+++PKA G
Sbjct  193  VVGPFLMPTMPPSLITALSLI---TGNEAHYSIIKQGQYVHLDDLCLAHIFLFENPKAQG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R++CS++ ATIH+VA+MI   +PE+ VP++FK I  EL I+ FSSKK+ ++GF+FKY+LE
Sbjct  250  RYMCSAYEATIHEVARMINKKYPEFNVPTKFKDIPDELDIIKFSSKKITDLGFKFKYSLE  309

Query  722  DMYKGAIETLRKKGLLPYSTKEPA  793
            DMY GA+ET R+KGLLP + + PA
Sbjct  310  DMYTGAVETCREKGLLPKTAETPA  333



>ref|XP_006383711.1| hypothetical protein POPTR_0005s25110g [Populus trichocarpa]
 gb|ERP61508.1| hypothetical protein POPTR_0005s25110g [Populus trichocarpa]
Length=376

 Score =   319 bits (818),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 156/264 (59%), Positives = 208/264 (79%), Gaps = 3/264 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EA+ GC GVFHVA  ++F SKDPENEVIKP + G+L I+ +CAKAKTV+++VFTSS   V
Sbjct  73   EAVQGCTGVFHVATPMDFESKDPENEVIKPTINGVLDIMKACAKAKTVRRIVFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E ++  YDES WSDL+F+   KM GWMYF SKTLAE+ AWK AKE  ++FIS+IPPL
Sbjct  133  DVEEHKKPVYDESCWSDLEFVQTVKMTGWMYFVSKTLAEQAAWKYAKENNLDFISVIPPL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF++ + P SL+TALS I    GN  H+ IIKQG +VHLDDLC A I L+++PKA G
Sbjct  193  VVGPFIMHSMPPSLITALSLI---TGNEAHYGIIKQGNYVHLDDLCRAHIVLFENPKAEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATIHD+AK++R  +P+Y VP++FK I+++L  V FSSKKL ++GF+FKY+LE
Sbjct  250  RYICSSHEATIHDLAKLLREKYPKYNVPAKFKDIDEDLASVVFSSKKLLDLGFEFKYSLE  309

Query  722  DMYKGAIETLRKKGLLPYSTKEPA  793
            +M+ GA+ET R+KGL+P S ++ A
Sbjct  310  EMFAGAVETCREKGLIPLSHEKQA  333



>gb|AAN63056.1| dihydroflavonol reductase [Populus tremuloides]
Length=346

 Score =   318 bits (815),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 153/264 (58%), Positives = 205/264 (78%), Gaps = 3/264 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+L I+ +CAK+KT++K++FTSS   V
Sbjct  73   EAIQGCTGVFHVATPMDFESKDPENEVIKPTINGVLDIMRACAKSKTIRKIIFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E ++  YDES WSDLDF+   KM GWMYF SKTLAE+ AWK A++  ++FISIIP L
Sbjct  133  DVEEKRKPVYDESCWSDLDFVQGIKMTGWMYFVSKTLAEQAAWKFAEDNNLDFISIIPTL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF++ + P SL+TALS I    GN  H+ I+KQG +VHLDDLC + IFLY++PKA G
Sbjct  193  VVGPFIMQSMPPSLLTALSLI---TGNEAHYGILKQGHYVHLDDLCMSHIFLYENPKAEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+IC+S  A IHD+A+++R  +PEY VP +FK I++ L  V+FSSKKL ++GF+FKY+LE
Sbjct  250  RYICNSDDANIHDLAQLLREKYPEYNVPDKFKDIDENLACVAFSSKKLTDLGFEFKYSLE  309

Query  722  DMYKGAIETLRKKGLLPYSTKEPA  793
            DM+ GA+ET R+KGL+P S K+ A
Sbjct  310  DMFAGAVETCREKGLIPLSHKKQA  333



>ref|XP_002300759.1| dihydroflavonol reductase family protein [Populus trichocarpa]
 gb|EEE80032.1| dihydroflavonol reductase family protein [Populus trichocarpa]
Length=346

 Score =   318 bits (814),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 155/262 (59%), Positives = 205/262 (78%), Gaps = 3/262 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+L I+ +CA +KTV+K+VFTSS   V
Sbjct  73   EAIQGCTGVFHVATPMDFESKDPENEVIKPTINGVLDIMRACANSKTVRKIVFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E ++  YDES WSDLDF+ + KM GWMYF SKTLAE+ AWK AKE  ++FISIIP L
Sbjct  133  DVEEKRKPVYDESCWSDLDFVQSIKMTGWMYFVSKTLAEQAAWKFAKENNLDFISIIPTL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF++ + P SL+TALS I    GN  H+ I+KQG +VHLDDLC + IFLY++PKA G
Sbjct  193  VVGPFIMQSMPPSLLTALSLI---TGNEAHYGILKQGHYVHLDDLCMSHIFLYENPKAEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+IC+S  A IHD+AK++R  +PEY VP++FK I++ L  V+FSSKKL ++GF+FKY+LE
Sbjct  250  RYICNSDDANIHDLAKLLREKYPEYNVPAKFKDIDENLACVAFSSKKLTDLGFEFKYSLE  309

Query  722  DMYKGAIETLRKKGLLPYSTKE  787
            DM+ GA+ET R+KGL+P S ++
Sbjct  310  DMFAGAVETCREKGLIPLSHRK  331



>gb|AIB06741.1| dihydroflavonol 4-reductase [Mangifera indica]
Length=333

 Score =   317 bits (813),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 155/259 (60%), Positives = 201/259 (78%), Gaps = 3/259 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  + F +KDPENE+IKP + G+L I+ +C  AKTV++LVFTSS   +
Sbjct  71   EAIKGCTGVFHVATPMFFDAKDPENEMIKPTINGMLDIMKACKNAKTVRRLVFTSSAGTL  130

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E ++  YDESSWSDL+F+ A KM GWMYF SKTLAE+ AWK A+E  ++FISIIP L
Sbjct  131  DVEEHKKPVYDESSWSDLEFVLATKMTGWMYFVSKTLAEQAAWKFAEENNLDFISIIPSL  190

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPFL+P+ P SL++ALSPI    GN  H++IIKQG+FVHLDDLC + IFLY+ P+A G
Sbjct  191  VVGPFLMPSMPPSLISALSPI---TGNEDHYSIIKQGQFVHLDDLCNSHIFLYEKPEAKG  247

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSS  ATI +VAK++R  +PEY +P++FKG++  L    FSSKKL ++GF+FKY LE
Sbjct  248  RYICSSDSATILEVAKLLREKYPEYNIPTKFKGVDDNLENYKFSSKKLTDLGFKFKYNLE  307

Query  722  DMYKGAIETLRKKGLLPYS  778
            DMY GA+ET R KGL+P S
Sbjct  308  DMYTGAVETCRAKGLIPLS  326



>ref|XP_010673251.1| PREDICTED: dihydroflavonol-4-reductase [Beta vulgaris subsp. 
vulgaris]
Length=338

 Score =   317 bits (812),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 158/259 (61%), Positives = 199/259 (77%), Gaps = 4/259 (2%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+L I+ SC  AK +++LVFTSS   V
Sbjct  73   EAINGCTGVFHVATPMDFESKDPENEVIKPTINGMLDIMKSCVNAK-IRRLVFTSSAGTV  131

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E Q+ EYDE+ WSD+DF  ++ M GWMYF SKTLAE+ AWK A E  ++FISIIPPL
Sbjct  132  NVEEIQKPEYDETCWSDMDFCRSSNMTGWMYFVSKTLAEQVAWKFAAENNLDFISIIPPL  191

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPFL PT P SL+TALSPI     N  H++IIKQG+FVHLDDLC A IFLY+HP A G
Sbjct  192  VVGPFLTPTMPPSLITALSPI---TKNEAHYSIIKQGQFVHLDDLCMAHIFLYEHPNAKG  248

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+I S+  ATI+D+ KM+R  +PEY +P +FK IE+++ +V FSS+KL  + F+FKY L+
Sbjct  249  RYIASACDATIYDIGKMLREEYPEYNIPIKFKDIEEDIELVHFSSEKLMSLSFKFKYGLK  308

Query  722  DMYKGAIETLRKKGLLPYS  778
            DMYKGAIET R KGLLP S
Sbjct  309  DMYKGAIETCRAKGLLPLS  327



>gb|AET74075.2| dihydroflavonol 4-reductase, partial [Punica granatum]
Length=327

 Score =   317 bits (811),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 154/259 (59%), Positives = 205/259 (79%), Gaps = 4/259 (2%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            E I GC GVFHVA  ++F SKDPENEVIKP ++G+LSI+ SC KAK V++LVFTSS   V
Sbjct  59   EPIQGCTGVFHVATPMDFESKDPENEVIKPTIEGMLSIMKSCVKAK-VRRLVFTSSAGTV  117

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++  Q+  +DE+SWSDLDF++A KM GWMYF SKT+AE+ AWK A+E  ++FISIIP L
Sbjct  118  NVQPVQRPVHDETSWSDLDFVWATKMTGWMYFVSKTMAERAAWKFAEENNLDFISIIPTL  177

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPFL+P+FP SL+TALSPI     N  H+ II+QG+FVHLDDLC + IFLY+HP+A G
Sbjct  178  VVGPFLMPSFPPSLITALSPI---TRNEAHYGIIRQGQFVHLDDLCMSHIFLYEHPEAKG  234

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH   I  +AK++R  +PEY +P++F+G+++    VSFSSKKL+++GF+FK+ LE
Sbjct  235  RYICSSHDENITGIAKLLREKYPEYDIPTKFEGVDENTEKVSFSSKKLRDLGFEFKHNLE  294

Query  722  DMYKGAIETLRKKGLLPYS  778
            DM+ GA+E  R+KGLLP S
Sbjct  295  DMFVGAVECCREKGLLPLS  313



>gb|KHN20964.1| Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase 
[Glycine soja]
Length=343

 Score =   317 bits (812),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 157/257 (61%), Positives = 203/257 (79%), Gaps = 3/257 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+L I+ +C KAKTV++L+FTSS   +
Sbjct  73   EAIKGCTGVFHVATPMDFESKDPENEVIKPTINGVLDIMKACLKAKTVRRLIFTSSAGTL  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            ++ E Q+  +D++ WSD++F    KM GWMYF SKTLAEKEAWK AKE+ ++FI+IIPPL
Sbjct  133  NVIERQKPVFDDTCWSDVEFCRRVKMTGWMYFVSKTLAEKEAWKFAKEQGLDFITIIPPL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPFL+PT P SL+TALSPI    GN  H++IIKQG+FVHLDDLC A IFL++ P+  G
Sbjct  193  VVGPFLMPTMPPSLITALSPI---TGNEDHYSIIKQGQFVHLDDLCLAHIFLFEEPEVEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICS+  ATIHD+AK+I   +PEY VP++FK I  +L +V FSSKK+ ++GF+FKY+LE
Sbjct  250  RYICSACDATIHDIAKLINQKYPEYKVPTKFKNIPDQLELVRFSSKKITDLGFKFKYSLE  309

Query  722  DMYKGAIETLRKKGLLP  772
            DMY GAI+T R KGLLP
Sbjct  310  DMYTGAIDTCRDKGLLP  326



>gb|AEX07281.1| DFR [Arachis hypogaea]
Length=345

 Score =   317 bits (811),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 153/261 (59%), Positives = 200/261 (77%), Gaps = 3/261 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G++ I+ +C KAKTV++L+FTSS   V
Sbjct  73   EAINGCTGVFHVATPMDFESKDPENEVIKPTINGVIDIMKACLKAKTVRRLIFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            ++ E ++  YDE+ WSD+DF    KM GWMYF SKTLAE+EAWK +KE  ++FI+IIPPL
Sbjct  133  NVSEPKKDLYDETCWSDVDFCRRVKMTGWMYFVSKTLAEQEAWKFSKEHNMDFITIIPPL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF++PT P SL+TALSPI    GN  H++IIKQG+F HLDD C A IFL++ PK  G
Sbjct  193  VVGPFIMPTMPPSLITALSPI---TGNEAHYSIIKQGQFAHLDDFCRAHIFLFERPKVEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICS+  ATIH +AK +   +PEY VP+ FK I  EL ++ FSS K++++GFQFKYTLE
Sbjct  250  RYICSACDATIHQIAKFLNKKYPEYDVPTTFKNIPDELELIRFSSNKIKDLGFQFKYTLE  309

Query  722  DMYKGAIETLRKKGLLPYSTK  784
            +MY GA++T R+KGLLP + K
Sbjct  310  NMYTGAVDTCREKGLLPNNNK  330



>ref|NP_001238612.1| dihydroflavonol-4-reductase DFR1 [Glycine max]
 gb|AAD54273.1|AF167556_1 dihydroflavonol-4-reductase DFR1 [Glycine max]
Length=347

 Score =   317 bits (811),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 157/257 (61%), Positives = 203/257 (79%), Gaps = 3/257 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+L I+ +C KAKTV++L+FTSS   +
Sbjct  73   EAIKGCTGVFHVATPMDFESKDPENEVIKPTINGVLDIMKACLKAKTVRRLIFTSSAGTL  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            ++ E Q+  +D++ WSD++F    KM GWMYF SKTLAEKEAWK AKE+ ++FI+IIPPL
Sbjct  133  NVIERQKPVFDDTCWSDVEFCRRVKMTGWMYFVSKTLAEKEAWKFAKEQGLDFITIIPPL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPFL+PT P SL+TALSPI    GN  H++IIKQG+FVHLDDLC A IFL++ P+  G
Sbjct  193  VVGPFLMPTMPPSLITALSPI---TGNEDHYSIIKQGQFVHLDDLCLAHIFLFEEPEVEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICS+  ATIHD+AK+I   +PEY VP++FK I  +L +V FSSKK+ ++GF+FKY+LE
Sbjct  250  RYICSACDATIHDIAKLINQKYPEYKVPTKFKNIPDQLELVRFSSKKITDLGFKFKYSLE  309

Query  722  DMYKGAIETLRKKGLLP  772
            DMY GAI+T R KGLLP
Sbjct  310  DMYTGAIDTCRDKGLLP  326



>ref|XP_004499176.1| PREDICTED: bifunctional dihydroflavonol 4-reductase/flavanone 
4-reductase-like isoform X1 [Cicer arietinum]
Length=341

 Score =   316 bits (809),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 156/261 (60%), Positives = 200/261 (77%), Gaps = 3/261 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            E I GC GVFHVA  ++F SKDPENEVIKP + G+L I+ +C KAKTV++LVFTSS   V
Sbjct  73   EPIKGCTGVFHVATPMDFDSKDPENEVIKPTINGLLDILKACEKAKTVRRLVFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             + E  +  +DE+ WSD+DF    KM GWMYF SKTLAE+EAWK AK+  I+F+SIIPPL
Sbjct  133  DVTENSKSIFDETCWSDVDFCRRVKMTGWMYFVSKTLAEQEAWKFAKQNNIDFVSIIPPL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPFL+PT P SL+TALS I    GN  H+ IIKQG++VHLDDLC A IFL+++PKA G
Sbjct  193  VVGPFLMPTMPPSLITALSLI---TGNEAHYAIIKQGQYVHLDDLCLAHIFLFENPKAEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+IC SH ATIHDVA +I   +P + VP++FK I  +L I+ FSSKK+ E+GF+FKY+LE
Sbjct  250  RYICCSHEATIHDVATLINKKYPHFNVPTKFKDIPDQLEIIKFSSKKITELGFKFKYSLE  309

Query  722  DMYKGAIETLRKKGLLPYSTK  784
            DM+ GA+ET R+KG+LP + +
Sbjct  310  DMFTGAVETCREKGILPKAAQ  330



>ref|XP_002510417.1| cinnamoyl-CoA reductase, putative [Ricinus communis]
 gb|EEF52604.1| cinnamoyl-CoA reductase, putative [Ricinus communis]
Length=347

 Score =   316 bits (809),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 158/266 (59%), Positives = 203/266 (76%), Gaps = 4/266 (2%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            +AI GC GVFHVA  ++F  KDPENEVI+P V G+L I+ +CAKAKTV+++VFTSS   V
Sbjct  73   DAIRGCSGVFHVATPMDFEPKDPENEVIRPTVNGVLDIMKACAKAKTVRRIVFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E ++  YDE  WSDLDFI   KM GW+YF SK+LAEK AWK A++  ++FISIIP L
Sbjct  133  DVEEHRKEMYDEHCWSDLDFILTKKMTGWVYFVSKSLAEKAAWKFAEKNNLDFISIIPTL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPFL   FP SL+TAL+PI    GN  H++IIKQG FVHLDDLC A IFL++HPKA G
Sbjct  193  VVGPFLGSFFPPSLITALAPI---TGNEAHYSIIKQGHFVHLDDLCNAHIFLFEHPKAEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATIH+VAK++R  +PEY +P++  G+E+++    FSSKKL +MGFQFKY+LE
Sbjct  250  RYICSSHDATIHEVAKLLREKYPEYNIPAKINGVEEDIKNFIFSSKKLTDMGFQFKYSLE  309

Query  722  DMYKGAIETLRKKGLLPY-STKEPAD  796
            DM  G +E+ R KG+LP  + KE AD
Sbjct  310  DMLVGGVESCRAKGVLPVPNVKELAD  335



>gb|ADZ54784.1| dihydrokaempferol 4-reductase [Prunus avium]
Length=346

 Score =   316 bits (809),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 154/257 (60%), Positives = 201/257 (78%), Gaps = 3/257 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+L I+ +C KAKTV++LVFTSS   V
Sbjct  73   EAIQGCTGVFHVATPMDFESKDPENEVIKPTINGVLDIMKACLKAKTVRRLVFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E Q+  YDE++WSD++F  + KM GWMYF SKTLAE+ AWK AKE  I+FI+IIP L
Sbjct  133  NVEEHQRPSYDETNWSDVEFCRSVKMTGWMYFVSKTLAEQAAWKFAKENNIDFITIIPTL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            VIGPFL+ + P SL+T LSP+    GN  H++IIK+G+FVHLDDLC + I+LY+HPKA G
Sbjct  193  VIGPFLMSSMPPSLITGLSPL---TGNTSHYSIIKRGQFVHLDDLCLSHIYLYEHPKAEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATI+D+AK++   +PEY +P++F  IE  L  V FSSKKL + GF+FKY+LE
Sbjct  250  RYICSSHDATIYDIAKLLXEKYPEYNIPTKFDNIEXNLTKVHFSSKKLTDQGFEFKYSLE  309

Query  722  DMYKGAIETLRKKGLLP  772
            DM+ GA++T R KGL+P
Sbjct  310  DMFVGAVDTCRAKGLIP  326



>gb|AAX12421.1| dihydroflavonol 4-reductase [Fragaria x ananassa]
Length=341

 Score =   315 bits (808),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 155/265 (58%), Positives = 205/265 (77%), Gaps = 3/265 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F S+DPENEVIKP + G+L I+ +C KAKTV+++VFTSS  AV
Sbjct  75   EAIKGCTGVFHVATPMDFESEDPENEVIKPTINGMLDIMKACLKAKTVRRVVFTSSAGAV  134

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             I+E ++  Y E++WSD+ F    KM GWMYF SKTLAE+ AW+ AKE  I+FI+IIP L
Sbjct  135  AIEEHRKEVYSENNWSDVVFCRKVKMTGWMYFVSKTLAEQAAWEFAKENNIDFITIIPTL  194

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            VIGPFL P+ P SL++ LSP+    GN  H+ IIKQ ++VHLDDLC++ IFLY+HPKA G
Sbjct  195  VIGPFLAPSMPPSLISGLSPL---TGNEAHYGIIKQCQYVHLDDLCQSHIFLYEHPKAKG  251

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATIHD+A+++   +P+Y VP +FKGIE+ L  + FSSKKL+EMGF+FK++LE
Sbjct  252  RYICSSHDATIHDIARLLNEKYPKYNVPKKFKGIEENLTNIHFSSKKLKEMGFEFKHSLE  311

Query  722  DMYKGAIETLRKKGLLPYSTKEPAD  796
            DM+ GA++  R+KGLLP   +E A+
Sbjct  312  DMFTGAVDACREKGLLPLPQEEEAE  336



>gb|ADP09380.1| dihydroflavonol reductase, partial [Pyrus pyrifolia]
Length=268

 Score =   313 bits (802),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 154/250 (62%), Positives = 199/250 (80%), Gaps = 3/250 (1%)
 Frame = +2

Query  23   GVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAVHIKETQQ  202
            GVFHVA  ++F SKDPENEVIKP + G+L I+ +C KAKTV+KLVFTSS   V+++E Q+
Sbjct  1    GVFHVATPMDFESKDPENEVIKPTINGLLDILKACQKAKTVRKLVFTSSAGTVNVEEHQK  60

Query  203  LEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPLVIGPFLI  382
              YDES+WSD++F  + KM GWMYF SKTLAE+ AWK AKE  I+FI+IIP LVIGPFL+
Sbjct  61   PVYDESNWSDVEFCRSVKMTGWMYFVSKTLAEQAAWKYAKENNIDFITIIPTLVIGPFLM  120

Query  383  PTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGGRFICSSH  562
            P+ P SL+T LSPI+    N  H+ IIKQG++VHLDDLC + I+LY+HPKA GR+ICSSH
Sbjct  121  PSMPPSLITGLSPILR---NESHYGIIKQGQYVHLDDLCLSHIYLYEHPKAEGRYICSSH  177

Query  563  HATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLEDMYKGAI  742
             ATIH++ KM+R  +PEY +P++FKGI+  L  V FSSKKL+E+GF+FKY+LEDM+ GA+
Sbjct  178  DATIHELVKMLREKYPEYNIPTKFKGIDDNLEPVHFSSKKLREIGFEFKYSLEDMFVGAV  237

Query  743  ETLRKKGLLP  772
            +  R KGL+P
Sbjct  238  DACRAKGLIP  247



>gb|AAU12364.1| dihydroflavonol 4-reductase [Fragaria x ananassa]
Length=342

 Score =   315 bits (808),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 156/265 (59%), Positives = 204/265 (77%), Gaps = 3/265 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F S+DPENEVIKP + G+L I+ +C KAKTV+++VFTSS  AV
Sbjct  76   EAIKGCTGVFHVATPMDFESEDPENEVIKPTINGMLDIMKACLKAKTVRRVVFTSSAGAV  135

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             I+E ++  Y E++WSD+ F    KM GWMYF SKTLAE+ AWK AKE  I+FI+IIP L
Sbjct  136  AIEEHRKEVYSENNWSDVVFCRKVKMTGWMYFVSKTLAEQAAWKFAKENNIDFITIIPTL  195

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            VIGPFL P+ P SL++ LSP+    GN  H+ IIKQ ++VHLDDLC++ IFLY+HPKA G
Sbjct  196  VIGPFLAPSMPPSLISGLSPL---TGNEAHYGIIKQCQYVHLDDLCQSHIFLYEHPKAEG  252

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATIHD+ K++  N+P+Y VP +FKGIE+ L  + FSSKKL+EMGF+FK++LE
Sbjct  253  RYICSSHDATIHDIVKLLNENYPKYNVPKKFKGIEENLTNIHFSSKKLKEMGFEFKHSLE  312

Query  722  DMYKGAIETLRKKGLLPYSTKEPAD  796
            DM+ GA++  R+KGLLP   +E  +
Sbjct  313  DMFTGAVDACREKGLLPLPQEEETE  337



>gb|AAS89833.1| dihydroflavonol 4-reductase [Fragaria x ananassa]
Length=341

 Score =   315 bits (808),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 157/265 (59%), Positives = 204/265 (77%), Gaps = 3/265 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F S+DPENEVIKP + G+L I+ +C KAKTV++LVFTSS  AV
Sbjct  75   EAIKGCTGVFHVATPMDFESEDPENEVIKPTINGMLDIMKACLKAKTVRRLVFTSSAGAV  134

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             I+E  +  Y E++WSD+ F    KM GWMYF SKTLAE+ AWK AKE  I+FI+IIP L
Sbjct  135  AIEEHPKEVYSENNWSDVVFCRKVKMTGWMYFVSKTLAEQAAWKFAKENNIDFITIIPTL  194

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            VIGPFL P+ P SL++ LSP+    GN  H+ IIKQ ++VHLDDLC++ IFLY+HPKA G
Sbjct  195  VIGPFLAPSMPPSLISGLSPL---TGNEAHYGIIKQCQYVHLDDLCQSHIFLYEHPKAKG  251

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATIHD+A+++   +P+Y VP +FKGIE+ L  + FSSKKL+EMGF+FK++LE
Sbjct  252  RYICSSHDATIHDIARLLNEKYPKYNVPKKFKGIEENLTNIHFSSKKLKEMGFEFKHSLE  311

Query  722  DMYKGAIETLRKKGLLPYSTKEPAD  796
            DM+ GA++  R+KGLLP   +E A+
Sbjct  312  DMFTGAVDACREKGLLPLPQEEEAE  336



>gb|AEF14420.1| dihydroflavonol 4-reductase [Onobrychis viciifolia]
Length=341

 Score =   315 bits (808),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 161/271 (59%), Positives = 202/271 (75%), Gaps = 3/271 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+L I+ +C KAKTV++LVFTSS   V
Sbjct  73   EAIKGCTGVFHVATPMDFDSKDPENEVIKPTINGLLDIMKACEKAKTVRRLVFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             + E  +   DE+ WSD++F    KM GWMYF SKTLAE+EAWK AKE  I+FIS+IPPL
Sbjct  133  DVTEHPKPVIDETCWSDIEFCRRVKMTGWMYFVSKTLAEQEAWKYAKEHNIDFISVIPPL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPFL+PT P SL+TALS I    GN  H++IIKQG++VHLDDLC   IFL++HPK  G
Sbjct  193  VVGPFLMPTMPPSLITALSLI---TGNESHYHIIKQGQYVHLDDLCLGHIFLFEHPKPEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+IC S  ATIHDVAK+I   +PE+ VP++FK I  EL I+ FSSKK+ ++GF+FKYTLE
Sbjct  250  RYICCSDEATIHDVAKLINKIYPEFNVPTKFKDIPDELEIIKFSSKKITDLGFKFKYTLE  309

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQH  814
            DM  GA+ET R+KGLLP + +E   +    H
Sbjct  310  DMLTGAVETCREKGLLPKAVEETTPVNGTTH  340



>gb|AHZ97873.1| dihydroflavonol 4-reductase [Punica granatum]
Length=341

 Score =   315 bits (806),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 153/259 (59%), Positives = 204/259 (79%), Gaps = 4/259 (2%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            E I GC GVFHVA  ++F SKDPENEVIKP ++G+LSI+ SC KAK V++LVFTSS   V
Sbjct  73   EPIQGCTGVFHVATPMDFESKDPENEVIKPTIEGMLSIMKSCVKAK-VRRLVFTSSAGTV  131

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++  Q+  +DE+SWSDLDF++A KM GWMYF SKT+AE+ AWK A+E  ++FISIIP L
Sbjct  132  NVQPVQRPVHDETSWSDLDFVWATKMTGWMYFVSKTMAERAAWKFAEENNLDFISIIPTL  191

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPFL+P+FP SL+TALSPI     N  H+ II+QG+FVHLDDLC + IFLY+HP+A G
Sbjct  192  VVGPFLMPSFPPSLITALSPI---TRNEAHYGIIRQGQFVHLDDLCMSHIFLYEHPEAKG  248

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH   I  +AK++R  +PEY +P++F+G+++    VSFSSKKL+++G +FK+ LE
Sbjct  249  RYICSSHDENITGIAKLLREKYPEYDIPTKFEGVDENTEKVSFSSKKLRDLGLEFKHNLE  308

Query  722  DMYKGAIETLRKKGLLPYS  778
            DM+ GA+E  R+KGLLP S
Sbjct  309  DMFVGAVECCREKGLLPLS  327



>gb|AAU12363.1| dihydroflavonol 4-reductase [Fragaria x ananassa]
 gb|AFP99286.1| dihydroflavonol 4-reductase [Fragaria x ananassa]
 gb|AHL46443.1| dihydroflavonol 4-reductase [Fragaria x ananassa]
 gb|AHL46444.1| dihydroflavonol 4-reductase [Fragaria x ananassa]
Length=341

 Score =   315 bits (806),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 156/265 (59%), Positives = 204/265 (77%), Gaps = 3/265 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F S+DPENEVIKP + G+L I+ +C KAKTV+++VFTSS  AV
Sbjct  75   EAIKGCTGVFHVATPMDFESEDPENEVIKPTINGMLDIMKACLKAKTVRRVVFTSSAGAV  134

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             I+E ++  Y E++WSD+ F    KM GWMYF SKTLAE+ AWK AKE  I+FI+IIP L
Sbjct  135  AIEEHRKEVYSENNWSDVVFCRKVKMTGWMYFVSKTLAEQAAWKFAKENNIDFITIIPTL  194

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            VIGPFL P+ P SL++ LSP+    GN  H+ IIKQ ++VHLDDLC++ IFLY+HPKA G
Sbjct  195  VIGPFLAPSMPPSLISGLSPL---TGNEAHYGIIKQCQYVHLDDLCQSHIFLYEHPKAEG  251

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATIHD+AK++   +P+Y VP +FKGIE+ L  + FSSKKL+EMGF+FK++LE
Sbjct  252  RYICSSHDATIHDIAKLLNEKYPKYNVPKKFKGIEENLTNIHFSSKKLKEMGFEFKHSLE  311

Query  722  DMYKGAIETLRKKGLLPYSTKEPAD  796
            DM+ GA++  R+KGLLP   +E  +
Sbjct  312  DMFTGAVDACREKGLLPLPQEEETE  336



>ref|XP_010523603.1| PREDICTED: dihydroflavonol-4-reductase [Tarenaya hassleriana]
Length=378

 Score =   316 bits (809),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 151/263 (57%), Positives = 206/263 (78%), Gaps = 3/263 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            E I GC+GVFHVA  ++F SKDPENEVIKP V G+L I+ +C  AKTV+++VFTSS   +
Sbjct  73   EPIQGCDGVFHVATPMDFESKDPENEVIKPTVNGVLGIMKACVTAKTVRRIVFTSSAGTL  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E Q+ +YDE++WSDL+F+ + KM GWMYF SK LAEK AW+ +KE +I+ I+IIPPL
Sbjct  133  NVEEHQRAQYDETNWSDLEFVKSKKMTGWMYFVSKALAEKAAWEYSKENRIDLITIIPPL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+  + P SL+TALSPI     N  H++I++QG++VHL+DLC A IFL++HPKA G
Sbjct  193  VVGPFITSSMPPSLITALSPITR---NEAHYSIVRQGQYVHLEDLCNAHIFLFEHPKAKG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATI  +A ++   +PEY VPS F+G+++ L  V+FSSKKL E+GF+FK++LE
Sbjct  250  RYICSSHDATILTLAGLLGQKYPEYNVPSVFEGVDENLKSVAFSSKKLLELGFEFKFSLE  309

Query  722  DMYKGAIETLRKKGLLPYSTKEP  790
            DM+ GAIET R KGLLP+S  +P
Sbjct  310  DMFSGAIETCRAKGLLPHSLHQP  332



>ref|XP_006601319.1| PREDICTED: bifunctional dihydroflavonol 4-reductase/flavanone 
4-reductase isoform X2 [Glycine max]
Length=341

 Score =   314 bits (805),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 158/257 (61%), Positives = 198/257 (77%), Gaps = 3/257 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+L I+ +C KAKTV++LVFTSS   V
Sbjct  62   EAIKGCTGVFHVATPMDFDSKDPENEVIKPTINGLLDIMKACVKAKTVRRLVFTSSAGTV  121

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             + E      DE+ WSD+DF    KM GWMYF SKTLAE+EAWK AKE  I+FIS+IPPL
Sbjct  122  DVTEHPNPVIDENCWSDVDFCTRVKMTGWMYFVSKTLAEQEAWKYAKEHNIDFISVIPPL  181

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPFL+PT P SL+TALS I    GN  H++IIKQG+FVHLDDLC   IF++++PKA G
Sbjct  182  VVGPFLMPTMPPSLITALSLI---TGNESHYHIIKQGQFVHLDDLCLGHIFVFENPKAEG  238

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+IC SH ATIHD+AK++   +PEY V ++FK I  EL I+ FSSKK+ ++GF+FKY+LE
Sbjct  239  RYICCSHEATIHDIAKLLNQKYPEYNVLTKFKNIPDELDIIKFSSKKITDLGFKFKYSLE  298

Query  722  DMYKGAIETLRKKGLLP  772
            DM+ GA+ET R+KGLLP
Sbjct  299  DMFTGAVETCREKGLLP  315



>ref|XP_007160734.1| hypothetical protein PHAVU_001G012700g [Phaseolus vulgaris]
 gb|ESW32728.1| hypothetical protein PHAVU_001G012700g [Phaseolus vulgaris]
Length=354

 Score =   315 bits (806),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 160/265 (60%), Positives = 202/265 (76%), Gaps = 3/265 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVI P V GIL I+ +C K KTV++L+FTSS   +
Sbjct  73   EAIKGCTGVFHVATPMDFESKDPENEVINPTVNGILDIMKACMKTKTVRRLIFTSSAGTL  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            ++ E Q+   DE+ WSD+DF    KM GWMYF SKTLAEKEAWK AKE  ++FI+IIPPL
Sbjct  133  NVFEHQKPVMDETCWSDVDFCRRVKMTGWMYFVSKTLAEKEAWKFAKEHGMDFITIIPPL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPFL+PT P SL+TALSPI    GN  H++IIKQG+FVHLDDLC A IFL++ PK  G
Sbjct  193  VVGPFLMPTMPPSLITALSPI---TGNEGHYSIIKQGQFVHLDDLCLAHIFLFEEPKVEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICS+   TIH +AK+I   +P+Y +P++FK I  EL +V FSSKK++++GFQFKY+LE
Sbjct  250  RYICSACDTTIHHIAKLINEKYPDYNIPTKFKNIPDELELVRFSSKKIRDLGFQFKYSLE  309

Query  722  DMYKGAIETLRKKGLLPYSTKEPAD  796
            DMY GAI+T R KGLLP    +PA+
Sbjct  310  DMYCGAIDTCRDKGLLPKPKPKPAE  334



>ref|XP_003550388.1| PREDICTED: bifunctional dihydroflavonol 4-reductase/flavanone 
4-reductase isoformX1 [Glycine max]
 gb|ABM64803.1| dihydroflavonol-4-reductase 2 [Glycine max]
 dbj|BAO53731.1| dihydroflavonol 4-reducatase 2 [Glycine max]
 dbj|BAO53732.1| dihydroflavonol 4-reducatase 2 [Glycine soja]
 gb|KHN12695.1| Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase 
[Glycine soja]
Length=354

 Score =   315 bits (806),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 158/257 (61%), Positives = 198/257 (77%), Gaps = 3/257 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+L I+ +C KAKTV++LVFTSS   V
Sbjct  75   EAIKGCTGVFHVATPMDFDSKDPENEVIKPTINGLLDIMKACVKAKTVRRLVFTSSAGTV  134

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             + E      DE+ WSD+DF    KM GWMYF SKTLAE+EAWK AKE  I+FIS+IPPL
Sbjct  135  DVTEHPNPVIDENCWSDVDFCTRVKMTGWMYFVSKTLAEQEAWKYAKEHNIDFISVIPPL  194

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPFL+PT P SL+TALS I    GN  H++IIKQG+FVHLDDLC   IF++++PKA G
Sbjct  195  VVGPFLMPTMPPSLITALSLI---TGNESHYHIIKQGQFVHLDDLCLGHIFVFENPKAEG  251

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+IC SH ATIHD+AK++   +PEY V ++FK I  EL I+ FSSKK+ ++GF+FKY+LE
Sbjct  252  RYICCSHEATIHDIAKLLNQKYPEYNVLTKFKNIPDELDIIKFSSKKITDLGFKFKYSLE  311

Query  722  DMYKGAIETLRKKGLLP  772
            DM+ GA+ET R+KGLLP
Sbjct  312  DMFTGAVETCREKGLLP  328



>gb|ACU28803.1| dihydroflavonol reductase [Rhizophora mangle]
Length=352

 Score =   315 bits (806),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 156/257 (61%), Positives = 200/257 (78%), Gaps = 3/257 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F S DPENEVIKP + G+L I+ +CAKA TV+++VFTSS   V
Sbjct  73   EAIKGCAGVFHVATPMDFESSDPENEVIKPTINGVLDIMKACAKAGTVRRIVFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E ++  YDES WSDLDF+ + KM GWMYF SKTLAEK AWK A+E  I+FI+IIP L
Sbjct  133  DVEEHKKTFYDESCWSDLDFVQSKKMTGWMYFVSKTLAEKAAWKFAEENNIDFITIIPTL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF++P+ P SL+TALS +    GN  H+ IIKQG +VHLDDLC A IFL++ PKA G
Sbjct  193  VVGPFIMPSMPPSLITALSLL---TGNESHYGIIKQGNYVHLDDLCIAHIFLFELPKAEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH A+I+D+AK++R N+PEY VP++FK I++ L  V FSSKKL + GF+F+YTLE
Sbjct  250  RYICSSHDASIYDIAKLLRENYPEYNVPAKFKDIDENLMRVVFSSKKLLDSGFEFRYTLE  309

Query  722  DMYKGAIETLRKKGLLP  772
            DM+ GA+ET R K LLP
Sbjct  310  DMFVGAVETCRAKELLP  326



>dbj|BAO53727.1| dihydroflavonol 4-reducatase 2 [Glycine max]
Length=354

 Score =   315 bits (806),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 158/257 (61%), Positives = 198/257 (77%), Gaps = 3/257 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+L I+ +C KAKTV++LVFTSS   V
Sbjct  75   EAIKGCTGVFHVATPMDFDSKDPENEVIKPTINGLLDIMKACVKAKTVRRLVFTSSAGTV  134

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             + E      DE+ WSD+DF    KM GWMYF SKTLAE+EAWK AKE  I+FIS+IPPL
Sbjct  135  DVTEHPNPVIDENCWSDVDFCTRVKMTGWMYFVSKTLAEQEAWKYAKEHNIDFISVIPPL  194

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPFL+PT P SL+TALS I    GN  H++IIKQG+FVHLDDLC   IF++++PKA G
Sbjct  195  VVGPFLMPTMPPSLITALSLI---TGNESHYHIIKQGQFVHLDDLCLGHIFVFENPKAEG  251

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+IC SH ATIHD+AK++   +PEY V ++FK I  EL I+ FSSKK+ ++GF+FKY+LE
Sbjct  252  RYICCSHEATIHDIAKLLNQKYPEYNVLTKFKNIPDELDIIKFSSKKITDLGFKFKYSLE  311

Query  722  DMYKGAIETLRKKGLLP  772
            DM+ GA+ET R+KGLLP
Sbjct  312  DMFTGAVETCREKGLLP  328



>dbj|BAO53730.1| dihydroflavonol 4-reducatase 2 [Glycine max]
Length=354

 Score =   315 bits (806),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 158/257 (61%), Positives = 198/257 (77%), Gaps = 3/257 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+L I+ +C KAKTV++LVFTSS   V
Sbjct  75   EAIKGCTGVFHVATPMDFDSKDPENEVIKPTINGLLDIMKACVKAKTVRRLVFTSSAGTV  134

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             + E      DE+ WSD+DF    KM GWMYF SKTLAE+EAWK AKE  I+FIS+IPPL
Sbjct  135  DVTEHPNPVIDENCWSDVDFCTRVKMTGWMYFVSKTLAEQEAWKYAKEHNIDFISVIPPL  194

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPFL+PT P SL+TALS I    GN  H++IIKQG+FVHLDDLC   IF++++PKA G
Sbjct  195  VVGPFLMPTMPPSLITALSLI---TGNESHYHIIKQGQFVHLDDLCLGHIFVFENPKAEG  251

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+IC SH ATIHD+AK++   +PEY V ++FK I  EL I+ FSSKK+ ++GF+FKY+LE
Sbjct  252  RYICCSHEATIHDIAKLLNQKYPEYNVLTKFKNIPDELDIIKFSSKKITDLGFKFKYSLE  311

Query  722  DMYKGAIETLRKKGLLP  772
            DM+ GA+ET R+KGLLP
Sbjct  312  DMFTGAVETCREKGLLP  328



>gb|AHL46438.1| dihydroflavonol 4-reductase [Fragaria vesca]
 gb|AHL46439.1| dihydroflavonol 4-reductase [Fragaria vesca]
 gb|AHL46441.1| dihydroflavonol 4-reductase [Fragaria vesca]
Length=333

 Score =   314 bits (804),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 156/262 (60%), Positives = 202/262 (77%), Gaps = 3/262 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F S+DPENEVIKP + G+L I+ +C KAKTV+++VFTSS  AV
Sbjct  75   EAIKGCTGVFHVATPMDFESEDPENEVIKPTINGMLDIMKACLKAKTVRRVVFTSSAGAV  134

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             I+E ++  Y E++WSD+ F    KM GWMYF SKTLAE+ AWK AKE  I+FI+IIP L
Sbjct  135  AIEEHRKEVYSENNWSDVVFCRKVKMTGWMYFVSKTLAEQAAWKFAKENNIDFITIIPTL  194

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            VIGPFL P+ P SL++ LSP+    GN  H+ IIKQ ++VHLDDLC++ IFLY+HPKA G
Sbjct  195  VIGPFLAPSMPPSLISGLSPL---TGNEAHYGIIKQCQYVHLDDLCQSHIFLYEHPKAEG  251

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATIHD+AK++   +P+Y VP +FKGIE+ L  + FSSKKL+EMGF+FK++LE
Sbjct  252  RYICSSHDATIHDIAKLLNERYPKYNVPKKFKGIEENLTNIHFSSKKLKEMGFEFKHSLE  311

Query  722  DMYKGAIETLRKKGLLPYSTKE  787
            DM+ GA++  R KGLLP   +E
Sbjct  312  DMFTGAVDACRAKGLLPLPQEE  333



>gb|AII26023.1| dihydroflavanol 4-reductase [Pisum sativum]
Length=342

 Score =   314 bits (804),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 155/257 (60%), Positives = 199/257 (77%), Gaps = 3/257 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+L I+ +C KAKTV++LVFTSS   V
Sbjct  73   EAIKGCVGVFHVATPMDFESKDPENEVIKPTINGLLDIMKACEKAKTVRRLVFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             + E  +   DE+ WSD+DF     M GWMYF SKTLAE+EAWK +KE +I+F+SIIPPL
Sbjct  133  DVTENPKPVIDETCWSDVDFCRRVNMTGWMYFVSKTLAEQEAWKYSKEHKIDFVSIIPPL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPFL+P+ P SL+TALS I    GN  H+ IIKQG++VHLDDLC A IFL+++PKA G
Sbjct  193  VVGPFLMPSMPPSLITALSLI---TGNEAHYTIIKQGQYVHLDDLCLAHIFLFENPKAQG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+IC SH ATIH+VA +I+  +PE+ VP++FK I  EL I+ F SKK+ ++GF+FKY+LE
Sbjct  250  RYICCSHEATIHEVATLIKQKYPEFNVPTKFKDIPDELEIIKFCSKKITDLGFKFKYSLE  309

Query  722  DMYKGAIETLRKKGLLP  772
            DM+ GA+ET R+KGLLP
Sbjct  310  DMFTGAVETCREKGLLP  326



>dbj|BAB92999.1| dihydroflavonol reductase [Malus domestica]
Length=314

 Score =   312 bits (800),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 154/248 (62%), Positives = 198/248 (80%), Gaps = 3/248 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+L I+ +C KAKTV+KLVFTSS   V
Sbjct  70   EAIQGCSGVFHVATPMDFESKDPENEVIKPTINGLLDILKACQKAKTVRKLVFTSSAGTV  129

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E Q+  YDES+WSD++F  + KM GWMYF SKTLAE+ AWK AKE  I+FI+IIP L
Sbjct  130  NVEEHQKPVYDESNWSDVEFCRSVKMTGWMYFVSKTLAEQAAWKYAKENNIDFITIIPTL  189

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            VIGPFL+P+ P SL+T LSPI+    N  H+ IIKQG++VHLDDLC + I+LY+HPKA G
Sbjct  190  VIGPFLMPSMPPSLITGLSPILR---NESHYGIIKQGQYVHLDDLCLSHIYLYEHPKAEG  246

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATIH++ KM+R  +PEY +P++FKGI+  L  V FSSKKL+E+GF+FKY+LE
Sbjct  247  RYICSSHDATIHELVKMLREKYPEYNIPTKFKGIDDNLEPVHFSSKKLREIGFEFKYSLE  306

Query  722  DMYKGAIE  745
            DM+ GA++
Sbjct  307  DMFVGAVD  314



>dbj|BAE19948.1| dihydroflavonol 4-reductase [Lotus japonicus]
Length=340

 Score =   313 bits (802),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 155/265 (58%), Positives = 200/265 (75%), Gaps = 3/265 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA+ ++F SKDPENEVIKPA+ G+L I+ +C KAKTV++LVFTSS   +
Sbjct  74   EAIKGCSGVFHVASPMDFNSKDPENEVIKPAINGVLDIMKACLKAKTVRRLVFTSSAGIL  133

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             + E  +   DE+ W DL+F    KM GWMYF SK LAE+EA K AKE  I+F+SIIP L
Sbjct  134  SVSERHKHMLDETCWGDLEFCKKVKMTGWMYFVSKELAEQEALKFAKENNIDFVSIIPSL  193

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPFL+PT P SL TAL PI    GN  H+ I+KQ +FVH+DDLC A IFL++HP++ G
Sbjct  194  VVGPFLMPTMPPSLYTALCPI---TGNEAHYMIMKQSQFVHVDDLCLAHIFLFEHPESEG  250

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R++CS+  A IHD+AK+I   +PEY VP++FK I  EL +V FSSKK+++MGFQFKYTLE
Sbjct  251  RYMCSACDANIHDIAKLINTKYPEYNVPTKFKNIPDELELVRFSSKKIKDMGFQFKYTLE  310

Query  722  DMYKGAIETLRKKGLLPYSTKEPAD  796
            DMY GAI+  R+KGLLP + + P++
Sbjct  311  DMYTGAIDACREKGLLPKAAETPSN  335



>gb|KDP38534.1| hypothetical protein JCGZ_04459 [Jatropha curcas]
Length=357

 Score =   313 bits (803),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 156/270 (58%), Positives = 206/270 (76%), Gaps = 3/270 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+L I+ +CAKAKTVK++VFTSS   V
Sbjct  73   EAIQGCTGVFHVATPMDFDSKDPENEVIKPTINGVLDIMRACAKAKTVKRIVFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E ++  YDE+ WSDL FI   KM GWMYF SK+LAEK AW  AKE  ++FISIIP L
Sbjct  133  DVEEHRKEVYDENCWSDLKFIQTKKMTGWMYFVSKSLAEKAAWDYAKENGLDFISIIPTL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF++P+ P SL+TALS I    GN  H++I+KQG +VHLDDLC + IFL+++PKA G
Sbjct  193  VVGPFIMPSMPPSLITALSLI---TGNEAHYSILKQGHYVHLDDLCNSHIFLFENPKAEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSS  ATI+++A +++  +PEY +P++FK IE+E+   +FSSKKL ++GFQFKY LE
Sbjct  250  RYICSSDDATIYEIAGLLKQKYPEYNIPTKFKDIEEEIKNPTFSSKKLLDLGFQFKYNLE  309

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQ  811
            DM+ GA+ET R KGLLP S  + A  + E+
Sbjct  310  DMFTGAVETCRSKGLLPVSDGKEAMKKSEE  339



>ref|XP_003638261.1| Dihydroflavonol reductase [Medicago truncatula]
Length=334

 Score =   313 bits (801),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 154/257 (60%), Positives = 201/257 (78%), Gaps = 3/257 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENE+IKP +KG+L I+ +C KAKTV++ +FTSS   +
Sbjct  73   EAIKGCTGVFHVATPMDFESKDPENEMIKPTIKGVLDIMKACLKAKTVRRFIFTSSAGTL  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            ++ E Q+  +DES WSD++F    KM GWMYF SKTLAE+EAWK AKE  ++FI+IIPPL
Sbjct  133  NVTEDQKPLWDESCWSDVEFCRRVKMTGWMYFVSKTLAEQEAWKFAKEHNMDFITIIPPL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPFLIPT P SL+TALSPI    GN  H++IIKQG+FVHLDDLCEA IFL++H +  G
Sbjct  193  VVGPFLIPTMPPSLITALSPI---TGNEAHYSIIKQGQFVHLDDLCEAHIFLFEHMEVEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R++CS+  A IHD+AK+I   +PEY +P++F  I  EL +V FSSKK++++GF+FKY+LE
Sbjct  250  RYLCSACEANIHDIAKLINTKYPEYNIPTKFNNIPDELELVRFSSKKIKDLGFEFKYSLE  309

Query  722  DMYKGAIETLRKKGLLP  772
            DMY  AI+T  +KGLLP
Sbjct  310  DMYTEAIDTCIEKGLLP  326



>gb|AAR27014.1| dihydroflavanol-4-reductase 1 [Medicago truncatula]
 gb|KEH40173.1| dihydroflavonol 4-reductase [Medicago truncatula]
Length=334

 Score =   313 bits (801),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 154/257 (60%), Positives = 201/257 (78%), Gaps = 3/257 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENE+IKP +KG+L I+ +C KAKTV++ +FTSS   +
Sbjct  73   EAIKGCTGVFHVATPMDFESKDPENEMIKPTIKGVLDIMKACLKAKTVRRFIFTSSAGTL  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            ++ E Q+  +DES WSD++F    KM GWMYF SKTLAE+EAWK AKE  ++FI+IIPPL
Sbjct  133  NVTEDQKPLWDESCWSDVEFCRRVKMTGWMYFVSKTLAEQEAWKFAKEHNMDFITIIPPL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPFLIPT P SL+TALSPI    GN  H++IIKQG+FVHLDDLCEA IFL++H +  G
Sbjct  193  VVGPFLIPTMPPSLITALSPI---TGNEAHYSIIKQGQFVHLDDLCEAHIFLFEHMEVEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R++CS+  A IHD+AK+I   +PEY +P++F  I  EL +V FSSKK++++GF+FKY+LE
Sbjct  250  RYLCSACEANIHDIAKLINTKYPEYNIPTKFNNIPDELELVRFSSKKIKDLGFEFKYSLE  309

Query  722  DMYKGAIETLRKKGLLP  772
            DMY  AI+T  +KGLLP
Sbjct  310  DMYTEAIDTCIEKGLLP  326



>gb|AHL46442.1| dihydroflavonol 4-reductase [Fragaria vesca]
Length=333

 Score =   312 bits (800),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 156/262 (60%), Positives = 201/262 (77%), Gaps = 3/262 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F S+DPENEVIKP + G+L I+ +C KAKTV+++VFTSS  AV
Sbjct  75   EAIKGCTGVFHVATPMDFESEDPENEVIKPTINGMLDIMKACLKAKTVRRVVFTSSAGAV  134

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             I+E ++  Y E++WSD+ F    KM GWMYF SKTLAE+ AWK AKE  I+FI+IIP L
Sbjct  135  AIEEHRKEVYSENNWSDVVFCRKVKMTGWMYFVSKTLAEQAAWKFAKENNIDFITIIPTL  194

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            VIGPFL P  P SL++ LSP+    GN  H+ IIKQ ++VHLDDLC++ IFLY+HPKA G
Sbjct  195  VIGPFLAPPMPPSLISGLSPL---TGNEAHYGIIKQCQYVHLDDLCQSHIFLYEHPKAEG  251

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATIHD+AK++   +P+Y VP +FKGIE+ L  + FSSKKL+EMGF+FK++LE
Sbjct  252  RYICSSHDATIHDIAKLLNERYPKYNVPKKFKGIEENLTNIHFSSKKLKEMGFEFKHSLE  311

Query  722  DMYKGAIETLRKKGLLPYSTKE  787
            DM+ GA++  R KGLLP   +E
Sbjct  312  DMFTGAVDACRAKGLLPLPQEE  333



>dbj|BAF45153.1| dihydroflavonol 4-reductase [Humulus lupulus]
Length=350

 Score =   313 bits (801),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 156/277 (56%), Positives = 206/277 (74%), Gaps = 5/277 (2%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+L I+ +C +AKTVK LVFTSS   V
Sbjct  73   EAIKGCNGVFHVATPMDFESKDPENEVIKPTISGMLDIMKACVEAKTVKXLVFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++  Q+  YDES+WSD+DF    KM GWMYF SKTLAE+ AW+ A++  + FI+IIP L
Sbjct  133  NVEPIQKPTYDESNWSDIDFCRKVKMTGWMYFTSKTLAEQAAWEYARKHNLNFITIIPTL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            VIGPFL+P+ P SL+T LS I    GN  H+ IIKQG+FVHLDDLC A IFLY++PKA G
Sbjct  193  VIGPFLMPSMPPSLITGLSLI---TGNESHYFIIKQGQFVHLDDLCNAHIFLYENPKAEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+I SSH ATI+++AK+++  +PEY +P++ K +E+ +P V FSSKKL ++GF+FKY+LE
Sbjct  250  RYIASSHDATIYELAKLLKDKYPEYNIPTKIKDMEENIPNVHFSSKKLTDLGFEFKYSLE  309

Query  722  DMYKGAIETLRKKGLLP--YSTKEPADIEQEQHSGKE  826
            DM+ GA++T R KGLLP  + TK   +   + H   E
Sbjct  310  DMFTGAVDTCRAKGLLPLTHQTKPQNNTTDQDHPKNE  346



>ref|XP_010060970.1| PREDICTED: dihydroflavonol-4-reductase [Eucalyptus grandis]
 gb|KCW67873.1| hypothetical protein EUGRSUZ_F01589 [Eucalyptus grandis]
Length=337

 Score =   312 bits (799),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 151/259 (58%), Positives = 202/259 (78%), Gaps = 3/259 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP V+G+L I+ +CAKAKTV++LVFTSS   V
Sbjct  73   EAINGCTGVFHVATPMDFESKDPENEVIKPTVEGVLGIMRACAKAKTVRRLVFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E ++  Y E  WSD+DF+ A KM GWMYF SKTLAEK AWK A+E  I+ ISIIP L
Sbjct  133  DVQEHRKPVYSEEDWSDMDFVLATKMTGWMYFVSKTLAEKAAWKFAEENNIDLISIIPSL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF++ + P SL+T LSPI     N  H++I+KQG FVH DDLCE+ IFL++HP+A G
Sbjct  193  VVGPFIMSSMPPSLITGLSPI---TRNEAHYSIMKQGHFVHTDDLCESHIFLFEHPEAKG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH A+I +VA ++R  +PEY +P+EF+G+++ +  V+F +KKL ++GF++KYTLE
Sbjct  250  RYICSSHDASILEVANLLRKKYPEYDIPTEFEGVDENMQSVTFCTKKLLDLGFKYKYTLE  309

Query  722  DMYKGAIETLRKKGLLPYS  778
            D++ GA+ET R+KGLLP S
Sbjct  310  DIFVGAVETCREKGLLPLS  328



>ref|XP_008377381.1| PREDICTED: bifunctional dihydroflavonol 4-reductase/flavanone 
4-reductase-like [Malus domestica]
Length=347

 Score =   311 bits (798),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 152/257 (59%), Positives = 198/257 (77%), Gaps = 3/257 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+L I+ +C K KTV++LVFTSS   V
Sbjct  73   EAIQGCTGVFHVATPMDFESKDPENEVIKPTINGLLDILKACQKVKTVRRLVFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E ++  YDES+WSD++F  + KM GWMYF SKTLAE+ AWK AKE  I+FI+IIP L
Sbjct  133  IMEEHKKPVYDESNWSDVEFCLSVKMTGWMYFVSKTLAEQAAWKYAKENNIDFITIIPTL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            VIGPFL+P+ P SL+T LSPI        H+ IIKQG++VHLDDLC + I+LY+HPKA G
Sbjct  193  VIGPFLMPSMPPSLITGLSPI---TRTKSHYGIIKQGQYVHLDDLCXSHIYLYEHPKAEG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATIHD+ KM+R  +P Y +P++F+GI+  L  + FSSKKL+++GF+FKY+ E
Sbjct  250  RYICSSHDATIHDLVKMLREKYPAYNIPTKFEGIDDNLDTIHFSSKKLRDIGFEFKYSFE  309

Query  722  DMYKGAIETLRKKGLLP  772
            DM+ GA +T R KGL+P
Sbjct  310  DMFVGAXDTCRAKGLIP  326



>gb|AAC25960.1| dihydroflavonol 4-reductase [Fragaria x ananassa]
Length=341

 Score =   311 bits (798),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 156/265 (59%), Positives = 202/265 (76%), Gaps = 3/265 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F S+DPENEVIKP + G+L I+ +C KAKTV++LVFTSS  AV
Sbjct  75   EAIKGCTGVFHVATPMDFESEDPENEVIKPTINGMLDIMKACLKAKTVRRLVFTSSAGAV  134

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             I+E  +  Y E++WSD+ F    KM GWMYF SKTLAE+ AWK AKE  I+FI+IIP L
Sbjct  135  AIEEHPKEVYSENNWSDVVFCRKVKMTGWMYFVSKTLAEQAAWKFAKENNIDFITIIPTL  194

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            VIGPFL P+ P SL++ LSP+    GN  H+ IIKQ ++VHLDDLC++ IFLY+H KA G
Sbjct  195  VIGPFLAPSMPPSLISGLSPL---TGNEAHYGIIKQCQYVHLDDLCQSHIFLYEHAKAEG  251

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATIHD+AK++   +P+Y VP +FKGIE+ L  + FSSKKL+EMGF+FK++LE
Sbjct  252  RYICSSHDATIHDIAKLLNEKYPKYNVPKKFKGIEENLTNIHFSSKKLKEMGFEFKHSLE  311

Query  722  DMYKGAIETLRKKGLLPYSTKEPAD  796
            DM+ GA++  R+KGLLP   +E  +
Sbjct  312  DMFTGAVDACREKGLLPLPQEEETE  336



>gb|AHL46440.1| dihydroflavonol 4-reductase [Fragaria vesca]
Length=333

 Score =   311 bits (796),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 155/262 (59%), Positives = 200/262 (76%), Gaps = 3/262 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F S+DPENEVIKP + G+L I+ +C KAKTV+++VFTSS  AV
Sbjct  75   EAIKGCTGVFHVATPMDFESEDPENEVIKPTINGMLDIMKACLKAKTVRRVVFTSSAGAV  134

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             I+E ++  Y E++WSD+ F    KM GWMYF SK LAE+ AWK AKE  I+FI+IIP L
Sbjct  135  AIEEHRKEVYSENNWSDVVFCRKVKMTGWMYFVSKALAEQAAWKFAKENNIDFITIIPTL  194

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            VIGPFL P+ P SL++ LSP+    GN  H+ IIKQ ++VHLDDLC++ IFLY+HPKA G
Sbjct  195  VIGPFLAPSMPPSLISGLSPL---TGNEAHYGIIKQCQYVHLDDLCQSHIFLYEHPKAEG  251

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATIHD+AK++   +P+Y VP +FKGIE+ L  + FSSKKL+EMGF+FK +LE
Sbjct  252  RYICSSHDATIHDIAKLLNERYPKYNVPKKFKGIEENLTNIHFSSKKLKEMGFEFKRSLE  311

Query  722  DMYKGAIETLRKKGLLPYSTKE  787
            DM+ GA++  R KGLLP   +E
Sbjct  312  DMFTGAVDACRAKGLLPLPQEE  333



>dbj|BAE17125.1| dihydroflavonol 4-reductase [Fragaria x ananassa]
Length=341

 Score =   310 bits (793),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 153/265 (58%), Positives = 202/265 (76%), Gaps = 3/265 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F S+DPENEVIKP + G+L I+ +C KAK V++ VFTSS  AV
Sbjct  75   EAIKGCTGVFHVATPMDFESEDPENEVIKPTINGMLDIMKACLKAKAVRREVFTSSAGAV  134

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             I+E ++  Y E++WSD+ F    KM GWMYF SKTLAE+ AWK AKE  I+FI+IIP L
Sbjct  135  AIEEHRKEVYSENNWSDVVFCRKVKMTGWMYFVSKTLAEQAAWKFAKENNIDFITIIPTL  194

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            VIGPFL P+ P SL++ LSP+    GN  H+ IIKQ ++VHLDDLC++ IFLY+HPKA G
Sbjct  195  VIGPFLAPSMPPSLISGLSPL---TGNEAHYGIIKQCQYVHLDDLCQSHIFLYEHPKAKG  251

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATIHD+AK++   +P+Y VP +FKGIE+ L  + FSSKKL+EMGF+FK++LE
Sbjct  252  RYICSSHDATIHDIAKLLNEKYPKYNVPKKFKGIEENLTNIHFSSKKLKEMGFEFKHSLE  311

Query  722  DMYKGAIETLRKKGLLPYSTKEPAD  796
            DM+ GA++  R+KG++P   +E  +
Sbjct  312  DMFTGAVDACREKGMIPLPQEEETE  336



>ref|XP_009394236.1| PREDICTED: dihydroflavonol-4-reductase-like [Musa acuminata subsp. 
malaccensis]
Length=356

 Score =   310 bits (794),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 152/274 (55%), Positives = 204/274 (74%), Gaps = 7/274 (3%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EA+ GCEGVFHVA  ++F SKDPENE+IKP V G+LSI+ SC +A TV+++VFTSS   V
Sbjct  70   EAVKGCEGVFHVATPMDFESKDPENEIIKPTVDGVLSIMRSCKEAGTVRRVVFTSSAGTV  129

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E QQ +YDESSWSD+DF    KM GWMYF SK+LAEK A++ A+E  I+ ISIIP L
Sbjct  130  NVQEQQQPQYDESSWSDIDFCRRVKMTGWMYFVSKSLAEKAAYEFARENGIDLISIIPTL  189

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+  T P S++TALS I    GN  H++I+KQ + VHLDDLC+  +FLY+HP A G
Sbjct  190  VVGPFITTTMPPSMITALSLI---TGNEAHYSILKQVQLVHLDDLCDTHVFLYEHPDANG  246

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATI+D+AKM R  +P+Y +P +F+GI++ +  V FSSKKL ++G++F+YT+E
Sbjct  247  RYICSSHDATIYDLAKMFRARYPQYNIPQQFEGIDETIERVHFSSKKLTDLGYKFRYTME  306

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQHSGK  823
            DM+  AIE+  +K L+P  T E    EQ    GK
Sbjct  307  DMFDAAIESCWEKHLIPLRTAE----EQCSEVGK  336



>ref|NP_001275860.1| dihydroflavonol-4-reductase [Citrus sinensis]
 ref|XP_006435032.1| hypothetical protein CICLE_v10001757mg [Citrus clementina]
 gb|AAS00611.1| dihydroflavonol-4-reductase [Citrus sinensis]
 gb|AAY87035.1| dihydroflavonol 4-reductase [Citrus sinensis]
 gb|AAY87036.1| dihydroflavonol 4-reductase [Citrus sinensis]
 gb|ESR48272.1| hypothetical protein CICLE_v10001757mg [Citrus clementina]
Length=338

 Score =   310 bits (793),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 150/257 (58%), Positives = 200/257 (78%), Gaps = 3/257 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFH+A  ++F SKDPENEVI+P + G++SI+ +C  AKTV++LVFTSS   +
Sbjct  73   EAIRGCTGVFHLATPMDFESKDPENEVIRPTINGMVSIMRACKNAKTVRRLVFTSSAGTL  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E ++  YDE+SWSDLDF+ + KM GWMYF SKTLAE+ AWK A+E  I+FISIIP L
Sbjct  133  DVEEHRKPVYDETSWSDLDFVRSVKMTGWMYFVSKTLAEQAAWKFAEENNIDFISIIPSL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPFL  + P SL+TALSPI     N  H+ IIKQG+FVHLDDLC A IFL++HP A G
Sbjct  193  VVGPFLTSSMPPSLITALSPI---TRNEAHYPIIKQGQFVHLDDLCSAHIFLFEHPNAKG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATI ++AK +R  +PE+ VP+EF+ +++ +  + FSSKKL ++GF+FKY+L+
Sbjct  250  RYICSSHPATILELAKFLREKYPEFNVPTEFEDVDENMKNMLFSSKKLTDLGFKFKYSLD  309

Query  722  DMYKGAIETLRKKGLLP  772
            DM+ GA++T R KGLLP
Sbjct  310  DMFTGAVDTCRAKGLLP  326



>ref|XP_010906334.1| PREDICTED: bifunctional dihydroflavonol 4-reductase/flavanone 
4-reductase-like [Elaeis guineensis]
Length=337

 Score =   309 bits (792),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 153/262 (58%), Positives = 199/262 (76%), Gaps = 3/262 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            E I GC GVFHVA  ++F S DPENEVIKP + G+L+I+ SCAKAKTV+++VFTSS   V
Sbjct  72   EPIQGCVGVFHVATPMDFESSDPENEVIKPTIDGMLNILKSCAKAKTVRRVVFTSSAGTV  131

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             + E ++  YDE SWSD+DF  A KM GWMYF SKTLAEK AW+   +  ++FISIIP L
Sbjct  132  AVHEHRKPAYDEDSWSDVDFCRATKMTGWMYFVSKTLAEKAAWEFCHKNSLDFISIIPTL  191

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V GPF++PT P S++TAL+ I     N  H++I+   +FVHLDDLC A IFL++HP+A G
Sbjct  192  VNGPFIMPTMPPSMLTALALI---TRNTPHYSILNPVQFVHLDDLCRAHIFLFEHPEAKG  248

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH  TI D+AKM+R  +PEY +P+EF+GI+    ++ FSSKKL E+GF+FKY+LE
Sbjct  249  RYICSSHDITISDLAKMLRGMYPEYDIPTEFEGIDVVPEVIKFSSKKLTELGFEFKYSLE  308

Query  722  DMYKGAIETLRKKGLLPYSTKE  787
            DMYKGAI++ R+KGLLP +TK 
Sbjct  309  DMYKGAIQSCREKGLLPLATKR  330



>gb|AFU90827.1| dihydroflavonol 4-reductase [Epimedium sagittatum]
Length=360

 Score =   310 bits (794),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/277 (56%), Positives = 210/277 (76%), Gaps = 4/277 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAK-TVKKLVFTSSTAA  178
            EAIAGC GVFHVA  ++F S+DPENEVIKP ++G+L+I+ SCAKAK T++++VFTSS   
Sbjct  73   EAIAGCTGVFHVATPMDFESQDPENEVIKPTIEGMLNIMRSCAKAKNTIRRIVFTSSAGT  132

Query  179  VHIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPP  358
            V+++E Q+ EY+E  WSD++F+ + KM  WMYF SKTLAEK AW  AKE  ++FISIIP 
Sbjct  133  VNVEEHQKPEYNEECWSDMEFVRSKKMTAWMYFVSKTLAEKAAWDFAKEHNLDFISIIPT  192

Query  359  LVIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAG  538
            LVIG FL+P+ P SL+T LSPI     N  H++IIKQG+FVHLDDLC A IFL++HP+A 
Sbjct  193  LVIGSFLMPSMPPSLITGLSPI---TRNESHYSIIKQGQFVHLDDLCIAHIFLFEHPEAK  249

Query  539  GRFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTL  718
            GR+ICSSH  TI ++AKM+R  +PEY VP++   I++ + +V FSSKKL ++GFQ+KY+ 
Sbjct  250  GRYICSSHDDTIFNLAKMLRERFPEYNVPTKLGNIDENVSVVKFSSKKLLDLGFQYKYSF  309

Query  719  EDMYKGAIETLRKKGLLPYSTKEPADIEQEQHSGKEP  829
            EDM+  A+ET RKKGLLP + +  A+ +  +    EP
Sbjct  310  EDMFVDAVETCRKKGLLPLAFEAEANGQCLESKKCEP  346



>ref|XP_010263613.1| PREDICTED: LOW QUALITY PROTEIN: bifunctional dihydroflavonol 
4-reductase/flavanone 4-reductase-like [Nelumbo nucifera]
Length=342

 Score =   309 bits (792),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 147/257 (57%), Positives = 204/257 (79%), Gaps = 3/257 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP ++G+L+I+ SCAKAKTV+++VFTSS   V
Sbjct  73   EAIQGCSGVFHVATPMDFESKDPENEVIKPCIEGVLNIMRSCAKAKTVRRVVFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E QQ EYDESSWSD+DF    KM GWMYF SK+LAEK AW+ A++  I+FISIIP L
Sbjct  133  NVQEHQQPEYDESSWSDVDFCRRTKMTGWMYFVSKSLAEKAAWEFAEQNNIDFISIIPTL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF++ + P S++TAL+ I    G   H++I+KQ +FVHLDDLC A I+L++HP+A G
Sbjct  193  VVGPFIMSSMPPSMITALALI---TGTESHYSILKQVQFVHLDDLCNAHIYLFEHPEAKG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSS  ATI+ +A M++  +PEY +P++F+GI++ L  V FSS+K++ +GF+FKY++E
Sbjct  250  RYICSSDQATIYSLANMLKEKFPEYNIPTKFEGIDESLEAVRFSSEKIRSLGFEFKYSVE  309

Query  722  DMYKGAIETLRKKGLLP  772
            DMY GA++  R+KGL+P
Sbjct  310  DMYVGAVKCAREKGLIP  326



>emb|CBI19727.3| unnamed protein product [Vitis vinifera]
Length=931

 Score =   326 bits (835),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 161/265 (61%), Positives = 207/265 (78%), Gaps = 3/265 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP ++G+L I+ SCA AKTV++LVFTSS   V
Sbjct  667  EAIKGCTGVFHVATPMDFESKDPENEVIKPTIEGMLGIMKSCAAAKTVRRLVFTSSAGTV  726

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +I+E Q   YDES WSD++F  A KM  WMYF SKTLAE+ AWK AKE  I+FI+IIP L
Sbjct  727  NIQEHQLPVYDESCWSDMEFCRAKKMTAWMYFVSKTLAEQAAWKYAKENNIDFITIIPTL  786

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF++ + P SL+TALSPI    GN  H++II+QG+FVHLDDLC A I+L+++PKA G
Sbjct  787  VVGPFIMSSMPPSLITALSPI---TGNEAHYSIIRQGQFVHLDDLCNAHIYLFENPKAEG  843

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH   I D+AKM+R  +PEY +P+EFKG+++ L  V FSSKKL ++GF+FKY+LE
Sbjct  844  RYICSSHDCIILDLAKMLREKYPEYNIPTEFKGVDENLKSVCFSSKKLTDLGFEFKYSLE  903

Query  722  DMYKGAIETLRKKGLLPYSTKEPAD  796
            DM+ GA++T R KGLLP S ++P D
Sbjct  904  DMFTGAVDTCRAKGLLPPSHEKPVD  928


 Score =   230 bits (586),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 117/263 (44%), Positives = 183/263 (70%), Gaps = 9/263 (3%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            +AI GC GVFHVA+ ++ +++D +NEVI P V G+L I+ +C KAKTVK+ ++TS+T  +
Sbjct  74   DAIQGCIGVFHVASPMDISTQDAQNEVIDPTVNGVLDIMRACTKAKTVKRFIYTSTTGTI  133

Query  182  HIK-ETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPP  358
             +  E   LEYDES W+D+D+  A KM  WMYF +KT AEK AW+ AKEK ++ ++I PP
Sbjct  134  TVGPEPLPLEYDESFWTDVDYCKAQKMTAWMYFIAKTTAEKAAWEFAKEKGLDVVTIQPP  193

Query  359  LVIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAG  538
            +V+GPF+ P+ P S    L+ +    G     N++ +G+ VH+DDLC+A I+L++HP+A 
Sbjct  194  VVVGPFVTPSLPPSAKLVLAVL---TGEEAGCNLLARGRAVHVDDLCDAHIYLFEHPEAK  250

Query  539  GRFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTL  718
            GR+ICSSH   I ++A+ +   + EY +P++F+G+++ L  +  SS+KL ++G++FKY  
Sbjct  251  GRYICSSHCFNIIELARSLSLKYSEYNIPTKFEGVDESLKSIPCSSRKLLDLGYKFKYNS  310

Query  719  E-----DMYKGAIETLRKKGLLP  772
            E     D+  GAIE+ ++KGL+P
Sbjct  311  EEYDIGDLCSGAIESCKEKGLMP  333



>gb|AAR27015.1| dihydroflavonal-4-reductase 2 [Medicago truncatula]
 gb|KEH40172.1| dihydroflavonol 4-reductase-like protein [Medicago truncatula]
Length=339

 Score =   309 bits (791),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 154/265 (58%), Positives = 201/265 (76%), Gaps = 3/265 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPE EVI P + G+L I+ +C KAKTV++LVFTSS   +
Sbjct  73   EAIKGCTGVFHVATPMDFESKDPEKEVINPTINGLLDIMKACKKAKTVRRLVFTSSAGTL  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             + E Q    DE+ WSD++F    KM GWMYF SKTLAE+EAWK +KE  I+F+SIIPPL
Sbjct  133  DVTEQQNSVIDETCWSDVEFCRRVKMTGWMYFVSKTLAEQEAWKFSKEHNIDFVSIIPPL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF++P+ P SL+TALS I    G   H++IIKQG+++HLDDLC A IFL+++PKA G
Sbjct  193  VVGPFIMPSMPPSLITALSLI---TGYEAHYSIIKQGQYIHLDDLCLAHIFLFENPKAHG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+IC SH ATIH+VAK+I   +PE+ VP++FK I  +L I+ FSSKK+ ++GF FKY+LE
Sbjct  250  RYICCSHEATIHEVAKLINKKYPEFNVPTKFKDIPDDLEIIKFSSKKITDLGFIFKYSLE  309

Query  722  DMYKGAIETLRKKGLLPYSTKEPAD  796
            DM+ GAIET R+KGLLP  T+ P +
Sbjct  310  DMFTGAIETCREKGLLPKVTETPVN  334



>ref|XP_006473894.1| PREDICTED: dihydroflavonol-4-reductase [Citrus sinensis]
Length=340

 Score =   309 bits (791),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 151/259 (58%), Positives = 200/259 (77%), Gaps = 3/259 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            E I GC GVFH+A  ++F SKDPENEVI+P + G+LSI+ +C  AKTV++LVFTSS   +
Sbjct  73   EPIRGCTGVFHLATPMDFESKDPENEVIRPTINGMLSIMRACKNAKTVRRLVFTSSAGTL  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E ++  YDE+SWSDLDF+ + KM GWMYF SKTLAE+ AWK A+E  I+FISIIP L
Sbjct  133  DVEEHRKPVYDETSWSDLDFVRSVKMTGWMYFVSKTLAEQAAWKFAEENNIDFISIIPSL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPFL  + P SL+TALSPI     N  H+ IIKQG+FVHLDDLC A IFL++HP A G
Sbjct  193  VVGPFLTSSMPPSLITALSPI---TRNEAHYPIIKQGQFVHLDDLCSAHIFLFEHPNAKG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATI ++AK++R  + E+ VP+EF+ +++ +  + FSSKKL ++GF+FKY+LE
Sbjct  250  RYICSSHPATILELAKLLREKYTEFTVPTEFEDVDENMKNMLFSSKKLTDLGFKFKYSLE  309

Query  722  DMYKGAIETLRKKGLLPYS  778
            DM+ GA++T R KGLLP S
Sbjct  310  DMFTGAVDTCRTKGLLPLS  328



>gb|AHZ31751.1| dihydroflavonol 4-reductase [Viola x wittrockiana]
Length=347

 Score =   308 bits (789),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 154/257 (60%), Positives = 198/257 (77%), Gaps = 4/257 (2%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP V G+L I+ +C KAKTV+++VFTSS   V
Sbjct  77   EAIQGCNGVFHVATPMDFDSKDPENEVIKPTVYGVLDIMKACVKAKTVQRVVFTSSAGTV  136

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E ++  YDES+ SDL+F+ + KM GWMYF SKTLAE+ AWK A E +I+FISIIPPL
Sbjct  137  DVEEHKKPVYDESNRSDLEFVRSVKMTGWMYFVSKTLAERAAWKFAAENKIDFISIIPPL  196

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF++P  P SL+TALS I    GN  H+ IIK G +VHLDDLC+A IFL++HPK+ G
Sbjct  197  VVGPFIMPLMPPSLITALSLI---TGNEAHYGIIKLGNYVHLDDLCQAHIFLFEHPKSEG  253

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICS+  ATIHD+AKM+R  +PEY +P  + G ++ L    FSSKK+ ++GFQFKY LE
Sbjct  254  RYICSAEAATIHDLAKMLRQKYPEYNIPESY-GTDENLSKCVFSSKKVTDLGFQFKYNLE  312

Query  722  DMYKGAIETLRKKGLLP  772
            DM+ GA+ET R+KGLLP
Sbjct  313  DMFVGAVETCREKGLLP  329



>dbj|BAD67185.1| dihydroflavonol 4-reductase [Spinacia oleracea]
Length=342

 Score =   308 bits (789),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 154/259 (59%), Positives = 199/259 (77%), Gaps = 4/259 (2%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI+GC GVFHVA  ++F S DPENEVIKP + G+L I+ SCAKAK +++LVFTSS   V
Sbjct  73   EAISGCAGVFHVATPMDFDSNDPENEVIKPTINGMLDIMRSCAKAK-IRRLVFTSSAGTV  131

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E Q+  YDE+ WSD++F  + KM GWMYF SKTLAEK AWK A E  ++FISIIPPL
Sbjct  132  NVEEIQKPVYDETCWSDMEFCSSKKMTGWMYFVSKTLAEKAAWKFAAENNLDFISIIPPL  191

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+ PT P SL+TALSPI     N  H++IIKQG+FVHLDDLC A I+LY+HP A G
Sbjct  192  VVGPFITPTMPPSLITALSPI---TRNEAHYSIIKQGQFVHLDDLCMAHIYLYEHPNAKG  248

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+I S+  ATI+D+ KM+R  +PEY +P++FK  E+++  V FSS+KL  + F+FKY L+
Sbjct  249  RYIASACDATIYDIGKMLREEYPEYNIPTKFKDFEEDMEHVHFSSEKLMGLNFKFKYELK  308

Query  722  DMYKGAIETLRKKGLLPYS  778
            DMYKGA++T R KGLLP S
Sbjct  309  DMYKGAVDTCRTKGLLPPS  327



>gb|AEI59122.1| dihydroflavonol 4-reductase [Medicago sativa]
Length=339

 Score =   308 bits (788),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 153/265 (58%), Positives = 202/265 (76%), Gaps = 3/265 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPE EVI P + G+L I+ +C KAKTV++LVFTSS   +
Sbjct  73   EAIKGCTGVFHVATPMDFESKDPEKEVINPTINGLLDIMKACEKAKTVRRLVFTSSAGTL  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             + E Q+   DE+ WSD++F    KM GWMYF SKTLAE+EAWK +KE  I+F+SIIPPL
Sbjct  133  DVTEHQKSVIDETCWSDVEFCRRVKMTGWMYFVSKTLAEQEAWKFSKEHNIDFVSIIPPL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF++P+ P SL+TALS I    GN  H++IIKQG+++HL DLC A IFL+++PKA G
Sbjct  193  VVGPFIMPSMPPSLITALSLI---TGNEAHYSIIKQGQYIHLHDLCLAHIFLFENPKAQG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+IC SH ATIH+VAK+I   +PE+ VP++FK I  EL I+ FSSKK+ ++GF+F+Y+LE
Sbjct  250  RYICCSHEATIHEVAKLINKKYPEFNVPTKFKDIPDELEIIKFSSKKITDLGFKFEYSLE  309

Query  722  DMYKGAIETLRKKGLLPYSTKEPAD  796
            DM+ GAIET R+KGLLP   + P +
Sbjct  310  DMFTGAIETCREKGLLPKVEETPVN  334



>ref|XP_006281803.1| hypothetical protein CARUB_v10027976mg, partial [Capsella rubella]
 gb|EOA14701.1| hypothetical protein CARUB_v10027976mg, partial [Capsella rubella]
Length=326

 Score =   307 bits (786),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/257 (59%), Positives = 195/257 (76%), Gaps = 3/257 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            +AI GC+GVFHVA  ++F SKDPENEVIKP V G+L I+ +C KAKTV++ VFTSS   V
Sbjct  73   DAIKGCDGVFHVATPMDFESKDPENEVIKPTVNGMLGILKACVKAKTVRRFVFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E ++  YDE  WSDL+FI + KM GWMYF SKTLAEK AW  A+EK ++FISIIP L
Sbjct  133  NVEEHKKSVYDEQDWSDLEFIMSKKMTGWMYFVSKTLAEKAAWDYAEEKGLDFISIIPTL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+  + P SL+TALSPI     N  H++II+QG++VHLDDLC A IFLY+H  A G
Sbjct  193  VVGPFITTSMPPSLITALSPI---TRNEAHYSIIRQGQYVHLDDLCNAHIFLYEHNAAKG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATI  ++K +R  +PEY VPS F+G+++ L  + FSSKKL EMGF FKY+LE
Sbjct  250  RYICSSHDATILTISKFLRQKYPEYNVPSTFEGVDENLKSIKFSSKKLTEMGFNFKYSLE  309

Query  722  DMYKGAIETLRKKGLLP  772
            +M   +IET R+KG LP
Sbjct  310  EMMVESIETCRQKGFLP  326



>gb|ACJ84553.1| unknown [Medicago truncatula]
Length=339

 Score =   307 bits (787),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 153/265 (58%), Positives = 200/265 (75%), Gaps = 3/265 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPE EVI P + G+L I+ +C KAKTV++LVFTSS   +
Sbjct  73   EAIKGCTGVFHVATPMDFESKDPEKEVINPTINGLLDIMKACKKAKTVRRLVFTSSAGTL  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             + E Q    DE+ WSD++F    KM GWMYF SKTLAE+EAWK +KE  I+ +SIIPPL
Sbjct  133  DVTEQQNSVIDETCWSDVEFCRRVKMTGWMYFVSKTLAEQEAWKFSKEHNIDLVSIIPPL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF++P+ P SL+TALS I    G   H++IIKQG+++HLDDLC A IFL+++PKA G
Sbjct  193  VVGPFIMPSMPPSLITALSLI---TGYEAHYSIIKQGQYIHLDDLCLAHIFLFENPKAHG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+IC SH ATIH+VAK+I   +PE+ VP++FK I  +L I+ FSSKK+ ++GF FKY+LE
Sbjct  250  RYICCSHEATIHEVAKLINKKYPEFNVPTKFKDIPDDLEIIKFSSKKITDLGFIFKYSLE  309

Query  722  DMYKGAIETLRKKGLLPYSTKEPAD  796
            DM+ GAIET R+KGLLP  T+ P +
Sbjct  310  DMFTGAIETCREKGLLPKVTETPVN  334



>gb|KDO84613.1| hypothetical protein CISIN_1g040253mg [Citrus sinensis]
Length=338

 Score =   307 bits (786),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 149/257 (58%), Positives = 199/257 (77%), Gaps = 3/257 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            E I GC GVFH+A  ++F SKDPENEVI+P + G++SI+ +C  AKTV++LVFTSS   +
Sbjct  73   EPIRGCTGVFHLATPMDFESKDPENEVIRPTINGMVSIMRACKNAKTVRRLVFTSSAGTL  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E ++  YDE+SWSDLDF+ + KM GWMYF SKTLAE+ AWK A+E  I+FISIIP L
Sbjct  133  DVEEHRKPVYDETSWSDLDFVRSVKMTGWMYFVSKTLAEQAAWKFAEENNIDFISIIPSL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPFL  + P SL+TALSPI     N  H+ IIKQG+FVHLDDLC A IFL++HP A G
Sbjct  193  VVGPFLTSSMPPSLITALSPI---TRNEAHYPIIKQGQFVHLDDLCSAHIFLFEHPNAKG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATI ++AK +R  +PE+ VP+EF+ +++ +  + FSSKKL ++GF+FKY+L+
Sbjct  250  RYICSSHPATILELAKFLREKYPEFNVPTEFEDVDENMKNMLFSSKKLTDLGFKFKYSLD  309

Query  722  DMYKGAIETLRKKGLLP  772
            DM+ GA++T R KGLLP
Sbjct  310  DMFTGAVDTCRAKGLLP  326



>ref|XP_010926084.1| PREDICTED: dihydroflavonol-4-reductase-like [Elaeis guineensis]
Length=359

 Score =   307 bits (787),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/263 (58%), Positives = 202/263 (77%), Gaps = 3/263 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP V G+LSI+ SC KA TVK+++FTSS   V
Sbjct  70   EAIEGCSGVFHVATPMDFESKDPENEVIKPTVNGLLSIMKSCKKAGTVKRVIFTSSAGTV  129

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E  + EYDESSW+D++F    KM GWMYF SKTLAE+ AW+ A+E  I FISIIP L
Sbjct  130  NVQEHLKSEYDESSWTDIEFCRRVKMTGWMYFVSKTLAEQAAWEFARENGIHFISIIPTL  189

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+  + P SL+TALS I    GN  H++I+KQ +FVHLDDLC A IFLY+HP+A G
Sbjct  190  VVGPFISSSMPPSLITALSLI---TGNEPHYSILKQVQFVHLDDLCIAHIFLYEHPEANG  246

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH  TI+++A+M++  +P+Y +P +F+GI+  +  V FSSKKL ++GF+F+Y++E
Sbjct  247  RYICSSHDVTIYELARMMKERYPQYSIPQKFEGIDDGIGRVCFSSKKLIDLGFKFRYSME  306

Query  722  DMYKGAIETLRKKGLLPYSTKEP  790
            DM+  AI+T R+K LLP  TKEP
Sbjct  307  DMFDAAIQTCREKKLLPLQTKEP  329



>ref|XP_010442115.1| PREDICTED: dihydroflavonol-4-reductase [Camelina sativa]
Length=377

 Score =   308 bits (788),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 153/259 (59%), Positives = 196/259 (76%), Gaps = 3/259 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            +AI GC+GVFHVA  ++F SKDPENEVIKP V GIL I+ +C +AKTV++ VFTSS   V
Sbjct  73   DAIKGCDGVFHVATPMDFESKDPENEVIKPTVNGILGILKACVEAKTVRRFVFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E Q+  YDE  WSDL+FI + KM GWMYF SKTLAEK AW  A+EK ++FISIIP L
Sbjct  133  NVEENQKSVYDEQDWSDLEFIMSKKMTGWMYFVSKTLAEKAAWDYAEEKGLDFISIIPTL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+  + P SL+TALSPI     N  H++II+QG++VHLDDLC A IFLY+   A G
Sbjct  193  VVGPFITTSMPPSLITALSPI---TRNEAHYSIIRQGQYVHLDDLCNAHIFLYEKTAAKG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATI  ++K +R  +PEY VPS F+G+++ L  + FSSKKL EMGF FKY+LE
Sbjct  250  RYICSSHDATILTMSKFLRQKYPEYNVPSTFEGVDENLKGIVFSSKKLTEMGFNFKYSLE  309

Query  722  DMYKGAIETLRKKGLLPYS  778
            +M+  +IET R+KG LP S
Sbjct  310  EMFIESIETCRQKGFLPVS  328



>gb|AIM48930.1| dihydroflavonol 4-reductase [Raphanus sativus]
Length=389

 Score =   308 bits (789),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 154/259 (59%), Positives = 197/259 (76%), Gaps = 3/259 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            +AI GC+GVFH+A  ++F SKDPENEVIKP V G+L I+ +C KAKTV+++VFTSS   V
Sbjct  76   DAINGCDGVFHIATPMDFESKDPENEVIKPTVNGVLGIMKACDKAKTVRRIVFTSSAGTV  135

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E Q+  YDE+ WSDLDFI + KM GWMYF SKTLAEK AW  AKEK I+FISIIP L
Sbjct  136  NVEEHQKNVYDENDWSDLDFIMSKKMTGWMYFMSKTLAEKAAWDYAKEKGIDFISIIPTL  195

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            VIGPF+  + P SL+TALSPI     N   ++II+QG++VHLDDLC A IFLY+   A G
Sbjct  196  VIGPFITTSMPPSLITALSPI---TRNEAQYSIIRQGQYVHLDDLCNAHIFLYEQTVAKG  252

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R++CSSH ATI  +++ IR  +PEY VPS F+G+++ L  ++FSSKKL +MGF FKY+LE
Sbjct  253  RYVCSSHDATILSISEFIRQKYPEYNVPSSFEGVDENLKSIAFSSKKLIDMGFNFKYSLE  312

Query  722  DMYKGAIETLRKKGLLPYS  778
            DM   +IET R+KG LP S
Sbjct  313  DMLVESIETCRQKGFLPVS  331



>gb|ABY89686.1| dihydroflavonol-4-reductase 2 protein [Brassica rapa subsp. oleifera]
Length=332

 Score =   306 bits (783),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 153/257 (60%), Positives = 196/257 (76%), Gaps = 3/257 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            +AI GC+GVFH+A  ++F SKDPENEVIKP V G+L I+ +C KAKTV+++VFTSS   V
Sbjct  73   DAINGCDGVFHIATPMDFESKDPENEVIKPTVNGVLGIMKACDKAKTVRRIVFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E Q+  YDE+ WSDLDFI + KM GWMYF SKTLAEK AW  AKEK I+FISIIP L
Sbjct  133  NVEEHQKNVYDENDWSDLDFIMSKKMTGWMYFMSKTLAEKAAWDYAKEKGIDFISIIPTL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            VIGPF+  + P SL+TALSPI     N  H++II+QG++VHLDDLC A IFLY+   A G
Sbjct  193  VIGPFITTSMPPSLITALSPI---TRNEAHYSIIRQGQYVHLDDLCNAHIFLYEQAGAKG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R++CSSH ATI  +++ +R  +PEY VPS F+G+++ L  + FSSKKL +MGF FKY+LE
Sbjct  250  RYVCSSHDATILTISEFLRQKYPEYNVPSTFEGVDENLKSIMFSSKKLIDMGFNFKYSLE  309

Query  722  DMYKGAIETLRKKGLLP  772
            DM   +IET R+KG LP
Sbjct  310  DMLVESIETCRQKGFLP  326



>gb|ABG76202.1| dihydroflavonol reductase [Brassica napus]
Length=385

 Score =   308 bits (788),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 154/262 (59%), Positives = 198/262 (76%), Gaps = 3/262 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            +AI GC+GVFH+A  ++F SKDPENEVIKP V G+L I+ +C KAKTV+++VFTSS   V
Sbjct  73   DAINGCDGVFHIATPMDFESKDPENEVIKPTVNGVLGIMKACDKAKTVRRIVFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E Q+  YDE+ WSDLDFI + KM GWMYF SKTLAEK AW  AKEK I+FISIIP L
Sbjct  133  NVEEHQKNVYDENDWSDLDFIMSKKMTGWMYFMSKTLAEKAAWDYAKEKGIDFISIIPTL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            VIGPF+  + P SL+TALSPI     N  H++II+QG++VHLDDLC A IFLY+   A G
Sbjct  193  VIGPFITTSMPPSLITALSPI---TRNEAHYSIIRQGQYVHLDDLCNAHIFLYEQAAAKG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R++CSSH ATI  +++ +R  +PEY VPS F+G+++ L  + FSSKKL +MGF FKY+LE
Sbjct  250  RYVCSSHDATILTISEFLRQKYPEYNVPSTFEGVDENLKSIMFSSKKLIDMGFNFKYSLE  309

Query  722  DMYKGAIETLRKKGLLPYSTKE  787
            DM   +IET R+KG LP +  E
Sbjct  310  DMLVESIETCRQKGFLPVTLPE  331



>emb|CAP08818.1| dihydroflavonol reductase [Arabidopsis thaliana]
 emb|CAP08820.1| dihydroflavonol reductase [Arabidopsis thaliana]
 emb|CAP08824.1| dihydroflavonol reductase [Arabidopsis thaliana]
Length=384

 Score =   307 bits (787),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 153/259 (59%), Positives = 197/259 (76%), Gaps = 3/259 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            +AI GC+GVFHVA  ++F SKDPENEVIKP V G+L I+ +C KAKTV++ VFTSS   V
Sbjct  73   DAINGCDGVFHVATPMDFESKDPENEVIKPTVNGMLGIMKACVKAKTVRRFVFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E Q+  YDE+ WSDL+FI + KM GWMYF SKTLAEK AW  A+EK ++FISIIP L
Sbjct  133  NVEEHQKNVYDENDWSDLEFIMSKKMTGWMYFVSKTLAEKAAWDFAEEKGLDFISIIPTL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+  + P SL+TALSPI     N  H++II+QG++VHLDDLC A IFLY+   A G
Sbjct  193  VVGPFITTSMPPSLITALSPI---TRNEAHYSIIRQGQYVHLDDLCNAHIFLYEQAAAKG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATI  ++K +R  +PEY VPS F+G+++ L  + FSSKKL EMGF FKY+LE
Sbjct  250  RYICSSHDATILTISKFLRPKYPEYNVPSTFEGVDENLKSIEFSSKKLTEMGFNFKYSLE  309

Query  722  DMYKGAIETLRKKGLLPYS  778
            +M+  +IET R+KG LP S
Sbjct  310  EMFIESIETCRQKGFLPVS  328



>emb|CAP08805.1| dihydroflavonol reductase [Arabidopsis thaliana]
 emb|CAP08810.1| dihydroflavonol reductase [Arabidopsis thaliana]
 emb|CAP08826.1| dihydroflavonol reductase [Arabidopsis thaliana]
Length=384

 Score =   307 bits (787),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 153/259 (59%), Positives = 197/259 (76%), Gaps = 3/259 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            +AI GC+GVFHVA  ++F SKDPENEVIKP V G+L I+ +C KAKTV++ VFTSS   V
Sbjct  73   DAINGCDGVFHVATPMDFESKDPENEVIKPTVNGMLGIMKACVKAKTVRRFVFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E Q+  YDE+ WSDL+FI + KM GWMYF SKTLAEK AW  A+EK ++FISIIP L
Sbjct  133  NVEEHQKNVYDENDWSDLEFIMSKKMTGWMYFVSKTLAEKAAWDFAEEKGLDFISIIPTL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+  + P SL+TALSPI     N  H++II+QG++VHLDDLC A IFLY+   A G
Sbjct  193  VVGPFITTSMPPSLITALSPI---TRNEAHYSIIRQGQYVHLDDLCNAHIFLYEQAAAKG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH ATI  ++K +R  +PEY VPS F+G+++ L  + FSSKKL EMGF FKY+LE
Sbjct  250  RYICSSHDATILTISKFLRPKYPEYNVPSTFEGVDENLKSIEFSSKKLTEMGFNFKYSLE  309

Query  722  DMYKGAIETLRKKGLLPYS  778
            +M+  +IET R+KG LP S
Sbjct  310  EMFIESIETCRQKGFLPVS  328



>gb|AFK35813.1| unknown [Medicago truncatula]
Length=339

 Score =   306 bits (783),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 153/265 (58%), Positives = 199/265 (75%), Gaps = 3/265 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPE EVI P + G+L I+ +C KAKTV++LVFTSS   +
Sbjct  73   EAIKGCTGVFHVATPMDFESKDPEKEVINPTINGLLDIMKACKKAKTVRRLVFTSSAGTL  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             + E Q    DE+ WSD++F    KM GWMYF SKTLAE+EAWK +KE  I+ +SIIPPL
Sbjct  133  DVTEQQNSVIDETCWSDVEFCRRVKMTGWMYFVSKTLAEQEAWKFSKEHNIDLVSIIPPL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF++P+ P SL+TALS I    G   H++IIKQG ++HLDDLC A IFL+++PKA G
Sbjct  193  VVGPFIMPSMPPSLITALSLI---TGYEAHYSIIKQGPYIHLDDLCLAHIFLFENPKAHG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+IC SH ATIH+VAK+I   +PE+ VP++FK I  +L I+ FSSKK+ ++GF FKY+LE
Sbjct  250  RYICCSHEATIHEVAKLINKKYPEFNVPTKFKDIPDDLEIIKFSSKKITDLGFIFKYSLE  309

Query  722  DMYKGAIETLRKKGLLPYSTKEPAD  796
            DM+ GAIET R+KGLLP  T+ P +
Sbjct  310  DMFTGAIETCREKGLLPKVTETPVN  334



>ref|XP_009114035.1| PREDICTED: dihydroflavonol-4-reductase [Brassica rapa]
 gb|ABL86389.1| dihydroflavonol 4-reductase [Brassica juncea]
 gb|ABL86390.1| dihydroflavonol 4-reductase [Brassica juncea]
 emb|CDY52372.1| BnaA09g15710D [Brassica napus]
Length=385

 Score =   307 bits (787),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 154/262 (59%), Positives = 198/262 (76%), Gaps = 3/262 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            +AI GC+GVFH+A  ++F SKDPENEVIKP V G+L I+ +C KAKTV+++VFTSS   V
Sbjct  73   DAINGCDGVFHIATPMDFESKDPENEVIKPTVNGVLGIMKACDKAKTVRRIVFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E Q+  YDE+ WSDLDFI + KM GWMYF SKTLAEK AW  AKEK I+FISIIP L
Sbjct  133  NVEEHQKNVYDENDWSDLDFIMSKKMTGWMYFMSKTLAEKAAWDYAKEKGIDFISIIPTL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            VIGPF+  + P SL+TALSPI     N  H++II+QG++VHLDDLC A IFLY+   A G
Sbjct  193  VIGPFITTSMPPSLITALSPI---TRNEAHYSIIRQGQYVHLDDLCNAHIFLYEQAAAKG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R++CSSH ATI  +++ +R  +PEY VPS F+G+++ L  + FSSKKL +MGF FKY+LE
Sbjct  250  RYVCSSHDATILTISEFLRQKYPEYNVPSTFEGVDENLKSIMFSSKKLIDMGFNFKYSLE  309

Query  722  DMYKGAIETLRKKGLLPYSTKE  787
            DM   +IET R+KG LP +  E
Sbjct  310  DMLVESIETCRQKGFLPVTLPE  331



>gb|AGU42192.1| dihydroflavonol 4-reductase [Raphanus sativus]
Length=387

 Score =   307 bits (787),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 154/259 (59%), Positives = 196/259 (76%), Gaps = 3/259 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            +AI GC+GVFH+A  ++F SKDPENEVIKP V G+L I+ +C KAKTV+++VFTSS   V
Sbjct  74   DAINGCDGVFHIATPMDFESKDPENEVIKPTVNGVLGIMKACDKAKTVRRIVFTSSAGTV  133

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E Q+  YDE+ WSDLDFI + KM GWMYF SKTLAEK AW  AKEK I+FISIIP L
Sbjct  134  NVEEHQKNVYDENDWSDLDFIMSKKMTGWMYFMSKTLAEKAAWDYAKEKGIDFISIIPTL  193

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            VIGPF+  + P SL+TALSPI     N  H++II+QG++VHLDDLC A IFLY+   A G
Sbjct  194  VIGPFITTSMPPSLITALSPI---TRNEAHYSIIRQGQYVHLDDLCNAHIFLYEQAVAKG  250

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R++CSSH ATI  +++  R  +PEY VPS F+G+++ L  + FSSKKL +MGF FKY+LE
Sbjct  251  RYVCSSHDATILTISEFFRQKYPEYNVPSSFEGVDENLKSIVFSSKKLIDMGFNFKYSLE  310

Query  722  DMYKGAIETLRKKGLLPYS  778
            DM   +IET R+KG LP S
Sbjct  311  DMLVESIETCRQKGFLPVS  329



>ref|XP_008797532.1| PREDICTED: dihydroflavonol-4-reductase [Phoenix dactylifera]
Length=356

 Score =   306 bits (784),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 150/263 (57%), Positives = 202/263 (77%), Gaps = 3/263 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP V G+LSI+ SC KA TVK+++FTSS   V
Sbjct  72   EAIEGCSGVFHVATPMDFESKDPENEVIKPTVTGLLSIMKSCKKAGTVKRVIFTSSAGTV  131

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E Q  EY+ESSWSD++F    KM GWMYF SKTLAE+ AW+ A+E  I FISIIP L
Sbjct  132  NVQEHQHSEYEESSWSDIEFCRRVKMTGWMYFVSKTLAEQAAWEFARENGIHFISIIPTL  191

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF+  + P SL+TALS I    GN  H++I+KQ +FVHLDDLC A IFL++HP+A G
Sbjct  192  VVGPFISSSMPPSLITALSLI---TGNEAHYSILKQIQFVHLDDLCVAHIFLFEHPEANG  248

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R+ICSSH  TI+++A+M++  +P+Y +P +F+GI+  +  V FSSKKL ++GF+F+Y++E
Sbjct  249  RYICSSHDVTIYELARMMKERYPQYSIPQKFEGIDDGIGRVCFSSKKLIDLGFKFRYSME  308

Query  722  DMYKGAIETLRKKGLLPYSTKEP  790
            DM+  AI+  R+K L+P+ TKEP
Sbjct  309  DMFDAAIQICREKKLIPHQTKEP  331



>gb|AAV80210.1| dihydroflavonol-4-reductase [Brassica rapa subsp. pekinensis]
 gb|ABY89685.1| dihydroflavonol-4-reductase 1 protein [Brassica rapa subsp. oleifera]
Length=385

 Score =   307 bits (786),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 154/262 (59%), Positives = 198/262 (76%), Gaps = 3/262 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            +AI GC+GVFH+A  ++F SKDPENEVIKP V G+L I+ +C KAKTV+++VFTSS   V
Sbjct  73   DAINGCDGVFHIATPMDFESKDPENEVIKPTVNGVLGIMKACDKAKTVRRIVFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E Q+  YDE+ WSDLDFI + KM GWMYF SKTLAEK AW  AKEK I+FISIIP L
Sbjct  133  NVEEHQKNVYDENDWSDLDFIMSKKMTGWMYFMSKTLAEKAAWDYAKEKGIDFISIIPTL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            VIGPF+  + P SL+TALSPI     N  H++II+QG++VHLDDLC A IFLY+   A G
Sbjct  193  VIGPFITTSMPPSLITALSPI---TRNEAHYSIIRQGQYVHLDDLCNAHIFLYEQAGAKG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R++CSSH ATI  +++ +R  +PEY VPS F+G+++ L  + FSSKKL +MGF FKY+LE
Sbjct  250  RYVCSSHDATILTISEFLRQKYPEYNVPSTFEGVDENLKSIMFSSKKLIDMGFNFKYSLE  309

Query  722  DMYKGAIETLRKKGLLPYSTKE  787
            DM   +IET R+KG LP +  E
Sbjct  310  DMLVESIETCRQKGFLPVTLPE  331



>gb|ADB45307.1| dihydroflavonol 4-reductase [Brassica juncea var. napiformis]
Length=385

 Score =   307 bits (786),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 154/262 (59%), Positives = 197/262 (75%), Gaps = 3/262 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            +AI GC+GVFH+A  ++F SKDPENEVIKP V G+L I+ +C KAKTV+++VFTSS   V
Sbjct  73   DAINGCDGVFHIATPMDFESKDPENEVIKPTVNGVLGIMKACDKAKTVRRIVFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
             ++E Q+  YDE+ WSDLDFI + KM GWMYF SKTLAEK AW  AKEK I+FISIIP L
Sbjct  133  SVEEHQKNVYDENDWSDLDFIMSKKMTGWMYFMSKTLAEKAAWDYAKEKGIDFISIIPTL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            VIGPF+  + P SL+TALSPI     N  H++II+QG++VHLDDLC A IFLY+   A G
Sbjct  193  VIGPFITTSMPPSLITALSPI---TRNEAHYSIIRQGQYVHLDDLCNAHIFLYEQAAAKG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R++CSSH ATI  +++ +R  +PEY VPS F+G+++ L  + FSSKKL +MGF FKY+LE
Sbjct  250  RYVCSSHDATILTISEFLRQKYPEYNVPSTFEGVDENLKSIMFSSKKLIDMGFNFKYSLE  309

Query  722  DMYKGAIETLRKKGLLPYSTKE  787
            DM   +IET R+KG LP +  E
Sbjct  310  DMLVESIETCRQKGFLPVTLPE  331



>gb|ACZ48697.1| dihydroflavonol-4-reductase [Fagopyrum tataricum]
Length=341

 Score =   305 bits (782),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 154/274 (56%), Positives = 207/274 (76%), Gaps = 7/274 (3%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            EAI GC GVFHVA  ++F SKDPENEVIKP + G+L I+ +C KA  V+KLVFTSS   V
Sbjct  73   EAIQGCAGVFHVATPMDFESKDPENEVIKPTINGMLDIMKACLKA-NVRKLVFTSSAGTV  131

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E Q+  YDE+ WSD+DF    KM GWMYF SKTLAE+ AWK A+E  ++FISIIP L
Sbjct  132  NVEEKQKPVYDETCWSDVDFCRRVKMTGWMYFVSKTLAEQAAWKFAEENNMDFISIIPTL  191

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            V+GPF++P+FP SL+TALSPI    G   H+ IIKQ ++VHLDDLC + I+LY+   + G
Sbjct  192  VVGPFIMPSFPPSLITALSPITRTEG---HYTIIKQCQYVHLDDLCMSHIYLYEKAGSKG  248

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R++CSSH+ATI+D+ KM+R+ +PEY VP++F+  ++ +  VSFSSKKL + GF+FKY+LE
Sbjct  249  RYVCSSHNATIYDLGKMLRNKYPEYNVPTKFRDFDENMEAVSFSSKKLTDEGFEFKYSLE  308

Query  722  DMYKGAIETLRKKGLLPYSTKEPADIEQEQHSGK  823
            DM+ GA+ET R+KGLLP + +E   IE+   +G 
Sbjct  309  DMFVGAVETCREKGLLPKTFEE---IEKNHVNGN  339



>ref|XP_002862988.1| dihydroflavonol reductase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39247.1| dihydroflavonol reductase [Arabidopsis lyrata subsp. lyrata]
Length=384

 Score =   307 bits (786),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 149/258 (58%), Positives = 198/258 (77%), Gaps = 3/258 (1%)
 Frame = +2

Query  5    AIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAVH  184
            AI GC+GVFHVA  ++F SKDPENEVIKP V G+L I+ +C KAKTV++ +FTSS   V+
Sbjct  74   AITGCDGVFHVATPMDFESKDPENEVIKPTVNGMLGIMKACVKAKTVRRFIFTSSAGTVN  133

Query  185  IKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPLV  364
            ++E Q+  YDE+ WSDL+FI + KM GWMYF SKTLAEK AW  A+EK ++FISIIP LV
Sbjct  134  VEEHQKSVYDENDWSDLEFIMSKKMTGWMYFVSKTLAEKAAWDYAEEKGLDFISIIPTLV  193

Query  365  IGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGGR  544
            +GPF+  + P SL+TALSPI     N  H++II+QG++VHLDDLC + IFLY+   A GR
Sbjct  194  VGPFITTSMPPSLITALSPI---TRNEAHYSIIRQGQYVHLDDLCNSHIFLYEQETAKGR  250

Query  545  FICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLED  724
            +ICSSH ATI  ++K++R  +PEY VPS ++G+++ L  + FSSKKL +MGF FKY+LE+
Sbjct  251  YICSSHDATILTISKLLRQKYPEYNVPSTYEGVDENLKSIEFSSKKLTDMGFNFKYSLEE  310

Query  725  MYKGAIETLRKKGLLPYS  778
            M+  +IET R+KG LP+S
Sbjct  311  MFIESIETCRQKGFLPFS  328



>gb|AAX53571.1| dihydroflavonol 4-reductase [Brassica rapa subsp. oleifera]
 gb|AAX53572.1| dihydroflavonol 4-reductase [Brassica rapa subsp. oleifera]
Length=385

 Score =   306 bits (785),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 154/262 (59%), Positives = 197/262 (75%), Gaps = 3/262 (1%)
 Frame = +2

Query  2    EAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSSTAAV  181
            +AI GC+GVFH+A  ++F SKDPENEVIKP V G+L I  +C KAKTV+++VFTSS   V
Sbjct  73   DAINGCDGVFHIATPMDFESKDPENEVIKPTVNGVLGITKACDKAKTVRRIVFTSSAGTV  132

Query  182  HIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLaekeawkaakekQIEFISIIPPL  361
            +++E Q+  YDE+ WSDLDFI + KM GWMYF SKTLAEK AW  AKEK I+FISIIP L
Sbjct  133  NVEEHQKNVYDENDWSDLDFIMSKKMTGWMYFMSKTLAEKAAWDYAKEKGIDFISIIPTL  192

Query  362  VIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYQHPKAGG  541
            VIGPF+  + P SL+TALSPI     N  H++II+QG++VHLDDLC A IFLY+   A G
Sbjct  193  VIGPFITTSMPPSLITALSPI---TRNEAHYSIIRQGQYVHLDDLCNAHIFLYEQAAAKG  249

Query  542  RFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFSSKKLQEMGFQFKYTLE  721
            R++CSSH ATI  +++ +R  +PEY VPS F+G+++ L  + FSSKKL +MGF FKY+LE
Sbjct  250  RYVCSSHDATILTISEFLRQKYPEYNVPSTFEGVDENLKSIMFSSKKLIDMGFNFKYSLE  309

Query  722  DMYKGAIETLRKKGLLPYSTKE  787
            DM   +IET R+KG LP +  E
Sbjct  310  DMLVESIETCRQKGFLPVTLPE  331



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2375559402664