BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7720_g1_i2 len=1285 path=[1:0-460 2516:461-511 462:512-1284]

Length=1285
                                                                      Score     E

ref|XP_009782453.1|  PREDICTED: annexin-like protein RJ4                423   5e-143   
gb|AAX78200.1|  putative annexin                                        422   8e-143   Nicotiana tabacum [American tobacco]
ref|XP_009610866.1|  PREDICTED: annexin-like protein RJ4                421   2e-142   
ref|XP_011088404.1|  PREDICTED: annexin-like protein RJ4                421   2e-142   
gb|AAX78199.1|  putative annexin                                        421   3e-142   Nicotiana tabacum [American tobacco]
ref|XP_009765996.1|  PREDICTED: annexin-like protein RJ4                410   4e-138   
emb|CDP17929.1|  unnamed protein product                                408   2e-137   
ref|XP_004248844.1|  PREDICTED: annexin-like protein RJ4                405   3e-136   
ref|XP_006339971.1|  PREDICTED: annexin-like protein RJ4-like           403   4e-135   
gb|AGQ56696.1|  cotton annexin 5                                        400   3e-134   
gb|AGG76001.1|  annexin AnxGb5                                          399   6e-134   
gb|AGQ56695.1|  cotton annexin 4                                        399   9e-134   
ref|XP_009589394.1|  PREDICTED: annexin-like protein RJ4                397   8e-133   
ref|XP_011042168.1|  PREDICTED: annexin-like protein RJ4 isoform X2     396   1e-132   
ref|XP_007011125.1|  Annexin-like protein RJ4 isoform 2                 396   1e-132   
gb|ACJ11719.1|  annexin                                                 396   2e-132   Gossypium hirsutum [American cotton]
gb|AGG76002.1|  annexin AnxGb6                                          395   3e-132   
ref|XP_006341838.1|  PREDICTED: annexin-like protein RJ4-like           394   2e-131   
ref|XP_011042167.1|  PREDICTED: annexin-like protein RJ4 isoform X1     389   5e-130   
ref|XP_004248802.1|  PREDICTED: annexin-like protein RJ4                389   1e-129   
ref|XP_008356783.1|  PREDICTED: LOW QUALITY PROTEIN: annexin-like...    388   2e-129   
ref|XP_006438868.1|  hypothetical protein CICLE_v10032154mg             387   6e-129   
ref|XP_004307132.1|  PREDICTED: annexin-like protein RJ4-like iso...    385   2e-128   
ref|XP_010032320.1|  PREDICTED: annexin-like protein RJ4                385   5e-128   
ref|XP_008375301.1|  PREDICTED: annexin-like protein RJ4 isoform X1     384   6e-128   
gb|KHG14512.1|  Annexin-like protein RJ4                                384   8e-128   
ref|XP_009361985.1|  PREDICTED: annexin-like protein RJ4                382   3e-127   
ref|XP_010032319.1|  PREDICTED: annexin-like protein RJ4 isoform X3     379   1e-125   
gb|EYU38267.1|  hypothetical protein MIMGU_mgv1a010356mg                379   1e-125   
ref|XP_004307131.1|  PREDICTED: annexin-like protein RJ4-like iso...    378   1e-125   
ref|XP_007011124.1|  Annexin-like protein RJ4 isoform 1                 380   3e-125   
sp|P51074.2|ANX4_FRAAN  RecName: Full=Annexin-like protein RJ4          377   4e-125   Fragaria x ananassa
gb|KGN52305.1|  hypothetical protein Csa_5G623690                       377   4e-125   
ref|XP_007218705.1|  hypothetical protein PRUPE_ppa008912mg             377   4e-125   
ref|XP_008245414.1|  PREDICTED: annexin-like protein RJ4 isoform X2     377   5e-125   
ref|XP_010273218.1|  PREDICTED: annexin-like protein RJ4                376   1e-124   
ref|XP_008346978.1|  PREDICTED: annexin-like protein RJ4                374   4e-124   
ref|XP_008375302.1|  PREDICTED: annexin-like protein RJ4 isoform X2     374   6e-124   
ref|NP_001289780.1|  uncharacterized protein LOC104590190               374   6e-124   
ref|XP_009361986.1|  PREDICTED: annexin-like protein RJ4                372   2e-123   
ref|XP_008446932.1|  PREDICTED: annexin-like protein RJ4                373   2e-123   
ref|XP_002513080.1|  annexin, putative                                  372   4e-123   Ricinus communis
ref|NP_001240999.1|  uncharacterized protein LOC100794511               372   4e-123   
ref|XP_003542834.1|  PREDICTED: annexin-like protein RJ4-like iso...    372   5e-123   
ref|XP_009354449.1|  PREDICTED: annexin-like protein RJ4 isoform X2     370   2e-122   
ref|XP_007011126.1|  Annexin-like protein RJ4 isoform 3                 369   3e-122   
ref|XP_002304784.1|  annexin-like protein RJ4                           367   1e-121   Populus trichocarpa [western balsam poplar]
ref|XP_010032318.1|  PREDICTED: annexin-like protein RJ4 isoform X2     367   6e-121   
ref|XP_010095951.1|  Annexin-like protein                               366   8e-121   
ref|XP_010670447.1|  PREDICTED: annexin-like protein RJ4                366   9e-121   
ref|XP_010032317.1|  PREDICTED: annexin-like protein RJ4 isoform X1     367   2e-120   
ref|XP_008245413.1|  PREDICTED: annexin-like protein RJ4 isoform X1     365   2e-120   
ref|XP_008348392.1|  PREDICTED: annexin-like protein RJ4 isoform X2     364   4e-120   
ref|XP_006597033.1|  PREDICTED: uncharacterized protein LOC100794...    363   1e-119   
ref|XP_003542833.1|  PREDICTED: annexin-like protein RJ4-like iso...    363   2e-119   
ref|XP_004142392.1|  PREDICTED: annexin A6-like                         374   2e-119   
ref|XP_007218704.1|  hypothetical protein PRUPE_ppa008912mg             362   2e-119   
ref|XP_009354448.1|  PREDICTED: annexin-like protein RJ4 isoform X1     362   3e-119   
gb|AFK45151.1|  unknown                                                 362   3e-119   
ref|XP_003627780.1|  Annexin-like protein                               362   4e-119   
gb|KHN37649.1|  Annexin-like protein RJ4                                361   8e-119   
ref|XP_003627779.1|  Annexin-like protein                               362   1e-118   
ref|XP_007133789.1|  hypothetical protein PHAVU_011G209200g             358   1e-117   
gb|ADN34200.1|  annexin                                                 369   2e-117   
gb|AFK35882.1|  unknown                                                 357   2e-117   
gb|ADT91309.1|  annexin-like protein                                    357   3e-117   
ref|XP_006590331.1|  PREDICTED: uncharacterized protein LOC100806...    356   5e-117   
ref|XP_008348387.1|  PREDICTED: annexin-like protein RJ4 isoform X1     356   7e-117   
gb|KDP40511.1|  hypothetical protein JCGZ_24510                         356   7e-117   
ref|XP_006399755.1|  hypothetical protein EUTSA_v10014146mg             353   6e-116   
ref|XP_004514653.1|  PREDICTED: annexin-like protein RJ4-like           353   8e-116   
gb|AET02255.2|  annexin D8                                              352   2e-115   
ref|XP_010521627.1|  PREDICTED: annexin-like protein RJ4 isoform X2     352   2e-115   
ref|XP_010521553.1|  PREDICTED: annexin-like protein RJ4 isoform X1     352   2e-115   
ref|XP_004511011.1|  PREDICTED: annexin-like protein RJ4-like iso...    352   3e-115   
ref|XP_002871524.1|  hypothetical protein ARALYDRAFT_488086             352   3e-115   
ref|XP_003598648.1|  Annexin-like protein RJ4                           352   3e-115   
ref|XP_010453308.1|  PREDICTED: annexin D8                              351   5e-115   
gb|KGN52304.1|  hypothetical protein Csa_5G623680                       350   1e-114   
gb|ACV50434.1|  annexin-like protein                                    350   1e-114   Jatropha curcas
ref|XP_004515568.1|  PREDICTED: annexin-like protein RJ4-like           349   2e-114   
ref|XP_003598649.1|  Annexin                                            349   3e-114   
ref|XP_008446931.1|  PREDICTED: annexin-like protein RJ4                349   3e-114   
ref|NP_001242171.1|  uncharacterized protein LOC100806472               348   7e-114   
ref|XP_003522953.1|  PREDICTED: annexin-like protein RJ4-like iso...    348   8e-114   
ref|NP_568271.2|  annexin D8                                            348   8e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007148975.1|  hypothetical protein PHAVU_005G030100g             347   2e-113   
ref|XP_002527036.1|  annexin, putative                                  347   2e-113   Ricinus communis
ref|XP_004511012.1|  PREDICTED: annexin-like protein RJ4-like iso...    347   2e-113   
ref|XP_006289187.1|  hypothetical protein CARUB_v10002628mg             347   3e-113   
ref|XP_007148976.1|  hypothetical protein PHAVU_005G030200g             345   1e-112   
gb|KHN25117.1|  Annexin-like protein RJ4                                345   2e-112   
emb|CDX69683.1|  BnaA10g20320D                                          343   5e-112   
emb|CAA75308.1|  annexin                                                342   3e-111   Medicago truncatula
emb|CDX97190.1|  BnaC09g44350D                                          342   3e-111   
ref|XP_009121851.1|  PREDICTED: annexin D8                              341   6e-111   
ref|NP_001241261.1|  uncharacterized protein LOC100796092               340   7e-111   
gb|KHG12913.1|  Annexin-like protein RJ4                                340   7e-111   
gb|AET02254.2|  annexin D8                                              340   9e-111   
ref|XP_007133790.1|  hypothetical protein PHAVU_011G209300g             340   1e-110   
ref|XP_004511010.1|  PREDICTED: annexin-like protein RJ4-like iso...    340   2e-110   
ref|XP_010536110.1|  PREDICTED: annexin D8                              338   6e-110   
ref|XP_007015223.1|  Annexin 8                                          337   2e-109   
ref|XP_010931989.1|  PREDICTED: annexin-like protein RJ4                337   2e-109   
ref|XP_009413531.1|  PREDICTED: annexin-like protein RJ4                336   4e-109   
ref|NP_001242031.1|  uncharacterized protein LOC100784424               334   2e-108   
gb|AFK41857.1|  unknown                                                 333   7e-108   
ref|XP_002298480.1|  annexin family protein                             333   8e-108   Populus trichocarpa [western balsam poplar]
ref|XP_010670446.1|  PREDICTED: annexin-like protein RJ4                332   1e-107   
ref|XP_002279669.1|  PREDICTED: annexin D8                              332   2e-107   Vitis vinifera
ref|XP_003627778.1|  Annexin-like protein RJ4                           333   2e-107   
gb|KHN37647.1|  Annexin-like protein RJ4                                332   4e-107   
gb|AAA79922.1|  annexin                                                 328   1e-106   Fragaria x ananassa
gb|AIY34673.1|  annexin4                                                330   1e-106   
ref|XP_004511017.1|  PREDICTED: annexin-like protein RJ4-like           328   4e-106   
ref|XP_011024946.1|  PREDICTED: annexin D8-like                         327   1e-105   
gb|KFK25510.1|  hypothetical protein AALP_AA8G124300                    327   1e-105   
ref|XP_004139124.1|  PREDICTED: annexin D8-like                         326   6e-105   
ref|XP_003627776.1|  Annexin                                            325   8e-105   
ref|XP_008786903.1|  PREDICTED: annexin-like protein RJ4                325   9e-105   
ref|XP_010046708.1|  PREDICTED: annexin D8                              325   9e-105   
ref|XP_004511018.1|  PREDICTED: annexin-like protein RJ4-like           324   2e-104   
ref|XP_008794526.1|  PREDICTED: annexin D1-like                         323   7e-104   
ref|XP_009413545.1|  PREDICTED: annexin D2-like                         320   9e-103   
ref|XP_006578485.1|  PREDICTED: annexin-like protein RJ4-like iso...    319   9e-103   
ref|XP_010268092.1|  PREDICTED: annexin D1                              318   3e-102   
ref|XP_009395142.1|  PREDICTED: annexin-like protein RJ4                318   7e-102   
ref|XP_010939631.1|  PREDICTED: annexin D1-like                         315   9e-101   
ref|XP_003546292.1|  PREDICTED: annexin D8-like                         314   2e-100   
gb|KHN14285.1|  Annexin D8                                              314   2e-100   
ref|XP_007147424.1|  hypothetical protein PHAVU_006G123400g             312   7e-100   
ref|XP_006839165.1|  hypothetical protein AMTR_s00097p00076000          311   3e-99    
gb|ACF81674.1|  unknown                                                 311   3e-99    Zea mays [maize]
ref|XP_008455214.1|  PREDICTED: annexin D2-like                         311   3e-99    
ref|XP_008795561.1|  PREDICTED: annexin D2-like isoform X1              311   3e-99    
ref|XP_004299644.1|  PREDICTED: annexin D1-like                         310   8e-99    
ref|XP_004155446.1|  PREDICTED: annexin D2-like                         309   2e-98    
ref|XP_009417575.1|  PREDICTED: annexin D7-like isoform X1              310   2e-98    
ref|XP_006828500.1|  hypothetical protein AMTR_s00060p00176720          309   2e-98    
ref|NP_001105475.1|  annexin2                                           308   2e-98    Zea mays [maize]
gb|AIY34672.1|  annexin D2-like protein                                 308   4e-98    
ref|XP_009380196.1|  PREDICTED: annexin D2-like                         308   4e-98    
ref|XP_010916889.1|  PREDICTED: annexin D2-like isoform X2              308   5e-98    
ref|XP_009417576.1|  PREDICTED: annexin D7-like isoform X2              307   8e-98    
ref|XP_011074177.1|  PREDICTED: annexin D1-like                         307   9e-98    
ref|XP_006828499.1|  hypothetical protein AMTR_s00060p00176150          306   1e-97    
ref|XP_004136871.1|  PREDICTED: annexin D2-like                         306   3e-97    
gb|AGQ56697.1|  cotton annexin 6                                        306   3e-97    
ref|XP_007047969.1|  Annexin 2                                          305   5e-97    
ref|XP_010061809.1|  PREDICTED: annexin D1-like                         304   1e-96    
gb|KHG08791.1|  Annexin D2 -like protein                                304   1e-96    
gb|KFK23853.1|  hypothetical protein AALP_AAs49431U000100               303   2e-96    
gb|KDP46839.1|  hypothetical protein JCGZ_24048                         303   3e-96    
ref|XP_004288207.1|  PREDICTED: annexin D2-like                         303   3e-96    
gb|KCW62129.1|  hypothetical protein EUGRSUZ_H04787                     303   3e-96    
ref|XP_008450361.1|  PREDICTED: annexin D8                              302   3e-96    
dbj|BAD68998.1|  putative calcium-binding protein annexin 6             303   5e-96    Oryza sativa Japonica Group [Japonica rice]
gb|KCW62127.1|  hypothetical protein EUGRSUZ_H04787                     302   6e-96    
ref|XP_008782135.1|  PREDICTED: annexin D2-like                         302   7e-96    
ref|XP_008795562.1|  PREDICTED: annexin D2-like isoform X2              302   7e-96    
ref|XP_007227485.1|  hypothetical protein PRUPE_ppa008882mg             302   1e-95    
gb|KCW62130.1|  hypothetical protein EUGRSUZ_H04787                     301   1e-95    
ref|XP_006644197.1|  PREDICTED: annexin-like protein RJ4-like           301   2e-95    
ref|XP_010025470.1|  PREDICTED: annexin D2-like                         301   2e-95    
gb|EMS50782.1|  Annexin D1                                              301   2e-95    
ref|XP_004288206.1|  PREDICTED: annexin D1-like                         301   2e-95    
ref|XP_010025469.1|  PREDICTED: annexin D2-like                         301   2e-95    
gb|KCW62128.1|  hypothetical protein EUGRSUZ_H04787                     301   3e-95    
ref|XP_010926280.1|  PREDICTED: annexin D2-like                         300   3e-95    
gb|EYU36506.1|  hypothetical protein MIMGU_mgv1a010414mg                300   3e-95    
ref|XP_004504069.1|  PREDICTED: annexin D2-like                         300   4e-95    
ref|XP_009337417.1|  PREDICTED: annexin D1-like                         300   5e-95    
ref|NP_174810.1|  annexin 1                                             300   6e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010680554.1|  PREDICTED: annexin D2-like                         300   8e-95    
dbj|BAJ92233.1|  predicted protein                                      299   8e-95    
dbj|BAJ97416.1|  predicted protein                                      299   1e-94    
ref|XP_003525057.1|  PREDICTED: annexin D2                              299   1e-94    
ref|XP_006655923.1|  PREDICTED: annexin D1-like                         299   1e-94    
ref|XP_008219675.1|  PREDICTED: annexin D1                              299   1e-94    
ref|XP_010269245.1|  PREDICTED: annexin D2-like                         299   2e-94    
ref|XP_003533096.1|  PREDICTED: annexin D8-like                         298   2e-94    
ref|XP_010500052.1|  PREDICTED: annexin D1                              298   2e-94    
ref|XP_009145116.1|  PREDICTED: annexin D1                              298   2e-94    
ref|XP_002513910.1|  annexin, putative                                  298   2e-94    Ricinus communis
gb|ABK22223.1|  unknown                                                 298   3e-94    Picea sitchensis
ref|XP_011097579.1|  PREDICTED: annexin D7                              298   3e-94    
ref|XP_010544079.1|  PREDICTED: annexin D1                              298   3e-94    
ref|XP_008790831.1|  PREDICTED: annexin D1-like                         298   4e-94    
ref|XP_007159652.1|  hypothetical protein PHAVU_002G255700g             298   4e-94    
gb|ADK13090.1|  annexin 1                                               298   5e-94    
pdb|1YCN|A  Chain A, X-Ray Structure Of Annexin From Arabidopsis ...    297   5e-94    
gb|EAZ00194.1|  hypothetical protein OsI_22198                          297   6e-94    Oryza sativa Indica Group [Indian rice]
ref|NP_001057176.1|  Os06g0221200                                       297   7e-94    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011098465.1|  PREDICTED: annexin D1-like                         297   7e-94    
ref|NP_001239752.1|  uncharacterized protein LOC100815639               297   9e-94    
gb|AAB67994.1|  annexin                                                 296   1e-93    Gossypium hirsutum [American cotton]
emb|CDX73353.1|  BnaC05g27530D                                          296   1e-93    
ref|XP_009349785.1|  PREDICTED: annexin D1-like                         296   1e-93    
ref|XP_007205592.1|  hypothetical protein PRUPE_ppa008881mg             295   3e-93    
ref|XP_004169361.1|  PREDICTED: annexin D2-like isoform 1               296   4e-93    
ref|XP_011016329.1|  PREDICTED: annexin D1                              295   5e-93    
ref|XP_011022789.1|  PREDICTED: annexin D2-like                         295   5e-93    
gb|KHN21299.1|  Annexin-like protein RJ4                                293   6e-93    
ref|XP_002309980.1|  annexin-like protein RJ4                           295   7e-93    Populus trichocarpa [western balsam poplar]
ref|XP_008455624.1|  PREDICTED: annexin D2-like isoform X1              295   8e-93    
ref|XP_002302291.1|  annexin 1 family protein                           294   9e-93    Populus trichocarpa [western balsam poplar]
ref|XP_008233942.1|  PREDICTED: annexin D2-like                         294   1e-92    
ref|XP_004137187.1|  PREDICTED: annexin D2-like                         294   1e-92    
ref|XP_006434000.1|  hypothetical protein CICLE_v10001888mg             294   1e-92    
gb|AAC49472.1|  annexin-like protein                                    294   1e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008455626.1|  PREDICTED: annexin D2-like isoform X2              293   2e-92    
gb|KEH37119.1|  annexin D8                                              293   2e-92    
gb|KCW68822.1|  hypothetical protein EUGRSUZ_F02423                     292   2e-92    
ref|XP_009791036.1|  PREDICTED: annexin D2-like                         293   3e-92    
gb|EMT22984.1|  Annexin-like protein RJ4                                293   3e-92    
emb|CAA63710.1|  annexin                                                293   3e-92    Capsicum annuum
pdb|1DK5|A  Chain A, Crystal Structure Of Annexin 24(Ca32) From C...    293   4e-92    
ref|XP_006305394.1|  hypothetical protein CARUB_v10009786mg             293   4e-92    
ref|XP_002285795.1|  PREDICTED: annexin D1                              292   4e-92    Vitis vinifera
ref|XP_004953954.1|  PREDICTED: annexin D7-like                         292   4e-92    
gb|AFZ78531.1|  annexin                                                 292   8e-92    
emb|CAA52903.1|  annexin                                                291   1e-91    Medicago sativa [alfalfa]
ref|XP_010916888.1|  PREDICTED: annexin D1-like isoform X1              292   1e-91    
ref|XP_006399517.1|  hypothetical protein EUTSA_v10014138mg             291   1e-91    
ref|XP_010087582.1|  Annexin D2                                         291   1e-91    
gb|ABK95721.1|  unknown                                                 291   2e-91    Populus trichocarpa [western balsam poplar]
ref|XP_007018794.1|  Annexin 1                                          291   2e-91    
ref|XP_003615096.1|  Annexin                                            291   2e-91    
emb|CAA10210.1|  annexin cap32                                          291   2e-91    Capsicum annuum
ref|XP_007141170.1|  hypothetical protein PHAVU_008G173100g             291   2e-91    
gb|KDO56580.1|  hypothetical protein CISIN_1g021204mg                   291   2e-91    
ref|XP_004964979.1|  PREDICTED: annexin D2-like                         291   2e-91    
ref|XP_011031008.1|  PREDICTED: annexin D2-like                         292   2e-91    
ref|XP_008353937.1|  PREDICTED: annexin D1-like                         291   2e-91    
gb|AFK45764.1|  unknown                                                 290   2e-91    
ref|XP_010673729.1|  PREDICTED: annexin D8                              290   3e-91    
ref|XP_009130484.1|  PREDICTED: annexin D2-like                         290   3e-91    
gb|EAY87564.1|  hypothetical protein OsI_08976                          290   5e-91    Oryza sativa Indica Group [Indian rice]
ref|NP_001048149.1|  Os02g0753800                                       290   6e-91    Oryza sativa Japonica Group [Japonica rice]
gb|AFZ78532.1|  annexin                                                 290   6e-91    
gb|AFL69958.1|  annexin E1                                              290   7e-91    
ref|XP_002306311.2|  annexin-like protein RJ4                           289   7e-91    Populus trichocarpa [western balsam poplar]
gb|AFK33579.1|  unknown                                                 289   7e-91    
emb|CAA10261.1|  annexin P38                                            289   8e-91    Capsicum annuum
gb|AAR13288.1|  Anx1                                                    289   9e-91    Gossypium hirsutum [American cotton]
ref|XP_009339720.1|  PREDICTED: annexin D2-like                         289   1e-90    
ref|XP_006464229.1|  PREDICTED: annexin D2-like                         289   1e-90    
ref|XP_009150578.1|  PREDICTED: annexin D2                              288   2e-90    
gb|ABD47519.1|  annexin 2                                               288   2e-90    Brassica juncea [brown mustard]
ref|XP_006366530.1|  PREDICTED: annexin D2-like                         288   2e-90    
ref|XP_010227843.1|  PREDICTED: annexin D1-like                         288   3e-90    
ref|XP_006279651.1|  hypothetical protein CARUB_v10026799mg             288   4e-90    
ref|XP_002452537.1|  hypothetical protein SORBIDRAFT_04g027590          287   4e-90    Sorghum bicolor [broomcorn]
gb|ABB59547.1|  annexin-like protein                                    287   5e-90    Brassica juncea [brown mustard]
gb|KEH16214.1|  annexin D8                                              287   5e-90    
gb|AAC33305.1|  fiber annexin                                           287   5e-90    Gossypium hirsutum [American cotton]
ref|NP_001105728.1|  annexin p33                                        287   6e-90    Zea mays [maize]
emb|CDP01046.1|  unnamed protein product                                286   8e-90    
ref|XP_010453050.1|  PREDICTED: annexin D7                              286   9e-90    
gb|ADO32900.1|  antifungal activity protein                             286   9e-90    
ref|NP_001240889.1|  uncharacterized protein LOC100784252               286   9e-90    
gb|AFW76764.1|  annexin p33Annexin-like protein RJ4                     287   1e-89    
emb|CDY33992.1|  BnaC02g43450D                                          286   1e-89    
gb|KDP41371.1|  hypothetical protein JCGZ_15778                         286   1e-89    
ref|XP_009593609.1|  PREDICTED: annexin D2-like                         286   1e-89    
ref|XP_010484307.1|  PREDICTED: annexin D2                              286   1e-89    
emb|CDY41873.1|  BnaA08g06260D                                          286   1e-89    
gb|AIU41030.1|  annexin 1                                               286   1e-89    
ref|XP_006355349.1|  PREDICTED: annexin D2-like                         286   2e-89    
ref|NP_196585.1|  annexin D7                                            285   2e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004240238.1|  PREDICTED: annexin D2-like                         285   3e-89    
gb|AGQ56694.1|  cotton annexin 3                                        285   4e-89    
gb|AGG75999.1|  annexin AnxGb3                                          285   4e-89    
gb|AHA84259.1|  annexin-like protein                                    285   4e-89    
gb|AGG75998.1|  annexin AnxGb2                                          285   5e-89    
ref|XP_002436730.1|  hypothetical protein SORBIDRAFT_10g007760          285   5e-89    Sorghum bicolor [broomcorn]
ref|XP_010444468.1|  PREDICTED: annexin D2-like                         285   5e-89    
ref|XP_010462444.1|  PREDICTED: annexin D2-like                         285   6e-89    
ref|XP_010491680.1|  PREDICTED: annexin D7-like                         284   7e-89    
gb|KFK28188.1|  hypothetical protein AALP_AA8G483600                    284   8e-89    
ref|XP_009622947.1|  PREDICTED: annexin D1-like                         284   8e-89    
ref|XP_009122074.1|  PREDICTED: annexin D7                              283   1e-88    
emb|CDX69852.1|  BnaA10g22010D                                          283   1e-88    
ref|XP_002864936.1|  ANNAT2                                             283   1e-88    
ref|NP_201307.1|  annexin 2                                             283   2e-88    
gb|AHN63214.1|  annexin 2                                               283   2e-88    
ref|XP_009107912.1|  PREDICTED: annexin D1                              283   2e-88    
gb|ADM48798.1|  annexin 1                                               283   2e-88    
gb|ACK44502.1|  AT5G10230-like protein                                  283   2e-88    
gb|ABD47518.1|  annexin 7                                               283   3e-88    
gb|AAB67993.2|  annexin                                                 282   3e-88    
pdb|3BRX|A  Chain A, Crystal Structure Of Calcium-Bound Cotton An...    282   4e-88    
ref|XP_002873444.1|  hypothetical protein ARALYDRAFT_350231             282   4e-88    
ref|XP_006288251.1|  hypothetical protein CARUB_v10001496mg             282   4e-88    
ref|XP_010422872.1|  PREDICTED: annexin D7-like                         282   5e-88    
ref|XP_010491679.1|  PREDICTED: annexin D6-like                         282   5e-88    
pdb|1N00|A  Chain A, Annexin Gh1 From Cotton                            282   5e-88    
gb|AGG76000.1|  annexin AnxGb4                                          281   1e-87    
emb|CDP01446.1|  unnamed protein product                                281   1e-87    
ref|XP_003570621.1|  PREDICTED: annexin D1-like                         281   1e-87    
emb|CAN82835.1|  hypothetical protein VITISV_030870                     281   2e-87    
ref|XP_010453047.1|  PREDICTED: annexin D6-like                         281   2e-87    
ref|NP_001234104.1|  annexin p34                                        280   2e-87    
gb|ACZ57337.1|  annexin 1                                               280   2e-87    
ref|XP_006399516.1|  hypothetical protein EUTSA_v10014136mg             280   2e-87    
emb|CDX96984.1|  BnaC09g46410D                                          280   3e-87    
ref|XP_009787351.1|  PREDICTED: annexin D1-like                         280   3e-87    
ref|XP_006394085.1|  hypothetical protein EUTSA_v10004625mg             280   3e-87    
gb|EMT13109.1|  Annexin D1                                              281   3e-87    
emb|CAA67608.1|  annexin                                                280   5e-87    
gb|ACZ57338.1|  annexin 1                                               279   5e-87    
gb|KFK25346.1|  hypothetical protein AALP_AA8G100700                    280   5e-87    
gb|AAB71830.1|  annexin                                                 279   6e-87    
emb|CAB92956.1|  annexin p34                                            279   6e-87    
emb|CDX91750.1|  BnaC08g06690D                                          279   7e-87    
ref|XP_004516176.1|  PREDICTED: annexin D1-like isoform X1              279   7e-87    
gb|EMT22115.1|  Annexin D7                                              278   1e-86    
gb|KGN53652.1|  hypothetical protein Csa_4G096610                       279   2e-86    
ref|XP_004154688.1|  PREDICTED: annexin D8-like                         276   2e-86    
emb|CAA75213.1|  annexin                                                278   2e-86    
ref|XP_003567741.1|  PREDICTED: annexin-like protein RJ4                278   3e-86    
gb|ACK44503.1|  AT5G10220-like protein                                  278   4e-86    
gb|AAG61156.1|  calcium-binding protein annexin 7                       276   1e-85    
ref|XP_010422874.1|  PREDICTED: annexin D6                              276   1e-85    
ref|XP_002873445.1|  hypothetical protein ARALYDRAFT_908980             276   1e-85    
ref|XP_009594353.1|  PREDICTED: annexin D2 isoform X1                   275   2e-85    
gb|EMS56517.1|  Annexin D7                                              275   2e-85    
ref|NP_196584.1|  annexin D6                                            275   4e-85    
gb|KDO56583.1|  hypothetical protein CISIN_1g021204mg                   274   4e-85    
gb|ABM87934.1|  annexin 6                                               274   5e-85    
dbj|BAD43335.1|  annexin -like protein                                  274   5e-85    
gb|ABK28695.1|  unknown                                                 274   6e-85    
ref|XP_009122077.1|  PREDICTED: annexin D6                              274   8e-85    
dbj|BAN45713.1|  putative annexin                                       273   9e-85    
ref|XP_007199232.1|  hypothetical protein PRUPE_ppa022090mg             273   1e-84    
ref|XP_006288241.1|  hypothetical protein CARUB_v10001483mg             272   5e-84    
ref|XP_008237182.1|  PREDICTED: annexin D2-like                         272   5e-84    
ref|NP_001234101.1|  annexin p35                                        271   6e-84    
gb|AAG61155.1|  calcium-binding protein annexin 6                       271   1e-83    
ref|NP_001274782.1|  annexin D1-like                                    270   2e-83    
gb|EEE65351.1|  hypothetical protein OsJ_20631                          269   2e-83    
emb|CBI19153.3|  unnamed protein product                                269   3e-83    
ref|XP_010527610.1|  PREDICTED: annexin D2-like                         269   6e-83    
ref|NP_001154798.1|  annexin 2                                          268   7e-83    
ref|XP_009802682.1|  PREDICTED: annexin D2-like                         268   1e-82    
ref|XP_002455141.1|  hypothetical protein SORBIDRAFT_03g004990          267   3e-82    
ref|XP_009123806.1|  PREDICTED: annexin D1-like                         264   4e-81    
ref|XP_009594354.1|  PREDICTED: annexin D2 isoform X2                   263   8e-81    
gb|KDP27364.1|  hypothetical protein JCGZ_20188                         261   3e-80    
ref|XP_008655655.1|  PREDICTED: annexin-like protein RJ4                262   3e-80    
emb|CAC42899.1|  annexin-like protein                                   259   5e-80    
gb|AFW80106.1|  hypothetical protein ZEAMMB73_547697                    261   1e-79    
ref|XP_008673676.1|  PREDICTED: annexin-like protein RJ4 isoform X1     260   2e-79    
ref|XP_003598650.1|  Annexin                                            257   5e-79    
gb|KCW68826.1|  hypothetical protein EUGRSUZ_F02429                     257   8e-79    
ref|XP_006399515.1|  hypothetical protein EUTSA_v10014136mg             252   8e-77    
ref|XP_008373200.1|  PREDICTED: annexin D7-like                         244   2e-73    
ref|XP_004289606.1|  PREDICTED: annexin D7-like                         244   3e-73    
ref|XP_006397475.1|  hypothetical protein EUTSA_v10001831mg             241   9e-73    
ref|XP_010645676.1|  PREDICTED: LOW QUALITY PROTEIN: annexin D3         238   8e-71    
gb|AET41708.1|  annexin                                                 232   2e-69    
ref|XP_010519596.1|  PREDICTED: annexin D2 isoform X1                   232   8e-69    
ref|XP_010247043.1|  PREDICTED: annexin D3-like                         232   1e-68    
ref|XP_006445769.1|  hypothetical protein CICLE_v10016149mg             229   6e-68    
ref|XP_010670441.1|  PREDICTED: annexin D3                              228   4e-67    
ref|XP_010938585.1|  PREDICTED: annexin D3                              228   5e-67    
ref|XP_010519602.1|  PREDICTED: annexin D2 isoform X2                   226   1e-66    
ref|XP_010273220.1|  PREDICTED: annexin D3-like                         226   2e-66    
ref|XP_002513082.1|  annexin, putative                                  226   3e-66    
dbj|BAJ90765.1|  predicted protein                                      226   5e-66    
ref|XP_009412819.1|  PREDICTED: annexin D3-like                         225   1e-65    
ref|XP_010554472.1|  PREDICTED: annexin D3                              223   5e-65    
emb|CDP18832.1|  unnamed protein product                                223   5e-65    
ref|NP_001141942.1|  annexin-like protein RJ4                           224   5e-65    
emb|CDP18837.1|  unnamed protein product                                222   6e-65    
dbj|BAJ94939.1|  predicted protein                                      222   2e-64    
ref|XP_006347770.1|  PREDICTED: annexin D3-like                         221   3e-64    
ref|XP_004230105.1|  PREDICTED: annexin D3-like isoform X2              220   4e-64    
gb|KHN44671.1|  Annexin D8                                              216   9e-64    
ref|XP_002439719.1|  hypothetical protein SORBIDRAFT_09g018980          219   3e-63    
emb|CBI17722.3|  unnamed protein product                                217   3e-63    
gb|KDP40509.1|  hypothetical protein JCGZ_24508                         218   3e-63    
gb|EAY97859.1|  hypothetical protein OsI_19780                          218   4e-63    
gb|AFK38054.1|  unknown                                                 214   7e-63    
ref|XP_009771187.1|  PREDICTED: annexin D3-like                         217   7e-63    
ref|XP_002264884.1|  PREDICTED: annexin D3 isoform X1                   216   9e-63    
ref|XP_003568545.1|  PREDICTED: annexin D3-like                         218   9e-63    
emb|CBI24787.3|  unnamed protein product                                216   1e-62    
emb|CDP18831.1|  unnamed protein product                                216   2e-62    
dbj|BAJ99019.1|  predicted protein                                      216   2e-62    
dbj|BAK02389.1|  predicted protein                                      216   2e-62    
ref|XP_010095947.1|  Annexin D3                                         217   2e-62    
ref|XP_010327723.1|  PREDICTED: annexin D3-like isoform X1              216   2e-62    
ref|XP_004307134.1|  PREDICTED: annexin D3-like                         214   1e-61    
ref|XP_010523387.1|  PREDICTED: LOW QUALITY PROTEIN: annexin D3-like    214   1e-61    
ref|XP_011088381.1|  PREDICTED: annexin D3                              213   2e-61    
ref|XP_009771168.1|  PREDICTED: annexin D3-like isoform X2              213   2e-61    
ref|NP_001055408.1|  Os05g0382900                                       214   2e-61    
emb|CDY71429.1|  BnaAnng37420D                                          209   5e-61    
gb|KDO56581.1|  hypothetical protein CISIN_1g021204mg                   208   6e-61    
gb|AIU49191.1|  annexin ANNAT3                                          210   9e-61    
ref|XP_006438870.1|  hypothetical protein CICLE_v10031919mg             212   1e-60    
ref|XP_008446929.1|  PREDICTED: annexin D3                              212   1e-60    
gb|KCW64683.1|  hypothetical protein EUGRSUZ_G02270                     209   1e-60    
gb|KGN52302.1|  hypothetical protein Csa_5G623660                       212   1e-60    
ref|XP_009361987.1|  PREDICTED: annexin D3-like                         212   2e-60    
ref|XP_010517193.1|  PREDICTED: annexin D3                              211   2e-60    
ref|XP_002297754.2|  annexin 3 family protein                           210   2e-60    
ref|XP_010505530.1|  PREDICTED: annexin D3-like isoform X1              211   2e-60    
ref|XP_009610017.1|  PREDICTED: annexin D3-like                         210   2e-60    
gb|KDO83195.1|  hypothetical protein CISIN_1g018771mg                   211   3e-60    
ref|XP_010509173.1|  PREDICTED: annexin D3-like                         210   3e-60    
ref|XP_009610015.1|  PREDICTED: annexin D3-like isoform X2              209   5e-60    
ref|XP_007218219.1|  hypothetical protein PRUPE_ppa007879mg             210   7e-60    
ref|XP_002264333.2|  PREDICTED: annexin D3                              209   7e-60    
gb|AFW77833.1|  annexin-like protein RJ4                                211   8e-60    
ref|XP_006347773.1|  PREDICTED: annexin D3-like                         209   9e-60    
ref|XP_006411099.1|  hypothetical protein EUTSA_v10016949mg             209   9e-60    
ref|XP_010067751.1|  PREDICTED: annexin D3                              211   1e-59    
ref|XP_010999602.1|  PREDICTED: annexin D3                              209   1e-59    
gb|AIU49185.1|  annexin ANNAT3                                          207   1e-59    
gb|EEE63558.1|  hypothetical protein OsJ_18375                          214   2e-59    
gb|AFW77832.1|  hypothetical protein ZEAMMB73_094113                    210   2e-59    
ref|XP_006294609.1|  hypothetical protein CARUB_v10023645mg             208   2e-59    
ref|XP_008245411.1|  PREDICTED: annexin D3-like                         209   2e-59    
ref|XP_002268873.2|  PREDICTED: annexin D3                              207   3e-59    
ref|XP_004230107.1|  PREDICTED: annexin D3-like                         207   3e-59    
emb|CBI24793.3|  unnamed protein product                                207   4e-59    
ref|XP_006359178.1|  PREDICTED: annexin D3-like                         207   4e-59    
gb|AFW81594.1|  hypothetical protein ZEAMMB73_146238                    209   6e-59    
emb|CDY08828.1|  BnaA06g23960D                                          204   6e-59    
emb|CDY07703.1|  BnaA03g18080D                                          206   7e-59    
ref|XP_008245076.1|  PREDICTED: annexin D3-like                         207   9e-59    
emb|CDY14435.1|  BnaC03g21600D                                          206   1e-58    
gb|AES68908.2|  annexin D8                                              201   1e-58    
ref|XP_008656201.1|  PREDICTED: LOW QUALITY PROTEIN: annexin-like...    208   1e-58    
ref|XP_009133293.1|  PREDICTED: annexin D3-like                         206   1e-58    
ref|XP_003598657.1|  Annexin                                            202   2e-58    
gb|AIU49223.1|  annexin ANNAT3                                          204   2e-58    
gb|EMT13323.1|  Annexin D3                                              206   3e-58    
emb|CAN79417.1|  hypothetical protein VITISV_000221                     205   3e-58    
gb|AIU49205.1|  annexin ANNAT3                                          203   3e-58    
gb|KHG15758.1|  Annexin D3 -like protein                                205   4e-58    
ref|XP_008673677.1|  PREDICTED: annexin D1-like isoform X2              202   4e-58    
ref|XP_002264684.2|  PREDICTED: annexin D3-like                         204   7e-58    
emb|CBI24802.3|  unnamed protein product                                204   8e-58    
ref|XP_010645990.1|  PREDICTED: annexin D3-like isoform X1              204   8e-58    
gb|KFK36779.1|  hypothetical protein AALP_AA4G169600                    204   8e-58    
ref|XP_009771159.1|  PREDICTED: annexin D3-like isoform X1              204   9e-58    
gb|AIU49216.1|  annexin ANNAT3                                          202   1e-57    
gb|EYU38265.1|  hypothetical protein MIMGU_mgv1a010228mg                203   2e-57    
gb|AIU49202.1|  annexin ANNAT3                                          201   2e-57    
ref|XP_006438875.1|  hypothetical protein CICLE_v10031919mg             204   2e-57    
ref|XP_002971143.1|  hypothetical protein SELMODRAFT_94768              202   2e-57    
ref|XP_003546730.1|  PREDICTED: annexin D3 isoform X1                   202   2e-57    
ref|XP_006438877.1|  hypothetical protein CICLE_v10031919mg             202   2e-57    
ref|XP_006482991.1|  PREDICTED: annexin D3-like                         202   3e-57    
emb|CBI34105.3|  unnamed protein product                                207   3e-57    
gb|ABR25831.1|  annexin-like protein rj4                                197   5e-57    
gb|ACU23333.1|  unknown                                                 201   6e-57    
ref|XP_004503249.1|  PREDICTED: annexin D5-like                         201   7e-57    
gb|AIU49201.1|  annexin ANNAT3                                          199   8e-57    
ref|NP_181410.1|  annexin D3                                            201   9e-57    
gb|KCW65939.1|  hypothetical protein EUGRSUZ_G03248                     200   9e-57    
ref|XP_009610014.1|  PREDICTED: annexin D3-like isoform X1              201   1e-56    
gb|AIU49182.1|  annexin ANNAT3                                          199   2e-56    
ref|XP_010229579.1|  PREDICTED: annexin D3-like                         200   2e-56    
gb|AAF14580.1|AF188362_1  AnnAt3                                        200   3e-56    
gb|ACU23990.1|  unknown                                                 196   3e-56    
ref|XP_006438871.1|  hypothetical protein CICLE_v10031919mg             199   4e-56    
ref|XP_002986584.1|  hypothetical protein SELMODRAFT_124402             199   4e-56    
ref|XP_002986497.1|  hypothetical protein SELMODRAFT_271856             199   5e-56    
gb|AIU49204.1|  annexin ANNAT3                                          197   5e-56    
ref|XP_006428188.1|  hypothetical protein CICLE_v10027333mg             195   5e-56    
gb|EYU30188.1|  hypothetical protein MIMGU_mgv1a010283mg                199   5e-56    
ref|XP_010645981.1|  PREDICTED: annexin D3 isoform X2                   197   6e-56    
ref|XP_002964916.1|  hypothetical protein SELMODRAFT_167346             198   8e-56    
ref|XP_009389624.1|  PREDICTED: annexin D3-like                         199   1e-55    
ref|XP_009602692.1|  PREDICTED: annexin D5-like                         198   1e-55    
ref|XP_010505531.1|  PREDICTED: annexin D3-like isoform X2              197   1e-55    
gb|AIU49222.1|  annexin ANNAT3                                          196   2e-55    
dbj|BAJ34273.1|  unnamed protein product                                193   3e-55    
ref|XP_010932515.1|  PREDICTED: annexin D5                              197   3e-55    
gb|ACQ65866.1|  annexin 3                                               197   3e-55    
ref|XP_007011163.1|  Annexin                                            197   3e-55    
ref|XP_002965256.1|  hypothetical protein SELMODRAFT_227533             196   7e-55    
ref|NP_001240140.1|  uncharacterized protein LOC100820062               196   7e-55    
gb|AFK36109.1|  unknown                                                 196   8e-55    
ref|XP_009354446.1|  PREDICTED: annexin D3                              196   9e-55    
gb|KCW64684.1|  hypothetical protein EUGRSUZ_G02270                     192   1e-54    
ref|XP_002285166.1|  PREDICTED: annexin D5                              195   1e-54    
gb|EMT20678.1|  Annexin D3                                              195   1e-54    
gb|KDP24765.1|  hypothetical protein JCGZ_25425                         195   1e-54    
ref|XP_003631146.1|  Annexin-like protein                               195   1e-54    
gb|AET41709.1|  annexin                                                 195   1e-54    
ref|XP_009372990.1|  PREDICTED: annexin D5-like                         194   2e-54    
ref|XP_006438872.1|  hypothetical protein CICLE_v10031919mg             195   2e-54    
gb|EMS49320.1|  Annexin D3                                              194   3e-54    
gb|AHV84994.1|  annexin protein 3                                       194   3e-54    
ref|XP_009793577.1|  PREDICTED: annexin D5-like                         194   3e-54    



>ref|XP_009782453.1| PREDICTED: annexin-like protein RJ4 [Nicotiana sylvestris]
Length=317

 Score =   423 bits (1087),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 207/329 (63%), Positives = 258/329 (78%), Gaps = 15/329 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MAT+ +P++PSPVADAEAI  AC+GWGT EK +I I GHRN TQ+KLI++AY + Y EDL
Sbjct  1     MATINYPENPSPVADAEAIRKACQGWGTDEKAIISIFGHRNATQKKLIRRAYEELYNEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             ++R E ELSG  EKAVYR +LDPEDRDAV+L+ AI++  +PDYRVIIE +CIY PEEFL 
Sbjct  61    VKRLESELSGHFEKAVYRWILDPEDRDAVMLHAAIKETPIPDYRVIIEYSCIYSPEEFLA  120

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             VKRAYQARYKRS EEDLA++S  D RKLLVALVG+YRY+G E++A++A TE+  LH+AI 
Sbjct  121   VKRAYQARYKRSVEEDLAEHSAGDLRKLLVALVGIYRYAGKEINARVANTEADNLHSAIC  180

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              KE+NHEEIVRI+STRS  QLIAT NRYKD++G++ITK               L+D   +
Sbjct  181   NKEFNHEEIVRIISTRSIPQLIATLNRYKDDYGSSITK--------------HLRD-DAN  225

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
                +YL ALR+TIR + DP KYYEK+IR A+ ++G DE+ LTRVIVTRAE+DL+ IKE+Y
Sbjct  226   AAKEYLVALRTTIRCINDPQKYYEKVIRYAINESGTDEESLTRVIVTRAEKDLKDIKEIY  285

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLG  180
              KRNSVTL+ AV+K TSG Y+A LL LLG
Sbjct  286   YKRNSVTLDHAVSKHTSGDYKAFLLTLLG  314



>gb|AAX78200.1| putative annexin [Nicotiana tabacum]
Length=317

 Score =   422 bits (1086),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 207/329 (63%), Positives = 259/329 (79%), Gaps = 15/329 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MAT+ +P++PSPVADAEAI  AC+GWGT EK +I I GHRN TQ+KLI++AY + Y EDL
Sbjct  1     MATINYPENPSPVADAEAIRKACQGWGTDEKAIISIFGHRNATQKKLIRRAYEELYNEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             ++R E ELSG  EKAVYR +LDPEDRDAV+L+ AI++  +PDYRVIIE +CIY PEEFL 
Sbjct  61    VKRLESELSGHFEKAVYRWILDPEDRDAVMLHAAIKETPIPDYRVIIEYSCIYSPEEFLA  120

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             VKRAYQARYKRS EEDLA++S  D RKLLVALVG+YRY+G E++A++A TE+  LH+AI 
Sbjct  121   VKRAYQARYKRSVEEDLAEHSAGDLRKLLVALVGIYRYAGKEINARVANTEADNLHSAIC  180

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              KE+NHEEIVRI+STRS  QLIAT NRYKD++G++ITK               L+D   +
Sbjct  181   NKEFNHEEIVRIISTRSIPQLIATLNRYKDDYGSSITK--------------HLRD-DAN  225

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
                +YL ALR+TIR + DP KYYEK+IR A+ ++G DE+ LTRVIVTRAE+DL+ IKE+Y
Sbjct  226   AAKEYLVALRTTIRCINDPQKYYEKVIRYAINESGTDEESLTRVIVTRAEKDLKDIKELY  285

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLG  180
              KRNSVTL+ A++K TSG Y+A LLALLG
Sbjct  286   YKRNSVTLDHALSKHTSGDYKAFLLALLG  314



>ref|XP_009610866.1| PREDICTED: annexin-like protein RJ4 [Nicotiana tomentosiformis]
Length=317

 Score =   421 bits (1083),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 204/329 (62%), Positives = 261/329 (79%), Gaps = 15/329 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MAT+++P++PSPVADAEAI  AC+GWGT EK +I I GHRN TQ+KLI++AY + Y EDL
Sbjct  1     MATIIYPENPSPVADAEAIRKACQGWGTDEKAIISIFGHRNATQKKLIRRAYEELYNEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             ++R E ELSG  EKAVYR +LDPEDRDAV+L+VAI++  +PDYRVIIE +CIY PEE L 
Sbjct  61    VKRLESELSGHFEKAVYRWILDPEDRDAVILHVAIKETPIPDYRVIIEYSCIYSPEELLA  120

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             VKRAYQARYKRS EEDLA++S  + RKLLVALVG+YRY+G +++A++A TE+ ILH+AI 
Sbjct  121   VKRAYQARYKRSVEEDLAEHSAGELRKLLVALVGIYRYAGEDINARVANTEADILHSAIS  180

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              KE+N+EEIVRI+STRS  QLIAT NRYKD++G++ITK               L+D   +
Sbjct  181   NKEFNNEEIVRIISTRSIPQLIATLNRYKDDYGSSITK--------------HLRD-DAN  225

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
                +YL ALR+TIR + DP KYYEK+IR A+ ++G DE+ +TRVIVTRAE+DL+ IKE+Y
Sbjct  226   AAKEYLVALRTTIRCISDPQKYYEKVIRYAINESGTDEESVTRVIVTRAEKDLKDIKELY  285

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLG  180
              KRNSVTL+ A++K TSG Y+A LLALLG
Sbjct  286   YKRNSVTLDHALSKHTSGDYKAFLLALLG  314



>ref|XP_011088404.1| PREDICTED: annexin-like protein RJ4 [Sesamum indicum]
Length=315

 Score =   421 bits (1082),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 204/332 (61%), Positives = 254/332 (77%), Gaps = 17/332 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             M+T+ FP+HPSPVADAEA+  A +GWGT EK VI I+G RN TQRKLI+QAY D YQEDL
Sbjct  1     MSTICFPEHPSPVADAEALRKAFQGWGTDEKAVISILGRRNATQRKLIRQAYEDLYQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             ++R E ELSG  E+AVYR +LDPEDRDAVLL+VAI+K  VPDYRVIIE +CI+ PEEFL 
Sbjct  61    VKRLESELSGDFERAVYRWILDPEDRDAVLLHVAIKKTPVPDYRVIIEISCIHSPEEFLA  120

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
              KRAYQARYKRS EEDLAQ+++ D RK LV LVG+YRY G E+  KLA +E+ ILH AI 
Sbjct  121   TKRAYQARYKRSLEEDLAQHTSGDIRKFLVGLVGIYRYRGEEITTKLANSEADILHKAIT  180

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
             +K ++H+E+VRI+STRSKAQ++AT N YKD+HG +ITK                  L+ D
Sbjct  181   EKAFSHDEVVRIISTRSKAQILATLNHYKDDHGASITK-----------------HLRGD  223

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               + YL+ALR+ IR   D  KYYEK+IR+AL +   DE+ LTRV+VTRAE+DL+ IK++Y
Sbjct  224   PCSDYLSALRTAIRCFTDHEKYYEKVIRQALNRPSTDEESLTRVVVTRAEKDLKEIKQLY  283

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
             QKRN+++L+ AVAKETSG Y A LL LLGKQ+
Sbjct  284   QKRNNISLDHAVAKETSGDYNAFLLTLLGKQD  315



>gb|AAX78199.1| putative annexin [Nicotiana tabacum]
Length=317

 Score =   421 bits (1082),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 206/329 (63%), Positives = 258/329 (78%), Gaps = 15/329 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MAT+ +P++PSPVADAEAI  AC+GWGT EK +I I GHRN TQ+KLI++AY + Y EDL
Sbjct  1     MATINYPENPSPVADAEAIRKACQGWGTDEKAIISIFGHRNATQKKLIRRAYEELYNEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             ++R E ELSG  EKAVYR +LDPEDRDAV+L+ AI++  +PDYRVIIE +CIY PEEFL 
Sbjct  61    VKRLESELSGHFEKAVYRWILDPEDRDAVMLHAAIKETPIPDYRVIIEYSCIYSPEEFLA  120

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             VKRAYQARYKRS EEDLA++S  D RKLLVALVG+YRY+G E++A++A TE+  LH+AI 
Sbjct  121   VKRAYQARYKRSVEEDLAEHSAGDLRKLLVALVGIYRYAGKEINARVANTEADNLHSAIC  180

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              KE+NHEEIVRI+STRS  QLIAT NRYKD++G++ITK               L+D   +
Sbjct  181   NKEFNHEEIVRIISTRSIPQLIATLNRYKDDYGSSITK--------------HLRD-DAN  225

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
                +YL ALR+TIR + DP KY+EK+IR A+ ++G DE+ LTRVIVTRAE+DL+ IKE+Y
Sbjct  226   AAKEYLVALRTTIRCINDPQKYHEKVIRYAINESGTDEESLTRVIVTRAEKDLKDIKEIY  285

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLG  180
              KRNSVTL+ AV+K TSG Y+A LL LLG
Sbjct  286   YKRNSVTLDHAVSKHTSGDYKAFLLTLLG  314



>ref|XP_009765996.1| PREDICTED: annexin-like protein RJ4 [Nicotiana sylvestris]
Length=319

 Score =   410 bits (1055),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 204/332 (61%), Positives = 256/332 (77%), Gaps = 15/332 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATL+ P+  SPVADAEAI  ACKGWGT EKT+I I+GHRN TQRK+I++ Y + Y E L
Sbjct  1     MATLICPEDHSPVADAEAIRKACKGWGTDEKTLISILGHRNATQRKIIRKTYEEMYNEHL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             ++R E ELSG  EKAVYR MLD E+RDAV+LNVAI++  +PDY  IIE +CIY P+EFLG
Sbjct  61    VKRLESELSGHFEKAVYRWMLDEEERDAVILNVAIKEKPIPDYTSIIELSCIYSPQEFLG  120

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             VKRAYQARYK S EEDLA +ST + RKLLV LVG+YRY+G E+DA+LA++E+ I+ NAIK
Sbjct  121   VKRAYQARYKHSVEEDLALHSTGELRKLLVFLVGIYRYAGDEIDARLAKSEADIMCNAIK  180

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              KE+NHEEIVRI++TRSK QL AT NRYKD++G+++TK               L+D +  
Sbjct  181   SKEFNHEEIVRIITTRSKTQLRATLNRYKDDNGSSLTK--------------HLRDGEAK  226

Query  446   TGNQYLTALRSTIRAMV-DPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
               N +L ALR+TIR ++ DP  YYEK+IRRAL K+G DE+ +TRVIV+RAE+DL  IKE+
Sbjct  227   AANAFLGALRTTIRCIINDPQLYYEKVIRRALMKSGTDEESVTRVIVSRAEKDLEVIKEL  286

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQ  174
             + KRNSVTL  AV+K TSG Y++ LLALLG Q
Sbjct  287   FYKRNSVTLCHAVSKHTSGDYKSFLLALLGNQ  318



>emb|CDP17929.1| unnamed protein product [Coffea canephora]
Length=314

 Score =   408 bits (1049),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 196/330 (59%), Positives = 248/330 (75%), Gaps = 17/330 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATL+FP+HPSPVADAEA+  A +GWGT+EK +I I+GHRN  QRKLI++AY D Y EDL
Sbjct  1     MATLIFPEHPSPVADAEALKKAFQGWGTNEKAIISILGHRNAVQRKLIRKAYEDMYAEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             ++R E ELSG  EK +YR +LDPE+RDAVLLNVAI++   PDYRVI+E + IY PEEFL 
Sbjct  61    VKRLESELSGDFEKVIYRWILDPEERDAVLLNVAIKQKPSPDYRVIVEFSTIYNPEEFLA  120

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             VKRAYQ R+K S EED+AQ++T D RKLLV L   Y+Y+G E+D KLA++E+  L + +K
Sbjct  121   VKRAYQHRFKHSLEEDIAQHTTGDLRKLLVGLASPYKYAGGEMDVKLAKSEADKLQDLVK  180

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
             +K  NHEE++RI++TRS AQ++AT N YKD HGTAITK                  LK+D
Sbjct  181   EKALNHEEVIRIITTRSNAQIVATLNHYKDSHGTAITK-----------------HLKDD  223

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               N YL AL + IR++ +P K+YEK++R AL K G DED +TRVIVTRAE+DL  IKE+Y
Sbjct  224   PANDYLAALLTAIRSINNPQKHYEKVLRIALNKPGTDEDAITRVIVTRAEKDLNDIKEIY  283

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGK  177
              KRNSV L+ A++KETS HY+A LLALLGK
Sbjct  284   YKRNSVALDHAISKETSSHYKAFLLALLGK  313



>ref|XP_004248844.1| PREDICTED: annexin-like protein RJ4 [Solanum lycopersicum]
Length=317

 Score =   405 bits (1042),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 198/332 (60%), Positives = 251/332 (76%), Gaps = 16/332 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             M+T+++P++ SP ADAEAI  AC+GWGT EK +I IIGHRN TQ+KLI+QAY + Y EDL
Sbjct  1     MSTIIYPENTSPAADAEAIRKACQGWGTDEKAIISIIGHRNATQKKLIRQAYEELYCEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             ++R E ELSG  EKAVYR +L+P DRDAV+L+VAI++  +P+YRV+IE +CIY PEE L 
Sbjct  61    VKRLESELSGQFEKAVYRWILNPRDRDAVILHVAIKERAIPNYRVVIEYSCIYSPEELLA  120

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             VKRAYQARYK S EED+AQ ST   RK LV L G YRY G E++A++A +E+ ILHNAI 
Sbjct  121   VKRAYQARYKTSVEEDIAQYSTGHLRKFLVGLAGTYRYVGDELNARVANSEADILHNAIS  180

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K++N+EEIVRI+STRS  QL+AT NRYKD +G++ITK               L D  E 
Sbjct  181   TKDFNNEEIVRIISTRSTTQLVATLNRYKDHYGSSITK-------------HLLDDTNE-  226

Query  446   TGN-QYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
              GN +YL ALR+TIR + DP KYYEK+IR A+ + G DE+ +TRVIVTRAE+DL+ IKEV
Sbjct  227   -GNKEYLLALRTTIRCISDPQKYYEKVIRYAMNECGTDEESVTRVIVTRAEKDLKEIKEV  285

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQ  174
             Y KRNSVTL+QA+   TSG+Y+A LL LLG +
Sbjct  286   YYKRNSVTLDQAITNHTSGNYKAFLLTLLGNE  317



>ref|XP_006339971.1| PREDICTED: annexin-like protein RJ4-like [Solanum tuberosum]
Length=319

 Score =   403 bits (1035),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 191/331 (58%), Positives = 248/331 (75%), Gaps = 13/331 (4%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             M+T+++P++ SPVADAEAI  AC+GWGT EK +I I GHRN TQ+KLI+QAY + Y EDL
Sbjct  1     MSTIIYPENTSPVADAEAIRKACQGWGTDEKAIISIFGHRNATQKKLIRQAYEELYSEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             ++R E ELSG  EKAVYR +L+P DRDAV+L+VAI++  +P+YRV++E +CIY PEE L 
Sbjct  61    VKRLESELSGQFEKAVYRWILNPRDRDAVILHVAIKERAIPNYRVVVEYSCIYSPEELLA  120

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             VKRAYQARYK S EED+AQ ST   RK LV LVG YRY G E++A++  +E+ ILHNAI 
Sbjct  121   VKRAYQARYKTSVEEDIAQYSTGHLRKFLVGLVGTYRYVGDEINARVTNSEADILHNAIS  180

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              KE+N+EEIVRI+ TRS  QL+AT NRYKD +G++ITK               + D  ++
Sbjct  181   NKEFNNEEIVRIICTRSTTQLVATLNRYKDYYGSSITK-------------HLIDDTNDE  227

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
                +YL ALR+TIR + DP KYYEK+IR A+ ++G DE+ LTRVIVTRAE+DL+ IKE+Y
Sbjct  228   DYKEYLLALRTTIRCIKDPQKYYEKVIRYAINESGTDEESLTRVIVTRAEKDLKEIKELY  287

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQ  174
              KRNSVTL+ A+   T G+Y+A LL LLG +
Sbjct  288   YKRNSVTLDHAITNHTCGNYKAFLLTLLGNE  318



>gb|AGQ56696.1| cotton annexin 5 [Gossypium hirsutum]
Length=314

 Score =   400 bits (1028),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 195/332 (59%), Positives = 248/332 (75%), Gaps = 18/332 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATL+ P+H S V DAE +  ACKGWGT EK +I ++GHRN  QRK I+ AY D YQEDL
Sbjct  1     MATLIAPEHTSAVEDAEKLQKACKGWGTDEKAIISVLGHRNAVQRKQIRLAYEDLYQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I+R E ELSG  EKAVYR +LDP DRDAVL NVAI+K   PD+ VI+E +C   PEE L 
Sbjct  61    IKRLESELSGDFEKAVYRWILDPADRDAVLANVAIKKLS-PDHHVIVEISCTRSPEELLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V+RAYQARYK S EED+A ++  D RKLLVALV  +RY G E++ ++A +E+ ILH A+K
Sbjct  120   VRRAYQARYKHSLEEDVAAHTKGDTRKLLVALVSAFRYDGEEINTRVANSEAKILHEAVK  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              KE+NHEEI+RILSTRSK QL+ATFNRY+D+HGT ITK                 +L+ D
Sbjct  180   DKEFNHEEIIRILSTRSKMQLMATFNRYRDDHGTTITK-----------------NLEGD  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
             +G+++L  LR TIR + DP KY+EK++R ++ + G DED LTRVIVTRAE+DL+ +KE+Y
Sbjct  223   SGDEFLKTLRPTIRCLNDPKKYFEKVLRNSIRRVGTDEDALTRVIVTRAEKDLKDVKELY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              KRNSV L+QAVAK+T+G Y+ALLL LLGK++
Sbjct  283   YKRNSVPLDQAVAKDTTGDYKALLLTLLGKED  314



>gb|AGG76001.1| annexin AnxGb5 [Gossypium barbadense]
Length=314

 Score =   399 bits (1026),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 195/332 (59%), Positives = 250/332 (75%), Gaps = 18/332 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MAT+  P+  S +ADAEA+  ACKGWGT EK +I ++GHRN  QRK I+ AY D YQEDL
Sbjct  1     MATIDVPEQVSVLADAEALRKACKGWGTDEKAIISVLGHRNAVQRKQIRLAYEDLYQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I+R E ELSG  EKAVYR +LDP DRDAVL NVAI+K   PD+ VI+E +C   PEE L 
Sbjct  61    IKRLESELSGDFEKAVYRWILDPADRDAVLANVAIKKLS-PDHHVIVEISCTRSPEELLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V+RAYQARYK S EED+A ++  D RKLLV+LV  +RY G E++ ++A +E+ ILH A+K
Sbjct  120   VRRAYQARYKHSLEEDVAAHTKGDTRKLLVSLVSAFRYDGEEINTRVANSEAKILHEAVK  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              KE+NHEEI+RILSTRSK QL+ATFNRY+D+HGT ITK                 +L+ D
Sbjct  180   DKEFNHEEIIRILSTRSKMQLMATFNRYRDDHGTTITK-----------------NLEGD  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
             +G+++L  LR+TIR + DP KY+EK++R ++ + G DED LTRVIVTRAE+DL+ IKE+Y
Sbjct  223   SGDEFLKTLRATIRCLNDPKKYFEKVLRNSIRRVGTDEDALTRVIVTRAEKDLKDIKELY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              KRNSV+L+QAVAK+TSG Y+ALLL LLGK++
Sbjct  283   YKRNSVSLDQAVAKDTSGDYKALLLTLLGKED  314



>gb|AGQ56695.1| cotton annexin 4 [Gossypium hirsutum]
Length=314

 Score =   399 bits (1026),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 195/332 (59%), Positives = 250/332 (75%), Gaps = 18/332 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MAT+  P+  S +ADAEA+  ACKGWGT EK +I ++GHRN  QRK I+ AY D YQEDL
Sbjct  1     MATIDVPEQVSVLADAEALRKACKGWGTDEKAIISVLGHRNAVQRKQIRLAYEDLYQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I+R E ELSG  EKAVYR +LDP DRDAVL NVAI+K   PD+ VI+E +C   PEE L 
Sbjct  61    IKRLESELSGDFEKAVYRWVLDPADRDAVLANVAIKKLS-PDHHVIVEISCTRSPEELLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V+RAYQARYK S EED+A ++  D RKLLV+LV  +RY G E++ ++A +E+ ILH A+K
Sbjct  120   VRRAYQARYKHSLEEDVAAHTKGDTRKLLVSLVSAFRYDGEEINTRVANSEAKILHEAVK  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              KE+NHEEI+RILSTRSK QL+ATFNRY+D+HGT ITK                 +L+ D
Sbjct  180   DKEFNHEEIIRILSTRSKMQLMATFNRYRDDHGTTITK-----------------NLEGD  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
             +G+++L  LR+TIR + DP KY+EK++R ++ + G DED LTRVIVTRAE+DL+ IKE+Y
Sbjct  223   SGDEFLKTLRATIRCLNDPKKYFEKVLRNSIRRVGTDEDALTRVIVTRAEKDLKDIKELY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              KRNSV+L+QAVAK+TSG Y+ALLL LLGK++
Sbjct  283   YKRNSVSLDQAVAKDTSGDYKALLLTLLGKED  314



>ref|XP_009589394.1| PREDICTED: annexin-like protein RJ4 [Nicotiana tomentosiformis]
Length=319

 Score =   397 bits (1020),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 195/332 (59%), Positives = 253/332 (76%), Gaps = 15/332 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATL+ P+  SPVADAEAI  ACKGWGT EK +I I+GHR  TQRK+I++ Y + Y E+L
Sbjct  1     MATLICPEDHSPVADAEAIRKACKGWGTDEKALISILGHRTATQRKIIRKTYEEMYNEEL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             ++R E ELSG  EKAVYR MLDPE+RDAV+LNVAI++  + DY  IIE +CIY P+E L 
Sbjct  61    VKRLESELSGHFEKAVYRWMLDPEERDAVILNVAIKEKPILDYTSIIELSCIYSPQELLA  120

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             VKRAY+ RYK S EEDLA +ST + RKLLV LVG+YRY+G E+DA+LA++E+ I+ NAIK
Sbjct  121   VKRAYETRYKHSVEEDLALHSTGELRKLLVFLVGIYRYAGDEIDARLAKSEADIMCNAIK  180

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
               ++NHEEIVRI++TRSK QL AT NRYKD++G+++TK              +L+D +  
Sbjct  181   SNDFNHEEIVRIITTRSKTQLRATLNRYKDDNGSSLTK--------------YLRDDEAK  226

Query  446   TGNQYLTALRSTIRAMV-DPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
               N +L ALR+TIR ++ DP +YYEK+IRRAL K+G DE+ +TRVIV+RAE+DL  IKE+
Sbjct  227   AANAFLGALRTTIRCIINDPQQYYEKVIRRALMKSGTDEESVTRVIVSRAEKDLEIIKEL  286

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQ  174
             + KRNSVTL  AV+K TSG Y++ L+ALLG Q
Sbjct  287   FYKRNSVTLCHAVSKHTSGDYKSFLVALLGNQ  318



>ref|XP_011042168.1| PREDICTED: annexin-like protein RJ4 isoform X2 [Populus euphratica]
Length=313

 Score =   396 bits (1018),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 195/332 (59%), Positives = 247/332 (74%), Gaps = 19/332 (6%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MA+L+ P++  P  DAEA+Y ACKGWGT+EK +I I+GHRN  QRK I+ AY + +QEDL
Sbjct  1     MASLIAPENHVPSEDAEALYKACKGWGTNEKAIISILGHRNAAQRKQIRLAYSELFQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             ++R E EL+G  EKAVYR +LDPEDRDAVL NVAIRK G  DY VI+E AC+   EE L 
Sbjct  61    VKRLESELTGDFEKAVYRWVLDPEDRDAVLANVAIRKSG--DYHVIVEIACVLSSEELLA  118

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V+RAY ARYK S EEDLA  +T D RKLLV LV  +RY G E++ +LA +E+ ILH+AIK
Sbjct  119   VRRAYHARYKHSLEEDLAARTTGDIRKLLVGLVTAFRYEGDEINTRLANSEADILHDAIK  178

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K +NHE+++RIL+TRSKAQL+ATFNRY+D+HG++ITK                 DL E+
Sbjct  179   GKAFNHEDVIRILTTRSKAQLMATFNRYRDDHGSSITK-----------------DLLEE  221

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               +++ T LR+ IR + D  KYYEK++R A+ K G DED LTRVIVTRAE+DL  IKE+Y
Sbjct  222   PADEFKTVLRTAIRCLNDHKKYYEKILRNAIKKVGTDEDALTRVIVTRAEKDLNDIKEIY  281

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              KRNSV L+QAVAK+TSG Y+A LLALLG++E
Sbjct  282   YKRNSVPLDQAVAKDTSGDYKAFLLALLGEEE  313



>ref|XP_007011125.1| Annexin-like protein RJ4 isoform 2 [Theobroma cacao]
 gb|EOY19935.1| Annexin-like protein RJ4 isoform 2 [Theobroma cacao]
Length=314

 Score =   396 bits (1017),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 194/332 (58%), Positives = 244/332 (73%), Gaps = 18/332 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATL+ PDHPS V DAEA+  ACKGWGT EK +I ++GHRN  QRK I+ AY + YQEDL
Sbjct  1     MATLIAPDHPSAVEDAEALQKACKGWGTDEKAIISVLGHRNAAQRKQIRLAYEELYQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I+R E ELSG  EKAVYR +LDP DRDAVL NVAI+K   PD+ V+IE +C   PEE L 
Sbjct  61    IKRLESELSGDFEKAVYRWVLDPADRDAVLANVAIKKIS-PDHHVVIEISCTRSPEELLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V+RAYQARYK S EED+A ++  D RKLLVALV  +RY G E++ +LA +E+ ILH+AIK
Sbjct  120   VRRAYQARYKHSLEEDVAAHTKGDIRKLLVALVSAFRYDGEEINTRLANSEANILHDAIK  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K +NHEE+VRILSTRSK QL+ATFNRY+D+ GT ITK                  L  +
Sbjct  180   DKAFNHEEVVRILSTRSKMQLMATFNRYRDDQGTTITKK-----------------LLGE  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
             +G+++L ALR+ +R   DP KY+EK++R ++   G DED LTRVIVTRAE+DL+ IK++Y
Sbjct  223   SGDEFLVALRTAVRCFNDPKKYFEKVLRNSIKGIGTDEDALTRVIVTRAEKDLKEIKDLY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              KRNS+ LEQ VAK+TSG Y+A LL LLGK++
Sbjct  283   HKRNSMPLEQVVAKDTSGDYKAFLLTLLGKED  314



>gb|ACJ11719.1| annexin [Gossypium hirsutum]
Length=314

 Score =   396 bits (1017),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 194/332 (58%), Positives = 248/332 (75%), Gaps = 18/332 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MAT+  P+  S +ADAEA+  ACKGWGT EK +I ++GHRN  QRK I+ AY D YQEDL
Sbjct  1     MATIDVPEQVSVLADAEALRKACKGWGTDEKAIISVLGHRNAVQRKQIRLAYEDLYQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I+R E ELSG  EKAVYR +LDP DRDAVL NVAI+K   PD+ VI+E +C   PEE L 
Sbjct  61    IKRLESELSGDFEKAVYRWILDPADRDAVLANVAIKKLS-PDHHVIVEISCTRSPEELLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V+RAYQARYK S EED+A ++  D RKLLVALV  +RY G E++ ++A +E+ ILH A+K
Sbjct  120   VRRAYQARYKHSLEEDVAAHTKGDTRKLLVALVSAFRYDGEEINTRVANSEAKILHEAVK  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              KE+NHEEI+RILSTRSK QL+ATFNRY+D+HGT ITK                 +L+ D
Sbjct  180   DKEFNHEEIIRILSTRSKMQLMATFNRYRDDHGTTITK-----------------NLEGD  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
             +G+++L  LR TIR + DP KY+EK++R ++ + G DED LTRVIVTRAE+DL+ +KE+Y
Sbjct  223   SGDEFLKTLRPTIRCLNDPKKYFEKVLRNSIRRVGTDEDALTRVIVTRAEKDLKDVKELY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              KRNSV L+QAVAK+T+G Y+ALLL LLGK++
Sbjct  283   YKRNSVPLDQAVAKDTTGDYKALLLTLLGKED  314



>gb|AGG76002.1| annexin AnxGb6 [Gossypium barbadense]
Length=314

 Score =   395 bits (1015),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 193/332 (58%), Positives = 248/332 (75%), Gaps = 18/332 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MAT+  P+  S +ADAEA+  ACKGWGT EK +I ++GHRN  QRK I+ AY D YQEDL
Sbjct  1     MATIDVPEQVSVLADAEALRKACKGWGTDEKAIISVLGHRNAVQRKQIRLAYEDLYQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I+R E ELSG  E+AVYR +LDP DRDAVL NVAI+K   PD+ VI+E +C   PEE L 
Sbjct  61    IKRLESELSGDFEEAVYRWILDPADRDAVLANVAIKKLS-PDHHVIVEISCTRSPEELLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V+RAYQARYK S EED+A ++  D RKLLVALV  +RY G E++ ++A +E+ +LH A+K
Sbjct  120   VRRAYQARYKHSLEEDVAAHTKGDTRKLLVALVSAFRYDGEEINTRVANSEAKVLHEAVK  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              KE+NHEEI+RILSTRSK QL+ATFNRY+D+HGT ITK                 +L+ D
Sbjct  180   DKEFNHEEIIRILSTRSKMQLMATFNRYRDDHGTTITK-----------------NLEGD  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
             +G+++L  LR TIR + DP KY+EK++R ++ + G DED LTRVIVTRAE+DL+ +KE+Y
Sbjct  223   SGDEFLKTLRPTIRCLNDPKKYFEKVLRNSIRRVGTDEDALTRVIVTRAEKDLKDVKELY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              KRNSV L+QAVAK+TSG Y+ALLL LLGK++
Sbjct  283   YKRNSVPLDQAVAKDTSGDYKALLLTLLGKED  314



>ref|XP_006341838.1| PREDICTED: annexin-like protein RJ4-like [Solanum tuberosum]
Length=319

 Score =   394 bits (1011),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 192/333 (58%), Positives = 252/333 (76%), Gaps = 15/333 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATL+ P+  SPV DAEAI  ACKGWGT EK +I I+GHRN +QRK+I++ Y + Y EDL
Sbjct  1     MATLICPEEHSPVTDAEAIRKACKGWGTDEKALISILGHRNASQRKIIRKTYEEMYNEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             ++R E ELSG  E+AVYR MLDP++RDAV+L+VAI++  + DY  IIE +CIY P++FL 
Sbjct  61    VKRLESELSGHFERAVYRWMLDPQERDAVILHVAIKEKPILDYTSIIELSCIYSPQDFLA  120

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             VK AYQARYKRS EEDLAQ+ T D RKLLV++V +YRY+G E+DAKLA++E+ +++NAIK
Sbjct  121   VKCAYQARYKRSLEEDLAQHCTGDLRKLLVSVVSIYRYAGDEIDAKLAKSEADVIYNAIK  180

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              KE+NHEEIVRI++TRSK QL AT NRYKD++ +++TK               L+D  E 
Sbjct  181   SKEFNHEEIVRIITTRSKTQLRATLNRYKDDYTSSLTK--------------HLRDDGEK  226

Query  446   TGNQYLTALRSTIRAMV-DPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             T N +L ALR+TIR +  D   YYEK+IRRAL K+G DE+ +TRVIV+RA++DL  IKE+
Sbjct  227   TANAFLGALRTTIRCITYDSQAYYEKVIRRALMKSGTDEESVTRVIVSRADKDLEVIKEL  286

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
             Y KRNSV+L+ A++K TSG Y   LL LLG ++
Sbjct  287   YYKRNSVSLDHAISKHTSGDYMDFLLTLLGNKK  319



>ref|XP_011042167.1| PREDICTED: annexin-like protein RJ4 isoform X1 [Populus euphratica]
Length=313

 Score =   389 bits (1000),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 194/332 (58%), Positives = 246/332 (74%), Gaps = 19/332 (6%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATLV  ++ S V DA+A+  AC+GWGT+EK +I I+GHRN  QRK I+ AY + +QEDL
Sbjct  1     MATLVVLENVSCVDDAQALQKACQGWGTNEKAIISILGHRNAAQRKQIRLAYSELFQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             ++R E EL+G  EKAVYR +LDPEDRDAVL NVAIRK G  DY VI+E AC+   EE L 
Sbjct  61    VKRLESELTGDFEKAVYRWVLDPEDRDAVLANVAIRKSG--DYHVIVEIACVLSSEELLA  118

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V+RAY ARYK S EEDLA  +T D RKLLV LV  +RY G E++ +LA +E+ ILH+AIK
Sbjct  119   VRRAYHARYKHSLEEDLAARTTGDIRKLLVGLVTAFRYEGDEINTRLANSEADILHDAIK  178

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K +NHE+++RIL+TRSKAQL+ATFNRY+D+HG++ITK                 DL E+
Sbjct  179   GKAFNHEDVIRILTTRSKAQLMATFNRYRDDHGSSITK-----------------DLLEE  221

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               +++ T LR+ IR + D  KYYEK++R A+ K G DED LTRVIVTRAE+DL  IKE+Y
Sbjct  222   PADEFKTVLRTAIRCLNDHKKYYEKILRNAIKKVGTDEDALTRVIVTRAEKDLNDIKEIY  281

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              KRNSV L+QAVAK+TSG Y+A LLALLG++E
Sbjct  282   YKRNSVPLDQAVAKDTSGDYKAFLLALLGEEE  313



>ref|XP_004248802.1| PREDICTED: annexin-like protein RJ4 [Solanum lycopersicum]
Length=319

 Score =   389 bits (999),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 191/333 (57%), Positives = 248/333 (74%), Gaps = 15/333 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATL+ P+  SPV DAEAI  ACKGWGT EK +I I+GHRN +QRK+I++ Y + Y EDL
Sbjct  1     MATLICPEEYSPVTDAEAIRKACKGWGTDEKALISILGHRNASQRKIIRKTYEEMYNEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             ++R E ELSG  EKAVYR MLDP++RDAV+L+VAI++  + DY  IIE +CIY P +FL 
Sbjct  61    MKRLESELSGHFEKAVYRWMLDPQERDAVILHVAIKEKPILDYTSIIELSCIYSPHDFLS  120

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             VK  YQARYKRS EEDLAQ+ T + RKLL+++VG YRY+G E+D KLA++E+ +++NAIK
Sbjct  121   VKCTYQARYKRSLEEDLAQHCTGELRKLLLSVVGTYRYAGDEIDVKLAKSEADVIYNAIK  180

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              KE+NHEEIVRI++TRSK QL AT NRYKD++ +++TK              +L+D  E 
Sbjct  181   SKEFNHEEIVRIITTRSKTQLRATLNRYKDDYASSLTK--------------YLRDDGEK  226

Query  446   TGNQYLTALRSTIRAMV-DPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             T N +L ALR+ IR +  DP  YYEK+IRRAL K+G DE  +TRVIV+RAE DL  IKE+
Sbjct  227   TANAFLGALRTIIRCITYDPQAYYEKVIRRALMKSGTDEASVTRVIVSRAENDLGVIKEL  286

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
             Y KRNSV+L+ A++K TSG Y   LL LLG ++
Sbjct  287   YYKRNSVSLDHAISKHTSGDYMNFLLTLLGNKK  319



>ref|XP_008356783.1| PREDICTED: LOW QUALITY PROTEIN: annexin-like protein RJ4 [Malus 
domestica]
 ref|XP_008364732.1| PREDICTED: LOW QUALITY PROTEIN: annexin-like protein RJ4 [Malus 
domestica]
Length=314

 Score =   388 bits (996),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 197/332 (59%), Positives = 240/332 (72%), Gaps = 18/332 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MA+L+ PDH SP  DAEA+ NACKGWGT EK +I I+GHRN  QRK I+ AY   YQEDL
Sbjct  1     MASLIAPDHFSPHDDAEALRNACKGWGTDEKAIISILGHRNAAQRKQIRLAYEQSYQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             ++R E ELSG  EKAVYR +LDP DRDAVL +VAI+K    +Y VIIE A I  PEE L 
Sbjct  61    LKRLESELSGDFEKAVYRWILDPADRDAVLAHVAIKKSEC-NYNVIIEIATILSPEELLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V++AYQ RYK S EEDLA ++T D RKLLVALV  YRY G E++AKLA +E+ ILH+AIK
Sbjct  120   VRKAYQVRYKHSLEEDLAAHTTGDIRKLLVALVTAYRYDGCEINAKLANSEADILHDAIK  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K +NH+E++RILSTRSK QL+ATFNRY+D+HGT+I+K                  L E+
Sbjct  180   DKAFNHDEVIRILSTRSKTQLMATFNRYRDDHGTSISKS-----------------LLEE  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               +    AL   IR + DP KY+EK++R A+ + G DED LTRVIVTRAERDL+ IKEVY
Sbjct  223   GADGLQKALHVAIRCLNDPKKYFEKVLRNAIKRVGTDEDALTRVIVTRAERDLKDIKEVY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              K+NSV L+ AVAKETSG YE  LL LLGK++
Sbjct  283   YKKNSVPLDHAVAKETSGDYEDFLLTLLGKED  314



>ref|XP_006438868.1| hypothetical protein CICLE_v10032154mg [Citrus clementina]
 ref|XP_006482996.1| PREDICTED: annexin-like protein RJ4-like [Citrus sinensis]
 gb|ESR52108.1| hypothetical protein CICLE_v10032154mg [Citrus clementina]
Length=316

 Score =   387 bits (994),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 197/332 (59%), Positives = 245/332 (74%), Gaps = 16/332 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATLV P   S + DA+A+Y ACKGWGT EK VI I+GHR   QR+ I+ AY + YQEDL
Sbjct  1     MATLVAPVQHSHIEDAKALYKACKGWGTDEKAVISILGHRTAAQRQQIRLAYQNLYQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             ++R E ELSG+ EKAVYR +L+P DRDAVL NVAI+K   PDY VIIE AC++ PEE L 
Sbjct  61    VKRLESELSGAFEKAVYRWILEPADRDAVLANVAIKKA-CPDYHVIIEIACVHSPEELLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V+RAYQ RYK S EED+A ++T D RKLLVALV V RY G E++A+LA++E+ IL +A K
Sbjct  120   VRRAYQLRYKLSLEEDVAAHTTGDLRKLLVALVSVLRYDGPEINARLAKSEADILEDATK  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K +NHEE++RIL+TRSKAQL+ATFNRY+D+ GT+ITK  L                + D
Sbjct  180   NKAFNHEEVIRILTTRSKAQLMATFNRYRDDCGTSITKSLL---------------REGD  224

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               N++  ALR+ IR + + +KY+EK+IR A+   G DED LTRVIVTRAE+DL+ IKEVY
Sbjct  225   QVNEFPAALRTAIRCINNSNKYFEKIIRNAIKGAGTDEDALTRVIVTRAEKDLKVIKEVY  284

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              KRNSVTLEQAVAK+TSG Y A LL LLGK +
Sbjct  285   YKRNSVTLEQAVAKDTSGDYNAFLLTLLGKAD  316



>ref|XP_004307132.1| PREDICTED: annexin-like protein RJ4-like isoform 2 [Fragaria 
vesca subsp. vesca]
Length=313

 Score =   385 bits (990),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 197/332 (59%), Positives = 241/332 (73%), Gaps = 19/332 (6%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MA+L+ PD  S   DAEA+  AC+GWGT+EK VI I+GHRN  QRK I+ AY   YQEDL
Sbjct  1     MASLITPDQFSANQDAEALRKACQGWGTNEKAVISILGHRNAGQRKEIRAAYEQLYQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             ++R E ELSG  EKAVYR +LDP DRDAVL NVAI+K    DY VIIE +CI+ PEE L 
Sbjct  61    LKRLESELSGDFEKAVYRWILDPADRDAVLANVAIKKS--TDYNVIIEISCIHSPEELLA  118

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V+RAYQ RYK S EEDLA ++T D RKLLVALV  YRY G E++AKLA +E+ IL +AIK
Sbjct  119   VRRAYQLRYKHSVEEDLAAHTTGDIRKLLVALVTAYRYDGHEINAKLANSEADILQDAIK  178

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K +N EEI+RILSTRSK QL+ATFN+Y+D+ G +I+K                 +L E+
Sbjct  179   DKAFNLEEIIRILSTRSKTQLMATFNKYRDDQGISISK-----------------NLLEE  221

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               N +  AL + IR + DP KY+EK++R A+ + G DED LTRVIVTRAERDLR IKEVY
Sbjct  222   GANDFQKALHTAIRCLNDPKKYFEKVLRNAIKRVGTDEDALTRVIVTRAERDLRDIKEVY  281

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              K+NSV LEQAVAK+TSG Y+A LL LLGK++
Sbjct  282   YKKNSVPLEQAVAKDTSGDYKAFLLTLLGKED  313



>ref|XP_010032320.1| PREDICTED: annexin-like protein RJ4 [Eucalyptus grandis]
 gb|KCW51730.1| hypothetical protein EUGRSUZ_J01192 [Eucalyptus grandis]
Length=334

 Score =   385 bits (989),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 188/332 (57%), Positives = 245/332 (74%), Gaps = 18/332 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MA+ V PDH S   DAE +  AC+GWGT+EK +I ++GHRN  QRK I+QAY   Y+EDL
Sbjct  21    MASFVVPDHFSATEDAETLRKACQGWGTNEKLIIKVLGHRNAAQRKQIRQAYEQLYEEDL  80

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             ++R E ELSG  EKAVYR +LDP DRDAVL NVA++K   PD+ VIIE +C++ P+E L 
Sbjct  81    VKRLESELSGDFEKAVYRWILDPVDRDAVLANVALKKSN-PDFPVIIEISCVHSPDELLE  139

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V++AY+ RYKRS EED+A ++T D RKLLV LV  YR+ G E++A+LA +E+ +LHNAIK
Sbjct  140   VRKAYKLRYKRSLEEDVAAHTTGDIRKLLVGLVSAYRFEGEEINARLANSEADVLHNAIK  199

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K +NH+E++RIL+TRSKAQL ATFNRY+D+ GT+ITK  LV                 +
Sbjct  200   DKAFNHDEVIRILTTRSKAQLRATFNRYRDDQGTSITKNILV-----------------E  242

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               + +  ALR+TIR   D  KY+EK++R A+ + G DEDD+TRVIVTRAE+DL+ IKE Y
Sbjct  243   HPDDFSVALRTTIRCFNDQQKYFEKVLRNAIKRAGTDEDDITRVIVTRAEKDLKEIKEEY  302

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              KRNS +L+QAVAK+TSG Y+A LLALLGK+E
Sbjct  303   YKRNSASLDQAVAKDTSGDYKAFLLALLGKEE  334



>ref|XP_008375301.1| PREDICTED: annexin-like protein RJ4 isoform X1 [Malus domestica]
Length=314

 Score =   384 bits (987),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 194/332 (58%), Positives = 240/332 (72%), Gaps = 18/332 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MA+L+ PDH SP  DAEA+ NACKGWGT EK +  I+GHRN  QRK I+ AY   YQEDL
Sbjct  1     MASLIAPDHFSPHDDAEALRNACKGWGTDEKAIJSILGHRNAAQRKQIRLAYEQSYQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             ++R E ELSG  EKAVYR +LDP DRDAVL +VAI+K    +Y VIIE A I  PEE L 
Sbjct  61    LKRLESELSGDFEKAVYRWILDPADRDAVLAHVAIKKSEC-NYNVIIEIATILSPEELLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V++AYQ RYK S EEDLA ++T D RKLLVALV  YRY GSE++AKLA +E+ I+H+AIK
Sbjct  120   VRKAYQVRYKHSLEEDLAAHTTGDVRKLLVALVTAYRYDGSEINAKLANSEADIIHDAIK  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K +NH+E++RILSTRSK QL+ATFNRY+D+HGT+I+K                  L E+
Sbjct  180   DKAFNHDEVIRILSTRSKTQLMATFNRYRDDHGTSISKS-----------------LLEE  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               +    AL   IR + DP KY+EK++R A+ + G DED LTRVIVTR+ERDL+ IKEVY
Sbjct  223   GCDGLQKALHVAIRCLNDPKKYFEKVLRNAIKRVGTDEDALTRVIVTRSERDLKDIKEVY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              K+NSV L+ AVAKETSG Y+  LL LLGK++
Sbjct  283   YKKNSVPLDHAVAKETSGDYKDFLLTLLGKED  314



>gb|KHG14512.1| Annexin-like protein RJ4 [Gossypium arboreum]
Length=303

 Score =   384 bits (985),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 191/332 (58%), Positives = 243/332 (73%), Gaps = 29/332 (9%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MAT+  P+  S +ADAEA+  ACKGWGT EK +I ++GHRN  QRK I+ AY D YQEDL
Sbjct  1     MATIDVPEQVSVLADAEALRKACKGWGTDEKAIISVLGHRNAVQRKQIRLAYEDLYQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I+R E ELSG  EKAVYR +LDP DRDAVL NVAI+K   PD+ VI+E +C   PEE L 
Sbjct  61    IKRLESELSGDFEKAVYRWILDPADRDAVLANVAIKKLS-PDHHVIVEISCTRSPEELLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V+RAYQARYK S EED           LLV+LV  +RY G E++ ++A +E+ ILH A+K
Sbjct  120   VRRAYQARYKHSLEED-----------LLVSLVSAFRYDGEEINTRVANSEAKILHEAVK  168

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              KE+NHEEI+RILSTRSK QL+ATFNRY+D+HGT ITK                 +L+ D
Sbjct  169   DKEFNHEEIIRILSTRSKMQLMATFNRYRDDHGTTITK-----------------NLEGD  211

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
             +G+++L  LR+TIR + DP KY+EK++R ++ + G DED LTRVIVTRAE+DL+ IKE+Y
Sbjct  212   SGDEFLKTLRATIRCLNDPKKYFEKVLRNSIRRVGTDEDALTRVIVTRAEKDLKDIKELY  271

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              KRNSV+L+QAVAK+TSG Y+ALLL LLGK++
Sbjct  272   YKRNSVSLDQAVAKDTSGDYKALLLTLLGKED  303



>ref|XP_009361985.1| PREDICTED: annexin-like protein RJ4 [Pyrus x bretschneideri]
Length=317

 Score =   382 bits (982),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 197/332 (59%), Positives = 238/332 (72%), Gaps = 18/332 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MA+L+ PDH SP  DAEA+ NACKGWGT EK +I I+GHRN  QRK I+ AY   YQEDL
Sbjct  1     MASLIVPDHFSPHDDAEALRNACKGWGTDEKAIISILGHRNAAQRKQIRLAYEQSYQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             ++R E ELSG  EKAVYR +LDP DRDAVL +VAI+K    +Y VIIE A I  PEE L 
Sbjct  61    LKRLESELSGDFEKAVYRWILDPADRDAVLAHVAIKKSEC-NYNVIIEIATILSPEELLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V++AYQ RYK S EEDLA ++T D RKLLVALV  YRY G E++AKLA +E+ ILH+AIK
Sbjct  120   VRKAYQVRYKHSLEEDLAAHTTGDIRKLLVALVTAYRYDGCEINAKLANSEADILHDAIK  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K +NH+E++RILSTRSK QL+ATFNRY+D+HGT+I+K                  L E+
Sbjct  180   DKAFNHDEVIRILSTRSKTQLMATFNRYRDDHGTSISKS-----------------LLEE  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
              G+    AL   IR + DP KY+EK++R A+ + G DED LTRVIVTRAERDL+ IKEVY
Sbjct  223   GGDGLQKALYVAIRCLNDPKKYFEKVLRSAIKRVGTDEDALTRVIVTRAERDLKDIKEVY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              K+NSV L+ AVAKETSG YE  LL L  K E
Sbjct  283   YKKNSVPLDHAVAKETSGDYEDFLLTLGKKIE  314



>ref|XP_010032319.1| PREDICTED: annexin-like protein RJ4 isoform X3 [Eucalyptus grandis]
 gb|KCW51731.1| hypothetical protein EUGRSUZ_J01193 [Eucalyptus grandis]
Length=314

 Score =   379 bits (972),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 187/332 (56%), Positives = 248/332 (75%), Gaps = 18/332 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MA+LV PDH SP  DA A+  ACKG+GT+EK +I ++GHRN  QRK I+QAY   Y+EDL
Sbjct  1     MASLVAPDHFSPTEDAAALQKACKGFGTNEKAIIEVLGHRNAAQRKQIRQAYEQLYEEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             ++R E EL+   EKAVYR +LDP DRDAVL NVA++K   PDY VIIE +CI  P+E L 
Sbjct  61    VKRLESELTRDFEKAVYRWILDPADRDAVLANVALKKSN-PDYPVIIEISCIRTPDELLE  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V++AYQ RYKRS EED+A ++T D RKLLV LV  YRY G E++A+LA +E+ ++H+AIK
Sbjct  120   VRKAYQLRYKRSLEEDVAAHTTGDIRKLLVGLVSAYRYQGEEINARLANSEADLIHDAIK  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K ++H+E++RIL+TRSKAQL ATFNRY+++ GT+ITK NL+V                +
Sbjct  180   DKAFSHDEVIRILTTRSKAQLRATFNRYQEDQGTSITK-NLLV----------------E  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               ++ L ALR+TIR + DP+KY+ K++   + + G DEDDLTRVIVTRAE+DL+ IKE Y
Sbjct  223   NPDEILVALRTTIRGLNDPNKYFVKVLSNGIKRAGTDEDDLTRVIVTRAEKDLKEIKEEY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              K+NSV+L+QAVAK+T+G Y+A LLALLG +E
Sbjct  283   YKKNSVSLDQAVAKDTTGDYKAFLLALLGNEE  314



>gb|EYU38267.1| hypothetical protein MIMGU_mgv1a010356mg [Erythranthe guttata]
Length=314

 Score =   379 bits (972),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 189/330 (57%), Positives = 238/330 (72%), Gaps = 18/330 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             M+T+VFPDH S  ADAEA+  AC+GWGT EK +IGI+G RN  QRKLI+QAY D YQEDL
Sbjct  1     MSTIVFPDHHSAAADAEALRKACQGWGTDEKGIIGILGRRNAIQRKLIRQAYEDLYQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I+R E ELSG  EKAVYR  LDPEDRDAV+L+ AI+K    DYR I+E +C     E L 
Sbjct  61    IKRLESELSGDFEKAVYRWALDPEDRDAVILHTAIKKTPTIDYRAIVEISCTSSFVELLA  120

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI-  630
             +KRAYQ RYK S EEDLAQ +T+  R  LV LV ++RY G E++A+LA +E+ ILH AI 
Sbjct  121   IKRAYQIRYKHSLEEDLAQRTTSHMRTFLVGLVSIFRYQGEEINARLANSEADILHGAIC  180

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
             K+K + HE+I+RIL+TR+K Q+IAT N YKD+HGT+ITK                  L++
Sbjct  181   KEKAFTHEDIIRILTTRTKPQIIATLNHYKDDHGTSITKH-----------------LRD  223

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             +    Y++ALR  IR + D  KYY K+IR+AL + G DE+ LTRV+VTRAE+DL+ IKEV
Sbjct  224   EQSCDYVSALRVAIRCINDHKKYYAKVIRQALNRAGTDEESLTRVVVTRAEKDLKEIKEV  283

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLG  180
             Y KRNSVTL+ AVAK+TSG Y+A L+ LLG
Sbjct  284   YHKRNSVTLDHAVAKDTSGDYKAFLITLLG  313



>ref|XP_004307131.1| PREDICTED: annexin-like protein RJ4-like isoform 1 [Fragaria 
vesca subsp. vesca]
Length=313

 Score =   378 bits (971),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 196/332 (59%), Positives = 239/332 (72%), Gaps = 19/332 (6%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATLV P +     DAEA+  + KGWGT+EK VI I+GHRN  QRK I+ AY   YQEDL
Sbjct  1     MATLVSPPNFCANEDAEALRKSVKGWGTNEKAVISILGHRNAGQRKEIRAAYEQLYQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             ++R E ELSG  EKAVYR +LDP DRDAVL NVAI+K    DY VIIE +CI+ PEE L 
Sbjct  61    LKRLESELSGDFEKAVYRWILDPADRDAVLANVAIKKS--TDYNVIIEISCIHSPEELLA  118

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V+RAYQ RYK S EEDLA ++T D RKLLVALV  YRY G E++AKLA +E+ IL +AIK
Sbjct  119   VRRAYQLRYKHSVEEDLAAHTTGDIRKLLVALVTAYRYDGHEINAKLANSEADILQDAIK  178

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K +N EEI+RILSTRSK QL+ATFN+Y+D+ G +I+K                 +L E+
Sbjct  179   DKAFNLEEIIRILSTRSKTQLMATFNKYRDDQGISISK-----------------NLLEE  221

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               N +  AL + IR + DP KY+EK++R A+ + G DED LTRVIVTRAERDLR IKEVY
Sbjct  222   GANDFQKALHTAIRCLNDPKKYFEKVLRNAIKRVGTDEDALTRVIVTRAERDLRDIKEVY  281

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              K+NSV LEQAVAK+TSG Y+A LL LLGK++
Sbjct  282   YKKNSVPLEQAVAKDTSGDYKAFLLTLLGKED  313



>ref|XP_007011124.1| Annexin-like protein RJ4 isoform 1 [Theobroma cacao]
 gb|EOY19934.1| Annexin-like protein RJ4 isoform 1 [Theobroma cacao]
Length=387

 Score =   380 bits (976),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 188/334 (56%), Positives = 241/334 (72%), Gaps = 18/334 (5%)
 Frame = -3

Query  1172  RSMATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQE  993
             + MAT+  P   S + DAEA+  AC+GWGT EK +I ++GHRN  QRK I+ AY + YQE
Sbjct  72    KQMATIDVPHQVSFLEDAEALRKACQGWGTDEKAIISVLGHRNAAQRKQIRLAYEELYQE  131

Query  992   DLIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEF  813
             DLI+R E ELSG  EKAVYR +LDP DRDAVL NVAI+K   PD+ V+IE +C   PEE 
Sbjct  132   DLIKRLESELSGDFEKAVYRWVLDPADRDAVLANVAIKKIS-PDHHVVIEISCTRSPEEL  190

Query  812   LGVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNA  633
             L V+RAYQARYK S EED+A ++  D RKLLVALV  +RY G E++ +LA +E+ ILH+A
Sbjct  191   LAVRRAYQARYKHSLEEDVAAHTKGDIRKLLVALVSAFRYDGEEINTRLANSEANILHDA  250

Query  632   IKKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLK  453
             IK K +NHEE+VRILSTRSK QL+ATFNRY+D+ GT ITK                  L 
Sbjct  251   IKDKAFNHEEVVRILSTRSKMQLMATFNRYRDDQGTTITKK-----------------LL  293

Query  452   EDTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKE  273
              ++G+++L ALR+ +R   DP KY+EK++R ++   G DED LTRVIVTRAE+DL+ IK+
Sbjct  294   GESGDEFLVALRTAVRCFNDPKKYFEKVLRNSIKGIGTDEDALTRVIVTRAEKDLKEIKD  353

Query  272   VYQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
             +Y KRNS+ LEQ VAK+TSG Y+A LL LLGK++
Sbjct  354   LYHKRNSMPLEQVVAKDTSGDYKAFLLTLLGKED  387



>sp|P51074.2|ANX4_FRAAN RecName: Full=Annexin-like protein RJ4 [Fragaria x ananassa]
 gb|AAF01250.1| annexin [Fragaria x ananassa]
Length=314

 Score =   377 bits (968),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 195/332 (59%), Positives = 238/332 (72%), Gaps = 18/332 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATLV P +     DAEA+  + KGWGT+EK +I I+GHRN  QRK I+ AY   YQEDL
Sbjct  1     MATLVSPPNFCAKEDAEALRKSVKGWGTNEKAIISILGHRNAGQRKEIRAAYEQLYQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             ++  E ELSG  EKAVYR  LDP DRDAVL NVAI+K     Y VIIE +CI+ PEE L 
Sbjct  61    LKPLESELSGDFEKAVYRWTLDPADRDAVLANVAIKKS-TDVYNVIIEISCIHSPEELLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V+RAYQ RYK S EEDLA ++T D RKLLVALV  YRY G E++AKLA +E+ ILH+AIK
Sbjct  120   VRRAYQLRYKHSVEEDLAAHTTGDIRKLLVALVTAYRYDGHEINAKLANSEADILHDAIK  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K +NHEEI+RILSTRSK QL+ATFN+Y+D+ G +I+K                 +L E+
Sbjct  180   DKAFNHEEIIRILSTRSKTQLMATFNKYRDDQGISISK-----------------NLLEE  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               N +  AL + IR + DP KY+EK++R A+ + G DED LTRVIVTRAERDLR IKEVY
Sbjct  223   GANDFQKALHTAIRCLNDPKKYFEKVLRNAIKRVGTDEDALTRVIVTRAERDLRDIKEVY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              K+NSV LEQAVAK+TSG Y+A LL LLGK++
Sbjct  283   YKKNSVPLEQAVAKDTSGDYKAFLLTLLGKED  314



>gb|KGN52305.1| hypothetical protein Csa_5G623690 [Cucumis sativus]
Length=318

 Score =   377 bits (968),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 192/333 (58%), Positives = 245/333 (74%), Gaps = 19/333 (6%)
 Frame = -3

Query  1166  MATLVFP-DHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATL+ P D P P  DAEAI  A +GWGT EK ++ ++G+RN  QR+ I+ AY   ++ED
Sbjct  1     MATLLVPHDVPPPNVDAEAIKAAFRGWGTDEKAIVAVLGYRNAPQRRQIRIAYEQLFEED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++RFE ELSG LE+AVYR +LDPEDRDAVL +VA+RK    D+ V++E +CIY PEEFL
Sbjct  61    LVKRFESELSGHLERAVYRWILDPEDRDAVLAHVALRKPN-EDFAVLVEFSCIYSPEEFL  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
             GV+RAYQ RYKRS EED+A N+  DFRKLLV LV  YRY+G E+DAKLA++E+ IL  A+
Sbjct  120   GVRRAYQHRYKRSLEEDVAANTHDDFRKLLVGLVSAYRYNGGEIDAKLAKSEAEILERAV  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
             K K +NHE+++RIL+TRSKAQLIATFN YKD +G +I+K                Q  ++
Sbjct  180   KDKAFNHEDVIRILTTRSKAQLIATFNHYKDANGISISK----------------QLGQD  223

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTG-ADEDDLTRVIVTRAERDLRGIKE  273
                N++  AL++ IR + DP KYYEK++R A+ K G +DED LTRV+VTRAE+DLR IKE
Sbjct  224   RDANEFTEALKTVIRCINDPVKYYEKVVRNAIKKVGKSDEDALTRVVVTRAEKDLRQIKE  283

Query  272   VYQKRNSVTLEQAVAKETSGHYEALLLALLGKQ  174
              Y KRNSVTL+ AV KETSG YE  +LALLG Q
Sbjct  284   AYHKRNSVTLDDAVKKETSGDYERFILALLGNQ  316



>ref|XP_007218705.1| hypothetical protein PRUPE_ppa008912mg [Prunus persica]
 gb|EMJ19904.1| hypothetical protein PRUPE_ppa008912mg [Prunus persica]
Length=314

 Score =   377 bits (968),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 193/332 (58%), Positives = 239/332 (72%), Gaps = 18/332 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATLV PDH SP  DAEA++ ACKGWGT EK VI I+ HRN  QR  I+ AY   Y EDL
Sbjct  1     MATLVAPDHFSPNEDAEALHKACKGWGTDEKAVISILSHRNAAQRYEIRLAYEGLYHEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I+R E ELSG  EKAVYR +LDP DR AVL +VAI+K    DY VI+E +    PEE L 
Sbjct  61    IKRLESELSGDFEKAVYRWILDPTDRYAVLAHVAIKKPET-DYNVIVEISSTLSPEELLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V+RAYQ RYK S EEDLA ++T D RKLLVALV  YRY G E++AK+A++E+ ILH+AIK
Sbjct  120   VRRAYQLRYKHSLEEDLAAHTTGDIRKLLVALVTTYRYDGGEINAKVAKSEADILHDAIK  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K +NHEE++RILSTRSK QL+ATFNRY+D+HG +I+K                 +L +D
Sbjct  180   DKAFNHEEVIRILSTRSKTQLMATFNRYRDDHGISISK-----------------NLLDD  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               + +  AL   IR + DP KY+EK++R+A+ + G DED LTRVIVTRAERDL+ IKE+Y
Sbjct  223   GADDFQKALHVVIRCLNDPKKYFEKVLRQAIKRAGTDEDALTRVIVTRAERDLKDIKELY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              K+NSV LE AVAKETSG Y+A L+ LLG+Q+
Sbjct  283   YKKNSVHLEHAVAKETSGDYKAFLVTLLGQQD  314



>ref|XP_008245414.1| PREDICTED: annexin-like protein RJ4 isoform X2 [Prunus mume]
Length=314

 Score =   377 bits (968),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 191/332 (58%), Positives = 240/332 (72%), Gaps = 18/332 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATL+ P H SP  DAEA++ ACKGWGT EK VI I+ HRN  QR  I+ AY   Y+EDL
Sbjct  1     MATLIAPGHFSPNEDAEALHKACKGWGTDEKAVISILAHRNAAQRYEIRLAYEGLYREDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I+R E ELSG  EKAVYR +LDP DR AVL +VAI+K    DY VI+E +C   PEE L 
Sbjct  61    IKRLESELSGDFEKAVYRWILDPTDRYAVLAHVAIKKSET-DYNVIVEISCTLSPEELLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V+RAYQ RYK S EEDLA ++T D RKLLVALV  YRY G E++AK+A++E+ ILH+AIK
Sbjct  120   VRRAYQLRYKHSLEEDLAAHTTGDIRKLLVALVTTYRYDGGEINAKVAKSEADILHDAIK  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K +NHEE++RILSTRSK QL+ATFNRY+D+HG +I+K                 +L +D
Sbjct  180   DKAFNHEEVIRILSTRSKTQLMATFNRYRDDHGISISK-----------------NLLDD  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               + +  AL   IR + DP KY+EK++R+A+ + G DED LTRVIVTRAERDL+ IKE+Y
Sbjct  223   GADDFQKALHVVIRCLNDPKKYFEKVLRQAIKRAGTDEDALTRVIVTRAERDLKDIKELY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              K+NSV LE AVAKETSG Y+A L+ LLG+++
Sbjct  283   YKKNSVHLEHAVAKETSGDYKAFLVTLLGQED  314



>ref|XP_010273218.1| PREDICTED: annexin-like protein RJ4 [Nelumbo nucifera]
Length=315

 Score =   376 bits (965),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 187/332 (56%), Positives = 237/332 (71%), Gaps = 18/332 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATLV PDHPSPV DAE++  AC+GWGT EK +I I+GHRN  QR  I++AY + YQE+L
Sbjct  1     MATLVVPDHPSPVQDAESLRKACQGWGTDEKAIIQILGHRNAVQRNQIRKAYEELYQENL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I+R E ELSG  EKAVYR +LDP +RDAVL +VA+ K  + DY+ IIE AC+   EE L 
Sbjct  61    IKRLESELSGDFEKAVYRWLLDPAERDAVLAHVAV-KDSMLDYQTIIEIACVRSSEELLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             VKRAY  RYK S +ED+A ++T DFRKLLVALV  +RY G E++  LA++E+ +LH  IK
Sbjct  120   VKRAYHLRYKHSLDEDVASHTTGDFRKLLVALVSTFRYDGDEINVSLAESEAKLLHEVIK  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K ++HEEI+RILSTRSK+QL ATFN Y+D HGT+ITK                  L +D
Sbjct  180   GKAFSHEEIIRILSTRSKSQLNATFNCYRDAHGTSITKS-----------------LLDD  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               +++L ALR  IR +  P KY+EK++R A+ K   DED LTRVIVTRAE+DL  IKE+Y
Sbjct  223   PADEFLAALRMAIRCITFPQKYFEKVLRNAVNKGRTDEDALTRVIVTRAEKDLNDIKELY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              KRN+ +LE A+ K TSG Y+A LLALLG +E
Sbjct  283   HKRNNASLEHAINKHTSGDYKAFLLALLGDKE  314



>ref|XP_008346978.1| PREDICTED: annexin-like protein RJ4 [Malus domestica]
Length=314

 Score =   374 bits (961),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 190/332 (57%), Positives = 238/332 (72%), Gaps = 18/332 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATL+ P++ SPV DAE +  + KGWGT EK +  I+GHRN  QRK I+ AY   YQEDL
Sbjct  1     MATLIAPENFSPVDDAEVLRKSXKGWGTDEKAIJSILGHRNAAQRKQIRLAYEQSYQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             ++R E ELSG  EKAVYR +LDP DRDAVL +VAI+K    +Y VIIE A I  PEE L 
Sbjct  61    LKRLESELSGDFEKAVYRWILDPADRDAVLAHVAIKKSEC-NYNVIIEIATILSPEELLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V++AYQ RYK S EEDLA ++T D RKLLVALV  YRY GSE++AKLA +E+ I+H+AIK
Sbjct  120   VRKAYQVRYKHSLEEDLAAHTTGDVRKLLVALVTAYRYDGSEINAKLANSEADIIHDAIK  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K +NH+E++RILSTRSK QL+ATFNRY+D+HGT+I+K                  L E+
Sbjct  180   DKAFNHDEVIRILSTRSKTQLMATFNRYRDDHGTSISKS-----------------LLEE  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               +    AL   IR + DP KY+EK++R A+ + G DED LTRVIVTR+ERDL+ IKEVY
Sbjct  223   GXDGLQKALHVAIRCLNDPKKYFEKVLRNAIKRVGTDEDALTRVIVTRSERDLKDIKEVY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              K+NSV L+ AVAKETSG Y+  LL LLGK++
Sbjct  283   YKKNSVPLDHAVAKETSGDYKDFLLTLLGKED  314



>ref|XP_008375302.1| PREDICTED: annexin-like protein RJ4 isoform X2 [Malus domestica]
Length=314

 Score =   374 bits (960),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 190/332 (57%), Positives = 238/332 (72%), Gaps = 18/332 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATL+ P++ SPV DAE +  + KGWGT EK +  I+GHRN  QRK I+ AY   YQEDL
Sbjct  1     MATLIAPENFSPVDDAEVLRKSXKGWGTDEKAIJSILGHRNAAQRKQIRLAYEQSYQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             ++R E ELSG  EKAVYR +LDP DRDAVL +VAI+K    +Y VIIE A I  PEE L 
Sbjct  61    LKRLESELSGDFEKAVYRWILDPADRDAVLAHVAIKKSEC-NYNVIIEIATILSPEELLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V++AYQ RYK S EEDLA ++T D RKLLVALV  YRY GSE++AKLA +E+ I+H+AIK
Sbjct  120   VRKAYQVRYKHSLEEDLAAHTTGDVRKLLVALVTAYRYDGSEINAKLANSEADIIHDAIK  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K +NH+E++RILSTRSK QL+ATFNRY+D+HGT+I+K                  L E+
Sbjct  180   DKAFNHDEVIRILSTRSKTQLMATFNRYRDDHGTSISKS-----------------LLEE  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               +    AL   IR + DP KY+EK++R A+ + G DED LTRVIVTR+ERDL+ IKEVY
Sbjct  223   GCDGLQKALHVAIRCLNDPKKYFEKVLRNAIKRVGTDEDALTRVIVTRSERDLKDIKEVY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              K+NSV L+ AVAKETSG Y+  LL LLGK++
Sbjct  283   YKKNSVPLDHAVAKETSGDYKDFLLTLLGKED  314



>ref|NP_001289780.1| uncharacterized protein LOC104590190 [Nelumbo nucifera]
 gb|AEK21246.1| annexin [Nelumbo nucifera]
Length=315

 Score =   374 bits (960),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 186/332 (56%), Positives = 230/332 (69%), Gaps = 18/332 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MAT+  PDH SPV DAE +  AC+GWGT+E T++ I+GHRN  QRK I+QAY + YQEDL
Sbjct  1     MATITVPDHTSPVEDAENLRKACEGWGTNENTIVSILGHRNAVQRKQIRQAYEEIYQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I+R E EL G  EKAVYR +LDP DRDA+L +VA R     D R IIE ACI  PEE L 
Sbjct  61    IKRLESELKGEFEKAVYRWILDPADRDAILAHVAARNAK-SDNRTIIEIACIRSPEELLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
              KRAY  RYK S EED+A  +T DFRKLLVALV  YRY G EVD  LA +E+ ILHN I+
Sbjct  120   AKRAYHFRYKHSLEEDVASRTTGDFRKLLVALVSTYRYDGDEVDVSLAGSEAKILHNMIE  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K +NHEE++RILSTRSKAQL ATFNRYKD HG +ITK                  L  +
Sbjct  180   GKSFNHEEVIRILSTRSKAQLNATFNRYKDTHGASITKS-----------------LSGN  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               +++  AL   I+ +  P KY+EK++R A+ K G DED +TRVIVTRAE+DL+ IK++Y
Sbjct  223   PADEFSEALCIAIQCIRSPQKYFEKVLRNAINKVGTDEDAITRVIVTRAEKDLKDIKDLY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              KRN+ +LE A++K+TSG Y+  LL LLG +E
Sbjct  283   HKRNNASLEHAISKDTSGDYKIFLLTLLGCEE  314



>ref|XP_009361986.1| PREDICTED: annexin-like protein RJ4 [Pyrus x bretschneideri]
Length=314

 Score =   372 bits (956),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 189/332 (57%), Positives = 238/332 (72%), Gaps = 18/332 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATL+  ++ SPV DAE +  + KGWGT EK +I I+GHRN  QRK I+ AY   YQEDL
Sbjct  1     MATLIALENFSPVDDAEVLRKSVKGWGTDEKAIISILGHRNAAQRKQIRLAYEQSYQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             ++R E ELSG  EKA+YR +LDP DRDAVL +VAI+K    +Y VIIE A I  PEE L 
Sbjct  61    LKRLESELSGDFEKAMYRWILDPADRDAVLAHVAIKKSEC-NYNVIIENATILSPEELLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V++AYQ RYK S EEDLA ++T D RKLLVALV  YRY G E++AKLA +E+ ILH+AIK
Sbjct  120   VRKAYQVRYKHSLEEDLAAHTTGDIRKLLVALVTAYRYDGCEINAKLANSEADILHDAIK  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K +NH+E++RILSTRSK QL+ATFNRY+D+HGT+I+K                  L E+
Sbjct  180   DKAFNHDEVIRILSTRSKTQLMATFNRYRDDHGTSISKS-----------------LLEE  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
              G+    AL   IR + DP KY+EK++R A+ + G DED LTRVIVTRAERDL+ IKEVY
Sbjct  223   GGDGLQKALHVAIRCLNDPKKYFEKVLRNAIKRVGTDEDALTRVIVTRAERDLKDIKEVY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              K+N+V+L+  VAKETSG Y+  LL LLGK++
Sbjct  283   YKKNNVSLDHTVAKETSGDYKDFLLTLLGKED  314



>ref|XP_008446932.1| PREDICTED: annexin-like protein RJ4 [Cucumis melo]
Length=318

 Score =   373 bits (957),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 189/333 (57%), Positives = 244/333 (73%), Gaps = 19/333 (6%)
 Frame = -3

Query  1166  MATLVFP-DHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATL+ P D P P  DAEAI  A +GWGT EK ++ ++G+RN  QR+ I+ AY   ++ED
Sbjct  1     MATLLVPHDVPPPNVDAEAIKAAFRGWGTDEKAIVAVLGYRNAPQRRQIRIAYEQLFEED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++RFE ELSG LE+AVYR +LDPEDRDAVL +VA+RK    D+ V++E +CIY PEEFL
Sbjct  61    LVKRFESELSGHLERAVYRWILDPEDRDAVLAHVALRKPN-EDFAVLVEFSCIYSPEEFL  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              V+RAYQ RYKRS EED+A N+  DFRKLLV LV  YRY+G E+DA+LA++E+ IL  A+
Sbjct  120   AVRRAYQHRYKRSLEEDVAANTHDDFRKLLVGLVSAYRYNGGEIDARLAKSEAEILERAV  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
             K K +NHE+++RIL+TRSKAQLIATFN YKD +G +I+K                Q  ++
Sbjct  180   KDKAFNHEDVIRILTTRSKAQLIATFNHYKDANGISISK----------------QLGQD  223

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTG-ADEDDLTRVIVTRAERDLRGIKE  273
                N++  AL++ IR + DP KYYEK++R A+ K G +DED LTRV+VTRAE+DLR IKE
Sbjct  224   RAANEFTEALKTVIRCINDPVKYYEKVVRNAIKKVGKSDEDALTRVVVTRAEKDLRQIKE  283

Query  272   VYQKRNSVTLEQAVAKETSGHYEALLLALLGKQ  174
              Y KRNSVTL+ AV KETSG Y+  +LALLG Q
Sbjct  284   AYHKRNSVTLDDAVKKETSGDYKHFILALLGNQ  316



>ref|XP_002513080.1| annexin, putative [Ricinus communis]
 gb|EEF49583.1| annexin, putative [Ricinus communis]
Length=314

 Score =   372 bits (955),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 189/332 (57%), Positives = 239/332 (72%), Gaps = 18/332 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MA+LV P     V DAE +Y A KGWGT+EK VI ++GHRN  QRK I+QAY D YQE+L
Sbjct  1     MASLVAPGDHDSVQDAETLYKAFKGWGTNEKAVISVLGHRNAAQRKQIRQAYWDLYQEEL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             ++R E EL+G  E+AVYR +LDPEDRDAVL NVA+RK G  DY VIIE AC+   EE L 
Sbjct  61    VKRLESELTGDFERAVYRWILDPEDRDAVLANVALRKSG--DYHVIIEIACVRSAEELLT  118

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V+RAYQARYK S EED+A ++T D RKLLV LV  +RY G+E++ +LA++E+ IL +AIK
Sbjct  119   VRRAYQARYKHSLEEDVAAHTTGDVRKLLVGLVTAFRYEGAEINTRLAKSEADILQDAIK  178

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K +NH+E++RIL+TRSK QL+ATFN +KD+ GT+ITK                  L E 
Sbjct  179   DKAFNHDEVIRILTTRSKTQLMATFNTFKDDQGTSITK----------------MLLGES  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               N++ T LR  IR + +P KYYEK++R A+ K G DED LTRVIVTRAE+DL  IK++Y
Sbjct  223   ADNEFKTLLRIAIRCINEPLKYYEKVLRNAIRKVGTDEDALTRVIVTRAEKDLLDIKDLY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              KRNSV L+ AVA ETSG Y+  LLALLGK++
Sbjct  283   YKRNSVALDHAVANETSGDYKHFLLALLGKED  314



>ref|NP_001240999.1| uncharacterized protein LOC100794511 [Glycine max]
 gb|ACU17717.1| unknown [Glycine max]
Length=314

 Score =   372 bits (955),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 191/332 (58%), Positives = 234/332 (70%), Gaps = 18/332 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATLV P+  SPV D EA++ A KGWGT EKTVI I+GHRN  QR+ I++ Y + YQEDL
Sbjct  1     MATLVAPNQKSPVEDVEALHKAFKGWGTDEKTVIAILGHRNVHQRQQIRKIYEEIYQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I+R E ELSG  E+AVYR ML+P DRDAVL NVAI K G   Y VI+E AC+   EE L 
Sbjct  61    IKRLESELSGDFERAVYRWMLEPADRDAVLANVAI-KNGSKGYHVIVEIACVLSAEEVLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             VKRAY  RYKRS EED+A N+T D R+LLV LV  YRY G E++AKLA+TE+ ILH +IK
Sbjct  120   VKRAYHNRYKRSLEEDVATNTTGDIRQLLVGLVTAYRYGGDEINAKLAKTEADILHESIK  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
             +K+ NHEE +RIL+TRSK QL+ATFNRY+D+HG +ITK                  L ++
Sbjct  180   EKKGNHEEAIRILTTRSKTQLLATFNRYRDDHGASITKK-----------------LLDN  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
                 +  AL + IR + D  KYYEK++R AL   G DED LTRV+V+RAE+DLR IKE Y
Sbjct  223   ASTDFQKALHTAIRCINDHKKYYEKVLRNALKNVGTDEDALTRVVVSRAEKDLRDIKERY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              KRNSV LE AVAKE SG Y+  +L LLGK++
Sbjct  283   YKRNSVHLEDAVAKEISGDYKKFILTLLGKED  314



>ref|XP_003542834.1| PREDICTED: annexin-like protein RJ4-like isoform 2 [Glycine max]
Length=314

 Score =   372 bits (954),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 190/332 (57%), Positives = 235/332 (71%), Gaps = 18/332 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATLV P+  SPV D EA++ A KGWGT EKTVI I+GHRN  QR+ I++ Y + YQEDL
Sbjct  1     MATLVAPNQKSPVEDVEALHKAFKGWGTDEKTVIAILGHRNVHQRQQIRKVYEEIYQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I+R E ELSG  E+AVYR ML+P DRDAVL NVAI K G   Y VI+E AC+   +E L 
Sbjct  61    IKRLESELSGDFERAVYRWMLEPADRDAVLANVAI-KNGSKGYHVIVEIACVLSADEVLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             VKRAY  RYKRS EED+A N+T D R+LLV LV  YRY G EV+AKLA+TE+ ILH +IK
Sbjct  120   VKRAYHNRYKRSLEEDVATNTTGDIRQLLVGLVTAYRYDGDEVNAKLAKTEADILHESIK  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
             +K+ NHEE +RIL+TRSK QL+ATFNRY+D+HG +ITK                  L ++
Sbjct  180   EKKGNHEEAIRILTTRSKTQLLATFNRYRDDHGASITKK-----------------LLDN  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
                 +  AL + IR + D  KYYEK++R A+   G DED LTRV+V+RAE+DLR IKE+Y
Sbjct  223   ASTDFQKALHTAIRCINDHKKYYEKVLRNAIKGVGTDEDALTRVVVSRAEKDLRDIKELY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              KRNSV LE AVAKE SG Y+  +L LLGK++
Sbjct  283   YKRNSVHLEDAVAKEISGDYKKFILTLLGKED  314



>ref|XP_009354449.1| PREDICTED: annexin-like protein RJ4 isoform X2 [Pyrus x bretschneideri]
Length=313

 Score =   370 bits (950),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 190/331 (57%), Positives = 233/331 (70%), Gaps = 18/331 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATL  PDH S   DAEA+  ACKGWGT EK +I I+GHRN  QRK I+ AY   YQEDL
Sbjct  1     MATLTVPDHFSSNEDAEALRKACKGWGTDEKAIISILGHRNAAQRKQIRLAYEQSYQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             ++R E ELSG  EKAVYR +LDP DRDAVL +VAI+K G  +Y VIIE A I  PE+   
Sbjct  61    LKRLESELSGDFEKAVYRWILDPADRDAVLAHVAIKKSGC-NYNVIIEIATILSPEDLFA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V++AYQ RYK S EEDLA ++T D RKLLVALV  YRY G E++AKLA++E+ ILH+AIK
Sbjct  120   VRKAYQVRYKHSLEEDLAAHTTGDIRKLLVALVTAYRYDGGEINAKLAKSEADILHDAIK  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K +NH+EI+RILSTRSK QL+ATFN Y+D+H  +I+K                  L E+
Sbjct  180   DKAFNHDEIIRILSTRSKTQLMATFNHYRDDHKISISKT-----------------LLEE  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               + +  AL   IR + D  KY+EK++R A+ + G DED L RVIVTRAERDL+ IKEVY
Sbjct  223   GADDFQKALHVVIRCLNDHKKYFEKVLRNAIRRLGTDEDALIRVIVTRAERDLKDIKEVY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQ  174
              K+NSV LE AVAK+TSG Y+  LL LLGK+
Sbjct  283   YKKNSVPLEHAVAKDTSGDYKDFLLTLLGKE  313



>ref|XP_007011126.1| Annexin-like protein RJ4 isoform 3 [Theobroma cacao]
 gb|EOY19936.1| Annexin-like protein RJ4 isoform 3 [Theobroma cacao]
Length=303

 Score =   369 bits (948),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 187/332 (56%), Positives = 236/332 (71%), Gaps = 29/332 (9%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATL+ PDHPS V DAEA+  ACK           ++GHRN  QRK I+ AY + YQEDL
Sbjct  1     MATLIAPDHPSAVEDAEALQKACK-----------VLGHRNAAQRKQIRLAYEELYQEDL  49

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I+R E ELSG  EKAVYR +LDP DRDAVL NVAI+K   PD+ V+IE +C   PEE L 
Sbjct  50    IKRLESELSGDFEKAVYRWVLDPADRDAVLANVAIKKIS-PDHHVVIEISCTRSPEELLA  108

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V+RAYQARYK S EED+A ++  D RKLLVALV  +RY G E++ +LA +E+ ILH+AIK
Sbjct  109   VRRAYQARYKHSLEEDVAAHTKGDIRKLLVALVSAFRYDGEEINTRLANSEANILHDAIK  168

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K +NHEE+VRILSTRSK QL+ATFNRY+D+ GT ITK                  L  +
Sbjct  169   DKAFNHEEVVRILSTRSKMQLMATFNRYRDDQGTTITKK-----------------LLGE  211

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
             +G+++L ALR+ +R   DP KY+EK++R ++   G DED LTRVIVTRAE+DL+ IK++Y
Sbjct  212   SGDEFLVALRTAVRCFNDPKKYFEKVLRNSIKGIGTDEDALTRVIVTRAEKDLKEIKDLY  271

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              KRNS+ LEQ VAK+TSG Y+A LL LLGK++
Sbjct  272   HKRNSMPLEQVVAKDTSGDYKAFLLTLLGKED  303



>ref|XP_002304784.1| annexin-like protein RJ4 [Populus trichocarpa]
 gb|EEE79763.1| annexin-like protein RJ4 [Populus trichocarpa]
Length=301

 Score =   367 bits (943),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 185/332 (56%), Positives = 238/332 (72%), Gaps = 31/332 (9%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATLV P++ S   DA+A+  AC+GWGT+EK +I I+GHRN  QRK I+ AY + +QEDL
Sbjct  1     MATLVVPENVSYADDAQALRKACQGWGTNEKAIISILGHRNAAQRKQIRLAYSELFQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             ++R E EL+G  EKAVYR +LDPEDRDAVL NVAIRK G  DY VI+E AC+   EE L 
Sbjct  61    VKRLESELNGDFEKAVYRWVLDPEDRDAVLANVAIRKSG--DYHVIVEIACVLSSEELLA  118

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V+RAY ARYK S EEDLA ++TA            +RY G E++ +L  +E+ ILH+AIK
Sbjct  119   VRRAYHARYKHSLEEDLAAHTTA------------FRYEGDEINTRLTNSEADILHDAIK  166

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K +NHE+++RIL+TRSKAQL+ATFNRY+D+HG++ITK                 DL ++
Sbjct  167   DKAFNHEDVIRILTTRSKAQLMATFNRYRDDHGSSITK-----------------DLLDE  209

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               +++ T LR+ IR + D  KYYEK++R A+ K G DED LTRVIVTRAE+DL  IKE+Y
Sbjct  210   PADEFKTVLRTAIRCLNDHKKYYEKILRNAIKKVGTDEDALTRVIVTRAEKDLNDIKEIY  269

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              KRNSV L+QAVA +TSG Y+A LLALLGK+E
Sbjct  270   YKRNSVPLDQAVANDTSGDYKAFLLALLGKEE  301



>ref|XP_010032318.1| PREDICTED: annexin-like protein RJ4 isoform X2 [Eucalyptus grandis]
Length=334

 Score =   367 bits (942),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 183/332 (55%), Positives = 245/332 (74%), Gaps = 18/332 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MA+LV  DH S   DAE +  A +G+GT+EK +I ++GHRN  QRK I+QAY   Y+EDL
Sbjct  21    MASLVVADHFSATEDAETLRKAFEGFGTNEKAIIEVLGHRNAAQRKQIRQAYEQLYEEDL  80

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             ++R E EL+   EKAVYR +LDP DRDAVL NVA++K   PDY VIIE +CI  P+E L 
Sbjct  81    VKRLESELTRDFEKAVYRWILDPADRDAVLANVALKKSN-PDYPVIIEISCIRTPDELLE  139

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V++AYQ RYKRS EED+A ++T D RKLLV LV  YRY G E++A+LA +E+ ++H+AIK
Sbjct  140   VRKAYQLRYKRSLEEDVAAHTTGDIRKLLVGLVSAYRYQGEEINARLANSEADLIHDAIK  199

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K ++H+E++RIL+TRSKAQL ATFNRY+++ GT+ITK NL+V                +
Sbjct  200   DKAFSHDEVIRILTTRSKAQLRATFNRYQEDQGTSITK-NLLV----------------E  242

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               ++ L ALR+TIR + DP+KY+ K++   + + G DEDDLTRVIVTRAE+DL+ IKE Y
Sbjct  243   NPDEILVALRTTIRGLNDPNKYFVKVLSNGIKRAGTDEDDLTRVIVTRAEKDLKEIKEEY  302

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              K+NSV+L+QAVAK+T+G Y+A LLALLG +E
Sbjct  303   YKKNSVSLDQAVAKDTTGDYKAFLLALLGNEE  334



>ref|XP_010095951.1| Annexin-like protein [Morus notabilis]
 gb|EXB62644.1| Annexin-like protein [Morus notabilis]
Length=314

 Score =   366 bits (939),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 184/332 (55%), Positives = 238/332 (72%), Gaps = 18/332 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATLV PDH S V DAEA+  AC+GWGT EK +I ++GHRN +QRK I+++Y   ++EDL
Sbjct  1     MATLVAPDHLSVVEDAEALRKACQGWGTDEKAIIKVLGHRNASQRKQIRESYEQLFEEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             ++R E ELSG  EKAVYR +L+PEDRDAVL NVA+RK    D++ IIE +CI  PEE LG
Sbjct  61    VKRLESELSGDFEKAVYRWVLEPEDRDAVLANVALRKSET-DFKAIIELSCILSPEELLG  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             VKRAYQ R K S EED+A  +T D +K  ++    YRY+G EV+A+LA +E+ ILH AIK
Sbjct  120   VKRAYQNRNKHSLEEDVAARTTGDLQKACISYTFTYRYNGEEVNARLASSEADILHEAIK  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K +N+EE++RILSTRSKAQL ATFN Y+D + T+ITK                 DL  +
Sbjct  180   DKAFNNEEVIRILSTRSKAQLNATFNHYRDVNKTSITK-----------------DLLGE  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
             + N +  AL +T+R   DP KYY KL+   + + G DED +TRVIVTRAE+DL+ IKEVY
Sbjct  223   SANDFQKALHTTVRCTNDPLKYYAKLLCDGIKRFGTDEDSVTRVIVTRAEKDLKDIKEVY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              K+NS++L+ AVAKETSG Y+A LLALLGK++
Sbjct  283   YKKNSISLDDAVAKETSGDYKAFLLALLGKED  314



>ref|XP_010670447.1| PREDICTED: annexin-like protein RJ4 [Beta vulgaris subsp. vulgaris]
Length=313

 Score =   366 bits (939),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 190/331 (57%), Positives = 233/331 (70%), Gaps = 20/331 (6%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATL+ PDH  P ADAEA++ ACKGWGT+EK +I +IGHRN  QRK IK+AY   + E+L
Sbjct  1     MATLIAPDHADPFADAEALHKACKGWGTNEKGIIEVIGHRNAGQRKFIKEAYEQNFNENL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             IRRFEKELSG  E+AVYR MLDP DR+AVL NVA++K    DY+VIIE +CI   EE L 
Sbjct  61    IRRFEKELSGDFERAVYRWMLDPLDREAVLANVALKKS---DYKVIIELSCIPSTEELLA  117

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             +KRAYQARYK S EED+A + + D RKLL+ LV VYRY     + KL +TE+ ILH  IK
Sbjct  118   IKRAYQARYKHSLEEDIASHFSGDMRKLLLLLVSVYRYETEVTEPKLVETEAEILHKCIK  177

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K YNH+EIVRIL+TRSKA L ATF R++D + T ITK             F   D  +D
Sbjct  178   DKAYNHDEIVRILTTRSKAHLTATFYRFRDVYSTPITK-------------FLASDQDKD  224

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
                 +++AL++ IR +  P KY E+++  A+ K G DED LTRVIVTRAE+DL  IKE++
Sbjct  225   ----FVSALQTAIRCIKSPLKYLERVLSDAIKKRGTDEDALTRVIVTRAEKDLGEIKELF  280

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQ  174
              KRNSVTLE AVAKET G YE  LL LLGK+
Sbjct  281   YKRNSVTLEHAVAKETRGDYENFLLTLLGKE  311



>ref|XP_010032317.1| PREDICTED: annexin-like protein RJ4 isoform X1 [Eucalyptus grandis]
Length=348

 Score =   367 bits (941),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 183/332 (55%), Positives = 245/332 (74%), Gaps = 18/332 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MA+LV  DH S   DAE +  A +G+GT+EK +I ++GHRN  QRK I+QAY   Y+EDL
Sbjct  35    MASLVVADHFSATEDAETLRKAFEGFGTNEKAIIEVLGHRNAAQRKQIRQAYEQLYEEDL  94

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             ++R E EL+   EKAVYR +LDP DRDAVL NVA++K   PDY VIIE +CI  P+E L 
Sbjct  95    VKRLESELTRDFEKAVYRWILDPADRDAVLANVALKKSN-PDYPVIIEISCIRTPDELLE  153

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V++AYQ RYKRS EED+A ++T D RKLLV LV  YRY G E++A+LA +E+ ++H+AIK
Sbjct  154   VRKAYQLRYKRSLEEDVAAHTTGDIRKLLVGLVSAYRYQGEEINARLANSEADLIHDAIK  213

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K ++H+E++RIL+TRSKAQL ATFNRY+++ GT+ITK NL+V                +
Sbjct  214   DKAFSHDEVIRILTTRSKAQLRATFNRYQEDQGTSITK-NLLV----------------E  256

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               ++ L ALR+TIR + DP+KY+ K++   + + G DEDDLTRVIVTRAE+DL+ IKE Y
Sbjct  257   NPDEILVALRTTIRGLNDPNKYFVKVLSNGIKRAGTDEDDLTRVIVTRAEKDLKEIKEEY  316

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              K+NSV+L+QAVAK+T+G Y+A LLALLG +E
Sbjct  317   YKKNSVSLDQAVAKDTTGDYKAFLLALLGNEE  348



>ref|XP_008245413.1| PREDICTED: annexin-like protein RJ4 isoform X1 [Prunus mume]
Length=314

 Score =   365 bits (936),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 186/332 (56%), Positives = 237/332 (71%), Gaps = 18/332 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATL+  ++ SP  DAE +  + KGWGT EK VI I+ HRN  QR  I+ AY   Y+EDL
Sbjct  1     MATLIASENFSPTEDAEVLRRSVKGWGTDEKAVISILAHRNAAQRYEIRLAYEGLYREDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I+R E ELSG  EKAVYR +LDP DR AVL +VAI+K    DY VI+E +C   PEE L 
Sbjct  61    IKRLESELSGDFEKAVYRWILDPTDRYAVLAHVAIKKSET-DYNVIVEISCTLSPEELLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V+RAYQ RYK S EEDLA ++T D RKLLVALV  YRY G E++AK+A++E+ ILH+AIK
Sbjct  120   VRRAYQLRYKHSLEEDLAAHTTGDIRKLLVALVTTYRYDGGEINAKVAKSEADILHDAIK  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K +NHEE++RILSTRSK QL+ATFNRY+D+HG +I+K                 +L +D
Sbjct  180   DKAFNHEEVIRILSTRSKTQLMATFNRYRDDHGISISK-----------------NLLDD  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               + +  AL   IR + DP KY+EK++R+A+ + G DED LTRVIVTRAERDL+ IKE+Y
Sbjct  223   GADDFQKALHVVIRCLNDPKKYFEKVLRQAIKRAGTDEDALTRVIVTRAERDLKDIKELY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              K+NSV LE AVAKETSG Y+A L+ LLG+++
Sbjct  283   YKKNSVHLEHAVAKETSGDYKAFLVTLLGQED  314



>ref|XP_008348392.1| PREDICTED: annexin-like protein RJ4 isoform X2 [Malus domestica]
Length=313

 Score =   364 bits (935),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 188/331 (57%), Positives = 229/331 (69%), Gaps = 18/331 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATL  PDH S   DAEA+  ACKGWGT EK +I I+GHRN  QRK I+  Y   YQEDL
Sbjct  1     MATLTVPDHFSSNEDAEALRKACKGWGTDEKAIISILGHRNAAQRKQIRLXYEQSYQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             ++R E ELSG  EKAVYR +LDP DRDAVL +VAI+K G  +Y VIIE   I  PEE   
Sbjct  61    LKRLESELSGDFEKAVYRWILDPADRDAVLAHVAIKKSGC-NYNVIIEIXTILSPEELFA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V++AYQ RYK S EEDLA ++T D RKLLVALV  YRY G E++AKLA++E+ ILH+AIK
Sbjct  120   VRKAYQVRYKHSLEEDLAAHTTGDIRKLLVALVTAYRYDGGEINAKLAKSEADILHDAIK  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K +NH+EI+RILSTRSK QL+ATFN Y+D+H  +I+K                  L E+
Sbjct  180   DKAFNHDEIIRILSTRSKTQLMATFNHYRDDHKISISKT-----------------LLEE  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               +    AL   IR + D  KY+EK++R  + + G DED LTRVIV RAERDL+ IKEVY
Sbjct  223   GADDLQKALHVVIRCLNDHKKYFEKVLRNGIRRLGTDEDALTRVIVXRAERDLKDIKEVY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQ  174
              K+NSV LE AVAK+TSG Y+  LL LLGK+
Sbjct  283   YKKNSVPLEHAVAKDTSGDYKDFLLTLLGKE  313



>ref|XP_006597033.1| PREDICTED: uncharacterized protein LOC100794511 isoform X1 [Glycine 
max]
 gb|KHN25115.1| Annexin-like protein RJ4 [Glycine soja]
Length=314

 Score =   363 bits (931),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 189/332 (57%), Positives = 232/332 (70%), Gaps = 18/332 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATL+ P   SP  DAEA+  A +GWGT EKTVI I+GHRN  QR+ I++ Y + YQEDL
Sbjct  1     MATLIAPITFSPGLDAEALRKAFQGWGTDEKTVIAILGHRNVHQRQQIRKIYEEIYQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I+R E ELSG  E+AVYR ML+P DRDAVL NVAI K G   Y VI+E AC+   EE L 
Sbjct  61    IKRLESELSGDFERAVYRWMLEPADRDAVLANVAI-KNGSKGYHVIVEIACVLSAEEVLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             VKRAY  RYKRS EED+A N+T D R+LLV LV  YRY G E++AKLA+TE+ ILH +IK
Sbjct  120   VKRAYHNRYKRSLEEDVATNTTGDIRQLLVGLVTAYRYGGDEINAKLAKTEADILHESIK  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
             +K+ NHEE +RIL+TRSK QL+ATFNRY+D+HG +ITK                  L ++
Sbjct  180   EKKGNHEEAIRILTTRSKTQLLATFNRYRDDHGASITKK-----------------LLDN  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
                 +  AL + IR + D  KYYEK++R AL   G DED LTRV+V+RAE+DLR IKE Y
Sbjct  223   ASTDFQKALHTAIRCINDHKKYYEKVLRNALKNVGTDEDALTRVVVSRAEKDLRDIKERY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              KRNSV LE AVAKE SG Y+  +L LLGK++
Sbjct  283   YKRNSVHLEDAVAKEISGDYKKFILTLLGKED  314



>ref|XP_003542833.1| PREDICTED: annexin-like protein RJ4-like isoform 1 [Glycine max]
Length=314

 Score =   363 bits (931),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 188/332 (57%), Positives = 233/332 (70%), Gaps = 18/332 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATL+ P   SP  DAEA+  A +GWGT EKTVI I+GHRN  QR+ I++ Y + YQEDL
Sbjct  1     MATLIAPITFSPGLDAEALRKAFQGWGTDEKTVIAILGHRNVHQRQQIRKVYEEIYQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I+R E ELSG  E+AVYR ML+P DRDAVL NVAI K G   Y VI+E AC+   +E L 
Sbjct  61    IKRLESELSGDFERAVYRWMLEPADRDAVLANVAI-KNGSKGYHVIVEIACVLSADEVLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             VKRAY  RYKRS EED+A N+T D R+LLV LV  YRY G EV+AKLA+TE+ ILH +IK
Sbjct  120   VKRAYHNRYKRSLEEDVATNTTGDIRQLLVGLVTAYRYDGDEVNAKLAKTEADILHESIK  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
             +K+ NHEE +RIL+TRSK QL+ATFNRY+D+HG +ITK                  L ++
Sbjct  180   EKKGNHEEAIRILTTRSKTQLLATFNRYRDDHGASITKK-----------------LLDN  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
                 +  AL + IR + D  KYYEK++R A+   G DED LTRV+V+RAE+DLR IKE+Y
Sbjct  223   ASTDFQKALHTAIRCINDHKKYYEKVLRNAIKGVGTDEDALTRVVVSRAEKDLRDIKELY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              KRNSV LE AVAKE SG Y+  +L LLGK++
Sbjct  283   YKRNSVHLEDAVAKEISGDYKKFILTLLGKED  314



>ref|XP_004142392.1| PREDICTED: annexin A6-like [Cucumis sativus]
 ref|XP_004157511.1| PREDICTED: annexin A6-like [Cucumis sativus]
Length=629

 Score =   374 bits (959),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 190/331 (57%), Positives = 243/331 (73%), Gaps = 19/331 (6%)
 Frame = -3

Query  1166  MATLVFP-DHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATL+ P D P P  DAEAI  A +GWGT EK ++ ++G+RN  QR+ I+ AY   ++ED
Sbjct  1     MATLLVPHDVPPPNVDAEAIKAAFRGWGTDEKAIVAVLGYRNAPQRRQIRIAYEQLFEED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++RFE ELSG LE+AVYR +LDPEDRDAVL +VA+RK    D+ V++E +CIY PEEFL
Sbjct  61    LVKRFESELSGHLERAVYRWILDPEDRDAVLAHVALRKPN-EDFAVLVEFSCIYSPEEFL  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
             GV+RAYQ RYKRS EED+A N+  DFRKLLV LV  YRY+G E+DAKLA++E+ IL  A+
Sbjct  120   GVRRAYQHRYKRSLEEDVAANTHDDFRKLLVGLVSAYRYNGGEIDAKLAKSEAEILERAV  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
             K K +NHE+++RIL+TRSKAQLIATFN YKD +G +I+K                Q  ++
Sbjct  180   KDKAFNHEDVIRILTTRSKAQLIATFNHYKDANGISISK----------------QLGQD  223

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTG-ADEDDLTRVIVTRAERDLRGIKE  273
                N++  AL++ IR + DP KYYEK++R A+ K G +DED LTRV+VTRAE+DLR IKE
Sbjct  224   RDANEFTEALKTVIRCINDPVKYYEKVVRNAIKKVGKSDEDALTRVVVTRAEKDLRQIKE  283

Query  272   VYQKRNSVTLEQAVAKETSGHYEALLLALLG  180
              Y KRNSVTL+ AV KETSG YE  +LALL 
Sbjct  284   AYHKRNSVTLDDAVKKETSGDYERFILALLA  314


 Score =   350 bits (899),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 179/332 (54%), Positives = 235/332 (71%), Gaps = 19/332 (6%)
 Frame = -3

Query  1169  SMATLVFP-DHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQE  993
             +MATL+ P D PS   DAEA+  A KGWG+ EK +I I+ HRN  QR+ I+ AY   +QE
Sbjct  314   AMATLIVPRDVPSANVDAEALRTAFKGWGSDEKAIISILAHRNAIQRRHIRIAYEQLFQE  373

Query  992   DLIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEF  813
             DLI+R E E+SG  E+AVYR MLDPEDRDAVL N+AIRK    D+ V++E +CIY PEE 
Sbjct  374   DLIKRLESEISGHFERAVYRWMLDPEDRDAVLANIAIRKPK-EDFAVLVELSCIYSPEEL  432

Query  812   LGVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNA  633
             LGV+RAYQ RYKRS EED+A ++  D R LLV LV  YRY+G++VD  LA++E+  L  A
Sbjct  433   LGVRRAYQHRYKRSLEEDVAASTNDDLRTLLVGLVSAYRYNGADVDLSLAKSEAERLERA  492

Query  632   IKKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLK  453
             IK K + HE++VRIL+TRS+ QL+ATFN YKD +G +I++                Q   
Sbjct  493   IKDKTFYHEDVVRILTTRSRPQLVATFNHYKDAYGISISE----------------QLSS  536

Query  452   EDTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTG-ADEDDLTRVIVTRAERDLRGIK  276
             +  G ++  ALR+ I  + DP++YYEK++R A+ + G +DED LTRV+V+RAE+DLR IK
Sbjct  537   DKAGKEFTEALRTIIECIDDPYQYYEKVVRNAIKRVGKSDEDALTRVVVSRAEKDLRQIK  596

Query  275   EVYQKRNSVTLEQAVAKETSGHYEALLLALLG  180
             E Y KRNSVTL+ AV+KETSG Y+  +LALLG
Sbjct  597   EAYHKRNSVTLDDAVSKETSGDYKRFILALLG  628



>ref|XP_007218704.1| hypothetical protein PRUPE_ppa008912mg [Prunus persica]
 gb|EMJ19903.1| hypothetical protein PRUPE_ppa008912mg [Prunus persica]
Length=314

 Score =   362 bits (930),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 186/332 (56%), Positives = 236/332 (71%), Gaps = 18/332 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATL+  ++ SP+ DAE +  + KGWGT EK VI I+ HRN  QR  I+ AY   Y EDL
Sbjct  1     MATLIASENFSPIEDAEVLRRSVKGWGTDEKAVISILSHRNAAQRYEIRLAYEGLYHEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I+R E ELSG  EKAVYR +LDP DR AVL +VAI+K    DY VI+E +    PEE L 
Sbjct  61    IKRLESELSGDFEKAVYRWILDPTDRYAVLAHVAIKKPET-DYNVIVEISSTLSPEELLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V+RAYQ RYK S EEDLA ++T D RKLLVALV  YRY G E++AK+A++E+ ILH+AIK
Sbjct  120   VRRAYQLRYKHSLEEDLAAHTTGDIRKLLVALVTTYRYDGGEINAKVAKSEADILHDAIK  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K +NHEE++RILSTRSK QL+ATFNRY+D+HG +I+K                 +L +D
Sbjct  180   DKAFNHEEVIRILSTRSKTQLMATFNRYRDDHGISISK-----------------NLLDD  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               + +  AL   IR + DP KY+EK++R+A+ + G DED LTRVIVTRAERDL+ IKE+Y
Sbjct  223   GADDFQKALHVVIRCLNDPKKYFEKVLRQAIKRAGTDEDALTRVIVTRAERDLKDIKELY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              K+NSV LE AVAKETSG Y+A L+ LLG+Q+
Sbjct  283   YKKNSVHLEHAVAKETSGDYKAFLVTLLGQQD  314



>ref|XP_009354448.1| PREDICTED: annexin-like protein RJ4 isoform X1 [Pyrus x bretschneideri]
Length=313

 Score =   362 bits (929),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 185/331 (56%), Positives = 233/331 (70%), Gaps = 18/331 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATL+  ++ SP+ DAE +  + KGWGT EK +I I+GHRN  QRK I+ AY   YQEDL
Sbjct  1     MATLIASENFSPIEDAEVLRKSVKGWGTDEKAIISILGHRNAAQRKQIRLAYEQSYQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             ++R E ELSG  EKAVYR +LDP DRDAVL +VAI+K G  +Y VIIE A I  PE+   
Sbjct  61    LKRLESELSGDFEKAVYRWILDPADRDAVLAHVAIKKSGC-NYNVIIEIATILSPEDLFA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V++AYQ RYK S EEDLA ++T D RKLLVALV  YRY G E++AKLA++E+ ILH+AIK
Sbjct  120   VRKAYQVRYKHSLEEDLAAHTTGDIRKLLVALVTAYRYDGGEINAKLAKSEADILHDAIK  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K +NH+EI+RILSTRSK QL+ATFN Y+D+H  +I+K                  L E+
Sbjct  180   DKAFNHDEIIRILSTRSKTQLMATFNHYRDDHKISISKT-----------------LLEE  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               + +  AL   IR + D  KY+EK++R A+ + G DED L RVIVTRAERDL+ IKEVY
Sbjct  223   GADDFQKALHVVIRCLNDHKKYFEKVLRNAIRRLGTDEDALIRVIVTRAERDLKDIKEVY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQ  174
              K+NSV LE AVAK+TSG Y+  LL LLGK+
Sbjct  283   YKKNSVPLEHAVAKDTSGDYKDFLLTLLGKE  313



>gb|AFK45151.1| unknown [Medicago truncatula]
Length=314

 Score =   362 bits (929),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 185/332 (56%), Positives = 238/332 (72%), Gaps = 18/332 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATL+ P + SPVADAEA++ A KGWGT EK+VI I+GHRN  QR+ I+++Y + YQED+
Sbjct  1     MATLIAPINHSPVADAEALHGAFKGWGTDEKSVITILGHRNVYQRQQIRKSYQEIYQEDI  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             ++R E ELSG  E+AVYR ML+P DRDAVL NVAI K G   Y VIIE   +  PEE L 
Sbjct  61    LKRLESELSGDFERAVYRWMLEPADRDAVLANVAI-KDGSKSYHVIIEIVSVLSPEEVLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             ++RAY  RYK S EEDLA ++T   R+LLV LV  +RY G+E++ KLA+TE+ ILH +IK
Sbjct  120   MRRAYHNRYKHSLEEDLAAHTTGHLRQLLVGLVTSFRYGGAEINPKLAKTEADILHESIK  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
             +K+ NHEE +RIL+TRSK QL+ATFNRY+D+HG +ITK                  L ++
Sbjct  180   EKKGNHEEAIRILTTRSKTQLLATFNRYRDDHGISITKK-----------------LLDN  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               + +  AL +TIR + D  KYYEK++R AL + G DED LTRV+VTRAE+DL+ IKE+Y
Sbjct  223   ASDDFHNALHTTIRCINDHKKYYEKILRGALKRVGTDEDGLTRVVVTRAEKDLKDIKELY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              KRNSV LE AVAKE SG Y+  +L LLGKQ+
Sbjct  283   YKRNSVHLEDAVAKEISGDYKKFILTLLGKQD  314



>ref|XP_003627780.1| Annexin-like protein [Medicago truncatula]
 gb|AET02256.1| annexin D8 [Medicago truncatula]
Length=314

 Score =   362 bits (928),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 185/332 (56%), Positives = 238/332 (72%), Gaps = 18/332 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATL+ P + SPVADAEA++ A KGWGT EK+VI I+GHRN  QR+ I+++Y + YQED+
Sbjct  1     MATLIAPINHSPVADAEALHGAFKGWGTDEKSVITILGHRNVYQRQQIRKSYQEIYQEDI  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             ++R E ELSG  E+AVYR ML+P DRDAVL NVAI K G   Y VIIE   +  PEE L 
Sbjct  61    LKRLESELSGDFERAVYRWMLEPADRDAVLANVAI-KDGSKSYHVIIEIVSVLSPEEVLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             ++RAY  RYK S EEDLA ++T   R+LLV LV  +RY G+E++ KLA+TE+ ILH +IK
Sbjct  120   MRRAYHNRYKHSLEEDLAAHTTGHLRQLLVGLVTSFRYGGAEINPKLAKTEADILHESIK  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
             +K+ NHEE +RIL+TRSK QL+ATFNRY+D+HG +ITK                  L ++
Sbjct  180   EKKGNHEEAIRILTTRSKTQLLATFNRYRDDHGISITKK-----------------LLDN  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               + +  AL +TIR + D  KYYEK++R AL + G DED LTRV+VTRAE+DL+ IKE+Y
Sbjct  223   ASDDFHKALHTTIRCINDHKKYYEKILRGALKRVGTDEDGLTRVVVTRAEKDLKDIKELY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              KRNSV LE AVAKE SG Y+  +L LLGKQ+
Sbjct  283   YKRNSVHLEDAVAKEISGDYKKFILTLLGKQD  314



>gb|KHN37649.1| Annexin-like protein RJ4 [Glycine soja]
Length=314

 Score =   361 bits (926),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 187/332 (56%), Positives = 233/332 (70%), Gaps = 18/332 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATL+ P   SP  DAEA+  A +GWGT EKTVI I+GHRN  QR+ I++ Y + YQE+L
Sbjct  1     MATLIAPITFSPGLDAEALRKAFQGWGTDEKTVIAILGHRNVHQRQQIRKVYEEIYQENL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I+R E ELSG  E+AVYR ML+P DRDAVL NVAI K G   Y VI+E AC+   +E L 
Sbjct  61    IKRLESELSGDFERAVYRWMLEPADRDAVLANVAI-KNGSKGYHVIVEIACVLSADEVLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             VKRAY  RYKRS EED+A N+T D R+LLV LV  YRY G EV+AKLA+TE+ ILH +IK
Sbjct  120   VKRAYHNRYKRSLEEDVATNTTGDIRQLLVGLVTAYRYDGDEVNAKLAKTEADILHESIK  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
             +K+ NHEE +RIL+TRSK QL+ATFNRY+D+HG +ITK                  L ++
Sbjct  180   EKKGNHEEAIRILTTRSKTQLLATFNRYRDDHGASITKK-----------------LLDN  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
                 +  AL + IR + D  KYYEK++R A+   G DED LTRV+V+RAE+DLR IKE+Y
Sbjct  223   ASTDFQKALHTAIRCINDHKKYYEKVLRNAIKGVGTDEDALTRVVVSRAEKDLRDIKELY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              KRNSV LE AVAKE SG Y+  +L LLGK++
Sbjct  283   YKRNSVHLEDAVAKEISGDYKKFILTLLGKED  314



>ref|XP_003627779.1| Annexin-like protein [Medicago truncatula]
Length=373

 Score =   362 bits (930),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 185/332 (56%), Positives = 238/332 (72%), Gaps = 18/332 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATL+ P + SPVADAEA++ A KGWGT EK+VI I+GHRN  QR+ I+++Y + YQED+
Sbjct  60    MATLIAPINHSPVADAEALHGAFKGWGTDEKSVITILGHRNVYQRQQIRKSYQEIYQEDI  119

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             ++R E ELSG  E+AVYR ML+P DRDAVL NVAI K G   Y VIIE   +  PEE L 
Sbjct  120   LKRLESELSGDFERAVYRWMLEPADRDAVLANVAI-KDGSKSYHVIIEIVSVLSPEEVLA  178

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             ++RAY  RYK S EEDLA ++T   R+LLV LV  +RY G+E++ KLA+TE+ ILH +IK
Sbjct  179   MRRAYHNRYKHSLEEDLAAHTTGHLRQLLVGLVTSFRYGGAEINPKLAKTEADILHESIK  238

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
             +K+ NHEE +RIL+TRSK QL+ATFNRY+D+HG +ITK                  L ++
Sbjct  239   EKKGNHEEAIRILTTRSKTQLLATFNRYRDDHGISITKK-----------------LLDN  281

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               + +  AL +TIR + D  KYYEK++R AL + G DED LTRV+VTRAE+DL+ IKE+Y
Sbjct  282   ASDDFHKALHTTIRCINDHKKYYEKILRGALKRVGTDEDGLTRVVVTRAEKDLKDIKELY  341

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              KRNSV LE AVAKE SG Y+  +L LLGKQ+
Sbjct  342   YKRNSVHLEDAVAKEISGDYKKFILTLLGKQD  373



>ref|XP_007133789.1| hypothetical protein PHAVU_011G209200g [Phaseolus vulgaris]
 gb|ESW05783.1| hypothetical protein PHAVU_011G209200g [Phaseolus vulgaris]
Length=314

 Score =   358 bits (919),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 182/330 (55%), Positives = 233/330 (71%), Gaps = 18/330 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATL+ P   SP ADAE ++ A KGWGT EKTVI I+GHRN  QR+ I++ Y + YQE+L
Sbjct  1     MATLIAPITFSPGADAEDLHKAFKGWGTDEKTVIAILGHRNVYQRQQIRKIYEEIYQEEL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             ++R E EL+G  E++VYR ML+P DRDAVL NVAI K G   Y VI+E AC+   EE L 
Sbjct  61    LKRLESELTGDFERSVYRWMLEPADRDAVLANVAI-KSGSKGYHVIVEIACVLSSEELLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
              +RAY  RYKRS EED+A +++ D R+LLV LV  YRY G E++A+LA+TE+ ILH++IK
Sbjct  120   ARRAYHNRYKRSLEEDVATHTSGDLRQLLVGLVTSYRYGGDEINARLAKTEADILHSSIK  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
             +K+ NHEE +RIL+TRSK QL+ATFNRY+D+HGT+ITK                  L +D
Sbjct  180   EKKGNHEEAIRILTTRSKTQLLATFNRYRDDHGTSITKK-----------------LLDD  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               + +  AL + IR   D  KYYEK++R A+ K G DED LTRV+V+RAE+DLR I E+Y
Sbjct  223   ASDDFRKALHTAIRCTNDHKKYYEKVLRNAMKKVGTDEDALTRVVVSRAEKDLRNIAEIY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGK  177
              KRNSV LE AVAKE SG Y+  +L LLGK
Sbjct  283   YKRNSVHLEDAVAKEISGDYKKFILTLLGK  312



>gb|ADN34200.1| annexin [Cucumis melo subsp. melo]
Length=629

 Score =   369 bits (946),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 187/331 (56%), Positives = 242/331 (73%), Gaps = 19/331 (6%)
 Frame = -3

Query  1166  MATLVFP-DHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATL+ P D P P  DAEAI  A +GWGT EK ++ ++G+RN  QR+ I+ AY   ++ED
Sbjct  1     MATLLVPHDVPPPNVDAEAIKAAFRGWGTDEKAIVAVLGYRNAPQRRQIRIAYEQLFEED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++RFE ELSG LE+AVYR +LDPEDRDAVL +VA+RK    D+ V++E +CIY PEEFL
Sbjct  61    LVKRFESELSGHLERAVYRWILDPEDRDAVLAHVALRKPN-EDFAVLVEFSCIYSPEEFL  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              V+RAYQ RYKRS EED+A N+  DFRKLLV LV  YRY+G E+DA+LA++E+ IL  A+
Sbjct  120   AVRRAYQHRYKRSLEEDVAANTHDDFRKLLVGLVSAYRYNGGEIDARLAKSEAEILERAV  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
             K K +NHE+++RIL+TRSKAQLIATFN YKD +G +I+K                Q  ++
Sbjct  180   KDKAFNHEDVIRILTTRSKAQLIATFNHYKDANGISISK----------------QLGQD  223

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTG-ADEDDLTRVIVTRAERDLRGIKE  273
                N++  AL++ IR + DP KYYEK++R A+ K G +DED LTRV+VTRAE+DLR IKE
Sbjct  224   RAANEFTEALKTVIRCINDPVKYYEKVVRNAIKKVGKSDEDALTRVVVTRAEKDLRQIKE  283

Query  272   VYQKRNSVTLEQAVAKETSGHYEALLLALLG  180
              Y KRNSVTL+ AV KETSG Y+  +LALL 
Sbjct  284   AYHKRNSVTLDDAVKKETSGDYKHFILALLA  314


 Score =   349 bits (896),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 178/332 (54%), Positives = 235/332 (71%), Gaps = 19/332 (6%)
 Frame = -3

Query  1169  SMATLVFP-DHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQE  993
             +MATL+ P D PS   DAEA+  A KGWG+ EK +I I+ HRN  QR+ I+ AY   +QE
Sbjct  314   AMATLIVPRDVPSANVDAEALRTAFKGWGSDEKAIISILAHRNAIQRRHIRIAYEQLFQE  373

Query  992   DLIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEF  813
             DLI+R E E+SG  E+AVYR MLDPEDRDAVL N+AIRK    D+ V++E +CIY PEE 
Sbjct  374   DLIKRLESEISGHFERAVYRWMLDPEDRDAVLANIAIRKPK-EDFAVLVELSCIYSPEEL  432

Query  812   LGVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNA  633
             LGV+RAYQ RYKRS EED+A ++  D R LLV LV  YRY+G++VD  LA++E+  L  A
Sbjct  433   LGVRRAYQHRYKRSLEEDVAASTNDDLRTLLVGLVSAYRYNGADVDLSLAKSEAERLERA  492

Query  632   IKKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLK  453
             I+ K + HE++VRIL+TRS+ QL+ATFN YKD +G +I++                Q   
Sbjct  493   IRDKTFYHEDVVRILTTRSRPQLVATFNHYKDAYGISISE----------------QLSS  536

Query  452   EDTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTG-ADEDDLTRVIVTRAERDLRGIK  276
             +  G ++  ALR+ I  + DP++YYEK++R A+ + G +DED LTRV+V+RAE+DLR IK
Sbjct  537   DKAGKEFTEALRTIIECIDDPYQYYEKVVRNAIKRVGKSDEDALTRVVVSRAEKDLRQIK  596

Query  275   EVYQKRNSVTLEQAVAKETSGHYEALLLALLG  180
             E Y KRNSVTL+ AV+KETSG Y+  +LALLG
Sbjct  597   EAYHKRNSVTLDDAVSKETSGDYKRFILALLG  628



>gb|AFK35882.1| unknown [Lotus japonicus]
Length=313

 Score =   357 bits (916),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 185/332 (56%), Positives = 238/332 (72%), Gaps = 19/332 (6%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATLV     SP  DAEA+  A KGWGT EKTVI I+GHR+  QR+ I++AY + YQED+
Sbjct  1     MATLV-AFQSSPKDDAEALQKAFKGWGTDEKTVIAILGHRSVHQRQQIRKAYEELYQEDI  59

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I+R E ELSG +EKAVYR ML+P DRDAVL NVAI+ GG   Y VI+E A +  PEE L 
Sbjct  60    IKRLESELSGDIEKAVYRWMLEPTDRDAVLANVAIKSGG-KGYNVIVEIATVLSPEEVLA  118

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V+RAY  RYKRS EED+A ++T D R+LLV LV  +RY G E++A+LA+TE+ ILH +IK
Sbjct  119   VRRAYHNRYKRSLEEDVAAHTTGDLRQLLVGLVSSFRYGGDEINARLAKTEADILHESIK  178

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
             +K+ N+EE +RIL+TRSK QL+ATFNRY+D+HG +ITK +L                 ++
Sbjct  179   QKKGNNEEAIRILTTRSKTQLVATFNRYRDDHGISITKKSL-----------------DN  221

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               + +  AL + IR + D  KYYEK++  AL + G+DED LTRV+VTRAE+DL+ IKE+Y
Sbjct  222   ASDDFHKALHTAIRCINDHQKYYEKVLCNALKRVGSDEDGLTRVVVTRAEKDLKEIKELY  281

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              KRNSV LE AVAKE SG Y+  +L LLGKQ+
Sbjct  282   YKRNSVHLEDAVAKELSGDYKKFILTLLGKQD  313



>gb|ADT91309.1| annexin-like protein [Arachis hypogaea var. vulgaris]
Length=315

 Score =   357 bits (916),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 182/332 (55%), Positives = 234/332 (70%), Gaps = 17/332 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATL+ P + S   DAEA+  A KGWG  +KT+I I+GHRN  QR+ I++AY + +QEDL
Sbjct  1     MATLIAPSNHSSAEDAEALQKAFKGWGADDKTIIAILGHRNVHQRQQIRKAYEELHQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I+R E E+SG  E+A+YR ML+P DRDAVL NVAIR G   D+ VI E AC+   EE L 
Sbjct  61    IKRLESEISGDFERAMYRWMLEPADRDAVLANVAIRNGK-KDFHVIAEIACVLSAEELLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V+RAY+ RYKRS EED+A N+T   R+LLV LV  +RY G E++A+LAQ+E+ ILH  +K
Sbjct  120   VRRAYRHRYKRSLEEDVAANTTGHLRELLVGLVSSFRYEGDEINARLAQSEANILHETVK  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
             +K+ N+EE +RIL+TRSK QL+ATFNRY+DEH  +I+K           KL     L   
Sbjct  180   EKKGNYEEAIRILTTRSKTQLVATFNRYRDEHAISISK-----------KL-----LDNQ  223

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               + +  AL + IR + D  KYYEK++R A+ K G DED L+RV+VTRAE+DLR IKE+Y
Sbjct  224   ASDDFYKALHTAIRCINDHKKYYEKVLRNAIKKVGTDEDALSRVVVTRAEKDLRDIKELY  283

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              KRNSV LE AVAKETSG Y+  LL LLGKQ+
Sbjct  284   YKRNSVHLEDAVAKETSGDYKKFLLTLLGKQD  315



>ref|XP_006590331.1| PREDICTED: uncharacterized protein LOC100806472 isoform X1 [Glycine 
max]
Length=312

 Score =   356 bits (914),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 180/330 (55%), Positives = 230/330 (70%), Gaps = 18/330 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATL+ P H S V DAEA+ NA KGWG  +K +I I+GHRN  QR+ I++AY + YQEDL
Sbjct  1     MATLIAPSHHSRVEDAEALRNAFKGWGADDKAIIAILGHRNVHQRQEIRKAYEEIYQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I+R E E+SG  E+A+YR ML P DRDAVL+NVAI K G  DY VI E AC+   EE L 
Sbjct  61    IKRLESEISGDFERAMYRWMLQPADRDAVLVNVAI-KNGTKDYHVIAEIACVLSAEELLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V+RAY  RYK S EED+A N+T + R+LLV LV  YRY G E++ K +QTE+ +LH ++K
Sbjct  120   VRRAYHRRYKCSLEEDVAANTTGNLRQLLVGLVTSYRYEGDEINVKFSQTEANVLHESVK  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
             +K+ N EE++RIL+TRSK QL+ATFNRY+DEHG +I+K                  L + 
Sbjct  180   EKKGNSEEVIRILTTRSKTQLVATFNRYRDEHGISISKK-----------------LLDQ  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
             T + +   L + IR + D  KYYEK++R A+ K G DED L+RVIVTRAE+DL+ IKE+Y
Sbjct  223   TSDDFHKVLHTAIRCINDHKKYYEKVLRNAVKKFGTDEDGLSRVIVTRAEKDLKDIKELY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGK  177
              KRNSV LE  V+KETSG Y+  LL LLGK
Sbjct  283   YKRNSVHLEDEVSKETSGDYKKFLLTLLGK  312



>ref|XP_008348387.1| PREDICTED: annexin-like protein RJ4 isoform X1 [Malus domestica]
Length=313

 Score =   356 bits (913),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 183/331 (55%), Positives = 229/331 (69%), Gaps = 18/331 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATL+  ++ SP+ DAE +  + KGWGT EK +I I+GHRN  QRK I+  Y   YQEDL
Sbjct  1     MATLIASENFSPIEDAEVLRKSVKGWGTDEKAIISILGHRNAAQRKQIRLXYEQSYQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             ++R E ELSG  EKAVYR +LDP DRDAVL +VAI+K G  +Y VIIE   I  PEE   
Sbjct  61    LKRLESELSGDFEKAVYRWILDPADRDAVLAHVAIKKSGC-NYNVIIEIXTILSPEELFA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V++AYQ RYK S EEDLA ++T D RKLLVALV  YRY G E++AKLA++E+ ILH+AIK
Sbjct  120   VRKAYQVRYKHSLEEDLAAHTTGDIRKLLVALVTAYRYDGGEINAKLAKSEADILHDAIK  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K +NH+EI+RILSTRSK QL+ATFN Y+D+H  +I+K                  L E+
Sbjct  180   DKAFNHDEIIRILSTRSKTQLMATFNHYRDDHKISISKT-----------------LLEE  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               +    AL   IR + D  KY+EK++R  + + G DED LTRVIV RAERDL+ IKEVY
Sbjct  223   GADDLQKALHVVIRCLNDHKKYFEKVLRNGIRRLGTDEDALTRVIVXRAERDLKDIKEVY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQ  174
              K+NSV LE AVAK+TSG Y+  LL LLGK+
Sbjct  283   YKKNSVPLEHAVAKDTSGDYKDFLLTLLGKE  313



>gb|KDP40511.1| hypothetical protein JCGZ_24510 [Jatropha curcas]
Length=314

 Score =   356 bits (913),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 181/332 (55%), Positives = 233/332 (70%), Gaps = 18/332 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MAT+V P + S V DAE +  A +GWGT+EK VI ++GHRN  Q+K I+QAY D YQEDL
Sbjct  1     MATIVVPANVSYVEDAETLRKAFEGWGTNEKAVIAVLGHRNAVQKKHIRQAYWDLYQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             ++R E EL G  E+A+YR +LDPEDRDAVL NVA+RK G  D+ VI+E AC    EE L 
Sbjct  61    VKRLESELGGDFERAMYRWILDPEDRDAVLANVALRKSG--DFHVIVEIACARSAEELLL  118

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V+RAYQARYK S EED+A ++T D RKLLV LV  +RY G+E++ +LA++E+ +L  AIK
Sbjct  119   VRRAYQARYKHSLEEDVATHTTGDIRKLLVGLVTAFRYEGAEINTRLAKSEADVLQEAIK  178

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K +NH+E++RIL+TRSK QL  TFN +KD+HGT+ITK                  L E 
Sbjct  179   DKHFNHDEVIRILTTRSKTQLNTTFNHFKDDHGTSITKAL----------------LGEK  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               N+++  LR  IR M +P KYYEK++R A+ + G DED LTRVIVTRAE+DL  IKE+Y
Sbjct  223   ADNEFVRLLRIAIRTMNEPLKYYEKVLRNAIKRIGTDEDALTRVIVTRAEKDLLHIKELY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              KRN+V L+ AV KE  G Y+  LLALLG Q+
Sbjct  283   HKRNNVPLDHAVDKEIHGDYKHFLLALLGHQD  314



>ref|XP_006399755.1| hypothetical protein EUTSA_v10014146mg [Eutrema salsugineum]
 gb|ESQ41208.1| hypothetical protein EUTSA_v10014146mg [Eutrema salsugineum]
Length=315

 Score =   353 bits (907),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 177/332 (53%), Positives = 233/332 (70%), Gaps = 18/332 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MAT+V P H SPV DAE+I  AC+GWGT EKT+I I+GHRN  QRKLI+QAY + Y EDL
Sbjct  1     MATIVCPPHFSPVVDAESIKKACQGWGTDEKTIISILGHRNLFQRKLIRQAYQEIYHEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I + + ELSG  E+A+   +LDP +RDA L N+A++K G+ DY+V++E AC+  PE+ L 
Sbjct  61    IHQLKSELSGDFERAICLWVLDPPERDAHLANLALQKPGL-DYKVLVEIACMRSPEDLLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
              +RAY+  YKRS EEDLA  +T D RKLLVA+   Y+Y G EVD  LAQ+E+ ILH+ I+
Sbjct  120   ARRAYRCLYKRSLEEDLASRTTGDIRKLLVAMATAYKYDGEEVDEVLAQSEASILHDEIR  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
                 +HEE + +LSTRS  QL A FN YKD +G +ITK                 DL + 
Sbjct  180   GNAVDHEETISVLSTRSSVQLSAIFNSYKDIYGRSITK-----------------DLLKH  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               N+YL+ALR+ IR + +P++YY K++R A+   G DED LTRVIVTRAE+DL+ I E+Y
Sbjct  223   PTNEYLSALRAAIRCIKNPNRYYAKVLRNAINTVGTDEDALTRVIVTRAEKDLKKITELY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
             +KRN+V+L+QA+AKETSG Y+  LLALLG  E
Sbjct  283   RKRNNVSLDQAIAKETSGDYKTFLLALLGHAE  314



>ref|XP_004514653.1| PREDICTED: annexin-like protein RJ4-like [Cicer arietinum]
Length=315

 Score =   353 bits (906),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 180/333 (54%), Positives = 233/333 (70%), Gaps = 19/333 (6%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATL+ P +  PV DA A++ A KGWG  +KT+I I+GHRN  QR+ I++AY + +QEDL
Sbjct  1     MATLIAPINHFPVEDANALHTAFKGWGADDKTIIAILGHRNVYQRQQIRKAYEELFQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I+R E E+SG  E+AVYR ML+P DRDAVL+NVA+R G   DY V+ E A +   EE L 
Sbjct  61    IKRLESEISGDFERAVYRWMLEPADRDAVLINVAVRNGS-KDYHVVAEIASVLSAEELLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V+RAY  RYKRS EED+A ++T   R+LLV LV  +RY G E++AKLAQ E+ I+H ++K
Sbjct  120   VRRAYHNRYKRSIEEDVAAHTTGHLRQLLVGLVSSFRYEGDEINAKLAQNEANIIHESVK  179

Query  626   -KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
              KK  N EE++RIL+TRSK QL+ATFNRY+DEHGT+I+K                  L +
Sbjct  180   EKKGNNEEEVIRILTTRSKTQLVATFNRYRDEHGTSISKK-----------------LLD  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
              T + +  AL + IR + D  KYYEK++R A+ K G DED L RVIVTRAE+DLR IKE+
Sbjct  223   QTSDDFHKALHTVIRCINDHTKYYEKVLRNAIKKFGTDEDGLNRVIVTRAEKDLRDIKEL  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
             Y KRNSV LE AV+KE SG Y+  +L LLGKQ+
Sbjct  283   YYKRNSVHLEDAVSKEISGDYKKFILTLLGKQD  315



>gb|AET02255.2| annexin D8 [Medicago truncatula]
Length=313

 Score =   352 bits (904),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 184/332 (55%), Positives = 234/332 (70%), Gaps = 19/332 (6%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATLV     SPV DAEA+  A KGWGT EK+VI I+GHRN  QR+ I+++Y + YQED+
Sbjct  1     MATLVTIK-SSPVEDAEALQKAFKGWGTDEKSVITILGHRNVYQRQQIRKSYQEIYQEDI  59

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             ++R E ELSG  E+AVYR ML+P DRDAVL NVAI K G   Y VIIE   +  PEE L 
Sbjct  60    LKRLESELSGDFERAVYRWMLEPADRDAVLANVAI-KDGSKSYHVIIEIVSVLSPEEVLA  118

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             ++RAY  RYK S EEDLA ++T   R+LLV LV  +RY G+E++ KLA+TE+ ILH +IK
Sbjct  119   MRRAYHNRYKHSLEEDLAAHTTGHLRQLLVGLVTSFRYGGAEINPKLAKTEADILHESIK  178

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
             +K+ NHEE +RIL+TRSK QL+ATFNRY+D+HG +ITK                  L ++
Sbjct  179   EKKGNHEEAIRILTTRSKTQLLATFNRYRDDHGISITKK-----------------LLDN  221

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               + +  AL +TIR + D  KYYEK++R AL + G DED LTRV+VTRAE+DL+ IKE+Y
Sbjct  222   ASDDFHKALHTTIRCINDHKKYYEKILRGALKRVGTDEDGLTRVVVTRAEKDLKDIKELY  281

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              KRNSV LE AVAKE SG Y+  +L LLGKQ+
Sbjct  282   YKRNSVHLEDAVAKEISGDYKKFILTLLGKQD  313



>ref|XP_010521627.1| PREDICTED: annexin-like protein RJ4 isoform X2 [Tarenaya hassleriana]
Length=316

 Score =   352 bits (904),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 184/335 (55%), Positives = 240/335 (72%), Gaps = 22/335 (7%)
 Frame = -3

Query  1166  MATLVFP-DHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATLV P D  SP+ DAEA+  A KGWGT E+ +I I+GHRN TQR  I+QAYHD YQED
Sbjct  1     MATLVAPLDLFSPIEDAEALNKAVKGWGTDEEAIINILGHRNATQRLQIRQAYHDLYQED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKG-GVPDYRVIIEQACIYCPEEF  813
             LI+R E ELSG  E+A+YR +LDP DRDAVL NVAIRKG G P+   IIE +C    EE 
Sbjct  61    LIKRLESELSGHFERAMYRWVLDPFDRDAVLANVAIRKGSGNPE--AIIEISCARSSEEL  118

Query  812   LGVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNA  633
             L V+RAY ARYKRS EED+A +++ D R++LV+LV  +RY G E++ ++A +E+ IL  A
Sbjct  119   LAVRRAYMARYKRSLEEDVAAHTSGDIRRILVSLVTAFRYEGDEINLRVANSEAEILRVA  178

Query  632   IKKKEYNHEEIVRILSTRSKAQLIATFNRYKD-EHGTAITKPNLVV*SWSNLKLFFLQDL  456
             +K+  Y+H+E++R+LSTRSK+QL+ATFN Y+D  +G +ITK                 +L
Sbjct  179   VKEGVYSHDEVLRVLSTRSKSQLMATFNCYRDGNNGISITK-----------------EL  221

Query  455   KEDTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIK  276
               D+GN+    L +TIR + DP KY+EK++R AL + G DED LTRVIVTRAE+DL GIK
Sbjct  222   LSDSGNELAMVLHTTIRCLNDPTKYFEKVVREALKRYGTDEDGLTRVIVTRAEKDLMGIK  281

Query  275   EVYQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
             E Y K+N+++L+ AVAKE SG Y+A LLAL+G  E
Sbjct  282   ERYYKKNNISLDHAVAKEISGDYKAFLLALMGYLE  316



>ref|XP_010521553.1| PREDICTED: annexin-like protein RJ4 isoform X1 [Tarenaya hassleriana]
Length=315

 Score =   352 bits (903),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 182/334 (54%), Positives = 238/334 (71%), Gaps = 21/334 (6%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATL+ P    PV DAEA+  A KGWGT E+ +I I+GHRN TQR  I+QAYHD YQEDL
Sbjct  1     MATLLAPSEIFPVEDAEALRKATKGWGTDEEAIINILGHRNATQRLQIRQAYHDLYQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKG-GVPDYRVIIEQACIYCPEEFL  810
             I+R E ELSG  E+A+YR +LDP DRDAVL NVAIRKG G P+   IIE +C    EE L
Sbjct  61    IKRLESELSGHFERAMYRWVLDPFDRDAVLANVAIRKGSGNPE--AIIEISCARSSEELL  118

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              V+RAY ARYKRS EED+A +++ D R++LV+LV  +RY G E++ ++A +E+ IL  A+
Sbjct  119   AVRRAYMARYKRSLEEDVAAHTSGDIRRILVSLVTAFRYEGDEINLRVANSEAEILRVAV  178

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKD-EHGTAITKPNLVV*SWSNLKLFFLQDLK  453
             K+  Y+H+E++R+LSTRSK+QL+ATFN Y+D  +G +ITK                 +L 
Sbjct  179   KEGVYSHDEVLRVLSTRSKSQLMATFNCYRDGNNGISITK-----------------ELL  221

Query  452   EDTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKE  273
              D+GN+    L +TIR + DP KY+EK++R AL + G DED LTRVIVTRAE+DL GIKE
Sbjct  222   SDSGNELAMVLHTTIRCLNDPTKYFEKVVREALKRYGTDEDGLTRVIVTRAEKDLMGIKE  281

Query  272   VYQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              Y K+N+++L+ AVAKE SG Y+A LLAL+G  E
Sbjct  282   RYYKKNNISLDHAVAKEISGDYKAFLLALMGYLE  315



>ref|XP_004511011.1| PREDICTED: annexin-like protein RJ4-like isoform X2 [Cicer arietinum]
Length=312

 Score =   352 bits (903),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 178/330 (54%), Positives = 236/330 (72%), Gaps = 18/330 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATL+ P + S VADAEA++ A +GWGT EK+VI I+GHRN  QR+ I+++Y + YQED+
Sbjct  1     MATLIAPINHSLVADAEALHKAFQGWGTDEKSVIEILGHRNVYQRQQIRKSYQEIYQEDI  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             ++R E ELSG  E+AVYR ML+P DRDAVL+NVAI+ G    Y VI+E  C+  PEE L 
Sbjct  61    LKRLESELSGDFERAVYRWMLEPADRDAVLVNVAIKDGN-KGYNVIVEIVCVLSPEEVLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             ++RAYQ RYK S EED+A ++T   R+LLV LVG +RY G E++ +LA+TE+ ILH +IK
Sbjct  120   MRRAYQNRYKHSLEEDVAAHTTGHLRQLLVGLVGSFRYGGDEINPRLAKTEADILHESIK  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
             +K+ N+EE +RI++TRSK QL+AT NRY+D+HGT+ITK                  L ++
Sbjct  180   EKKGNYEEAIRIITTRSKTQLLATLNRYRDDHGTSITKK-----------------LLDN  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               + +  AL + IR + D  KYYEK++R AL + G DED LTRV+VTRAE+DL+ IKE+Y
Sbjct  223   ASDDFHKALHTAIRCINDHKKYYEKVMRSALKRVGTDEDGLTRVVVTRAEKDLKDIKELY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGK  177
              KRNSV LE  VAKE SG Y+  LL LLGK
Sbjct  283   YKRNSVHLEDEVAKEISGDYKKFLLTLLGK  312



>ref|XP_002871524.1| hypothetical protein ARALYDRAFT_488086 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47783.1| hypothetical protein ARALYDRAFT_488086 [Arabidopsis lyrata subsp. 
lyrata]
Length=315

 Score =   352 bits (903),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 174/329 (53%), Positives = 231/329 (70%), Gaps = 18/329 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MAT+V P H SPV DAE I  AC+GWGT+EK +I I+GHRN  QRKLI+QAY + Y EDL
Sbjct  1     MATIVSPSHFSPVEDAENIKAACQGWGTNEKAIISILGHRNLFQRKLIRQAYQEIYHEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I + + ELSG+ E+A+   +LDP +RDA L N+A++K  +PDY+V++E AC+  PE+ L 
Sbjct  61    IHQLKSELSGNFERAICLWVLDPPERDAFLANLALQKP-IPDYKVLVEIACMRSPEDLLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
              +RAY+  YKRS EEDLA  +  D R+LLVA+V  Y+Y G E+D  LAQ+E+ ILH+ I 
Sbjct  120   ARRAYRCLYKRSLEEDLASRTIGDIRRLLVAMVSAYKYDGEEIDEMLAQSEAAILHDEIL  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K  +HEE +R+LSTRS  QL A FNRYKD +G +ITK                 DL   
Sbjct  180   GKAVDHEETIRVLSTRSSMQLSAIFNRYKDIYGRSITK-----------------DLLNH  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               N+YL+ALR+ IR + +P +Y+ K++R ++   G DED L RVIVTRAE+DL+ I E+Y
Sbjct  223   PTNEYLSALRAAIRCIKNPIRYHAKVLRNSINTVGTDEDALNRVIVTRAEKDLKNITELY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLG  180
              KRN+V+L+QA+AKETSG Y+A LLALLG
Sbjct  283   HKRNNVSLDQAIAKETSGDYKAFLLALLG  311



>ref|XP_003598648.1| Annexin-like protein RJ4 [Medicago truncatula]
 gb|ACJ85059.1| unknown [Medicago truncatula]
 gb|AES68899.1| annexin D8 [Medicago truncatula]
 gb|AFK34011.1| unknown [Medicago truncatula]
Length=314

 Score =   352 bits (903),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 177/332 (53%), Positives = 231/332 (70%), Gaps = 18/332 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MAT+V     SPV DAEA+  A KGWG   K +I I+GHRN  QR+ I++AY + ++EDL
Sbjct  1     MATIVVHSQTSPVQDAEALRLAFKGWGADNKAIIAILGHRNVHQRQQIRKAYEELFEEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I+R E E+SG  E+AVYR MLDP DRDAVL+NVAIR G   DY V+ E A +   EE L 
Sbjct  61    IKRLESEISGDFERAVYRWMLDPADRDAVLINVAIRNGN-KDYHVVAEIASVLSTEELLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V+RAY  RYKRS EED++ ++T   R+LLV LV  +RY G E++AKLAQTE+ I+H ++K
Sbjct  120   VRRAYHNRYKRSIEEDVSAHTTGHLRQLLVGLVSSFRYEGDEINAKLAQTEANIIHESVK  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
             +K+ N+EE++RIL+TRSK QL+ATFNRY+DEHG +I+K                  L + 
Sbjct  180   EKKGNNEEVIRILTTRSKTQLVATFNRYRDEHGISISKK-----------------LLDQ  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
             T + +   L + IR + D  KYYEK++R A+ K G DED L+RVIVTRAE+DLR IKE+Y
Sbjct  223   TSDDFQKTLHTAIRCINDHKKYYEKVLRNAIKKFGTDEDGLSRVIVTRAEKDLRDIKELY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              KRNSV LE  V+KETSG Y+  +L LLGK +
Sbjct  283   YKRNSVHLEDEVSKETSGDYKKFILTLLGKHD  314



>ref|XP_010453308.1| PREDICTED: annexin D8 [Camelina sativa]
Length=315

 Score =   351 bits (901),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 177/332 (53%), Positives = 228/332 (69%), Gaps = 18/332 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MAT+V P H SPV DAE I  AC+GWGT EK +I I+GHRN  QRKLI+QAY + Y EDL
Sbjct  1     MATIVSPSHFSPVEDAENIKKACQGWGTDEKAIISILGHRNLFQRKLIRQAYQEIYHEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I + + ELSG  E+AV   +LDP +RDA+L N+A++K  +PDY+V++E AC+  PE+ L 
Sbjct  61    IHQLKSELSGDFERAVCLWVLDPPERDALLANLALQKP-IPDYKVLVEIACMRSPEDLLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
              +RAY+  YKRS EEDLA  +  D RKLLVAL   Y+Y G E+D  LAQ+E+ ILH+ I 
Sbjct  120   ARRAYRCLYKRSLEEDLASRTIGDIRKLLVALASAYKYDGEEIDEMLAQSEAGILHDEIL  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K   HEE +R+LSTRS  QL A FNRYKD +G +ITK                 DL   
Sbjct  180   GKAVEHEETIRVLSTRSNMQLSAIFNRYKDIYGRSITK-----------------DLLNH  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               N+YL+ALR+ IR + +P +YY K++R ++   G DED L RVIVTRAE+DL+ I E+Y
Sbjct  223   PTNEYLSALRAAIRCIKNPTRYYSKVLRNSINTVGTDEDALNRVIVTRAEKDLKKISELY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              KRN V+L+QA+AKETSG Y++ LLALLG  E
Sbjct  283   LKRNDVSLDQAIAKETSGDYKSFLLALLGHGE  314



>gb|KGN52304.1| hypothetical protein Csa_5G623680 [Cucumis sativus]
Length=315

 Score =   350 bits (899),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 179/331 (54%), Positives = 234/331 (71%), Gaps = 19/331 (6%)
 Frame = -3

Query  1166  MATLVFP-DHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATL+ P D PS   DAEA+  A KGWG+ EK +I I+ HRN  QR+ I+ AY   +QED
Sbjct  1     MATLIVPRDVPSANVDAEALRTAFKGWGSDEKAIISILAHRNAIQRRHIRIAYEQLFQED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             LI+R E E+SG  E+AVYR MLDPEDRDAVL N+AIRK    D+ V++E +CIY PEE L
Sbjct  61    LIKRLESEISGHFERAVYRWMLDPEDRDAVLANIAIRKPK-EDFAVLVELSCIYSPEELL  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
             GV+RAYQ RYKRS EED+A ++  D R LLV LV  YRY+G++VD  LA++E+  L  AI
Sbjct  120   GVRRAYQHRYKRSLEEDVAASTNDDLRTLLVGLVSAYRYNGADVDLSLAKSEAERLERAI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
             K K + HE++VRIL+TRS+ QL+ATFN YKD +G +I++                Q   +
Sbjct  180   KDKTFYHEDVVRILTTRSRPQLVATFNHYKDAYGISISE----------------QLSSD  223

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTG-ADEDDLTRVIVTRAERDLRGIKE  273
               G ++  ALR+ I  + DP++YYEK++R A+ + G +DED LTRV+V+RAE+DLR IKE
Sbjct  224   KAGKEFTEALRTIIECIDDPYQYYEKVVRNAIKRVGKSDEDALTRVVVSRAEKDLRQIKE  283

Query  272   VYQKRNSVTLEQAVAKETSGHYEALLLALLG  180
              Y KRNSVTL+ AV+KETSG Y+  +LALLG
Sbjct  284   AYHKRNSVTLDDAVSKETSGDYKRFILALLG  314



>gb|ACV50434.1| annexin-like protein [Jatropha curcas]
Length=314

 Score =   350 bits (899),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 179/332 (54%), Positives = 231/332 (70%), Gaps = 18/332 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MAT+V P + S V DAE +  A +GWGT+EK VI ++GHRN  Q+K I+QAY D YQEDL
Sbjct  1     MATIVVPANVSYVEDAETLRKAFEGWGTNEKAVIAVLGHRNAVQKKHIRQAYWDLYQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             ++R E EL G  E+A+YR +LDPEDRDAVL NVA+RK G  D+ VI+E AC    EE L 
Sbjct  61    VKRLESELGGDFERAMYRWILDPEDRDAVLANVALRKSG--DFHVIVEIACARSAEELLL  118

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V+RAYQARYK S EED+A ++T D RKLLV LV  + Y G+E++ +LA++E+ +L  AIK
Sbjct  119   VRRAYQARYKHSLEEDVATHTTGDIRKLLVGLVTAFMYEGAEINTRLAKSEADVLQEAIK  178

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K +NH+E++RIL+TRSK QL  TFN +KD+HGT+ITK                  L E 
Sbjct  179   DKHFNHDEVIRILTTRSKTQLNTTFNHFKDDHGTSITKAL----------------LGEK  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               N+++  L   IR M +P KYYEK++R A+ + G DED LTRVIVTRAE+DL  IKE+Y
Sbjct  223   ADNEFVRLLSIAIRTMNEPLKYYEKVLRNAIKRIGTDEDALTRVIVTRAEKDLLHIKELY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              KRN+V L+ AV KE  G Y+  LLALLG Q+
Sbjct  283   PKRNNVPLDHAVDKEIHGDYKHFLLALLGHQD  314



>ref|XP_004515568.1| PREDICTED: annexin-like protein RJ4-like [Cicer arietinum]
Length=314

 Score =   349 bits (896),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 172/332 (52%), Positives = 232/332 (70%), Gaps = 18/332 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MA+LV P   SP+ DAEA+  A KGWG  EK +I I+GHRN TQR  I+QAY+D +QEDL
Sbjct  1     MASLVDPSDHSPIEDAEALQKAVKGWGADEKAIIAILGHRNATQRTQIRQAYYDLFQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I+R E ELSG LE+A+YR +L+P +R+A+L N+A+R   + +Y +I+E +C+  P+E   
Sbjct  61    IKRLESELSGDLERAMYRWILEPAEREALLANIALRNANI-NYHIIVEISCVSSPDELFI  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V+RAY  R+KRS EED+A N+T   R+LLV LV  +RY GSEV+A++AQ E+ +LH AIK
Sbjct  120   VRRAYHNRFKRSLEEDVATNTTGHLRQLLVGLVSSFRYGGSEVNARMAQCEADVLHEAIK  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K  NH+E++RIL+TRSK QL+ATFNRY+D+HG AITK                  L ++
Sbjct  180   NKNQNHQEVIRILTTRSKFQLMATFNRYRDDHGIAITKK-----------------LSDE  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               + +  A++  I  + D  KYYEK++R A+     DED LTRVIVTRAE+DL+ I EVY
Sbjct  223   GFDDFHKAMQIAISCINDHKKYYEKVLRNAIENVEIDEDALTRVIVTRAEKDLKNINEVY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              KRNSV LE +VAK+TSG Y+  LL L+G +E
Sbjct  283   YKRNSVHLEHSVAKKTSGDYKKFLLTLMGNEE  314



>ref|XP_003598649.1| Annexin [Medicago truncatula]
 gb|AES68900.1| annexin D8 [Medicago truncatula]
Length=314

 Score =   349 bits (896),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 173/332 (52%), Positives = 230/332 (69%), Gaps = 18/332 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MA+L+ P + SPV DAEA+  A KGWG  EK +I I+GHRN TQR  I+QAY++ YQEDL
Sbjct  1     MASLIAPSNHSPVEDAEALQRAVKGWGADEKAIIAILGHRNGTQRTQIRQAYYELYQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I+R E ELSG  E+A+YR +L+P +R+A+L N+A+R   + +Y +I+E +C+  P+E   
Sbjct  61    IKRLESELSGDFERAMYRWILEPAEREALLANIALRNANI-NYHLIVEISCVSSPDELFN  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             ++RAY  RYKRS EED+A N+    R+LLV LV  +RY GSEV+A LAQ E+ +LH AIK
Sbjct  120   LRRAYHNRYKRSLEEDVATNTNGHLRQLLVGLVSSFRYDGSEVNASLAQCEADMLHEAIK  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K YNHEE++RIL+TRSK QL+ATFN Y+ +HG AITK                  L ++
Sbjct  180   NKNYNHEEVIRILTTRSKTQLVATFNCYRHDHGIAITKK-----------------LSDE  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               + +  A+   I  + D +KYYEK++R A+   G DED LTRVIVTRAE+DL  IK+VY
Sbjct  223   GSDGFHKAVSLAISCINDHNKYYEKVLRNAMETVGTDEDALTRVIVTRAEKDLEDIKKVY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              KRNSV LE AVAK+TSG Y+  L  L+GK+E
Sbjct  283   YKRNSVQLEHAVAKKTSGDYKNFLRTLMGKEE  314



>ref|XP_008446931.1| PREDICTED: annexin-like protein RJ4 [Cucumis melo]
Length=315

 Score =   349 bits (896),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 178/331 (54%), Positives = 234/331 (71%), Gaps = 19/331 (6%)
 Frame = -3

Query  1166  MATLVFP-DHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATL+ P D PS   DAEA+  A KGWG+ EK +I I+ HRN  QR+ I+ AY   +QED
Sbjct  1     MATLIVPRDVPSANVDAEALRTAFKGWGSDEKAIISILAHRNAIQRRHIRIAYEQLFQED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             LI+R E E+SG  E+AVYR MLDPEDRDAVL N+AIRK    D+ V++E +CIY PEE L
Sbjct  61    LIKRLESEISGHFERAVYRWMLDPEDRDAVLANIAIRKPK-EDFAVLVELSCIYSPEELL  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
             GV+RAYQ RYKRS EED+A ++  D R LLV LV  YRY+G++VD  LA++E+  L  AI
Sbjct  120   GVRRAYQHRYKRSLEEDVAASTNDDLRTLLVGLVSAYRYNGADVDLSLAKSEAERLERAI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
             + K + HE++VRIL+TRS+ QL+ATFN YKD +G +I++                Q   +
Sbjct  180   RDKTFYHEDVVRILTTRSRPQLVATFNHYKDAYGISISE----------------QLSSD  223

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTG-ADEDDLTRVIVTRAERDLRGIKE  273
               G ++  ALR+ I  + DP++YYEK++R A+ + G +DED LTRV+V+RAE+DLR IKE
Sbjct  224   KAGKEFTEALRTIIECIDDPYQYYEKVVRNAIKRVGKSDEDALTRVVVSRAEKDLRQIKE  283

Query  272   VYQKRNSVTLEQAVAKETSGHYEALLLALLG  180
              Y KRNSVTL+ AV+KETSG Y+  +LALLG
Sbjct  284   AYHKRNSVTLDDAVSKETSGDYKRFILALLG  314



>ref|NP_001242171.1| uncharacterized protein LOC100806472 [Glycine max]
 gb|ACU17824.1| unknown [Glycine max]
Length=312

 Score =   348 bits (893),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 177/330 (54%), Positives = 226/330 (68%), Gaps = 18/330 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATLV     S   DAEA+  A KGWG  +K +I I+GHRN  QR+ I++AY + YQEDL
Sbjct  1     MATLVVHSQTSSAQDAEALQQAFKGWGADDKAIIAILGHRNVHQRQEIRKAYEEIYQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I+R E E+SG  E+A+YR ML P DRDAVL+NVAI K G  DY VI E AC+   EE L 
Sbjct  61    IKRLESEISGDFERAMYRWMLQPADRDAVLVNVAI-KNGTKDYHVIAEIACVLSAEELLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V+RAY  RYK S EED+A N+T + R+LLV LV  YRY G E++ K +QTE+ +LH ++K
Sbjct  120   VRRAYHRRYKCSLEEDVAANTTGNLRQLLVGLVTSYRYEGDEINVKFSQTEANVLHESVK  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
             +K+ N EE++RIL+TRSK QL+ATFNRY+DEHG +I+K                  L + 
Sbjct  180   EKKGNSEEVIRILTTRSKTQLVATFNRYRDEHGISISKK-----------------LLDQ  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
             T + +   L + IR + D  KYYEK++R A+ K G DED L+RVIVTRAE+DL+ IKE+Y
Sbjct  223   TSDDFHKVLHTAIRCINDHKKYYEKVLRNAVKKFGTDEDGLSRVIVTRAEKDLKDIKELY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGK  177
              KRNSV LE  V+KETSG Y+  LL LLGK
Sbjct  283   YKRNSVHLEDEVSKETSGDYKKFLLTLLGK  312



>ref|XP_003522953.1| PREDICTED: annexin-like protein RJ4-like isoform X1 [Glycine 
max]
Length=314

 Score =   348 bits (893),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 174/332 (52%), Positives = 232/332 (70%), Gaps = 18/332 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATL+ P + SPV DAE++  A KGWG   K +I I+GHRN TQR LI++AY + +QEDL
Sbjct  1     MATLIAPSNHSPVEDAESLRKAVKGWGADGKAIIAILGHRNATQRTLIREAYQNLFQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I+R E ELSG  E+A+YR +L+P +R+A+L N+AI K    +Y+VI+E +C+  PEE   
Sbjct  61    IKRLESELSGDFERAMYRWILEPAEREALLANIAI-KSADKNYQVIVEISCVLSPEELFA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V+RAY  +YKR  EED+A N++   R+LLV LV  +RY GSE++AKLAQ+E+  LH AIK
Sbjct  120   VRRAYHNKYKRCLEEDVAANTSGHLRQLLVGLVSSFRYGGSEINAKLAQSEADALHEAIK  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K  +++EI+RIL+TRSK QL+ATFNRY+D+HG AITK                  L ++
Sbjct  180   NKNKSNDEIIRILTTRSKTQLVATFNRYRDDHGIAITKK-----------------LSDE  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               +++  A    I  + D  KYYEK++R A+   G  ED LTRVIVTRAE+DL+ IKEVY
Sbjct  223   GSDEFHKAANLAISCINDHKKYYEKVLRNAMEHLGTAEDALTRVIVTRAEKDLKEIKEVY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              KRNSV LE AVAKETSG Y+  LL+L+GK+E
Sbjct  283   YKRNSVHLEHAVAKETSGDYKKFLLSLMGKEE  314



>ref|NP_568271.2| annexin D8 [Arabidopsis thaliana]
 sp|Q94CK4.2|ANXD8_ARATH RecName: Full=Annexin D8; AltName: Full=AnnAt8 [Arabidopsis thaliana]
 gb|AED91803.1| annexin D8 [Arabidopsis thaliana]
 emb|CDJ79777.1| annexin D8 [Arabidopsis thaliana]
Length=316

 Score =   348 bits (893),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 173/329 (53%), Positives = 229/329 (70%), Gaps = 18/329 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MAT+V P H SPV DAE I  AC+GWGT+E  +I I+GHRN  QRKLI+QAY + Y EDL
Sbjct  1     MATIVSPPHFSPVEDAENIKAACQGWGTNENAIISILGHRNLFQRKLIRQAYQEIYHEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I + + ELSG+ E+A+   +LDP +RDA+L N+A++K  +PDY+V++E AC+  PE+ L 
Sbjct  61    IHQLKSELSGNFERAICLWVLDPPERDALLANLALQKP-IPDYKVLVEIACMRSPEDMLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
              +RAY+  YK S EEDLA  +  D R+LLVA+V  Y+Y G E+D  LAQ+E+ ILH+ I 
Sbjct  120   ARRAYRCLYKHSLEEDLASRTIGDIRRLLVAMVSAYKYDGEEIDEMLAQSEAAILHDEIL  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K  +HEE +R+LSTRS  QL A FNRYKD +GT+ITK                 DL   
Sbjct  180   GKAVDHEETIRVLSTRSSMQLSAIFNRYKDIYGTSITK-----------------DLLNH  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               N+YL+ALR+ IR + +P +YY K++R ++   G DED L RVIVTRAE+DL  I  +Y
Sbjct  223   PTNEYLSALRAAIRCIKNPTRYYAKVLRNSINTVGTDEDALNRVIVTRAEKDLTNITGLY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLG  180
              KRN+V+L+QA+AKETSG Y+A LLALLG
Sbjct  283   FKRNNVSLDQAIAKETSGDYKAFLLALLG  311



>ref|XP_007148975.1| hypothetical protein PHAVU_005G030100g [Phaseolus vulgaris]
 gb|ESW20969.1| hypothetical protein PHAVU_005G030100g [Phaseolus vulgaris]
Length=314

 Score =   347 bits (891),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 176/332 (53%), Positives = 229/332 (69%), Gaps = 18/332 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATLV     SP  DAE ++ A KGWG+  K +I I+GHRN  QR+ I++AY + YQE+L
Sbjct  1     MATLVLHHQTSPAEDAEVLHQAFKGWGSDGKAIIAILGHRNVHQRQEIRRAYEEIYQENL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I+R E E+SG  E+AVYR ML+  DRDAVL+NVAI K G  +Y VI E + +   +E L 
Sbjct  61    IKRLESEISGDFERAVYRWMLEAADRDAVLINVAI-KNGPKEYHVIAEISSVLSAKELLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V+ AY  RYKRS EED+A ++T   R+LLV LV  YRY G ++ AKLAQTE+ ILH +IK
Sbjct  120   VRSAYHDRYKRSMEEDVAAHTTGHLRQLLVGLVSSYRYEGDDIHAKLAQTEANILHESIK  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
             +K+ NHEE++RIL+TRSK QL+ATFNRY+DEHG +ITK                  L + 
Sbjct  180   EKKANHEEVIRILTTRSKTQLVATFNRYRDEHGISITKK-----------------LVDQ  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
             + + ++  L + IR + DP KYYEK++R A+ K G DED LTRVIVTRAE+DL+ IKE+Y
Sbjct  223   SSDDFVKVLHTVIRCINDPRKYYEKVLRNAMKKFGTDEDGLTRVIVTRAEKDLKDIKEIY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              KRNSV LE  V+KE SG Y+  +L LLG Q+
Sbjct  283   YKRNSVHLEDDVSKEISGDYKRFILTLLGNQD  314



>ref|XP_002527036.1| annexin, putative [Ricinus communis]
 gb|EEF35336.1| annexin, putative [Ricinus communis]
Length=318

 Score =   347 bits (890),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 181/329 (55%), Positives = 228/329 (69%), Gaps = 18/329 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MAT++ P   SPV DAE I  AC GWGT EK +I I+GHRN  QRKLI+ AY + YQEDL
Sbjct  1     MATIIVPKDFSPVEDAENIKRACLGWGTDEKAIISILGHRNSFQRKLIRLAYEEIYQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I + + ELSG+ E+AV    L+P DRDAVL N A++K  +PDYRVI+E +C+  PE+ L 
Sbjct  61    IFQLKSELSGNFERAVCLWTLEPADRDAVLANEALQKV-IPDYRVIVEISCVSSPEDLLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             ++RAY+ RYK S EED+A ++T D RKLLVALV  Y Y G E+D K+A  E+ IL + I 
Sbjct  120   IRRAYRFRYKHSLEEDVASHTTGDIRKLLVALVSAYGYDGPEIDEKVAHLEADILRDNIF  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K +NHEE +RIL+TRSKAQL ATFN YKD HGT+ITK  LV                 D
Sbjct  180   GKAFNHEEFIRILTTRSKAQLKATFNYYKDIHGTSITKVLLV-----------------D  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               +QYL ALR  IR + DP KY+ K++R A+   G DED L+RVIVT AE+DL  IKE+Y
Sbjct  223   HADQYLAALRMVIRCIGDPKKYFAKVLRYAINTEGTDEDALSRVIVTHAEKDLEEIKELY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLG  180
              KRN+V+L+ AV ++TSG Y+A LLALLG
Sbjct  283   LKRNNVSLDVAVGRDTSGDYKAFLLALLG  311



>ref|XP_004511012.1| PREDICTED: annexin-like protein RJ4-like isoform X3 [Cicer arietinum]
Length=311

 Score =   347 bits (890),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 177/330 (54%), Positives = 233/330 (71%), Gaps = 19/330 (6%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATLV     SP+ D+EA+  A KGWGT EK+VI I+GHRN  QR+ I+++Y + YQED+
Sbjct  1     MATLV-TKKSSPIEDSEALQKAFKGWGTDEKSVIEILGHRNVYQRQQIRKSYQEIYQEDI  59

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             ++R E ELSG  E+AVYR ML+P DRDAVL+NVAI+ G    Y VI+E  C+  PEE L 
Sbjct  60    LKRLESELSGDFERAVYRWMLEPADRDAVLVNVAIKDGN-KGYNVIVEIVCVLSPEEVLA  118

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             ++RAYQ RYK S EED+A ++T   R+LLV LVG +RY G E++ +LA+TE+ ILH +IK
Sbjct  119   MRRAYQNRYKHSLEEDVAAHTTGHLRQLLVGLVGSFRYGGDEINPRLAKTEADILHESIK  178

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
             +K+ N+EE +RI++TRSK QL+AT NRY+D+HGT+ITK                  L ++
Sbjct  179   EKKGNYEEAIRIITTRSKTQLLATLNRYRDDHGTSITKK-----------------LLDN  221

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               + +  AL + IR + D  KYYEK++R AL + G DED LTRV+VTRAE+DL+ IKE+Y
Sbjct  222   ASDDFHKALHTAIRCINDHKKYYEKVMRSALKRVGTDEDGLTRVVVTRAEKDLKDIKELY  281

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGK  177
              KRNSV LE  VAKE SG Y+  LL LLGK
Sbjct  282   YKRNSVHLEDEVAKEISGDYKKFLLTLLGK  311



>ref|XP_006289187.1| hypothetical protein CARUB_v10002628mg [Capsella rubella]
 gb|EOA22085.1| hypothetical protein CARUB_v10002628mg [Capsella rubella]
Length=315

 Score =   347 bits (890),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 173/332 (52%), Positives = 229/332 (69%), Gaps = 18/332 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MAT+V P H SPV DAE I  AC+GWGT EK +I I+GHRN  QRKLI+QAY + Y EDL
Sbjct  1     MATIVSPPHFSPVEDAENIKKACQGWGTDEKAIISILGHRNLFQRKLIRQAYQEIYHEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I + + ELSG  E+AV   +LDP +RDA+L N+A++K  +PDY+V++E AC+  PE+ L 
Sbjct  61    IHQLKSELSGDFERAVCLWVLDPPERDALLANLALQKP-IPDYKVLVEIACMRSPEDLLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
              +RAY+  YKRS EEDLA ++  D R+LLVA+V  Y+Y G E+D  LA++E+ ILH+ I 
Sbjct  120   ARRAYRCLYKRSLEEDLASHTIGDIRRLLVAMVSAYKYDGDEIDEMLAKSEAAILHDEIL  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K  +HEE +R+LSTRS  QL A FN YKD  G +ITK                 DL + 
Sbjct  180   GKPVDHEETIRVLSTRSSMQLSAIFNSYKDIFGKSITK-----------------DLLKH  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               N+YL+ALR+ IR + +P +YY K++R ++   G DED L RVIVTRAE+DL+ I E+Y
Sbjct  223   QTNEYLSALRAAIRCIKNPTRYYAKVLRNSINTVGTDEDALNRVIVTRAEKDLKKITELY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              KRN+V+ +QA+AKETSG Y+  LLALLG  E
Sbjct  283   LKRNNVSFDQAIAKETSGDYKGFLLALLGHGE  314



>ref|XP_007148976.1| hypothetical protein PHAVU_005G030200g [Phaseolus vulgaris]
 gb|ESW20970.1| hypothetical protein PHAVU_005G030200g [Phaseolus vulgaris]
Length=314

 Score =   345 bits (885),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 174/332 (52%), Positives = 233/332 (70%), Gaps = 18/332 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATLV P + SPV DAEA+  A KGWG  EK +I I+GHRN  QR  I++AY + +QEDL
Sbjct  1     MATLVAPPNHSPVEDAEALGKAVKGWGADEKAIISILGHRNGAQRTQIREAYQNLFQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I+R E ELSG LE+A+YR +L+P +R+A+L N+A+++     Y+VI+E +C+  P+E   
Sbjct  61    IKRLESELSGDLERAMYRWILEPAEREALLANLALKRDE-KCYQVIVEISCVLSPQELFA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V+ AY  R+KRS EED+A N+T   R+LLV LV  +RY GSE++A+LAQ+E+  LH AIK
Sbjct  120   VRSAYHNRFKRSMEEDVAANTTGHLRQLLVGLVSSFRYGGSEINARLAQSEADALHEAIK  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
             KK  ++EEI+RIL+TRSK QL+ATFNRYKD+HG AITK                  L ++
Sbjct  180   KKNESNEEIIRILTTRSKTQLVATFNRYKDDHGIAITKK-----------------LSDE  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               +++  A    I  + D  KYYEK++R A+   G DE+ LTRVIVTRAE+DL+ IK+VY
Sbjct  223   GSDEFHMAANLAISCINDHKKYYEKVLRNAMGSIGTDEEALTRVIVTRAEKDLKEIKDVY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              KRNSV LE AVAKETSG Y+  LL L+GK++
Sbjct  283   YKRNSVHLEHAVAKETSGDYKKFLLTLMGKED  314



>gb|KHN25117.1| Annexin-like protein RJ4 [Glycine soja]
Length=313

 Score =   345 bits (884),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 175/332 (53%), Positives = 235/332 (71%), Gaps = 19/332 (6%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATL+ P + SP  DAEA+  A +GWGT EKTVI I+GHR   QR+ I++ Y + +QEDL
Sbjct  1     MATLIAPSNHSPQEDAEALRKAFEGWGTDEKTVIVILGHRTVYQRQQIRRVYEEIFQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             ++R E E+ G  EKAVYR +L+P DRDAVL NVAI+ G   +Y VI+E A I  PEE L 
Sbjct  61    VKRLESEIKGDFEKAVYRWILEPADRDAVLANVAIKNG--KNYNVIVEIATILSPEELLA  118

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V+RAY  RYK S EED+A +++   R+LLV LV  YRY G E++ KLAQTE+ ILH+A+K
Sbjct  119   VRRAYLNRYKHSLEEDVAAHTSGHLRQLLVGLVTSYRYVGDEINPKLAQTEAEILHDAVK  178

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
             +K+ ++EE +R+L+TRS+ QL+ATFNRY++ HGT+I+K                  L ++
Sbjct  179   EKKGSYEETIRVLTTRSRTQLVATFNRYREIHGTSISKK-----------------LVDE  221

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               +++  AL + IR + DP KYYEK++R A+ K G DED LTRV+V+RAE+DL+ I EVY
Sbjct  222   GSDEFQRALYTAIRGINDPIKYYEKVVRNAIKKVGTDEDALTRVVVSRAEKDLKIISEVY  281

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              KRNSV LE A+AKETSG Y+  LL LLGK++
Sbjct  282   YKRNSVLLEHAIAKETSGDYKKFLLTLLGKED  313



>emb|CDX69683.1| BnaA10g20320D [Brassica napus]
Length=315

 Score =   343 bits (881),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 173/329 (53%), Positives = 226/329 (69%), Gaps = 18/329 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MAT+V P H SPV DAE I  AC+G+GT EK +I I+GHRN  QRKLI+QAY + Y EDL
Sbjct  1     MATIVSPSHFSPVEDAENIKKACQGFGTDEKAIISILGHRNLFQRKLIRQAYQEIYHEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I + + ELSG  EKA+   +LDP +RDA+L N+A++K  VPD +V++E AC+  PE+ L 
Sbjct  61    IHQLKSELSGDFEKAICLWVLDPPERDALLANLALQKP-VPDCKVLVEIACMRSPEDLLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
              +RAY+  YKRS EEDLA  +T D RKLLVA V  Y+Y G E+D  LA +E+ ILH+ I 
Sbjct  120   TRRAYRCLYKRSLEEDLASRTTGDIRKLLVATVSAYKYDGDEIDETLAHSEAAILHDEIL  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K   HEE +R++STR+  QL A FNRYKD +G +ITK                 D+   
Sbjct  180   DKAVGHEETIRVISTRTSVQLCAIFNRYKDVYGRSITK-----------------DILSH  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               N+YL+ALR+ IR   +P++YY K++R A+   G DED LTRVIVTRAE+DL+ I E+Y
Sbjct  223   PTNEYLSALRAAIRCTKNPNRYYAKVLRNAINTAGTDEDALTRVIVTRAEKDLKNITELY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLG  180
              KRN+ +L+QA+AKETS  Y+A LLALLG
Sbjct  283   HKRNNESLDQAIAKETSRDYKAFLLALLG  311



>emb|CAA75308.1| annexin [Medicago truncatula]
 emb|CAD29698.1| annexin [Medicago truncatula]
 gb|KEH19109.1| annexin D8 [Medicago truncatula]
Length=313

 Score =   342 bits (876),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 178/332 (54%), Positives = 230/332 (69%), Gaps = 19/332 (6%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATL  P + SP  DAEA+  A +GWGT EKTVI I+GHRN  Q + I++AY   Y EDL
Sbjct  1     MATLSAPSNHSPNEDAEALRKAFEGWGTDEKTVITILGHRNSNQIQQIRKAYEGIYNEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I+R E E+ G  EKAVYR +L+P +RDAVL NVAI+ G   +Y VI+E + +  PEE L 
Sbjct  61    IKRLESEIKGDFEKAVYRWILEPAERDAVLANVAIKSG--KNYNVIVEISAVLSPEELLN  118

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V+RAY  RYK S EEDLA +++   R+LLV LV  +RY G E++ KLAQTE+ ILH ++K
Sbjct  119   VRRAYVKRYKHSLEEDLAAHTSGHLRQLLVGLVTAFRYVGDEINPKLAQTEAGILHESVK  178

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
             +K+ +HEE +RIL+TRSK QLIATFNRY++ HGT+ITK                  L ++
Sbjct  179   EKKGSHEEAIRILTTRSKTQLIATFNRYRETHGTSITKK-----------------LLDE  221

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               +++  AL +TIR+  D  KYYEK++R A+ K G DED LTRVIV+RA+ DL+ I +VY
Sbjct  222   GSDEFQKALYTTIRSFNDHVKYYEKVVRDAIKKVGTDEDALTRVIVSRAQHDLKVISDVY  281

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              KRNSV LE  VAKETSG Y+  LL LLGK+E
Sbjct  282   YKRNSVLLEHVVAKETSGDYKKFLLTLLGKEE  313



>emb|CDX97190.1| BnaC09g44350D [Brassica napus]
Length=315

 Score =   342 bits (876),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 174/329 (53%), Positives = 226/329 (69%), Gaps = 18/329 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MAT+V P H SPV DAE I  AC+G+GT EK +I I+GHRN  QRKLI+QAY + Y EDL
Sbjct  1     MATIVSPPHFSPVEDAENIKKACQGFGTDEKAIISILGHRNLFQRKLIRQAYQEIYHEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I + + ELSG  EKA+   +LDP +RDA+L N+A++K  VPD +V+IE AC+  PE+ L 
Sbjct  61    IHQLKSELSGDFEKAICLWVLDPPERDALLANLALQKP-VPDSKVLIEIACMRSPEDLLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
              +RAY+  YKRS EEDLA  +T D RKLLVA    Y+Y G E D  LA +E+ ILH+ I 
Sbjct  120   TRRAYRCLYKRSLEEDLASRTTGDIRKLLVATASAYKYDGEEFDETLAHSEAAILHDEIL  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K  +HEE +R++STRS  QL A FNRYKD +G +ITK                 D+   
Sbjct  180   GKAVDHEETIRVISTRSGVQLCAIFNRYKDIYGRSITK-----------------DMLSH  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               N+YL+ALR+ IR + +P++YY K++R A+   G DED LTRVIVTRAE+DL+ I E+Y
Sbjct  223   PTNEYLSALRAAIRCIKNPNRYYAKVLRNAINTAGTDEDALTRVIVTRAEKDLKKITELY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLG  180
              KRN+ +L+QA+AKETS  Y+A LLALLG
Sbjct  283   HKRNNESLDQAIAKETSRDYKAFLLALLG  311



>ref|XP_009121851.1| PREDICTED: annexin D8 [Brassica rapa]
Length=315

 Score =   341 bits (874),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 171/329 (52%), Positives = 227/329 (69%), Gaps = 18/329 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MAT+V P H SPV DAE I  AC+G+GT EK +I I+GHRN  QRKLI+QAY + Y EDL
Sbjct  1     MATIVSPPHFSPVEDAENIKKACQGFGTDEKAIISILGHRNLFQRKLIRQAYQEIYHEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I + + ELSG  E+A+   +LDP +RDA+L N+A++K  VPD +V++E AC+  P++ L 
Sbjct  61    IHQLKSELSGDFERAICLWVLDPPERDALLANLALQKP-VPDCKVLVEIACMRSPDDLLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
              +RAY+  YKRS EEDLA  +T D RKLLVA    Y+Y G E+D  LA +E+ ILH+ I 
Sbjct  120   TRRAYRCLYKRSLEEDLASRTTGDIRKLLVATASAYKYDGEEIDETLAHSEAAILHDEIL  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K  +HEE +R++STRS  QL A FNRYKD +G +ITK                 D+   
Sbjct  180   GKAVDHEETIRVISTRSSMQLCAIFNRYKDLYGRSITK-----------------DILSH  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               N+YL+ALR+ IR + +P++YY K++R A+   G DED LTRVIVTRAE+DL+ I E+Y
Sbjct  223   PTNEYLSALRAAIRCIKNPNRYYAKVLRNAINTAGTDEDALTRVIVTRAEKDLKNITELY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLG  180
              KRN+ +L+QA+AKETS  Y+A LLALLG
Sbjct  283   HKRNNESLDQAIAKETSRDYKAFLLALLG  311



>ref|NP_001241261.1| uncharacterized protein LOC100796092 [Glycine max]
 gb|ACU23046.1| unknown [Glycine max]
Length=313

 Score =   340 bits (873),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 174/332 (52%), Positives = 234/332 (70%), Gaps = 19/332 (6%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATL+ P + SP  DAEA+  A +GWGT EKTVI I+GHR   QR+ I++ Y + +QEDL
Sbjct  1     MATLIAPSNHSPQEDAEALRKAFEGWGTDEKTVIVILGHRTVYQRQQIRRVYEEIFQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             ++R E E+ G  EKAVYR +L+P DRDAVL NVAI+ G   +Y VI+E A I  PEE L 
Sbjct  61    VKRLESEIKGDFEKAVYRWILEPADRDAVLANVAIKNG--KNYNVIVEIATILSPEELLA  118

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V+RAY  RYK S EED+A +++   R+LLV LV  YRY G E++ KLAQTE+ ILH+A+K
Sbjct  119   VRRAYLNRYKHSLEEDVAAHTSGHLRQLLVGLVTSYRYVGDEINPKLAQTEAEILHDAVK  178

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
             +K+ ++EE +R+L+TRS+ QL+ATFN Y++ HGT+I+K                  L ++
Sbjct  179   EKKGSYEETIRVLTTRSRTQLVATFNCYREIHGTSISKK-----------------LVDE  221

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               +++  AL + IR + DP KYYEK++R A+ K G DED LTRV+V+RAE+DL+ I EVY
Sbjct  222   GSDEFQRALYTAIRGIKDPIKYYEKVVRNAIKKVGTDEDALTRVVVSRAEKDLKIISEVY  281

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              KRNSV LE A+AKETSG Y+  LL LLGK++
Sbjct  282   YKRNSVLLEHAIAKETSGDYKKFLLTLLGKED  313



>gb|KHG12913.1| Annexin-like protein RJ4 [Gossypium arboreum]
Length=314

 Score =   340 bits (873),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 170/331 (51%), Positives = 232/331 (70%), Gaps = 18/331 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MAT+  P   S   DAEA+  AC+GWGT EK +I ++G RN  QR+ I+  Y + YQEDL
Sbjct  1     MATVSAPKQVSVKEDAEALRKACQGWGTDEKAIIAVLGRRNAAQRRQIRHVYEEIYQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I+R E ELSG  EKAVYR +LDP DRDAVL NV ++K G  ++ VI+E +C   PEE L 
Sbjct  61    IKRLESELSGHFEKAVYRWILDPPDRDAVLANVELKKSG-DEHHVIVEISCTKNPEELLD  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             ++RAY ARYKRS EED+A ++  D R+LLVALV  +RY G E++  LA++E+  LH A+K
Sbjct  120   IRRAYHARYKRSLEEDVAYHTKGDTRRLLVALVSAFRYYGEEINTTLAKSEAKKLHEAVK  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K++ +E+++RILSTRS AQL ATFN Y++E GT+ITK                 +L +D
Sbjct  180   NKKFGNEDVIRILSTRSIAQLQATFNCYREEEGTSITK-----------------NLPKD  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
             + ++Y+  LR  +R + DP KY+EK++RR++   G DED LTRVIVTRAE+DL+ IKE+Y
Sbjct  223   SSDEYIATLRMAVRCLKDPKKYFEKVLRRSIEGIGTDEDALTRVIVTRAEKDLKEIKELY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQ  174
             +KRN+V L++AV KE SG Y+ +LL LLG +
Sbjct  283   RKRNNVPLDKAVDKEISGDYKDMLLTLLGNE  313



>gb|AET02254.2| annexin D8 [Medicago truncatula]
Length=313

 Score =   340 bits (873),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 176/332 (53%), Positives = 230/332 (69%), Gaps = 19/332 (6%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATLV  D  + V DAE ++ + +GWGT EKTVI I+GHRN  Q + I++AY   Y EDL
Sbjct  1     MATLVVQDSTASVQDAELLHKSFEGWGTDEKTVITILGHRNSNQIQQIRKAYEGIYNEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I+R E E+ G  EKAVYR +L+P +RDAVL NVAI+ G   +Y VI+E + +  PEE L 
Sbjct  61    IKRLESEIKGDFEKAVYRWILEPAERDAVLANVAIKSG--KNYNVIVEISAVLSPEELLN  118

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V+RAY  RYK S EEDLA +++   R+LLV LV  +RY G E++ KLAQTE+ ILH ++K
Sbjct  119   VRRAYVKRYKHSLEEDLAAHTSGHLRQLLVGLVTAFRYVGDEINPKLAQTEAGILHESVK  178

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
             +K+ +HEE +RIL+TRSK QLIATFNRY++ HGT+ITK                  L ++
Sbjct  179   EKKGSHEEAIRILTTRSKTQLIATFNRYRETHGTSITKK-----------------LLDE  221

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               +++  AL +TIR+  D  KYYEK++R A+ K G DED LTRVIV+RA+ DL+ I +VY
Sbjct  222   GSDEFQKALYTTIRSFNDHVKYYEKVVRDAIKKVGTDEDALTRVIVSRAQHDLKVISDVY  281

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              KRNSV LE  VAKETSG Y+  LL LLGK+E
Sbjct  282   YKRNSVLLEHVVAKETSGDYKKFLLTLLGKEE  313



>ref|XP_007133790.1| hypothetical protein PHAVU_011G209300g [Phaseolus vulgaris]
 gb|ESW05784.1| hypothetical protein PHAVU_011G209300g [Phaseolus vulgaris]
Length=313

 Score =   340 bits (871),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 171/332 (52%), Positives = 232/332 (70%), Gaps = 19/332 (6%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATL+ P + SP  DAEA+  + +GWGT E T+I I+GHR   QR+ I++AY + YQEDL
Sbjct  1     MATLIAPSNHSPQEDAEALRKSFEGWGTDENTIIAILGHRTVHQRQQIRRAYEEIYQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             ++R E E+ G  EKAVYR +L+P DRDA+L NVAI+ G   +Y VI+E A I  PEE L 
Sbjct  61    VKRLESEIKGDFEKAVYRWILEPADRDAILANVAIKSG--KNYNVIVEIATINSPEELLA  118

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V+RAY  RYK S EEDLA ++T   R+LLV LV  +RY G E++ KLAQ E+ ILH+A+K
Sbjct  119   VRRAYLHRYKHSLEEDLAAHTTGPLRQLLVGLVTSFRYVGDEINPKLAQNEAEILHDAVK  178

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
             +K+ ++EE +R+L+TRSK QL+ATFNRY++ HG +I+K                  L ++
Sbjct  179   EKKSSYEEAIRVLTTRSKTQLVATFNRYREIHGGSISKK-----------------LVDE  221

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               + +  AL +TIR++ D  KYYEK++R A+ K G DED LTRV+V+RAE+DL+ + EVY
Sbjct  222   GSDDFEKALHTTIRSINDHFKYYEKVVRNAIKKVGTDEDALTRVVVSRAEKDLKTVSEVY  281

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              KRNSV LE A+AKE SG Y+  LL LLGK++
Sbjct  282   YKRNSVLLEHAIAKEISGDYKKFLLTLLGKED  313



>ref|XP_004511010.1| PREDICTED: annexin-like protein RJ4-like isoform X1 [Cicer arietinum]
Length=321

 Score =   340 bits (871),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 177/340 (52%), Positives = 234/340 (69%), Gaps = 29/340 (9%)
 Frame = -3

Query  1166  MATLVFPDHPSPV----------ADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQ  1017
             MATLV     SP+           DAEA++ A +GWGT EK+VI I+GHRN  QR+ I++
Sbjct  1     MATLV-TKKSSPIEDSEALQKAFKDAEALHKAFQGWGTDEKSVIEILGHRNVYQRQQIRK  59

Query  1016  AYHDQYQEDLIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQA  837
             +Y + YQED+++R E ELSG  E+AVYR ML+P DRDAVL+NVAI+ G    Y VI+E  
Sbjct  60    SYQEIYQEDILKRLESELSGDFERAVYRWMLEPADRDAVLVNVAIKDGN-KGYNVIVEIV  118

Query  836   CIYCPEEFLGVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQT  657
             C+  PEE L ++RAYQ RYK S EED+A ++T   R+LLV LVG +RY G E++ +LA+T
Sbjct  119   CVLSPEEVLAMRRAYQNRYKHSLEEDVAAHTTGHLRQLLVGLVGSFRYGGDEINPRLAKT  178

Query  656   ESLILHNAIKKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLK  477
             E+ ILH +IK+K+ N+EE +RI++TRSK QL+AT NRY+D+HGT+ITK            
Sbjct  179   EADILHESIKEKKGNYEEAIRIITTRSKTQLLATLNRYRDDHGTSITKK-----------  227

Query  476   LFFLQDLKEDTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAE  297
                   L ++  + +  AL + IR + D  KYYEK++R AL + G DED LTRV+VTRAE
Sbjct  228   ------LLDNASDDFHKALHTAIRCINDHKKYYEKVMRSALKRVGTDEDGLTRVVVTRAE  281

Query  296   RDLRGIKEVYQKRNSVTLEQAVAKETSGHYEALLLALLGK  177
             +DL+ IKE+Y KRNSV LE  VAKE SG Y+  LL LLGK
Sbjct  282   KDLKDIKELYYKRNSVHLEDEVAKEISGDYKKFLLTLLGK  321



>ref|XP_010536110.1| PREDICTED: annexin D8 [Tarenaya hassleriana]
Length=315

 Score =   338 bits (867),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 171/332 (52%), Positives = 227/332 (68%), Gaps = 18/332 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATLV P    P+ DAE I  AC+G GT E+ +I I+GHRN  QRKLI+QAY + Y EDL
Sbjct  1     MATLVAPHQFHPMEDAEKIKKACQGLGTDERAIISILGHRNMFQRKLIRQAYQELYSEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I + + ELSG  EKA+   ++DP +RDAVL N AI K  VPDY+ ++E +C+  PE+ L 
Sbjct  61    IHQMKSELSGDFEKAICLWVMDPPERDAVLANSAIHKP-VPDYKALVEISCMRSPEDLLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V+R YQ RYKRS EEDLA +++ D R+LLVA+   Y+Y G E+D  LAQ+E+ ILH+ I 
Sbjct  120   VRRYYQTRYKRSLEEDLASHTSGDIRRLLVAMSSAYKYDGDEMDEMLAQSEAGILHDEIV  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K  +HEE +R+LSTRS  QL A FNRYKD +G ++TK                 DL   
Sbjct  180   GKAVDHEETIRVLSTRSTTQLNAIFNRYKDIYGRSVTK-----------------DLLNH  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               + YL+ LR+ IR + +P++YY K++R A+ + G DED L+RVIVTRAE+DL+ I E+Y
Sbjct  223   PTDDYLSTLRAAIRCIKNPNRYYAKVLRNAINEVGTDEDALSRVIVTRAEKDLKKIDELY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              KRN+ +L Q+VAKETSG Y+A LLALLG +E
Sbjct  283   LKRNNASLLQSVAKETSGDYKAFLLALLGTEE  314



>ref|XP_007015223.1| Annexin 8 [Theobroma cacao]
 gb|EOY32842.1| Annexin 8 [Theobroma cacao]
Length=313

 Score =   337 bits (864),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 170/331 (51%), Positives = 225/331 (68%), Gaps = 18/331 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MAT++ P   SPV DAE I  AC+GWGT EK +I I+GHRN  Q+KLI+ A+ + Y EDL
Sbjct  1     MATIISPKQFSPVEDAENIKKACQGWGTDEKAIISILGHRNLFQKKLIRLAFEEIYHEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             +++ + ELSG  ++A+    LDP DRDA+L   A++K   PDYR I+E AC   PE+ L 
Sbjct  61    LQQLKCELSGDFQRAISLWTLDPADRDALLAYEALQKT-TPDYRAIVEIACTGSPEDLLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             VKRAY+ RYKRS EEDLA  ++ D RKLLVA+   YRY G E D  +A +E+ +LH  I 
Sbjct  120   VKRAYKFRYKRSLEEDLASYTSGDIRKLLVAVTSAYRYDGDEFDETVAHSEASVLHKEIH  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
             +K +NHEE++RILSTRSKAQL ATFN YKD HG +ITK                  L   
Sbjct  180   EKAFNHEEMIRILSTRSKAQLNATFNLYKDIHGRSITK-----------------GLLGG  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               + Y +ALR+ +R + DP KYY K++R A+   G DED L+RVI+TRAE+DL+ IKE+Y
Sbjct  223   PSDDYFSALRTVVRCIRDPKKYYAKVLRTAINMPGTDEDALSRVIITRAEKDLKEIKELY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQ  174
              KRN+V+L+ AV +++SG Y+A LLALLG +
Sbjct  283   LKRNNVSLDDAVGRDSSGDYKAFLLALLGAE  313



>ref|XP_010931989.1| PREDICTED: annexin-like protein RJ4 [Elaeis guineensis]
Length=311

 Score =   337 bits (863),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 175/329 (53%), Positives = 229/329 (70%), Gaps = 21/329 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATL  P+  PSPV DAE +  A +GWGT EK VI I+ HR+  QRK I+ AY + Y+E+
Sbjct  1     MATLTVPEPVPSPVEDAERLRKAFQGWGTDEKAVIAILAHRDAAQRKQIRLAYEELYKEN  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             LI+R E ELSG  E+AVYR M DP +R+A++ NVA++K    DY+VIIE AC+  P+E L
Sbjct  61    LIKRLESELSGDFERAVYRWMFDPVEREAIMANVALKKN--VDYQVIIEIACVNSPKELL  118

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              VK+AY  RYK S EED+A  +  DFRKLLVALV  YRY G E+D  LA++E+ ILH+ I
Sbjct  119   VVKQAYHGRYKHSLEEDVASKTIGDFRKLLVALVSTYRYDGEEIDTGLAKSEAKILHDVI  178

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
             ++K +N EEI+RILSTRSKAQL ATFN YKDE+G+ ITK                  L  
Sbjct  179   EQKIFNDEEIIRILSTRSKAQLNATFNCYKDEYGS-ITKA-----------------LAS  220

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             ++ N++  ALR  IR +  P KY+ K++R A+ K+G DED LTRVIV  AE+DL+ IKE+
Sbjct  221   ESPNEFALALRIAIRCITSPKKYFAKVLRHAVDKSGTDEDALTRVIVMHAEKDLKEIKEM  280

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALL  183
             + +R +V LE AVAK+TSG Y++ LLAL+
Sbjct  281   FHERTNVALEHAVAKQTSGDYKSFLLALI  309



>ref|XP_009413531.1| PREDICTED: annexin-like protein RJ4 [Musa acuminata subsp. malaccensis]
Length=312

 Score =   336 bits (862),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 167/330 (51%), Positives = 223/330 (68%), Gaps = 20/330 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATL  P+  PS   DAE I+ ACKGWGT E  +I I+ HR+ TQRK+I+ A+ +QY+E+
Sbjct  1     MATLAVPETIPSASEDAEQIWKACKGWGTDETALITILAHRDATQRKIIRLAFEEQYKEN  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             LI R E ELSG LE+AVY  + DP +R+A++ N+A++K    DY+ IIE AC+  P+E L
Sbjct  61    LIMRLESELSGDLERAVYLWIFDPVEREAIIANIAVKKN--IDYQAIIEIACVNSPKELL  118

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              VK  Y ARYKRS EED+A ++  DFR+LLV+LV  YRY G E D  + + E+  LH+AI
Sbjct  119   AVKEEYHARYKRSLEEDIAVHTVGDFRQLLVSLVSTYRYDGDETDTGVVRLEAKTLHDAI  178

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
             K + +NH E++RILSTRSKAQL ATFN YKDE+G  ITK                  L  
Sbjct  179   KSQTFNHSEVIRILSTRSKAQLCATFNYYKDEYGIPITKA-----------------LTS  221

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             ++ N++  ALR  IR +V P K++ K+++ A+ K G DED LTRVIV  AE+DL+ IKE+
Sbjct  222   ESPNEFALALRMAIRCIVSPQKHFAKVLQNAVGKAGTDEDALTRVIVMHAEKDLKVIKEI  281

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLG  180
             + KR + TL+ AV  ET GHY + LLAL+G
Sbjct  282   FHKRTNATLKHAVGTETCGHYNSFLLALVG  311



>ref|NP_001242031.1| uncharacterized protein LOC100784424 [Glycine max]
 gb|ACU21331.1| unknown [Glycine max]
Length=313

 Score =   334 bits (857),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 171/332 (52%), Positives = 231/332 (70%), Gaps = 19/332 (6%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATL+ P + SP  DAEA+  A +GWGT E TVI I+GHR   QR+ I++ Y + YQEDL
Sbjct  1     MATLIAPSNHSPQEDAEALRKAFEGWGTDENTVIVILGHRTVYQRQQIRRVYEEIYQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             ++R E E+ G  EKAVYR +L+P DRDAVL NVAI+ G   +Y VI+E A I  PEE L 
Sbjct  61    VKRLESEIKGDFEKAVYRWILEPADRDAVLANVAIKSG--KNYNVIVEIATILSPEELLA  118

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V+RAY  RYK S EED+A +++   R+LLV LV  +R+ G E++ KLAQ+E+ ILH+A+K
Sbjct  119   VRRAYLNRYKHSLEEDVAAHTSGHLRQLLVGLVTAFRHVGDEINPKLAQSEAEILHDAVK  178

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
             +K+ ++EE +R+L TRS+ QL+ATFN Y++ HGT+I+K                  L  +
Sbjct  179   EKKGSYEETIRVLITRSRTQLVATFNHYREIHGTSISKK-----------------LVGE  221

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               +++  AL + IRA+ DP KYYEK++R A+ K G DED LTRV+V+RAE+DL+ I EVY
Sbjct  222   GSDEFQRALYTAIRAINDPIKYYEKVVRNAIKKVGTDEDALTRVVVSRAEKDLKIISEVY  281

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              KRNSV LE A+AKE SG Y+  LL LLGK++
Sbjct  282   YKRNSVLLEHAIAKEISGDYKKFLLTLLGKED  313



>gb|AFK41857.1| unknown [Lotus japonicus]
Length=313

 Score =   333 bits (854),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 173/332 (52%), Positives = 228/332 (69%), Gaps = 19/332 (6%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATL+ P + SP  DAE++  A +GWGT E  VI I+GHRN  QR+ I++AY + YQEDL
Sbjct  1     MATLIAPSNHSPQTDAESLKKAFEGWGTDENLVISILGHRNVHQRQAIRRAYEEIYQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
              +R E E+ G LEKAVYR  L+  DRDAVL+NV I+ G   +Y VI+E + +  PEE   
Sbjct  61    AKRLESEIKGDLEKAVYRWNLEHADRDAVLINVVIKSG--KNYHVIVEISSVLSPEELFA  118

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V+RAY  RYK S EED+A +++   R+LLV LV  +RY G E++AKLAQ+E+ ILH A+K
Sbjct  119   VRRAYLNRYKHSLEEDVAAHTSGHLRQLLVGLVTSFRYVGEEINAKLAQSEAEILHEAVK  178

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
             +K+ +HEE +RIL+TRSK QLIATFNRY++ HGT+ITK                  L ++
Sbjct  179   EKKGSHEEAIRILTTRSKTQLIATFNRYREIHGTSITKK-----------------LLDE  221

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               + +   L + IR   D  KYYEK++R A+ K+G DED LTRVIV+RAE+DL+ I +VY
Sbjct  222   KSDDFQKGLYTAIRCFNDHIKYYEKVVRDAIKKSGTDEDALTRVIVSRAEKDLKLISDVY  281

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              KRNSV LE AVAKE SG Y+  LL LLGK++
Sbjct  282   YKRNSVHLEDAVAKEISGDYKKFLLTLLGKED  313



>ref|XP_002298480.1| annexin family protein [Populus trichocarpa]
 gb|EEE83285.1| annexin family protein [Populus trichocarpa]
Length=315

 Score =   333 bits (853),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 172/332 (52%), Positives = 230/332 (69%), Gaps = 18/332 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MAT+V P   SPV DAE I  AC G GT EK +I ++G+RN  QRKLI+ AY + Y EDL
Sbjct  1     MATVVAPKDFSPVEDAETIKKACLGLGTDEKAIISVLGNRNSFQRKLIRLAYEEIYHEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I + + E+SG  E+A+ +  L+P DRDAVL N A++K   PDYRVI+E AC+  PE+ L 
Sbjct  61    IHQLKSEISGDFERAMSQWTLEPADRDAVLANAALQKSK-PDYRVIVEIACVGSPEDLLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             VKRAY+ RY+ S EED+A ++  D RK+LVALV  YRY G EVD  LA +E+ +LH+ + 
Sbjct  120   VKRAYRFRYRHSLEEDVALHTKGDIRKVLVALVSAYRYDGHEVDEDLAISEAGLLHDDVY  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K +NH+E+VR+L+TRSKAQL ATFNRY+D HG +ITK                  L  D
Sbjct  180   GKAFNHDELVRVLTTRSKAQLNATFNRYQDIHGKSITKG-----------------LLGD  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               ++YL ALR+ +R + DP KY+ K++RRA+ K   DED L+RVIVTRAE+DL+ IKE+Y
Sbjct  223   PIDEYLGALRTAVRCIRDPRKYFVKVLRRAVHKEDTDEDALSRVIVTRAEKDLKEIKELY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              KRN+++L+QAVA +T G Y+  LL LLG ++
Sbjct  283   LKRNNISLDQAVAVDTHGEYKEFLLTLLGNEK  314



>ref|XP_010670446.1| PREDICTED: annexin-like protein RJ4 [Beta vulgaris subsp. vulgaris]
Length=311

 Score =   332 bits (851),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 175/332 (53%), Positives = 224/332 (67%), Gaps = 22/332 (7%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATL  P+H  P+ADAEA+  AC+GWGT EK +I IIGHRN  QR LIK+ Y  Q+ E+L
Sbjct  1     MATLNSPEHTDPLADAEALRKACEGWGTDEKGIIEIIGHRNAAQRMLIKEVYEQQFNENL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I+RFEKELSG  EKAVYR MLDP DR+AVL + A++K    D++VIIE +CI   EE L 
Sbjct  61    IKRFEKELSGDFEKAVYRWMLDPCDREAVLAHNALKKA---DFKVIIELSCIPSAEELLA  117

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             VKRAYQARYK S EED+A + + D RKLL+ LV VYRY     + KL ++E+ +LH  IK
Sbjct  118   VKRAYQARYKHSLEEDVACHFSGDMRKLLLLLVSVYRYETEVSEPKLVESEAELLHKYIK  177

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              KEYNH+EI+RIL+TRSK QLI+TF R+ D   T I +                     D
Sbjct  178   DKEYNHDEIIRILTTRSKIQLISTFYRFGDICETPIVESL-------------------D  218

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
             + + ++ AL++ IR +  P +Y E+++  AL K G DE+ LTRVIVTRAE+DL  IKE++
Sbjct  219   SDDDFVVALQAAIRCIKSPQEYLEQVLTDALMKHGTDEEALTRVIVTRAEKDLADIKELF  278

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              KR+S TLE  V KET   YE  LL LLGK++
Sbjct  279   YKRHSRTLEHVVLKETRSDYETFLLTLLGKED  310



>ref|XP_002279669.1| PREDICTED: annexin D8 [Vitis vinifera]
 emb|CBI24222.3| unnamed protein product [Vitis vinifera]
Length=321

 Score =   332 bits (851),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 173/334 (52%), Positives = 227/334 (68%), Gaps = 18/334 (5%)
 Frame = -3

Query  1172  RSMATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQE  993
             ++MATLV P+  SP  DA AI  AC+GWGT EK +I I+GHRN  QRK I+ AY + Y E
Sbjct  5     KTMATLVAPEDFSPGEDALAINRACQGWGTDEKAIISILGHRNAAQRKQIRLAYQEIYLE  64

Query  992   DLIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEF  813
             DL ++ + ELSG LE+A+   +LDP +RDAVL N A++K   PDYRVI+E A +  PEE 
Sbjct  65    DLTKQLKSELSGDLERAICHWILDPVERDAVLANEALKKAR-PDYRVILETAYMKSPEEL  123

Query  812   LGVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNA  633
             L VKRAYQ  YKRS EED+A ++T D R+LL+A+V VYRY G E+D  +A +E+ IL + 
Sbjct  124   LAVKRAYQFLYKRSLEEDVASHTTGDMRRLLIAVVSVYRYEGEEIDEGVAHSEANILGDE  183

Query  632   IKKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLK  453
             ++      EEI+RILSTRSKAQLIATFN YK  HGT+ITK                  L+
Sbjct  184   MQGGALKGEEIIRILSTRSKAQLIATFNNYKQIHGTSITKS-----------------LR  226

Query  452   EDTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKE  273
              D   ++  ALR+ IR + +P KY +KL+   +   G DED L+RVI+TRAE+DL+ +KE
Sbjct  227   GDPTEEFSAALRAAIRCIRNPKKYLQKLLCNVINNMGTDEDTLSRVIITRAEKDLKEMKE  286

Query  272   VYQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
             +Y +RNS +LE AV+ ET+G Y+A LL LLG QE
Sbjct  287   LYLERNSRSLEDAVSSETTGDYKAFLLTLLGNQE  320



>ref|XP_003627778.1| Annexin-like protein RJ4 [Medicago truncatula]
Length=339

 Score =   333 bits (853),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 175/329 (53%), Positives = 227/329 (69%), Gaps = 20/329 (6%)
 Frame = -3

Query  1154  VFPD-HPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDLIRR  978
             V P  + SP  DAEA+  A +GWGT EKTVI I+GHRN  Q + I++AY   Y EDLI+R
Sbjct  30    VLPKFNHSPNEDAEALRKAFEGWGTDEKTVITILGHRNSNQIQQIRKAYEGIYNEDLIKR  89

Query  977   FEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLGVKR  798
              E E+ G  EKAVYR +L+P +RDAVL NVAI+ G   +Y VI+E + +  PEE L V+R
Sbjct  90    LESEIKGDFEKAVYRWILEPAERDAVLANVAIKSG--KNYNVIVEISAVLSPEELLNVRR  147

Query  797   AYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIKKKE  618
             AY  RYK S EEDLA +++   R+LLV LV  +RY G E++ KLAQTE+ ILH ++K+K+
Sbjct  148   AYVKRYKHSLEEDLAAHTSGHLRQLLVGLVTAFRYVGDEINPKLAQTEAGILHESVKEKK  207

Query  617   YNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKEDTGN  438
              +HEE +RIL+TRSK QLIATFNRY++ HGT+ITK                  L ++  +
Sbjct  208   GSHEEAIRILTTRSKTQLIATFNRYRETHGTSITKK-----------------LLDEGSD  250

Query  437   QYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVYQKR  258
             ++  AL +TIR+  D  KYYEK++R A+ K G DED LTRVIV+RA+ DL+ I +VY KR
Sbjct  251   EFQKALYTTIRSFNDHVKYYEKVVRDAIKKVGTDEDALTRVIVSRAQHDLKVISDVYYKR  310

Query  257   NSVTLEQAVAKETSGHYEALLLALLGKQE  171
             NSV LE  VAKETSG Y+  LL LLGK+E
Sbjct  311   NSVLLEHVVAKETSGDYKKFLLTLLGKEE  339



>gb|KHN37647.1| Annexin-like protein RJ4 [Glycine soja]
Length=322

 Score =   332 bits (850),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 172/341 (50%), Positives = 234/341 (69%), Gaps = 28/341 (8%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATL+ P + SP  DAEA+  A +GWGT E TVI I+GHR   QR+ I++ Y + YQEDL
Sbjct  1     MATLIAPSNHSPQEDAEALRKAFEGWGTDENTVIVILGHRTVYQRQQIRRVYEEIYQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             ++R E E+ G  EKAVYR +L+P DRDAVL NVAI+ G   +Y VI+E A I  PEE L 
Sbjct  61    VKRLESEIKGDFEKAVYRWILEPADRDAVLANVAIKSG--KNYNVIVEIATILSPEELLA  118

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRK---------LLVALVGVYRYSGSEVDAKLAQTE  654
             V+RAY  RYK S EED+A +++   R+         LLV LV  +R+ G E++ KLAQ+E
Sbjct  119   VRRAYLNRYKHSLEEDVAAHTSGHLRQASSCVHLTHLLVGLVTAFRHVGDEINPKLAQSE  178

Query  653   SLILHNAIKKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKL  474
             + ILH+A+K+K+ ++EE +R+L+TRS+ QL+ATFNRY++ HGT+I+K             
Sbjct  179   AEILHDAVKEKKGSYEETIRVLTTRSRTQLVATFNRYREIHGTSISKK------------  226

Query  473   FFLQDLKEDTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAER  294
                  L ++  +++  AL + IRA+ DP KYYEK++R A+ K G DED LTRV+V+RAE+
Sbjct  227   -----LVDEGSDEFQRALYTAIRAINDPIKYYEKVVRNAIKKVGTDEDALTRVVVSRAEK  281

Query  293   DLRGIKEVYQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
             DL+ I EVY KRNSV LE A+AKE SG Y+  LL LLGK++
Sbjct  282   DLKIISEVYYKRNSVLLEHAIAKEISGDYKKFLLTLLGKED  322



>gb|AAA79922.1| annexin, partial [Fragaria x ananassa]
Length=271

 Score =   328 bits (841),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 171/289 (59%), Positives = 209/289 (72%), Gaps = 18/289 (6%)
 Frame = -3

Query  1037  QRKLIKQAYHDQYQEDLIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDY  858
             +RK I+ AY   YQEDL++  E ELSG  EKAVYR  LDP DRDAVL NVAI+K     Y
Sbjct  1     ERKEIRAAYEQLYQEDLLKPLESELSGDFEKAVYRWTLDPADRDAVLANVAIKKS-TDVY  59

Query  857   RVIIEQACIYCPEEFLGVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEV  678
              VIIE +CI+ PEE L V+RAYQ RYK S EEDLA ++T D RKLLVALV  YRY G E+
Sbjct  60    NVIIEISCIHSPEELLAVRRAYQLRYKHSVEEDLAAHTTGDIRKLLVALVTAYRYDGHEI  119

Query  677   DAKLAQTESLILHNAIKKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV  498
             +AKLA +E+ ILH+AIK K +NHEEI+RILSTRSK QL+ATFN+Y+D+ G +I+K     
Sbjct  120   NAKLANSEADILHDAIKDKAFNHEEIIRILSTRSKTQLMATFNKYRDDQGISISK-----  174

Query  497   *SWSNLKLFFLQDLKEDTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTR  318
                         +L E+  N +  AL + IR + DP KY+EK++R A+ + G DED LTR
Sbjct  175   ------------NLLEEGANDFQKALHTAIRCLNDPKKYFEKVLRNAIKRVGTDEDALTR  222

Query  317   VIVTRAERDLRGIKEVYQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
             VIVTRAERDLR IKEVY K+NSV LEQAVAK+TSG Y+A LL LLGK++
Sbjct  223   VIVTRAERDLRDIKEVYYKKNSVPLEQAVAKDTSGDYKAFLLTLLGKED  271



>gb|AIY34673.1| annexin4 [Galtonia saundersiae]
Length=310

 Score =   330 bits (845),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 173/331 (52%), Positives = 227/331 (69%), Gaps = 22/331 (7%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATL  P   P+P  DA+A+  AC+GWGT EK VI +I HRN  Q +LIK AY   Y E+
Sbjct  1     MATLNVPHPVPTPEEDAQALRKACQGWGTDEKGVIEVIAHRNADQLRLIKLAYERLYNEN  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             LI+R E ELSG  E+AVYR M  P +R+A+L +VA+ +    D+RVI+E ACI    E L
Sbjct  61    LIKRLESELSGDFERAVYRWMHPPTEREALLAHVAVTES---DHRVIVETACINSTNELL  117

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              VK+AY A YKRS EED+A +++ D RK LVAL+G YRY G +V+ +LA++E+ ILH+AI
Sbjct  118   VVKKAYHALYKRSLEEDVASHTSGDMRKFLVALLGTYRYDGPDVNIRLAESEAKILHDAI  177

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
             K+K ++HEE++RIL TRSKAQL+ATFNRYKDE G +ITK                 DL  
Sbjct  178   KEKVFSHEEVIRILGTRSKAQLVATFNRYKDEFGVSITK-----------------DLSG  220

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
              T + ++ ALR  +R +V P KYYEKL++ A +  G  ED LTRVIVTRAE+DL+ IKE+
Sbjct  221   KTSDDFVAALRVAVRCIVAPKKYYEKLLQSATSNPGY-EDALTRVIVTRAEKDLKEIKEL  279

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGK  177
             ++ R +  LEQA++ + SG Y   LLALLGK
Sbjct  280   FEHRTNALLEQAISNKASGDYRKFLLALLGK  310



>ref|XP_004511017.1| PREDICTED: annexin-like protein RJ4-like [Cicer arietinum]
Length=314

 Score =   328 bits (842),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 171/331 (52%), Positives = 221/331 (67%), Gaps = 18/331 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             M+TLV P +  P  DA+ ++ A KGWGT E ++I I+GHRN  QR+ I+ AY+D YQEDL
Sbjct  1     MSTLVAPKNHFPKDDADVLWKAVKGWGTDESSIIDIMGHRNAAQRQQIRLAYNDIYQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I+R E ELSG  EKA+YR +L+P +R AVL NVAIR     DY VI+E AC+  P+E L 
Sbjct  61    IKRLESELSGDFEKAMYRWILEPAERYAVLANVAIRNAN-KDYHVIVEIACVLHPDELLS  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V+ AY  RYK S EED+A  +    R+LLV LV  +RY G E++  LA+ E+ ILH AIK
Sbjct  120   VRHAYHNRYKHSLEEDVAAYTNGHLRQLLVGLVTSFRYDGIEINPSLAKFEANILHEAIK  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
               + N EE++RILSTRSK QL+ATFN Y+D H  +ITK                  L  +
Sbjct  180   DNKGNLEEVIRILSTRSKTQLLATFNSYRDLHSISITKK-----------------LLNE  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               + +L A+   IR + D  KYYEK++R AL + G DED LTRV+VTRAE+DL+ IKE+Y
Sbjct  223   VSDDFLKAVHVAIRCLNDHKKYYEKVLRNALKRVGTDEDGLTRVVVTRAEKDLKDIKELY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQ  174
              KRNSV +E AVAKE SG+Y+  LL LLGK+
Sbjct  283   YKRNSVHIEDAVAKEISGNYKRFLLTLLGKE  313



>ref|XP_011024946.1| PREDICTED: annexin D8-like [Populus euphratica]
Length=315

 Score =   327 bits (839),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 169/332 (51%), Positives = 227/332 (68%), Gaps = 18/332 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MAT+V P   SPV DAE I  AC G GT EK +I ++G+RN  QRKLI+ AY + Y EDL
Sbjct  1     MATVVAPKDFSPVEDAETIKKACFGLGTDEKAIISVLGNRNSFQRKLIRLAYEEIYHEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I + + E+SG  E+A+    L+P DRDAVL N A++K   PDYRVI+E AC+  PE+ L 
Sbjct  61    IHQLKSEISGDFERAMSHWTLEPADRDAVLANAALQKSK-PDYRVIVEIACVGSPEDLLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             VKRAY+ RY+ S EED+A ++  D RK+LVALV  YRY G E+D  LA +E+ +LH+ + 
Sbjct  120   VKRAYRFRYRHSLEEDVALHTKGDIRKVLVALVSAYRYDGHEIDEDLAISEAGLLHDDVY  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K +NH+E+VR+L+TRSKAQL ATFNRY+D HG +I K                  L  D
Sbjct  180   GKAFNHDELVRVLTTRSKAQLNATFNRYQDIHGKSIAKG-----------------LLGD  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               ++YL ALR+ +R + D  KY+ K++RRA+ K   DED L+RVIVTRAE+DL+ IKE+Y
Sbjct  223   PIDEYLGALRTAVRCLRDSRKYFVKVLRRAVHKEDTDEDALSRVIVTRAEKDLKEIKELY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              KRN+++L+QAVA +T G Y+  LL LLG ++
Sbjct  283   LKRNNISLDQAVAADTHGEYKEFLLTLLGNEK  314



>gb|KFK25510.1| hypothetical protein AALP_AA8G124300 [Arabis alpina]
Length=320

 Score =   327 bits (839),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 163/332 (49%), Positives = 222/332 (67%), Gaps = 19/332 (6%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MAT+V P H SPV DAE I  AC+GWGT EK ++ I+GHRN  QRKLI+QAY + Y EDL
Sbjct  1     MATIVSPSHFSPVEDAENIKKACQGWGTDEKAIVSILGHRNLFQRKLIRQAYQEIYHEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I + + ELSG  E+A+   ++DP +RDA L  +A++  G  DY+V++E +C+  PE+ L 
Sbjct  61    IHQLKSELSGDFERAICLWVMDPPERDAHLAKLALQ--GPIDYKVLVEISCMRSPEDLLA  118

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
              +RAY+  YKRS EEDLA  +T + R LLVA+   Y+Y G E+D  LA +E+ ILH+ I+
Sbjct  119   TRRAYRCLYKRSLEEDLAARTTGEIRSLLVAMATAYKYDGKEIDEMLAMSEASILHDEIR  178

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
                 +HEE + +LSTRS AQL A FN YKD +G +IT+                 DL   
Sbjct  179   GNAVDHEETISVLSTRSSAQLCAIFNHYKDTYGRSITR-----------------DLLRH  221

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               N+YL+ALR+ IR + +P++YY K++R A+   G DE  LTRVIVTRAE+DL+ I +++
Sbjct  222   PTNEYLSALRAAIRCIKNPNRYYAKVLRNAINTVGTDEYALTRVIVTRAEKDLKNISDLF  281

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              KRN+V+L QA+ KETSG Y+  LLALLG  E
Sbjct  282   FKRNNVSLRQAIEKETSGDYKDFLLALLGNDE  313



>ref|XP_004139124.1| PREDICTED: annexin D8-like [Cucumis sativus]
 gb|KGN66532.1| hypothetical protein Csa_1G627420 [Cucumis sativus]
Length=321

 Score =   326 bits (835),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 169/330 (51%), Positives = 222/330 (67%), Gaps = 19/330 (6%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATL+ P + SPV DAE I  AC G GT E  +I I+GHRN TQRKLI+ AY + Y EDL
Sbjct  1     MATLITPKYFSPVEDAENIKKACLGLGTDENAIISILGHRNATQRKLIRLAYEEIYNEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I++   EL G  E+A+    LDP DRDA L N A+ K   PDYRVIIE AC+   E+ L 
Sbjct  61    IQQLNSELCGDFERAICHWTLDPADRDATLANNAL-KSSTPDYRVIIEIACVQSAEDLLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             VKRAY+ R+KRS EED+A  +T + RKLLV +V  YR  G+E+D  +A+ E+ I+ + IK
Sbjct  120   VKRAYRFRFKRSLEEDVASCTTGNMRKLLVGVVSAYRCEGNEIDENMAELEANIIDDEIK  179

Query  626   KKEY-NHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
              K   N+EE++RI+STRSK QL ATFNRY+D H T+ITK                  L  
Sbjct  180   GKGLKNNEEMIRIVSTRSKPQLHATFNRYRDIHATSITKG-----------------LIG  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D+ ++YL ALR+ IR + DP KYY K++R A+     D+D ++RVIVTRAE+DL+ I E+
Sbjct  223   DSSDEYLAALRTVIRCIRDPKKYYAKVLRNAMNTDRVDKDGISRVIVTRAEKDLKEIMEM  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLG  180
             Y KRN+++LE+AV++E  G Y+A LLALLG
Sbjct  283   YLKRNNISLEEAVSREIGGDYKAFLLALLG  312



>ref|XP_003627776.1| Annexin [Medicago truncatula]
 gb|AET02252.1| annexin D8 [Medicago truncatula]
Length=314

 Score =   325 bits (833),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 172/330 (52%), Positives = 221/330 (67%), Gaps = 18/330 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATL+ P + SP  DA+ ++ A KGWGT E  +I I+G RN  QR+ I+QAY D YQEDL
Sbjct  1     MATLIAPMNHSPKEDADVLWKAVKGWGTDESAIIAIMGQRNAVQRQQIRQAYQDIYQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I+R E ELSG+ EKA+YR +LDP DR AVL NVAI K    DY VI+E A +  P+E L 
Sbjct  61    IKRLESELSGNFEKAMYRWILDPADRYAVLANVAI-KSINKDYHVIVEIASVLQPQELLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V+ AY  RYK S EED+A +++   R+LLV LV  +RY G E++  LA+ E+ ILH A+K
Sbjct  120   VRHAYHNRYKNSLEEDVAAHTSGYHRQLLVGLVSSFRYDGVEINPILAKHEADILHEAVK  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K+ N EE++RIL TRSK QL ATFNRY+D+HG +I+K                  L  +
Sbjct  180   NKKGNIEEVIRILITRSKTQLKATFNRYRDDHGFSISKK-----------------LLNE  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               + +L A+   IR + D  KYYEK++R AL + G DED LTRV++TRAE+DL+ IKE+Y
Sbjct  223   ASDDFLKAVHVAIRCIDDHKKYYEKVLRGALKRIGTDEDGLTRVVITRAEKDLKDIKELY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGK  177
              KRNSV LE  VAKE SG Y+  LL LLGK
Sbjct  283   YKRNSVHLEDTVAKEISGDYKKFLLTLLGK  312



>ref|XP_008786903.1| PREDICTED: annexin-like protein RJ4 [Phoenix dactylifera]
Length=310

 Score =   325 bits (833),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 171/330 (52%), Positives = 225/330 (68%), Gaps = 22/330 (7%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATL  PD  PSP  DAE +  A +GWGT EK VI I+ HR+  QR+ I+ AY + Y+E+
Sbjct  1     MATLTVPDPIPSPAEDAEKLRKAFQGWGTDEKAVIAILAHRDAAQREQIRLAYEELYKEN  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             LI R E ELSG  E+AVYR + DP +R+A++ NVA++K    DY+VIIE AC+  P+E L
Sbjct  61    LITRLESELSGHFERAVYRWIFDPVEREAIMANVALKKN--VDYQVIIEIACVNSPKELL  118

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              VK+AY ARYK S EED+A N+  DFRKLLVALV  YRY G E +  LA++E+ ILH+ I
Sbjct  119   AVKQAYHARYKHSLEEDVASNTIGDFRKLLVALVSTYRYDGEETNTGLAKSEAKILHDVI  178

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
             ++K +N +E++RILSTRSKAQL ATFN YKDE+G+ ITK                  L  
Sbjct  179   EQKIFNDDEVIRILSTRSKAQLTATFNCYKDEYGS-ITKA-----------------LAG  220

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             ++ N++  ALR  IR +  P KY+ K++R  +  +GADED LTRVIV  AE+DL+ IKE+
Sbjct  221   ESPNEFALALRIAIRCITSPKKYFAKVLRHGV-DSGADEDALTRVIVMHAEKDLKEIKEM  279

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLG  180
             + KR +  L  AVAK TSG Y++ LLAL+G
Sbjct  280   FHKRTNAALGHAVAKVTSGDYKSFLLALIG  309



>ref|XP_010046708.1| PREDICTED: annexin D8 [Eucalyptus grandis]
 gb|KCW87211.1| hypothetical protein EUGRSUZ_B03725 [Eucalyptus grandis]
Length=318

 Score =   325 bits (833),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 159/334 (48%), Positives = 225/334 (67%), Gaps = 18/334 (5%)
 Frame = -3

Query  1172  RSMATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQE  993
             + ++TLV P   SPV DAEAI  AC+GWGT E+ +I ++GHRN  QR+LI+ AY + Y E
Sbjct  2     KKVSTLVAPKDFSPVEDAEAIKEACQGWGTDERAIISVLGHRNMFQRRLIRLAYEEVYHE  61

Query  992   DLIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEF  813
             DLIR+ + ELSG  E A+   +LDP DRDAV  N+A++K   P++RVI+E A +  PEE 
Sbjct  62    DLIRQLQSELSGHFETAMCHWILDPADRDAVFANLALKKA-TPNHRVIVELASLKSPEEL  120

Query  812   LGVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNA  633
             L ++RAY+ RY+RS EED+A +++ D R++LVAL   YRY G ++D ++ + E+ IL++ 
Sbjct  121   LAIRRAYKFRYRRSLEEDVAAHTSGDVRRILVALASAYRYDGDDIDKEMVKLEATILYDE  180

Query  632   IKKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLK  453
             I    +NHEE++RILSTRSK QL +TFN Y+D HGT+ITK                  L 
Sbjct  181   IHSNSFNHEELIRILSTRSKVQLNSTFNHYRDIHGTSITK-----------------GLS  223

Query  452   EDTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKE  273
              D  ++YL  LR+ IR + +P KY  K++R A+     DED L+RVI+T AE+DL  IKE
Sbjct  224   GDPADEYLAGLRTAIRCIKEPKKYLAKVLRTAVNAVVTDEDALSRVILTCAEKDLAEIKE  283

Query  272   VYQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
             ++ +RNS +LE+AVA  TSG ++  LL LLG ++
Sbjct  284   LFFRRNSTSLEEAVANSTSGDFKNFLLTLLGSED  317



>ref|XP_004511018.1| PREDICTED: annexin-like protein RJ4-like [Cicer arietinum]
Length=314

 Score =   324 bits (830),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 166/329 (50%), Positives = 224/329 (68%), Gaps = 19/329 (6%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             M+T++ P   +P  DAEA+  A +GWGT E TVI I+GHR   Q +LI+++Y D Y EDL
Sbjct  1     MSTVIAPSINTPQEDAEALRKAFEGWGTDENTVISILGHRTSHQIQLIRKSYEDIYHEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             ++R E E+ G  EKAVYR +L+P DRDAVL++VAI+ G   +Y VI+E + +  PEE   
Sbjct  61    VKRLESEIKGDFEKAVYRWILEPADRDAVLVHVAIKSG--KNYNVIVEISSVLSPEELFN  118

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             V+RAY  RYK S EEDLA +++   R+LLV LV  YRY+G E++AKLAQ+E+ ILH ++K
Sbjct  119   VRRAYINRYKHSIEEDLAIHTSGHLRQLLVGLVTSYRYTGDEINAKLAQSEAEILHESVK  178

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
             +K+ +HEE +RIL+TRSK QLIATFNRY++ HG +ITK                  L ++
Sbjct  179   EKKGSHEEAIRILTTRSKTQLIATFNRYRETHGGSITKK-----------------LLDE  221

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               + +  +L +TIR   D  KYYEK++R A+ K G DED LTRVIV+RA  DL+ I +VY
Sbjct  222   GSDDFQKSLYTTIRCFNDHVKYYEKVVRDAVKKIGTDEDALTRVIVSRAYTDLKNISDVY  281

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLG  180
              KRNSV LE  +AKE SG Y+  LL +LG
Sbjct  282   YKRNSVLLEHVIAKEISGDYKKFLLTILG  310



>ref|XP_008794526.1| PREDICTED: annexin D1-like [Phoenix dactylifera]
Length=315

 Score =   323 bits (827),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 168/332 (51%), Positives = 220/332 (66%), Gaps = 19/332 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MA+L  P   PSP  DAE +  A +GWGT+E  +I I+GHR+  QR+ I+QAY   Y E+
Sbjct  1     MASLKVPATVPSPSEDAEQLRKAFEGWGTNEGLIISILGHRSAAQRRAIRQAYRQSYDEE  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  + E+SG  E+AV    LDP +RDA L N A+RK   P+ RV+IE AC     E  
Sbjct  61    LLKALDGEISGDFERAVLLWTLDPAERDAWLANEAVRKWR-PENRVLIEIACARSSGELF  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              V++AY AR+KRS EED+A ++T DFRKLLV LV  YRY G E++  LA++E+ +LH  I
Sbjct  120   AVRQAYHARFKRSLEEDVAAHTTGDFRKLLVPLVSAYRYEGEEINLTLAKSEARMLHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
               K YNHEE++RIL+TRSKAQLI TFN Y DE G  + K                 DLK 
Sbjct  180   SDKAYNHEELIRILTTRSKAQLIKTFNHYNDEFGKPVNK-----------------DLKS  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  + +L ALR+TIR +  P +Y+EK+IR A+   G DE+ LTRVI  RAE DL+ I EV
Sbjct  223   DPKDDFLAALRATIRCICCPERYFEKVIRLAINGLGTDENALTRVITIRAEVDLKVIAEV  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQ  174
             YQKRNS+ LE+A+  +TSG YEA+LLALLG++
Sbjct  283   YQKRNSMPLERAIKGDTSGDYEAMLLALLGQE  314



>ref|XP_009413545.1| PREDICTED: annexin D2-like [Musa acuminata subsp. malaccensis]
Length=316

 Score =   320 bits (820),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 167/330 (51%), Positives = 220/330 (67%), Gaps = 19/330 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             M+TL FP   PSP  D E ++ A +GWGT+E  +I ++ HR    R+ I++AY + Y ED
Sbjct  1     MSTLTFPGSLPSPADDCEQLHKAFQGWGTNEGLIISVLAHRPAAHRREIRRAYAEIYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KEL+   E+AV   +LD  +RDAVL N  +RK   P  RV+IE A     +E  
Sbjct  61    LLKALDKELTRDFERAVLLWVLDAAERDAVLANEVVRKWS-PGNRVLIEIAVARTADELF  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
               KRAYQAR+KRS EED+A ++  DFRKLLV LV  YRY GSEV+A LA++E+ +LH  I
Sbjct  120   AAKRAYQARFKRSLEEDVAAHTNGDFRKLLVPLVSSYRYEGSEVNASLAKSEAKMLHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
             K K+YNHEE++RIL+TRSKAQL+ATFN YK++ G  I K                 DLK 
Sbjct  180   KGKDYNHEEVIRILTTRSKAQLLATFNDYKNQFGNPINK-----------------DLKS  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  N++L+ LR+ IR +  P +Y EK+IR A+ K G DE  LTRVI TRAE D++ IKE+
Sbjct  223   DPKNEFLSVLRAIIRCITCPERYLEKVIRLAINKMGTDEGSLTRVITTRAEVDMKQIKEL  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLG  180
             Y KRNSVTL +AV K+T+G YE  LLAL+G
Sbjct  283   YHKRNSVTLYRAVKKDTTGDYEDFLLALIG  312



>ref|XP_006578485.1| PREDICTED: annexin-like protein RJ4-like isoform X2 [Glycine 
max]
Length=291

 Score =   319 bits (817),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 160/308 (52%), Positives = 214/308 (69%), Gaps = 18/308 (6%)
 Frame = -3

Query  1094  GWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDLIRRFEKELSGSLEKAVYRLMLDPE  915
              WG   K +I I+GHRN TQR LI++AY + +QEDLI+R E ELSG  E+A+YR +L+P 
Sbjct  2     SWGADGKAIIAILGHRNATQRTLIREAYQNLFQEDLIKRLESELSGDFERAMYRWILEPA  61

Query  914   DRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLGVKRAYQARYKRSFEEDLAQNSTAD  735
             +R+A+L N+AI K    +Y+VI+E +C+  PEE   V+RAY  +YKR  EED+A N++  
Sbjct  62    EREALLANIAI-KSADKNYQVIVEISCVLSPEELFAVRRAYHNKYKRCLEEDVAANTSGH  120

Query  734   FRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIKKKEYNHEEIVRILSTRSKAQLIAT  555
              R+LLV LV  +RY GSE++AKLAQ+E+  LH AIK K  +++EI+RIL+TRSK QL+AT
Sbjct  121   LRQLLVGLVSSFRYGGSEINAKLAQSEADALHEAIKNKNKSNDEIIRILTTRSKTQLVAT  180

Query  554   FNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKEDTGNQYLTALRSTIRAMVDPHKYYE  375
             FNRY+D+HG AITK                  L ++  +++  A    I  + D  KYYE
Sbjct  181   FNRYRDDHGIAITKK-----------------LSDEGSDEFHKAANLAISCINDHKKYYE  223

Query  374   KLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVYQKRNSVTLEQAVAKETSGHYEALL  195
             K++R A+   G  ED LTRVIVTRAE+DL+ IKEVY KRNSV LE AVAKETSG Y+  L
Sbjct  224   KVLRNAMEHLGTAEDALTRVIVTRAEKDLKEIKEVYYKRNSVHLEHAVAKETSGDYKKFL  283

Query  194   LALLGKQE  171
             L+L+GK+E
Sbjct  284   LSLMGKEE  291



>ref|XP_010268092.1| PREDICTED: annexin D1 [Nelumbo nucifera]
Length=316

 Score =   318 bits (816),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 162/333 (49%), Positives = 219/333 (66%), Gaps = 19/333 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             M+TLV P+  PS + D E +  A +GWGT+EK +I I+ HRN  QRK+I+Q Y ++Y ED
Sbjct  1     MSTLVVPESIPSAIEDCEQLRKAFQGWGTNEKLIISILAHRNAAQRKIIRQTYAEKYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  E+EL+   E  V    LDP DRDA L N A RK    + +V++E AC     E L
Sbjct  61    LLKSLERELTSDFEIVVLLWTLDPTDRDAFLANEATRKWKATN-QVLLEIACTRTSNELL  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
               ++AY AR+KRS EED+A ++T DFRKLLV LV  YRY G EV+  LA++E+ ILH  I
Sbjct  120   SARQAYHARFKRSLEEDVAYHTTGDFRKLLVPLVSSYRYEGPEVNTTLAKSEAKILHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
             K+K YNHE+++RIL+TRSK QLIATFN Y ++ G AI K                 DLK 
Sbjct  180   KEKAYNHEDVIRILTTRSKEQLIATFNNYNNDFGNAINK-----------------DLKA  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  +++  ALR+ ++ +  P KY+EK +R A+ K G DE  LTR++ TRA  D++ IKE 
Sbjct  223   DPKDEFQAALRALVKCLTRPEKYFEKALRLAINKNGTDEFALTRIVTTRAGVDMKKIKEE  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
             YQ+RNSV LE+A+  +TSGHYE +LLAL+G  E
Sbjct  283   YQRRNSVPLERAIGSDTSGHYEEMLLALIGHGE  315



>ref|XP_009395142.1| PREDICTED: annexin-like protein RJ4 [Musa acuminata subsp. malaccensis]
Length=312

 Score =   318 bits (814),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 168/331 (51%), Positives = 223/331 (67%), Gaps = 22/331 (7%)
 Frame = -3

Query  1166  MATLVFPDHPSPVA--DAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQE  993
             MATL  P HP P A  DAE I  A +GWGT EK +I ++ HR+  QRK I+ AY + Y E
Sbjct  1     MATLTIP-HPVPSAAEDAEHIRKAVQGWGTDEKALILVLAHRDAAQRKHIQLAYEEMYNE  59

Query  992   DLIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEF  813
             +LI+R E EL+G  E+AVYR + DP +R+AV+  VA++K    +Y+VIIE AC+   +E 
Sbjct  60    NLIKRLESELTGHFERAVYRWIFDPIEREAVMAYVALKKTF--NYQVIIEIACVNSSKEL  117

Query  812   LGVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNA  633
             L VK AY ARYK S EED+A ++  DFRKLLVALV  YRY G E+D  LA++E+ IL + 
Sbjct  118   LAVKEAYHARYKHSLEEDVAAHTVGDFRKLLVALVSTYRYGGDEIDISLAKSEARILQDV  177

Query  632   IKKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLK  453
             IK+K+ NHEE +RIL TRSKAQL ATFN Y++++GT I                  + L 
Sbjct  178   IKQKKLNHEETIRILGTRSKAQLNATFNCYREDYGTPIE-----------------ESLA  220

Query  452   EDTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKE  273
              +  N++ +ALR  I  +V+P  Y+ +++  AL+K   DED LTRVIV  AE+DLRGIKE
Sbjct  221   GEDPNEFASALRMAIGCIVNPQPYFVEVLHDALSKPDTDEDTLTRVIVMHAEKDLRGIKE  280

Query  272   VYQKRNSVTLEQAVAKETSGHYEALLLALLG  180
             +YQ RN+V LEQAV ++TSG Y+  LLAL+G
Sbjct  281   MYQSRNNVPLEQAVRQKTSGDYKTFLLALIG  311



>ref|XP_010939631.1| PREDICTED: annexin D1-like [Elaeis guineensis]
Length=315

 Score =   315 bits (806),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 163/331 (49%), Positives = 217/331 (66%), Gaps = 19/331 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MA+L  P   PSP  DAE +  A +GWGT+E  +I I+GHR   QR+ I+QAY   Y ED
Sbjct  1     MASLKVPATVPSPSEDAEQLRKAFEGWGTNEALIISILGHRTADQRRAIRQAYRQAYNED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  + E+SG  E+ V    LD  +RDA L N A+RK   P  RV+IE AC    +E  
Sbjct  61    LLKSLDGEISGDFERVVLLWTLDSAERDAWLANEAVRKWR-PGNRVLIEIACARSSKELF  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              V++AY +R+KRS EED+A ++T DFRKLLV LV  +RY G E++  LA++E+ +L   I
Sbjct  120   AVRQAYHSRFKRSLEEDVAVHTTGDFRKLLVPLVSAFRYEGPEINLTLAKSEAKMLREKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
               K YNHEE++RIL+TRSKAQL+ATFN Y D  G  + K                 DLK 
Sbjct  180   SDKAYNHEELIRILTTRSKAQLVATFNHYNDAFGNPVNK-----------------DLKS  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  +++L ALR+TIR +  P +Y+EK+IR A+   G DE+ LTRVI TRAE DL+ + EV
Sbjct  223   DPKDEFLAALRATIRCICCPERYFEKVIRLAINGLGTDENALTRVIATRAEVDLKVVAEV  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGK  177
             YQKRNS+ LE+A+  +TSG YEA+LLALLG+
Sbjct  283   YQKRNSMPLERAIKGDTSGDYEAMLLALLGQ  313



>ref|XP_003546292.1| PREDICTED: annexin D8-like [Glycine max]
Length=313

 Score =   314 bits (804),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 158/331 (48%), Positives = 216/331 (65%), Gaps = 18/331 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATL+   H S + DAE I  ACKG GT E  +I I+ HRN  QRKL++ AY + YQEDL
Sbjct  1     MATLIAAKHSSSIEDAENIKKACKGLGTDETALISILAHRNVAQRKLVRMAYEELYQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I++F+ ELSGS E+A+    +DP +RDA  +N A++K   PDY+VI+E  C    EEFL 
Sbjct  61    IQQFKSELSGSFERAICNWTMDPAERDAAFINEALKKE-TPDYKVIVEIVCTRTSEEFLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
              KR+YQ +YK   EED+A  +  D R+LLVA++  YRY G E D  LA  E+ ILH  I+
Sbjct  120   AKRSYQFQYKHCLEEDVASKTIGDIRRLLVAVISTYRYDGDEFDENLAHLEANILHQVIE  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K +N +EI+RIL TRSK QL ATF+ +++ +GT ITK                  L  +
Sbjct  180   NKAFNDDEIIRILCTRSKKQLCATFSTFRNVYGTTITKG-----------------LSTN  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               ++Y+TALR+ IR + +P +Y  K++  AL +  A+E +L+RVI+TRAERDL  I ++Y
Sbjct  223   PNDEYMTALRTVIRCIKNPRRYLAKVLCYALNELIAEEHELSRVIITRAERDLNEINDLY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQ  174
              KRN VTL+ +VAK+TSG+Y+  LLALLG  
Sbjct  283   FKRNGVTLDSSVAKKTSGNYKNFLLALLGNN  313



>gb|KHN14285.1| Annexin D8, partial [Glycine soja]
Length=320

 Score =   314 bits (804),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 158/331 (48%), Positives = 216/331 (65%), Gaps = 18/331 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATL+   H S + DAE I  ACKG GT E  +I I+ HRN  QRKL++ AY + YQEDL
Sbjct  8     MATLIAAKHSSSIEDAENIKKACKGLGTDETALISILAHRNVAQRKLVRMAYEELYQEDL  67

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I++F+ ELSGS E+A+    +DP +RDA  +N A++K   PDY+VI+E  C    EEFL 
Sbjct  68    IQQFKSELSGSFERAICNWTMDPAERDAAFINEALKKE-TPDYKVIVEIVCTRTSEEFLA  126

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
              KR+YQ +YK   EED+A  +  D R+LLVA++  YRY G E D  LA  E+ ILH  I+
Sbjct  127   AKRSYQFQYKHCLEEDVASKTIGDIRRLLVAVISTYRYDGDEFDENLAHLEANILHQVIE  186

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K +N +EI+RIL TRSK QL ATF+ +++ +GT ITK                  L  +
Sbjct  187   NKAFNDDEIIRILCTRSKKQLCATFSTFRNVYGTTITKG-----------------LSTN  229

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               ++Y+TALR+ IR + +P +Y  K++  AL +  A+E +L+RVI+TRAERDL  I ++Y
Sbjct  230   PNDEYMTALRTVIRCIKNPRRYLAKVLCYALNELIAEEHELSRVIITRAERDLNEINDLY  289

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQ  174
              KRN VTL+ +VAK+TSG+Y+  LLALLG  
Sbjct  290   FKRNGVTLDSSVAKKTSGNYKNFLLALLGNN  320



>ref|XP_007147424.1| hypothetical protein PHAVU_006G123400g [Phaseolus vulgaris]
 gb|ESW19418.1| hypothetical protein PHAVU_006G123400g [Phaseolus vulgaris]
Length=313

 Score =   312 bits (800),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 159/331 (48%), Positives = 218/331 (66%), Gaps = 18/331 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             M TL+  +  SP+ DAE I NACKG+GT E  +I I+ HRN T+RKL++ AY + Y EDL
Sbjct  1     MTTLIAANDSSPIEDAENIKNACKGFGTDEAALISILAHRNVTERKLVRMAYEEIYHEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I++ + ELSGS ++ + +  +DP +RDA  +   ++K  V DY+VIIE AC    EEFL 
Sbjct  61    IQQLKSELSGSFQRGMCKWTMDPAERDAAFIKETLKKETV-DYKVIIEIACTRTSEEFLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             VKR+YQ  YK S EED+A  +  D R+LLVA+V  YRY G E D  LA  E+ ILH AI+
Sbjct  120   VKRSYQLLYKHSLEEDVASKTIGDIRRLLVAVVSTYRYEGEEFDESLANLEANILHQAIE  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
             KK +  +EI+RILSTRSK QL ATF+ +++ +GT ITK                  L  D
Sbjct  180   KKVFCDDEIIRILSTRSKKQLFATFSTFRNTYGTTITKG-----------------LSSD  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
             + ++Y+  LR+TIR + +P +Y  K+I  AL    A+E  L+RVI+TRAE+DL  I ++Y
Sbjct  223   SSDEYMVTLRTTIRCIKNPKRYLAKVICYALNDLVAEEHALSRVIITRAEKDLNEISDLY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQ  174
              KRN VTL+ +VA++TSG+Y+  LLALLGK 
Sbjct  283   FKRNGVTLQNSVAEKTSGNYKTFLLALLGKN  313



>ref|XP_006839165.1| hypothetical protein AMTR_s00097p00076000 [Amborella trichopoda]
 gb|ERN01734.1| hypothetical protein AMTR_s00097p00076000 [Amborella trichopoda]
Length=316

 Score =   311 bits (797),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 167/333 (50%), Positives = 221/333 (66%), Gaps = 21/333 (6%)
 Frame = -3

Query  1166  MATLVFPDHPSPVA--DAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQE  993
             M+T+  P HP P A  D+E +  A +GWG+ +KT+I I+GHRN +QRKLI++AY + Y+E
Sbjct  1     MSTITVP-HPPPSATDDSEKLREAFEGWGSDKKTIISILGHRNASQRKLIREAYAEIYKE  59

Query  992   DLIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEF  813
             DL +R E EL    E+A+    LDP +RDAVL N A+RKG   D RV++E AC    EE 
Sbjct  60    DLCKRLEYELIRHFERAMLLWALDPAERDAVLANGALRKGETCD-RVVLEIACARSAEEL  118

Query  812   LGVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNA  633
             L V+RAY  R+KRS EED+A ++T D RKLLVA+V  YRY G EV+A LA  E+  L++A
Sbjct  119   LMVRRAYHERFKRSLEEDIASHTTGDIRKLLVAMVSSYRYEGPEVNASLASKEAQALNDA  178

Query  632   IKKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLK  453
             I+   +N EE++RILS+RSK QL AT N+YKD  GT I K                 +LK
Sbjct  179   IQSNCFNDEEVIRILSSRSKHQLNATLNKYKDYFGTHIIK-----------------NLK  221

Query  452   EDTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKE  273
                 ++++ A+R  IR +  P KY+EK+IR A+   G DE+ LTR I+TRAE DLR IKE
Sbjct  222   SSPEDKFIPAIRIMIRCIYSPQKYFEKVIRHAIVGLGTDEEMLTRAIITRAEVDLREIKE  281

Query  272   VYQKRNSVTLEQAVAKETSGHYEALLLALLGKQ  174
              YQKRNS +LE+AVA +TSG Y+  LL LLG +
Sbjct  282   AYQKRNSKSLEKAVADDTSGDYKDFLLTLLGAE  314



>gb|ACF81674.1| unknown [Zea mays]
 gb|AFW73484.1| annexin p35 [Zea mays]
Length=314

 Score =   311 bits (796),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 165/332 (50%), Positives = 214/332 (64%), Gaps = 19/332 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATL  P   P+   D E ++ A +GWGT+EK +I I+ HRN  QR+ I++ Y + Y ++
Sbjct  1     MATLTVPSSVPAVAEDCEQLHKAFEGWGTNEKLIISILAHRNAAQRRAIRRGYAEAYGKE  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L+R    E+ G  E+AV    LDP +RDAVL N   +K   P  R ++E AC   P +  
Sbjct  61    LLRALGDEIHGKFERAVILWTLDPAERDAVLANEEAKKSH-PGGRALVEIACARTPAQLF  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              VK+AY  R+KRS EED+A + T DFRKLLV LV  YRY G EV+  LA +E+ ILH  I
Sbjct  120   AVKQAYHDRFKRSLEEDVAAHVTGDFRKLLVPLVSAYRYDGPEVNTSLAHSEAKILHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
              KK Y+ EEI+RIL+TRSKAQL+ATFN YKD+   AI K                 DLK 
Sbjct  180   HKKAYSDEEIIRILTTRSKAQLLATFNSYKDQFTHAINK-----------------DLKA  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  +++L+ LR+ IR    P +Y+EK+IR AL   G DEDDLTRV+ TRAE DL+ IKE 
Sbjct  223   DPKDEFLSTLRAIIRCFTCPDRYFEKVIRLALGGMGTDEDDLTRVVTTRAEVDLKLIKEA  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQ  174
             YQKRNSV LE+AVAK+T+  YE ++LALLG +
Sbjct  283   YQKRNSVPLERAVAKDTTRDYEDIMLALLGAE  314



>ref|XP_008455214.1| PREDICTED: annexin D2-like [Cucumis melo]
Length=314

 Score =   311 bits (796),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 166/332 (50%), Positives = 215/332 (65%), Gaps = 21/332 (6%)
 Frame = -3

Query  1166  MATLVFPDHPSPVA-DAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATL  PD   PVA D + ++NA +GWGT E  +I I+ HRN  QR LI+Q Y + Y ED
Sbjct  1     MATLSVPDQLPPVAEDCDRLHNAFQGWGTDEGAIISILAHRNAKQRSLIRQTYAETYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KELS   E+AV    L P +RDA+L N AIRK     + V++E AC   P +  
Sbjct  61    LLKSLDKELSSDFERAVLLWTLHPAERDALLANEAIRK---LKHFVVLEIACSRTPRDLF  117

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              VK  Y AR+KRS EED+AQ +T DFR+LLV LV  YRY G EV+A LA +E+ ILH  I
Sbjct  118   LVKEEYHARFKRSIEEDVAQYTTGDFRRLLVPLVTAYRYDGPEVNATLATSEARILHEKI  177

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
              +K YN EE++RI+STRSKAQL ATFN Y D+ G AI+K                 DLK 
Sbjct  178   TEKAYNDEELIRIISTRSKAQLNATFNHYNDQFGNAISK-----------------DLKT  220

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  + YL  LRS I+ +  P KY+EK++R A+   G DE+ LTRV+VTRAE D++ I E 
Sbjct  221   DPNDNYLKLLRSAIKCLTWPEKYFEKVLRLAIKGLGTDEEALTRVVVTRAEVDMKRIVEE  280

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQ  174
             Y +RNSV   QA+  +TSG YE++LLAL+GK+
Sbjct  281   YYRRNSVPFGQAIKGDTSGDYESMLLALVGKE  312



>ref|XP_008795561.1| PREDICTED: annexin D2-like isoform X1 [Phoenix dactylifera]
Length=315

 Score =   311 bits (796),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 163/331 (49%), Positives = 218/331 (66%), Gaps = 19/331 (6%)
 Frame = -3

Query  1166  MATLVFP-DHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             M+TL  P   PSP  D+E +  A +GWGT+E  +I I+ HR+  QR+ I+ AY   Y ED
Sbjct  1     MSTLSIPVSVPSPYDDSEQLRKAFEGWGTNEGLIISIVAHRSAAQRRQIRDAYAQAYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             +++  E+EL+   EKAV   MLDP +RDAVL N A++K   P  R +IE A     +E  
Sbjct  61    ILKALERELTRDFEKAVLLWMLDPPERDAVLANEALKKWS-PGNRALIEIAATRTADELF  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              V+RAY AR+KRS EED+A +++ DFRKLLV LV  YRY G EV+A LA++E+ +LH  I
Sbjct  120   AVRRAYHARFKRSLEEDVAAHTSGDFRKLLVPLVSSYRYEGLEVNASLAKSEAKVLHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
               K+Y HEEI+RIL+TRSKAQL+ATFN Y +E G  I K                 DLK 
Sbjct  180   NDKDYGHEEIIRILTTRSKAQLLATFNDYNNEFGHPINK-----------------DLKA  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  + +L+ALRS +R ++ P +Y EK+IR A+ K G DE  LTRVI T AE +++ IKE+
Sbjct  223   DPKDDFLSALRSIVRCIICPERYLEKVIRLAINKVGTDEYALTRVITTHAEVNMKPIKEI  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGK  177
             Y KRNSV LE+A+ K+T+G YE  LLAL+G+
Sbjct  283   YYKRNSVPLERAIKKDTTGDYEDFLLALIGE  313



>ref|XP_004299644.1| PREDICTED: annexin D1-like [Fragaria vesca subsp. vesca]
Length=316

 Score =   310 bits (794),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 165/332 (50%), Positives = 215/332 (65%), Gaps = 19/332 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             M+TL  P   PSP  D+E +  A KGWGT+E  +I I+GHRN  QRK I++ Y + Y ED
Sbjct  1     MSTLAVPAQVPSPAEDSEQLKKAFKGWGTNEDLIISIVGHRNAAQRKAIRKTYAETYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KELS   E+ V    LDP +RDA L N A +K    + +V+ E AC       L
Sbjct  61    LLKDLDKELSNDFERIVMLWTLDPAERDAFLANEATKKWTSSN-QVLAEIACSRSSYGLL  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
               K+ Y +RYK+S EED+A ++T DFRKLLV LV  YRY G EV+  LA++E+ +LH  I
Sbjct  120   LAKQEYHSRYKKSLEEDVAHHTTGDFRKLLVPLVSSYRYEGYEVNMTLAKSEAKLLHERI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
               KEYNHE+I+RIL+TRSKAQ+ AT N YK+E G  I K                 DLK 
Sbjct  180   SDKEYNHEDIIRILATRSKAQINATLNHYKNEFGNDINK-----------------DLKA  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  ++YL  LRSTI+ ++ P KY+EK +R A+ + G DE  LTRV+ TRAE DL+ IKE 
Sbjct  223   DPKDEYLAILRSTIKCLIRPEKYFEKSLRLAINRLGTDEGALTRVVATRAEVDLKIIKEE  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQ  174
             Y KRNSVTL+QA+ K+T G YEA+LLALLG +
Sbjct  283   YHKRNSVTLDQAIKKDTRGDYEAMLLALLGHE  314



>ref|XP_004155446.1| PREDICTED: annexin D2-like [Cucumis sativus]
Length=314

 Score =   309 bits (791),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 164/332 (49%), Positives = 216/332 (65%), Gaps = 21/332 (6%)
 Frame = -3

Query  1166  MATLVFPDHPSPVA-DAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATL  PD   PVA D + +++A +GWGT E  ++ I+ HRN  QR LI+Q Y + Y ED
Sbjct  1     MATLSVPDQLPPVAEDCDRLHSAFQGWGTDEGAIVSILAHRNAKQRSLIRQTYAETYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KELS   E+AV      P +RDA+L N AIRK     + V++E AC   P + L
Sbjct  61    LLKALDKELSSDFERAVLLWTFHPAERDALLANEAIRK---LKHFVVLEIACTRTPRDLL  117

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              VK  Y AR+KRS EED+A  +T DFR+LLV LV  YRY G EV+A LA +E+ ILH+ I
Sbjct  118   LVKEEYHARFKRSIEEDVAHYTTGDFRRLLVPLVTAYRYGGPEVNATLATSEAKILHDKI  177

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
              +K YN EE++RI+STRSKAQL ATFN Y D+ G AI+K                 DLK 
Sbjct  178   TEKAYNDEELIRIISTRSKAQLNATFNHYNDQFGNAISK-----------------DLKT  220

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  + YL  LRS I+ +  P KY+EK++R A+   G DE+ LTRV+VTRAE D++ I E 
Sbjct  221   DPNDNYLKLLRSAIKCLTWPEKYFEKVLRLAIKGLGTDEEALTRVVVTRAEVDMKRIAEE  280

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQ  174
             Y +RNSV L QA+  +TSG YE++LLAL+GK+
Sbjct  281   YYRRNSVPLGQAIKGDTSGDYESMLLALIGKE  312



>ref|XP_009417575.1| PREDICTED: annexin D7-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=338

 Score =   310 bits (793),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 163/331 (49%), Positives = 212/331 (64%), Gaps = 19/331 (6%)
 Frame = -3

Query  1169  SMATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQE  993
             SMAT+  P   PSP  D + +  A +GWGT+E+ +I I+ HR   QR+ I+  Y + Y E
Sbjct  22    SMATIKVPATVPSPAEDCDQLRKAFQGWGTNERLIISILAHRTAAQRRAIRATYAETYGE  81

Query  992   DLIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEF  813
             +L++  E E+SG  E+AV    LDP DRDA L N A+R G  P  RV+IE AC     E 
Sbjct  82    ELLKSLEDEISGDFERAVLLWTLDPADRDAQLANEALR-GWNPSNRVLIEIACTRNSSEL  140

Query  812   LGVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNA  633
               V+RAY  RYKRS EED+A+++T DFRKLLV LV  YRY G EV  KL ++E+ +LH  
Sbjct  141   FDVRRAYHLRYKRSLEEDVAKHTTGDFRKLLVPLVSSYRYEGIEVSGKLVKSEAKMLHEK  200

Query  632   IKKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLK  453
             I +K Y+HEE++RI +TRSKAQLIAT N YK+E+G  I K                 DLK
Sbjct  201   ITEKAYSHEELIRIFTTRSKAQLIATINHYKNEYGKPINK-----------------DLK  243

Query  452   EDTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKE  273
              D  N++L ALR+ IR    P +Y EK+IR A+   G DE+ LTR+I TRAE DL+ I+ 
Sbjct  244   SDHKNEFLAALRAIIRCTFCPERYLEKVIRLAIKGLGTDENSLTRIITTRAEVDLKAIEA  303

Query  272   VYQKRNSVTLEQAVAKETSGHYEALLLALLG  180
              Y KRNSV L+QA+  +TSG Y+A+L ALLG
Sbjct  304   AYYKRNSVPLKQAIKGDTSGDYKAMLTALLG  334



>ref|XP_006828500.1| hypothetical protein AMTR_s00060p00176720 [Amborella trichopoda]
 gb|ERM95916.1| hypothetical protein AMTR_s00060p00176720 [Amborella trichopoda]
Length=316

 Score =   309 bits (791),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 159/330 (48%), Positives = 218/330 (66%), Gaps = 19/330 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             M+++V P+  PSP  D E +  A  GWGT+EK +I I+GHR  TQR+LI++ Y + Y ED
Sbjct  1     MSSVVVPESVPSPADDCEQLRVAFAGWGTNEKLIISILGHRTATQRQLIRKTYFELYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  + E+SG  E+A+    LDP +RDA++ N A+R+   P+ RV+IE AC    EE L
Sbjct  61    LLKSLDSEVSGDFERALLLWTLDPAERDALMANQALRRWN-PEDRVLIEIACARSSEELL  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              ++RAY AR+KRS EED+AQ++T DFRKLLV LV  YRY G EV+  LA+ E+  L + I
Sbjct  120   LIRRAYHARFKRSLEEDVAQHTTGDFRKLLVPLVSSYRYDGQEVNGHLAKLEAKTLKDVI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
             K K +NHEE+VRILSTRSKAQL AT N YKD  G  I K                 DLK 
Sbjct  180   KDKAFNHEELVRILSTRSKAQLNATLNNYKDGSGMQINK-----------------DLKG  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  +++ +A+R+ ++ +  P  Y+EK +R A+ K G DE  LTRV+VTRA+ D++ IK  
Sbjct  223   DAEDKFQSAVRAVVKCITKPQSYFEKTLRLAIVKLGTDEVALTRVVVTRADVDMKDIKAE  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLG  180
             Y KRNS  L++A+A +TSG Y+ LLL L+G
Sbjct  283   YHKRNSTPLDRAIASDTSGDYKNLLLTLIG  312



>ref|NP_001105475.1| annexin2 [Zea mays]
 emb|CAA66901.1| annexin p35 [Zea mays]
Length=314

 Score =   308 bits (790),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 164/332 (49%), Positives = 213/332 (64%), Gaps = 19/332 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATL  P   P+   D E ++ A +GWGT+EK +I I+ HRN  Q + I++ Y + Y ++
Sbjct  1     MATLTVPSSVPAVAEDCEQLHKAFEGWGTNEKLIISILAHRNAAQARAIRRGYAEAYGKE  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L+R    E+ G  E+AV    LDP +RDAVL N   +K   P  R ++E AC   P +  
Sbjct  61    LLRALGDEIHGKFERAVILWTLDPAERDAVLANEEAKKSH-PGGRALVEIACARTPAQLF  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              VK+AY  R+KRS EED+A + T DFRKLLV LV  YRY G EV+  LA +E+ ILH  I
Sbjct  120   AVKQAYHDRFKRSLEEDVAAHVTGDFRKLLVPLVSAYRYDGPEVNTSLAHSEAKILHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
              KK Y+ EEI+RIL+TRSKAQL+ATFN YKD+   AI K                 DLK 
Sbjct  180   HKKAYSDEEIIRILTTRSKAQLLATFNSYKDQFTHAINK-----------------DLKA  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  +++L+ LR+ IR    P +Y+EK+IR AL   G DEDDLTRV+ TRAE DL+ IKE 
Sbjct  223   DPKDEFLSTLRAIIRCFTCPDRYFEKVIRLALGGMGTDEDDLTRVVTTRAEVDLKLIKEA  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQ  174
             YQKRNSV LE+AVAK+T+  YE ++LALLG +
Sbjct  283   YQKRNSVPLERAVAKDTTRDYEDIMLALLGAE  314



>gb|AIY34672.1| annexin D2-like protein [Galtonia saundersiae]
Length=316

 Score =   308 bits (789),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 161/333 (48%), Positives = 217/333 (65%), Gaps = 19/333 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATL  P   P P  DA+ +  A  GWGT+E  +I I+ HRN  QRK I+QAY D + ED
Sbjct  1     MATLSVPSQVPPPSEDADQLRKAFGGWGTNEGLIISILTHRNAAQRKQIRQAYADLFGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KEL+   E+ V    LDP +RDA+L   + +KG  P  R +IE AC    +E L
Sbjct  61    LLKALDKELTRDFERVVLIWTLDPPERDALLAYESAKKGS-PSDRALIEIACTRTSDELL  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              +++AY ARYKRSFEED+A ++  +FRKLLV LV   RY G EV+A LA +E+ +LH  I
Sbjct  120   LIRKAYHARYKRSFEEDVAAHTKENFRKLLVPLVSALRYEGPEVNASLANSEAKLLHGKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
              +K Y+ EE++RIL+TRSKAQL+ATFN Y ++ G  I+K                 DLK 
Sbjct  180   AEKAYSDEEVIRILTTRSKAQLLATFNEYNNDFGNPISK-----------------DLKA  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  +++L+ALR+ I+    P KYYEK+IR A+ K G DE  LTRVI TRAE D++ IK+ 
Sbjct  223   DPKDEFLSALRAVIKCFTYPEKYYEKIIRLAINKMGTDEGALTRVIATRAEVDMKLIKDA  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
             Y KRNSV LE+A+ K+T+G YE  LLAL+G+ +
Sbjct  283   YYKRNSVPLERAIKKDTTGDYEDFLLALIGQDD  315



>ref|XP_009380196.1| PREDICTED: annexin D2-like [Musa acuminata subsp. malaccensis]
Length=316

 Score =   308 bits (789),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 159/332 (48%), Positives = 221/332 (67%), Gaps = 19/332 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             M+TL FP   PSP  D E ++ A +GWGT+E  +I ++ HR    R+ I++AY + Y ED
Sbjct  1     MSTLTFPSPLPSPSEDCEQLHKAFEGWGTNEGLIISVLAHRPAAHRREIRRAYAEIYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KEL+   E+AV   +LD  +RDAVL N  +RK   P  RV+IE A +   EE L
Sbjct  61    LLKPLDKELTRDFERAVLLWVLDAAERDAVLANEVVRKWS-PGNRVLIEIAVVRKTEELL  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
               KRAYQ R+KR  EED+A ++  ++RKLLV LV  YRY G+EVD  L+++E+ ILH  I
Sbjct  120   AAKRAYQVRFKRCLEEDVAAHTRDEYRKLLVPLVSTYRYEGAEVDKSLSKSEAKILHQKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
             K  +Y+HE+++RIL+TRSKAQL+ATFN Y +E G  I K                 DLK 
Sbjct  180   KDNDYSHEDVIRILTTRSKAQLLATFNDYHNEFGNPINK-----------------DLKA  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  N++L+A+R+ IR ++ P KY EK+IR A++KTG DE  L+R+I TRAE D++ IK++
Sbjct  223   DPKNEFLSAMRAIIRCIICPEKYLEKVIRLAISKTGTDEGALSRIITTRAEVDMKQIKDL  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQ  174
             Y KRNSV L+ AV K+TSG +E  LLAL+G +
Sbjct  283   YYKRNSVALDSAVKKDTSGDFEDFLLALIGHE  314



>ref|XP_010916889.1| PREDICTED: annexin D2-like isoform X2 [Elaeis guineensis]
Length=315

 Score =   308 bits (788),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 164/331 (50%), Positives = 219/331 (66%), Gaps = 19/331 (6%)
 Frame = -3

Query  1166  MATLVFP-DHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             M+TL  P   PSP  D+E +  A +GWGT+E  +I I+ HR+  QR+ I+ AY   Y ED
Sbjct  1     MSTLSIPVSVPSPYDDSEQLRKAFEGWGTNEGLIIAILAHRSAAQRRQIRDAYAQAYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             +++  EKEL+   EKAV   MLDP +RDAVL N A++K    + R +IE +     +E  
Sbjct  61    ILKALEKELTRHFEKAVLLWMLDPPERDAVLANEALKKWSSGN-RALIEISVTRTSDEMF  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              V+RAY AR+KRS EED+A +++ DFRKLLV LV  YRY G EV+A LA++E+ +LH  I
Sbjct  120   AVRRAYHARFKRSLEEDVAVHTSGDFRKLLVPLVSSYRYEGLEVNASLAKSEAKMLHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
               K+Y +EEI+RIL+TRSKAQL+ATFN Y +E G  I K                 DLK 
Sbjct  180   NDKDYGNEEIIRILTTRSKAQLLATFNDYNNEFGHPINK-----------------DLKA  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  + +L ALRS IR ++ P KY+EK+IR A+ K G DE  LTRVI TRAE +++ IKE+
Sbjct  223   DPKDDFLFALRSIIRCIICPEKYFEKVIRLAINKMGTDEYALTRVITTRAEVNMKQIKEI  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGK  177
             Y KRNSV LE+A+ K+T+G YE  LLAL+G+
Sbjct  283   YYKRNSVPLERAIKKDTTGDYEDFLLALIGE  313



>ref|XP_009417576.1| PREDICTED: annexin D7-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=316

 Score =   307 bits (787),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 162/330 (49%), Positives = 211/330 (64%), Gaps = 19/330 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MAT+  P   PSP  D + +  A +GWGT+E+ +I I+ HR   QR+ I+  Y + Y E+
Sbjct  1     MATIKVPATVPSPAEDCDQLRKAFQGWGTNERLIISILAHRTAAQRRAIRATYAETYGEE  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  E E+SG  E+AV    LDP DRDA L N A+R G  P  RV+IE AC     E  
Sbjct  61    LLKSLEDEISGDFERAVLLWTLDPADRDAQLANEALR-GWNPSNRVLIEIACTRNSSELF  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              V+RAY  RYKRS EED+A+++T DFRKLLV LV  YRY G EV  KL ++E+ +LH  I
Sbjct  120   DVRRAYHLRYKRSLEEDVAKHTTGDFRKLLVPLVSSYRYEGIEVSGKLVKSEAKMLHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
              +K Y+HEE++RI +TRSKAQLIAT N YK+E+G  I K                 DLK 
Sbjct  180   TEKAYSHEELIRIFTTRSKAQLIATINHYKNEYGKPINK-----------------DLKS  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  N++L ALR+ IR    P +Y EK+IR A+   G DE+ LTR+I TRAE DL+ I+  
Sbjct  223   DHKNEFLAALRAIIRCTFCPERYLEKVIRLAIKGLGTDENSLTRIITTRAEVDLKAIEAA  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLG  180
             Y KRNSV L+QA+  +TSG Y+A+L ALLG
Sbjct  283   YYKRNSVPLKQAIKGDTSGDYKAMLTALLG  312



>ref|XP_011074177.1| PREDICTED: annexin D1-like [Sesamum indicum]
Length=316

 Score =   307 bits (786),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 158/333 (47%), Positives = 222/333 (67%), Gaps = 19/333 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             M+TL  P   PS   D E ++ A  GWGT+E  +I I+GHRN TQRKLI+Q Y + Y ED
Sbjct  1     MSTLCVPSQVPSVAEDCEQLHKAFSGWGTNEDLIISILGHRNATQRKLIRQVYAETYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KEL+   E+ V    LDP +RDA L N A +K    + +V++E AC   P+E L
Sbjct  61    LLKALDKELTNDFERVVLLWTLDPPERDAYLANEATKKWTSSN-QVLVEIACTRSPKELL  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
               + AY AR+K+S EED+A +++ DFRKLLV LV  YRYSG EV+  LA+TE+ +LH  I
Sbjct  120   LAREAYHARFKKSLEEDVAYHTSGDFRKLLVPLVSSYRYSGDEVNLTLAKTEAKLLHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
              +K Y+ ++++RIL+TRSKAQ+ AT N+YK+E G  I K                 DLK 
Sbjct  180   SEKAYSCDDVIRILTTRSKAQINATLNQYKNEFGNDINK-----------------DLKA  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  +++L  LR+T++ +V P KY+EK++R A+ + G DE  LTRV+ TRAE DL+ IK+ 
Sbjct  223   DPKDEFLDILRATVKCLVCPEKYFEKVLRLAINRRGTDEGALTRVVATRAEVDLKIIKDE  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
             Y KRNSV L++A+AK+T+G YE +LLAL+G +E
Sbjct  283   YHKRNSVPLDRAIAKDTTGDYEKMLLALIGHEE  315



>ref|XP_006828499.1| hypothetical protein AMTR_s00060p00176150 [Amborella trichopoda]
 gb|ERM95915.1| hypothetical protein AMTR_s00060p00176150 [Amborella trichopoda]
Length=316

 Score =   306 bits (785),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 156/330 (47%), Positives = 216/330 (65%), Gaps = 19/330 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             M+++V P+  PSP  D E +  A  GWGT+EK +I I+GHR  TQR+LI++ Y + Y ED
Sbjct  1     MSSVVVPESVPSPADDCEQLRVAFAGWGTNEKLIISILGHRTATQRQLIRKTYFELYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  + ELSG  E+A+    LDP +RDA++ N A+R+   P+ RV+IE AC    EE  
Sbjct  61    LLKSLDSELSGDFERALLLWTLDPAERDALMANQALRRWN-PEDRVLIEIACARSSEELF  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              ++RAY AR+KRSFEED+AQ++T DFRKLLV LV  YRY G EV+  +A+ E+  + + I
Sbjct  120   FIRRAYHARFKRSFEEDVAQHTTGDFRKLLVPLVSSYRYDGPEVNMHMAKLEAKTMKDVI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
               K +NHEE++RILSTRSKAQL AT N YKDE G  I                   DLK 
Sbjct  180   NDKAFNHEELIRILSTRSKAQLNATLNNYKDEFGMQIN-----------------NDLKG  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D   ++ +A+R+ ++ +  P  Y+EK +R A+ K G DE  LTRV+VTRA+ D++ IK  
Sbjct  223   DPEEKFQSAVRAVVKCITKPQNYFEKTLRLAIVKLGTDEVALTRVVVTRADVDMKDIKVE  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLG  180
             Y KRNS  L++A+A +TSG Y+ LLL L+G
Sbjct  283   YHKRNSTPLDRAIASDTSGDYKNLLLTLIG  312



>ref|XP_004136871.1| PREDICTED: annexin D2-like [Cucumis sativus]
 gb|KGN43712.1| hypothetical protein Csa_7G062780 [Cucumis sativus]
Length=314

 Score =   306 bits (783),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 163/332 (49%), Positives = 215/332 (65%), Gaps = 21/332 (6%)
 Frame = -3

Query  1166  MATLVFPDHPSPVA-DAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATL  PD   PVA D + +++A +GWGT E  ++ I+ HRN  QR LI+Q Y + Y ED
Sbjct  1     MATLSVPDQLPPVAEDCDRLHSAFQGWGTDEGAIVSILAHRNAKQRSLIRQTYAETYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KELS   E+AV      P +RDA+L N AIRK     + V++E AC   P + L
Sbjct  61    LLKALDKELSSDFERAVLLWTFHPAERDALLANEAIRK---LKHFVVLEIACTRTPRDLL  117

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              VK  Y AR+KRS EED+A  +T DFR+LLV LV  YRY G EV+A LA +E+ ILH+ I
Sbjct  118   LVKEEYHARFKRSIEEDVAHYTTGDFRRLLVPLVTAYRYGGPEVNATLATSEAKILHDKI  177

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
              +K YN EE++RI+STRSKAQL ATFN Y D+ G AI+K                 DLK 
Sbjct  178   TEKAYNDEELIRIISTRSKAQLNATFNHYNDQFGNAISK-----------------DLKT  220

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  + YL  LRS I+ +    KY+EK++R A+   G DE+ LTRV+VTRAE D++ I E 
Sbjct  221   DPNDNYLKLLRSAIKCLTWSEKYFEKVLRLAIKGLGTDEEALTRVVVTRAEVDMKRIAEE  280

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQ  174
             Y +RNSV L QA+  +TSG YE++LLAL+GK+
Sbjct  281   YYRRNSVPLGQAIKGDTSGDYESMLLALIGKE  312



>gb|AGQ56697.1| cotton annexin 6 [Gossypium hirsutum]
Length=316

 Score =   306 bits (783),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 159/330 (48%), Positives = 215/330 (65%), Gaps = 19/330 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATL  P H PSP  DAE +  A +GWGT+E+ +I I+ HRN  QR  I++ Y + Y ED
Sbjct  1     MATLKVPVHVPSPSEDAEQLRKAFEGWGTNEQLIIDILAHRNAAQRNSIRKVYGEAYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  EKEL+   E+AV    LDP +RDA L N A +K    ++ +++E AC     E L
Sbjct  61    LLKCLEKELTSDFERAVLLFTLDPAERDAHLANEATKKFTSSNW-ILMEIACSRSSHELL  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              VK+AY ARYK+S EED+A ++T ++RKLLV LV  +RY G EV+  LA++E+ ILH+ I
Sbjct  120   NVKKAYHARYKKSLEEDVAHHTTGEYRKLLVPLVSAFRYEGEEVNMTLAKSEAKILHDKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
               K Y  EE++RI+STRSKAQL AT N Y    G AI K                 DLK 
Sbjct  180   SDKHYTDEEVIRIVSTRSKAQLNATLNHYNTSFGNAINK-----------------DLKA  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  +++L  LR+ I+ +  P +Y+EK++R+A+ K G+DE  LTRV+ TRAE D+  IKE 
Sbjct  223   DPSDEFLKLLRAVIKCLTTPEQYFEKVLRQAINKLGSDEWALTRVVTTRAEVDMVRIKEA  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLG  180
             YQ+RNS+ LEQA+AK+TSG YE  LLAL+G
Sbjct  283   YQRRNSIPLEQAIAKDTSGDYEKFLLALIG  312



>ref|XP_007047969.1| Annexin 2 [Theobroma cacao]
 gb|EOX92126.1| Annexin 2 [Theobroma cacao]
Length=316

 Score =   305 bits (781),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 159/330 (48%), Positives = 215/330 (65%), Gaps = 19/330 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATL  P H P+P  DAE +  A +GWGT+E+ +I ++ HRN  QR LI+ +Y + Y ED
Sbjct  1     MATLKVPAHVPAPSEDAEQLRKAFEGWGTNEQLIIDVLAHRNAAQRNLIRISYGEAYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KELS   E+AV    LDP +RDA L N A ++    ++ V++E AC     E  
Sbjct  61    LLKSLDKELSSDFERAVLLFTLDPAERDAYLANEATKRFTSSNW-VLMEIACTRSSYELF  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              V++AY ARYK+S EED+A ++T D+RKLLV LV  +RY G EV+  LA++E+ IL + I
Sbjct  120   NVRKAYHARYKKSLEEDVAHHTTGDYRKLLVPLVSAFRYEGEEVNMTLAKSEAKILRDKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
               K YN EE++RIL+TRSKAQL AT N Y    G AI K                 DLK 
Sbjct  180   SDKHYNDEEVIRILTTRSKAQLNATLNHYNTAFGNAINK-----------------DLKA  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  +++L  LR+ I+ +  P KY+EKL+R+A+ K G DE  LTRV+ TRAE D+  IKE 
Sbjct  223   DPNDEFLKLLRAAIKCLTVPEKYFEKLLRQAIVKLGTDESALTRVVTTRAEVDMVRIKEE  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLG  180
             YQ+RNSVTLE+A+A +TSG YE +LLAL+G
Sbjct  283   YQRRNSVTLEKAIAGDTSGDYERMLLALIG  312



>ref|XP_010061809.1| PREDICTED: annexin D1-like [Eucalyptus grandis]
 gb|KCW68821.1| hypothetical protein EUGRSUZ_F02423 [Eucalyptus grandis]
Length=316

 Score =   304 bits (779),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 156/333 (47%), Positives = 217/333 (65%), Gaps = 19/333 (6%)
 Frame = -3

Query  1166  MATLVFPDHPSPVAD-AEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             M+TL  P    PVAD  E +  A  GWGT+EK +I I+GHRN  QRKLI+Q Y + Y ED
Sbjct  1     MSTLTVPQPLPPVADDCEQLRTAFAGWGTNEKLIISILGHRNAAQRKLIRQTYAETYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  ++EL+   E+ V    LDP +RDA L N A ++    + +V++E AC   P++ L
Sbjct  61    LLKALDRELTNDFERLVVLWSLDPAERDAYLANEATKRWTSSN-QVLMEIACTRSPQQLL  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
               ++AY ARYK+S EED+  ++T DFRKLLV LV  YRY G EV+  LA+ E+ ILH  I
Sbjct  120   MARQAYHARYKKSLEEDVGHHTTGDFRKLLVPLVSSYRYDGDEVNMTLAKAEAKILHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
              +K Y HE+++RIL+TRSKAQ+ AT N YK+E G  I K                 DLK 
Sbjct  180   SEKAYGHEDLIRILATRSKAQVNATLNHYKNEFGNDINK-----------------DLKT  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  +++LT LR+T++ +  P KY+EK++R A+ K G DE  LTRV+ TRAE D++ I E 
Sbjct  223   DPKDEFLTILRATVKCLTRPEKYFEKVLRLAINKRGTDEGALTRVVATRAEVDMKFISEE  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
             YQ+RNS+ L++A+ K+T+G YE +LLAL+G  E
Sbjct  283   YQRRNSIPLDRAIVKDTTGDYEKMLLALIGHVE  315



>gb|KHG08791.1| Annexin D2 -like protein [Gossypium arboreum]
Length=316

 Score =   304 bits (778),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 158/330 (48%), Positives = 215/330 (65%), Gaps = 19/330 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATL  P H PSP  DAE +  A +GWGT+E+ +I I+ HRN  QR  I++ Y + Y ED
Sbjct  1     MATLKVPVHVPSPSDDAEQLRKAFEGWGTNEQLIIDILAHRNAAQRNSIRKVYGEAYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  EKEL+   E+AV    LDP +RDA L N A +K    ++ +++E AC     E L
Sbjct  61    LLKCLEKELTSDFERAVLLFTLDPAERDAHLANEATKKFTSSNW-ILMEIACSRSSHELL  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              VK+AY ARYK+S EED+A ++T ++RKLLV LV  +RY G EV+  LA++E+ ILH+ I
Sbjct  120   NVKKAYHARYKKSLEEDVAHHTTGEYRKLLVPLVSAFRYEGEEVNMTLAKSEAKILHDKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
               K Y  +E++RI+STRSKAQL AT N Y    G AI K                 DLK 
Sbjct  180   SDKHYTDDEVIRIVSTRSKAQLNATLNHYNTSFGNAINK-----------------DLKA  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  +++L  LR+ I+ +  P +Y+EK++R+A+ K G+DE  LTRV+ TRAE D+  IKE 
Sbjct  223   DPSDEFLKLLRAVIKCLTTPEQYFEKVLRQAINKLGSDEWALTRVVTTRAEVDMVRIKEA  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLG  180
             YQ+RNS+ LEQA+AK+TSG YE  LLAL+G
Sbjct  283   YQRRNSIPLEQAIAKDTSGDYEKFLLALIG  312



>gb|KFK23853.1| hypothetical protein AALP_AAs49431U000100 [Arabis alpina]
Length=317

 Score =   303 bits (777),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 158/334 (47%), Positives = 224/334 (67%), Gaps = 20/334 (6%)
 Frame = -3

Query  1166  MATL-VFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATL V P  PSP+ DA+ +  A +GWGT+E  +I I+ HR+  QRKLI+QAYH+ + ED
Sbjct  1     MATLKVSPSVPSPLEDADQLRTAFEGWGTNEDLIISILAHRSAEQRKLIRQAYHETHGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KELS   E+++    L+P +RDA+L N A ++    + +V++E AC     + L
Sbjct  61    LLKTLDKELSNDFERSILLWTLEPGERDALLANEATKRWTSSN-QVLMEVACTRNSAQLL  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
               ++AY ARYK+S EED+A ++T DFRKLLV LV  YRY G EV+  LA+ E+ ++H  I
Sbjct  120   HARQAYHARYKKSLEEDVAHHTTGDFRKLLVPLVSSYRYEGDEVNMTLAKQEAKLIHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
             K KEY +EE++RILSTRSKAQ+ ATFNRY+DEHG  I                 L+ L+E
Sbjct  180   KDKEYTNEEVIRILSTRSKAQINATFNRYQDEHGEEI-----------------LKSLEE  222

Query  449   -DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKE  273
              D  +++L  LRSTI+ +  P  Y+  ++R A+ KTG DE  LTR++ TRAE DL+ I E
Sbjct  223   GDDDDKFLALLRSTIQCLTRPELYFVDVLRSAINKTGTDEGALTRIVTTRAEIDLKVIGE  282

Query  272   VYQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              YQ+RNS+ LE+A+ K+T G YE +L+ALLG+ +
Sbjct  283   EYQRRNSIPLEKAITKDTRGDYEKMLVALLGEDD  316



>gb|KDP46839.1| hypothetical protein JCGZ_24048 [Jatropha curcas]
Length=316

 Score =   303 bits (776),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 158/333 (47%), Positives = 218/333 (65%), Gaps = 19/333 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MAT+  P H P+P  DAE ++ A +GWGT+E  +I I+ HRN  QR LI+Q Y + Y ED
Sbjct  1     MATVKVPAHVPAPSEDAEQLHKAFEGWGTNEALIISILAHRNAAQRNLIRQTYAEAYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KELS   E+AV    LDP +RDA L N A +K    ++ V+IE AC     +  
Sbjct  61    LLKALDKELSSDFERAVLLWTLDPAERDAYLANEATKKFTSSNW-VLIEIACSRSSLDLF  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              V++AY AR+K+S EED+A ++T DFRKLLV LV  +RY G EV+  LA++E+ ILH  I
Sbjct  120   KVRQAYHARFKKSLEEDVAYHTTGDFRKLLVPLVSAFRYEGDEVNMTLAKSEAKILHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
               K Y+ EEI+RI++TRSKAQL AT N Y +  G AI K                 DLK 
Sbjct  180   SHKAYSDEEIIRIIATRSKAQLNATLNHYNNAFGNAINK-----------------DLKG  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  +++L  LR+TI+ +  P KY+EK++R A+ K G DE  LTRV+ TRAE D++ IKE 
Sbjct  223   DPKDEFLNLLRATIKCLTTPEKYFEKVLRLAINKLGTDELALTRVVTTRAEVDMQRIKEE  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
             Y +RNSVTL++A++ +TSG YE +LLAL+G ++
Sbjct  283   YHRRNSVTLDRAISGDTSGDYEKMLLALIGHED  315



>ref|XP_004288207.1| PREDICTED: annexin D2-like [Fragaria vesca subsp. vesca]
Length=316

 Score =   303 bits (776),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 162/331 (49%), Positives = 215/331 (65%), Gaps = 19/331 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATL  P   PSP  D+E +  A +GWGT+E  +  I+ HRN  QR+LI+Q Y + Y ED
Sbjct  1     MATLKVPACVPSPAEDSEQLRKAFEGWGTNEALITSILAHRNADQRRLIQQTYAETYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KELS   E+AV    L P +RDAVL N A ++    ++ V++E AC     E L
Sbjct  61    LLKSLDKELSSDFERAVMLWTLHPSERDAVLANEATKRFTSSNW-VLMEIACSRSSYELL  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              VK+AY A++K+S EED+A +++ DFRKLLV LV  +RY G EV+  +A+ E+ ILH  I
Sbjct  120   QVKQAYHAKFKKSLEEDVAFHTSGDFRKLLVPLVSAFRYEGDEVNVTVAKREAKILHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
             K K YN EE++RI +TRSKAQL ATFN+Y +E G AITK                 DLK 
Sbjct  180   KDKHYNDEELIRIFTTRSKAQLNATFNQYNNEFGNAITK-----------------DLKA  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  +++L  LR+T + +  P KY+EKL+R  + K G DE  LTRVI TRAE DL  IKE 
Sbjct  223   DQDDEFLKLLRATAKLLTFPEKYFEKLLRLCINKLGTDEGALTRVITTRAEVDLHRIKEE  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGK  177
             YQ+RNSV L++A+ K+TSG YE  LLALLG+
Sbjct  283   YQRRNSVPLDRAIEKDTSGDYEKFLLALLGQ  313



>gb|KCW62129.1| hypothetical protein EUGRSUZ_H04787 [Eucalyptus grandis]
Length=316

 Score =   303 bits (776),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 158/333 (47%), Positives = 217/333 (65%), Gaps = 19/333 (6%)
 Frame = -3

Query  1166  MATL-VFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MAT+ V P  PSP  DAE +  A  GWGT+E  +I I+ HRN  QRK+I+Q Y + Y ED
Sbjct  1     MATIAVPPSVPSPAEDAEQLQKAFAGWGTNEDLIISILAHRNAAQRKVIRQTYAETYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KELS   E++V    LDP +RDA L N A ++    ++ V++E AC     E  
Sbjct  61    LLKALDKELSSDFERSVLLWTLDPAERDAFLSNEATKRLTSSNW-VLMEIACTRSSMELF  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              V++AY ARYK+S EED+A ++T DFRKLLV L   +RY G EV+  LA++E+ ILH  I
Sbjct  120   MVRQAYHARYKKSLEEDIAYHTTGDFRKLLVPLASTFRYEGPEVNMTLARSEAKILHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
              +K YNH+E++RI++TRSKAQL AT N Y +E G AI K                 DLK 
Sbjct  180   HEKAYNHDELIRIVTTRSKAQLNATLNYYNNEFGNAINK-----------------DLKA  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  +++L  LRS I+ +  P KY+EK++R A+ K G DE  LTRV+ TRAE D++ IKE 
Sbjct  223   DPNDEFLKLLRSAIKCLTYPEKYFEKVLRLAINKLGTDEWALTRVVTTRAEVDMQRIKEQ  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
             Y KRNSV L++A+A +TSG Y+ +LLAL+G ++
Sbjct  283   YHKRNSVPLDRAIANDTSGDYKKMLLALVGHED  315



>ref|XP_008450361.1| PREDICTED: annexin D8 [Cucumis melo]
Length=300

 Score =   302 bits (774),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 156/307 (51%), Positives = 207/307 (67%), Gaps = 19/307 (6%)
 Frame = -3

Query  1097  KGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDLIRRFEKELSGSLEKAVYRLMLDP  918
             +G GT E  +I I+GHRN  QRKLI+ AY + Y EDLI++   EL G  E+A+    LDP
Sbjct  3     EGLGTDENAIISILGHRNANQRKLIRLAYEEIYNEDLIQQLNSELCGDFERAISHWTLDP  62

Query  917   EDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLGVKRAYQARYKRSFEEDLAQNSTA  738
              DRDA+L N A+ K   PDYRVIIE AC+   E+ L VKRAY+ R+K S EED+A  +T 
Sbjct  63    ADRDAILANNAL-KASTPDYRVIIEIACVRSAEDLLAVKRAYRFRFKHSLEEDVASCTTK  121

Query  737   DFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIKKKEY-NHEEIVRILSTRSKAQLI  561
             D RKLLV +V  YR  G+E+D  +A+ E+ I+ + IK K   N+EEI+RI+STRSK QL 
Sbjct  122   DMRKLLVGVVSAYRCEGNEIDENMAELEANIIDDEIKGKGCKNNEEIIRIVSTRSKPQLN  181

Query  560   ATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKEDTGNQYLTALRSTIRAMVDPHKY  381
             ATFNRY+D HGT+ITK                  L  D+ ++YL AL++ IR + DP KY
Sbjct  182   ATFNRYRDIHGTSITKG-----------------LIGDSSDEYLAALKTVIRCIRDPKKY  224

Query  380   YEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVYQKRNSVTLEQAVAKETSGHYEA  201
             Y K++R A+   G D D ++RVIVTRAE+DL+ I E+Y KRN+++LE+AV++E  G Y+A
Sbjct  225   YAKVLRNAMNTIGVDRDGISRVIVTRAEKDLKEIMEMYLKRNNISLEEAVSREIGGDYKA  284

Query  200   LLLALLG  180
              LLALLG
Sbjct  285   FLLALLG  291



>dbj|BAD68998.1| putative calcium-binding protein annexin 6 [Oryza sativa Japonica 
Group]
 dbj|BAD73710.1| putative calcium-binding protein annexin 6 [Oryza sativa Japonica 
Group]
 gb|EEE54639.1| hypothetical protein OsJ_01908 [Oryza sativa Japonica Group]
Length=316

 Score =   303 bits (775),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 158/330 (48%), Positives = 218/330 (66%), Gaps = 18/330 (5%)
 Frame = -3

Query  1166  MATLVFPD-HPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MAT+V P   PSP  DA+A+  A +GWGT E+ VIG++ HR+ TQRK I+  Y + Y E+
Sbjct  1     MATIVVPPVTPSPAEDADALLKAFQGWGTDEQAVIGVLAHRDATQRKQIRLTYEENYNEN  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             LI+R + ELSG LE+A+Y  +LDP +R AV++N A  K    DY VI+E AC     E L
Sbjct  61    LIQRLQSELSGDLERAMYHWVLDPVERQAVMVNTAT-KCIHEDYAVIVEIACTNSSSELL  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              VKR Y   YK S EED+A  +T + R LL+ALV  YRY G EV+  LA++E+ ILH  +
Sbjct  120   AVKRTYHVLYKCSLEEDVAARATGNLRSLLLALVSTYRYDGDEVNDALAKSEAKILHETV  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
                + +H E++RI+ TRS+AQL ATF+ ++DE GT+ITK               LQ   +
Sbjct  180   TNGDTDHGELIRIVGTRSRAQLNATFSWFRDERGTSITKA--------------LQHGAD  225

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
              TG  Y  ALR+ +R + D +KY+ K++R A+ K+G +ED LTRVIV  AE+DL+GIK+ 
Sbjct  226   PTG--YSHALRTALRCISDANKYFVKVLRNAMHKSGTNEDSLTRVIVLHAEKDLKGIKDA  283

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLG  180
             +QKR SV LE+A+  +TSG Y++ L+ALLG
Sbjct  284   FQKRASVALEKAIGNDTSGDYKSFLMALLG  313



>gb|KCW62127.1| hypothetical protein EUGRSUZ_H04787 [Eucalyptus grandis]
Length=316

 Score =   302 bits (774),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 158/333 (47%), Positives = 216/333 (65%), Gaps = 19/333 (6%)
 Frame = -3

Query  1166  MATL-VFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MAT+ V P  PSP  DAE +  A  GWGT+E  +I I+ HRN  QRK+I+Q Y + Y ED
Sbjct  1     MATIAVPPSVPSPAEDAEQLQKAFAGWGTNEDLIISILAHRNAAQRKVIRQTYAETYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KELS   E++V    LDP +RDA L N A ++    ++ V++E AC     E  
Sbjct  61    LLKALDKELSSDFERSVLLWTLDPAERDAFLSNEATKRLTSSNW-VLMEIACTRSSMELF  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              V++AY ARYK+S EED+A ++T DF KLLV L   +RY G EV+  LA++E+ ILH  I
Sbjct  120   MVRQAYHARYKKSLEEDIAYHTTGDFHKLLVPLASTFRYEGPEVNMTLARSEAKILHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
              KK YNH+E++RI++TRSKAQL AT N Y +E G AI K                 DLK 
Sbjct  180   HKKAYNHDELIRIVTTRSKAQLNATLNYYNNEFGNAINK-----------------DLKA  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  +++L  LRS I+ +  P KY+EK++R A+ K G DE  LTRV+ TRAE D++ IKE 
Sbjct  223   DPNDEFLKLLRSAIKCLTYPEKYFEKVLRLAINKLGTDEWALTRVVTTRAEVDMQRIKEQ  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
             Y KRNSV L++A+A +TSG Y+ +LLAL+G ++
Sbjct  283   YHKRNSVPLDRAIANDTSGDYKKMLLALVGHED  315



>ref|XP_008782135.1| PREDICTED: annexin D2-like [Phoenix dactylifera]
Length=315

 Score =   302 bits (774),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 158/321 (49%), Positives = 208/321 (65%), Gaps = 18/321 (6%)
 Frame = -3

Query  1139  PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDLIRRFEKELS  960
             PSP  D E +  A +GWGT+E  +I I+ HR+  QR+ I+ AY   Y EDL++  +KEL+
Sbjct  11    PSPAEDCEQLRKAFQGWGTNEGLIISILAHRSAAQRRQIRDAYAQAYSEDLLKALDKELT  70

Query  959   GSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLGVKRAYQARY  780
                EKAV   +LDP +RDAVL N A++K   P  R +IE A     +E   V+RAYQ R+
Sbjct  71    RDFEKAVLLWILDPPERDAVLANEALKKWS-PGNRALIEIAVTRTADEMFAVRRAYQGRF  129

Query  779   KRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIKKKEYNHEEI  600
             KRS EED+A ++  DFRKLLV LV  YRY G EV+A LA++E+ ILH  I +K Y HEEI
Sbjct  130   KRSLEEDVAAHTNGDFRKLLVPLVSSYRYEGPEVNASLAKSEAKILHEKINEKAYGHEEI  189

Query  599   VRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKEDTGNQYLTAL  420
             +RIL+TRSKAQL ATFN Y +  G  I K                 DLK D  + +L AL
Sbjct  190   IRILTTRSKAQLFATFNDYNNGFGHPINK-----------------DLKSDPKDDFLFAL  232

Query  419   RSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVYQKRNSVTLE  240
             R+ IR ++ P +Y EK+IR A+ K G DE  LTRVI TRAE +++ IKE+Y KRNSV L+
Sbjct  233   RAIIRCIICPERYLEKVIRLAINKMGTDECALTRVITTRAEANMKHIKEIYYKRNSVRLD  292

Query  239   QAVAKETSGHYEALLLALLGK  177
              A+ K+T+G YE  L+AL+G+
Sbjct  293   HALKKDTTGDYEDFLVALIGQ  313



>ref|XP_008795562.1| PREDICTED: annexin D2-like isoform X2 [Phoenix dactylifera]
Length=308

 Score =   302 bits (773),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 159/325 (49%), Positives = 212/325 (65%), Gaps = 19/325 (6%)
 Frame = -3

Query  1166  MATLVFP-DHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             M+TL  P   PSP  D+E +  A +GWGT+E  +I I+ HR+  QR+ I+ AY   Y ED
Sbjct  1     MSTLSIPVSVPSPYDDSEQLRKAFEGWGTNEGLIISIVAHRSAAQRRQIRDAYAQAYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             +++  E+EL+   EKAV   MLDP +RDAVL N A++K   P  R +IE A     +E  
Sbjct  61    ILKALERELTRDFEKAVLLWMLDPPERDAVLANEALKKWS-PGNRALIEIAATRTADELF  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              V+RAY AR+KRS EED+A +++ DFRKLLV LV  YRY G EV+A LA++E+ +LH  I
Sbjct  120   AVRRAYHARFKRSLEEDVAAHTSGDFRKLLVPLVSSYRYEGLEVNASLAKSEAKVLHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
               K+Y HEEI+RIL+TRSKAQL+ATFN Y +E G  I K                 DLK 
Sbjct  180   NDKDYGHEEIIRILTTRSKAQLLATFNDYNNEFGHPINK-----------------DLKA  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  + +L+ALRS +R ++ P +Y EK+IR A+ K G DE  LTRVI T AE +++ IKE+
Sbjct  223   DPKDDFLSALRSIVRCIICPERYLEKVIRLAINKVGTDEYALTRVITTHAEVNMKPIKEI  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALL  195
             Y KRNSV LE+A+ K+T+G YE  L
Sbjct  283   YYKRNSVPLERAIKKDTTGDYEDFL  307



>ref|XP_007227485.1| hypothetical protein PRUPE_ppa008882mg [Prunus persica]
 gb|EMJ28684.1| hypothetical protein PRUPE_ppa008882mg [Prunus persica]
Length=316

 Score =   302 bits (773),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 158/333 (47%), Positives = 215/333 (65%), Gaps = 19/333 (6%)
 Frame = -3

Query  1166  MATLVFPDHPSPVA-DAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             M+TL  P    P + D E +  A KGWGT+E  +I I+GHRN  QRK+I+Q Y + Y ED
Sbjct  1     MSTLRVPQQVPPASEDCEQLKKAFKGWGTNEDLIISILGHRNAPQRKVIRQTYAEAYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  EKEL+   E+++    LDP +RDA L N A +K    + +V+ E AC     E L
Sbjct  61    LLKELEKELTSDFERSILLWTLDPAERDAFLANEATKKWTKSN-QVLAEIACSRSSHELL  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
               ++AY +RYK+S EED+A ++T DFRKLL  LV  YRY G EV+  LA++E+ +LH  I
Sbjct  120   MARQAYHSRYKKSLEEDVAHHTTGDFRKLLAPLVSSYRYEGDEVNLTLAKSEAKLLHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
               K YN E+I+RIL+TRSKAQ+ AT N YK+E G  I K                 DLK 
Sbjct  180   SDKAYNDEDIIRILATRSKAQINATLNHYKNEFGNDINK-----------------DLKA  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  ++YL  LR+TI+ +V P KY+EK +R A+ K G DE  L+RV+ TRAE D++ IKE 
Sbjct  223   DPKDEYLAILRATIKCLVRPEKYFEKSLRLAINKRGTDEGALSRVVTTRAEVDMKLIKEQ  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
             Y KRNSVTL+QA+ K+T+G YE +LLAL+G ++
Sbjct  283   YHKRNSVTLDQAIKKDTTGDYEKMLLALVGHED  315



>gb|KCW62130.1| hypothetical protein EUGRSUZ_H04787 [Eucalyptus grandis]
Length=316

 Score =   301 bits (772),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 158/333 (47%), Positives = 217/333 (65%), Gaps = 19/333 (6%)
 Frame = -3

Query  1166  MATL-VFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MAT+ V P  PSP  DAE +  A  GWGT+E  +I I+ HRN  QRK+I+Q Y + Y ED
Sbjct  1     MATIAVPPSVPSPAEDAEQLQKAFAGWGTNEDLIISILPHRNAAQRKVIRQTYAETYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KELS   E++V    LDP +RDA L + A ++    ++ V++E AC     E  
Sbjct  61    LLKALDKELSSDFERSVLLWTLDPAERDAFLSSEATKRLTSSNW-VLMEIACTRSSMELF  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              VK+AY ARYK+S EED+A ++T DFRKLLV L   +RY G EV+  LA++E+ ILH  I
Sbjct  120   MVKQAYHARYKKSLEEDIAYHTTGDFRKLLVPLASTFRYEGPEVNMTLARSEAKILHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
              +K YNH+E++RI++TRSKAQL AT N Y +E G AI K                 DLK 
Sbjct  180   HEKAYNHDELIRIVTTRSKAQLNATLNYYNNEFGNAINK-----------------DLKA  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  +++L  LRS I+ +  P KY+EK++R A+ K G DE  LTRV+ TRAE D++ IKE 
Sbjct  223   DPNDEFLKLLRSAIKCLTYPEKYFEKVLRLAINKLGTDEWALTRVVTTRAEVDMQRIKEQ  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
             Y KRNSV L++A+A +TSG Y+ +LLAL+G ++
Sbjct  283   YHKRNSVPLDRAIANDTSGDYKKMLLALVGHED  315



>ref|XP_006644197.1| PREDICTED: annexin-like protein RJ4-like [Oryza brachyantha]
Length=318

 Score =   301 bits (772),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 157/333 (47%), Positives = 220/333 (66%), Gaps = 19/333 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             M T+V P   P+P  DA+A+  A +GWGT E+TVI ++ HR+ TQRK I+ AY + Y E+
Sbjct  1     MTTIVVPPVIPTPAEDADALLKAFQGWGTDERTVIAVLAHRDATQRKKIRMAYEENYNEN  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
              I+R + ELSG  E+A+Y  +LDP +R AV+ N A R     DY VI+E AC+    E +
Sbjct  61    FIQRLQSELSGHFERAMYHWVLDPVERQAVMANTATRCIH-EDYPVIVEIACVNSSPELV  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              VKRAY   YK S EED+A  +T + R LL+ALV  YRY G EV+  LA++E+ ILH  +
Sbjct  120   AVKRAYHVLYKCSLEEDVAARATGNLRSLLLALVSTYRYDGDEVNDALAKSEAKILHETV  179

Query  629   -KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLK  453
                 E +H E++RI+ TRS+AQL ATF  ++DEHG++ITK               L    
Sbjct  180   MNSSETDHGELIRIVGTRSRAQLNATFGWFRDEHGSSITKA--------------LHCGA  225

Query  452   EDTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKE  273
             + TG  Y  ALR+++R + D +KY+ K+++ A+ K+G DED LTRVIV  AE+DL+ IK+
Sbjct  226   DPTG--YSHALRTSVRCISDANKYFVKVLKNAMHKSGTDEDSLTRVIVMHAEKDLKSIKD  283

Query  272   VYQKRNSVTLEQAVAKETSGHYEALLLALLGKQ  174
              +QKR SV+LEQ++AK+TSG Y++ L+ALLGK 
Sbjct  284   AFQKRASVSLEQSIAKDTSGDYKSFLMALLGKS  316



>ref|XP_010025470.1| PREDICTED: annexin D2-like [Eucalyptus grandis]
Length=316

 Score =   301 bits (771),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 158/333 (47%), Positives = 217/333 (65%), Gaps = 19/333 (6%)
 Frame = -3

Query  1166  MATL-VFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MAT+ V P  PSP  DAE +  A  GWGT+E  +I I+ HRN  QRK+I+Q Y + Y ED
Sbjct  1     MATITVPPSVPSPAEDAEQLQKAFAGWGTNEDLIISILPHRNAAQRKVIRQTYAETYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KELS   E++V    LDP +RDA L + A ++    ++ V++E AC     E  
Sbjct  61    LLKALDKELSSDFERSVLLWTLDPAERDAFLSSEATKRLTSSNW-VLMEIACTRSSMELF  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              VK+AY ARYK+S EED+A ++T DFRKLLV L   +RY G EV+  LA++E+ ILH  I
Sbjct  120   MVKQAYHARYKKSLEEDIAYHTTGDFRKLLVPLASTFRYEGPEVNMTLARSEAKILHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
              +K YNH+E++RI++TRSKAQL AT N Y +E G AI K                 DLK 
Sbjct  180   HEKAYNHDELIRIVTTRSKAQLNATLNYYNNEFGNAINK-----------------DLKA  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  +++L  LRS I+ +  P KY+EK++R A+ K G DE  LTRV+ TRAE D++ IKE 
Sbjct  223   DPNDEFLKLLRSAIKCLTYPEKYFEKVLRLAINKLGTDEWALTRVVTTRAEVDMQRIKEQ  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
             Y KRNSV L++A+A +TSG Y+ +LLAL+G ++
Sbjct  283   YHKRNSVPLDRAIANDTSGDYKKMLLALVGHED  315



>gb|EMS50782.1| Annexin D1 [Triticum urartu]
Length=314

 Score =   301 bits (771),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 160/332 (48%), Positives = 214/332 (64%), Gaps = 19/332 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATL  P + P+   D + +  A +GWGT+E  +I I+GHR+ +QR+ I++ Y D Y E+
Sbjct  1     MATLKVPSNVPALADDCDNLRKAFQGWGTNEALIISILGHRDASQRRAIRKHYADTYGEE  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L+R    E+SG  E+AV    LDP +RDAVL N   RK   P   V++E AC    ++  
Sbjct  61    LLRSITDEISGDFERAVILWTLDPAERDAVLANETARKWH-PGNPVLVEIACARGSKQLF  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              V++AY  R+KRS EED+A + T DFRKLLV LV  +RY G EV+ +LA +E+ +LH  I
Sbjct  120   AVRQAYHDRFKRSLEEDVASHVTGDFRKLLVPLVSSHRYEGPEVNTRLAHSEAKLLHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
             + K Y  +E++RIL+TRSKAQL+ATFN Y D  G  ITK                 DLK 
Sbjct  180   EHKAYADDEVIRILTTRSKAQLLATFNNYNDTFGHPITK-----------------DLKA  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  +++L  LR+ IR    P +Y+EK+ R A+   G DE+ LTRVI TRAE DL+ IKE 
Sbjct  223   DPKDEFLKTLRAVIRCFTCPDRYFEKVARVAIAGNGTDENSLTRVITTRAEVDLKLIKEA  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQ  174
             YQKRNSV LE+AVA +TSG YE++LLALLGK+
Sbjct  283   YQKRNSVPLEKAVAGDTSGDYESMLLALLGKE  314



>ref|XP_004288206.1| PREDICTED: annexin D1-like [Fragaria vesca subsp. vesca]
Length=316

 Score =   301 bits (770),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 161/330 (49%), Positives = 215/330 (65%), Gaps = 19/330 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATL  P   PSP  DAE +  A +GWGT+E  +I I+ HRN  QR+LI+Q Y + Y ED
Sbjct  1     MATLQVPACVPSPAEDAEQLKKAFEGWGTNEGLLISILAHRNADQRRLIQQTYTETYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KELS + E+A+    L P +RDAVL N AI++    ++ V++E AC     E  
Sbjct  61    LLKALDKELSSNFERALLLWTLHPSERDAVLANEAIKRFTSSNW-VLMEIACSRSSHELH  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              VK+AY A++K+S EED+A +++ DFRKLLV LV  +RY G EV+  +A+ E+ +LH  I
Sbjct  120   MVKQAYHAKFKKSLEEDVAFHTSGDFRKLLVPLVSAFRYEGDEVNVTVAKREAKLLHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
             K K YN EE++RI+STRSKAQL ATFN+Y +E G AITK                 DLK 
Sbjct  180   KDKHYNDEELIRIISTRSKAQLNATFNQYNNEFGNAITK-----------------DLKA  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  +++L  LR+T + +  P KY+EKL+R  + K G DE  LTRV+ TRAE DL  IKE 
Sbjct  223   DKDDEFLKLLRATTKLLTYPEKYFEKLLRLCINKLGTDEGALTRVVTTRAEVDLHRIKEE  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLG  180
             YQ+RNSVTL  A+ K+T G YE LLL L+G
Sbjct  283   YQRRNSVTLAHAIQKDTRGDYENLLLELIG  312



>ref|XP_010025469.1| PREDICTED: annexin D2-like [Eucalyptus grandis]
 gb|KCW62131.1| hypothetical protein EUGRSUZ_H04787 [Eucalyptus grandis]
Length=316

 Score =   301 bits (770),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 157/333 (47%), Positives = 215/333 (65%), Gaps = 19/333 (6%)
 Frame = -3

Query  1166  MATL-VFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MAT+ V P  PSP  DAE +  A  GWGT+E  +I I+ HRN  QRK+I+Q Y + Y ED
Sbjct  1     MATIAVPPSVPSPAEDAEQLQKAFAGWGTNEDLIISILAHRNAAQRKVIRQTYAETYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KELS   E++V    LDP +RDA L N A ++    ++ V++E AC     E  
Sbjct  61    LLKALDKELSSDFERSVLLWTLDPAERDAFLSNEATKRLTSSNW-VLMEIACTRSSMELF  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              V++AY ARYK+S EED+A ++T DF KLLV L   +RY G EV+  LA++E+ ILH  I
Sbjct  120   MVRQAYHARYKKSLEEDIAYHTTGDFHKLLVPLASTFRYEGPEVNMTLARSEAKILHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
              KK YNH+E++RI++TRSKAQL AT N Y +E G AI K                 DLK 
Sbjct  180   HKKAYNHDELIRIVTTRSKAQLNATLNYYNNEFGNAINK-----------------DLKA  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  +++L  LRS I+ +  P KY+EK++R A+ K G DE  LTRV+ TRAE D++ IKE 
Sbjct  223   DPNDEFLKLLRSAIKCLTYPEKYFEKVLRLAINKLGTDEWALTRVVTTRAEVDMQRIKEQ  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
             Y KRNSV L++A+A +TSG Y+ +LL L+G ++
Sbjct  283   YHKRNSVPLDRAIANDTSGDYKKMLLTLVGHED  315



>gb|KCW62128.1| hypothetical protein EUGRSUZ_H04787 [Eucalyptus grandis]
Length=316

 Score =   301 bits (770),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 157/333 (47%), Positives = 216/333 (65%), Gaps = 19/333 (6%)
 Frame = -3

Query  1166  MATL-VFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MAT+ V P  PSP  DAE +  A  GWGT+E  +I I+ HRN  QRK+I+Q Y + Y ED
Sbjct  1     MATIAVPPSVPSPAEDAEQLQKAFAGWGTNEDLIISILAHRNAAQRKVIRQTYAETYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KELS   E++V    LDP +RDA L N A ++    ++ V++E AC     E  
Sbjct  61    LLKALDKELSSDFERSVLLWTLDPAERDAFLSNEATKRLTSSNW-VLMEIACTRSSMELF  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              V++AY ARYK+S EED+A ++T DF KLLV L   +RY G EV+  LA++E+ ILH  I
Sbjct  120   MVRQAYHARYKKSLEEDIAYHTTGDFHKLLVPLASTFRYEGPEVNMTLARSEAKILHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
              +K YNH+E++RI++TRSKAQL AT N Y +E G AI K                 DLK 
Sbjct  180   HEKAYNHDELIRIVTTRSKAQLNATLNYYNNEFGNAINK-----------------DLKA  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  +++L  LRS I+ +  P KY+EK++R A+ K G DE  LTRV+ TRAE D++ IKE 
Sbjct  223   DPNDEFLKLLRSAIKCLTYPEKYFEKVLRLAINKLGTDEWALTRVVTTRAEVDMQRIKEQ  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
             Y KRNSV L++A+A +TSG Y+ +LLAL+G ++
Sbjct  283   YHKRNSVPLDRAIANDTSGDYKKMLLALVGHED  315



>ref|XP_010926280.1| PREDICTED: annexin D2-like [Elaeis guineensis]
Length=315

 Score =   300 bits (769),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 158/331 (48%), Positives = 216/331 (65%), Gaps = 19/331 (6%)
 Frame = -3

Query  1166  MATLVFP-DHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             M+T+  P   PSP  D E +  A +GWGT+E ++I I+ HR+  QR+ I+ +Y   Y ED
Sbjct  1     MSTISVPVSVPSPAEDCEQLRKAFQGWGTNEGSIISILAHRSGAQRRQIRDSYAQAYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KEL+   EKAV   +LDP +RDAVL N A++K   P+ R +IE A     +E  
Sbjct  61    LLKVLDKELTRDFEKAVLLWILDPPERDAVLANEALKKWS-PNNRALIEIAMTRTADEMF  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              V+RAY+ R+KRS EED+A ++  DFRKLLV LV  YRY G EV+A LA++E+ ILH  I
Sbjct  120   AVRRAYRGRFKRSLEEDVAVHTNGDFRKLLVPLVSSYRYEGPEVNASLAKSEAKILHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
             ++K Y HEEI+RIL+TRSK  L+ATFN Y +E G  I K                 DLK 
Sbjct  180   EEKAYGHEEIIRILTTRSKEHLLATFNDYNNEFGHPINK-----------------DLKS  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  + +L ALR+ +R ++ P +Y EK+IR A+ K G DE  LTRVI TRAE +++ IKE+
Sbjct  223   DPKDDFLFALRAIVRCIICPERYLEKVIRLAINKMGTDECALTRVITTRAEVNMKHIKEI  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGK  177
             Y KRNSV L+ A+ K+T+G YE  LLAL+G+
Sbjct  283   YYKRNSVRLDHALKKDTTGDYEDFLLALIGQ  313



>gb|EYU36506.1| hypothetical protein MIMGU_mgv1a010414mg [Erythranthe guttata]
Length=313

 Score =   300 bits (769),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 159/333 (48%), Positives = 220/333 (66%), Gaps = 23/333 (7%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             M+TL  P H PS   D E ++ A  GWGT+E  +I I+GHRN  QRKLI+Q Y + Y ED
Sbjct  1     MSTLCVPSHVPSVAEDCEQLHKAFSGWGTNEGLIISILGHRNAAQRKLIRQVYAETYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KEL+   E+ V    LD    DA L N A +K    + +V++E AC   P+E L
Sbjct  61    LLKALDKELTSDFERVVKVWTLD----DAYLANEATKKWTSSN-QVLVEIACARSPKELL  115

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
               + AY A +K+S EED+A +++ DFRKLLV LV  YRY G +V+  LA++E+ ILH  I
Sbjct  116   LAREAYHALFKKSLEEDVAHHTSGDFRKLLVPLVSSYRYGGDDVNLILAKSEAKILHEKI  175

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
               KEY+ ++IVRILSTRSKAQ+ AT N+YK+E G  I K                 DLK 
Sbjct  176   SAKEYSCDDIVRILSTRSKAQINATLNQYKNEFGNDINK-----------------DLKA  218

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  ++YL+ LR+T++ +V+P KY+EK++R A+ + G DE  LTRV+ TRAE D++ IKE 
Sbjct  219   DAKDEYLSILRATVKCLVNPEKYFEKVLRLAINRQGTDEGALTRVVATRAEVDMKIIKEE  278

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
             YQKR+SV L++A+AK+T+G YE +LLALLG +E
Sbjct  279   YQKRSSVPLDKAIAKDTTGDYENMLLALLGHEE  311



>ref|XP_004504069.1| PREDICTED: annexin D2-like [Cicer arietinum]
Length=315

 Score =   300 bits (769),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 157/333 (47%), Positives = 218/333 (65%), Gaps = 19/333 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATL  P H PSP  D E + NA +GWGT+E  +I I+ HRN  QRKLI++ Y + + ED
Sbjct  1     MATLKIPAHVPSPSEDGEQLRNAFQGWGTNEGLIISILAHRNAAQRKLIRETYAETHGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KELS   E+AV    LDP +RDAVL N A  K    +  +I+E        + L
Sbjct  61    LLKDLDKELSSDFERAVMLWALDPAERDAVLANQAT-KMLTANNSIIMEIGSTRSSLDLL  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
               K+AYQAR+K+S EED+A +++ D RKLLV+LVG+ RY G EV+  LA++E+ +LH  I
Sbjct  120   RAKQAYQARFKKSLEEDVAYHTSGDIRKLLVSLVGIVRYEGDEVNMTLAKSEAKLLHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
              +K YNHE+++RI++TRSKAQL AT N Y +E G  I K                 DL+ 
Sbjct  180   AEKAYNHEDVIRIVTTRSKAQLNATLNHYTNEFGNEIDK-----------------DLET  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D+ ++YL  LR+ I+ +  P KY+E+L+R A+ KTG DE  LTRV+ TRAE DL+ I + 
Sbjct  223   DSEDEYLKLLRAAIKGLAYPEKYFEELLRLAINKTGTDEGALTRVVTTRAEVDLQRIADE  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
             YQ+RNSV L++A+  +TSG Y+ +LLALLG+ E
Sbjct  283   YQRRNSVPLDRAIDNDTSGDYQKILLALLGRDE  315



>ref|XP_009337417.1| PREDICTED: annexin D1-like [Pyrus x bretschneideri]
 ref|XP_009337424.1| PREDICTED: annexin D1-like [Pyrus x bretschneideri]
Length=316

 Score =   300 bits (768),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 159/332 (48%), Positives = 214/332 (64%), Gaps = 19/332 (6%)
 Frame = -3

Query  1166  MATL-VFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             M+TL V P  P+   D+E +  A KGWGT+E  VI I+GHRN  QRK I++ Y D Y ED
Sbjct  1     MSTLRVPPQVPAASEDSEQLKKAFKGWGTNEDLVISILGHRNAAQRKAIRKTYADAYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  EKEL+   E+ V+   LDP +RDA L N A +K    + +V+ E AC     E L
Sbjct  61    LLKELEKELTSDFERIVWLWTLDPAERDAFLANEATKKWTKSN-QVLAEIACSRSAHELL  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
               ++AY +RYK+S EED+A ++T DFRKLL  LV  YRY G EV+  LA++E+ +LH  I
Sbjct  120   SARQAYHSRYKKSLEEDVAHHTTGDFRKLLAPLVSSYRYEGDEVNLPLAKSEAKLLHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
               K YN ++I+RIL+TRSKAQ+ AT N YK+E G  I K                 DLK 
Sbjct  180   SDKAYNDDDIIRILATRSKAQINATLNHYKNEFGNDINK-----------------DLKA  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  ++YL  LR+TI+ +V P KY+EK +R A+ K G DE  LTRV+ TRAE D+  IK++
Sbjct  223   DPKDEYLAILRATIKCLVRPEKYFEKSLRLAINKRGTDEGALTRVVATRAEVDMMIIKDL  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQ  174
             Y KRNSV L+QA+ K+T+G YE +LLAL+G +
Sbjct  283   YHKRNSVPLDQAIKKDTTGDYEKMLLALVGHE  314



>ref|NP_174810.1| annexin 1 [Arabidopsis thaliana]
 ref|XP_002891204.1| ANNAT1 [Arabidopsis lyrata subsp. lyrata]
 sp|Q9SYT0.1|ANXD1_ARATH RecName: Full=Annexin D1; AltName: Full=AnnAt1; AltName: Full=Annexin 
A1 [Arabidopsis thaliana]
 gb|AAD34236.1|AF083913_1 annexin [Arabidopsis thaliana]
 gb|AAF79882.1|AC021198_2 Identical to annexin (AnnAt1) mRNA from Arabidopsis thaliana 
gb|AF083913. It contains an annexin domain PF|00191. ESTs gb|H76460, 
gb|Z18518, gb|Z26190, gb|N96455, gb|Z47714, gb|T41940, 
gb|T43657, gb|N95995, gb|R30014, gb|T22046, gb|H37398, gb|H77008, 
gb|R29768, gb|H36260, gb|Z17514, gb|W43175, gb|T76739, 
gb|AA712753, gb|H76134, gb|T42209, gb|H36536, gb|AI998553, 
gb|Z32565, gb|AA597533, gb|AI100145 and gb|AI100054 come 
from this gene [Arabidopsis thaliana]
 gb|AAG48798.1|AF332435_1 putative Ca2+-dependent membrane-binding protein annexin [Arabidopsis 
thaliana]
 gb|AAL61954.1| Ca2+-dependent membrane-binding protein annexin [Arabidopsis 
thaliana]
 gb|AAM63633.1| Ca2+-dependent membrane-binding protein annexin [Arabidopsis 
thaliana]
 gb|AAO29977.1| Ca2+-dependent membrane-binding protein annexin [Arabidopsis 
thaliana]
 gb|EFH67463.1| ANNAT1 [Arabidopsis lyrata subsp. lyrata]
 gb|AEE31825.1| annexin 1 [Arabidopsis thaliana]
Length=317

 Score =   300 bits (768),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 156/334 (47%), Positives = 222/334 (66%), Gaps = 20/334 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATL   D  P+P  DAE +  A +GWGT+E  +I I+ HR+  QRK+I+QAYH+ Y ED
Sbjct  1     MATLKVSDSVPAPSDDAEQLRTAFEGWGTNEDLIISILAHRSAEQRKVIRQAYHETYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KELS   E+A+    L+P +RDA+L N A ++    + +V++E AC     + L
Sbjct  61    LLKTLDKELSNDFERAILLWTLEPGERDALLANEATKRWTSSN-QVLMEVACTRTSTQLL  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
               ++AY ARYK+S EED+A ++T DFRKLLV+LV  YRY G EV+  LA+ E+ ++H  I
Sbjct  120   HARQAYHARYKKSLEEDVAHHTTGDFRKLLVSLVTSYRYEGDEVNMTLAKQEAKLVHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
             K K YN E+++RILSTRSKAQ+ ATFNRY+D+HG  I                 L+ L+E
Sbjct  180   KDKHYNDEDVIRILSTRSKAQINATFNRYQDDHGEEI-----------------LKSLEE  222

Query  449   -DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKE  273
              D  +++L  LRSTI+ +  P  Y+  ++R A+ KTG DE  LTR++ TRAE DL+ I E
Sbjct  223   GDDDDKFLALLRSTIQCLTRPELYFVDVLRSAINKTGTDEGALTRIVTTRAEIDLKVIGE  282

Query  272   VYQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              YQ+RNS+ LE+A+ K+T G YE +L+ALLG+ +
Sbjct  283   EYQRRNSIPLEKAITKDTRGDYEKMLVALLGEDD  316



>ref|XP_010680554.1| PREDICTED: annexin D2-like [Beta vulgaris subsp. vulgaris]
Length=316

 Score =   300 bits (767),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 158/330 (48%), Positives = 211/330 (64%), Gaps = 19/330 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MA+L  P   P    D E ++ A  GWGT+E  +I I+ HRN  QRKLI++ Y   Y ED
Sbjct  1     MASLSVPAALPDVAEDVEQLHKAFSGWGTNEDLIITILAHRNACQRKLIRELYTSTYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KELS   EKAV+   LDP +RDA L N A +K    ++ V+IE AC    ++  
Sbjct  61    LLKTLDKELSSDFEKAVHLFTLDPPERDAHLANEATKKFTSSNW-VLIEVACTRSSDDLF  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
               +RAY ARYK+S EED+AQ++T DFRKLLV LV  +RY G EV+  LA++E+ ILH  I
Sbjct  120   SARRAYHARYKKSLEEDVAQHTTGDFRKLLVPLVSSFRYEGPEVNTHLAKSEAKILHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
               K Y  ++ +RI++TRSKAQL AT N Y +++G AITK                 DLKE
Sbjct  180   SDKAYADDDFIRIIATRSKAQLSATLNTYNNDYGHAITK-----------------DLKE  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  + YL  LR+TI+ +  P KYYEKL+R A+ K G DE  LTRV+ TRAE D++ IKE 
Sbjct  223   DPKDDYLKLLRATIKCLTCPEKYYEKLLRLAINKMGTDESALTRVVTTRAEVDMQRIKEE  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLG  180
             Y +RNSV L+ A+AK+T G YE +L+ L+G
Sbjct  283   YYRRNSVPLDHAIAKDTHGDYEKMLIELVG  312



>dbj|BAJ92233.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=314

 Score =   299 bits (766),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 161/332 (48%), Positives = 210/332 (63%), Gaps = 19/332 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATL  P + P+   D + +  A +GWGT+E  +I I+GHR+  QR+ I++ Y D Y E+
Sbjct  1     MATLKVPSNVPALADDCDNLRKAFQGWGTNEALIISILGHRDAAQRRAIRKHYADTYGEE  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L+R    E+SG  E+AV    LDP +RDAVL N   +K   P   V++E AC     +  
Sbjct  61    LLRSITDEISGDFERAVILWTLDPAERDAVLANETAKKWH-PGNPVLVEIACSRGSAQLF  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              V++AY  R+KRS EED+A + T DFRKLLV LV  YRY G EV+ +LA +E+ ILH  I
Sbjct  120   AVRQAYHDRFKRSLEEDVAAHVTGDFRKLLVPLVSSYRYEGPEVNTRLAHSEAKILHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
             + K Y  +EI+RIL+TRSKAQL+AT N Y D  G  ITK                 DLK 
Sbjct  180   EHKAYGDDEIIRILTTRSKAQLLATLNNYNDTFGHPITK-----------------DLKA  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  +++L  LR+ IR    P +Y+EK+ R A+   G DE+ LTRVI TRAE DL+ IKE 
Sbjct  223   DPKDEFLKTLRAVIRCFTCPDRYFEKVARLAIAGNGTDENSLTRVITTRAEVDLKLIKEA  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQ  174
             YQKRNSV LE+AVA +TSG YE +LLALLGK+
Sbjct  283   YQKRNSVPLEKAVADDTSGDYETMLLALLGKE  314



>dbj|BAJ97416.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=314

 Score =   299 bits (766),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 161/332 (48%), Positives = 210/332 (63%), Gaps = 19/332 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATL  P + P+   D + +  A +GWGT+E  +I I+GHR+  QR+ I++ Y D Y E+
Sbjct  1     MATLKVPSNVPALADDCDNLRKAFQGWGTNEALIISILGHRDAAQRRAIRKHYADTYGEE  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L+R    E+SG  E+AV    LDP +RDAVL N   +K   P   V++E AC     +  
Sbjct  61    LLRSITDEISGDFERAVILWTLDPAERDAVLANETAKKWH-PGNPVLVEIACSRGSAQLF  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              V++AY  R+KRS EED+A + T DFRKLLV LV  YRY G EV+ +LA +E+ ILH  I
Sbjct  120   AVRQAYHDRFKRSLEEDVAAHVTGDFRKLLVPLVSSYRYEGPEVNTRLAHSEAKILHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
             + K Y  +EI+RIL+TRSKAQL+AT N Y D  G  ITK                 DLK 
Sbjct  180   EHKAYGDDEIIRILTTRSKAQLLATLNNYNDTFGHPITK-----------------DLKA  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  +++L  LR+ IR    P +Y+EK+ R A+   G DE+ LTRVI TRAE DL+ IKE 
Sbjct  223   DPKDEFLKTLRAVIRCFTCPDRYFEKVARLAIAGNGTDENSLTRVITTRAEVDLKLIKEA  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQ  174
             YQKRNSV LE+AVA +TSG YE +LLALLGK+
Sbjct  283   YQKRNSVPLEKAVAGDTSGDYETMLLALLGKE  314



>ref|XP_003525057.1| PREDICTED: annexin D2 [Glycine max]
 gb|KHN06583.1| Annexin D2 [Glycine soja]
Length=315

 Score =   299 bits (766),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 158/333 (47%), Positives = 217/333 (65%), Gaps = 19/333 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATL  P   PSPV D+E +  A +GWGT+E  +I I+GHRN  QRKLI++AY   + ED
Sbjct  1     MATLKVPAQLPSPVEDSEQLRKAFQGWGTNEGLIISILGHRNAAQRKLIREAYSATHGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L +  +KELS   E+AV    LDP +RDA L N A +     ++ VI+E A      + L
Sbjct  61    LFKDLDKELSSDFERAVLVWTLDPAERDAFLANEATKMLTSNNW-VILEIASTRSSLDLL  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
               K+AYQAR+K+S EED+A ++  D RKLLV LV ++RY G EV+  LA++E+ +LH  I
Sbjct  120   KAKQAYQARFKKSLEEDVAYHTKGDIRKLLVPLVSIFRYEGDEVNMTLAKSEAKLLHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
              +K YN EE++RILSTRSKAQL AT N+Y +E G AI K                 DLK 
Sbjct  180   AEKAYNDEELIRILSTRSKAQLTATLNQYNNEFGNAINK-----------------DLKT  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  ++YL  LR+ I+ +  P KY+ K++R A+ K G DE  LTRV+ TRAE DL+ I E 
Sbjct  223   DPKDEYLQLLRAAIKCLTYPEKYFAKVLRMAINKLGTDEGALTRVVTTRAEVDLQRIAEE  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
             YQ+RNS+ L++A+A +TSG Y+++LLAL+G ++
Sbjct  283   YQRRNSIPLDRAIANDTSGDYQSILLALVGHED  315



>ref|XP_006655923.1| PREDICTED: annexin D1-like [Oryza brachyantha]
Length=314

 Score =   299 bits (765),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 168/332 (51%), Positives = 215/332 (65%), Gaps = 19/332 (6%)
 Frame = -3

Query  1166  MATLVFPDHPSPVAD-AEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATL  P    PVAD  E +  A +GWGT+E  +I I+ HR   QR+ I++AY D Y E+
Sbjct  1     MATLTVPSAVPPVADDCEQLRKAFQGWGTNEALIISILAHREAAQRRAIRRAYADTYGEE  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L+R    E+SG  E+AV    LDP +RDAVL N   RK   P  RV++E AC     +  
Sbjct  61    LLRSITDEISGDFERAVILWTLDPAERDAVLANEVARKWH-PGNRVLVEIACTRGSAQLF  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              V++AY  R+KRS EED+A + T DFRKLLV LV  YR+ G EV+ KLAQ+E+ ILH  I
Sbjct  120   AVRQAYHERFKRSLEEDVAAHVTGDFRKLLVPLVSAYRFEGPEVNTKLAQSEAKILHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
             + K Y  +EI+RIL+TRSKAQL+ATFNRY DE+G  I K                 DLK 
Sbjct  180   QHKAYADDEIIRILTTRSKAQLLATFNRYNDEYGHPINK-----------------DLKA  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  +++L  LR+ IR    P +Y+EK+IR A+   G DE+ LTR+I TRAE DL+ IKE 
Sbjct  223   DPKDEFLATLRAVIRCFSCPDRYFEKVIRLAIAGMGTDENSLTRIITTRAEVDLKLIKEA  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQ  174
             YQKRNSV LE+AVA +TSG YE +LLALLG++
Sbjct  283   YQKRNSVPLERAVAGDTSGDYERMLLALLGQE  314



>ref|XP_008219675.1| PREDICTED: annexin D1 [Prunus mume]
Length=316

 Score =   299 bits (765),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 157/333 (47%), Positives = 214/333 (64%), Gaps = 19/333 (6%)
 Frame = -3

Query  1166  MATLVFPDHPSPVA-DAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             M+TL  P    P + D + +  A KGWGT+E  +I I+GHRN  QRK+I+Q Y + Y ED
Sbjct  1     MSTLRVPQQVPPASEDCDQLKKAFKGWGTNEDLIISILGHRNAAQRKVIRQTYAEAYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  EKEL+   E+++    LDP +RDA L N A +K    + +V+ E AC     E L
Sbjct  61    LLKELEKELTSDFERSILLWTLDPAERDAFLANEATKKWTKSN-QVLAEIACSRSSHELL  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
               ++AY +RYK+S EED+A ++T DFRKLL  LV  YRY G EV+  LA++E+ +LH  I
Sbjct  120   MARQAYHSRYKKSLEEDVAHHTTGDFRKLLAPLVSSYRYEGDEVNLTLAKSEAKLLHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
               K YN E+I+RIL+TRSKAQ+ AT N YK+E G  I K                 DLK 
Sbjct  180   SDKAYNDEDIIRILATRSKAQINATLNHYKNEFGNDINK-----------------DLKA  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  ++YL  LR+TI+ +V P KY+EK +R A+ K G DE  L+RV+ TRAE D++ IKE 
Sbjct  223   DPKDEYLAILRATIKCLVRPEKYFEKSLRLAINKRGTDEGALSRVVTTRAEVDMKLIKEQ  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
             Y KRNSVTL+QA+ K+T G YE +LLAL+G ++
Sbjct  283   YHKRNSVTLDQAIKKDTIGDYEKMLLALVGHED  315



>ref|XP_010269245.1| PREDICTED: annexin D2-like [Nelumbo nucifera]
Length=317

 Score =   299 bits (765),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 157/329 (48%), Positives = 213/329 (65%), Gaps = 19/329 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             M+TLV P+  PS   D E +  A  GWGT+E+ +I I+ HRN  QRKLI++ Y + Y ED
Sbjct  1     MSTLVVPELVPSVTEDCEQLRKAFAGWGTNERLIIDILAHRNAAQRKLIRKTYAETYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L+   +KELS   EKAV    LDP +RDA   N A R+    ++ V++E AC    +E  
Sbjct  61    LLISLDKELSSDFEKAVLMWTLDPAERDAFFANEATRRWTSNNW-VLLEIACTRTSQELF  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              V++AY AR+KRS EED+A ++T DFRKLLV LV  YRY G EV+  LA++E+ +LH  I
Sbjct  120   LVRQAYHARFKRSLEEDVAYHTTGDFRKLLVPLVSSYRYEGQEVNMTLAKSEAKVLHQKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
              +K YN E+++RIL+TRSK QL AT N Y DE G  I K                 DLK 
Sbjct  180   SEKAYNDEDLIRILTTRSKIQLNATLNHYNDEFGNPINK-----------------DLKA  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  +Q+L ALR+ ++ +  P KY+EK++R A+   G DE  LTRV+ TR+E D++ IKE 
Sbjct  223   DPKDQFLAALRAAVKCLTYPEKYFEKVLRLAINGLGTDEWALTRVVTTRSEVDMKQIKEE  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALL  183
             Y +RNSVTLE+A++ +TSG YEA+LLAL+
Sbjct  283   YYRRNSVTLERAISGDTSGDYEAMLLALI  311



>ref|XP_003533096.1| PREDICTED: annexin D8-like [Glycine max]
Length=314

 Score =   298 bits (764),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 153/332 (46%), Positives = 212/332 (64%), Gaps = 19/332 (6%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             M TL+     S + DAE I  ACKG+GT E  +I I+ HRN  Q+KL++ AY + YQEDL
Sbjct  1     MTTLIAAKDSSSIEDAENIRKACKGFGTDEAVLISILAHRNVAQKKLVRMAYEELYQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I++F+ ELSGS E+A+    +DP +RDA  +N A++K   PDY+VIIE AC    EEFL 
Sbjct  61    IQQFKSELSGSFERAICNWTMDPAERDAAFINEALKKE-TPDYKVIIEIACTRTSEEFLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
              KR+YQ +YK   EED+A  +  DFR+LLV +   YRY G E D  LA +E+ ILH  I+
Sbjct  120   AKRSYQFQYKHCLEEDVASKTIGDFRRLLVVVTSAYRYDGDEFDENLAHSEANILHQVIE  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K +N++EI+RIL TRSK QL +TF  +++ +GT ITK                  L  D
Sbjct  180   NKAFNNDEIIRILCTRSKKQLCSTFIAFRNMYGTTITKG-----------------LSTD  222

Query  446   TGN-QYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
               N +Y+ ALR+ IR + +P +Y  K++  AL    A+E  L+RVI++RAE+DL  I ++
Sbjct  223   HPNDEYMEALRTVIRCIKNPRRYLAKVLYYALNDLIAEEHALSRVIISRAEKDLNEINDL  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQ  174
             Y +RN +TL+ +VAK+TSG+Y   LLALLG  
Sbjct  283   YFQRNGITLDSSVAKKTSGNYMNFLLALLGNN  314



>ref|XP_010500052.1| PREDICTED: annexin D1 [Camelina sativa]
 ref|XP_010461335.1| PREDICTED: annexin D1 [Camelina sativa]
 ref|XP_010478957.1| PREDICTED: annexin D1 [Camelina sativa]
Length=317

 Score =   298 bits (764),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 155/334 (46%), Positives = 221/334 (66%), Gaps = 20/334 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATL   D  P+P  DAE +  A +GWGT+E  +I I+GHR+  QRK I+Q+YH+ Y ED
Sbjct  1     MATLKVSDSVPAPSEDAEQLRTAFEGWGTNEDLIISILGHRSAEQRKQIRQSYHETYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KELS   E+A+    L+P +RDA+L N A ++    + +V++E AC     + L
Sbjct  61    LLKTLDKELSNDFERAILLWTLEPAERDALLTNEATKRWTSSN-QVLMEVACTRTSTQLL  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
               ++AY ARYK+S EED+A ++T DFRKLLV LV  YRY G EV+  LA+ E+ ++H  I
Sbjct  120   HARQAYHARYKKSLEEDVAHHTTGDFRKLLVPLVTSYRYEGDEVNMTLAKQEAKLIHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
             K K Y  E+++RILSTRSKAQ+ ATFNRY+D+HG  I                 L+ L+E
Sbjct  180   KDKHYTDEDVIRILSTRSKAQINATFNRYQDDHGEEI-----------------LKSLEE  222

Query  449   -DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKE  273
              D  +++L+ LRSTI+ +  P  Y+  ++R A+ KTG DE  LTR++ TRAE DL+ I E
Sbjct  223   GDDDDKFLSLLRSTIQCLTRPELYFVDVLRSAINKTGTDEGALTRIVTTRAEIDLKVIGE  282

Query  272   VYQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              YQ+RNS+ LE+A+ K+T G YE +L+ALLG+ +
Sbjct  283   EYQRRNSIPLEKAITKDTRGDYEKMLVALLGEDD  316



>ref|XP_009145116.1| PREDICTED: annexin D1 [Brassica rapa]
 gb|AHN63213.1| annexin 1 [Brassica rapa subsp. rapa]
 emb|CDY37093.1| BnaAnng04520D [Brassica napus]
Length=317

 Score =   298 bits (764),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 156/333 (47%), Positives = 221/333 (66%), Gaps = 18/333 (5%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATL    H PSP  DAE + +A  GWGT+E  +I I+ HR+  QRKLI+QAYH+   ED
Sbjct  1     MATLKVSSHVPSPSEDAEQLKSAFDGWGTNEDLIISILAHRSAEQRKLIRQAYHEACGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KEL+   E+A+    L+P +RDA+L N A ++    + +V++E AC     + L
Sbjct  61    LLKTLDKELTSDFERAILLWTLEPGERDALLANEATKRWTSSN-QVLMEVACTRTSTQLL  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
               ++AY ARYK+S EED+A ++T DFRKLLV+LV  YRY G EV+  LA+ E+ ++H  I
Sbjct  120   HARQAYHARYKKSIEEDVAHHTTGDFRKLLVSLVSSYRYEGDEVNMTLAKQEAKLIHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
             K K Y+ E+++RILSTRSKAQ+ ATFNRY+DEHG  I K               L++  E
Sbjct  180   KDKHYSDEDVIRILSTRSKAQINATFNRYQDEHGEEILKS--------------LEEGDE  225

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  +++L  LRSTI+ +  P  Y+  ++R A+ KTG DE  LTR++ TRAE DL+ I E 
Sbjct  226   D--DKFLGLLRSTIQCLTRPELYFVDVLRSAINKTGTDEGALTRIVTTRAEIDLKVIGEE  283

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
             YQ+RNS+ LE+A+ K+T G YE +L+ALLG+ +
Sbjct  284   YQRRNSIPLEKAITKDTRGDYEKMLVALLGEDD  316



>ref|XP_002513910.1| annexin, putative [Ricinus communis]
 gb|EEF48493.1| annexin, putative [Ricinus communis]
Length=315

 Score =   298 bits (764),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 154/333 (46%), Positives = 217/333 (65%), Gaps = 19/333 (6%)
 Frame = -3

Query  1166  MATLVFPDHPSPVAD-AEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             M+TL  P    PV+D  E +  A  GWGT+E  +I I+GHRN  QRKLI+Q Y + Y ED
Sbjct  1     MSTLTIPQPLPPVSDDCEQLRKAFSGWGTNEGLIISILGHRNAAQRKLIRQTYAETYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KELS   E+ V   +LDP +RDA L N A ++    + +V++E AC     E L
Sbjct  61    LLKALDKELSNDFERVVMLWILDPHERDAFLANEATKRW-TSNNQVLMEIACTRSSNELL  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              +++AY ARYK+S EED+A ++T DFRKLL  LV  YRY G EV+  LA+TE+ +LH  I
Sbjct  120   HIRQAYHARYKKSLEEDVAHHTTGDFRKLLFPLVCSYRYEGDEVNLTLAKTEAKLLHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
               K Y+ E+++RIL+TRSKAQ+ AT N YK+E G  I K                 DLK 
Sbjct  180   SNKAYSDEDLIRILATRSKAQINATLNHYKNEFGNDINK-----------------DLKT  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  +++L  LR+T++ +    KY+EKL+R A+ + G DE  LTR+I TRAE D++ IK+V
Sbjct  223   DPKDEFLALLRATVKCLTRSEKYFEKLLRLAINRRGTDEGALTRIIATRAEVDMKIIKDV  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
             +Q+RN+V L++A+AK+T G YE +LLAL+G +E
Sbjct  283   FQQRNTVPLDRAIAKDTHGDYEKMLLALVGHEE  315



>gb|ABK22223.1| unknown [Picea sitchensis]
 gb|ABK26348.1| unknown [Picea sitchensis]
Length=316

 Score =   298 bits (763),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 152/333 (46%), Positives = 218/333 (65%), Gaps = 19/333 (6%)
 Frame = -3

Query  1166  MATLVFP-DHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             M+T++ P   P+PV D+E++  A +GWGT+EK +I I+GHR   QR+ I+QAY   Y+ED
Sbjct  1     MSTIIVPTPTPTPVEDSESLRKAFEGWGTNEKLIIEILGHRTAAQRRAIRQAYTQLYEED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
              ++R + EL+   E+A++   LDP +RDA+L + +I+K   P  R +IE +C     E  
Sbjct  61    FLKRLQSELTREFERALFLWSLDPPERDALLAHESIKKWS-PKNRSLIEISCARSSSELW  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              V++AY  RYK+S EED+A ++  DFRKLLV LV  YRY G EVD +LA++E+  LH AI
Sbjct  120   LVRQAYHVRYKKSLEEDIASHTQGDFRKLLVQLVSSYRYEGPEVDMRLAKSEAKQLHEAI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
             + K + +EE +RI++TRSKAQL ATFN YKDE+G  I K                 DLK 
Sbjct  180   EDKAFGNEEFIRIITTRSKAQLNATFNNYKDEYGHHINK-----------------DLKN  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             +   ++L +LR  I+ +  P +Y+ K++R A+ K G +E+ L RV+VTRAE D+  IKE 
Sbjct  223   EKPEEFLESLRVVIKCICFPERYFAKVLRLAIDKLGTEEEALIRVVVTRAETDMNNIKEE  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
             Y KR S TLE A+A +TSG+YE  LL L+GK++
Sbjct  283   YHKRTSKTLEHAIAADTSGYYEEFLLTLIGKEQ  315



>ref|XP_011097579.1| PREDICTED: annexin D7 [Sesamum indicum]
 ref|XP_011097580.1| PREDICTED: annexin D7 [Sesamum indicum]
Length=318

 Score =   298 bits (763),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 165/332 (50%), Positives = 212/332 (64%), Gaps = 19/332 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATL  P + P    DAE ++ A  GWGT E+ ++GI  HRN  QRKLI++AY   Y ED
Sbjct  1     MATLKVPANVPPSEEDAEKLHKAFAGWGTDEEGIVGIFAHRNGAQRKLIREAYAAAYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  EKELSG   +A+    LDP +RDA L N AI+K    +  VI+E AC     +  
Sbjct  61    LLKELEKELSGDFLRAILLWTLDPAERDAYLANEAIKKLTASNL-VIMEIACTRSSYDLF  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              +++AY A YK+S EED+A  +T DFRKLLV LV  +RY G EVD  LA++E+ ILH  I
Sbjct  120   KIRQAYHACYKKSLEEDVAYYTTGDFRKLLVPLVSAFRYEGDEVDMILAKSEAKILHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
               K    EE++RIL+TRSKAQL ATFN+Y D  G AI+K                 DLK 
Sbjct  180   SGKACADEELIRILTTRSKAQLNATFNQYNDHFGNAISK-----------------DLKA  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  ++YL  LR+TI+ +  P KYYEK +R A+T  G DE  LTRV+VT+AE +L+ IKE 
Sbjct  223   DPKDEYLRFLRATIKCLTSPEKYYEKTLRLAITGLGTDEWALTRVVVTQAEVNLQRIKEE  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQ  174
             Y KRNS+TL  AVA +TSG YE  LLAL+GK+
Sbjct  283   YHKRNSMTLVHAVAGDTSGDYEKFLLALVGKE  314



>ref|XP_010544079.1| PREDICTED: annexin D1 [Tarenaya hassleriana]
Length=316

 Score =   298 bits (763),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 157/333 (47%), Positives = 217/333 (65%), Gaps = 19/333 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATL  P   PSP  DAE +  A +GWGT+E  +I I+GHRN  QRK I++ YH+ + +D
Sbjct  1     MATLKVPAVVPSPSEDAEQLRTAFEGWGTNEHLIISILGHRNAAQRKQIREIYHELHGQD  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KELS   E+A+     +P +RDA L N A ++    + +V++E AC    ++ L
Sbjct  61    LLKALDKELSNDFERAILLWTHEPAERDAYLANEATKRWTSSN-QVLMEIACTRTSDQLL  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
               ++AY ARYK+S EED+A ++T DFRKLLV LV  YRY G EV+  LA+ E  ++H  I
Sbjct  120   HARQAYHARYKKSLEEDVAHHTTGDFRKLLVPLVTSYRYEGPEVNMTLAKQECKLIHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
             K K Y+ E+++RILSTRSKAQ+ ATFN Y+DEHG  I                 L+DL  
Sbjct  180   KDKHYSDEDVIRILSTRSKAQINATFNHYQDEHGHEI-----------------LKDLGG  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D+ +++L  LRSTI  +  P  Y+EK++R A+ K G DE DLTRV+ TRAE DL+ I E 
Sbjct  223   DSDDEFLALLRSTIECLTRPELYFEKVLRSAINKRGTDEGDLTRVVTTRAEIDLQVIGEE  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
             YQ+RNSV L +A+ K+T G YE +LLALLG+ +
Sbjct  283   YQRRNSVPLAKAITKDTHGDYEKMLLALLGEDD  315



>ref|XP_008790831.1| PREDICTED: annexin D1-like [Phoenix dactylifera]
Length=319

 Score =   298 bits (763),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 165/336 (49%), Positives = 219/336 (65%), Gaps = 23/336 (7%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKG----WGTHEKTVIGIIGHRNWTQRKLIKQAYHDQ  1002
             MATL  P   PSP  DAE +  A +G    WGT+E  +I I+GHR   +R+ I+QAYH  
Sbjct  1     MATLKVPATVPSPSEDAEQLRKAFEGIIPCWGTNEALIISILGHRTAARRRAIRQAYHQT  60

Query  1001  YQEDLIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCP  822
             Y EDL++  + E+SG  E+AV    LDP +RDA L N A+RK   P  RV+IE AC    
Sbjct  61    YNEDLLKSLDGEISGDFERAVLLWTLDPAERDAWLANEAVRKWR-PGNRVLIEIACARSS  119

Query  821   EEFLGVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLIL  642
              E   V++AY AR+KRS EED+A ++T DFRKLLV LV  YRY  +EV+  LA++E+ +L
Sbjct  120   RELFAVRQAYHARFKRSLEEDVAAHTTGDFRKLLVPLVSAYRYENAEVNLTLAKSEAKML  179

Query  641   HNAIKKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQ  462
             H  I  K YNHE+++RIL+TRSKAQL+ATFN Y DE G ++ K                 
Sbjct  180   HEKISGKAYNHEDLIRILATRSKAQLVATFNHYNDEFGNSVNK-----------------  222

Query  461   DLKEDTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRG  282
             DLK D  +++L ALR+ IR +  P +Y+EK+IR A+     +E+ LTRVI T AE DL+ 
Sbjct  223   DLKCDPKDEFLAALRAAIRCICFPERYFEKVIRSAINGLRTEENALTRVITTCAEVDLKE  282

Query  281   IKEVYQKRNSVTLEQAVAKETSGHYEALLLALLGKQ  174
             I EVYQKRNS+ LE A+  +T+G YEA+LLALLG++
Sbjct  283   IAEVYQKRNSMPLEHAIKGDTTGDYEAMLLALLGQE  318



>ref|XP_007159652.1| hypothetical protein PHAVU_002G255700g [Phaseolus vulgaris]
 gb|ESW31646.1| hypothetical protein PHAVU_002G255700g [Phaseolus vulgaris]
Length=315

 Score =   298 bits (762),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 159/333 (48%), Positives = 214/333 (64%), Gaps = 19/333 (6%)
 Frame = -3

Query  1166  MATLVFPDHP-SPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATL  P HP SP  D+E +  A KGWGT+E  +I I+GHRN  QRKLI++AY+  Y ED
Sbjct  1     MATLKVPPHPPSPTEDSEQLRKAFKGWGTNEALIISILGHRNAVQRKLIREAYNVTYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KELS   E+ V   +LDP +RDA L N A +K    D  VI+E A      + L
Sbjct  61    LLKDLDKELSSDFERVVLLWILDPAERDAYLANEATKKM-TSDNWVILEIASTRSSLDLL  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
               K+AYQ R+K+S EED+A +++ D RKLLV LV  +RY G EV+  LA++E+ +LH  I
Sbjct  120   KAKQAYQIRFKKSLEEDVAYHTSGDIRKLLVPLVSTFRYEGEEVNMTLAKSEAKVLHGKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
               K YN E+++RIL+TRS+AQL AT N YKDE G AI K                 DLK 
Sbjct  180   SGKTYNDEDLIRILTTRSRAQLSATLNHYKDEFGNAINK-----------------DLKT  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  + YL  LR+ I+ +  P KY+ K++R A+ K G DE  LTRV+ TRAE DL+ + E 
Sbjct  223   DPKDAYLKLLRAAIKCLTFPEKYFAKVLRLAINKLGTDECALTRVVATRAEVDLQRVGEE  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
             YQ+RNSV L++A+A +TSG Y++ LLAL G ++
Sbjct  283   YQRRNSVPLDRAIANDTSGDYKSFLLALAGHEK  315



>gb|ADK13090.1| annexin 1 [Brassica napus]
Length=317

 Score =   298 bits (762),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 155/333 (47%), Positives = 221/333 (66%), Gaps = 18/333 (5%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATL    H PSP  DAE + +A  GWGT+E  +I I+ HR+  QRKLI+Q YH+   ED
Sbjct  1     MATLKVSSHVPSPSEDAEQLKSAFDGWGTNEDLIISILAHRSAEQRKLIRQTYHEACGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KEL+   E+A+    L+P +RDA+L N A ++    + +V++E AC     + L
Sbjct  61    LLKTLDKELTSDFERAILLWTLEPGERDALLANEATKRWTSSN-QVLMEVACTRTSTQLL  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
               ++AY ARYK+S EED+A ++T+DFRKLLV+LV  YRY G EV+  LA+ E+ ++H  I
Sbjct  120   HARQAYHARYKKSIEEDVAHHTTSDFRKLLVSLVSSYRYEGDEVNMTLAKQEAKLIHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
             K K Y+ E+++RILSTRSKAQ+ ATFNRY+DEHG  I K               L++  E
Sbjct  180   KDKHYSDEDVIRILSTRSKAQINATFNRYQDEHGEEILKS--------------LEEGDE  225

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  +++L  LRSTI+ +  P  Y+  ++R A+ KTG DE  LTR++ TRAE DL+ I E 
Sbjct  226   D--DKFLGLLRSTIQCLTRPELYFVDVLRSAINKTGTDEGALTRIVTTRAEIDLKVIGEE  283

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
             YQ+RNS+ LE+A+ K+T G YE +L+ALLG+ +
Sbjct  284   YQRRNSIPLEKAITKDTRGDYEKMLVALLGEDD  316



>pdb|1YCN|A Chain A, X-Ray Structure Of Annexin From Arabidopsis Thaliana 
Gene At1g35720
 pdb|1YCN|B Chain B, X-Ray Structure Of Annexin From Arabidopsis Thaliana 
Gene At1g35720
 pdb|2Q4C|A Chain A, Ensemble Refinement Of The Protein Crystal Structure 
Of Annexin From Arabidopsis Thaliana Gene At1g35720
 pdb|2Q4C|B Chain B, Ensemble Refinement Of The Protein Crystal Structure 
Of Annexin From Arabidopsis Thaliana Gene At1g35720
Length=317

 Score =   297 bits (761),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 155/333 (47%), Positives = 221/333 (66%), Gaps = 20/333 (6%)
 Frame = -3

Query  1163  ATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             ATL   D  P+P  DAE +  A +GWGT+E  +I I+ HR+  QRK+I+QAYH+ Y EDL
Sbjct  2     ATLKVSDSVPAPSDDAEQLRTAFEGWGTNEDLIISILAHRSAEQRKVIRQAYHETYGEDL  61

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             ++  +KELS   E+A+    L+P +RDA+L N A ++    + +V++E AC     + L 
Sbjct  62    LKTLDKELSNDFERAILLWTLEPGERDALLANEATKRWTSSN-QVLMEVACTRTSTQLLH  120

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
              ++AY ARYK+S EED+A ++T DFRKLLV+LV  YRY G EV+  LA+ E+ ++H  IK
Sbjct  121   ARQAYHARYKKSLEEDVAHHTTGDFRKLLVSLVTSYRYEGDEVNMTLAKQEAKLVHEKIK  180

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE-  450
              K YN E+++RILSTRSKAQ+ ATFNRY+D+HG  I                 L+ L+E 
Sbjct  181   DKHYNDEDVIRILSTRSKAQINATFNRYQDDHGEEI-----------------LKSLEEG  223

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  +++L  LRSTI+ +  P  Y+  ++R A+ KTG DE  LTR++ TRAE DL+ I E 
Sbjct  224   DDDDKFLALLRSTIQCLTRPELYFVDVLRSAINKTGTDEGALTRIVTTRAEIDLKVIGEE  283

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
             YQ+RNS+ LE+A+ K+T G YE +L+ALLG+ +
Sbjct  284   YQRRNSIPLEKAITKDTRGDYEKMLVALLGEDD  316



>gb|EAZ00194.1| hypothetical protein OsI_22198 [Oryza sativa Indica Group]
Length=317

 Score =   297 bits (761),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 166/334 (50%), Positives = 217/334 (65%), Gaps = 19/334 (6%)
 Frame = -3

Query  1166  MATLVFPDHPSPVAD-AEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATL  P    PVAD  + +  A +GWGT+E  +I I+ HR+  QR+ I++AY D Y E+
Sbjct  1     MATLTVPSAVPPVADDCDQLRKAFQGWGTNEALIISILAHRDAAQRRAIRRAYADTYGEE  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGV-PDYRVIIEQACIYCPEEF  813
             L+R    E+SG  E+AV    LDP +RDAVL N   RK       RV++E AC   P + 
Sbjct  61    LLRSITDEISGDFERAVILWTLDPAERDAVLANEVARKWHPGSGSRVLVEIACARGPAQL  120

Query  812   LGVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNA  633
               V++AY  R+KRS EED+A ++T DFRKLLV L+  YRY G EV+ KLA +E+ ILH  
Sbjct  121   FAVRQAYHERFKRSLEEDVAAHATGDFRKLLVPLISAYRYEGPEVNTKLAHSEAKILHEK  180

Query  632   IKKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLK  453
             I+ K Y  +EI+RIL+TRSKAQLIATFNRY DE+G  I K                 DLK
Sbjct  181   IQHKAYGDDEIIRILTTRSKAQLIATFNRYNDEYGHPINK-----------------DLK  223

Query  452   EDTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKE  273
              D  +++L+ LR+ IR    P +Y+EK+IR A+   G DE+ LTR+I TRAE DL+ I E
Sbjct  224   ADPKDEFLSTLRAIIRCFCCPDRYFEKVIRLAIAGMGTDENSLTRIITTRAEVDLKLITE  283

Query  272   VYQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              YQKRNSV LE+AVA +TSG YE +LLALLG+++
Sbjct  284   AYQKRNSVPLERAVAGDTSGDYERMLLALLGQEQ  317



>ref|NP_001057176.1| Os06g0221200 [Oryza sativa Japonica Group]
 dbj|BAD37678.1| putative annexin [Oryza sativa Japonica Group]
 dbj|BAF19090.1| Os06g0221200 [Oryza sativa Japonica Group]
 dbj|BAG93033.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ACT64891.1| annexin p33 [Oryza sativa Indica Group]
Length=317

 Score =   297 bits (761),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 166/334 (50%), Positives = 217/334 (65%), Gaps = 19/334 (6%)
 Frame = -3

Query  1166  MATLVFPDHPSPVAD-AEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATL  P    PVAD  + +  A +GWGT+E  +I I+ HR+  QR+ I++AY D Y E+
Sbjct  1     MATLTVPSAVPPVADDCDQLRKAFQGWGTNEALIISILAHRDAAQRRAIRRAYADTYGEE  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKG-GVPDYRVIIEQACIYCPEEF  813
             L+R    E+SG  E+AV    LDP +RDAVL N   RK       RV++E AC   P + 
Sbjct  61    LLRSITDEISGDFERAVILWTLDPAERDAVLANEVARKWYPGSGSRVLVEIACARGPAQL  120

Query  812   LGVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNA  633
               V++AY  R+KRS EED+A ++T DFRKLLV L+  YRY G EV+ KLA +E+ ILH  
Sbjct  121   FAVRQAYHERFKRSLEEDVAAHATGDFRKLLVPLISAYRYEGPEVNTKLAHSEAKILHEK  180

Query  632   IKKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLK  453
             I+ K Y  +EI+RIL+TRSKAQLIATFNRY DE+G  I K                 DLK
Sbjct  181   IQHKAYGDDEIIRILTTRSKAQLIATFNRYNDEYGHPINK-----------------DLK  223

Query  452   EDTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKE  273
              D  +++L+ LR+ IR    P +Y+EK+IR A+   G DE+ LTR+I TRAE DL+ I E
Sbjct  224   ADPKDEFLSTLRAIIRCFCCPDRYFEKVIRLAIAGMGTDENSLTRIITTRAEVDLKLITE  283

Query  272   VYQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              YQKRNSV LE+AVA +TSG YE +LLALLG+++
Sbjct  284   AYQKRNSVPLERAVAGDTSGDYERMLLALLGQEQ  317



>ref|XP_011098465.1| PREDICTED: annexin D1-like [Sesamum indicum]
Length=316

 Score =   297 bits (760),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 154/330 (47%), Positives = 217/330 (66%), Gaps = 19/330 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             M+TL  P   PS   D E +  A  GWGT+E  +I I+GHRN  QRKLI+Q Y + Y ED
Sbjct  1     MSTLCVPSQVPSVAEDCEQLRKAFAGWGTNEGLIISILGHRNAAQRKLIRQVYAETYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KEL+   E+ V    LDP +RDA L N AI+K    + +V++E AC   P+E L
Sbjct  61    LLKVLDKELTSDFERVVKLWTLDPAERDAFLANEAIKKWTSSN-KVLVEIACARSPKELL  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
               + AY A +KRS EED+A +++ DFRKLLV LV  YRY G +V+  LA+TE+ +LH  I
Sbjct  120   LAREAYHACFKRSLEEDVAYHTSGDFRKLLVPLVSSYRYGGDDVNLTLAKTEAKLLHQKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
              +K Y+ ++I+RIL+TRSKAQ+ AT N+YK+E G+ I K                 +LK 
Sbjct  180   SEKAYSCDDIIRILTTRSKAQINATLNQYKNEFGSDINK-----------------NLKA  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  +++L  LR+TI+ +V P +Y+ K++R ++ K G +E  LTRV+ TRAE D++ IK+ 
Sbjct  223   DPKDEFLALLRATIKCLVCPEQYFAKVLRLSINKLGTEEGALTRVVATRAEVDMKVIKDA  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLG  180
             YQKR+SV LEQA+AK+TSG YE +LL L+G
Sbjct  283   YQKRSSVPLEQAIAKDTSGDYEKMLLTLIG  312



>ref|NP_001239752.1| uncharacterized protein LOC100815639 [Glycine max]
 gb|ACU20690.1| unknown [Glycine max]
 gb|KHN29064.1| Annexin D2 [Glycine soja]
Length=315

 Score =   297 bits (760),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 156/333 (47%), Positives = 217/333 (65%), Gaps = 19/333 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATL  P   PSP+ D+E +  A +GWGT+E  +I I+GHRN  QRKLI++AY   + ED
Sbjct  1     MATLKVPAQLPSPLEDSEQLRKAFQGWGTNEGLIISILGHRNAAQRKLIREAYSTTHGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KELS   E+AV    LDP +RDA L N A +     ++ VI+E A      + L
Sbjct  61    LLKDLDKELSSDFERAVMVWTLDPSERDAFLANEATKMLTSNNW-VILEIASTRSSLDLL  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
               K+AYQAR+K+S EED+A ++  D RKLLV LV  +RY G EV+  LA++E+ +LH  I
Sbjct  120   KAKQAYQARFKKSLEEDVAYHTKGDIRKLLVPLVSTFRYEGDEVNMTLAKSEAKLLHQKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
              +K YN E+++RILSTRSKAQL AT N+Y +E G AI K                 DLK 
Sbjct  180   AEKAYNDEDLIRILSTRSKAQLTATLNQYNNEFGNAINK-----------------DLKT  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  ++YL  LR+ I+ +  P KY+ K++R A+ K G DE  LTRV+ TRAE DL+ I E 
Sbjct  223   DPKDEYLQLLRAAIKCLTYPEKYFAKVLRLAINKLGTDEGALTRVVTTRAEVDLQRIAEE  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
             YQ+RNS+ L++A+A +TSG Y+++LLAL+G ++
Sbjct  283   YQRRNSIPLDRAIASDTSGDYQSILLALVGHED  315



>gb|AAB67994.1| annexin, partial [Gossypium hirsutum]
Length=315

 Score =   296 bits (759),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 157/329 (48%), Positives = 213/329 (65%), Gaps = 20/329 (6%)
 Frame = -3

Query  1160  TLVFPDH-PSPVADAE-AIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             TL  P H PSP  DAE  +  A +GWGT+E+ +I I+ HRN  QR  I++ Y + Y EDL
Sbjct  1     TLKVPVHVPSPSEDAEWQLRKAFEGWGTNEQLIIDILAHRNAAQRNSIRKVYGEAYGEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             ++  EKEL+   E+AV    LDP +RDA L N A +K    ++ +++E AC     E L 
Sbjct  61    LKCLEKELTSDFERAVLLFTLDPAERDAHLANEATKKFTSSNW-ILMEIACSRSSHELLN  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             VK+AY ARYK+S EED+A ++T ++RKLLV LV  +RY G EV+  LA++E+ ILH+ I 
Sbjct  120   VKKAYHARYKKSLEEDVAHHTTGEYRKLLVPLVSAFRYEGEEVNMTLAKSEAKILHDKIS  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K Y  EE++RI+STRSKAQL AT N Y    G AI K                 DLK D
Sbjct  180   DKHYTDEEVIRIVSTRSKAQLNATLNHYNTSFGNAINK-----------------DLKAD  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               +++L  LR+ I+ +  P +Y+EK++R+A+ K G+DE  LTRV+ TRAE D+  IKE Y
Sbjct  223   PSDEFLKLLRAVIKCLTTPEQYFEKVLRQAINKLGSDEWALTRVVTTRAEVDMVRIKEAY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLG  180
             Q+RNS+ LEQA+AK+TSG YE  LLAL+G
Sbjct  283   QRRNSIPLEQAIAKDTSGDYEKFLLALIG  311



>emb|CDX73353.1| BnaC05g27530D [Brassica napus]
Length=317

 Score =   296 bits (759),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 155/333 (47%), Positives = 219/333 (66%), Gaps = 18/333 (5%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATL    H PSP  DAE + +A  GWGT+E  +I I+ HR+  QRKLI+Q YH+   ED
Sbjct  1     MATLKVSSHVPSPSEDAEQLKSAFDGWGTNEDLIISILAHRSAEQRKLIRQTYHEACGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KEL+   E+A+    L+P +RDA+L N A ++    + +V++E AC     + L
Sbjct  61    LLKTLDKELTSDFERAILLWTLEPGERDALLANEATKRWTSSN-QVLMEVACTRTSTQLL  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
               ++AY ARYK+S EED+A ++T DFRKLLV+LV  YRY G EV+  LA  E+ ++H  I
Sbjct  120   HARQAYHARYKKSIEEDVAHHTTGDFRKLLVSLVSSYRYEGDEVNMTLATQEAKLIHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
             K K Y+ E+++RILSTRSKAQ+ ATFNRY+DEHG  I K               L++  E
Sbjct  180   KDKHYSDEDVIRILSTRSKAQINATFNRYQDEHGEEILKS--------------LEEGDE  225

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  +++L  LRSTI+ +  P  Y+  ++R A+ KTG DE  LTR++ TRAE DL+ I E 
Sbjct  226   D--DKFLGLLRSTIQCLTRPELYFVDVLRSAINKTGTDEGALTRIVTTRAEIDLKVIGEE  283

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
             YQ+RNS+ LE+A+ K+T G YE +L+ALLG+ +
Sbjct  284   YQRRNSIPLEKAITKDTRGDYEKMLVALLGEDD  316



>ref|XP_009349785.1| PREDICTED: annexin D1-like [Pyrus x bretschneideri]
Length=316

 Score =   296 bits (759),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 158/332 (48%), Positives = 213/332 (64%), Gaps = 19/332 (6%)
 Frame = -3

Query  1166  MATL-VFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             M+TL V P  P+   D+E +  A KGWGT+E  VI I+GHRN  QRK I++ Y D Y ED
Sbjct  1     MSTLRVPPQVPAASEDSEQLKKAFKGWGTNEDLVISILGHRNAAQRKAIRKTYADAYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  EKEL+   E+ V+   LD  +RDA L N A +K    + +V+ E AC     E L
Sbjct  61    LLKELEKELTSDFERIVWLWTLDXAERDAFLANEATKKWTKSN-QVLAEIACSRSAHELL  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
               ++AY +RYK+S EED+A ++T DFRKLL  LV  YRY G EV+  LA++E+ +LH  I
Sbjct  120   SARQAYHSRYKKSLEEDVAHHTTGDFRKLLAPLVSSYRYEGDEVNLALAKSEAKLLHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
               K YN ++I+RIL+TRSKAQ+ AT N YK+E G  I K                 DLK 
Sbjct  180   SDKAYNDDDIIRILATRSKAQINATLNHYKNEFGNDINK-----------------DLKA  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  ++YL  LR+TI+ +V P KY+EK +R A+ K G DE  LTRV+ TRAE D+  IK++
Sbjct  223   DPKDEYLAILRATIKCLVRPEKYFEKSLRLAINKRGTDEGALTRVVATRAEVDMMIIKDL  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQ  174
             Y KRNSV L+QA+ K+T+G YE +LLAL+G +
Sbjct  283   YHKRNSVPLDQAIKKDTTGDYEKMLLALVGHE  314



>ref|XP_007205592.1| hypothetical protein PRUPE_ppa008881mg [Prunus persica]
 gb|EMJ06791.1| hypothetical protein PRUPE_ppa008881mg [Prunus persica]
Length=316

 Score =   295 bits (756),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 159/330 (48%), Positives = 211/330 (64%), Gaps = 19/330 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATL  PD  PSPV DAE +  A +GWGT+E  +I I+ HRN  QRKLI+QAY + Y E+
Sbjct  1     MATLRVPDVVPSPVEDAEQLRKAFEGWGTNEALIISILTHRNAAQRKLIQQAYAETYGEE  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KELS   E+AV    L P +RDA L N A ++    + +V++E A      + L
Sbjct  61    LLKSLDKELSSEFERAVLLWTLVPAERDAFLANEATKRFTSSN-KVLLEIATTRSSHDLL  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              VK+AY AR+K+S EED+A +++ D RKLLV L+  YRY G E+   LA+ E+ ILH  I
Sbjct  120   LVKQAYHARFKKSLEEDVAYHTSGDLRKLLVPLLSTYRYEGDEISVPLAKKEAKILHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
               K YN EE++RILSTRSKAQL AT N Y +E G AI K                 DLK 
Sbjct  180   SDKAYNDEELIRILSTRSKAQLNATLNHYNNEFGNAINK-----------------DLKA  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  +++L  LR TI+++  P KY+EK++R A+ K G DE  LTRV+ TRAE DL  IK+ 
Sbjct  223   DKDDEFLLLLRQTIKSLTVPEKYFEKVLRLAINKLGTDEGALTRVVTTRAEVDLHRIKQE  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLG  180
             Y +RNSV L+QA+ K+TSG YE  L+ L+G
Sbjct  283   YHRRNSVPLDQAIVKDTSGDYEKFLVELVG  312



>ref|XP_004169361.1| PREDICTED: annexin D2-like isoform 1 [Cucumis sativus]
Length=335

 Score =   296 bits (757),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 155/333 (47%), Positives = 220/333 (66%), Gaps = 6/333 (2%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             M+++  PDH PSP  D E +  A +GWGT+E  +I I+ HRN  QR LI++AY + Y ED
Sbjct  1     MSSIKAPDHLPSPAEDCEQLRKAFQGWGTNEDLIISILAHRNAAQRSLIRKAYAETYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KELS   E+ V    L+P DRDA ++N A ++    +  VI+E AC     E  
Sbjct  61    LLKALDKELSSDFERIVLLWTLEPADRDAFMVNEATKRL-TSNNLVIVEVACTRTSIELF  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              V++AYQAR+KRS EED+A +++ D RKLLV L+   +Y G EV+  LA++E+ ILH  I
Sbjct  120   KVRQAYQARFKRSVEEDVAYHTSGDIRKLLVPLISSLQYEGDEVNKTLAKSEAKILHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV---*SWSNLKLFFLQD  459
               KEYNH+E++RIL+TRSKAQL+AT N Y +E+G AI K         + SN    F QD
Sbjct  180   AGKEYNHDEVIRILTTRSKAQLLATLNHYNNEYGNAINKCYQTAELRATMSNECACF-QD  238

Query  458   LKEDTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGI  279
             LK D  ++YL  LR+T++++  P +++ K++R A+ K G DE  L RV+ +RAE D+  I
Sbjct  239   LKADPNDEYLKLLRTTVKSLTFPERHFAKILRLAINKLGTDEWALARVVASRAEIDMERI  298

Query  278   KEVYQKRNSVTLEQAVAKETSGHYEALLLALLG  180
             KE Y +RNSV L +A+AK+TSG YE +LL L+G
Sbjct  299   KEEYYRRNSVPLGRAIAKDTSGDYEKMLLELIG  331



>ref|XP_011016329.1| PREDICTED: annexin D1 [Populus euphratica]
Length=316

 Score =   295 bits (755),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 151/333 (45%), Positives = 215/333 (65%), Gaps = 19/333 (6%)
 Frame = -3

Query  1166  MATLVFPDHPSPVA-DAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             M+TL  P    PV+ D E +  A  GWGT+E  +I I+GHRN  QRKLI+QAY + Y ED
Sbjct  1     MSTLTVPQQVPPVSEDVEQLRKAFSGWGTNEGLIISILGHRNAAQRKLIRQAYAEAYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KELS   E+ +    LDP +RDA L N A ++    + +V++E AC     E L
Sbjct  61    LLKALDKELSNDFERVLLLWTLDPAERDAALANEATKRWTSSN-QVLMEIACTRSSNELL  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
               ++AY AR+K+S EED+A ++  DFRKLL  LV  YRY+G EV+  LA++E+ +LH  I
Sbjct  120   LARQAYHARFKKSLEEDVAHHTIGDFRKLLFPLVSSYRYNGDEVNMTLAKSEAKMLHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
               K Y+ EE++RIL+TRSKAQ+ AT N+YK+E G  I K                 DLK 
Sbjct  180   SNKAYSDEELIRILATRSKAQINATLNQYKNEFGNDINK-----------------DLKA  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  +++L  LR+T++ +  P KY+EK++R A+ K G +E  LTRV+ TRAE D++ IK+ 
Sbjct  223   DPNDEFLALLRATVKCLTRPEKYFEKVLRLAINKRGTNEGALTRVVATRAEIDMKLIKDE  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
             YQ+RNS+ L++A+ K+T G YE LLL L+G Q+
Sbjct  283   YQRRNSIPLDRAIVKDTHGEYEKLLLELVGHQD  315



>ref|XP_011022789.1| PREDICTED: annexin D2-like [Populus euphratica]
Length=316

 Score =   295 bits (755),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 155/330 (47%), Positives = 212/330 (64%), Gaps = 19/330 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MA+L  P   P P  DAE ++ A +GWGT+E  +I I+ HRN  QR LI++ Y + Y +D
Sbjct  1     MASLKVPASVPPPYEDAEQLHKAFEGWGTNEGLIISILAHRNAAQRNLIRKVYAEAYGQD  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KELS   E+AV    LDP +RDA L N A ++    ++ V++E AC     +  
Sbjct  61    LLKDLDKELSSDFERAVLLWTLDPAERDAYLANEATKRFTSSNW-VLMEIACTRSSHDLF  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              V++AY ARYK+S EED+A ++T DFRKLLV LV  +RY G EV+  LA++E+ ILH  I
Sbjct  120   KVRQAYHARYKKSLEEDVAHHTTGDFRKLLVPLVSAFRYEGEEVNTMLAKSEAKILHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
               K Y+ EEI+RIL+TRSKAQL AT N Y +  G AI K                 +LKE
Sbjct  180   SAKAYSDEEIIRILTTRSKAQLNATLNHYNNAFGNAINK-----------------NLKE  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             +  N +L  LR+TI+ +  P KY+EKL+R ++ K G DE  LTRV+ TRAE D+  IKE 
Sbjct  223   EADNDFLKLLRATIKCLTYPEKYFEKLLRLSIKKLGTDERALTRVVTTRAEVDMERIKEE  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLG  180
             Y +RNSVTL++ +A +TSG YE +LLAL+G
Sbjct  283   YHRRNSVTLDRDIAGDTSGDYERMLLALIG  312



>gb|KHN21299.1| Annexin-like protein RJ4 [Glycine soja]
Length=285

 Score =   293 bits (751),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 163/330 (49%), Positives = 207/330 (63%), Gaps = 45/330 (14%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATL+ P H S V DAEA+ NA KGWG  +K +I I+GHRN  QR+ I++AY + YQEDL
Sbjct  1     MATLIAPSHHSRVEDAEALRNAFKGWGADDKAIIAILGHRNVHQRQEIRKAYEEIYQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I   E E+SG  E+A+YR ML P DRDAVL+NVAI K G  DY VI E AC+        
Sbjct  61    IVCLESEISGDFERAMYRWMLQPADRDAVLVNVAI-KNGTKDYHVIAEIACV--------  111

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
                                 S  +   LLV LV  YRY G E++ K AQTE+ +LH ++K
Sbjct  112   -------------------LSAEELLALLVGLVTSYRYEGDEINVKFAQTEANVLHESVK  152

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
             +K+ N EE++RIL+TRSK QL+ATFNRY+DEHG +I+K                  L + 
Sbjct  153   EKKGNSEEVIRILTTRSKTQLVATFNRYRDEHGISISKK-----------------LLDQ  195

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
             T + +   L + IR + D  KYYEK++R A+ K G DED L+RVIVTRAE+DL+ IKE+Y
Sbjct  196   TSDDFHKVLHTAIRCINDHKKYYEKVLRNAVKKFGTDEDGLSRVIVTRAEKDLKDIKELY  255

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGK  177
              KRNSV LE  V+KETSG Y+  LL LLGK
Sbjct  256   YKRNSVHLEDEVSKETSGDYKKFLLTLLGK  285



>ref|XP_002309980.1| annexin-like protein RJ4 [Populus trichocarpa]
 gb|EEE90430.1| annexin-like protein RJ4 [Populus trichocarpa]
Length=316

 Score =   295 bits (754),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 156/330 (47%), Positives = 212/330 (64%), Gaps = 19/330 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MA+L  P   P P  DAE ++ A +GWGT+E  +I I+ HRN  QR LI++ Y + Y +D
Sbjct  1     MASLKVPASVPPPYEDAEQLHKAFEGWGTNEGLIISILAHRNAAQRNLIRKVYAEAYGQD  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KELS   E+AV    LDP +RDA L N A ++    ++ V++E AC     +  
Sbjct  61    LLKDLDKELSSDFERAVLLWTLDPAERDAYLANEATKRFTSSNW-VLMEIACTRSSHDLF  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              V++AY ARYK+S EED+A ++T DFRKLLV LV  +RY G EV+  LA++E+ ILH  I
Sbjct  120   KVRQAYHARYKKSLEEDVAYHTTGDFRKLLVPLVSAFRYEGEEVNTILAKSEAKILHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
               K Y+ EEI+RIL+TRSKAQL AT N Y +  G AI K                 +LKE
Sbjct  180   SDKAYSDEEIIRILTTRSKAQLNATLNHYNNAFGNAINK-----------------NLKE  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             +  N +L  LR+TI+ +  P KY+EKL+R ++ K G DE  LTRV+ TRAE D+  IKE 
Sbjct  223   EADNDFLKLLRATIKCLTYPEKYFEKLLRLSIKKLGTDERALTRVVTTRAEVDMERIKEE  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLG  180
             Y +RNSVTLE+ +A +TSG YE +LLAL+G
Sbjct  283   YHRRNSVTLERDIAGDTSGDYERMLLALIG  312



>ref|XP_008455624.1| PREDICTED: annexin D2-like isoform X1 [Cucumis melo]
 ref|XP_008455625.1| PREDICTED: annexin D2-like isoform X1 [Cucumis melo]
Length=335

 Score =   295 bits (755),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 153/333 (46%), Positives = 219/333 (66%), Gaps = 6/333 (2%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             M+++  PDH PSP  D E + NA +GWGT+E  +I I+ HRN  QR LI+  Y + Y ED
Sbjct  1     MSSIKVPDHLPSPAEDCEQLRNAFQGWGTNEDLIISILAHRNAAQRSLIRNNYAETYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KELS   E+ V    L+P DRDA ++N A ++    +  V++E AC     E  
Sbjct  61    LLKELDKELSSDFERIVLLWTLEPADRDAFMVNEATKRL-TSNNLVLVEVACTRKSIELF  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              V++AYQ R+KRS EED+A +++ D RKLLV L+   RY G EV   LA++E+ ILH  I
Sbjct  120   KVRQAYQVRFKRSLEEDVAYHTSGDIRKLLVPLITSLRYEGDEVSKTLAKSEAKILHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV---*SWSNLKLFFLQD  459
               KE+NH+E++RIL+TRSKAQL+AT N Y +++G AI K         + SN    F QD
Sbjct  180   ADKEFNHDEVIRILTTRSKAQLLATLNHYNNDYGNAINKCYQTAELRATMSNECACF-QD  238

Query  458   LKEDTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGI  279
             LK+D  ++YL  LR+TI+++  P +++ K++R A+ K G DE  L RV+ +RAE D+  I
Sbjct  239   LKDDPNDEYLKLLRTTIKSLTFPERHFAKILRLAINKLGTDEWALARVVASRAEIDMERI  298

Query  278   KEVYQKRNSVTLEQAVAKETSGHYEALLLALLG  180
             KE Y +RNSV L++A+AK+TSG YE +LL L+G
Sbjct  299   KEEYYRRNSVPLDRAIAKDTSGDYEKMLLELIG  331



>ref|XP_002302291.1| annexin 1 family protein [Populus trichocarpa]
 gb|ABK93242.1| unknown [Populus trichocarpa]
 gb|EEE81564.1| annexin 1 family protein [Populus trichocarpa]
Length=316

 Score =   294 bits (753),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 150/333 (45%), Positives = 215/333 (65%), Gaps = 19/333 (6%)
 Frame = -3

Query  1166  MATLVFPDHPSPVA-DAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             M+TL  P    PV+ D E +  A  GWGT+E  +I I+GHRN  QRKLI+QAY + Y ED
Sbjct  1     MSTLTVPQQVPPVSEDVEQLRKAFSGWGTNEGLIISILGHRNAAQRKLIRQAYAEAYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KELS   E+ +    LDP +RDA L N A ++    + +V++E AC     E L
Sbjct  61    LLKALDKELSNDFERVLLLWTLDPAERDAALANEATKRWTSSN-QVLMEIACTRSSNELL  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
               ++AY AR+K+S EED+A +++ DFRKLL  LV  YRY G EV+  LA++E+ +LH  I
Sbjct  120   LARQAYHARFKKSLEEDVAHHTSGDFRKLLFPLVSSYRYDGDEVNMTLAKSEAKMLHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
               K Y+ EE++RIL+TRSKAQ+ AT N+YK+E G  I K                 DLK 
Sbjct  180   SNKAYSDEELIRILATRSKAQINATLNQYKNEFGNDINK-----------------DLKA  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  +++L  LR+T++ +  P KY+EK++R A+ K G +E  LTRV+ TRAE D++ IK+ 
Sbjct  223   DPNDEFLALLRATVKCLTRPEKYFEKVLRLAINKRGTNEGALTRVVATRAEIDMKLIKDE  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
             YQ+RNS+ L++A+ K+T G YE LLL L+G ++
Sbjct  283   YQRRNSIPLDRAIVKDTDGEYEKLLLELVGHED  315



>ref|XP_008233942.1| PREDICTED: annexin D2-like [Prunus mume]
Length=316

 Score =   294 bits (753),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 159/330 (48%), Positives = 211/330 (64%), Gaps = 19/330 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATL  PD  PS V DAE +  A +GWGT+E  +I I+ HRN  QRKLI+QAY + Y E+
Sbjct  1     MATLRVPDVVPSAVEDAEQLRKAFEGWGTNEGLIISILTHRNAAQRKLIQQAYAETYGEE  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KELS   E+AV    L P +RDA L N A ++    + +V++E A      + L
Sbjct  61    LLKSLDKELSSEFERAVLLWTLVPAERDAFLANEATKRFTSSN-KVLLEIATTRSSHDLL  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              VK+AY AR+K+S EED+A +++ D RKLLV L+  YRY G E+   LA+ E+ ILH  I
Sbjct  120   LVKQAYHARFKKSLEEDVAYHTSGDLRKLLVPLLSTYRYEGDEISVPLAKKEAKILHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
               K YN EE++RILSTRSKAQL ATFN Y +E G AI K                 DLK 
Sbjct  180   SDKAYNDEELIRILSTRSKAQLNATFNHYNNEFGNAINK-----------------DLKA  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  +++L  LR TI+++  P KY+EK++R A+ K G DE  LTRV+ TRAE DL  IK+ 
Sbjct  223   DKDDEFLLLLRQTIKSLTVPEKYFEKVLRLAINKLGTDEGALTRVVTTRAEFDLHRIKQE  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLG  180
             Y +RNSV L+QA+ K+TSG YE  L+ L+G
Sbjct  283   YHRRNSVPLDQAIVKDTSGDYEKFLVELVG  312



>ref|XP_004137187.1| PREDICTED: annexin D2-like [Cucumis sativus]
 ref|XP_004169362.1| PREDICTED: annexin D2-like isoform 2 [Cucumis sativus]
Length=316

 Score =   294 bits (753),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 151/333 (45%), Positives = 216/333 (65%), Gaps = 19/333 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             M+++  PDH PSP  D E +  A +GWGT+E  +I I+ HRN  QR LI++AY + Y ED
Sbjct  1     MSSIKAPDHLPSPAEDCEQLRKAFQGWGTNEDLIISILAHRNAAQRSLIRKAYAETYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KELS   E+ V    L+P DRDA ++N A ++    +  VI+E AC     E  
Sbjct  61    LLKALDKELSSDFERIVLLWTLEPADRDAFMVNEATKRL-TSNNLVIVEVACTRTSIELF  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              V++AYQAR+KRS EED+A +++ D RKLLV L+   +Y G EV+  LA++E+ ILH  I
Sbjct  120   KVRQAYQARFKRSVEEDVAYHTSGDIRKLLVPLISSLQYEGDEVNKTLAKSEAKILHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
               KEYNH+E++RIL+TRSKAQL+AT N Y +E+G AI K                 DLK 
Sbjct  180   AGKEYNHDEVIRILTTRSKAQLLATLNHYNNEYGNAINK-----------------DLKA  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  ++YL  LR+T++++  P +++ K++R A+ K G DE  L RV+ +RAE D+  IKE 
Sbjct  223   DPNDEYLKLLRTTVKSLTFPERHFAKILRLAINKLGTDEWALARVVASRAEIDMERIKEE  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
             Y +RNSV L +A+AK+TSG YE +LL L+G  +
Sbjct  283   YYRRNSVPLGRAIAKDTSGDYEKMLLELIGHSD  315



>ref|XP_006434000.1| hypothetical protein CICLE_v10001888mg [Citrus clementina]
 gb|ESR47240.1| hypothetical protein CICLE_v10001888mg [Citrus clementina]
 gb|KDO80945.1| hypothetical protein CISIN_1g035973mg [Citrus sinensis]
Length=316

 Score =   294 bits (752),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 153/330 (46%), Positives = 214/330 (65%), Gaps = 19/330 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             M+TL  P   PS   D E +  A +GWGT+E+ +I I+ HRN  QRKLI+Q Y D Y ED
Sbjct  1     MSTLTVPAQVPSVTEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KEL+   E+ V    LDP +RDA L N A ++    + +V++E AC    ++ L
Sbjct  61    LLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSN-QVLMEIACTRSSKQLL  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
               ++AY AR+K+S EED+  ++  DFRKLL+ LV  YRY G EV+  LA++E+ ILH  I
Sbjct  120   EARQAYHARFKKSLEEDVGYHTNGDFRKLLLPLVTAYRYEGDEVNITLAKSEAKILHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
               K YN E+++RIL+TRSKAQ+ AT N+YK+ +G  I                  QDL+ 
Sbjct  180   SNKTYNDEDLIRILATRSKAQINATLNQYKNVYGNDID-----------------QDLEA  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  ++YL  LR+T++ +V P  Y+EK++R A+ K G DE  LTRV+ TRAE DL+ IK+ 
Sbjct  223   DPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDE  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLG  180
             YQ+RNSV L++AV K+TSG YE +LLALLG
Sbjct  283   YQRRNSVPLDRAVVKDTSGDYEKMLLALLG  312



>gb|AAC49472.1| annexin-like protein [Arabidopsis thaliana]
Length=317

 Score =   294 bits (752),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 154/334 (46%), Positives = 220/334 (66%), Gaps = 20/334 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATL   D  P+P  DAE +  A +GWGT+E  +I I+ HR+  QRK+I+QAYH+ Y +D
Sbjct  1     MATLKVSDSVPAPSDDAEQLRTAFEGWGTNEDLIISILAHRSAEQRKVIRQAYHETYGKD  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KELS   E+A+    L+P +RDA+L N A ++    + +V++E AC     + L
Sbjct  61    LLKTLDKELSNDFERAILLWTLEPGERDALLANEATKRWTSSN-QVLMEVACTRTSTQLL  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
               ++AY ARYK+S EED+A ++T DFRKLLV+LV  YRY G EV+  LA+ E+ ++H  I
Sbjct  120   HARQAYHARYKKSLEEDVAHHTTGDFRKLLVSLVTSYRYEGDEVNMTLAKQEAKLVHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
             K K YN E+++RILSTRSKAQ+ ATFNRY+D+HG  I                 L+ L+E
Sbjct  180   KDKHYNDEDVIRILSTRSKAQINATFNRYQDDHGEEI-----------------LKSLEE  222

Query  449   -DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKE  273
              D  ++    LRSTI+ +  P  Y+  ++R A+ KTG DE  LTR++ TRAE DL+ I E
Sbjct  223   GDDDDKLPCTLRSTIQCLTRPELYFVDVLRSAINKTGTDEGALTRIVTTRAEIDLKVIGE  282

Query  272   VYQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              YQ+RNS+ LE+A+ K+T G YE +L+ALLG+ +
Sbjct  283   EYQRRNSIPLEKAITKDTRGDYEKMLVALLGEDD  316



>ref|XP_008455626.1| PREDICTED: annexin D2-like isoform X2 [Cucumis melo]
Length=316

 Score =   293 bits (751),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 149/330 (45%), Positives = 214/330 (65%), Gaps = 19/330 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             M+++  PDH PSP  D E + NA +GWGT+E  +I I+ HRN  QR LI+  Y + Y ED
Sbjct  1     MSSIKVPDHLPSPAEDCEQLRNAFQGWGTNEDLIISILAHRNAAQRSLIRNNYAETYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KELS   E+ V    L+P DRDA ++N A ++    +  V++E AC     E  
Sbjct  61    LLKELDKELSSDFERIVLLWTLEPADRDAFMVNEATKRL-TSNNLVLVEVACTRKSIELF  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              V++AYQ R+KRS EED+A +++ D RKLLV L+   RY G EV   LA++E+ ILH  I
Sbjct  120   KVRQAYQVRFKRSLEEDVAYHTSGDIRKLLVPLITSLRYEGDEVSKTLAKSEAKILHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
               KE+NH+E++RIL+TRSKAQL+AT N Y +++G AI K                 DLK+
Sbjct  180   ADKEFNHDEVIRILTTRSKAQLLATLNHYNNDYGNAINK-----------------DLKD  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  ++YL  LR+TI+++  P +++ K++R A+ K G DE  L RV+ +RAE D+  IKE 
Sbjct  223   DPNDEYLKLLRTTIKSLTFPERHFAKILRLAINKLGTDEWALARVVASRAEIDMERIKEE  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLG  180
             Y +RNSV L++A+AK+TSG YE +LL L+G
Sbjct  283   YYRRNSVPLDRAIAKDTSGDYEKMLLELIG  312



>gb|KEH37119.1| annexin D8 [Medicago truncatula]
Length=313

 Score =   293 bits (750),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 148/331 (45%), Positives = 212/331 (64%), Gaps = 18/331 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MA+L+     SP+ DAE I NACKG+GT E  +I ++ HRN  QRKL++ AY + Y +DL
Sbjct  1     MASLLAVKDFSPIEDAETIKNACKGFGTDETAIISVLAHRNEAQRKLVRLAYQEIYHQDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I + + ELSG+ E+A+   ++DP +RDA L+N A++K   PDY+VIIE  C    EE L 
Sbjct  61    IEQLKTELSGNFERAISHWIMDPAERDATLINEALKKA-TPDYKVIIEIVCTRNSEELLA  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             +KR+Y + YK   EED+A  +T D RKLLVA++  Y+Y G E D  +A +E+ I H  I+
Sbjct  120   LKRSYHSLYKHCLEEDVASQTTGDIRKLLVAVISTYKYDGDEFDENVAHSEATIFHQLIE  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
             KK +N ++IVRILSTRSK QL  TFN +KD +GT I K                  L   
Sbjct  180   KKAFNDDDIVRILSTRSKKQLCVTFNIFKDLYGTTINKG-----------------LSGG  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
             T ++Y+ ALR+++R + D  +Y  K++  AL     +ED L+RVIVTRAE+DL+ I + +
Sbjct  223   TIDEYIGALRTSVRCIDDSRRYLAKVLSHALNDLANEEDALSRVIVTRAEKDLKEINDHF  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQ  174
              KRN+VT+  +VA++T G Y+  +L LLG +
Sbjct  283   LKRNNVTIHDSVARKTWGIYKTFILELLGNE  313



>gb|KCW68822.1| hypothetical protein EUGRSUZ_F02423 [Eucalyptus grandis]
Length=296

 Score =   292 bits (748),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 147/312 (47%), Positives = 207/312 (66%), Gaps = 18/312 (6%)
 Frame = -3

Query  1106  NACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDLIRRFEKELSGSLEKAVYRLM  927
             N  +GWGT+EK +I I+GHRN  QRKLI+Q Y + Y EDL++  ++EL+   E+ V    
Sbjct  2     NDLEGWGTNEKLIISILGHRNAAQRKLIRQTYAETYGEDLLKALDRELTNDFERLVVLWS  61

Query  926   LDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLGVKRAYQARYKRSFEEDLAQN  747
             LDP +RDA L N A ++    + +V++E AC   P++ L  ++AY ARYK+S EED+  +
Sbjct  62    LDPAERDAYLANEATKRWTSSN-QVLMEIACTRSPQQLLMARQAYHARYKKSLEEDVGHH  120

Query  746   STADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIKKKEYNHEEIVRILSTRSKAQ  567
             +T DFRKLLV LV  YRY G EV+  LA+ E+ ILH  I +K Y HE+++RIL+TRSKAQ
Sbjct  121   TTGDFRKLLVPLVSSYRYDGDEVNMTLAKAEAKILHEKISEKAYGHEDLIRILATRSKAQ  180

Query  566   LIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKEDTGNQYLTALRSTIRAMVDPH  387
             + AT N YK+E G  I K                 DLK D  +++LT LR+T++ +  P 
Sbjct  181   VNATLNHYKNEFGNDINK-----------------DLKTDPKDEFLTILRATVKCLTRPE  223

Query  386   KYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVYQKRNSVTLEQAVAKETSGHY  207
             KY+EK++R A+ K G DE  LTRV+ TRAE D++ I E YQ+RNS+ L++A+ K+T+G Y
Sbjct  224   KYFEKVLRLAINKRGTDEGALTRVVATRAEVDMKFISEEYQRRNSIPLDRAIVKDTTGDY  283

Query  206   EALLLALLGKQE  171
             E +LLAL+G  E
Sbjct  284   EKMLLALIGHVE  295



>ref|XP_009791036.1| PREDICTED: annexin D2-like [Nicotiana sylvestris]
Length=316

 Score =   293 bits (750),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 156/330 (47%), Positives = 210/330 (64%), Gaps = 19/330 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MA+L  P   P P  DAE +  A  GWGT+E  +I I+ HRN  QRKLI++ Y   Y ED
Sbjct  1     MASLKVPTSVPEPYEDAEQLKKAFAGWGTNEALIIQILAHRNAAQRKLIRETYAAAYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  + ELS + ++AV    L P +RDA LLN A ++    ++ VI+E AC    ++  
Sbjct  61    LLKDLDAELSSNFQRAVLLWTLSPAERDAYLLNEATKRLTSSNW-VILEIACTRSSDDLF  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
               ++AY ARYK+S EED+A ++T DFRKLLV LV  +RY G EV+  LA+ E+ ILH  I
Sbjct  120   KARQAYHARYKKSLEEDVAYHTTGDFRKLLVPLVTAFRYEGEEVNMTLARKEANILHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
               K YN EE++RI+STRSKAQL ATFN Y D+HG  I K                 DL+ 
Sbjct  180   SDKAYNDEELIRIISTRSKAQLNATFNHYLDQHGCEINK-----------------DLET  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D+ ++YL  L + I  +  P KY+EK++R  +  TG DE DLTRV+ TRAE D+  IKE 
Sbjct  223   DSDDEYLKLLSAAIECLKTPEKYFEKVLRLGIKGTGTDEWDLTRVVTTRAEVDMERIKEE  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLG  180
             YQKRNSV L++A+A +TSG YE +LLA++G
Sbjct  283   YQKRNSVPLDRAIAGDTSGDYERMLLAMIG  312



>gb|EMT22984.1| Annexin-like protein RJ4 [Aegilops tauschii]
Length=317

 Score =   293 bits (750),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 161/334 (48%), Positives = 213/334 (64%), Gaps = 19/334 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MAT+  P   PSPV DAEA+  A +GWGT E+ VI I+ HR+  QRKLI+ AY ++Y E 
Sbjct  1     MATITVPQVVPSPVEDAEALMKAFQGWGTDEQAVIYILAHRDAAQRKLIRLAYEEKYDER  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L  R E ELSG L+ A+   +LDP +R AV+ N A  K    +Y VI+E AC   P E L
Sbjct  61    LTDRLESELSGDLQTAMGYWVLDPTERQAVIANAAT-KCIDEEYPVIVEIACANSPAELL  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              VKRAY A YKRS EED+A  +T + R LLVALV  YRY G EV+  LA++E+ I+   +
Sbjct  120   EVKRAYHAIYKRSLEEDVAAGATGNLRNLLVALVSAYRYDGDEVNGGLARSEAKIIQADV  179

Query  629   KKK-EYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLK  453
             K     +H E++R+L TRS+AQL ATFN ++DEHGT +TK               L    
Sbjct  180   KNGVTADHGELIRVLGTRSRAQLGATFNCFRDEHGTTVTKA--------------LLHAP  225

Query  452   EDTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKE  273
             + TG  Y  ALR+  R + D  KY+ K++R A+ K+G DE+ L RV+V RAE+DLRGIK+
Sbjct  226   DTTG--YARALRTAARCIADTDKYFAKVLRNAMHKSGTDEESLLRVVVMRAEKDLRGIKD  283

Query  272   VYQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              + KR SV LEQA+AKETSG ++  + AL+G  +
Sbjct  284   EFHKRASVALEQAIAKETSGDFKTFITALVGTSQ  317



>emb|CAA63710.1| annexin [Capsicum annuum]
Length=314

 Score =   293 bits (749),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 156/333 (47%), Positives = 217/333 (65%), Gaps = 21/333 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MA+L  P H PS   D E + +A KGWGT+EK +I I+ HR   QRKLI+Q Y + + ED
Sbjct  1     MASLTVPAHVPSAAEDCEQLRSAFKGWGTNEKLIISILAHRTAAQRKLIRQTYAETFGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  ++EL+   EK V    LDP +RDA L   A ++    ++ V++E AC   P+E +
Sbjct  61    LLKELDRELTHDFEKLVLVWTLDPSERDAHLAKEATKRWTKSNF-VLVELACTRSPKELV  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
               + AY ARYK+S EED+A ++T D RKLLV LV  YRY G EVD +LA+ ES ILH  I
Sbjct  120   LAREAYHARYKKSLEEDVAYHTTGDHRKLLVPLVSSYRYGGEEVDLRLAKAESKILHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
               K Y+ +E++RIL+TRSKAQL AT N YKDEHG  I K               L+D   
Sbjct  180   SDKAYSDDEVIRILATRSKAQLNATLNHYKDEHGEDILKQ--------------LED---  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
               G++++  LR+TI+ +V P  Y+ +++R A+ + G +ED LTRVI TRAE DL+ I + 
Sbjct  223   --GDEFVALLRATIKGLVYPEHYFVEVLRDAINRRGTEEDHLTRVIATRAEVDLKIIADE  280

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
             YQKR+S+ L +A+AK+T G YE++LLALLG++E
Sbjct  281   YQKRDSIPLGRAIAKDTRGDYESMLLALLGQEE  313



>pdb|1DK5|A Chain A, Crystal Structure Of Annexin 24(Ca32) From Capsicum 
Annuum
 pdb|1DK5|B Chain B, Crystal Structure Of Annexin 24(Ca32) From Capsicum 
Annuum
Length=322

 Score =   293 bits (750),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 156/333 (47%), Positives = 217/333 (65%), Gaps = 21/333 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MA+L  P H PS   D E + +A KGWGT+EK +I I+ HR   QRKLI+Q Y + + ED
Sbjct  9     MASLTVPAHVPSAAEDCEQLRSAFKGWGTNEKLIISILAHRTAAQRKLIRQTYAETFGED  68

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  ++EL+   EK V    LDP +RDA L   A ++    ++ V++E AC   P+E +
Sbjct  69    LLKELDRELTHDFEKLVLVWTLDPSERDAHLAKEATKRWTKSNF-VLVELACTRSPKELV  127

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
               + AY ARYK+S EED+A ++T D RKLLV LV  YRY G EVD +LA+ ES ILH  I
Sbjct  128   LAREAYHARYKKSLEEDVAYHTTGDHRKLLVPLVSSYRYGGEEVDLRLAKAESKILHEKI  187

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
               K Y+ +E++RIL+TRSKAQL AT N YKDEHG  I K               L+D   
Sbjct  188   SDKAYSDDEVIRILATRSKAQLNATLNHYKDEHGEDILKQ--------------LED---  230

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
               G++++  LR+TI+ +V P  Y+ +++R A+ + G +ED LTRVI TRAE DL+ I + 
Sbjct  231   --GDEFVALLRATIKGLVYPEHYFVEVLRDAINRRGTEEDHLTRVIATRAEVDLKIIADE  288

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
             YQKR+S+ L +A+AK+T G YE++LLALLG++E
Sbjct  289   YQKRDSIPLGRAIAKDTRGDYESMLLALLGQEE  321



>ref|XP_006305394.1| hypothetical protein CARUB_v10009786mg [Capsella rubella]
 gb|EOA38292.1| hypothetical protein CARUB_v10009786mg [Capsella rubella]
Length=317

 Score =   293 bits (749),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 153/334 (46%), Positives = 218/334 (65%), Gaps = 20/334 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATL   D  P P  DAE +  A +GWGT+E  +I I+ HR+  QRK I+QAYH+ Y ED
Sbjct  1     MATLKVSDSVPHPSEDAEQLRTAFEGWGTNEDLIISILAHRSAEQRKQIRQAYHETYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KELS   E+A+    L+P +RDA+L N A ++    + +V++E AC     + L
Sbjct  61    LLKTLDKELSNDFERAILLWTLEPAERDALLTNEATKRWTSSN-QVLMEVACTRTSTQLL  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
               ++AY ARYK+S EED+A ++T +FRKLLV LV  +RY G EV+  LA+ E+ ++H  I
Sbjct  120   HARQAYHARYKKSLEEDVAHHTTGEFRKLLVPLVTSFRYEGDEVNMTLAKQEAKLIHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
             K K Y  E+++RILSTRSKAQ+ ATFNRY+D+HG  I                 L+ L+E
Sbjct  180   KDKHYTDEDVIRILSTRSKAQINATFNRYQDDHGEEI-----------------LKSLEE  222

Query  449   -DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKE  273
              D  +++L  LRSTI+ +  P  Y+  ++R A+ KTG DE  LTR++ TRAE DL+ I E
Sbjct  223   GDDDDKFLALLRSTIQCLTRPELYFVDVLRSAINKTGTDEGALTRIVTTRAEIDLKVIGE  282

Query  272   VYQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              YQ+RNS+ LE+A+ K+T G YE +L+ALLG+ +
Sbjct  283   EYQRRNSIPLEKAITKDTRGDYEKMLVALLGEDD  316



>ref|XP_002285795.1| PREDICTED: annexin D1 [Vitis vinifera]
 emb|CAN81470.1| hypothetical protein VITISV_020506 [Vitis vinifera]
Length=309

 Score =   292 bits (748),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 155/329 (47%), Positives = 209/329 (64%), Gaps = 24/329 (7%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             MATL      S   D E +  A  GWGT+E  +I I+ HRN  Q K I+Q Y   Y EDL
Sbjct  1     MATL------SVTEDCEQLRKAFAGWGTNEGLIISILAHRNAAQIKSIRQTYAQTYGEDL  54

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             ++   KELS   E+ V    LDP +RDA L N A ++    + +V++E AC    ++ L 
Sbjct  55    LKDLNKELSNDFERVVLLWTLDPAERDAFLANEATKRWTSSN-QVLVEIACTRTSQQLLL  113

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
              K+AY AR+KRS EED+A +++ DFRKLLV LVG YRY G EV+  LA++E+ ILH  I 
Sbjct  114   AKQAYHARFKRSLEEDVAYHTSGDFRKLLVPLVGTYRYEGEEVNMTLAKSEAKILHEKIS  173

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
             +K YNHE+++RIL+TRSKAQ+ AT N YK+E G  I K                 DLK D
Sbjct  174   EKAYNHEDVIRILATRSKAQINATLNHYKNEFGNDINK-----------------DLKTD  216

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               +++L  LR+T++ +  P KY+EK++R A+ K G DE  LTRV+ TRAE D++ IKE Y
Sbjct  217   PKDEFLAILRATVKCLTRPEKYFEKVLRLAINKRGTDEGALTRVVTTRAEIDMKIIKEEY  276

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLG  180
              KRNSVTL+ A+ K+T+G YE +LLAL+G
Sbjct  277   HKRNSVTLDHAIGKDTTGDYEKMLLALIG  305



>ref|XP_004953954.1| PREDICTED: annexin D7-like [Setaria italica]
Length=314

 Score =   292 bits (748),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 166/332 (50%), Positives = 214/332 (64%), Gaps = 19/332 (6%)
 Frame = -3

Query  1166  MATLVFPDHPSPVA-DAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATL  P    PVA D E ++ A +GWGT+EK +I I+ HR+   R+ I++AY + Y ++
Sbjct  1     MATLTVPAAVPPVAEDCEQLHKAFEGWGTNEKLIISILAHRDAAHRRAIRRAYAEAYGKE  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L+R    E+ G  E+AV    LDP +RDAVL N   +K   P  RV++E AC   P +  
Sbjct  61    LLRALGDEIHGKFERAVILWTLDPAERDAVLANEEAKKWH-PGGRVLVEIACARTPAQLF  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
               K+AY  R+KRS EED+A + T DFRKLLV LV  YRY G EV+  LA +E+ ILH  I
Sbjct  120   AAKQAYHDRFKRSLEEDVAAHITGDFRKLLVPLVSAYRYDGPEVNTSLAHSEAKILHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
              KK Y+ EEI+RIL+TRSKAQL+ATFN YKD+    I K                 DLK 
Sbjct  180   HKKAYSDEEIIRILTTRSKAQLLATFNSYKDQFDHPINK-----------------DLKA  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  +++L  LR+ IR    P +Y+EK++R AL   G DEDDLTRVI TRAE DL+ IKE 
Sbjct  223   DPKDEFLATLRAIIRCFTCPDRYFEKILRLALGGMGTDEDDLTRVITTRAEVDLKLIKEA  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQ  174
             YQKRNSVTLE+AVAK+T+  YE ++LALLG +
Sbjct  283   YQKRNSVTLERAVAKDTTRDYEDIILALLGAE  314



>gb|AFZ78531.1| annexin [Populus tomentosa]
Length=316

 Score =   292 bits (747),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 154/330 (47%), Positives = 212/330 (64%), Gaps = 19/330 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MA+L  P   P P  DAE ++ A +GWGT+E  +I I+ HRN  QR LI++ Y + Y +D
Sbjct  1     MASLKVPASVPPPYEDAEQLHKAFEGWGTNEGLIISILAHRNAAQRNLIRKVYAEAYGQD  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KELS   E+AV    LDP +RDA L N A ++    ++ V++E AC     +  
Sbjct  61    LLKDLDKELSSDFERAVLLWTLDPAERDAYLANEATKRFSSSNW-VLMEIACSRSSHDLF  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              V++AY ARYK+S EED+A ++T DFRKLLV LV  +RY G EV+  LA++E+ ILH  I
Sbjct  120   KVRQAYHARYKKSLEEDVAYHTTGDFRKLLVPLVSAFRYEGEEVNTILAKSEAKILHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
               K Y+ EEI+RIL+TRSKAQ+ AT N Y +  G AI K                 +LKE
Sbjct  180   SAKAYSDEEIIRILTTRSKAQVNATLNHYNNAFGNAINK-----------------NLKE  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             +  N +L  LR+TI+ +  P KY+EKL+R ++ K G DE  LTRV+ TRAE D+  IKE 
Sbjct  223   EADNDFLKLLRATIKCLTYPEKYFEKLLRLSIKKLGTDERALTRVVTTRAEVDMERIKEE  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLG  180
             Y +RNSVTL++ +A +TSG YE +LLAL+G
Sbjct  283   YHRRNSVTLDRDIAGDTSGDYERMLLALIG  312



>emb|CAA52903.1| annexin [Medicago sativa]
Length=308

 Score =   291 bits (745),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 150/323 (46%), Positives = 209/323 (65%), Gaps = 18/323 (6%)
 Frame = -3

Query  1139  PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDLIRRFEKELS  960
             PSP  D+E +  A +GWGT+E  +I I+ HRN  QRK I++ Y   + EDL++  +KELS
Sbjct  4     PSPSEDSEQLRGAFQGWGTNEGLIISILAHRNAAQRKSIRETYTQTHGEDLLKDLDKELS  63

Query  959   GSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLGVKRAYQARY  780
                EKAV    LDP +RDA L N A  K    +  +I+E A    P E L  K+AYQ R+
Sbjct  64    SDFEKAVLLWTLDPAERDAFLANQAT-KMLTSNNSIIVEIASTRSPLELLKAKQAYQVRF  122

Query  779   KRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIKKKEYNHEEI  600
             K+S EED+A +++ D RKLLV LVG++RY G EV+  LA++E+ +LH  I  K YNH+++
Sbjct  123   KKSLEEDVAYHTSGDIRKLLVPLVGIHRYEGDEVNMTLAKSEAKLLHEKIADKAYNHDDL  182

Query  599   VRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKEDTGNQYLTAL  420
             +RI++TRSKAQL AT N Y +E G  I K                 DL+ D+ ++YL  L
Sbjct  183   IRIVTTRSKAQLNATLNHYNNEFGNVIDK-----------------DLETDSDDEYLKLL  225

Query  419   RSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVYQKRNSVTLE  240
             R+ I+ +  P KY+E+L+R A+ K G DE+ LTRV+ TRAE DL+ I E YQ+RNSV L+
Sbjct  226   RAAIKGLTYPEKYFEELLRLAINKMGTDENALTRVVTTRAEVDLQRIAEEYQRRNSVPLD  285

Query  239   QAVAKETSGHYEALLLALLGKQE  171
             +A+ K+TSG Y+ +LLAL+G  E
Sbjct  286   RAIDKDTSGDYQKILLALMGHDE  308



>ref|XP_010916888.1| PREDICTED: annexin D1-like isoform X1 [Elaeis guineensis]
Length=344

 Score =   292 bits (748),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 164/360 (46%), Positives = 219/360 (61%), Gaps = 48/360 (13%)
 Frame = -3

Query  1166  MATLVFP-DHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             M+TL  P   PSP  D+E +  A +GWGT+E  +I I+ HR+  QR+ I+ AY   Y ED
Sbjct  1     MSTLSIPVSVPSPYDDSEQLRKAFEGWGTNEGLIIAILAHRSAAQRRQIRDAYAQAYGED  60

Query  989   LIRRFEKELSGSLE-----------------------------KAVYRLMLDPEDRDAVL  897
             +++  EKEL+   E                             KAV   MLDP +RDAVL
Sbjct  61    ILKALEKELTRHFEVFSVSCFFSQRSLSFCSFSSLICFLIWKQKAVLLWMLDPPERDAVL  120

Query  896   LNVAIRKGGVPDYRVIIEQACIYCPEEFLGVKRAYQARYKRSFEEDLAQNSTADFRKLLV  717
              N A++K    + R +IE +     +E   V+RAY AR+KRS EED+A +++ DFRKLLV
Sbjct  121   ANEALKKWSSGN-RALIEISVTRTSDEMFAVRRAYHARFKRSLEEDVAVHTSGDFRKLLV  179

Query  716   ALVGVYRYSGSEVDAKLAQTESLILHNAIKKKEYNHEEIVRILSTRSKAQLIATFNRYKD  537
              LV  YRY G EV+A LA++E+ +LH  I  K+Y +EEI+RIL+TRSKAQL+ATFN Y +
Sbjct  180   PLVSSYRYEGLEVNASLAKSEAKMLHEKINDKDYGNEEIIRILTTRSKAQLLATFNDYNN  239

Query  536   EHGTAITKPNLVV*SWSNLKLFFLQDLKEDTGNQYLTALRSTIRAMVDPHKYYEKLIRRA  357
             E G  I K                 DLK D  + +L ALRS IR ++ P KY+EK+IR A
Sbjct  240   EFGHPINK-----------------DLKADPKDDFLFALRSIIRCIICPEKYFEKVIRLA  282

Query  356   LTKTGADEDDLTRVIVTRAERDLRGIKEVYQKRNSVTLEQAVAKETSGHYEALLLALLGK  177
             + K G DE  LTRVI TRAE +++ IKE+Y KRNSV LE+A+ K+T+G YE  LLAL+G+
Sbjct  283   INKMGTDEYALTRVITTRAEVNMKQIKEIYYKRNSVPLERAIKKDTTGDYEDFLLALIGE  342



>ref|XP_006399517.1| hypothetical protein EUTSA_v10014138mg [Eutrema salsugineum]
 gb|ESQ40970.1| hypothetical protein EUTSA_v10014138mg [Eutrema salsugineum]
Length=317

 Score =   291 bits (745),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 153/333 (46%), Positives = 213/333 (64%), Gaps = 19/333 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MA+L  P + P P  DA  +  A KGWGT+E  +I I+ HRN TQR  I+  Y   Y +D
Sbjct  1     MASLKVPANVPLPEEDANQLNEAFKGWGTNEGMIISILAHRNATQRNFIRAVYSANYDKD  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KELSG  E+AV     DP +RDA L   + +     ++ +++E AC     EFL
Sbjct  61    LLKELDKELSGDFERAVMLWTFDPAERDAYLAKESTKMFTKNNW-ILVEIACTRSSLEFL  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
               K+AYQARYK S EED+A +++ D RKLLV LV  +RY+G EV+  LA +E+ ILH  I
Sbjct  120   SAKQAYQARYKTSLEEDVAYHTSGDLRKLLVPLVSTFRYTGDEVNMMLASSEAKILHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
             ++K Y  E+++RIL+TRSKAQ+ AT N + D+ GT+ITK                  LKE
Sbjct  180   EEKAYGDEDLIRILTTRSKAQISATLNHFNDKFGTSITKY-----------------LKE  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D+ N+Y+  L++ I+ +  P KY+EK++R+A+ K G DE  LTRV+ TRAE D+  IKE 
Sbjct  223   DSDNEYVQLLKAVIKCLTYPEKYFEKVLRQAINKVGTDEWALTRVVTTRAEFDMERIKEE  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
             Y +RNSV L++A+AK+T G YE +LLALLG  E
Sbjct  283   YLRRNSVPLDRAIAKDTHGDYEDILLALLGHDE  315



>ref|XP_010087582.1| Annexin D2 [Morus notabilis]
 gb|EXB29437.1| Annexin D2 [Morus notabilis]
Length=316

 Score =   291 bits (745),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 158/330 (48%), Positives = 210/330 (64%), Gaps = 19/330 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATL  P+  PSP+ DAE +  A +GWGT+E  +I I+ HRN  QRKLI+QAY D Y ED
Sbjct  1     MATLSVPEVVPSPLEDAEQLRKAFEGWGTNESLIISILTHRNAHQRKLIRQAYADTYNED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KELS   E+AV    LDP +RDA+L   + R+    +  V++E A      +  
Sbjct  61    LLKALDKELSSDFERAVLLWTLDPAERDALLAYDSTRRF-TSNLWVLVEIATTRSTHDLF  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              V++AY ARYKRS EED+A ++T D+RKLLV LV   RY G EV+  LA+ E+ IL + I
Sbjct  120   EVRKAYHARYKRSIEEDIAYHATGDYRKLLVPLVSSLRYGGDEVNNTLAKAEAKILRDKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
               K YN ++ +RI+STRSKAQL AT N Y + +G AI K                 DLK 
Sbjct  180   TNKAYNDDDFIRIISTRSKAQLNATLNHYNNSYGNAINK-----------------DLKA  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  ++YL  LR+ I+ +  P KYYEK++R+A+ K G DE  LTRVI TRAE DL+ IKE 
Sbjct  223   DPNDEYLKLLRAVIKNLTVPEKYYEKVLRQAINKLGTDEWGLTRVITTRAEVDLKRIKEE  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLG  180
             Y +RNSV L++A+AK+ SG YE  L+ L G
Sbjct  283   YHRRNSVPLDRAIAKDVSGDYEKFLIELTG  312



>gb|ABK95721.1| unknown [Populus trichocarpa]
Length=316

 Score =   291 bits (745),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 149/333 (45%), Positives = 214/333 (64%), Gaps = 19/333 (6%)
 Frame = -3

Query  1166  MATLVFPDHPSPVA-DAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             M+TL  P    PV+ D E +  A  GWGT+E  +I I+GHRN  QRKLI+QAY + Y ED
Sbjct  1     MSTLTVPQQVPPVSEDVEQLRKAFSGWGTNEGLIISILGHRNAAQRKLIRQAYAEAYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KELS   E+ +    LDP +RDA L N A ++    + +V++E AC     E L
Sbjct  61    LLKALDKELSNDFERVLLLWTLDPAERDAALANEATKRWTSSN-QVLMEIACTRSSNELL  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
               ++AY AR+K+S EED+A +++ DFRKLL  LV  YRY G EV+  LA++E+ +LH  I
Sbjct  120   LARQAYHARFKKSLEEDVAHHTSGDFRKLLFPLVSSYRYDGDEVNMTLAKSEAKMLHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
               K Y+ EE++RIL+TRSKAQ+ AT N+YK+E G  I K                 DLK 
Sbjct  180   SNKAYSDEELIRILATRSKAQINATLNQYKNEFGNDINK-----------------DLKA  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  +++L  LR+T++ +  P KY+EK++R A+ K G +E  LTRV+ TRAE D++ IK+ 
Sbjct  223   DPNDEFLALLRATVKCLTRPEKYFEKVLRLAINKRGTNEGALTRVVATRAEIDMKLIKDE  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
             YQ+RNS+ L++A+ K+T G Y  LLL L+G ++
Sbjct  283   YQRRNSIPLDRAIVKDTDGEYGKLLLELVGHED  315



>ref|XP_007018794.1| Annexin 1 [Theobroma cacao]
 gb|EOY16019.1| Annexin 1 [Theobroma cacao]
Length=316

 Score =   291 bits (745),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 153/333 (46%), Positives = 213/333 (64%), Gaps = 19/333 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATL  P   PS   D E +  A  GWGT+E  +I I+GHRN  QRKLI+Q Y + Y ED
Sbjct  1     MATLTVPATVPSVNEDCEQLRKAFSGWGTNEGLIIAILGHRNAEQRKLIRQTYAETYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KELS   E+ V    LDP +RDA L N A ++    + +V++E AC     + L
Sbjct  61    LLKALDKELSDDFERVVLVWTLDPAERDAFLANEATKRWTSSN-QVLMEIACTRSANQLL  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
               ++AY ARYK+S EED+A ++T DFRKLL+ LV  YRY G EV+  LA++E+ +LH  I
Sbjct  120   HARQAYHARYKKSLEEDVAHHTTGDFRKLLLPLVCSYRYEGDEVNMTLAKSEAKLLHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
               K YN ++++R+L+TRSKAQ+ AT N YK+E+G  I K                 DLK 
Sbjct  180   SNKAYNDDDLIRVLATRSKAQINATLNHYKNEYGNDINK-----------------DLKA  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  +++L  LR+T++ +V P  Y+EK++R A+ + G DE  LTRV+ TRAE DL+ I + 
Sbjct  223   DPKDEFLALLRATVKCLVRPESYFEKVLRLAINRRGTDEGALTRVVTTRAEVDLKIIADE  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
             YQ+RNSV L++A+AK+T G YE +LLAL G  E
Sbjct  283   YQRRNSVPLDRAIAKDTHGDYEKMLLALAGHVE  315



>ref|XP_003615096.1| Annexin [Medicago truncatula]
 gb|AES98054.1| annexin D8 [Medicago truncatula]
 gb|AFK41639.1| unknown [Medicago truncatula]
Length=316

 Score =   291 bits (744),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 153/334 (46%), Positives = 213/334 (64%), Gaps = 21/334 (6%)
 Frame = -3

Query  1166  MATLVFPDHPSPVA--DAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQE  993
             M+TL  P HP P    D E +  A  GWGT+E  +I I+GHRN  QRK+I++AY   Y+E
Sbjct  1     MSTLSVP-HPLPPVSDDVEQLRKAFSGWGTNENLIISILGHRNEVQRKVIREAYAKTYEE  59

Query  992   DLIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEF  813
             DLI+   KEL+   E+ V+   L+  +RDA L N A ++    + +V++E AC    ++ 
Sbjct  60    DLIKALNKELTSDFERLVHLWTLESAERDAFLANEATKRWTSSN-QVLVELACTRSSDQL  118

Query  812   LGVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNA  633
                K+AY A +K+S EED+A ++T DFRKLL+ LV  YRY G EV+  +A+ E+ ILH  
Sbjct  119   FFAKKAYHALHKKSLEEDVAYHTTGDFRKLLLPLVSSYRYEGDEVNLTIAKAEAKILHEK  178

Query  632   IKKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLK  453
             I KK YN ++ +RIL+TRSKAQ+ AT N YKD  G  I K                 DLK
Sbjct  179   ISKKAYNDDDFIRILATRSKAQINATLNHYKDAFGKDINK-----------------DLK  221

Query  452   EDTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKE  273
             ED  N+YL+ LRST++ +V P +Y+ K+IR A+ K G DE  LTRV+ TRAE DL+ I E
Sbjct  222   EDPKNEYLSLLRSTVKCLVFPERYFAKIIREAINKRGTDEGALTRVVATRAEIDLKIIAE  281

Query  272   VYQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
              YQ+RNS+ L++A+ K+T+G YE +LLA+LG  +
Sbjct  282   EYQRRNSIPLDRAIVKDTTGDYEKMLLAILGHND  315



>emb|CAA10210.1| annexin cap32 [Capsicum annuum]
Length=314

 Score =   291 bits (744),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 155/333 (47%), Positives = 216/333 (65%), Gaps = 21/333 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MA+L  P H PS   D E + +A KGWGT+ K +I I+ HR   QRKLI+Q Y + + ED
Sbjct  1     MASLTVPAHVPSAAEDCEQLRSAFKGWGTNHKLIISILAHRTAAQRKLIRQTYAETFGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  ++EL+   EK V    LDP +RDA L   A ++    ++ V++E AC   P+E +
Sbjct  61    LLKELDRELTHDFEKLVLVWTLDPSERDAHLAKEATKRWTKSNF-VLVELACTRSPKELV  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
               + AY ARYK+S EED+A ++T D RKLLV LV  YRY G EVD +LA+ ES ILH  I
Sbjct  120   LAREAYHARYKKSLEEDVAYHTTGDHRKLLVPLVSSYRYGGEEVDLRLAKAESKILHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
               K Y+ +E++RIL+TRSKAQL AT N YKDEHG  I K               L+D   
Sbjct  180   SDKAYSDDEVIRILATRSKAQLNATLNHYKDEHGEDILKQ--------------LED---  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
               G++++  LR+TI+ +V P  Y+ +++R A+ + G +ED LTRVI TRAE DL+ I + 
Sbjct  223   --GDEFVALLRATIKGLVYPEHYFVEVLRDAINRRGTEEDHLTRVIATRAEVDLKIIADE  280

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
             YQKR+S+ L +A+AK+T G YE++LLALLG++E
Sbjct  281   YQKRDSIPLGRAIAKDTRGDYESMLLALLGQEE  313



>ref|XP_007141170.1| hypothetical protein PHAVU_008G173100g [Phaseolus vulgaris]
 gb|ESW13164.1| hypothetical protein PHAVU_008G173100g [Phaseolus vulgaris]
Length=316

 Score =   291 bits (744),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 153/331 (46%), Positives = 209/331 (63%), Gaps = 19/331 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             M+TL  P   PS   D E +  A  GWGT+E  +I I+GHR   QRK+I++ Y   Y ED
Sbjct  1     MSTLKVPQSVPSAADDCEQLRKAFAGWGTNEGLIISILGHRRADQRKIIRETYAKTYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KEL+   E+ V+   LD  +RDA L N A +K    + RV++E +C    E+ L
Sbjct  61    LLKVLDKELTSDFERLVHLWALDSAERDAFLANEAAKKWSSSN-RVLVEISCARSSEQLL  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
               +RAY   YK+S EED+A  +T DFRKLL+ LV  YRY G EVD  LA+TE+ +LH  I
Sbjct  120   AARRAYHVLYKKSLEEDVAHRTTGDFRKLLLLLVSSYRYEGDEVDLSLAKTEAKLLHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
              KK Y  ++ ++I +TRS+AQL A FN YKDE G  I K                 DLK 
Sbjct  180   SKKAYTDDDFIKIFATRSRAQLNAAFNHYKDEFGKDINK-----------------DLKA  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  N++L  LR+T + ++ P KY+ K++R A+   G +E++LTRV+VTRAE DL+ I E 
Sbjct  223   DPKNEFLALLRATTKCLIHPEKYFAKVVRLAIGGQGTNEENLTRVVVTRAEVDLKIIGEE  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGK  177
             YQ+RNSV LE+A+AK+TSG YE +LLALLG+
Sbjct  283   YQRRNSVPLERAIAKDTSGDYEKMLLALLGQ  313



>gb|KDO56580.1| hypothetical protein CISIN_1g021204mg [Citrus sinensis]
Length=316

 Score =   291 bits (744),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 151/330 (46%), Positives = 213/330 (65%), Gaps = 19/330 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATL  P   PS   DAE ++ A +GWGT+E  +I ++ HRN  QRKLI++ Y++ Y ED
Sbjct  1     MATLKVPTQTPSAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KELS   E++V    L P +RDA L N A ++  + ++ V++E AC     +  
Sbjct  61    LLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRFTLSNW-VLMEIACTRSSRDLF  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
               K+AY ARYK+S EED+A +++ DFRKLLV LV  +RY G +V+  LA+TE+ IL + I
Sbjct  120   AAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKILRDKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
               K+Y HEE++RIL+TRSKAQ+ AT N Y D  G AI K                 DLK 
Sbjct  180   SDKDYAHEELIRILTTRSKAQINATLNHYNDTFGNAINK-----------------DLKA  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  ++YL  LR+ I+ +  P K++ K++R A+   G DE  LTRV+ TRAE D++ IKE 
Sbjct  223   DPNDEYLKLLRAAIKCLTYPEKHFAKVLRLAINGLGTDEWGLTRVVTTRAEVDMQRIKEE  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLG  180
             Y +RN+VTLE+A+A +TSG YE +LLAL+G
Sbjct  283   YHRRNTVTLEKAIAGDTSGDYERMLLALIG  312



>ref|XP_004964979.1| PREDICTED: annexin D2-like [Setaria italica]
Length=314

 Score =   291 bits (744),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 164/332 (49%), Positives = 215/332 (65%), Gaps = 19/332 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATL  P   P+   D E +  A +GWGT+E  +I I+GHR+  QR+ I++AY + Y E+
Sbjct  1     MATLKVPATVPAVADDCEQLRKAFQGWGTNEALIISILGHRDAAQRRAIRRAYAETYGEE  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L+R    E+SG  E+AV    LDP +RDAVL N A RK   P  RV++E AC     +  
Sbjct  61    LLRSITDEISGDFERAVILWTLDPAERDAVLANEAARKWQ-PGNRVLVEIACTRGSAQLF  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              V++AY  R+KRS EED+A + T DFRKLLV LV  YRY G EV+ +LA +E+ +LH  I
Sbjct  120   AVRQAYHERFKRSLEEDIAAHVTGDFRKLLVPLVSAYRYDGPEVNTRLAHSEAKMLHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
               K Y+ +EI+RIL+TRSKAQL+ATFN Y D  G  I K                 DLK 
Sbjct  180   HHKAYSDDEIIRILTTRSKAQLLATFNYYNDAFGHPINK-----------------DLKA  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  ++YL  LR+ IR +  P +Y+EK++R+A+   G DE  LTRVI TRAE DL+ IKE 
Sbjct  223   DPKDEYLKTLRAIIRCLTCPDRYFEKVVRQAIAGLGTDESSLTRVITTRAEVDLKHIKEA  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQ  174
             YQKRNSV LE+AVA +TSG YE++LLALLG++
Sbjct  283   YQKRNSVPLERAVAGDTSGDYESMLLALLGQE  314



>ref|XP_011031008.1| PREDICTED: annexin D2-like [Populus euphratica]
Length=350

 Score =   292 bits (747),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 155/332 (47%), Positives = 209/332 (63%), Gaps = 19/332 (6%)
 Frame = -3

Query  1172  RSMATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQ  996
             ++MA+L  P   P P  DAE +  A KGWGT+E  +I I+ HRN  QR LI+Q Y + Y 
Sbjct  33    KTMASLKVPASVPPPYEDAEQLNKAFKGWGTNEGLIISILAHRNAAQRNLIRQVYAEAYG  92

Query  995   EDLIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEE  816
             +DL++  +KELS   E+ V    LDP +RDA L N A ++    ++ V++E AC     +
Sbjct  93    QDLLKDLDKELSSDFERVVLLWTLDPAERDAYLANEATKRFTSSNW-VLMEIACTRSSHD  151

Query  815   FLGVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHN  636
                V++AY AR+K+S EED+A ++T DFRKLLV LV  +RY G EV+  LA++E+  LH 
Sbjct  152   LFKVRQAYHARHKKSLEEDVAYHTTGDFRKLLVPLVSAFRYEGEEVNTMLAKSEAKTLHE  211

Query  635   AIKKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDL  456
              I  K Y+ +EI+RIL+TRSKAQL AT N Y +  G AI K                 +L
Sbjct  212   KISDKAYSDDEIIRILTTRSKAQLNATLNHYNNAFGNAINK-----------------NL  254

Query  455   KEDTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIK  276
             KED  N++L  LR+TI+ +  P KY+EKL+R A+ K G DE  LTRV+ TRAE D+  IK
Sbjct  255   KEDADNEFLKLLRATIKCLTYPEKYFEKLLRLAIKKIGTDEWALTRVVTTRAEVDMERIK  314

Query  275   EVYQKRNSVTLEQAVAKETSGHYEALLLALLG  180
             E Y +RNSVTL   +A E SG YE +LLAL+G
Sbjct  315   EEYHRRNSVTLAHDIAGEASGDYERMLLALIG  346



>ref|XP_008353937.1| PREDICTED: annexin D1-like [Malus domestica]
Length=316

 Score =   291 bits (744),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 157/333 (47%), Positives = 210/333 (63%), Gaps = 19/333 (6%)
 Frame = -3

Query  1166  MATL-VFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             M+TL V P  P+   D E +  A KGWGT+E  VI I+GHRN  QRK I++ Y D Y ED
Sbjct  1     MSTLRVPPQVPAASEDCEQLKKAFKGWGTNEDLVISILGHRNAAQRKAIRKTYADAYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  EK L+   E+ V    LDP +RDA L N A +K    + +V+ E AC     E L
Sbjct  61    LLKELEKXLTSDFERIVLLWTLDPAERDAFLANEATKKWTKCN-QVLAEIACSRSAHELL  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
               ++AY ARYK+S EED+A ++T DFRKLL  LV  YRY G EV+  LA++E+ +LH  I
Sbjct  120   LARQAYHARYKKSLEEDVAXHTTGDFRKLLAPLVSSYRYEGDEVNLALAKSEAKLLHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
               K YN ++I+RIL+TRSKAQ+ AT N YK+E G  I K                 DLK 
Sbjct  180   SDKAYNDDDIIRILATRSKAQINATLNHYKNEFGNDINK-----------------DLKA  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  ++YL   R+TI+ +V P KY+EK +R A+ K G DE  L RV+ TRAE D+  IK++
Sbjct  223   DPKDEYLAIXRATIKCLVRPEKYFEKSLRLAINKRGTDEGALXRVVATRAEVDMMIIKDL  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
             Y KRNSV L+QA+ K+T+G YE +LLAL+G ++
Sbjct  283   YHKRNSVPLDQAIKKDTTGDYEKMLLALVGHED  315



>gb|AFK45764.1| unknown [Lotus japonicus]
Length=316

 Score =   290 bits (743),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 150/333 (45%), Positives = 215/333 (65%), Gaps = 19/333 (6%)
 Frame = -3

Query  1166  MATLVFPDHPSPVAD-AEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATL  P  P PVAD  E +  A  GWGT+E  +I I+GHRN  QRKLI++ Y + Y ED
Sbjct  1     MATLRVPQTPPPVADDCEQLRKAFSGWGTNEDLIISILGHRNAAQRKLIRETYAETYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KEL+   E+ V+   LD  +RDA L N A ++    + +V++E AC    E+  
Sbjct  61    LLKALDKELTSDFERLVHLWALDSAERDAFLANEATKRWTSSN-QVLVEIACTRSSEQMF  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              V++AY A YK+S EED+A ++T DFRKLL+ L+  YRY G EV+  LA++E+ +LH  I
Sbjct  120   AVRKAYHALYKKSLEEDVAHHTTGDFRKLLLPLMSSYRYEGDEVNLTLAKSEAKLLHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
               K YN ++++RIL+TRS+AQ+ AT N YKD  G  I K                 DLK 
Sbjct  180   TDKAYNDDDLIRILATRSRAQINATLNHYKDAFGKDINK-----------------DLKA  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             +  ++YL+ LR+T++ +V P KY+EK IR ++ K G DE  LTRV+ TRAE DL+ I   
Sbjct  223   EPKDEYLSLLRATVKCLVRPEKYFEKFIRLSINKRGTDEGALTRVVATRAEIDLKIIANE  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
             YQ+R+S+ L++A+ K+T+G YE +LLALLG ++
Sbjct  283   YQRRSSIPLDRAIIKDTNGDYEKMLLALLGHED  315



>ref|XP_010673729.1| PREDICTED: annexin D8 [Beta vulgaris subsp. vulgaris]
Length=315

 Score =   290 bits (743),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 147/331 (44%), Positives = 213/331 (64%), Gaps = 18/331 (5%)
 Frame = -3

Query  1166  MATLVFPDHPSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQEDL  987
             M+T+V P+  SP+ DA  I  AC+G GT E  +I ++GHR   Q KLIK AY + YQEDL
Sbjct  1     MSTIVAPERTSPIDDAHIIKKACRGLGTDENAIISLLGHRMSCQIKLIKLAYQEVYQEDL  60

Query  986   IRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFLG  807
             I + + E+SG  EKA+ + ++DP +R+A+L+  A++K   PDY ++ E  C   PEE L 
Sbjct  61    INQLKCEISGDFEKAICQWVIDPVEREAILIFEALKKEK-PDYNLVAEIVCTKSPEELLT  119

Query  806   VKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAIK  627
             +KRAY   YK + EED+A ++    R  LV +V  Y+Y G E+D  LA +++  LH+ I+
Sbjct  120   LKRAYHKIYKHALEEDVASHTRGKVRNFLVGIVSTYKYYGDEIDEILAYSDATTLHDEIQ  179

Query  626   KKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKED  447
              K+  HEEI+RI++TRSK QL+ATFN +KD HGT IT+                  L+  
Sbjct  180   DKKSIHEEIIRIITTRSKQQLLATFNHFKDIHGTTITRA-----------------LRGT  222

Query  446   TGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEVY  267
               +++   +R  I+ +  P KY+ K++R+A+   G DED LTRVIVTRAE DL+ IKE+Y
Sbjct  223   PEHEFFETIRVAIKCISYPQKYFAKILRKAIIGLGTDEDVLTRVIVTRAEIDLKDIKELY  282

Query  266   QKRNSVTLEQAVAKETSGHYEALLLALLGKQ  174
              +RN+ +L+QA+A +TSG Y+A LL LLG +
Sbjct  283   LERNNTSLDQAIAGDTSGDYKAFLLTLLGSE  313



>ref|XP_009130484.1| PREDICTED: annexin D2-like [Brassica rapa]
Length=316

 Score =   290 bits (743),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 150/330 (45%), Positives = 212/330 (64%), Gaps = 19/330 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MA+L  P + P P  DAE ++ A  GWGT+EK +I I+ HR   QR LI+ AY   Y ED
Sbjct  1     MASLKVPTNVPLPEEDAEQLHKAFAGWGTNEKLIISILAHRTSAQRSLIRSAYAAAYNED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KELS   E+ V    LDP +RDA L   + +     ++ V++E AC  CP +  
Sbjct  61    LLKALDKELSSDFERVVMLWTLDPAERDAFLAKESTKMFTKNNW-VLVEIACTRCPLDLF  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              VK+AYQARYK+S EED+AQ+++ D RKLL+ LV  +RY G EV+ +LA++E+ +LH  +
Sbjct  120   KVKQAYQARYKKSLEEDVAQHTSGDLRKLLLPLVSTFRYEGDEVNMRLARSEAKLLHEKV  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
              +K ++ ++ +RIL+TRSKAQL AT N Y +E+G AI K                  LKE
Sbjct  180   SEKAFSDDDFIRILTTRSKAQLGATLNHYNNEYGNAINK-----------------HLKE  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D+ ++YL  LR+ I  +  P K++EK++R A+ K G DE  LTRV+ TR E D+  IKE 
Sbjct  223   DSDDEYLKLLRAAITCLTYPEKHFEKVLRLAINKMGTDEWALTRVVTTRTEVDMERIKEE  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLG  180
             YQ+RNS+ L  AVAK+TSG YE +L++LLG
Sbjct  283   YQRRNSIPLHHAVAKDTSGDYEDMLVSLLG  312



>gb|EAY87564.1| hypothetical protein OsI_08976 [Oryza sativa Indica Group]
 gb|ADE61246.1| annexin 2 [Oryza sativa Indica Group]
Length=314

 Score =   290 bits (741),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 166/332 (50%), Positives = 213/332 (64%), Gaps = 19/332 (6%)
 Frame = -3

Query  1166  MATLVFPDHPSPVA-DAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATL  P    PVA D E +  A KGWGT+EK +I I+ HR+  QR+ I++AY + Y E+
Sbjct  1     MATLTVPAAVPPVAEDCEQLRKAFKGWGTNEKLIISILAHRDAAQRRAIRRAYAEAYGEE  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L+R    E+ G  E+AV +  LDP +RDAVL N   RK   P  R ++E AC   P +  
Sbjct  61    LLRALNDEIHGKFERAVIQWTLDPAERDAVLANEEARKWH-PGGRALVEIACTRTPSQLF  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
               K+AY  R+KRS EED+A + T D+RKLLV LV VYRY G EV+  LA +E+ ILH  I
Sbjct  120   AAKQAYHERFKRSLEEDVAAHITGDYRKLLVPLVTVYRYDGPEVNTSLAHSEAKILHGKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
               K Y+ +EI+RIL+TRSKAQL+ATFN Y D+ G  ITK                 DLK 
Sbjct  180   HDKAYSDDEIIRILTTRSKAQLLATFNSYNDQFGHPITK-----------------DLKA  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  +++L  LR+ IR    P +Y+EK+IR AL   G DE+ LTR+I TRAE DL+ IKE 
Sbjct  223   DPKDEFLGTLRAIIRCFTCPDRYFEKVIRLALGGMGTDENSLTRIITTRAEVDLKLIKEA  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQ  174
             YQKRNSV LE+AVAK+T+  YE +LLALLG +
Sbjct  283   YQKRNSVPLERAVAKDTTRDYEDILLALLGAE  314



>ref|NP_001048149.1| Os02g0753800 [Oryza sativa Japonica Group]
 dbj|BAD15571.1| putative annexin P35 [Oryza sativa Japonica Group]
 dbj|BAD17230.1| putative annexin P35 [Oryza sativa Japonica Group]
 dbj|BAF10063.1| Os02g0753800 [Oryza sativa Japonica Group]
 gb|EEE57822.1| hypothetical protein OsJ_08419 [Oryza sativa Japonica Group]
Length=314

 Score =   290 bits (741),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 166/332 (50%), Positives = 213/332 (64%), Gaps = 19/332 (6%)
 Frame = -3

Query  1166  MATLVFPDHPSPVA-DAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATL  P    PVA D E +  A KGWGT+EK +I I+ HR+  QR+ I++AY + Y E+
Sbjct  1     MATLTVPAAVPPVAEDCEQLRKAFKGWGTNEKLIISILAHRDAAQRRAIRRAYAEAYGEE  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L+R    E+ G  E+AV +  LDP +RDAVL N   RK   P  R ++E AC   P +  
Sbjct  61    LLRALNDEIHGKFERAVIQWTLDPAERDAVLANEEARKWH-PGGRALVEIACTRTPSQLF  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
               K+AY  R+KRS EED+A + T D+RKLLV LV VYRY G EV+  LA +E+ ILH  I
Sbjct  120   AAKQAYHERFKRSLEEDVAAHITGDYRKLLVPLVTVYRYDGPEVNTSLAHSEAKILHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
               K Y+ +EI+RIL+TRSKAQL+ATFN Y D+ G  ITK                 DLK 
Sbjct  180   HDKAYSDDEIIRILTTRSKAQLLATFNSYNDQFGHPITK-----------------DLKA  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  +++L  LR+ IR    P +Y+EK+IR AL   G DE+ LTR+I TRAE DL+ IKE 
Sbjct  223   DPKDEFLGTLRAIIRCFTCPDRYFEKVIRLALGGMGTDENSLTRIITTRAEVDLKLIKEA  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQ  174
             YQKRNSV LE+AVAK+T+  YE +LLALLG +
Sbjct  283   YQKRNSVPLERAVAKDTTRDYEDILLALLGAE  314



>gb|AFZ78532.1| annexin [Populus tomentosa]
Length=316

 Score =   290 bits (741),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 155/330 (47%), Positives = 207/330 (63%), Gaps = 19/330 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MA+L  P   P P  DAE +  A KGWGT+E  +I I+ HRN  QR LI+Q Y + Y +D
Sbjct  1     MASLKVPASVPPPYEDAEQLNKAFKGWGTNEGLIISILAHRNAAQRNLIRQVYAEAYGQD  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KELS   E+ V    LD  +RDA L N A ++    ++ V++E AC     +  
Sbjct  61    LLKDLDKELSSDFERVVLLWTLDLAERDAYLANEATKRFTSSNW-VLMEIACTRSSHDLF  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
               ++AY ARYK+S EED+A ++T DFRKLLV LV  +RY G EV+  LA++E+ ILH  I
Sbjct  120   KARQAYHARYKKSLEEDVAYHTTGDFRKLLVPLVSAFRYEGEEVNTMLAKSEAKILHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
               K Y+ +EI+RIL+TRSKAQL AT N Y +  G AI K                 +LKE
Sbjct  180   SDKAYSDDEIIRILTTRSKAQLNATLNHYNNSFGNAINK-----------------NLKE  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  N++L  LR+TI+ +  P KY+EKL+R A+ K G DE  LTRV+ TRAE D+  IKE 
Sbjct  223   DADNEFLKLLRATIKCLTYPEKYFEKLLRLAIKKIGTDEWALTRVVTTRAEVDMERIKEE  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLG  180
             Y +RNSVTL+  +A E SG YE +LLAL+G
Sbjct  283   YHRRNSVTLDHDIAGEASGDYERMLLALIG  312



>gb|AFL69958.1| annexin E1 [Brassica oleracea var. capitata]
Length=316

 Score =   290 bits (741),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 151/330 (46%), Positives = 212/330 (64%), Gaps = 19/330 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MA+L  P + P P  DAE ++ A  GWGT+EK +I I+ HRN  QR LI+  Y   Y ED
Sbjct  1     MASLKVPSNVPLPEDDAEQLHKAFSGWGTNEKLIISILAHRNSAQRSLIRSVYAATYNED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KELS   E+AV    LDP +RDA L   + +     ++ V++E AC     E  
Sbjct  61    LLKALDKELSSDFERAVMLWTLDPAERDAYLAKESTKMFTKNNW-VLVEIACTRSAVELF  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              VK+AYQARYK+S EED+AQ+++ D RKLL+ LV  +RY G +V+  LA++E+ +LH  +
Sbjct  120   KVKQAYQARYKKSLEEDVAQHTSGDLRKLLLPLVSTFRYEGDDVNMMLARSEAKLLHEKV  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
              +K +N ++ +RIL+TRSKAQL AT N Y +EHG +I K                 +LKE
Sbjct  180   SEKAFNDDDFIRILTTRSKAQLGATLNHYNNEHGNSINK-----------------NLKE  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
              + ++YL  LR+ I  +  P K++EK++R A+ K G DE  LTRV+ TR E D+  IKE 
Sbjct  223   GSDDEYLKLLRAAITCLTYPEKHFEKVLRLAINKMGTDEWGLTRVVTTRTEVDMERIKEE  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLG  180
             YQ+RNSV L++AVAK+TSG YE +L+ALLG
Sbjct  283   YQRRNSVPLDRAVAKDTSGDYEDMLVALLG  312



>ref|XP_002306311.2| annexin-like protein RJ4 [Populus trichocarpa]
 gb|EEE93307.2| annexin-like protein RJ4 [Populus trichocarpa]
Length=316

 Score =   289 bits (740),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 154/330 (47%), Positives = 207/330 (63%), Gaps = 19/330 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MA+L  P   P P  DAE +  A KGWGT+E  ++ I+ HRN  QR LI+Q Y + Y +D
Sbjct  1     MASLKVPASVPPPYEDAEQLNKAFKGWGTNEGLIMSILAHRNAAQRNLIRQVYAEAYGQD  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KELS   E+ V    LD  +RDA L N A ++    ++ V++E AC     +  
Sbjct  61    LLKDLDKELSSDFERVVLLWTLDLAERDAYLANEATKRFTSSNW-VLMEIACTRSSHDLF  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
               ++AY ARYK+S EED+A ++T DFRKLLV LV  +RY G EV+  LA++E+ ILH  I
Sbjct  120   KARQAYHARYKKSLEEDVAYHTTGDFRKLLVPLVSAFRYEGEEVNTMLAKSEAKILHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
               K Y+ +EI+RIL+TRSKAQL AT N Y +  G AI K                 +LKE
Sbjct  180   SDKAYSDDEIIRILTTRSKAQLNATLNHYNNAFGNAINK-----------------NLKE  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  N++L  LR+TI+ +  P KY+EKL+R A+ K G DE  LTRV+ TRAE D+  IKE 
Sbjct  223   DADNEFLKLLRATIKCLTYPEKYFEKLLRLAIKKIGTDEGALTRVVTTRAEVDMERIKEE  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLG  180
             Y +RNSVTL+  +A E SG YE +LLAL+G
Sbjct  283   YHRRNSVTLDHDIAGEASGDYERMLLALIG  312



>gb|AFK33579.1| unknown [Lotus japonicus]
Length=314

 Score =   289 bits (740),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 153/333 (46%), Positives = 216/333 (65%), Gaps = 20/333 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATL  P   PSP  D+E +  A +GWGT+E  +I I+ HRN  QRKLI + Y   Y ED
Sbjct  1     MATLKVPSQVPSPAEDSEQLRKAFQGWGTNEDLIISILAHRNAAQRKLIHETYSQTYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L+   +KELS   E+AV    L P +RDA L+N A ++    ++ +++E A      +  
Sbjct  61    LLTDLDKELSSDFERAVVLWTLGPAERDAFLVNEATKRLTKNNW-ILMEIASTRSSLDLF  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
               K+AYQAR+KRS E D+A +++ D RKLLV LVG +RY G EV+  LA++E+ +LH  I
Sbjct  120   KAKQAYQARFKRSIE-DVAYHTSGDIRKLLVPLVGTFRYDGDEVNMILAKSEAKLLHEKI  178

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
              +K YNHE+++R+++TRSKAQL AT N Y +E G  I K                 DL+ 
Sbjct  179   AEKAYNHEDLLRVITTRSKAQLNATLNHYNNEFGNEIDK-----------------DLET  221

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D+ ++YL  LR+TI+++  P KY+E+L+R A+ KTG DE  LTRV+ TRAE DL+ I E 
Sbjct  222   DSDDEYLNLLRATIKSLTYPEKYFEELLRLAINKTGTDEWALTRVVTTRAEVDLQKIAEE  281

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLGKQE  171
             YQKRNSV L++A+A +TSG Y+ +LLAL+G+ +
Sbjct  282   YQKRNSVPLDRAIANDTSGDYQKILLALMGRDD  314



>emb|CAA10261.1| annexin P38 [Capsicum annuum]
Length=316

 Score =   289 bits (740),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 153/330 (46%), Positives = 207/330 (63%), Gaps = 19/330 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MA+L  P   P P  DAE +  A KGWGT+E+ +I I+ HRN  QRKLI+ +Y   Y ED
Sbjct  1     MASLKVPASVPDPCEDAEQLKKAFKGWGTNEELIIQILAHRNAAQRKLIRDSYAAAYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  + EL+   ++ V    L P +RDA L N A ++    ++ VI+E AC    +E  
Sbjct  61    LLKDLDSELTSDFQRIVLLWTLSPAERDAYLANEATKRLTASNW-VIMEIACTRSSDELF  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
               ++AY  RYK+SFEED+A ++T DFRKLLV L+  +RY G EV+  LA+ E+ ILH  +
Sbjct  120   KARQAYHTRYKKSFEEDVAYHTTGDFRKLLVPLITAFRYEGEEVNMTLARKEANILHEKV  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
               K YN EE++RI+STRSK QL ATFN Y D+HG  I K                 DL+ 
Sbjct  180   SGKAYNDEELIRIISTRSKTQLNATFNHYNDQHGHEIIK-----------------DLEA  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  ++YL  LR+ I  +  P KY+EK++R A+   G DE DLTRV+ TRAE D+  IKE 
Sbjct  223   DDDDEYLKLLRAAIECLKTPEKYFEKVLRVAIKGLGTDEWDLTRVVATRAEVDMERIKEE  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLG  180
             Y KRNSVTL++A+  +TSG YE +LLAL+G
Sbjct  283   YNKRNSVTLDRAITGDTSGDYERMLLALIG  312



>gb|AAR13288.1| Anx1 [Gossypium hirsutum]
 gb|AGG75997.1| annexin AnxGb1 [Gossypium barbadense]
 gb|KHG05039.1| Annexin D2 -like protein [Gossypium arboreum]
Length=316

 Score =   289 bits (740),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 152/330 (46%), Positives = 211/330 (64%), Gaps = 19/330 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATL  P H P+P  DAE +  A +GWGT+E+ +I I+ HRN  QR LI++ Y + Y ED
Sbjct  1     MATLKVPAHVPAPSEDAEQLRKAFEGWGTNEQLIIDILAHRNAAQRNLIRKTYREAYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  ++ELS   E+AV    LDP +RDA L + A ++     + V++E AC     E  
Sbjct  61    LLKSLDEELSSDFERAVVLFTLDPAERDAFLAHEATKRFTSSHW-VLMEIACTRSSHELF  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              V++AY   YK+S EED+A ++  D+RKLLV LV  +RY G EV+  LA++E+ IL   I
Sbjct  120   NVRKAYHDLYKKSLEEDVAHHTKGDYRKLLVPLVSAFRYQGEEVNMTLARSEAKILREKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
               K+Y+ EE++RI++TRSKAQL AT N Y    G AI K                 DLK 
Sbjct  180   SDKQYSDEEVIRIVTTRSKAQLNATLNHYNTAFGNAINK-----------------DLKA  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  +++L  LR+ I+ +  P KY+EK++R+A+ K G DE  LTRV+ TRAE D+  IKE 
Sbjct  223   DPEDEFLKLLRAAIKCLTVPEKYFEKVLRQAINKLGTDEWALTRVVATRAEVDMVRIKEE  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLG  180
             YQ+RNSVTLE+A+A +TSG YE +LLAL+G
Sbjct  283   YQRRNSVTLEKAIAGDTSGDYEKMLLALIG  312



>ref|XP_009339720.1| PREDICTED: annexin D2-like [Pyrus x bretschneideri]
Length=316

 Score =   289 bits (739),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 157/330 (48%), Positives = 209/330 (63%), Gaps = 19/330 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MA+   PD  PSPV DAE +  A  GWGT+E  +I I+ HRN  QRKLI+QAY + Y ED
Sbjct  1     MASCRVPDVVPSPVEDAEQLRKAFAGWGTNEGLIISILTHRNAAQRKLIQQAYAETYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++ F+KELS   E+AV    L P +RDA L N +  K    +Y +++E A      +  
Sbjct  61    LLKSFDKELSSDFERAVVLWTLAPAERDAFLANEST-KLLTKNYWILLEIATTRSSHDLY  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              VK AY ARYK+S EED+A +++ D RKLLV L+  +RY G E++  L++ E+ ILH  I
Sbjct  120   QVKVAYHARYKKSLEEDVAYHTSGDVRKLLVPLLSTFRYEGDEINVPLSKKEAKILHEKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
               K YN EE++RIL+TRSKAQL AT N+Y +E G AI K                 DLK 
Sbjct  180   SDKAYNDEELIRILTTRSKAQLNATLNQYNNEFGNAINK-----------------DLKA  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  +++L  LR TI+++  P KY+EK++R A+ K G DE  LTRVI TRAE DL+ IKE 
Sbjct  223   DKDDEFLKLLRQTIKSLTFPEKYFEKVLRLAINKLGTDEGALTRVITTRAEVDLQRIKEE  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLG  180
             Y +RNSV L+ A+ K+TSG YE  L+ L+G
Sbjct  283   YYRRNSVHLDHAIVKDTSGDYEKFLVELVG  312



>ref|XP_006464229.1| PREDICTED: annexin D2-like [Citrus sinensis]
Length=316

 Score =   289 bits (739),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 150/330 (45%), Positives = 212/330 (64%), Gaps = 19/330 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MATL  P   PS   DAE ++ A +GWGT+E  +I ++ HRN  QRKLI++ Y++ Y ED
Sbjct  1     MATLKVPTQTPSAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KELS   E++V    L P +RDA L N A ++    ++ V++E AC     +  
Sbjct  61    LLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNW-VLMEIACTRSSRDLF  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
               K+AY ARYK+S EED+A +++ DFRKLLV LV  +RY G +V+  LA+TE+ I+ + I
Sbjct  120   AAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKI  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
               K+Y HEE++RIL+TRSKAQ+ AT N Y D  G AI K                 DLK 
Sbjct  180   SDKDYAHEELIRILTTRSKAQINATLNHYNDAFGNAINK-----------------DLKA  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D  ++YL  LR+ I+ +  P K++ K++R A+   G DE  LTRV+ TRAE D++ IKE 
Sbjct  223   DPNDEYLKLLRAAIKCLTYPEKHFAKVLRLAINGLGTDEWGLTRVVTTRAEVDMQRIKEE  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLG  180
             Y +RN+VTLE+A+A +TSG YE +LLAL+G
Sbjct  283   YHRRNTVTLEKAIAGDTSGDYERMLLALIG  312



>ref|XP_009150578.1| PREDICTED: annexin D2 [Brassica rapa]
 emb|CDY14530.1| BnaC03g49290D [Brassica napus]
Length=316

 Score =   288 bits (738),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 151/330 (46%), Positives = 211/330 (64%), Gaps = 19/330 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MA+L  P + P P  DAE ++ A  GWGT+EK +I I+ HRN  QR LI+  Y   Y ED
Sbjct  1     MASLKVPSNVPLPEDDAEQLHKAFSGWGTNEKLIISILAHRNSAQRSLIRSVYAATYNED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KELS   E+AV    LDP +RDA L   + +     ++ V++E AC     E  
Sbjct  61    LLKALDKELSSDFERAVMLWTLDPAERDAYLAKESTKMFTKNNW-VLVEIACTRSAVELF  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              VK+AYQARYK+S EED+AQ+++ D RKLL+ LV  +RY G +V+  LA++E+ +LH  +
Sbjct  120   KVKQAYQARYKKSLEEDVAQHTSGDLRKLLLPLVSTFRYEGDDVNMMLARSEAKLLHEKV  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
              +K +N ++ +RIL+TRSKAQL AT N Y +EHG +I K                 +LKE
Sbjct  180   SEKAFNDDDFIRILTTRSKAQLGATLNHYNNEHGNSINK-----------------NLKE  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
              + + YL  LR+ I  +  P K++EK++R A+ K G DE  LTRV+ TR E D+  IKE 
Sbjct  223   GSDDDYLKLLRAAITCLTYPEKHFEKVLRLAINKMGTDEWGLTRVVTTRTEVDMERIKEE  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLG  180
             YQ+RNSV L++AVAK+TSG YE +L+ALLG
Sbjct  283   YQRRNSVPLDRAVAKDTSGDYEDMLVALLG  312



>gb|ABD47519.1| annexin 2 [Brassica juncea]
 gb|ABM87935.1| annexin 2 [Brassica juncea]
Length=316

 Score =   288 bits (737),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 151/330 (46%), Positives = 212/330 (64%), Gaps = 19/330 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             MA+L  P + P P  DAE ++ A  GWGT+EK +I I+ HRN  QR LI+  Y   Y ED
Sbjct  1     MASLKVPSNVPLPEDDAEQLHKAFSGWGTNEKLIISILAHRNSAQRSLIRSVYAATYNED  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVIIEQACIYCPEEFL  810
             L++  +KELS   E+AV    LDP +RDA L   + +     ++ V++E AC     E  
Sbjct  61    LLKALDKELSSDFERAVMLWTLDPAERDAYLAKESTKMFTKNNW-VLVEIACTRSALELF  119

Query  809   GVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNAI  630
              VK+AYQARYK+S EED+AQ+++ D RKLL+ LV  +RY G +V+  LA++E+ +LH  +
Sbjct  120   KVKQAYQARYKKSLEEDVAQHTSGDLRKLLLPLVSTFRYEGDDVNMMLARSEAKLLHEKV  179

Query  629   KKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLKE  450
              +K Y+ ++ +RIL+TRSKAQL AT N Y +E+G AI K                 +LKE
Sbjct  180   SEKAYSDDDFIRILTTRSKAQLGATLNHYNNEYGNAINK-----------------NLKE  222

Query  449   DTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKEV  270
             D+ + YL  LR+ I  +  P K++EK++R A+ K G DE  LTRV+ TR E D+  IKE 
Sbjct  223   DSDDDYLKLLRAAITCLTYPEKHFEKVLRLAINKMGTDEWGLTRVVTTRTEVDMERIKEE  282

Query  269   YQKRNSVTLEQAVAKETSGHYEALLLALLG  180
             YQ+RNS+ L++AVAK+TSG YE +L+ALLG
Sbjct  283   YQRRNSIPLDRAVAKDTSGDYEDMLVALLG  312



>ref|XP_006366530.1| PREDICTED: annexin D2-like [Solanum tuberosum]
Length=316

 Score =   288 bits (737),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 155/331 (47%), Positives = 210/331 (63%), Gaps = 21/331 (6%)
 Frame = -3

Query  1166  MATLVFPDH-PSPVADAEAIYNACKGWGTHEKTVIGIIGHRNWTQRKLIKQAYHDQYQED  990
             M +L  P+  PS   D++ +  A  GWGT E  +I I+GHRN  QRKLI++ Y   Y++D
Sbjct  1     MESLKIPELVPSAAEDSQQLRKAFVGWGTDEACIIKILGHRNAAQRKLIRETYEATYEKD  60

Query  989   LIRRFEKELSGSLEKAVYRLMLDPEDRDAVLLNVAIRKGGVPDYRVII-EQACIYCPEEF  813
             L++  + E+SG  ++ V+   + P +RDA L N AI+   +P    II E AC     + 
Sbjct  61    LLQDLDGEISGDFQRVVHLWTMAPAERDAYLANEAIKH--LPGSNCIIMEIACARSSVDL  118

Query  812   LGVKRAYQARYKRSFEEDLAQNSTADFRKLLVALVGVYRYSGSEVDAKLAQTESLILHNA  633
               V++ YQARYK+S EED+A +ST DFRKLLV+LV   RY G EV+ +LA  E+ ILH  
Sbjct  119   FKVRQNYQARYKKSLEEDVADHSTGDFRKLLVSLVTALRYEGEEVNMELASDEAKILHEK  178

Query  632   IKKKEYNHEEIVRILSTRSKAQLIATFNRYKDEHGTAITKPNLVV*SWSNLKLFFLQDLK  453
             I  K Y+ EE +RILS RSK QL ATFN+Y D+ G AI K                 DL+
Sbjct  179   ISDKAYSDEEFIRILSIRSKTQLNATFNQYNDKFGNAINK-----------------DLR  221

Query  452   EDTGNQYLTALRSTIRAMVDPHKYYEKLIRRALTKTGADEDDLTRVIVTRAERDLRGIKE  273
              +  +QYLT LRS I+ +++P KY+EK++R A+   G DE+ LTRV+ TRAE D+  IKE
Sbjct  222   ANPKDQYLTLLRSAIKCLMEPEKYFEKVLRLAMKGFGTDEESLTRVVATRAEVDMELIKE  281

Query  272   VYQKRNSVTLEQAVAKETSGHYEALLLALLG  180
              Y KRNSVTLE A++ +TSG YE +LLAL+G
Sbjct  282   KYYKRNSVTLESAISDDTSGDYEKMLLALIG  312



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3297274815984