BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7719_g1_i2 len=599 path=[1196:0-98 574:99-598]

Length=599
                                                                      Score     E

ref|XP_011099952.1|  PREDICTED: probable rhamnogalacturonate lyas...    109   6e-24   
ref|XP_011099953.1|  PREDICTED: probable rhamnogalacturonate lyas...    109   7e-24   
ref|XP_010935280.1|  PREDICTED: probable rhamnogalacturonate lyase B    108   9e-24   
ref|XP_009776336.1|  PREDICTED: uncharacterized protein LOC104226140    102   2e-23   
ref|XP_009801905.1|  PREDICTED: probable rhamnogalacturonate lyase B    107   2e-23   
ref|XP_006856573.1|  hypothetical protein AMTR_s00046p00191970          105   4e-23   
ref|XP_009387810.1|  PREDICTED: probable rhamnogalacturonate lyase B    102   1e-22   
ref|XP_008781312.1|  PREDICTED: probable rhamnogalacturonate lyas...    104   3e-22   
gb|EYU36440.1|  hypothetical protein MIMGU_mgv1a024423mg              97.8    3e-22   
ref|XP_008781313.1|  PREDICTED: probable rhamnogalacturonate lyas...    103   4e-22   
ref|XP_010935282.1|  PREDICTED: probable rhamnogalacturonate lyase B    103   5e-22   
ref|XP_009591967.1|  PREDICTED: probable rhamnogalacturonate lyase B    103   7e-22   
gb|EEC84004.1|  hypothetical protein OsI_30207                          103   8e-22   Oryza sativa Indica Group [Indian rice]
ref|NP_001062464.1|  Os08g0554100                                       102   1e-21   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD10227.1|  putative MYST1                                         102   1e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010235392.1|  PREDICTED: probable rhamnogalacturonate lyase B    102   1e-21   
ref|XP_008664579.1|  PREDICTED: probable rhamnogalacturonate lyas...    102   1e-21   
ref|XP_010060114.1|  PREDICTED: probable rhamnogalacturonate lyase B    102   1e-21   
ref|XP_008664578.1|  PREDICTED: probable rhamnogalacturonate lyas...    102   1e-21   
tpg|DAA48720.1|  TPA: hypothetical protein ZEAMMB73_778200              102   2e-21   
gb|AFD62270.1|  rhamnogalacturonate lyase family protein              98.6    2e-21   
ref|XP_010254609.1|  PREDICTED: probable rhamnogalacturonate lyas...    101   3e-21   
ref|XP_006364646.1|  PREDICTED: probable rhamnogalacturonate lyas...    101   3e-21   
gb|EEE69123.1|  hypothetical protein OsJ_28233                          102   4e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006364645.1|  PREDICTED: probable rhamnogalacturonate lyas...    101   4e-21   
ref|XP_009803167.1|  PREDICTED: uncharacterized protein LOC104248579  97.1    4e-21   
gb|EMT23951.1|  Rhamnogalacturonate lyase                               100   4e-21   
emb|CDP00942.1|  unnamed protein product                                101   4e-21   
ref|XP_009797073.1|  PREDICTED: probable rhamnogalacturonate lyase B    100   5e-21   
ref|XP_009418295.1|  PREDICTED: probable rhamnogalacturonate lyase B    100   5e-21   
ref|XP_006660373.1|  PREDICTED: probable rhamnogalacturonate lyas...    100   6e-21   
ref|XP_008384772.1|  PREDICTED: probable rhamnogalacturonate lyase B    100   7e-21   
ref|XP_006364653.1|  PREDICTED: rhamnogalacturonate lyase B-like        100   7e-21   
gb|EEE69124.1|  hypothetical protein OsJ_28234                        99.4    9e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004289511.1|  PREDICTED: probable rhamnogalacturonate lyas...  99.8    2e-20   
ref|XP_010664440.1|  PREDICTED: probable rhamnogalacturonate lyas...  99.4    2e-20   
ref|XP_002285626.2|  PREDICTED: probable rhamnogalacturonate lyas...  99.4    2e-20   Vitis vinifera
emb|CBI19298.3|  unnamed protein product                              99.4    2e-20   
ref|NP_001062465.1|  Os08g0554300                                     99.0    2e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004250188.2|  PREDICTED: uncharacterized protein LOC101259106    100   2e-20   
dbj|BAK04420.1|  predicted protein                                    99.0    2e-20   
ref|XP_002445711.1|  hypothetical protein SORBIDRAFT_07g024560        99.0    2e-20   Sorghum bicolor [broomcorn]
ref|XP_008384665.1|  PREDICTED: probable rhamnogalacturonate lyase B  99.0    3e-20   
ref|XP_009795923.1|  PREDICTED: probable rhamnogalacturonate lyas...  98.6    3e-20   
ref|XP_011098611.1|  PREDICTED: probable rhamnogalacturonate lyas...  98.6    3e-20   
gb|KDP41146.1|  hypothetical protein JCGZ_03640                       92.8    3e-20   
ref|XP_011098619.1|  PREDICTED: probable rhamnogalacturonate lyas...  98.2    4e-20   
ref|XP_011098603.1|  PREDICTED: probable rhamnogalacturonate lyas...  98.2    4e-20   
ref|XP_007208155.1|  hypothetical protein PRUPE_ppa022021mg           98.2    4e-20   
ref|XP_009789094.1|  PREDICTED: probable rhamnogalacturonate lyase B  98.2    5e-20   
ref|XP_009597661.1|  PREDICTED: probable rhamnogalacturonate lyas...  97.8    5e-20   
ref|XP_008353960.1|  PREDICTED: probable rhamnogalacturonate lyase B  97.8    5e-20   
ref|XP_010244706.1|  PREDICTED: probable rhamnogalacturonate lyase B  97.8    6e-20   
emb|CDP01611.1|  unnamed protein product                              97.8    6e-20   
ref|XP_010027974.1|  PREDICTED: rhamnogalacturonate lyase B           97.8    7e-20   
ref|XP_009597663.1|  PREDICTED: probable rhamnogalacturonate lyas...  96.7    7e-20   
ref|XP_006364652.1|  PREDICTED: probable rhamnogalacturonate lyas...  97.1    9e-20   
gb|KDP32172.1|  hypothetical protein JCGZ_12633                       97.4    1e-19   
ref|XP_006856575.1|  hypothetical protein AMTR_s00046p00193590        97.1    1e-19   
ref|XP_006472413.1|  PREDICTED: rhamnogalacturonate lyase B-like ...  97.1    1e-19   
ref|XP_006472412.1|  PREDICTED: rhamnogalacturonate lyase B-like ...  97.1    1e-19   
ref|XP_006472411.1|  PREDICTED: rhamnogalacturonate lyase B-like ...  97.1    1e-19   
ref|XP_008236572.1|  PREDICTED: probable rhamnogalacturonate lyase B  96.7    1e-19   
ref|XP_004974168.1|  PREDICTED: probable rhamnogalacturonate lyas...  96.7    1e-19   
ref|XP_004974169.1|  PREDICTED: probable rhamnogalacturonate lyas...  96.7    1e-19   
ref|XP_009801906.1|  PREDICTED: probable rhamnogalacturonate lyase B  96.7    2e-19   
ref|XP_009591965.1|  PREDICTED: probable rhamnogalacturonate lyas...  96.7    2e-19   
gb|KFK43287.1|  hypothetical protein AALP_AA1G104400                  96.3    2e-19   
ref|XP_009406093.1|  PREDICTED: uncharacterized protein LOC103989069  95.5    2e-19   
ref|XP_008347797.1|  PREDICTED: uncharacterized protein LOC103410923  91.7    2e-19   
ref|XP_008338489.1|  PREDICTED: probable rhamnogalacturonate lyase B  93.6    2e-19   
ref|XP_011098629.1|  PREDICTED: probable rhamnogalacturonate lyase B  95.9    2e-19   
ref|XP_009611897.1|  PREDICTED: uncharacterized protein LOC104105339  96.7    3e-19   
gb|EYU30915.1|  hypothetical protein MIMGU_mgv1a003154mg              95.5    3e-19   
gb|KEH36122.1|  rhamnogalacturonate lyase B-like protein              93.6    3e-19   
ref|XP_010244708.1|  PREDICTED: probable rhamnogalacturonate lyas...  95.5    3e-19   
gb|KDP41513.1|  hypothetical protein JCGZ_15920                       95.9    3e-19   
ref|XP_010244707.1|  PREDICTED: probable rhamnogalacturonate lyas...  95.5    3e-19   
ref|XP_002308510.2|  hypothetical protein POPTR_0006s23510g           95.9    3e-19   Populus trichocarpa [western balsam poplar]
gb|EYU36444.1|  hypothetical protein MIMGU_mgv1a002779mg              95.5    3e-19   
emb|CDP01612.1|  unnamed protein product                              95.5    3e-19   
emb|CDX93466.1|  BnaA06g05820D                                        95.5    3e-19   
ref|XP_004238544.1|  PREDICTED: probable rhamnogalacturonate lyase B  95.5    4e-19   
gb|KHN04903.1|  Rhamnogalacturonate lyase                             95.1    4e-19   
ref|XP_006572991.1|  PREDICTED: probable rhamnogalacturonate lyas...  95.5    4e-19   
ref|XP_010907787.1|  PREDICTED: probable rhamnogalacturonate lyase B  93.2    4e-19   
ref|XP_009364825.1|  PREDICTED: probable rhamnogalacturonate lyase B  95.5    4e-19   
emb|CDP08054.1|  unnamed protein product                              94.0    4e-19   
ref|XP_009626138.1|  PREDICTED: probable rhamnogalacturonate lyas...  95.1    5e-19   
ref|XP_009626137.1|  PREDICTED: probable rhamnogalacturonate lyas...  95.1    5e-19   
emb|CDP00941.1|  unnamed protein product                              94.7    6e-19   
ref|XP_009771423.1|  PREDICTED: probable rhamnogalacturonate lyas...  94.7    6e-19   
ref|XP_009148302.1|  PREDICTED: probable rhamnogalacturonate lyase B  94.7    6e-19   
ref|XP_009771424.1|  PREDICTED: probable rhamnogalacturonate lyas...  94.7    7e-19   
gb|KEH36123.1|  rhamnogalacturonate lyase B-like protein              94.0    7e-19   
ref|XP_009406069.1|  PREDICTED: uncharacterized protein LOC103989051  95.1    7e-19   
ref|XP_009771422.1|  PREDICTED: probable rhamnogalacturonate lyas...  94.7    7e-19   
ref|XP_004287408.1|  PREDICTED: probable rhamnogalacturonate lyas...  94.4    8e-19   
emb|CDP01613.1|  unnamed protein product                              93.6    9e-19   
ref|XP_006472995.1|  PREDICTED: probable rhamnogalacturonate lyas...  94.4    9e-19   
ref|XP_004501130.1|  PREDICTED: rhamnogalacturonate lyase B-like      94.4    9e-19   
gb|KEH36119.1|  rhamnogalacturonate lyase B-like protein              94.0    1e-18   
ref|XP_009366370.1|  PREDICTED: probable rhamnogalacturonate lyas...  94.4    1e-18   
gb|KEH36121.1|  rhamnogalacturonate lyase B-like protein              94.0    1e-18   
gb|KEH36120.1|  rhamnogalacturonate lyase B-like protein              93.6    1e-18   
ref|XP_008339034.1|  PREDICTED: uncharacterized protein LOC103402064  90.5    1e-18   
gb|AES73958.2|  rhamnogalacturonate lyase B-like protein              94.0    1e-18   
ref|XP_003603707.1|  Rhamnogalacturonate lyase                        94.0    1e-18   
ref|XP_002892533.1|  hypothetical protein ARALYDRAFT_334271           94.0    1e-18   
ref|XP_008219222.1|  PREDICTED: probable rhamnogalacturonate lyase B  94.0    1e-18   
ref|XP_010314591.1|  PREDICTED: probable rhamnogalacturonate lyas...  93.6    1e-18   
ref|XP_008219218.1|  PREDICTED: rhamnogalacturonate lyase B-like      93.6    1e-18   
ref|XP_004252722.1|  PREDICTED: probable rhamnogalacturonate lyas...  93.6    2e-18   
ref|XP_004133752.1|  PREDICTED: probable rhamnogalacturonate lyas...  93.6    2e-18   
gb|KDO81266.1|  hypothetical protein CISIN_1g042458mg                 93.6    2e-18   
ref|XP_002527352.1|  lyase, putative                                  93.6    2e-18   Ricinus communis
ref|XP_006433775.1|  hypothetical protein CICLE_v10000543mg           93.6    2e-18   
gb|KGN56316.1|  hypothetical protein Csa_3G115050                     93.6    2e-18   
emb|CDX94934.1|  BnaC05g07370D                                        93.2    2e-18   
ref|XP_002527229.1|  lyase, putative                                  93.6    2e-18   Ricinus communis
ref|XP_010458304.1|  PREDICTED: probable rhamnogalacturonate lyase B  93.2    2e-18   
ref|XP_007018291.1|  Rhamnogalacturonate lyase family protein         93.2    2e-18   
ref|XP_008781369.1|  PREDICTED: probable rhamnogalacturonate lyase B  93.2    2e-18   
gb|KFK43288.1|  hypothetical protein AALP_AA1G104600                  93.2    2e-18   
ref|XP_010312902.1|  PREDICTED: LOW QUALITY PROTEIN: probable rha...  92.8    2e-18   
gb|KDP41509.1|  hypothetical protein JCGZ_15916                       92.0    3e-18   
ref|XP_009397853.1|  PREDICTED: probable rhamnogalacturonate lyas...  92.8    3e-18   
ref|XP_007225136.1|  hypothetical protein PRUPE_ppa002538mg           93.2    3e-18   
ref|XP_008781370.1|  PREDICTED: probable rhamnogalacturonate lyase B  92.8    3e-18   
emb|CDX94935.1|  BnaC05g07360D                                        93.2    3e-18   
ref|XP_002319997.2|  hypothetical protein POPTR_0014s01060g           92.8    3e-18   Populus trichocarpa [western balsam poplar]
emb|CDY65730.1|  BnaCnng48490D                                        92.8    3e-18   
ref|XP_010104584.1|  hypothetical protein L484_025563                 93.6    3e-18   
ref|XP_006304407.1|  hypothetical protein CARUB_v10010965mg           92.8    3e-18   
ref|XP_004238020.1|  PREDICTED: probable rhamnogalacturonate lyas...  92.8    3e-18   
gb|KDP29301.1|  hypothetical protein JCGZ_19404                       92.4    3e-18   
ref|XP_010683375.1|  PREDICTED: uncharacterized protein LOC104898066  93.6    3e-18   
ref|XP_006366427.1|  PREDICTED: probable rhamnogalacturonate lyas...  92.4    3e-18   
ref|XP_009803162.1|  PREDICTED: probable rhamnogalacturonate lyase B  92.4    4e-18   
ref|XP_009397844.1|  PREDICTED: probable rhamnogalacturonate lyas...  92.4    4e-18   
ref|XP_007225130.1|  hypothetical protein PRUPE_ppa002544mg           92.4    4e-18   
ref|XP_007018289.1|  Rhamnogalacturonate lyase family protein         92.4    4e-18   
ref|XP_009397836.1|  PREDICTED: probable rhamnogalacturonate lyas...  92.4    4e-18   
ref|XP_006417521.1|  hypothetical protein EUTSA_v10007093mg           92.4    4e-18   
ref|XP_011098532.1|  PREDICTED: probable rhamnogalacturonate lyase B  92.4    4e-18   
ref|XP_010320230.1|  PREDICTED: probable rhamnogalacturonate lyas...  92.4    4e-18   
ref|XP_006338131.1|  PREDICTED: rhamnogalacturonate lyase B-like      92.4    5e-18   
ref|XP_010312681.1|  PREDICTED: probable rhamnogalacturonate lyase B  92.4    5e-18   
ref|XP_006417523.1|  hypothetical protein EUTSA_v100070380mg          87.8    5e-18   
ref|XP_008466138.1|  PREDICTED: probable rhamnogalacturonate lyas...  91.7    5e-18   
gb|KDO81265.1|  hypothetical protein CISIN_1g037887mg                 92.0    5e-18   
ref|XP_010935276.1|  PREDICTED: probable rhamnogalacturonate lyas...  92.0    5e-18   
ref|XP_010935278.1|  PREDICTED: probable rhamnogalacturonate lyas...  92.0    5e-18   
ref|XP_008466137.1|  PREDICTED: probable rhamnogalacturonate lyas...  92.0    5e-18   
ref|XP_009148296.1|  PREDICTED: probable rhamnogalacturonate lyase B  92.0    6e-18   
ref|XP_008389040.1|  PREDICTED: probable rhamnogalacturonate lyase B  92.0    6e-18   
ref|XP_002527245.1|  lyase, putative                                  91.7    6e-18   Ricinus communis
emb|CDX93467.1|  BnaA06g05810D                                        92.0    6e-18   
ref|XP_011003640.1|  PREDICTED: rhamnogalacturonate lyase B-like      92.0    6e-18   
ref|XP_006433776.1|  hypothetical protein CICLE_v10003807mg           92.0    6e-18   
ref|XP_008338981.1|  PREDICTED: rhamnogalacturonate lyase B-like      92.0    6e-18   
gb|AET03356.2|  rhamnogalacturonate lyase B-like protein              91.7    7e-18   
ref|XP_006587583.1|  PREDICTED: probable rhamnogalacturonate lyas...  91.3    7e-18   
ref|XP_003628880.1|  Rhamnogalacturonate lyase                        91.7    8e-18   
ref|XP_007221968.1|  hypothetical protein PRUPE_ppa002258mg           91.7    8e-18   
ref|XP_011100169.1|  PREDICTED: probable rhamnogalacturonate lyase B  91.7    9e-18   
gb|KDP41510.1|  hypothetical protein JCGZ_15917                       91.7    9e-18   
ref|XP_008389039.1|  PREDICTED: probable rhamnogalacturonate lyase B  91.7    9e-18   
ref|XP_008450226.1|  PREDICTED: probable rhamnogalacturonate lyase B  90.1    9e-18   
gb|KEH20099.1|  rhamnogalacturonate lyase B-like protein              91.7    9e-18   
ref|XP_006338026.1|  PREDICTED: probable rhamnogalacturonate lyas...  91.3    9e-18   
ref|XP_003628875.1|  Rhamnogalacturonate lyase                        91.7    9e-18   
ref|XP_002306520.2|  hypothetical protein POPTR_0005s19450g           91.7    9e-18   Populus trichocarpa [western balsam poplar]
gb|EYU45812.1|  hypothetical protein MIMGU_mgv1a0225581mg             89.4    9e-18   
gb|KHN38895.1|  Rhamnogalacturonate lyase                             91.3    1e-17   
ref|XP_010255178.1|  PREDICTED: probable rhamnogalacturonate lyase B  91.3    1e-17   
ref|NP_172460.6|  rhamnogalacturonate lyase-like protein              91.3    1e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004288871.1|  PREDICTED: probable rhamnogalacturonate lyas...  91.3    1e-17   
gb|KDO40182.1|  hypothetical protein CISIN_1g0067412mg                90.1    1e-17   
ref|XP_011019318.1|  PREDICTED: rhamnogalacturonate lyase B-like      91.3    1e-17   
ref|XP_009406080.1|  PREDICTED: probable rhamnogalacturonate lyase B  91.3    1e-17   
gb|KHN08234.1|  Rhamnogalacturonate lyase                             90.9    1e-17   
ref|XP_011011722.1|  PREDICTED: probable rhamnogalacturonate lyas...  91.3    1e-17   
ref|XP_008219219.1|  PREDICTED: probable rhamnogalacturonate lyase B  91.3    1e-17   
ref|XP_009366369.1|  PREDICTED: probable rhamnogalacturonate lyas...  90.9    1e-17   
gb|KHG04596.1|  Rhamnogalacturonate lyase                             90.9    1e-17   
ref|XP_009346851.1|  PREDICTED: rhamnogalacturonate lyase B-like      90.9    1e-17   
ref|XP_003522745.2|  PREDICTED: rhamnogalacturonate lyase B-like      90.9    1e-17   
ref|XP_010104583.1|  hypothetical protein L484_025562                 91.3    2e-17   
ref|XP_004509710.1|  PREDICTED: probable rhamnogalacturonate lyas...  90.9    2e-17   
ref|XP_006466349.1|  PREDICTED: rhamnogalacturonate lyase B-like      90.5    2e-17   
ref|XP_006426234.1|  hypothetical protein CICLE_v10025074mg           90.5    2e-17   
ref|XP_003519207.1|  PREDICTED: rhamnogalacturonate lyase B-like      90.5    2e-17   
gb|KDP37921.1|  hypothetical protein JCGZ_05360                       88.2    2e-17   
ref|XP_004287322.1|  PREDICTED: rhamnogalacturonate lyase-like is...  90.5    2e-17   
ref|XP_002527356.1|  lyase, putative                                  90.5    2e-17   Ricinus communis
ref|XP_009618923.1|  PREDICTED: LOW QUALITY PROTEIN: probable rha...  90.5    2e-17   
gb|KHN26157.1|  Rhamnogalacturonate lyase                             90.1    2e-17   
ref|XP_006433777.1|  hypothetical protein CICLE_v10003131mg           90.1    2e-17   
ref|XP_004287323.1|  PREDICTED: rhamnogalacturonate lyase-like is...  90.1    2e-17   
gb|EYU29460.1|  hypothetical protein MIMGU_mgv1a002710mg              90.1    2e-17   
ref|XP_009338020.1|  PREDICTED: probable rhamnogalacturonate lyase B  90.1    2e-17   
ref|XP_010671338.1|  PREDICTED: rhamnogalacturonate lyase B           90.1    2e-17   
ref|XP_006472414.1|  PREDICTED: uncharacterized protein LOC102607...  90.1    2e-17   
gb|KDO81264.1|  hypothetical protein CISIN_1g007269mg                 90.1    2e-17   
gb|KDP29802.1|  hypothetical protein JCGZ_18737                       90.1    3e-17   
ref|XP_004490463.1|  PREDICTED: rhamnogalacturonate lyase-like is...  89.7    3e-17   
ref|XP_002301114.1|  hypothetical protein POPTR_0002s11090g           90.1    3e-17   Populus trichocarpa [western balsam poplar]
ref|XP_002892532.1|  predicted protein                                90.1    3e-17   
ref|XP_003603709.1|  Rhamnogalacturonate lyase                        90.1    3e-17   
ref|XP_006346801.1|  PREDICTED: probable rhamnogalacturonate lyas...  90.1    3e-17   
gb|AES73960.2|  rhamnogalacturonate lyase B-like protein              89.7    3e-17   
ref|XP_008219212.1|  PREDICTED: probable rhamnogalacturonate lyase B  89.7    3e-17   
ref|XP_008368110.1|  PREDICTED: uncharacterized protein LOC103431713  90.5    3e-17   
ref|XP_009595414.1|  PREDICTED: probable rhamnogalacturonate lyas...  89.7    3e-17   
ref|XP_009366368.1|  PREDICTED: probable rhamnogalacturonate lyas...  90.5    3e-17   
ref|XP_010060118.1|  PREDICTED: probable rhamnogalacturonate lyas...  89.7    3e-17   
ref|XP_009366367.1|  PREDICTED: probable rhamnogalacturonate lyas...  90.5    3e-17   
ref|XP_004288875.1|  PREDICTED: rhamnogalacturonate lyase-like        89.7    3e-17   
ref|XP_009795926.1|  PREDICTED: probable rhamnogalacturonate lyas...  89.7    4e-17   
ref|XP_010458309.1|  PREDICTED: uncharacterized protein LOC104739595  85.9    4e-17   
ref|XP_008370921.1|  PREDICTED: probable rhamnogalacturonate lyase B  89.7    4e-17   
ref|XP_009595415.1|  PREDICTED: probable rhamnogalacturonate lyas...  89.4    4e-17   
ref|XP_010060117.1|  PREDICTED: probable rhamnogalacturonate lyas...  89.7    4e-17   
ref|XP_010935407.1|  PREDICTED: rhamnogalacturonate lyase B-like      89.7    4e-17   
emb|CDP01610.1|  unnamed protein product                              89.0    4e-17   
ref|XP_007224652.1|  hypothetical protein PRUPE_ppa026307mg           89.4    4e-17   
ref|XP_010060119.1|  PREDICTED: probable rhamnogalacturonate lyas...  89.4    4e-17   
ref|XP_011074281.1|  PREDICTED: probable rhamnogalacturonate lyas...  89.4    4e-17   
ref|XP_011016984.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  90.1    4e-17   
ref|XP_007156454.1|  hypothetical protein PHAVU_003G287300g           88.6    4e-17   
ref|XP_011074280.1|  PREDICTED: probable rhamnogalacturonate lyas...  89.4    4e-17   
ref|XP_009795927.1|  PREDICTED: probable rhamnogalacturonate lyas...  89.4    4e-17   
ref|XP_009795928.1|  PREDICTED: probable rhamnogalacturonate lyas...  89.4    4e-17   
ref|XP_010106796.1|  hypothetical protein L484_009236                 89.4    5e-17   
ref|XP_006364644.1|  PREDICTED: probable rhamnogalacturonate lyas...  89.4    5e-17   
gb|KDP41512.1|  hypothetical protein JCGZ_15919                       89.4    5e-17   
ref|XP_003615341.1|  LG27/30-like gene                                89.4    5e-17   
gb|AES98299.2|  rhamnogalacturonate lyase B-like protein              89.4    5e-17   
ref|XP_008466140.1|  PREDICTED: probable rhamnogalacturonate lyase C  89.4    5e-17   
ref|XP_008378659.1|  PREDICTED: probable rhamnogalacturonate lyase B  90.1    5e-17   
ref|XP_004161761.1|  PREDICTED: probable rhamnogalacturonate lyas...  89.0    5e-17   
ref|XP_008357559.1|  PREDICTED: LOW QUALITY PROTEIN: probable rha...  89.4    5e-17   
ref|XP_010490407.1|  PREDICTED: rhamnogalacturonate lyase B-like ...  89.4    5e-17   
ref|XP_010490414.1|  PREDICTED: rhamnogalacturonate lyase B-like ...  89.4    5e-17   
gb|ABK22261.1|  unknown                                               85.9    5e-17   Picea sitchensis
ref|XP_004490462.1|  PREDICTED: rhamnogalacturonate lyase-like is...  89.4    5e-17   
ref|XP_011099950.1|  PREDICTED: probable rhamnogalacturonate lyas...  89.4    5e-17   
ref|XP_011099951.1|  PREDICTED: probable rhamnogalacturonate lyas...  89.4    5e-17   
ref|XP_010490418.1|  PREDICTED: rhamnogalacturonate lyase B-like ...  89.4    5e-17   
emb|CDP01609.1|  unnamed protein product                              85.1    5e-17   
ref|XP_010671350.1|  PREDICTED: probable rhamnogalacturonate lyase B  89.0    6e-17   
ref|XP_004136250.1|  PREDICTED: probable rhamnogalacturonate lyas...  89.0    6e-17   
ref|XP_010458297.1|  PREDICTED: rhamnogalacturonate lyase B-like ...  89.0    6e-17   
ref|XP_010458296.1|  PREDICTED: rhamnogalacturonate lyase B-like ...  89.0    7e-17   
ref|XP_011016987.1|  PREDICTED: probable rhamnogalacturonate lyas...  89.0    7e-17   
ref|NP_172459.1|  rhamnogalacturonate lyase-like protein              89.0    7e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006472416.1|  PREDICTED: rhamnogalacturonate lyase B-like      89.0    7e-17   
ref|XP_010475840.1|  PREDICTED: rhamnogalacturonate lyase B-like ...  89.0    7e-17   
ref|XP_010475841.1|  PREDICTED: rhamnogalacturonate lyase B-like ...  89.0    7e-17   
ref|XP_010490435.1|  PREDICTED: probable rhamnogalacturonate lyas...  88.6    7e-17   
gb|KDO81260.1|  hypothetical protein CISIN_1g0069272mg                88.6    8e-17   
ref|XP_006306951.1|  hypothetical protein CARUB_v10008518mg           88.6    8e-17   
ref|XP_010671398.1|  PREDICTED: probable rhamnogalacturonate lyase B  89.0    8e-17   
ref|XP_010319233.1|  PREDICTED: probable rhamnogalacturonate lyase B  88.6    9e-17   
gb|KDP41508.1|  hypothetical protein JCGZ_15915                       88.6    9e-17   
ref|XP_003523772.1|  PREDICTED: rhamnogalacturonate lyase B-like      88.6    9e-17   
ref|XP_008365246.1|  PREDICTED: probable rhamnogalacturonate lyase B  88.6    1e-16   
ref|XP_010544057.1|  PREDICTED: probable rhamnogalacturonate lyas...  88.2    1e-16   
ref|XP_009346852.1|  PREDICTED: uncharacterized protein LOC103938556  86.7    1e-16   
ref|XP_009626140.1|  PREDICTED: probable rhamnogalacturonate lyas...  88.2    1e-16   
ref|XP_010671318.1|  PREDICTED: probable rhamnogalacturonate lyase B  88.2    1e-16   
ref|XP_002301112.2|  hypothetical protein POPTR_0002s11070g           88.2    1e-16   Populus trichocarpa [western balsam poplar]
ref|XP_002527357.1|  lyase, putative                                  88.2    1e-16   Ricinus communis
gb|KDO81270.1|  hypothetical protein CISIN_1g005706mg                 87.4    1e-16   
ref|XP_006433780.1|  hypothetical protein CICLE_v10000542mg           88.2    1e-16   
ref|XP_003526528.1|  PREDICTED: probable rhamnogalacturonate lyas...  87.8    1e-16   
gb|KDO81269.1|  hypothetical protein CISIN_1g005706mg                 87.0    1e-16   
ref|XP_009110794.1|  PREDICTED: probable rhamnogalacturonate lyase B  87.8    2e-16   
ref|XP_004305816.1|  PREDICTED: rhamnogalacturonate lyase-like        87.8    2e-16   
ref|XP_004288494.1|  PREDICTED: rhamnogalacturonate lyase B-like      87.8    2e-16   
emb|CDP00944.1|  unnamed protein product                              87.8    2e-16   
gb|KDO81268.1|  hypothetical protein CISIN_1g005706mg                 87.0    2e-16   
ref|XP_007137655.1|  hypothetical protein PHAVU_009G144800g           87.4    2e-16   
ref|XP_010554955.1|  PREDICTED: uncharacterized protein LOC104824556  87.8    2e-16   
ref|XP_010544055.1|  PREDICTED: probable rhamnogalacturonate lyas...  87.4    2e-16   
ref|XP_002301113.1|  hypothetical protein POPTR_0002s11080g           87.4    2e-16   
emb|CDY31059.1|  BnaA08g26090D                                        87.0    2e-16   
ref|XP_007137656.1|  hypothetical protein PHAVU_009G144900g           86.7    2e-16   
ref|XP_010320233.1|  PREDICTED: rhamnogalacturonate lyase B-like ...  87.4    2e-16   
ref|XP_006338024.1|  PREDICTED: rhamnogalacturonate lyase B-like      87.4    2e-16   
gb|KHN08233.1|  Rhamnogalacturonate lyase                             87.4    3e-16   
gb|KDO81267.1|  hypothetical protein CISIN_1g005706mg                 87.0    3e-16   
ref|XP_006472409.1|  PREDICTED: rhamnogalacturonate lyase B-like ...  87.0    3e-16   
ref|XP_006472410.1|  PREDICTED: rhamnogalacturonate lyase B-like ...  87.0    3e-16   
ref|XP_004238021.1|  PREDICTED: rhamnogalacturonate lyase B-like ...  87.0    3e-16   
ref|XP_003612971.1|  MYST1 protein                                    87.0    3e-16   
ref|XP_003526529.1|  PREDICTED: probable rhamnogalacturonate lyas...  86.7    3e-16   
ref|XP_004287405.1|  PREDICTED: rhamnogalacturonate lyase-like        86.7    3e-16   
ref|XP_006433774.1|  hypothetical protein CICLE_v10003466mg           86.7    3e-16   
gb|AES73961.2|  rhamnogalacturonate lyase B-like protein              86.7    3e-16   
ref|XP_003603710.1|  Rhamnogalacturonate lyase                        87.0    3e-16   
gb|AES95929.2|  rhamnogalacturonate lyase B-like protein              86.7    4e-16   
gb|KHG10248.1|  Rhamnogalacturonate lyase                             86.7    4e-16   
gb|KHN09024.1|  Rhamnogalacturonate lyase                             86.7    4e-16   
ref|XP_007137657.1|  hypothetical protein PHAVU_009G144900g           86.7    4e-16   
ref|XP_002892534.1|  hypothetical protein ARALYDRAFT_888241           86.7    4e-16   
ref|XP_004161760.1|  PREDICTED: probable rhamnogalacturonate lyas...  86.3    5e-16   
ref|XP_008466141.1|  PREDICTED: rhamnogalacturonate lyase B           86.3    5e-16   
gb|KGN60275.1|  hypothetical protein Csa_3G892760                     86.3    5e-16   
gb|AAB60743.1|  F21M12.30 gene product                                86.3    5e-16   
ref|XP_004136417.1|  PREDICTED: rhamnogalacturonate lyase-like        86.3    5e-16   
ref|XP_007018292.1|  Rhamnogalacturonate lyase family protein         86.7    6e-16   
ref|NP_172462.2|  rhamnogalacturonate lyase-like protein              86.3    6e-16   
ref|XP_008219198.1|  PREDICTED: rhamnogalacturonate lyase B-like      85.9    6e-16   
ref|XP_007225686.1|  hypothetical protein PRUPE_ppa002905mg           85.9    6e-16   
ref|XP_004501055.1|  PREDICTED: rhamnogalacturonate lyase B-like ...  85.9    7e-16   
ref|XP_011016991.1|  PREDICTED: probable rhamnogalacturonate lyas...  85.9    7e-16   
ref|XP_011016990.1|  PREDICTED: probable rhamnogalacturonate lyas...  85.9    8e-16   
ref|XP_010490461.1|  PREDICTED: probable rhamnogalacturonate lyas...  85.9    8e-16   
ref|XP_010475848.1|  PREDICTED: probable rhamnogalacturonate lyas...  85.5    8e-16   
ref|XP_010458307.1|  PREDICTED: probable rhamnogalacturonate lyas...  85.5    9e-16   
ref|XP_010475847.1|  PREDICTED: probable rhamnogalacturonate lyas...  85.5    9e-16   
ref|XP_004501056.1|  PREDICTED: rhamnogalacturonate lyase B-like ...  85.5    9e-16   
ref|XP_010458305.1|  PREDICTED: probable rhamnogalacturonate lyas...  85.5    9e-16   
ref|XP_010490456.1|  PREDICTED: probable rhamnogalacturonate lyas...  85.5    1e-15   
gb|KDO81262.1|  hypothetical protein CISIN_1g0389792mg                85.1    1e-15   
ref|XP_004288872.1|  PREDICTED: rhamnogalacturonate lyase B-like      85.5    1e-15   
ref|XP_006433778.1|  hypothetical protein CICLE_v10003567mg           85.1    1e-15   
ref|XP_007137654.1|  hypothetical protein PHAVU_009G144700g           85.5    1e-15   
ref|XP_002869720.1|  hypothetical protein ARALYDRAFT_354330           85.1    1e-15   
ref|XP_008347831.1|  PREDICTED: probable rhamnogalacturonate lyase B  82.4    1e-15   
ref|XP_010249437.1|  PREDICTED: probable rhamnogalacturonate lyase B  85.1    1e-15   
gb|AAU90065.1|  At4g24430                                             84.3    1e-15   
ref|XP_004143542.1|  PREDICTED: rhamnogalacturonate lyase B-like      85.1    1e-15   
gb|AAL15345.1|  AT4g24430/T22A6_260                                   84.3    1e-15   
ref|XP_006472996.1|  PREDICTED: rhamnogalacturonate lyase B-like      84.7    2e-15   
ref|XP_010555421.1|  PREDICTED: rhamnogalacturonate lyase B-like ...  84.7    2e-15   
ref|XP_004136251.1|  PREDICTED: rhamnogalacturonate lyase B-like      84.7    2e-15   
ref|XP_004161743.1|  PREDICTED: LOW QUALITY PROTEIN: rhamnogalact...  84.7    2e-15   
ref|NP_567703.4|  Rhamnogalacturonate lyase family protein            84.7    2e-15   
ref|XP_010555417.1|  PREDICTED: probable rhamnogalacturonate lyas...  84.7    2e-15   
ref|XP_010555419.1|  PREDICTED: rhamnogalacturonate lyase B-like ...  84.7    2e-15   
ref|XP_002527353.1|  lyase, putative                                  84.3    2e-15   
ref|XP_010320232.1|  PREDICTED: probable rhamnogalacturonate lyas...  84.0    2e-15   
ref|XP_006306941.1|  hypothetical protein CARUB_v10008508mg           84.3    3e-15   
ref|XP_010320231.1|  PREDICTED: rhamnogalacturonate lyase B-like ...  84.0    3e-15   
gb|KFK30410.1|  hypothetical protein AALP_AA7G257300                  84.0    3e-15   
ref|XP_002301115.1|  hypothetical protein POPTR_0002s11100g           84.3    3e-15   
gb|KFK43290.1|  hypothetical protein AALP_AA1G104800                  84.0    3e-15   
gb|KFK43291.1|  hypothetical protein AALP_AA1G104800                  84.0    3e-15   
ref|XP_006338025.1|  PREDICTED: rhamnogalacturonate lyase B-like      83.6    3e-15   
ref|XP_008440517.1|  PREDICTED: rhamnogalacturonate lyase B isofo...  84.0    4e-15   
gb|KHF97678.1|  Rhamnogalacturonate lyase                             80.9    4e-15   
gb|KHF97277.1|  Rhamnogalacturonate lyase                             83.2    4e-15   
ref|XP_009148304.1|  PREDICTED: rhamnogalacturonate lyase B           83.6    5e-15   
ref|XP_008440518.1|  PREDICTED: rhamnogalacturonate lyase B isofo...  83.2    5e-15   
ref|XP_010060116.1|  PREDICTED: probable rhamnogalacturonate lyase B  83.2    5e-15   
emb|CDX93464.1|  BnaA06g05840D                                        83.2    5e-15   
gb|KCW66665.1|  hypothetical protein EUGRSUZ_F00441                   83.2    5e-15   
ref|XP_010060112.1|  PREDICTED: probable rhamnogalacturonate lyase B  83.2    5e-15   
gb|EYU40265.1|  hypothetical protein MIMGU_mgv1a025746mg              81.6    5e-15   
ref|XP_007141289.1|  hypothetical protein PHAVU_008G183500g           83.2    5e-15   
ref|XP_006411824.1|  hypothetical protein EUTSA_v10024612mg           83.2    6e-15   
gb|EPS71848.1|  hypothetical protein M569_02906                       81.6    6e-15   
emb|CAB37536.1|  putative protein                                     80.5    6e-15   
ref|XP_010530581.1|  PREDICTED: probable rhamnogalacturonate lyas...  82.8    6e-15   
ref|XP_010530582.1|  PREDICTED: probable rhamnogalacturonate lyas...  82.8    7e-15   
ref|NP_001189578.1|  rhamnogalacturonate lyase-like protein           82.8    7e-15   
emb|CDX94932.1|  BnaC05g07390D                                        82.8    7e-15   
emb|CDX89492.1|  BnaC04g35110D                                        82.8    8e-15   
gb|KHN24870.1|  Rhamnogalacturonate lyase                             82.8    8e-15   
gb|EYU30914.1|  hypothetical protein MIMGU_mgv1a002612mg              82.8    8e-15   
ref|XP_006855936.1|  hypothetical protein AMTR_s00037p00213030        79.0    8e-15   
ref|NP_179847.1|  rhamnogalacturonate lyase-like protein              82.8    8e-15   
ref|XP_004240256.1|  PREDICTED: rhamnogalacturonate lyase B-like      82.8    8e-15   
ref|XP_007047727.1|  Rhamnogalacturonate lyase family protein, pu...  82.8    9e-15   
ref|XP_006602439.1|  PREDICTED: probable rhamnogalacturonate lyas...  82.4    1e-14   
ref|XP_006602438.1|  PREDICTED: probable rhamnogalacturonate lyas...  82.4    1e-14   
gb|AET03352.2|  rhamnogalacturonate lyase B-like protein              82.4    1e-14   
ref|XP_003628876.1|  Rhamnogalacturonate lyase                        82.4    1e-14   
ref|NP_176700.1|  Galactose-binding protein                           79.3    1e-14   
gb|KHN08932.1|  Rhamnogalacturonate lyase                             82.0    1e-14   
ref|XP_010530574.1|  PREDICTED: uncharacterized protein LOC104807...  82.8    1e-14   
ref|XP_010530576.1|  PREDICTED: uncharacterized protein LOC104807...  82.8    1e-14   
ref|XP_010530573.1|  PREDICTED: uncharacterized protein LOC104807...  82.8    1e-14   
ref|XP_010530571.1|  PREDICTED: uncharacterized protein LOC104807...  82.8    1e-14   
ref|XP_002527358.1|  lyase, putative                                  82.0    1e-14   
ref|XP_006586511.1|  PREDICTED: rhamnogalacturonate lyase B-like      82.0    1e-14   
ref|XP_006417520.1|  hypothetical protein EUTSA_v10007058mg           81.3    1e-14   
ref|XP_006417519.1|  hypothetical protein EUTSA_v10007058mg           81.3    2e-14   
gb|KHF97676.1|  Rhamnogalacturonate lyase                             81.3    3e-14   
gb|KFK30409.1|  hypothetical protein AALP_AA7G257200                  81.3    3e-14   
ref|NP_195508.2|  Rhamnogalacturonate lyase family protein            81.3    3e-14   
ref|XP_006495333.1|  PREDICTED: probable rhamnogalacturonate lyas...  81.3    3e-14   
emb|CAA76417.1|  MYST1                                                80.1    3e-14   
ref|XP_010555415.1|  PREDICTED: probable rhamnogalacturonate lyase B  80.9    4e-14   
ref|XP_006286257.1|  hypothetical protein CARUB_v10007831mg           80.9    4e-14   
ref|XP_010446599.1|  PREDICTED: probable rhamnogalacturonate lyase B  80.9    4e-14   
ref|XP_010432002.1|  PREDICTED: probable rhamnogalacturonate lyase B  80.5    4e-14   
ref|XP_002868957.1|  hypothetical protein ARALYDRAFT_912531           80.5    4e-14   
ref|XP_010496219.1|  PREDICTED: probable rhamnogalacturonate lyase B  80.5    4e-14   
ref|XP_002886827.1|  hypothetical protein ARALYDRAFT_315485           80.1    7e-14   
emb|CDX75691.1|  BnaA01g00110D                                        80.1    7e-14   
ref|XP_007156453.1|  hypothetical protein PHAVU_003G287200g           79.7    8e-14   
ref|XP_010683043.1|  PREDICTED: probable rhamnogalacturonate lyase B  79.7    8e-14   
ref|XP_010437156.1|  PREDICTED: probable rhamnogalacturonate lyase B  79.7    9e-14   
ref|XP_004301125.1|  PREDICTED: rhamnogalacturonate lyase B-like      79.7    9e-14   
gb|AAS99719.1|  At2g22620                                             79.3    1e-13   
ref|XP_006285725.1|  hypothetical protein CARUB_v10007197mg           79.3    1e-13   
gb|KHN08933.1|  Rhamnogalacturonate lyase                             79.3    1e-13   
ref|XP_006411832.1|  hypothetical protein EUTSA_v10027081mg           79.3    1e-13   
emb|CDX69351.1|  BnaC01g01020D                                        79.3    1e-13   
ref|XP_006421506.1|  hypothetical protein CICLE_v10006424mg           79.3    1e-13   
ref|XP_010472252.1|  PREDICTED: probable rhamnogalacturonate lyas...  79.3    1e-13   
ref|XP_010417021.1|  PREDICTED: probable rhamnogalacturonate lyase B  79.3    1e-13   
ref|XP_010472254.1|  PREDICTED: probable rhamnogalacturonate lyas...  79.0    1e-13   
ref|XP_006585905.1|  PREDICTED: probable rhamnogalacturonate lyas...  79.3    1e-13   
gb|EYU30909.1|  hypothetical protein MIMGU_mgv1a002454mg              79.0    2e-13   
gb|EYU30916.1|  hypothetical protein MIMGU_mgv1a002827mg              78.6    2e-13   
ref|XP_011099957.1|  PREDICTED: probable rhamnogalacturonate lyase B  78.6    2e-13   
ref|XP_003635277.1|  PREDICTED: probable rhamnogalacturonate lyase B  77.4    2e-13   
ref|XP_007018290.1|  Rhamnogalacturonate lyase family protein         78.6    2e-13   
emb|CBI33217.3|  unnamed protein product                              77.4    2e-13   
ref|XP_002880453.1|  hypothetical protein ARALYDRAFT_481121           78.6    2e-13   
ref|XP_009802086.1|  PREDICTED: rhamnogalacturonate lyase B-like      78.6    2e-13   
ref|XP_006283272.1|  hypothetical protein CARUB_v10004306mg           78.6    2e-13   
emb|CDX90393.1|  BnaA08g15910D                                        79.0    2e-13   
ref|XP_006293793.1|  hypothetical protein CARUB_v10022775mg           78.6    2e-13   
emb|CDY63550.1|  BnaC03g76550D                                        79.0    2e-13   
ref|XP_009109409.1|  PREDICTED: probable rhamnogalacturonate lyase B  78.6    2e-13   
emb|CDY13740.1|  BnaA09g42420D                                        78.6    2e-13   
ref|XP_006404724.1|  hypothetical protein EUTSA_v10000697mg           78.2    2e-13   
ref|XP_009112504.1|  PREDICTED: probable rhamnogalacturonate lyase B  78.2    2e-13   
emb|CDX76902.1|  BnaC08g34880D                                        78.2    2e-13   
emb|CBI33189.3|  unnamed protein product                              78.2    2e-13   
ref|XP_002271814.3|  PREDICTED: probable rhamnogalacturonate lyase B  78.2    3e-13   
ref|XP_002866919.1|  hypothetical protein ARALYDRAFT_353036           77.8    3e-13   
ref|XP_010683372.1|  PREDICTED: probable rhamnogalacturonate lyase B  77.8    3e-13   
dbj|BAD94618.1|  LG127/30 like gene                                   77.4    4e-13   
ref|XP_010683373.1|  PREDICTED: probable rhamnogalacturonate lyase B  75.5    4e-13   
emb|CAB37543.1|  LG127/30 like gene                                   77.8    4e-13   
emb|CBI33193.3|  unnamed protein product                              77.8    4e-13   
ref|NP_195516.2|  Rhamnogalacturonate lyase family protein            77.4    4e-13   
ref|XP_007158341.1|  hypothetical protein PHAVU_002G144400g           77.4    5e-13   
ref|XP_010439043.1|  PREDICTED: probable rhamnogalacturonate lyase B  77.0    6e-13   
ref|XP_008444896.1|  PREDICTED: rhamnogalacturonate lyase B-like ...  77.0    6e-13   
ref|XP_008444895.1|  PREDICTED: rhamnogalacturonate lyase B-like ...  77.0    6e-13   
ref|XP_010451209.1|  PREDICTED: probable rhamnogalacturonate lyase B  77.0    6e-13   
ref|XP_009131413.1|  PREDICTED: rhamnogalacturonate lyase B           77.0    6e-13   
ref|XP_010429187.1|  PREDICTED: probable rhamnogalacturonate lyas...  77.0    7e-13   
ref|XP_010429186.1|  PREDICTED: probable rhamnogalacturonate lyas...  76.6    7e-13   
ref|XP_010646859.1|  PREDICTED: rhamnogalacturonate lyase B-like      77.0    7e-13   
ref|XP_010319533.1|  PREDICTED: probable rhamnogalacturonate lyase B  76.6    7e-13   
gb|KCW59663.1|  hypothetical protein EUGRSUZ_H02416                   76.6    9e-13   
ref|XP_010023418.1|  PREDICTED: uncharacterized protein LOC104414097  76.6    1e-12   
gb|EYU30911.1|  hypothetical protein MIMGU_mgv1a023316mg              76.3    1e-12   
ref|XP_010433770.1|  PREDICTED: probable rhamnogalacturonate lyase B  76.3    1e-12   
ref|XP_006301664.1|  hypothetical protein CARUB_v10022113mg           76.3    1e-12   
gb|KFK28989.1|  hypothetical protein AALP_AA7G074100                  76.3    1e-12   
ref|XP_002993641.1|  hypothetical protein SELMODRAFT_431693           75.5    1e-12   
ref|XP_004512558.1|  PREDICTED: probable rhamnogalacturonate lyas...  75.9    1e-12   
ref|XP_006413432.1|  hypothetical protein EUTSA_v10024647mg           75.9    2e-12   
ref|XP_008224746.1|  PREDICTED: probable rhamnogalacturonate lyase B  75.9    2e-12   
ref|XP_004152608.1|  PREDICTED: rhamnogalacturonate lyase B-like      75.5    2e-12   
ref|XP_004163448.1|  PREDICTED: rhamnogalacturonate lyase B-like      75.5    2e-12   
ref|XP_007212351.1|  hypothetical protein PRUPE_ppa014556mg           75.5    2e-12   
ref|XP_009789095.1|  PREDICTED: probable rhamnogalacturonate lyase B  75.1    2e-12   
emb|CDX67779.1|  BnaA07g18190D                                        75.1    3e-12   
emb|CDX90388.1|  BnaA08g15960D                                        71.6    3e-12   
gb|KFK29690.1|  hypothetical protein AALP_AA7G166000                  74.7    3e-12   
ref|XP_009590660.1|  PREDICTED: rhamnogalacturonate lyase B-like      74.7    3e-12   
emb|CDX98350.1|  BnaC06g17110D                                        74.3    4e-12   
ref|XP_002973241.1|  hypothetical protein SELMODRAFT_413794           73.9    5e-12   
ref|XP_011097518.1|  PREDICTED: probable rhamnogalacturonate lyase B  73.9    6e-12   
ref|XP_010094027.1|  hypothetical protein L484_018043                 73.9    6e-12   
ref|XP_009140666.1|  PREDICTED: probable rhamnogalacturonate lyase B  73.9    7e-12   
ref|XP_002993615.1|  hypothetical protein SELMODRAFT_137340           73.6    8e-12   
ref|XP_009105545.1|  PREDICTED: probable rhamnogalacturonate lyase B  73.6    9e-12   
emb|CDY61006.1|  BnaA01g35120D                                        73.6    1e-11   
ref|XP_009109407.1|  PREDICTED: probable rhamnogalacturonate lyase B  73.6    1e-11   
emb|CDY56577.1|  BnaC01g41550D                                        73.2    1e-11   
ref|XP_002973439.1|  hypothetical protein SELMODRAFT_413798           73.2    1e-11   
ref|XP_009109978.1|  PREDICTED: probable rhamnogalacturonate lyase B  70.9    1e-11   
dbj|BAO45869.1|  rhamnogalacturonate lyase                            72.8    2e-11   
ref|XP_004979331.1|  PREDICTED: rhamnogalacturonate lyase B-like      72.8    2e-11   
ref|XP_006360390.1|  PREDICTED: rhamnogalacturonate lyase B-like      72.8    2e-11   
ref|XP_006346800.1|  PREDICTED: rhamnogalacturonate lyase B-like      72.4    2e-11   
emb|CDY52517.1|  BnaC03g61100D                                        72.4    2e-11   
gb|EMT04595.1|  hypothetical protein F775_22997                       70.9    2e-11   
ref|XP_010446606.1|  PREDICTED: probable rhamnogalacturonate lyase B  72.0    3e-11   
ref|XP_009786814.1|  PREDICTED: probable rhamnogalacturonate lyase B  71.2    4e-11   
ref|XP_010655419.1|  PREDICTED: probable rhamnogalacturonate lyase B  71.6    4e-11   
emb|CBI23231.3|  unnamed protein product                              71.6    4e-11   
ref|XP_009109417.1|  PREDICTED: rhamnogalacturonate lyase B-like      71.2    5e-11   
ref|XP_009109418.1|  PREDICTED: rhamnogalacturonate lyase B-like      70.9    6e-11   
ref|XP_006389593.1|  hypothetical protein POPTR_0021s00440g           70.9    7e-11   
gb|EYU33888.1|  hypothetical protein MIMGU_mgv1a019191mg              70.9    7e-11   
ref|XP_009620680.1|  PREDICTED: probable rhamnogalacturonate lyase B  67.8    1e-10   
ref|XP_011087033.1|  PREDICTED: rhamnogalacturonate lyase B-like      68.6    1e-10   



>ref|XP_011099952.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Sesamum 
indicum]
Length=687

 Score =   109 bits (272),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND+  E+PHF+TG+IG DNA+ARHGIHGLYWL+S  V GS LV   NTIF+T   
Sbjct  600  LQVRINDETTEVPHFTTGLIGRDNAIARHGIHGLYWLYSVDVPGSLLVTSTNTIFLTQSR  659

Query  274  AFTRWRGLLYDYIRFEGP  327
              + WRG++YDYIR EGP
Sbjct  660  GLSPWRGIMYDYIRLEGP  677



>ref|XP_011099953.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X2 [Sesamum 
indicum]
Length=676

 Score =   109 bits (272),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND+  E+PHF+TG+IG DNA+ARHGIHGLYWL+S  V GS LV   NTIF+T   
Sbjct  589  LQVRINDETTEVPHFTTGLIGRDNAIARHGIHGLYWLYSVDVPGSLLVTSTNTIFLTQSR  648

Query  274  AFTRWRGLLYDYIRFEGP  327
              + WRG++YDYIR EGP
Sbjct  649  GLSPWRGIMYDYIRLEGP  666



>ref|XP_010935280.1| PREDICTED: probable rhamnogalacturonate lyase B [Elaeis guineensis]
Length=666

 Score =   108 bits (270),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++RFND +A   HF+TG+IG DNA+ARHGIHGLYWL++  VR +WLV G+NTIF+T   
Sbjct  575  LQVRFNDSEANPAHFTTGLIGRDNAIARHGIHGLYWLYNIDVRSTWLVEGDNTIFLTQSR  634

Query  274  AFTRWRGLLYDYIRFEGPDQFKVS  345
            + + + G++YDYIR EGP  F + 
Sbjct  635  SLSPFHGIMYDYIRMEGPSDFYIE  658



>ref|XP_009776336.1| PREDICTED: uncharacterized protein LOC104226140, partial [Nicotiana 
sylvestris]
Length=161

 Score =   102 bits (253),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND  A+ PHF+ G IG DNA+ARHGIHGLYWL+S  ++G+ L  G NTIF+T   
Sbjct  82   LQVRINDGKAQEPHFTIGFIGGDNAIARHGIHGLYWLYSIGIQGNLLTKGANTIFLTQTI  141

Query  274  AFTRWRGLLYDYIRFEGPDQ  333
            A T ++G++YDY+R EGP Q
Sbjct  142  ALTPYQGVMYDYLRLEGPHQ  161



>ref|XP_009801905.1| PREDICTED: probable rhamnogalacturonate lyase B [Nicotiana sylvestris]
Length=667

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = +1

Query  97   KLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGGA  276
            ++R ND+ AE PHF+TG IG DNA+ARHGIHGLYWL+S R++G+ L  G NTIF+T   A
Sbjct  589  QVRVNDEKAEEPHFTTGFIGGDNAIARHGIHGLYWLYSIRIQGNLLSKGANTIFLTQTIA  648

Query  277  FTRWRGLLYDYIRFEGPDQ  333
             T ++G++YDY+R EGP Q
Sbjct  649  ITPYQGVMYDYLRLEGPHQ  667



>ref|XP_006856573.1| hypothetical protein AMTR_s00046p00191970 [Amborella trichopoda]
 gb|ERN18040.1| hypothetical protein AMTR_s00046p00191970 [Amborella trichopoda]
Length=467

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++RFND  A  PHF+TGIIG DNA+ARHGIHGLYWL+S  +  + LV G NTIF+T   
Sbjct  380  LQVRFNDPKANPPHFTTGIIGMDNAIARHGIHGLYWLYSIDIPNTQLVVGVNTIFLTQAN  439

Query  274  AFTRWRGLLYDYIRFEGP  327
            + + +RG+LYDYIR EGP
Sbjct  440  STSPFRGILYDYIRLEGP  457



>ref|XP_009387810.1| PREDICTED: probable rhamnogalacturonate lyase B, partial [Musa 
acuminata subsp. malaccensis]
Length=260

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++RFND     PHF+TG+IG DN++ARHGIHGLYWLF+  V+ +WL+ G+NTI++T   
Sbjct  180  LQVRFNDATINPPHFTTGLIGRDNSIARHGIHGLYWLFNIDVQSAWLIQGDNTIYLTQTK  239

Query  274  AFTRWRGLLYDYIRFEGP  327
            + + + G++YDYIR EGP
Sbjct  240  STSPFHGIMYDYIRMEGP  257



>ref|XP_008781312.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Phoenix 
dactylifera]
Length=655

 Score =   104 bits (260),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 45/78 (58%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++RFND  A   HF+TG+IG DNA+ARHGIHGLYWL++  VR +WLV G+NTIF+T   
Sbjct  575  LQVRFNDSKANPAHFATGLIGRDNAIARHGIHGLYWLYNIDVRSTWLVQGDNTIFLTQPR  634

Query  274  AFTRWRGLLYDYIRFEGP  327
            +   ++G++YDYIR EGP
Sbjct  635  SQGPFQGIMYDYIRMEGP  652



>gb|EYU36440.1| hypothetical protein MIMGU_mgv1a024423mg, partial [Erythranthe 
guttata]
Length=119

 Score = 97.8 bits (242),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 57/78 (73%), Gaps = 1/78 (1%)
 Frame = +1

Query  94   FKLRFNDKDAELPH-FSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNG  270
             ++R N+ D  +P  FSTG+IG DNA+ RHGIHGLYWLFS  + GS LV GNNTI++T  
Sbjct  41   LQVRVNNPDRNIPAIFSTGLIGKDNAIGRHGIHGLYWLFSVEILGSSLVTGNNTIYLTQA  100

Query  271  GAFTRWRGLLYDYIRFEG  324
             A    +G++YDYIRFEG
Sbjct  101  DATGPLQGIMYDYIRFEG  118



>ref|XP_008781313.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X2 [Phoenix 
dactylifera]
Length=558

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++RFND  A   HF+TG+IG DNA+ARHGIHGLYWL++  VR +WLV G+NTIF+T   
Sbjct  478  LQVRFNDSKANPAHFATGLIGRDNAIARHGIHGLYWLYNIDVRSTWLVQGDNTIFLTQPR  537

Query  274  AFTRWRGLLYDYIRFEGP  327
            +   ++G++YDYIR EGP
Sbjct  538  SQGPFQGIMYDYIRMEGP  555



>ref|XP_010935282.1| PREDICTED: probable rhamnogalacturonate lyase B [Elaeis guineensis]
 ref|XP_010935283.1| PREDICTED: probable rhamnogalacturonate lyase B [Elaeis guineensis]
Length=655

 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++RFND  A   HF+TG+IG DNA+ARHGIHGLYWL++  VR +WLV G+NTIF+T   
Sbjct  575  LQVRFNDSKANPAHFTTGLIGRDNAIARHGIHGLYWLYNINVRSTWLVQGDNTIFLTQSR  634

Query  274  AFTRWRGLLYDYIRFEGP  327
            +   ++G++YDYIR EGP
Sbjct  635  SQGPFQGIMYDYIRMEGP  652



>ref|XP_009591967.1| PREDICTED: probable rhamnogalacturonate lyase B [Nicotiana tomentosiformis]
Length=615

 Score =   103 bits (256),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = +1

Query  97   KLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGGA  276
            ++RFND     PHF+TG+IG DNA+ARHGIHGLYWL+S  V+G+ L+ G NTIF+T   A
Sbjct  536  QVRFNDGKLATPHFTTGVIGGDNAIARHGIHGLYWLYSIEVQGNLLLNGTNTIFLTQAIA  595

Query  277  FTRWRGLLYDYIRFEGPDQF  336
               ++G++YDY+RFE P Q 
Sbjct  596  TNPFQGVMYDYLRFEAPHQL  615



>gb|EEC84004.1| hypothetical protein OsI_30207 [Oryza sativa Indica Group]
Length=1186

 Score =   103 bits (258),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +1

Query  94    FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
              ++RFND+D   PHF+TG+IG DN +ARHGIHGLYWLF+  V G+WLV G NTI++    
Sbjct  1106  LQVRFNDQDRTAPHFTTGLIGKDNTIARHGIHGLYWLFNIDVSGAWLVQGMNTIYLKQPR  1165

Query  274   AFTRWRGLLYDYIRFEGP  327
               + ++GL+YDY+R EGP
Sbjct  1166  NQSPFQGLMYDYLRMEGP  1183



>ref|NP_001062464.1| Os08g0554100 [Oryza sativa Japonica Group]
 dbj|BAF24378.1| Os08g0554100 [Oryza sativa Japonica Group]
Length=658

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++RFND+D   PHF+TG+IG DN +ARHGIHGLYWLF+  V G+WLV G NTI++    
Sbjct  578  LQVRFNDQDRTAPHFTTGLIGKDNTIARHGIHGLYWLFNIDVSGAWLVQGMNTIYLKQPR  637

Query  274  AFTRWRGLLYDYIRFEGP  327
              + ++GL+YDY+R EGP
Sbjct  638  NQSPFQGLMYDYLRMEGP  655



>dbj|BAD10227.1| putative MYST1 [Oryza sativa Japonica Group]
 dbj|BAD33010.1| putative MYST1 [Oryza sativa Japonica Group]
Length=645

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++RFND+D   PHF+TG+IG DN +ARHGIHGLYWLF+  V G+WLV G NTI++    
Sbjct  565  LQVRFNDQDRTAPHFTTGLIGKDNTIARHGIHGLYWLFNIDVSGAWLVQGMNTIYLKQPR  624

Query  274  AFTRWRGLLYDYIRFEGP  327
              + ++GL+YDY+R EGP
Sbjct  625  NQSPFQGLMYDYLRMEGP  642



>ref|XP_010235392.1| PREDICTED: probable rhamnogalacturonate lyase B [Brachypodium 
distachyon]
 ref|XP_010235393.1| PREDICTED: probable rhamnogalacturonate lyase B [Brachypodium 
distachyon]
Length=658

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++RFND+D   PHFS+G+IG DN +ARHGIHGLYWLF+  V G+WLV G NT+++    
Sbjct  578  LQIRFNDQDRGAPHFSSGLIGRDNTIARHGIHGLYWLFTVDVSGAWLVQGMNTVYLKQPR  637

Query  274  AFTRWRGLLYDYIRFEGP  327
            + + ++GL+YDY+R EGP
Sbjct  638  SQSPFQGLMYDYLRLEGP  655



>ref|XP_008664579.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X2 [Zea 
mays]
Length=657

 Score =   102 bits (255),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 43/78 (55%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++ FND+D  +PHF+TG+IG DNA+ARHGIHGLYWLF+  V  +WLV G NTI++    
Sbjct  577  LQISFNDQDRAVPHFATGLIGRDNAIARHGIHGLYWLFNIDVASAWLVQGVNTIYLKQPR  636

Query  274  AFTRWRGLLYDYIRFEGP  327
            + + ++GL+YDY+R EGP
Sbjct  637  SQSPFQGLMYDYLRLEGP  654



>ref|XP_010060114.1| PREDICTED: probable rhamnogalacturonate lyase B [Eucalyptus grandis]
 gb|KCW66662.1| hypothetical protein EUGRSUZ_F00439 [Eucalyptus grandis]
Length=696

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++RFND +A  P FS+G+IG DN +ARHGIHGLYWLFS  V G+ L+ G NTIF+T  G
Sbjct  610  LQVRFNDANASSPLFSSGVIGRDNTIARHGIHGLYWLFSIDVPGTELIKGENTIFLTQIG  669

Query  274  AFTRWRGLLYDYIRFEGP  327
            + + ++G++YDYIR EGP
Sbjct  670  STSPFQGIMYDYIRLEGP  687



>ref|XP_008664578.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Zea 
mays]
Length=703

 Score =   102 bits (254),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 43/78 (55%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++ FND+D  +PHF+TG+IG DNA+ARHGIHGLYWLF+  V  +WLV G NTI++    
Sbjct  623  LQISFNDQDRAVPHFATGLIGRDNAIARHGIHGLYWLFNIDVASAWLVQGVNTIYLKQPR  682

Query  274  AFTRWRGLLYDYIRFEGP  327
            + + ++GL+YDY+R EGP
Sbjct  683  SQSPFQGLMYDYLRLEGP  700



>tpg|DAA48720.1| TPA: hypothetical protein ZEAMMB73_778200 [Zea mays]
Length=646

 Score =   102 bits (253),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 43/78 (55%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++ FND+D  +PHF+TG+IG DNA+ARHGIHGLYWLF+  V  +WLV G NTI++    
Sbjct  566  LQISFNDQDRAVPHFATGLIGRDNAIARHGIHGLYWLFNIDVASAWLVQGVNTIYLKQPR  625

Query  274  AFTRWRGLLYDYIRFEGP  327
            + + ++GL+YDY+R EGP
Sbjct  626  SQSPFQGLMYDYLRLEGP  643



>gb|AFD62270.1| rhamnogalacturonate lyase family protein, partial [Annona cherimola]
Length=256

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++RFND  A+ PHF+TG IG DN++ARHGI GLYWLF   V    LV G+NTIF+T   
Sbjct  167  LQVRFNDPTADPPHFTTGEIGKDNSIARHGIRGLYWLFDIDVPAGVLVEGDNTIFLTQAR  226

Query  274  AFTRWRGLLYDYIRFEGP  327
            + + ++G+LYDYIR EGP
Sbjct  227  SISPFQGILYDYIRLEGP  244



>ref|XP_010254609.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Nelumbo 
nucifera]
 ref|XP_010254610.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Nelumbo 
nucifera]
Length=640

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++RFND  A  PHF+TG+IG DN++ARHGIHGLYWL++  V G+ LV G+NTIF+T   
Sbjct  554  LQVRFNDPKANRPHFTTGLIGRDNSIARHGIHGLYWLYNVDVPGTRLVEGDNTIFLTQPR  613

Query  274  AFTRWRGLLYDYIRFEGP  327
            + + ++G++YDYIR EGP
Sbjct  614  SSSPFQGIMYDYIRLEGP  631



>ref|XP_006364646.1| PREDICTED: probable rhamnogalacturonate lyase B-like isoform 
X2 [Solanum tuberosum]
Length=623

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++RFND++   PHF+TG IG DNA+ARHGIHGLY+L+S  V+G+ LV G NTIF+T   
Sbjct  544  LQVRFNDENVVEPHFTTGKIGGDNAIARHGIHGLYFLYSIEVKGNLLVNGTNTIFLTQAI  603

Query  274  AFTRWRGLLYDYIRFEGPDQ  333
            A   ++G++YDY+R EGP Q
Sbjct  604  ATNPFQGVMYDYLRLEGPHQ  623



>gb|EEE69123.1| hypothetical protein OsJ_28233 [Oryza sativa Japonica Group]
Length=1374

 Score =   102 bits (253),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 42/76 (55%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = +1

Query  94    FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
              ++RFND+D   PHF+TG+IG DN +ARHGIHGLYWLF+  V G+WLV G NTI++    
Sbjct  1224  LQVRFNDQDRTAPHFTTGLIGKDNTIARHGIHGLYWLFNIDVSGAWLVQGMNTIYLKQPR  1283

Query  274   AFTRWRGLLYDYIRFE  321
               + ++GL+YDY+R E
Sbjct  1284  NQSPFQGLMYDYLRME  1299



>ref|XP_006364645.1| PREDICTED: probable rhamnogalacturonate lyase B-like isoform 
X1 [Solanum tuberosum]
Length=662

 Score =   101 bits (251),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++RFND++   PHF+TG IG DNA+ARHGIHGLY+L+S  V+G+ LV G NTIF+T   
Sbjct  583  LQVRFNDENVVEPHFTTGKIGGDNAIARHGIHGLYFLYSIEVKGNLLVNGTNTIFLTQAI  642

Query  274  AFTRWRGLLYDYIRFEGPDQ  333
            A   ++G++YDY+R EGP Q
Sbjct  643  ATNPFQGVMYDYLRLEGPHQ  662



>ref|XP_009803167.1| PREDICTED: uncharacterized protein LOC104248579 [Nicotiana sylvestris]
Length=209

 Score = 97.1 bits (240),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND     P FS+G+IG DNA+ARHGIHGLYWLF+  ++G  LV G NTI++T   
Sbjct  128  LQVRINDSSMNTPLFSSGLIGKDNAIARHGIHGLYWLFNVNLQGDMLVEGENTIYLTQAN  187

Query  274  AFTRWRGLLYDYIRFEGP  327
            A + ++G++YDYIR E P
Sbjct  188  ATSPFQGIMYDYIRLEAP  205



>gb|EMT23951.1| Rhamnogalacturonate lyase [Aegilops tauschii]
Length=594

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++RFND+   +PHF+TG+IG DNA+ARHGIHGLYWLFS  V G+WLV G NTI++    
Sbjct  504  LQVRFNDEARAVPHFTTGLIGRDNAIARHGIHGLYWLFSVGVSGAWLVRGINTIYLKQPR  563

Query  274  AFTRWRGLLYDYIRFEGP  327
              + ++G++YDY+R EGP
Sbjct  564  NQSPFQGVMYDYLRLEGP  581



>emb|CDP00942.1| unnamed protein product [Coffea canephora]
Length=681

 Score =   101 bits (251),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 44/81 (54%), Positives = 61/81 (75%), Gaps = 0/81 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND+ A  P FS+G+IGTDNA+ARHGIHGLYWLF+  + GS L+ G+NTIF+T   
Sbjct  599  LQVRVNDEMANPPLFSSGVIGTDNAIARHGIHGLYWLFNIDIPGSELLGGDNTIFLTQAK  658

Query  274  AFTRWRGLLYDYIRFEGPDQF  336
            + + ++G++YDYIR EGP   
Sbjct  659  SSSPFQGIMYDYIRLEGPSSL  679



>ref|XP_009797073.1| PREDICTED: probable rhamnogalacturonate lyase B [Nicotiana sylvestris]
 ref|XP_009797074.1| PREDICTED: probable rhamnogalacturonate lyase B [Nicotiana sylvestris]
 ref|XP_009797075.1| PREDICTED: probable rhamnogalacturonate lyase B [Nicotiana sylvestris]
 ref|XP_009797076.1| PREDICTED: probable rhamnogalacturonate lyase B [Nicotiana sylvestris]
Length=662

 Score =   100 bits (250),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = +1

Query  97   KLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGGA  276
            ++RFND     PHF+TG+IG DNA+ARHGIHGLYWL+S  V+G+  V G NTIF+T   A
Sbjct  585  QVRFNDGKLATPHFTTGVIGGDNAIARHGIHGLYWLYSIEVQGNLFVNGTNTIFLTQAIA  644

Query  277  FTRWRGLLYDYIRFEGP  327
               ++G++YDY+RFE P
Sbjct  645  TNPFQGVMYDYLRFEAP  661



>ref|XP_009418295.1| PREDICTED: probable rhamnogalacturonate lyase B [Musa acuminata 
subsp. malaccensis]
Length=634

 Score =   100 bits (250),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++RFND     PHF+T +IG DN++ARHGIHGLYWLF+  V+ +WL+ G+NTI++T   
Sbjct  554  LQVRFNDATVNPPHFTTRLIGRDNSIARHGIHGLYWLFNIDVQSTWLIQGDNTIYLTQTK  613

Query  274  AFTRWRGLLYDYIRFEGP  327
            + + ++G++YDYIR EGP
Sbjct  614  SASPFQGIMYDYIRMEGP  631



>ref|XP_006660373.1| PREDICTED: probable rhamnogalacturonate lyase B-like [Oryza brachyantha]
Length=648

 Score =   100 bits (249),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++RFND D   PHF++G+IG DN +ARHGIHGLYWLF+  V G+WLV G NTI++    
Sbjct  568  LQVRFNDPDRSAPHFTSGLIGRDNGIARHGIHGLYWLFNIDVSGAWLVQGMNTIYLKQPR  627

Query  274  AFTRWRGLLYDYIRFEGP  327
              + ++GL+YDY+R EGP
Sbjct  628  NQSPFQGLMYDYLRMEGP  645



>ref|XP_008384772.1| PREDICTED: probable rhamnogalacturonate lyase B [Malus domestica]
Length=803

 Score =   100 bits (250),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 44/77 (57%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = +1

Query  97   KLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGGA  276
            ++RFN++ A  PHF+TG+IG DNA+ARHGIHGLYWLFS  V    L  GNNTI++T   +
Sbjct  723  QVRFNBQSAFPPHFTTGLIGKDNAIARHGIHGLYWLFSIGVPSYRLREGNNTIYLTQSRS  782

Query  277  FTRWRGLLYDYIRFEGP  327
               + G++YDYIR EGP
Sbjct  783  LGTFEGVMYDYIRLEGP  799



>ref|XP_006364653.1| PREDICTED: rhamnogalacturonate lyase B-like [Solanum tuberosum]
Length=613

 Score =   100 bits (249),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 61/79 (77%), Gaps = 0/79 (0%)
 Frame = +1

Query  97   KLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGGA  276
            ++R ND+ A++PHF+TG IG  NA+ARHGIHGLYW++S  ++G  L+ G NTIF+T   A
Sbjct  535  QVRVNDEKAQMPHFTTGHIGGSNAIARHGIHGLYWIYSIGIQGKLLINGENTIFLTQILA  594

Query  277  FTRWRGLLYDYIRFEGPDQ  333
             + ++G++YDY+R EGP Q
Sbjct  595  LSPFQGIMYDYLRLEGPHQ  613



>gb|EEE69124.1| hypothetical protein OsJ_28234 [Oryza sativa Japonica Group]
Length=511

 Score = 99.4 bits (246),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++RFN++D   PHF+TG+IG DN +ARHGIH LYWLF+  V G+WLV G NTI++    
Sbjct  431  LQVRFNNQDRTAPHFTTGLIGKDNTIARHGIHALYWLFNIDVSGAWLVQGMNTIYLKQPR  490

Query  274  AFTRWRGLLYDYIRFEGP  327
              + ++GL+YDY+R EGP
Sbjct  491  NQSPFQGLMYDYLRMEGP  508



>ref|XP_004289511.1| PREDICTED: probable rhamnogalacturonate lyase B-like [Fragaria 
vesca subsp. vesca]
Length=736

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++RFND   + PHFSTG+IG DNA+ARHGIHGLYW FS  V  S L  G NTI++T   
Sbjct  652  IQVRFNDPSVKQPHFSTGLIGGDNAIARHGIHGLYWFFSVNVPSSLLQEGTNTIYLTQSR  711

Query  274  AFTRWRGLLYDYIRFEGP  327
                +RG++YDYIR EGP
Sbjct  712  GGAPFRGVMYDYIRLEGP  729



>ref|XP_010664440.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Vitis 
vinifera]
Length=694

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND  A  PHF++G+IG DN +ARHGIHGLYWL+S  V G+ LV G NTIF+T   
Sbjct  605  LQVRVNDPKANPPHFTSGLIGRDNTIARHGIHGLYWLYSVNVLGNLLVEGENTIFLTQPR  664

Query  274  AFTRWRGLLYDYIRFEGP  327
            + + ++G+LYDYIR EGP
Sbjct  665  STSPFQGILYDYIRLEGP  682



>ref|XP_002285626.2| PREDICTED: probable rhamnogalacturonate lyase B isoform X2 [Vitis 
vinifera]
Length=643

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND  A  PHF++G+IG DN +ARHGIHGLYWL+S  V G+ LV G NTIF+T   
Sbjct  554  LQVRVNDPKANPPHFTSGLIGRDNTIARHGIHGLYWLYSVNVLGNLLVEGENTIFLTQPR  613

Query  274  AFTRWRGLLYDYIRFEGP  327
            + + ++G+LYDYIR EGP
Sbjct  614  STSPFQGILYDYIRLEGP  631



>emb|CBI19298.3| unnamed protein product [Vitis vinifera]
Length=656

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND  A  PHF++G+IG DN +ARHGIHGLYWL+S  V G+ LV G NTIF+T   
Sbjct  567  LQVRVNDPKANPPHFTSGLIGRDNTIARHGIHGLYWLYSVNVLGNLLVEGENTIFLTQPR  626

Query  274  AFTRWRGLLYDYIRFEGP  327
            + + ++G+LYDYIR EGP
Sbjct  627  STSPFQGILYDYIRLEGP  644



>ref|NP_001062465.1| Os08g0554300 [Oryza sativa Japonica Group]
 dbj|BAF24379.1| Os08g0554300 [Oryza sativa Japonica Group]
Length=606

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++RFN++D   PHF+TG+IG DN +ARHGIH LYWLF+  V G+WLV G NTI++    
Sbjct  526  LQVRFNNQDRTAPHFTTGLIGKDNTIARHGIHALYWLFNIDVSGAWLVQGMNTIYLKQPR  585

Query  274  AFTRWRGLLYDYIRFEGP  327
              + ++GL+YDY+R EGP
Sbjct  586  NQSPFQGLMYDYLRMEGP  603



>ref|XP_004250188.2| PREDICTED: uncharacterized protein LOC101259106 [Solanum lycopersicum]
Length=1336

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = +1

Query  94    FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
              ++RFND+    PHF+TG IG DNA+ARHGIHGLY+L+S  V+G+ LV G NTIF+T   
Sbjct  1257  LQVRFNDEKVVEPHFTTGKIGGDNAIARHGIHGLYFLYSIEVKGNLLVNGTNTIFLTQTI  1316

Query  274   AFTRWRGLLYDYIRFEGPDQ  333
             A   ++G++YDY+R EGP Q
Sbjct  1317  ATNPFQGVMYDYLRLEGPHQ  1336


 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 67/97 (69%), Gaps = 1/97 (1%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R N ++A+ PHF+TG IG  NA+ARHGIHGLYW++S  ++G  LV G NTIF++   
Sbjct  559  LQVRVNYENAKTPHFTTGQIGGSNAIARHGIHGLYWIYSIGIQGKLLVNGANTIFLSQIL  618

Query  274  AFTRWRGLLYDYIRFEGPDQFKVSM*YVTIIPPGMML  384
            A + ++G++YDY+RFEGP    ++     I+ P + L
Sbjct  619  ALSPFQGVMYDYLRFEGPHHLMINF-LPQIVSPNVFL  654



>dbj|BAK04420.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=665

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 64/99 (65%), Gaps = 5/99 (5%)
 Frame = +1

Query  46   STPNKPTLKLYIFFLV-----FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFS  210
            + P   T KL +          ++RFND+    PHF+TG+IG DNA+ARHGIHGLYWLFS
Sbjct  560  AVPPNSTYKLRVALASSANAELQVRFNDEARAAPHFTTGLIGRDNAIARHGIHGLYWLFS  619

Query  211  FRVRGSWLVPGNNTIFMTNGGAFTRWRGLLYDYIRFEGP  327
              V G+WLV G N +++      + ++G++YDY+R EGP
Sbjct  620  MDVSGAWLVRGMNIVYLKQPRNQSPFQGVMYDYLRLEGP  658



>ref|XP_002445711.1| hypothetical protein SORBIDRAFT_07g024560 [Sorghum bicolor]
 gb|EES15206.1| hypothetical protein SORBIDRAFT_07g024560 [Sorghum bicolor]
Length=663

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 42/74 (57%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +1

Query  106  FNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGGAFTR  285
            FND+D   PHF+TG+IG +NA+ARHGIHGLYWLF+  V  +WLV G NTI++    + + 
Sbjct  587  FNDQDKARPHFATGLIGRENAIARHGIHGLYWLFNIDVASAWLVQGVNTIYLKQPRSQSP  646

Query  286  WRGLLYDYIRFEGP  327
            ++GL+YDY+R EGP
Sbjct  647  FQGLMYDYLRLEGP  660



>ref|XP_008384665.1| PREDICTED: probable rhamnogalacturonate lyase B [Malus domestica]
Length=675

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = +1

Query  97   KLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGGA  276
            ++RFN++ A+ PHF+TG+IG DNA+ARHGIHGLYWLFS  V    L  GNN+IF+T    
Sbjct  596  QVRFNNQSAKPPHFTTGLIGKDNAIARHGIHGLYWLFSIIVPSYRLQEGNNSIFLTQSRR  655

Query  277  FTRWRGLLYDYIRFEGPDQF  336
               + G++YDYIR EGP Q+
Sbjct  656  LGSFDGVMYDYIRLEGPPQW  675



>ref|XP_009795923.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Nicotiana 
sylvestris]
Length=640

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 42/78 (54%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND     P FS+G+IG DNA+ARHGIHGLYWLF+  ++G  LV G NTI++T   
Sbjct  559  LQVRINDSSMNTPLFSSGLIGKDNAIARHGIHGLYWLFNVNLQGDMLVEGENTIYLTQAR  618

Query  274  AFTRWRGLLYDYIRFEGP  327
            A + ++G++YDYIR EGP
Sbjct  619  ATSPFQGIMYDYIRLEGP  636



>ref|XP_011098611.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X2 [Sesamum 
indicum]
Length=640

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND DA+ P FSTG+IG DNA+ARHGIHG+YWLF+  +  + L+ G NTI++T   
Sbjct  556  LQVRVNDSDADPPLFSTGVIGADNAIARHGIHGIYWLFNVDIPAAQLMQGENTIYLTQAK  615

Query  274  AFTRWRGLLYDYIRFEGP  327
            + + ++G++YDY+R EGP
Sbjct  616  SSSPFQGIMYDYLRLEGP  633



>gb|KDP41146.1| hypothetical protein JCGZ_03640 [Jatropha curcas]
Length=137

 Score = 92.8 bits (229),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++RFND  A+ P F+TG++G DNA+ARHGIHG+YW ++  V    LV G NTI++T   
Sbjct  57   IQVRFNDAAAKRPLFTTGLVGKDNAIARHGIHGIYWFYTIDVPNDVLVDGKNTIYLTQTR  116

Query  274  AFTRWRGLLYDYIRFEGP  327
                + G++YDYIR EGP
Sbjct  117  VAAAFSGVMYDYIRLEGP  134



>ref|XP_011098619.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X3 [Sesamum 
indicum]
Length=589

 Score = 98.2 bits (243),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND DA+ P FSTG+IG DNA+ARHGIHG+YWLF+  +  + L+ G NTI++T   
Sbjct  505  LQVRVNDSDADPPLFSTGVIGADNAIARHGIHGIYWLFNVDIPAAQLMQGENTIYLTQAK  564

Query  274  AFTRWRGLLYDYIRFEGP  327
            + + ++G++YDY+R EGP
Sbjct  565  SSSPFQGIMYDYLRLEGP  582



>ref|XP_011098603.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Sesamum 
indicum]
Length=641

 Score = 98.2 bits (243),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND DA+ P FSTG+IG DNA+ARHGIHG+YWLF+  +  + L+ G NTI++T   
Sbjct  557  LQVRVNDSDADPPLFSTGVIGADNAIARHGIHGIYWLFNVDIPAAQLMQGENTIYLTQAK  616

Query  274  AFTRWRGLLYDYIRFEGP  327
            + + ++G++YDY+R EGP
Sbjct  617  SSSPFQGIMYDYLRLEGP  634



>ref|XP_007208155.1| hypothetical protein PRUPE_ppa022021mg, partial [Prunus persica]
 gb|EMJ09354.1| hypothetical protein PRUPE_ppa022021mg, partial [Prunus persica]
Length=618

 Score = 98.2 bits (243),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = +1

Query  97   KLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGGA  276
            ++R ND  A  PHF+TG+IG DNA+ARHGIHGLYWLFS  +R   L  GNNTI++T    
Sbjct  539  QVRVNDWSANPPHFTTGLIGKDNAIARHGIHGLYWLFSVGLRNDRLQEGNNTIYLTQSRH  598

Query  277  FTRWRGLLYDYIRFEGPDQ  333
             T + G++YDY+R EGP Q
Sbjct  599  KTTFDGIMYDYLRLEGPPQ  617



>ref|XP_009789094.1| PREDICTED: probable rhamnogalacturonate lyase B [Nicotiana sylvestris]
Length=685

 Score = 98.2 bits (243),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 57/79 (72%), Gaps = 1/79 (1%)
 Frame = +1

Query  94   FKLRFNDKDAE-LPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNG  270
             ++R ND+DA+ +P+F+TG+IG DNA+ARHGIHGLYWL+S  V GS    G N IF+   
Sbjct  603  LQIRVNDQDADHVPNFTTGLIGKDNAIARHGIHGLYWLYSIDVPGSVFATGKNVIFLKQS  662

Query  271  GAFTRWRGLLYDYIRFEGP  327
               + W GL+YDYIR EGP
Sbjct  663  RGSSPWSGLMYDYIRLEGP  681



>ref|XP_009597661.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009597662.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Nicotiana 
tomentosiformis]
Length=639

 Score = 97.8 bits (242),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 41/78 (53%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND     P FS+G+IG DNA+ARHGIHGL+WLF+  ++G+ LV G NTI++T   
Sbjct  558  LQVRVNDSSTNTPLFSSGVIGKDNAIARHGIHGLHWLFNVNLQGNILVEGENTIYLTQAN  617

Query  274  AFTRWRGLLYDYIRFEGP  327
            A + ++G++YDYIR EGP
Sbjct  618  ATSPFQGIMYDYIRLEGP  635



>ref|XP_008353960.1| PREDICTED: probable rhamnogalacturonate lyase B [Malus domestica]
Length=676

 Score = 97.8 bits (242),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = +1

Query  97   KLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGGA  276
            ++RFN++ A  PHF+TG+IG DNA+ARHGIHGLYWLFS  V    L  GNNTI++T   +
Sbjct  596  QVRFNBQSAFPPHFTTGLIGKDNAIARHGIHGLYWLFSIGVPSYRLREGNNTIYLTQSRS  655

Query  277  FTRWRGLLYDYIRFEGP  327
               + G++YDYIR EGP
Sbjct  656  LGTFEGVMYDYIRLEGP  672



>ref|XP_010244706.1| PREDICTED: probable rhamnogalacturonate lyase B [Nelumbo nucifera]
Length=637

 Score = 97.8 bits (242),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 60/81 (74%), Gaps = 0/81 (0%)
 Frame = +1

Query  85   FLVFKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMT  264
            F   ++RFND  A  PHF+TG+IG DN++ARHGIHGLY L++  V  + LV G+NTIF+T
Sbjct  550  FSELQVRFNDPKANPPHFTTGLIGKDNSIARHGIHGLYRLYNVDVPSTRLVEGDNTIFLT  609

Query  265  NGGAFTRWRGLLYDYIRFEGP  327
               + + ++GL+YDYIR EGP
Sbjct  610  QSRSSSPFQGLMYDYIRLEGP  630



>emb|CDP01611.1| unnamed protein product [Coffea canephora]
Length=674

 Score = 97.8 bits (242),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R N+ D E P+F+TG IG DNA+ARHGIHGLY L+S  + GS L+ G N I++T   
Sbjct  593  LQVRINNPDEEAPYFTTGTIGKDNAIARHGIHGLYRLYSLEIPGSQLLFGRNIIYLTQSR  652

Query  274  AFTRWRGLLYDYIRFEGPDQF  336
              + WRG++YDY+R EGP ++
Sbjct  653  GSSPWRGIMYDYVRLEGPPEY  673



>ref|XP_010027974.1| PREDICTED: rhamnogalacturonate lyase B [Eucalyptus grandis]
 gb|KCW54628.1| hypothetical protein EUGRSUZ_I00574 [Eucalyptus grandis]
Length=697

 Score = 97.8 bits (242),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++RFND   E P F+TG IG DNA+ARHGIHGLYWL+S  V  S L  G+NTIF+T   
Sbjct  617  LQVRFNDPTMEPPLFATGRIGQDNAIARHGIHGLYWLYSIPVPSSQLRRGSNTIFLTQAW  676

Query  274  AFTRWRGLLYDYIRFEGPDQF  336
            A   ++G++YDYIR EGP + 
Sbjct  677  AINPYQGVMYDYIRLEGPPEL  697



>ref|XP_009597663.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X2 [Nicotiana 
tomentosiformis]
Length=521

 Score = 96.7 bits (239),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND     P FS+G+IG DNA+ARHGIHGL+WLF+  ++G+ LV G NTI++T   
Sbjct  440  LQVRVNDSSTNTPLFSSGVIGKDNAIARHGIHGLHWLFNVNLQGNILVEGENTIYLTQAN  499

Query  274  AFTRWRGLLYDYIRFEGP  327
            A + ++G++YDYIR EGP
Sbjct  500  ATSPFQGIMYDYIRLEGP  517



>ref|XP_006364652.1| PREDICTED: probable rhamnogalacturonate lyase B-like [Solanum 
tuberosum]
Length=564

 Score = 97.1 bits (240),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 54/75 (72%), Gaps = 0/75 (0%)
 Frame = +1

Query  109  NDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGGAFTRW  288
            ND+  + PHFSTG IG  NA+ARHGIHGLYWL+S  ++G  LV G NTIF+      + +
Sbjct  490  NDEKIQKPHFSTGHIGGSNAIARHGIHGLYWLYSIGIQGKLLVKGTNTIFLVQSSGLSPF  549

Query  289  RGLLYDYIRFEGPDQ  333
             G++YDYIRFEGP Q
Sbjct  550  EGVMYDYIRFEGPHQ  564



>gb|KDP32172.1| hypothetical protein JCGZ_12633 [Jatropha curcas]
Length=679

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 59/79 (75%), Gaps = 0/79 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++RFND+ A  PHF+T +IG DNA+ARHGIHGLY L+S  V+   L  GNNTI++T   
Sbjct  592  LQVRFNDERANKPHFTTKLIGRDNAIARHGIHGLYRLYSINVQSYLLKRGNNTIYLTQTR  651

Query  274  AFTRWRGLLYDYIRFEGPD  330
            +   +RG++YDYIRFEGP+
Sbjct  652  SIGPFRGIMYDYIRFEGPE  670



>ref|XP_006856575.1| hypothetical protein AMTR_s00046p00193590 [Amborella trichopoda]
 gb|ERN18042.1| hypothetical protein AMTR_s00046p00193590 [Amborella trichopoda]
Length=630

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++RFND  A  PHF+TG IG DNA+ARHGIHGLYWL+S  +  + LV G NTIF+T   
Sbjct  543  LQVRFNDPKANRPHFTTGRIGMDNAIARHGIHGLYWLYSIDIPNTQLVVGVNTIFLTQPR  602

Query  274  AFTRWRGLLYDYIRFEGP  327
              + ++ +LYDYIR EGP
Sbjct  603  CTSPFQAILYDYIRLEGP  620



>ref|XP_006472413.1| PREDICTED: rhamnogalacturonate lyase B-like isoform X3 [Citrus 
sinensis]
Length=638

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND     P FS+G+IG DN++ARHGIHGLYWLF+  V G+ LV G+NTIF+T   
Sbjct  545  LQVRINDPSTNRPLFSSGLIGRDNSIARHGIHGLYWLFNVDVPGARLVSGDNTIFLTQPR  604

Query  274  AFTRWRGLLYDYIRFEGPDQFKVS  345
            + + ++G++YDYIRFEGP     S
Sbjct  605  STSPFQGIMYDYIRFEGPPDSTTS  628



>ref|XP_006472412.1| PREDICTED: rhamnogalacturonate lyase B-like isoform X2 [Citrus 
sinensis]
Length=647

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND     P FS+G+IG DN++ARHGIHGLYWLF+  V G+ LV G+NTIF+T   
Sbjct  554  LQVRINDPSTNRPLFSSGLIGRDNSIARHGIHGLYWLFNVDVPGARLVSGDNTIFLTQPR  613

Query  274  AFTRWRGLLYDYIRFEGPDQFKVS  345
            + + ++G++YDYIRFEGP     S
Sbjct  614  STSPFQGIMYDYIRFEGPPDSTTS  637



>ref|XP_006472411.1| PREDICTED: rhamnogalacturonate lyase B-like isoform X1 [Citrus 
sinensis]
Length=650

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND     P FS+G+IG DN++ARHGIHGLYWLF+  V G+ LV G+NTIF+T   
Sbjct  557  LQVRINDPSTNRPLFSSGLIGRDNSIARHGIHGLYWLFNVDVPGARLVSGDNTIFLTQPR  616

Query  274  AFTRWRGLLYDYIRFEGPDQFKVS  345
            + + ++G++YDYIRFEGP     S
Sbjct  617  STSPFQGIMYDYIRFEGPPDSTTS  640



>ref|XP_008236572.1| PREDICTED: probable rhamnogalacturonate lyase B [Prunus mume]
Length=626

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = +1

Query  97   KLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGGA  276
            ++R ND  A  PHF+TG+IG DNA+ARHGIHGLYWLFS  ++   L  GNNTI++T    
Sbjct  547  QVRVNDWSANPPHFTTGLIGKDNAIARHGIHGLYWLFSVGLQSDRLQEGNNTIYLTQSRH  606

Query  277  FTRWRGLLYDYIRFEGPDQ  333
             T + G++YDY+R EGP Q
Sbjct  607  KTTFDGVMYDYLRLEGPPQ  625



>ref|XP_004974168.1| PREDICTED: probable rhamnogalacturonate lyase B-like isoform 
X1 [Setaria italica]
Length=658

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++ FND++  +PHF+TG+IG DNA+ARHGIHGLYWLF+  V  +WLV G NTI++    
Sbjct  578  LQVFFNDQNRGVPHFATGLIGRDNAIARHGIHGLYWLFNINVDSAWLVQGMNTIYLKQPR  637

Query  274  AFTRWRGLLYDYIRFEGP  327
              + ++GL+YDY+R EGP
Sbjct  638  NQSPFQGLMYDYLRLEGP  655



>ref|XP_004974169.1| PREDICTED: probable rhamnogalacturonate lyase B-like isoform 
X2 [Setaria italica]
Length=642

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++ FND++  +PHF+TG+IG DNA+ARHGIHGLYWLF+  V  +WLV G NTI++    
Sbjct  562  LQVFFNDQNRGVPHFATGLIGRDNAIARHGIHGLYWLFNINVDSAWLVQGMNTIYLKQPR  621

Query  274  AFTRWRGLLYDYIRFEGP  327
              + ++GL+YDY+R EGP
Sbjct  622  NQSPFQGLMYDYLRLEGP  639



>ref|XP_009801906.1| PREDICTED: probable rhamnogalacturonate lyase B [Nicotiana sylvestris]
Length=666

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 60/77 (78%), Gaps = 1/77 (1%)
 Frame = +1

Query  100  LRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGGA-  276
            +R N++ A+ P F+TG+IG  NA+ARHGIHGLYWL+S R++G+ LV G+NTIF+T   A 
Sbjct  589  VRVNNEKAQEPVFTTGLIGGSNAIARHGIHGLYWLYSIRIQGNLLVKGSNTIFLTQTNAD  648

Query  277  FTRWRGLLYDYIRFEGP  327
             T + G+LYDY+R EGP
Sbjct  649  LTAFNGVLYDYLRLEGP  665



>ref|XP_009591965.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Nicotiana 
tomentosiformis]
Length=679

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             +++FND D + PH++TG+IG DNA+ARHGIHGLY L++  V GS LV G N +++    
Sbjct  598  LQVQFNDPDTDAPHYTTGLIGKDNAIARHGIHGLYRLYTINVPGSLLVFGTNVMYLKQTR  657

Query  274  AFTRWRGLLYDYIRFEGPDQ  333
            +   WRG++YDYIR EGP +
Sbjct  658  SERPWRGIMYDYIRLEGPPE  677



>gb|KFK43287.1| hypothetical protein AALP_AA1G104400 [Arabis alpina]
Length=697

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND   + P F+TG IG DN +ARHGIHGLYWL++ +V  S L PGNNTI++T   
Sbjct  611  LQVRVNDFSVDPPLFTTGQIGKDNTIARHGIHGLYWLYNVKVPASLLRPGNNTIYLTQPM  670

Query  274  AFTRWRGLLYDYIRFEGPD  330
            A + ++GL+YDYIR E PD
Sbjct  671  ATSPFQGLMYDYIRLECPD  689



>ref|XP_009406093.1| PREDICTED: uncharacterized protein LOC103989069 [Musa acuminata 
subsp. malaccensis]
Length=519

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 59/79 (75%), Gaps = 1/79 (1%)
 Frame = +1

Query  94   FKLRFNDKDAELP-HFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNG  270
             ++RFN+   + P HF+TG+IG DN++ARHGIHGLYWLFS  V  SWL+ G+N IF+T  
Sbjct  440  IQVRFNNPIVQQPAHFTTGLIGRDNSIARHGIHGLYWLFSIDVDSSWLLEGDNIIFLTQT  499

Query  271  GAFTRWRGLLYDYIRFEGP  327
             + + ++G++YDYIR E P
Sbjct  500  RSVSPFQGVMYDYIRLEAP  518



>ref|XP_008347797.1| PREDICTED: uncharacterized protein LOC103410923 [Malus domestica]
Length=181

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 61/96 (64%), Gaps = 8/96 (8%)
 Frame = +1

Query  64   TLKLYIFFLV-----FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGS  228
            TLKL I          ++R ND  A+ P F+TG+IG DN +ARHGIHGLYWL++  + G+
Sbjct  78   TLKLRIALATANIAELQIRINDSKADPPLFTTGVIGKDNTIARHGIHGLYWLYNINIPGT  137

Query  229  WLVPGNNTIFMTNGGA---FTRWRGLLYDYIRFEGP  327
             LV G NT+F+T   +      + GL+YDYIR EGP
Sbjct  138  LLVEGANTLFLTQTMSTRPLAPFHGLMYDYIRLEGP  173



>ref|XP_008338489.1| PREDICTED: probable rhamnogalacturonate lyase B [Malus domestica]
Length=346

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 63/98 (64%), Gaps = 3/98 (3%)
 Frame = +1

Query  43   ISTPNKPTLKLYIFFLV---FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSF  213
            ++ P   TL+L +        ++RFN++ A  PHF+TG+IG DNAVARHGIHGLYWLFS 
Sbjct  245  LTNPGNYTLQLALASATNAEVQVRFNNQSAFPPHFTTGLIGRDNAVARHGIHGLYWLFSI  304

Query  214  RVRGSWLVPGNNTIFMTNGGAFTRWRGLLYDYIRFEGP  327
                  L  GNN I++T   +   + G++YDYIR EGP
Sbjct  305  IGPSYQLREGNNAIYLTQSRSLGTFEGVMYDYIRLEGP  342



>ref|XP_011098629.1| PREDICTED: probable rhamnogalacturonate lyase B [Sesamum indicum]
Length=655

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = +1

Query  85   FLVFKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMT  264
            F + ++R N ++A  P FS+G+IG+DN +ARHG+HGLYWLF+  +  + LV G NTI++T
Sbjct  563  FSILEVRINREEANPPEFSSGLIGSDNTIARHGVHGLYWLFNLEISSAQLVQGENTIYLT  622

Query  265  NGGAFTRWRGLLYDYIRFEGP  327
               + +   G++YDYIR EGP
Sbjct  623  QARSASAVHGIMYDYIRLEGP  643



>ref|XP_009611897.1| PREDICTED: uncharacterized protein LOC104105339, partial [Nicotiana 
tomentosiformis]
Length=1214

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = +1

Query  94   FKLRFNDKDAE-LPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNG  270
             ++R ND+DA+ +PHF+TG+IG DN +ARHGIHGLYWL+S  V G     G N IF+   
Sbjct  413  LQIRVNDQDADHVPHFTTGLIGKDNVIARHGIHGLYWLYSINVPGFLFATGKNVIFLKQS  472

Query  271  GAFTRWRGLLYDYIRFEGP  327
               + W GL+YDYIR EGP
Sbjct  473  RGSSPWSGLMYDYIRLEGP  491


 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = +1

Query  103   RFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGGAFT  282
             R N+ D   P+F T  IG  NA+ARHGIHGLY LFSF++ G  L  G N I++      +
Sbjct  1138  RINNPDRRRPNFETPGIGRSNAIARHGIHGLYSLFSFQIPGYELQNGENIIYLKQAKGGS  1197

Query  283   RWRGLLYDYIRFEGPDQ  333
              + G++YDY+R EGP Q
Sbjct  1198  PFNGVMYDYLRLEGPPQ  1214



>gb|EYU30915.1| hypothetical protein MIMGU_mgv1a003154mg [Erythranthe guttata]
Length=604

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLV-PGNNTIFMTNG  270
             ++R ND+  E P+F TG+IG DNA+ARHGIHGLYWL+S  + GS LV    NTI +T  
Sbjct  520  LQVRINDETTETPYFKTGLIGKDNAIARHGIHGLYWLYSVSIPGSTLVCTTTNTILLTQS  579

Query  271  GAFTRWRGLLYDYIRFEGP  327
               T W+G++YDYIR E P
Sbjct  580  RGSTPWKGIMYDYIRLEAP  598



>gb|KEH36122.1| rhamnogalacturonate lyase B-like protein [Medicago truncatula]
Length=381

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 59/84 (70%), Gaps = 1/84 (1%)
 Frame = +1

Query  79   IFFLVFKLRFNDKDAELPH-FSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTI  255
            + +   ++R N+ DA  P  FSTG+IG +N +ARHGIHGLYWL++  V+GS LV GNNTI
Sbjct  296  VHYAELQIRINNLDATSPPLFSTGVIGKENTIARHGIHGLYWLYNIDVQGSLLVKGNNTI  355

Query  256  FMTNGGAFTRWRGLLYDYIRFEGP  327
            F+T       + G+LYDYIR EGP
Sbjct  356  FLTQATKDGPFVGILYDYIRLEGP  379



>ref|XP_010244708.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X2 [Nelumbo 
nucifera]
Length=622

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 56/81 (69%), Gaps = 1/81 (1%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVP-GNNTIFMTNG  270
             ++RFN+ +   PHFSTG+IG DNA+ARHGIHGLY LFS  V   WLV  GNNTI +T  
Sbjct  540  LQVRFNNPNVNPPHFSTGLIGKDNAIARHGIHGLYRLFSVAVESEWLVAGGNNTIILTQS  599

Query  271  GAFTRWRGLLYDYIRFEGPDQ  333
               T + G++YDYIR EG  Q
Sbjct  600  RHSTPFNGIMYDYIRLEGASQ  620



>gb|KDP41513.1| hypothetical protein JCGZ_15920 [Jatropha curcas]
Length=686

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND++A  P F+TG+IG DN++ARHGIHGLYWL++  + G+ LV G NTIF+T   
Sbjct  607  LQVRVNDQNAPRPLFTTGLIGRDNSIARHGIHGLYWLYNVNIPGARLVEGENTIFLTQPR  666

Query  274  AFTRWRGLLYDYIRFEGP  327
              + ++GL+YDY+R EGP
Sbjct  667  CTSPFQGLMYDYLRLEGP  684



>ref|XP_010244707.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Nelumbo 
nucifera]
Length=621

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 56/81 (69%), Gaps = 1/81 (1%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVP-GNNTIFMTNG  270
             ++RFN+ +   PHFSTG+IG DNA+ARHGIHGLY LFS  V   WLV  GNNTI +T  
Sbjct  539  LQVRFNNPNVNPPHFSTGLIGKDNAIARHGIHGLYRLFSVAVESEWLVAGGNNTIILTQS  598

Query  271  GAFTRWRGLLYDYIRFEGPDQ  333
               T + G++YDYIR EG  Q
Sbjct  599  RHSTPFNGIMYDYIRLEGASQ  619



>ref|XP_002308510.2| hypothetical protein POPTR_0006s23510g [Populus trichocarpa]
 gb|EEE92033.2| hypothetical protein POPTR_0006s23510g [Populus trichocarpa]
Length=678

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++RFN+  ++ P F+TG +G DNA+ARHGIHGLYWL+   V GS LV G NTI++T   
Sbjct  598  IQVRFNNPSSDRPLFTTGAVGKDNAIARHGIHGLYWLYGIDVPGSQLVEGKNTIYLTQAR  657

Query  274  AFTRWRGLLYDYIRFEGP  327
            +   ++G++YDYIRFEGP
Sbjct  658  SDGPFQGVMYDYIRFEGP  675



>gb|EYU36444.1| hypothetical protein MIMGU_mgv1a002779mg [Erythranthe guttata]
Length=638

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 57/78 (73%), Gaps = 1/78 (1%)
 Frame = +1

Query  94   FKLRFNDKDAELPH-FSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNG  270
             ++R N+ D  +P  FSTG+IG DNA+ RHGIHGLYWLFS  + GS LV GNNTI++T  
Sbjct  560  LQVRVNNPDRNIPAIFSTGLIGKDNAIGRHGIHGLYWLFSVEILGSSLVTGNNTIYLTQA  619

Query  271  GAFTRWRGLLYDYIRFEG  324
             A    +G++YDYIRFEG
Sbjct  620  DATGPLQGIMYDYIRFEG  637



>emb|CDP01612.1| unnamed protein product [Coffea canephora]
Length=673

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +1

Query  91   VFKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNG  270
            V ++R ND +A  P F+ G+IG DNA+ARHGIHGLY L+S  V GS LV G N+IF+T  
Sbjct  591  VLQVRINDPNARNPIFNKGLIGKDNAIARHGIHGLYRLYSIGVSGSQLVQGRNSIFLTQS  650

Query  271  GAFTRWRGLLYDYIRFEGPDQ  333
                 W G++YDYIR EGP Q
Sbjct  651  RNSFPWEGIMYDYIRLEGPPQ  671



>emb|CDX93466.1| BnaA06g05820D [Brassica napus]
Length=656

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 43/81 (53%), Positives = 60/81 (74%), Gaps = 1/81 (1%)
 Frame = +1

Query  85   FLVFKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMT  264
            F   ++R ND +A  P F++G+IG DN++ARHGIHGLYWLF+  V GS LV G NT+F+T
Sbjct  576  FAELQVRVNDANAS-PLFTSGLIGRDNSIARHGIHGLYWLFNVEVAGSKLVEGENTLFLT  634

Query  265  NGGAFTRWRGLLYDYIRFEGP  327
               + + ++G++YDYIRFE P
Sbjct  635  QPRSISPFQGIMYDYIRFEAP  655



>ref|XP_004238544.1| PREDICTED: probable rhamnogalacturonate lyase B [Solanum lycopersicum]
Length=640

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 59/79 (75%), Gaps = 1/79 (1%)
 Frame = +1

Query  94   FKLRFNDKDA-ELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNG  270
             ++R ND  +   P FS+G+IG DNA+ARHGIHGLYWLF+  ++G+ LV G NTI++T  
Sbjct  558  LQVRINDNSSTNTPLFSSGVIGKDNAIARHGIHGLYWLFNVNLQGTILVEGENTIYLTQA  617

Query  271  GAFTRWRGLLYDYIRFEGP  327
             A + ++G++YDYIR EGP
Sbjct  618  NATSPFQGIMYDYIRLEGP  636



>gb|KHN04903.1| Rhamnogalacturonate lyase, partial [Glycine soja]
Length=620

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++RFND++A+LPHFSTG+ G DNA+ARHGIHGLY L++  V  + LV G NTI++T   
Sbjct  538  LEVRFNDQNAKLPHFSTGLTGDDNAIARHGIHGLYRLYTIAVGSNHLVKGKNTIYLTQSK  597

Query  274  AFTRWRGLLYDYIRFEGP  327
                + GL+YDY+R E P
Sbjct  598  GIGPFMGLMYDYVRLESP  615



>ref|XP_006572991.1| PREDICTED: probable rhamnogalacturonate lyase B-like [Glycine 
max]
Length=672

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++RFND++A+LPHFSTG+ G DNA+ARHGIHGLY L++  V  + LV G NTI++T   
Sbjct  590  LEVRFNDQNAKLPHFSTGLTGDDNAIARHGIHGLYRLYTIAVGSNHLVKGKNTIYLTQSK  649

Query  274  AFTRWRGLLYDYIRFEGP  327
                + GL+YDY+R E P
Sbjct  650  GIGPFMGLMYDYVRLESP  667



>ref|XP_010907787.1| PREDICTED: probable rhamnogalacturonate lyase B [Elaeis guineensis]
Length=372

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++RFND  A   HF+T +IG DN++ RHGIHGLYWL++  ++ +WLV G+NTIF+T   
Sbjct  292  LQVRFNDLKANPAHFTTRLIGRDNSIVRHGIHGLYWLYNVDIQSAWLVQGDNTIFLTQPR  351

Query  274  AFTRWRGLLYDYIRFEGP  327
              + ++ ++YDYIR EGP
Sbjct  352  NQSAFQEIMYDYIRMEGP  369



>ref|XP_009364825.1| PREDICTED: probable rhamnogalacturonate lyase B [Pyrus x bretschneideri]
Length=660

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 64/98 (65%), Gaps = 3/98 (3%)
 Frame = +1

Query  43   ISTPNKPTLKLYIFFLV---FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSF  213
            ++ P   TL+L +        ++RFN++ A  PHF+TG+IG DNA+ARHGIHGLYWLF  
Sbjct  559  LTNPGNYTLQLALASATNAEVQVRFNNQSAFPPHFTTGLIGRDNAIARHGIHGLYWLFGI  618

Query  214  RVRGSWLVPGNNTIFMTNGGAFTRWRGLLYDYIRFEGP  327
             V    L  GNNTI++T   +   + G++YDYIR EGP
Sbjct  619  IVPSYQLREGNNTIYLTQSRSLGTFEGVMYDYIRLEGP  656



>emb|CDP08054.1| unnamed protein product [Coffea canephora]
Length=446

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND +A  P F+ G+IG DNA+ARH  HGLYWL+   V GS LV G N+IF+T   
Sbjct  365  LQVRINDPNAGNPIFNEGLIGKDNAIARHSFHGLYWLYGVGVSGSQLVRGRNSIFLTQSR  424

Query  274  AFTRWRGLLYDYIRFEGPDQ  333
              T W G++YDYIR EGP Q
Sbjct  425  NSTPWEGIMYDYIRIEGPPQ  444



>ref|XP_009626138.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X2 [Nicotiana 
tomentosiformis]
Length=642

 Score = 95.1 bits (235),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = +1

Query  91   VFKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNG  270
            + ++R ND +A  PHFS+G+IG+DNAVARHGIHGLYWLF+  V    L+ G N I++   
Sbjct  557  ILEVRVNDSEANPPHFSSGLIGSDNAVARHGIHGLYWLFNVEVAAGQLLQGENIIYLKQA  616

Query  271  GAFTRWRGLLYDYIRFEGP  327
             + +   G++YDYIR E P
Sbjct  617  WSVSALHGIMYDYIRLEAP  635



>ref|XP_009626137.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Nicotiana 
tomentosiformis]
Length=650

 Score = 95.1 bits (235),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = +1

Query  91   VFKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNG  270
            + ++R ND +A  PHFS+G+IG+DNAVARHGIHGLYWLF+  V    L+ G N I++   
Sbjct  565  ILEVRVNDSEANPPHFSSGLIGSDNAVARHGIHGLYWLFNVEVAAGQLLQGENIIYLKQA  624

Query  271  GAFTRWRGLLYDYIRFEGP  327
             + +   G++YDYIR E P
Sbjct  625  WSVSALHGIMYDYIRLEAP  643



>emb|CDP00941.1| unnamed protein product [Coffea canephora]
Length=642

 Score = 94.7 bits (234),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 57/85 (67%), Gaps = 0/85 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND DA  PHF++G+IG+DNA+ARHG+HGLYWLF+  +  S L  G N I++T   
Sbjct  557  LQVRVNDPDANPPHFTSGLIGSDNAIARHGVHGLYWLFNIDIPESHLRQGYNVIYLTQAK  616

Query  274  AFTRWRGLLYDYIRFEGPDQFKVSM  348
              T   G++YDYIR E P+   + M
Sbjct  617  NDTALHGIMYDYIRMECPEPDTIPM  641



>ref|XP_009771423.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X2 [Nicotiana 
sylvestris]
Length=642

 Score = 94.7 bits (234),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             +++FND + + PH++TG+IG DNA+ARHGIHGLY L++  V GS LV G N +++    
Sbjct  561  LQVQFNDAEPDAPHYTTGLIGKDNAIARHGIHGLYRLYTINVPGSLLVFGTNVMYLKQTR  620

Query  274  AFTRWRGLLYDYIRFEGPDQ  333
            +   WRG++YDYIR EGP +
Sbjct  621  SERPWRGIMYDYIRLEGPPE  640



>ref|XP_009148302.1| PREDICTED: probable rhamnogalacturonate lyase B [Brassica rapa]
Length=633

 Score = 94.7 bits (234),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 43/81 (53%), Positives = 60/81 (74%), Gaps = 1/81 (1%)
 Frame = +1

Query  85   FLVFKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMT  264
            F   ++R ND +A  P F++G+IG DN++ARHGIHGLYWLF+  V GS LV G NT+F+T
Sbjct  553  FAELQVRVNDANAS-PLFTSGLIGRDNSIARHGIHGLYWLFNVEVAGSKLVGGENTLFLT  611

Query  265  NGGAFTRWRGLLYDYIRFEGP  327
               + + ++G++YDYIRFE P
Sbjct  612  QPRSISPFQGIMYDYIRFEAP  632



>ref|XP_009771424.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X3 [Nicotiana 
sylvestris]
Length=607

 Score = 94.7 bits (234),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             +++FND + + PH++TG+IG DNA+ARHGIHGLY L++  V GS LV G N +++    
Sbjct  526  LQVQFNDAEPDAPHYTTGLIGKDNAIARHGIHGLYRLYTINVPGSLLVFGTNVMYLKQTR  585

Query  274  AFTRWRGLLYDYIRFEGPDQ  333
            +   WRG++YDYIR EGP +
Sbjct  586  SERPWRGIMYDYIRLEGPPE  605



>gb|KEH36123.1| rhamnogalacturonate lyase B-like protein [Medicago truncatula]
Length=498

 Score = 94.0 bits (232),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 59/84 (70%), Gaps = 1/84 (1%)
 Frame = +1

Query  79   IFFLVFKLRFNDKDAELPH-FSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTI  255
            + +   ++R N+ DA  P  FSTG+IG +N +ARHGIHGLYWL++  V+GS LV GNNTI
Sbjct  413  VHYAELQIRINNLDATSPPLFSTGVIGKENTIARHGIHGLYWLYNIDVQGSLLVKGNNTI  472

Query  256  FMTNGGAFTRWRGLLYDYIRFEGP  327
            F+T       + G+LYDYIR EGP
Sbjct  473  FLTQATKDGPFVGILYDYIRLEGP  496



>ref|XP_009406069.1| PREDICTED: uncharacterized protein LOC103989051, partial [Musa 
acuminata subsp. malaccensis]
Length=1042

 Score = 95.1 bits (235),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++RFN+   +  HF+TG+IG DN++ARHGIHGLYWLFS  V  SWL+ G+N IF+T   
Sbjct  517  LQVRFNNPRVQPAHFTTGLIGRDNSIARHGIHGLYWLFSIDVESSWLLKGDNIIFLTQTR  576

Query  274  AFTRWRGLLYDYIRFEGP  327
              + + G++YDYIR E P
Sbjct  577  GQSPFNGVMYDYIRMEAP  594



>ref|XP_009771422.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Nicotiana 
sylvestris]
Length=682

 Score = 94.7 bits (234),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             +++FND + + PH++TG+IG DNA+ARHGIHGLY L++  V GS LV G N +++    
Sbjct  601  LQVQFNDAEPDAPHYTTGLIGKDNAIARHGIHGLYRLYTINVPGSLLVFGTNVMYLKQTR  660

Query  274  AFTRWRGLLYDYIRFEGPDQ  333
            +   WRG++YDYIR EGP +
Sbjct  661  SERPWRGIMYDYIRLEGPPE  680



>ref|XP_004287408.1| PREDICTED: probable rhamnogalacturonate lyase B-like [Fragaria 
vesca subsp. vesca]
Length=638

 Score = 94.4 bits (233),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 40/78 (51%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND   + P F+TG+IG DN +ARHGIHGLYWL+S  + G+ L+ G NT+F+T   
Sbjct  555  LQIRVNDSKTDSPLFTTGVIGKDNTIARHGIHGLYWLYSIDIPGTLLLEGVNTVFLTQAM  614

Query  274  AFTRWRGLLYDYIRFEGP  327
            + +  +GL+YDYIR EGP
Sbjct  615  SSSPVQGLMYDYIRLEGP  632



>emb|CDP01613.1| unnamed protein product [Coffea canephora]
Length=484

 Score = 93.6 bits (231),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 57/81 (70%), Gaps = 1/81 (1%)
 Frame = +1

Query  85   FLVFKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMT  264
            F   ++RFND++A  P F+ G+IG DNAVARHG HGLYWLFS  V  + LV G NTIF+T
Sbjct  402  FAELQVRFNDRNAA-PLFTAGLIGRDNAVARHGTHGLYWLFSIGVPRNLLVKGKNTIFLT  460

Query  265  NGGAFTRWRGLLYDYIRFEGP  327
                  ++RG +YDYIRFE P
Sbjct  461  QARNSDQFRGFMYDYIRFEAP  481



>ref|XP_006472995.1| PREDICTED: probable rhamnogalacturonate lyase B-like [Citrus 
sinensis]
Length=623

 Score = 94.4 bits (233),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = +1

Query  109  NDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGGAFTRW  288
            ND     P FSTG+IG DN +ARHGIHGLY+L++  V GS L+ GNNTIF+T   + + +
Sbjct  546  NDPSKNPPLFSTGVIGKDNTIARHGIHGLYYLYNVSVPGSLLLKGNNTIFLTQTESISPF  605

Query  289  RGLLYDYIRFEGPDQFK  339
            +G++YDYIR EGP   K
Sbjct  606  QGIMYDYIRLEGPPSLK  622



>ref|XP_004501130.1| PREDICTED: rhamnogalacturonate lyase B-like [Cicer arietinum]
Length=682

 Score = 94.4 bits (233),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 58/85 (68%), Gaps = 0/85 (0%)
 Frame = +1

Query  85   FLVFKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMT  264
            F   ++R N+ +A  P FS+ +IG +N +ARHGIHGLYWL++  V G+ LV GNNTIF+T
Sbjct  588  FAQLQIRINNSNANPPIFSSEVIGKENTIARHGIHGLYWLYNIDVNGTLLVKGNNTIFLT  647

Query  265  NGGAFTRWRGLLYDYIRFEGPDQFK  339
                 + + G+LYDYIR EGP   K
Sbjct  648  QTNNASPFVGILYDYIRLEGPAYVK  672



>gb|KEH36119.1| rhamnogalacturonate lyase B-like protein [Medicago truncatula]
Length=560

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 59/84 (70%), Gaps = 1/84 (1%)
 Frame = +1

Query  79   IFFLVFKLRFNDKDAELPH-FSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTI  255
            + +   ++R N+ DA  P  FSTG+IG +N +ARHGIHGLYWL++  V+GS LV GNNTI
Sbjct  475  VHYAELQIRINNLDATSPPLFSTGVIGKENTIARHGIHGLYWLYNIDVQGSLLVKGNNTI  534

Query  256  FMTNGGAFTRWRGLLYDYIRFEGP  327
            F+T       + G+LYDYIR EGP
Sbjct  535  FLTQATKDGPFVGILYDYIRLEGP  558



>ref|XP_009366370.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X4 [Pyrus 
x bretschneideri]
Length=638

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND D+  P F++G+IG DN+VARHGIHG+YWL++  V G+ LV GNNT F     
Sbjct  553  LQVRINDPDSRRPLFTSGLIGRDNSVARHGIHGIYWLYNISVPGAQLVEGNNTFFFRQPR  612

Query  274  AFTRWRGLLYDYIRFEGP  327
              + ++G++YDYIRFEGP
Sbjct  613  CTSPFQGIMYDYIRFEGP  630



>gb|KEH36121.1| rhamnogalacturonate lyase B-like protein [Medicago truncatula]
Length=569

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 59/84 (70%), Gaps = 1/84 (1%)
 Frame = +1

Query  79   IFFLVFKLRFNDKDAELPH-FSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTI  255
            + +   ++R N+ DA  P  FSTG+IG +N +ARHGIHGLYWL++  V+GS LV GNNTI
Sbjct  484  VHYAELQIRINNLDATSPPLFSTGVIGKENTIARHGIHGLYWLYNIDVQGSLLVKGNNTI  543

Query  256  FMTNGGAFTRWRGLLYDYIRFEGP  327
            F+T       + G+LYDYIR EGP
Sbjct  544  FLTQATKDGPFVGILYDYIRLEGP  567



>gb|KEH36120.1| rhamnogalacturonate lyase B-like protein [Medicago truncatula]
Length=523

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 59/84 (70%), Gaps = 1/84 (1%)
 Frame = +1

Query  79   IFFLVFKLRFNDKDAELPH-FSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTI  255
            + +   ++R N+ DA  P  FSTG+IG +N +ARHGIHGLYWL++  V+GS LV GNNTI
Sbjct  438  VHYAELQIRINNLDATSPPLFSTGVIGKENTIARHGIHGLYWLYNIDVQGSLLVKGNNTI  497

Query  256  FMTNGGAFTRWRGLLYDYIRFEGP  327
            F+T       + G+LYDYIR EGP
Sbjct  498  FLTQATKDGPFVGILYDYIRLEGP  521



>ref|XP_008339034.1| PREDICTED: uncharacterized protein LOC103402064 [Malus domestica]
Length=218

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = +1

Query  85   FLVFKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMT  264
            F   ++R ND  A  P F++G+IG DN++ARHGIHGLYWL++  V  S LV G+N I++T
Sbjct  125  FSELQVRVNDPKANRPLFTSGMIGRDNSIARHGIHGLYWLYNVDVPSSRLVEGDNIIYLT  184

Query  265  NGGAFTRWRGLLYDYIRFEGP  327
               +   ++G++YDY+RFEGP
Sbjct  185  QPRSTGPFQGIMYDYLRFEGP  205



>gb|AES73958.2| rhamnogalacturonate lyase B-like protein [Medicago truncatula]
Length=648

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 59/84 (70%), Gaps = 1/84 (1%)
 Frame = +1

Query  79   IFFLVFKLRFNDKDAELPH-FSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTI  255
            + +   ++R N+ DA  P  FSTG+IG +N +ARHGIHGLYWL++  V+GS LV GNNTI
Sbjct  563  VHYAELQIRINNLDATSPPLFSTGVIGKENTIARHGIHGLYWLYNIDVQGSLLVKGNNTI  622

Query  256  FMTNGGAFTRWRGLLYDYIRFEGP  327
            F+T       + G+LYDYIR EGP
Sbjct  623  FLTQATKDGPFVGILYDYIRLEGP  646



>ref|XP_003603707.1| Rhamnogalacturonate lyase [Medicago truncatula]
Length=643

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 59/84 (70%), Gaps = 1/84 (1%)
 Frame = +1

Query  79   IFFLVFKLRFNDKDAELPH-FSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTI  255
            + +   ++R N+ DA  P  FSTG+IG +N +ARHGIHGLYWL++  V+GS LV GNNTI
Sbjct  558  VHYAELQIRINNLDATSPPLFSTGVIGKENTIARHGIHGLYWLYNIDVQGSLLVKGNNTI  617

Query  256  FMTNGGAFTRWRGLLYDYIRFEGP  327
            F+T       + G+LYDYIR EGP
Sbjct  618  FLTQATKDGPFVGILYDYIRLEGP  641



>ref|XP_002892533.1| hypothetical protein ARALYDRAFT_334271 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68792.1| hypothetical protein ARALYDRAFT_334271 [Arabidopsis lyrata subsp. 
lyrata]
Length=633

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 43/81 (53%), Positives = 60/81 (74%), Gaps = 1/81 (1%)
 Frame = +1

Query  85   FLVFKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMT  264
            F   ++R ND +A  P F++G+IG DN++ARHGIHGLYWLF+  V GS LV G NT+F+T
Sbjct  553  FSELQIRVNDANAS-PLFTSGLIGRDNSIARHGIHGLYWLFNVEVAGSKLVEGENTLFLT  611

Query  265  NGGAFTRWRGLLYDYIRFEGP  327
               + + ++G++YDYIRFE P
Sbjct  612  QPRSTSPFQGIMYDYIRFEAP  632



>ref|XP_008219222.1| PREDICTED: probable rhamnogalacturonate lyase B [Prunus mume]
Length=660

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 41/81 (51%), Positives = 55/81 (68%), Gaps = 3/81 (4%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMT---  264
             ++R ND  A+ P F+TG+IG DN + RHGIHGLYWL+S  +  + LV GNNT+F+T   
Sbjct  559  LQIRINDPQADTPLFTTGVIGKDNTILRHGIHGLYWLYSIDIPATLLVEGNNTLFLTQPI  618

Query  265  NGGAFTRWRGLLYDYIRFEGP  327
            +      + GL+YDYIR EGP
Sbjct  619  SNSPLAAFHGLMYDYIRLEGP  639



>ref|XP_010314591.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X2 [Solanum 
lycopersicum]
Length=543

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND   + P  STG IG DNA+ARH IHG+YWLF+  +RGS L+ G NTIF+T   
Sbjct  459  LQVRINDPTTDPPLLSTGEIGGDNAIARHAIHGIYWLFTVTIRGSLLLGGENTIFLTQAK  518

Query  274  AFTRWRGLLYDYIRFEGP  327
                ++G++YDYIR EGP
Sbjct  519  TANAFQGIMYDYIRLEGP  536



>ref|XP_008219218.1| PREDICTED: rhamnogalacturonate lyase B-like [Prunus mume]
Length=634

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND     PHFSTG+IG DN +ARHGIHGLY L++  V G  LV GNNTIF+T   
Sbjct  544  LQVRINDLRPSNPHFSTGLIGNDNTIARHGIHGLYRLYNVDVPGVQLVEGNNTIFLTRTW  603

Query  274  AFTRWRGLLYDYIRFEGPDQFK  339
            + + ++G++YDYIR EGP   K
Sbjct  604  STSPFQGIMYDYIRLEGPPSSK  625



>ref|XP_004252722.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Solanum 
lycopersicum]
Length=640

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND   + P  STG IG DNA+ARH IHG+YWLF+  +RGS L+ G NTIF+T   
Sbjct  556  LQVRINDPTTDPPLLSTGEIGGDNAIARHAIHGIYWLFTVTIRGSLLLGGENTIFLTQAK  615

Query  274  AFTRWRGLLYDYIRFEGP  327
                ++G++YDYIR EGP
Sbjct  616  TANAFQGIMYDYIRLEGP  633



>ref|XP_004133752.1| PREDICTED: probable rhamnogalacturonate lyase B-like [Cucumis 
sativus]
 ref|XP_004155216.1| PREDICTED: probable rhamnogalacturonate lyase B-like [Cucumis 
sativus]
Length=616

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R N++++E P FSTG IG DNA+ARHGIHGLYWL+S    G   + GNN+I++T   
Sbjct  536  LQVRLNNRESEQPGFSTGRIGKDNAIARHGIHGLYWLYSIPFPGDQFLQGNNSIYLTQAR  595

Query  274  AFTRWRGLLYDYIRFEGP  327
            + + + GL+YDYIR E P
Sbjct  596  SESPFEGLMYDYIRLEAP  613



>gb|KDO81266.1| hypothetical protein CISIN_1g042458mg [Citrus sinensis]
Length=649

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND     P FS+G+IG DN++ARHGIHGLYWLF+  V G+ LV G+NTIF     
Sbjct  557  LQVRINDPSTNRPLFSSGLIGRDNSIARHGIHGLYWLFNVDVPGARLVSGDNTIFFIQPR  616

Query  274  AFTRWRGLLYDYIRFEGP  327
            + + ++G++YDYIRFEGP
Sbjct  617  STSPFQGIMYDYIRFEGP  634



>ref|XP_002527352.1| lyase, putative [Ricinus communis]
 gb|EEF35024.1| lyase, putative [Ricinus communis]
Length=633

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND  A  P F+TG+IG DN++ARHGIHGLYWL++  V G+ LV G NTIF T   
Sbjct  554  LQVRVNDSKAVRPLFTTGLIGRDNSIARHGIHGLYWLYNVNVPGARLVEGENTIFFTQPR  613

Query  274  AFTRWRGLLYDYIRFEGP  327
                ++GL+YDYIR EGP
Sbjct  614  CTCPFQGLMYDYIRLEGP  631



>ref|XP_006433775.1| hypothetical protein CICLE_v10000543mg [Citrus clementina]
 gb|ESR47015.1| hypothetical protein CICLE_v10000543mg [Citrus clementina]
Length=649

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND     P FS+G+IG DN++ARHGIHGLYWLF+  V G+ LV G+NTIF     
Sbjct  557  LQVRINDPSTNRPLFSSGLIGRDNSIARHGIHGLYWLFNVDVPGARLVSGDNTIFFIQPR  616

Query  274  AFTRWRGLLYDYIRFEGP  327
            + + ++G++YDYIRFEGP
Sbjct  617  STSPFQGIMYDYIRFEGP  634



>gb|KGN56316.1| hypothetical protein Csa_3G115050 [Cucumis sativus]
Length=682

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R N++++E P FSTG IG DNA+ARHGIHGLYWL+S    G   + GNN+I++T   
Sbjct  602  LQVRLNNRESEQPGFSTGRIGKDNAIARHGIHGLYWLYSIPFPGDQFLQGNNSIYLTQAR  661

Query  274  AFTRWRGLLYDYIRFEGP  327
            + + + GL+YDYIR E P
Sbjct  662  SESPFEGLMYDYIRLEAP  679



>emb|CDX94934.1| BnaC05g07370D [Brassica napus]
Length=661

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 43/81 (53%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = +1

Query  85   FLVFKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMT  264
            F   ++R ND  A  P F++G+IG DN++ARHGIHGLYWLF+  V GS LV G NT+F+T
Sbjct  581  FAELQVRVNDATAS-PLFTSGLIGRDNSIARHGIHGLYWLFNVDVAGSKLVEGENTLFLT  639

Query  265  NGGAFTRWRGLLYDYIRFEGP  327
               + + ++G++YDYIRFE P
Sbjct  640  QPRSVSPFQGIMYDYIRFEAP  660



>ref|XP_002527229.1| lyase, putative [Ricinus communis]
 gb|EEF35155.1| lyase, putative [Ricinus communis]
Length=676

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 57/80 (71%), Gaps = 1/80 (1%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++RFND   + PHF+T +IG DNA+ARHGIHGLYWL+S  V GS L+  NNTI++T   
Sbjct  591  LQVRFNDPSKKRPHFTTKLIGRDNAIARHGIHGLYWLYSINVPGS-LLRQNNTIYLTQSR  649

Query  274  AFTRWRGLLYDYIRFEGPDQ  333
                +RG++YDYIR E P +
Sbjct  650  GSGPFRGVMYDYIRLEAPSE  669



>ref|XP_010458304.1| PREDICTED: probable rhamnogalacturonate lyase B [Camelina sativa]
Length=633

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 43/81 (53%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = +1

Query  85   FLVFKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMT  264
            F   ++R ND  A  P F++G+IG DN++ARHGIHGLYWLF+  V GS LV G NT+F+T
Sbjct  553  FSELQIRVNDATAS-PLFTSGLIGRDNSIARHGIHGLYWLFNVEVAGSKLVEGENTLFLT  611

Query  265  NGGAFTRWRGLLYDYIRFEGP  327
               + + ++G++YDYIRFE P
Sbjct  612  QPRSTSPFQGIMYDYIRFEAP  632



>ref|XP_007018291.1| Rhamnogalacturonate lyase family protein [Theobroma cacao]
 gb|EOY15516.1| Rhamnogalacturonate lyase family protein [Theobroma cacao]
Length=645

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND DA  P FS+G IG DN +ARHGIHGLYWL++  + G+ L  G+NTIF+T   
Sbjct  559  LQVRVNDPDAISPLFSSGQIGKDNTIARHGIHGLYWLYNVDIPGNLLHEGDNTIFLTQSK  618

Query  274  AFTRWRGLLYDYIRFEGP  327
            + + ++G++YDYIR EGP
Sbjct  619  STSPFQGIMYDYIRLEGP  636



>ref|XP_008781369.1| PREDICTED: probable rhamnogalacturonate lyase B [Phoenix dactylifera]
Length=646

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++ F++  A  PHF+  + G DNA+ARHGIHGLYWL++  ++ +WLV G+NTIF+T   
Sbjct  566  LQVHFSNLKANPPHFTAELNGKDNAIARHGIHGLYWLYNINIQNNWLVQGDNTIFLTQPN  625

Query  274  AFTRWRGLLYDYIRFEGP  327
            + + ++G++YDYIR EGP
Sbjct  626  SQSPFQGIMYDYIRMEGP  643



>gb|KFK43288.1| hypothetical protein AALP_AA1G104600 [Arabis alpina]
Length=633

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 61/82 (74%), Gaps = 1/82 (1%)
 Frame = +1

Query  85   FLVFKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMT  264
            +   ++R ND +A  P F++G+IG DN++ARHGIHGLYWLF+  V GS LV G+NT+F+T
Sbjct  553  YAELQIRLNDVNAS-PLFTSGLIGRDNSIARHGIHGLYWLFNVEVAGSKLVEGDNTMFLT  611

Query  265  NGGAFTRWRGLLYDYIRFEGPD  330
                 + ++G++YDYIRFE P+
Sbjct  612  QPRCTSPFQGIIYDYIRFEAPN  633



>ref|XP_010312902.1| PREDICTED: LOW QUALITY PROTEIN: probable rhamnogalacturonate 
lyase B [Solanum lycopersicum]
Length=572

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +1

Query  100  LRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGGAF  279
            L  ND+  + PHFSTG IG  NA+ARHGIHGLY+L+S  ++G  LV G NTIF+      
Sbjct  495  LIINDEKLQEPHFSTGNIGGSNAIARHGIHGLYFLYSIGIQGKLLVNGANTIFLIQSSGL  554

Query  280  TRWRGLLYDYIRFEGPDQ  333
            + + G++YDYIR EGP+Q
Sbjct  555  SPFEGIMYDYIRLEGPNQ  572



>gb|KDP41509.1| hypothetical protein JCGZ_15916 [Jatropha curcas]
Length=455

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND +A  P FSTG IG DN +ARHGIHGLY LF+  V G+ LV G NTIF+T   
Sbjct  371  LQVRINDVNASSPLFSTGNIGKDNTIARHGIHGLYRLFNVDVPGAHLVEGINTIFLTQTA  430

Query  274  AFTRWRGLLYDYIRFEGP  327
              + ++G++YDYIRFEGP
Sbjct  431  DQSPFQGIMYDYIRFEGP  448



>ref|XP_009397853.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=568

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 59/82 (72%), Gaps = 1/82 (1%)
 Frame = +1

Query  85   FLVFKLRFNDKDAELP-HFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFM  261
            F   ++RFN+   + P HF+T +IG DN++ARHGIHGLYWLFS  V  SWL+ G+N IF+
Sbjct  486  FSEIQVRFNNPIVQQPAHFTTELIGRDNSIARHGIHGLYWLFSIDVDSSWLLKGDNIIFL  545

Query  262  TNGGAFTRWRGLLYDYIRFEGP  327
            T   + + ++G++YDYIR E P
Sbjct  546  TQTRSESPFQGVMYDYIRLEAP  567



>ref|XP_007225136.1| hypothetical protein PRUPE_ppa002538mg [Prunus persica]
 gb|EMJ26335.1| hypothetical protein PRUPE_ppa002538mg [Prunus persica]
Length=660

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 41/81 (51%), Positives = 55/81 (68%), Gaps = 3/81 (4%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMT---  264
             ++R ND  A+ P F+TG+IG DN + RHGIHGLYWL+S  +  + LV GNNT+F+T   
Sbjct  559  LQIRINDPKADPPLFTTGVIGKDNTILRHGIHGLYWLYSIDIPATLLVEGNNTLFLTQPI  618

Query  265  NGGAFTRWRGLLYDYIRFEGP  327
            +      + GL+YDYIR EGP
Sbjct  619  SNSPLAAFHGLMYDYIRLEGP  639



>ref|XP_008781370.1| PREDICTED: probable rhamnogalacturonate lyase B [Phoenix dactylifera]
Length=657

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++ F++  A  PHF+  + G DNA+ARHGIHGLYWL++  ++ +WLV G+NTIF+T   
Sbjct  577  LQVHFSNLKANPPHFTAELNGKDNAIARHGIHGLYWLYNINIQNNWLVQGDNTIFLTQPN  636

Query  274  AFTRWRGLLYDYIRFEGP  327
            + + ++G++YDYIR EGP
Sbjct  637  SQSPFQGIMYDYIRMEGP  654



>emb|CDX94935.1| BnaC05g07360D [Brassica napus]
Length=697

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 55/81 (68%), Gaps = 0/81 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND   + P F+TG IG DN +ARHGIHGLYWL+S  V  S L  GNNTI++T   
Sbjct  613  LQVRVNDLSVDPPLFTTGEIGKDNTIARHGIHGLYWLYSVNVPASSLRHGNNTIYLTQPL  672

Query  274  AFTRWRGLLYDYIRFEGPDQF  336
            A + ++GL+YDYIR E PD  
Sbjct  673  AISPFQGLMYDYIRLECPDSI  693



>ref|XP_002319997.2| hypothetical protein POPTR_0014s01060g [Populus trichocarpa]
 gb|EEE98312.2| hypothetical protein POPTR_0014s01060g [Populus trichocarpa]
Length=625

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 58/85 (68%), Gaps = 0/85 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++RFND+ A+ PHF T +IG DNA+ARHGIHGLYW +S  V    L  GNNT+++T   
Sbjct  540  LQVRFNDRRAKRPHFRTRLIGRDNAIARHGIHGLYWFYSINVPSRLLRQGNNTVYLTQSR  599

Query  274  AFTRWRGLLYDYIRFEGPDQFKVSM  348
            + +   G++YDYIR EGP +   S+
Sbjct  600  SKSPVGGIMYDYIRLEGPPETGPSV  624



>emb|CDY65730.1| BnaCnng48490D [Brassica napus]
Length=668

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R N+   + P F+TG IG DN +ARHGIHGLYWL+S  V  S L PGNN+I++T   
Sbjct  584  LQVRVNNVSVDPPLFTTGQIGKDNTIARHGIHGLYWLYSVDVPASSLCPGNNSIYLTQPL  643

Query  274  AFTRWRGLLYDYIRFEGPD  330
            A + ++G +YDYIR E PD
Sbjct  644  AISPFQGFMYDYIRLEYPD  662



>ref|XP_010104584.1| hypothetical protein L484_025563 [Morus notabilis]
 gb|EXC01185.1| hypothetical protein L484_025563 [Morus notabilis]
Length=1193

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = +1

Query  94    FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
              ++R ND  AE P F+TG+IG DN +ARHGIHGLY LF+  V GS LV GNN IF+T   
Sbjct  1110  LQVRINDAKAERPLFTTGVIGNDNTIARHGIHGLYRLFNIDVPGSVLVEGNNKIFLTQAM  1169

Query  274   AFTRWRGLLYDYIRFEG  324
               + ++G++YDYIR EG
Sbjct  1170  CTSPFQGVMYDYIRLEG  1186


 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = +1

Query  85   FLVFKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMT  264
            F   ++R ND +A  P FSTG+IG DN +ARHGIHGLYWL++  + G+ L+ GNNTIF+T
Sbjct  469  FSELQVRINDPEAISPLFSTGVIGKDNTIARHGIHGLYWLYNIDIPGNRLLVGNNTIFLT  528

Query  265  NGGAFTRWRGLLYDYIRFEG  324
               + + ++G++YDYIR E 
Sbjct  529  RLNSTSPFQGIMYDYIRLEA  548



>ref|XP_006304407.1| hypothetical protein CARUB_v10010965mg [Capsella rubella]
 gb|EOA37305.1| hypothetical protein CARUB_v10010965mg [Capsella rubella]
Length=617

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = +1

Query  85   FLVFKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMT  264
            F   ++R ND  A  P F++G+IG DN++ARHGIHGLYWLF+  V GS LV G NT+F+T
Sbjct  537  FSELQIRVNDATAS-PLFTSGLIGRDNSIARHGIHGLYWLFNVEVAGSKLVEGENTLFLT  595

Query  265  NGGAFTRWRGLLYDYIRFEGP  327
               + + ++G++YDYIRFE P
Sbjct  596  QPRSTSPFQGIMYDYIRFEAP  616



>ref|XP_004238020.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Solanum 
lycopersicum]
Length=650

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 37/81 (46%), Positives = 55/81 (68%), Gaps = 0/81 (0%)
 Frame = +1

Query  85   FLVFKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMT  264
            F + ++R N+++A  PHFS+G+IG+DN +ARHG+HGLYWLF+  V    L  G N I++ 
Sbjct  563  FSILEVRVNEEEANPPHFSSGLIGSDNTIARHGVHGLYWLFNVEVAAGQLFQGENIIYLK  622

Query  265  NGGAFTRWRGLLYDYIRFEGP  327
               + +   G++YDYIR E P
Sbjct  623  QARSVSALHGIMYDYIRLEAP  643



>gb|KDP29301.1| hypothetical protein JCGZ_19404 [Jatropha curcas]
Length=613

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 40/77 (52%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = +1

Query  97   KLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGGA  276
            ++RFND +A+ P F+TG+IG DNA+ARHGIHG+YW ++  V    LV G NTI++T    
Sbjct  534  QVRFNDPNAKRPLFTTGLIGKDNAIARHGIHGIYWFYTIDVPNDVLVNGKNTIYLTQTRV  593

Query  277  FTRWRGLLYDYIRFEGP  327
               + G++YDYIR EGP
Sbjct  594  AAIFHGVMYDYIRLEGP  610



>ref|XP_010683375.1| PREDICTED: uncharacterized protein LOC104898066 [Beta vulgaris 
subsp. vulgaris]
Length=1381

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             +++FN K+  +PHFST +IG+DNA+ARHGIHGLY LF+  V   WL  GNNTI++    
Sbjct  602  LQVQFNHKELMIPHFSTKMIGSDNAIARHGIHGLYRLFNIDVPSEWLYDGNNTIYLKQSR  661

Query  274  AFTRWRGLLYDYIRFEGPDQFKV  342
              + + G++YDYIRFE P + K 
Sbjct  662  HDSPFYGVMYDYIRFEAPPRTKT  684


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 53/81 (65%), Gaps = 1/81 (1%)
 Frame = +1

Query  97    KLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGGA  276
             ++R N+ D+ +  FST ++G DNA+ARHGIHGLY L+S  + G+ L  G NTIF+     
Sbjct  1302  QVRVNNPDS-IAVFSTSLVGKDNAIARHGIHGLYQLYSIGIPGNLLKSGQNTIFLRQPRN  1360

Query  277   FTRWRGLLYDYIRFEGPDQFK  339
               ++ G +YDY+R EGP   K
Sbjct  1361  NGKFCGFMYDYVRLEGPASPK  1381



>ref|XP_006366427.1| PREDICTED: probable rhamnogalacturonate lyase B-like isoform 
X1 [Solanum tuberosum]
Length=640

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND  A+ P  STG IG DNA+ARH IHG+YWLF+  + GS L+ G NTIF+T   
Sbjct  556  LQVRINDPTADPPLLSTGEIGGDNAIARHAIHGIYWLFTVTIPGSLLLGGENTIFLTQAK  615

Query  274  AFTRWRGLLYDYIRFEGP  327
                ++G++YDYIR EGP
Sbjct  616  TANAFQGIMYDYIRLEGP  633



>ref|XP_009803162.1| PREDICTED: probable rhamnogalacturonate lyase B [Nicotiana sylvestris]
Length=662

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = +1

Query  91   VFKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNG  270
            + ++R N+ +A  PHFS+G+IG+DNA+ARHGIHGLYWLF+  V    L+ G N I++   
Sbjct  565  ILEVRVNEAEANPPHFSSGLIGSDNAIARHGIHGLYWLFNVEVAAGQLLQGENIIYLKQA  624

Query  271  GAFTRWRGLLYDYIRFEGP  327
             + +   G++YDYIR E P
Sbjct  625  WSVSALHGIMYDYIRLEAP  643



>ref|XP_009397844.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=618

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 59/82 (72%), Gaps = 1/82 (1%)
 Frame = +1

Query  85   FLVFKLRFNDKDAELP-HFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFM  261
            F   ++RFN+   + P HF+T +IG DN++ARHGIHGLYWLFS  V  SWL+ G+N IF+
Sbjct  536  FSEIQVRFNNPIVQQPAHFTTELIGRDNSIARHGIHGLYWLFSIDVDSSWLLKGDNIIFL  595

Query  262  TNGGAFTRWRGLLYDYIRFEGP  327
            T   + + ++G++YDYIR E P
Sbjct  596  TQTRSESPFQGVMYDYIRLEAP  617



>ref|XP_007225130.1| hypothetical protein PRUPE_ppa002544mg [Prunus persica]
 gb|EMJ26329.1| hypothetical protein PRUPE_ppa002544mg [Prunus persica]
Length=660

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 41/81 (51%), Positives = 55/81 (68%), Gaps = 3/81 (4%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMT---  264
             ++R ND  A+ P F+TG+IG DN + RHGIHGLYWL+S  +  + LV GNNT+F+T   
Sbjct  559  LQIRINDPKADPPLFTTGVIGKDNTILRHGIHGLYWLYSIGIPATLLVEGNNTLFLTQPI  618

Query  265  NGGAFTRWRGLLYDYIRFEGP  327
            +      + GL+YDYIR EGP
Sbjct  619  SNSPLAAFHGLMYDYIRLEGP  639



>ref|XP_007018289.1| Rhamnogalacturonate lyase family protein [Theobroma cacao]
 gb|EOY15514.1| Rhamnogalacturonate lyase family protein [Theobroma cacao]
Length=648

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R N+ DA  P F+TG+IG DN +ARHGIHGLY L+S  V+G+ L+ G NTIF+T   
Sbjct  562  LQVRINNPDANPPVFTTGVIGHDNTIARHGIHGLYRLYSIDVKGALLIEGENTIFLTQPM  621

Query  274  AFTRWRGLLYDYIRFEGP  327
              +  +GL+YDYIR E P
Sbjct  622  CSSALQGLMYDYIRLEAP  639



>ref|XP_009397836.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=624

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 59/82 (72%), Gaps = 1/82 (1%)
 Frame = +1

Query  85   FLVFKLRFNDKDAELP-HFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFM  261
            F   ++RFN+   + P HF+T +IG DN++ARHGIHGLYWLFS  V  SWL+ G+N IF+
Sbjct  542  FSEIQVRFNNPIVQQPAHFTTELIGRDNSIARHGIHGLYWLFSIDVDSSWLLKGDNIIFL  601

Query  262  TNGGAFTRWRGLLYDYIRFEGP  327
            T   + + ++G++YDYIR E P
Sbjct  602  TQTRSESPFQGVMYDYIRLEAP  623



>ref|XP_006417521.1| hypothetical protein EUTSA_v10007093mg [Eutrema salsugineum]
 gb|ESQ35874.1| hypothetical protein EUTSA_v10007093mg [Eutrema salsugineum]
Length=617

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 42/81 (52%), Positives = 58/81 (72%), Gaps = 1/81 (1%)
 Frame = +1

Query  85   FLVFKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMT  264
            F   ++R ND  A  P F++G+IG DN++ARHGIHGLYWLF+  V GS  V G+NT+F+T
Sbjct  537  FAELQIRVNDASAS-PLFTSGLIGRDNSIARHGIHGLYWLFNVEVAGSKFVEGDNTLFLT  595

Query  265  NGGAFTRWRGLLYDYIRFEGP  327
                 + ++G++YDYIRFE P
Sbjct  596  QPRCTSPFQGMMYDYIRFEAP  616



>ref|XP_011098532.1| PREDICTED: probable rhamnogalacturonate lyase B [Sesamum indicum]
Length=673

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND+    P FS+G+IG DN++ARHGIHGLYWL++  + G+ LV G+NTI++T   
Sbjct  594  LQVRVNDRTTNRPLFSSGLIGRDNSIARHGIHGLYWLYNIDIDGALLVQGDNTIYLTQPR  653

Query  274  AFTRWRGLLYDYIRFEGP  327
              + ++GL+YDYIR E P
Sbjct  654  CQSPFQGLMYDYIRLEAP  671



>ref|XP_010320230.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X2 [Solanum 
lycopersicum]
Length=621

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 37/81 (46%), Positives = 55/81 (68%), Gaps = 0/81 (0%)
 Frame = +1

Query  85   FLVFKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMT  264
            F + ++R N+++A  PHFS+G+IG+DN +ARHG+HGLYWLF+  V    L  G N I++ 
Sbjct  534  FSILEVRVNEEEANPPHFSSGLIGSDNTIARHGVHGLYWLFNVEVAAGQLFQGENIIYLK  593

Query  265  NGGAFTRWRGLLYDYIRFEGP  327
               + +   G++YDYIR E P
Sbjct  594  QARSVSALHGIMYDYIRLEAP  614



>ref|XP_006338131.1| PREDICTED: rhamnogalacturonate lyase B-like [Solanum tuberosum]
Length=650

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 36/79 (46%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = +1

Query  91   VFKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNG  270
            + ++R N+++A  PHFS+G+IG+DN +ARHG+HGLYWLF+  V    L+ G N I++   
Sbjct  565  ILEVRVNEEEANPPHFSSGLIGSDNTIARHGVHGLYWLFNVEVTAGQLLQGENIIYLKQA  624

Query  271  GAFTRWRGLLYDYIRFEGP  327
             + +   G++YDYIR E P
Sbjct  625  RSVSALNGIMYDYIRLEAP  643



>ref|XP_010312681.1| PREDICTED: probable rhamnogalacturonate lyase B [Solanum lycopersicum]
Length=680

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++RFND + + PH+STG+IG DNA+ARHGIHG+Y L++  V GS L  G N +++T   
Sbjct  598  LQVRFNDPEIDAPHYSTGLIGKDNAIARHGIHGIYRLYTINVPGSLLSFGTNILYLTQSR  657

Query  274  AFTRWRGLLYDYIRFEGP  327
                +RGL+YDYIR EGP
Sbjct  658  GDRPFRGLMYDYIRLEGP  675



>ref|XP_006417523.1| hypothetical protein EUTSA_v100070380mg, partial [Eutrema salsugineum]
 gb|ESQ35876.1| hypothetical protein EUTSA_v100070380mg, partial [Eutrema salsugineum]
Length=166

 Score = 87.8 bits (216),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 54/79 (68%), Gaps = 0/79 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND   + P F+TG IG DN +ARHGIHGLYWL+S  V  S    G+N+I++T   
Sbjct  80   LQVRVNDFSVDPPLFTTGQIGRDNTIARHGIHGLYWLYSVNVPASSFRQGDNSIYLTQPL  139

Query  274  AFTRWRGLLYDYIRFEGPD  330
            A + ++GL+YDYIR E PD
Sbjct  140  ATSPFQGLMYDYIRLECPD  158



>ref|XP_008466138.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X2 [Cucumis 
melo]
Length=540

 Score = 91.7 bits (226),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND  ++ P F++G+IG DN++ARHGIHG+YW++S  V G  LV G NTIF+T   
Sbjct  460  LQVRVNDPRSKRPLFTSGLIGRDNSIARHGIHGIYWVYSVSVAGCHLVEGENTIFLTQPR  519

Query  274  AFTRWRGLLYDYIRFEGP  327
              + ++G++YDYIR EGP
Sbjct  520  CTSPFQGIMYDYIRLEGP  537



>gb|KDO81265.1| hypothetical protein CISIN_1g037887mg, partial [Citrus sinensis]
Length=594

 Score = 92.0 bits (227),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 58/81 (72%), Gaps = 2/81 (2%)
 Frame = +1

Query  91   VFKLRF--NDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMT  264
            V +LR   N+     P FSTGIIG DN +ARHGIHGLY+L++  V GS L+ GNNTIF+T
Sbjct  512  VAQLRVGVNEPSKNPPLFSTGIIGKDNTIARHGIHGLYYLYNVSVPGSLLLKGNNTIFLT  571

Query  265  NGGAFTRWRGLLYDYIRFEGP  327
               + + ++G++YDYIR EGP
Sbjct  572  QTESISPFQGIMYDYIRLEGP  592



>ref|XP_010935276.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Elaeis 
guineensis]
 ref|XP_010935277.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Elaeis 
guineensis]
Length=662

 Score = 92.0 bits (227),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++RFND  A   HF+  + G DNA+ARHGIHGLYW ++  V+ +WLV G NTIF+T   
Sbjct  582  LQVRFNDLKANPAHFTAELNGRDNAIARHGIHGLYWFYNIDVQNTWLVQGANTIFLTQAN  641

Query  274  AFTRWRGLLYDYIRFEGP  327
            +   ++G++YDYIR EGP
Sbjct  642  SQGPFQGVMYDYIRMEGP  659



>ref|XP_010935278.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X2 [Elaeis 
guineensis]
 ref|XP_010935279.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X2 [Elaeis 
guineensis]
Length=590

 Score = 92.0 bits (227),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++RFND  A   HF+  + G DNA+ARHGIHGLYW ++  V+ +WLV G NTIF+T   
Sbjct  510  LQVRFNDLKANPAHFTAELNGRDNAIARHGIHGLYWFYNIDVQNTWLVQGANTIFLTQAN  569

Query  274  AFTRWRGLLYDYIRFEGP  327
            +   ++G++YDYIR EGP
Sbjct  570  SQGPFQGVMYDYIRMEGP  587



>ref|XP_008466137.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Cucumis 
melo]
Length=634

 Score = 92.0 bits (227),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND  ++ P F++G+IG DN++ARHGIHG+YW++S  V G  LV G NTIF+T   
Sbjct  554  LQVRVNDPRSKRPLFTSGLIGRDNSIARHGIHGIYWVYSVSVAGCHLVEGENTIFLTQPR  613

Query  274  AFTRWRGLLYDYIRFEGP  327
              + ++G++YDYIR EGP
Sbjct  614  CTSPFQGIMYDYIRLEGP  631



>ref|XP_009148296.1| PREDICTED: probable rhamnogalacturonate lyase B [Brassica rapa]
 ref|XP_009148297.1| PREDICTED: probable rhamnogalacturonate lyase B [Brassica rapa]
 ref|XP_009148298.1| PREDICTED: probable rhamnogalacturonate lyase B [Brassica rapa]
 ref|XP_009148299.1| PREDICTED: probable rhamnogalacturonate lyase B [Brassica rapa]
Length=694

 Score = 92.0 bits (227),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 55/81 (68%), Gaps = 0/81 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND   + P F+TG IG DN +ARHGIHGLYWL+S  V  S L  GNNTI++T   
Sbjct  610  LQVRVNDVSKDPPLFTTGEIGKDNTIARHGIHGLYWLYSVNVPASSLRNGNNTIYLTQPL  669

Query  274  AFTRWRGLLYDYIRFEGPDQF  336
            A + ++GL+YDYIR E PD  
Sbjct  670  ARSPFQGLMYDYIRLECPDSI  690



>ref|XP_008389040.1| PREDICTED: probable rhamnogalacturonate lyase B [Malus domestica]
Length=679

 Score = 92.0 bits (227),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 58/81 (72%), Gaps = 1/81 (1%)
 Frame = +1

Query  85   FLVFKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMT  264
            +   ++RFN+++ + PHFSTG+IG DNA+ARHGIHGLYWLFS  V    L  G NTI++T
Sbjct  597  YAELQVRFNNQN-DTPHFSTGLIGRDNAIARHGIHGLYWLFSVDVPSYRLQZGYNTIYLT  655

Query  265  NGGAFTRWRGLLYDYIRFEGP  327
                +  + GL+YDYIR EGP
Sbjct  656  QSRTWGPFAGLMYDYIRLEGP  676



>ref|XP_002527245.1| lyase, putative [Ricinus communis]
 gb|EEF35171.1| lyase, putative [Ricinus communis]
Length=621

 Score = 91.7 bits (226),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = +1

Query  100  LRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGGAF  279
            +RFND  +  P F+TG+IGTDNA+ARHGIHGLYWLF+  V    L  G N I++T     
Sbjct  543  VRFNDPSSNRPLFTTGLIGTDNAIARHGIHGLYWLFTINVPSDQLRDGKNIIYLTQARND  602

Query  280  TRWRGLLYDYIRFEGPDQ  333
              +RG++YDYIR EGP +
Sbjct  603  GPFRGVMYDYIRLEGPAE  620



>emb|CDX93467.1| BnaA06g05810D [Brassica napus]
Length=699

 Score = 92.0 bits (227),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND   + P F+TG IG DN +ARHGIHGLYWL+S  V  S L  GNNTI++T   
Sbjct  615  LQVRVNDVSKDPPLFTTGEIGKDNTIARHGIHGLYWLYSVNVPASSLRNGNNTIYLTQPL  674

Query  274  AFTRWRGLLYDYIRFEGPD  330
            A + ++GL+YDYIR E PD
Sbjct  675  ARSPFQGLMYDYIRLECPD  693



>ref|XP_011003640.1| PREDICTED: rhamnogalacturonate lyase B-like [Populus euphratica]
Length=697

 Score = 92.0 bits (227),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND +A+ P F++G+IG DNA+ARHGIHGLY L++  + G+ LV G NTIF+T   
Sbjct  606  LQVRVNDANAQRPLFTSGLIGRDNAIARHGIHGLYRLYNVNIPGARLVEGENTIFLTQPR  665

Query  274  AFTRWRGLLYDYIRFEGP  327
              + ++GL+YDYIR EGP
Sbjct  666  CTSPFQGLMYDYIRLEGP  683



>ref|XP_006433776.1| hypothetical protein CICLE_v10003807mg [Citrus clementina]
 gb|ESR47016.1| hypothetical protein CICLE_v10003807mg [Citrus clementina]
Length=650

 Score = 92.0 bits (227),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 58/81 (72%), Gaps = 2/81 (2%)
 Frame = +1

Query  91   VFKLRF--NDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMT  264
            V +LR   N+     P FSTGIIG DN +ARHGIHGLY+L++  V GS L+ GNNTIF+T
Sbjct  568  VAQLRVGVNEPSKNPPLFSTGIIGKDNTIARHGIHGLYYLYNVSVPGSLLLKGNNTIFLT  627

Query  265  NGGAFTRWRGLLYDYIRFEGP  327
               + + ++G++YDYIR EGP
Sbjct  628  QTESISPFQGIMYDYIRLEGP  648



>ref|XP_008338981.1| PREDICTED: rhamnogalacturonate lyase B-like [Malus domestica]
Length=698

 Score = 92.0 bits (227),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND +A  P FSTG IG DN +ARHGIHGLY L++  + G+ L+ GNNTIF+T   
Sbjct  605  LQVRINDLEASNPLFSTGQIGNDNTIARHGIHGLYRLYTVDIPGAQLLEGNNTIFLTRAL  664

Query  274  AFTRWRGLLYDYIRFEGP  327
            + + ++G++YDYIR EGP
Sbjct  665  SISPFQGIMYDYIRLEGP  682



>gb|AET03356.2| rhamnogalacturonate lyase B-like protein [Medicago truncatula]
Length=685

 Score = 91.7 bits (226),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++RFND+  + PHF+TG IG DNA+ARHGIHGLY LFS  V  + LV G N I++    
Sbjct  605  LQVRFNDRSKDPPHFATGRIGRDNAIARHGIHGLYRLFSINVSSNLLVKGKNIIYLRQSK  664

Query  274  AFTRWRGLLYDYIRFEGP  327
            A T ++G++YDYIR E P
Sbjct  665  ADTPFQGVMYDYIRLERP  682



>ref|XP_006587583.1| PREDICTED: probable rhamnogalacturonate lyase B-like [Glycine 
max]
Length=567

 Score = 91.3 bits (225),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++RFND +A+LPHFSTG+ G DNA+ARHGIHGLY L +  V  + LV G NTI++T   
Sbjct  485  LEVRFNDLNAKLPHFSTGLKGDDNAIARHGIHGLYRLHTIAVGSNHLVNGKNTIYLTQSK  544

Query  274  AFTRWRGLLYDYIRFEGP  327
              + + G++YDY+R E P
Sbjct  545  GISPFMGVMYDYVRLESP  562



>ref|XP_003628880.1| Rhamnogalacturonate lyase [Medicago truncatula]
Length=688

 Score = 91.7 bits (226),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++RFND+  + PHF+TG IG DNA+ARHGIHGLY LFS  V  + LV G N I++    
Sbjct  608  LQVRFNDRSKDPPHFATGRIGRDNAIARHGIHGLYRLFSINVSSNLLVKGKNIIYLRQSK  667

Query  274  AFTRWRGLLYDYIRFEGP  327
            A T ++G++YDYIR E P
Sbjct  668  ADTPFQGVMYDYIRLERP  685



>ref|XP_007221968.1| hypothetical protein PRUPE_ppa002258mg [Prunus persica]
 gb|EMJ23167.1| hypothetical protein PRUPE_ppa002258mg [Prunus persica]
Length=695

 Score = 91.7 bits (226),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND     PHFSTG IG DN +ARHGIHGLY L++  V G  LV GNNTIF+T   
Sbjct  605  LQVRINDLRPSNPHFSTGPIGNDNTIARHGIHGLYRLYNVDVPGVQLVEGNNTIFLTRTL  664

Query  274  AFTRWRGLLYDYIRFEGP  327
            + + ++G++YDYIR EGP
Sbjct  665  STSPFQGIMYDYIRLEGP  682



>ref|XP_011100169.1| PREDICTED: probable rhamnogalacturonate lyase B [Sesamum indicum]
Length=679

 Score = 91.7 bits (226),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++RFND    LPHF+TG IG DN +ARHGIHG+Y  +S  + GSWL  G NTIF+T   
Sbjct  602  LQVRFNDPKT-LPHFTTGPIGKDNTLARHGIHGVYHFYSIGIAGSWLATGMNTIFLTQAS  660

Query  274  AFTRWRGLLYDYIRFEGP  327
            +   +R ++YDYIRFEGP
Sbjct  661  SRGLFREVMYDYIRFEGP  678



>gb|KDP41510.1| hypothetical protein JCGZ_15917 [Jatropha curcas]
Length=694

 Score = 91.7 bits (226),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND +A  P FSTG IG DN +ARHGIHGLY LF+  V G+ LV G NTIF+T   
Sbjct  610  LQVRINDVNASSPLFSTGRIGKDNTIARHGIHGLYRLFNVDVPGAHLVEGINTIFLTQTA  669

Query  274  AFTRWRGLLYDYIRFEGP  327
              + ++G++YDYIRFEGP
Sbjct  670  DQSPFQGIMYDYIRFEGP  687



>ref|XP_008389039.1| PREDICTED: probable rhamnogalacturonate lyase B [Malus domestica]
Length=675

 Score = 91.7 bits (226),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 58/81 (72%), Gaps = 1/81 (1%)
 Frame = +1

Query  85   FLVFKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMT  264
            +   ++RFN+++ + PHFSTG+IG DNA+ARHGIHGLYWLFS  V    L  G NTI++T
Sbjct  593  YAELQVRFNNRN-DAPHFSTGLIGKDNAIARHGIHGLYWLFSVDVPSYRLQQGYNTIYLT  651

Query  265  NGGAFTRWRGLLYDYIRFEGP  327
                +  + GL+YDYIR EGP
Sbjct  652  QSRNWGPFAGLMYDYIRLEGP  672



>ref|XP_008450226.1| PREDICTED: probable rhamnogalacturonate lyase B [Cucumis melo]
Length=447

 Score = 90.1 bits (222),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R N++++E   FSTG IG DNA+ARHGIHGLYWL+S    G   + GNN+I++T   
Sbjct  367  LQVRLNNRESEQSAFSTGRIGKDNAIARHGIHGLYWLYSIPFPGDQFLQGNNSIYLTQAR  426

Query  274  AFTRWRGLLYDYIRFEGP  327
            + + + GL+YDYIR E P
Sbjct  427  SESPFEGLMYDYIRLEAP  444



>gb|KEH20099.1| rhamnogalacturonate lyase B-like protein [Medicago truncatula]
Length=693

 Score = 91.7 bits (226),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +1

Query  97   KLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGGA  276
            ++RFND     PHF+TG+IG DNA+ARHGIHGL+WLFS  V    LV G N +++    A
Sbjct  613  QVRFNDPSIYPPHFATGLIGGDNAIARHGIHGLHWLFSIDVPSDLLVKGKNIVYLRQSKA  672

Query  277  FTRWRGLLYDYIRFEGP  327
             + ++G++YDYIR E P
Sbjct  673  LSPFQGVMYDYIRLERP  689



>ref|XP_006338026.1| PREDICTED: probable rhamnogalacturonate lyase B-like [Solanum 
tuberosum]
Length=623

 Score = 91.3 bits (225),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 58/79 (73%), Gaps = 1/79 (1%)
 Frame = +1

Query  94   FKLRFNDKDA-ELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNG  270
             ++R ND  +   P FS+G+IG DNA+ARHGIHGL WLF+  ++G+ L+ G NTI++T  
Sbjct  541  LQVRVNDSSSMNTPLFSSGVIGKDNAIARHGIHGLNWLFNVNLQGTILIEGENTIYLTQA  600

Query  271  GAFTRWRGLLYDYIRFEGP  327
             A + ++G++YDYIR EGP
Sbjct  601  NATSPFQGIMYDYIRLEGP  619



>ref|XP_003628875.1| Rhamnogalacturonate lyase [Medicago truncatula]
 gb|AET03351.1| rhamnogalacturonate lyase B-like protein [Medicago truncatula]
Length=684

 Score = 91.7 bits (226),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +1

Query  97   KLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGGA  276
            ++RFND     PHF+TG+IG DNA+ARHGIHGL+WLFS  V    LV G N +++    A
Sbjct  604  QVRFNDPSIYPPHFATGLIGGDNAIARHGIHGLHWLFSIDVPSDLLVKGKNIVYLRQSKA  663

Query  277  FTRWRGLLYDYIRFEGP  327
             + ++G++YDYIR E P
Sbjct  664  LSPFQGVMYDYIRLERP  680



>ref|XP_002306520.2| hypothetical protein POPTR_0005s19450g [Populus trichocarpa]
 gb|EEE93516.2| hypothetical protein POPTR_0005s19450g [Populus trichocarpa]
Length=697

 Score = 91.7 bits (226),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND  A+ P F++G+IG DNA+ARHGIHGLY L++  + G+ LV G NTIF+T   
Sbjct  606  LQVRVNDAKAQRPLFTSGLIGRDNAIARHGIHGLYRLYNVNIPGARLVEGENTIFLTQPR  665

Query  274  AFTRWRGLLYDYIRFEGP  327
              + ++GL+YDYIR EGP
Sbjct  666  CTSPFQGLMYDYIRLEGP  683



>gb|EYU45812.1| hypothetical protein MIMGU_mgv1a0225581mg, partial [Erythranthe 
guttata]
Length=379

 Score = 89.4 bits (220),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 55/81 (68%), Gaps = 0/81 (0%)
 Frame = +1

Query  85   FLVFKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMT  264
            F   ++R ND DA  PHF+TG IG DNA+ARHGIHG Y L++  + G  L+ G NTI++ 
Sbjct  294  FAEIQVRINDPDARNPHFTTGRIGRDNAIARHGIHGQYLLYNVDLLGFQLINGKNTIYLK  353

Query  265  NGGAFTRWRGLLYDYIRFEGP  327
               A + + G+LYDYIR EGP
Sbjct  354  QARASSPFNGVLYDYIRLEGP  374



>gb|KHN38895.1| Rhamnogalacturonate lyase [Glycine soja]
Length=667

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++RFND +A+LPHFSTG+ G DNA+ARHGIHGLY L +  V  + LV G NTI++T   
Sbjct  585  LEVRFNDLNAKLPHFSTGLKGDDNAIARHGIHGLYRLHTIAVGSNHLVNGKNTIYLTQSK  644

Query  274  AFTRWRGLLYDYIRFEGP  327
              + + G++YDY+R E P
Sbjct  645  GISPFMGVMYDYVRLESP  662



>ref|XP_010255178.1| PREDICTED: probable rhamnogalacturonate lyase B [Nelumbo nucifera]
Length=627

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +1

Query  97   KLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVP-GNNTIFMTNGG  273
            ++RFN  +   PHF+T +IG DNA+ARHGIHGLY LF+  VR  WLV  GNNTIF+T   
Sbjct  541  QVRFNKPNLRRPHFTTKLIGRDNAIARHGIHGLYRLFNITVRSEWLVIGGNNTIFLTQSR  600

Query  274  AFTRWRGLLYDYIRFEGP  327
              + + G++YDYIR EGP
Sbjct  601  HLSPFFGVMYDYIRLEGP  618



>ref|NP_172460.6| rhamnogalacturonate lyase-like protein [Arabidopsis thaliana]
 gb|AEE28511.1| rhamnogalacturonate lyase-like protein [Arabidopsis thaliana]
Length=617

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 41/81 (51%), Positives = 60/81 (74%), Gaps = 1/81 (1%)
 Frame = +1

Query  85   FLVFKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMT  264
            F   ++R N+ +A  P F++G+IG DN++ARHGIHGLYWLF+  V GS L+ G NT+F+T
Sbjct  537  FSELQIRVNNANAS-PMFTSGLIGRDNSIARHGIHGLYWLFNVEVAGSKLLEGENTLFLT  595

Query  265  NGGAFTRWRGLLYDYIRFEGP  327
               + + ++G++YDYIRFE P
Sbjct  596  QPRSTSPFQGIMYDYIRFEAP  616



>ref|XP_004288871.1| PREDICTED: probable rhamnogalacturonate lyase B-like [Fragaria 
vesca subsp. vesca]
Length=624

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND +A+ P F+TG+IG DNA+ RHGIHGLY L+S  V G+ L  G+NT+F+T   
Sbjct  541  LQIRVNDSNADTPLFTTGVIGHDNAICRHGIHGLYRLYSINVPGTLLAKGDNTVFLTQAM  600

Query  274  AFTRWRGLLYDYIRFEGP  327
            + + + G++YDYIR E P
Sbjct  601  STSPFVGIMYDYIRLEAP  618



>gb|KDO40182.1| hypothetical protein CISIN_1g0067412mg, partial [Citrus sinensis]
Length=435

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = +1

Query  100  LRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGGAF  279
            +RFN+ +A+ PHF+TG IG DNA+ARHGIHGLY L+S  V    L  G NTI++T   + 
Sbjct  357  VRFNNPNADPPHFATGTIGKDNAIARHGIHGLYRLYSIDVPSVLLNRGRNTIYLTQSRSR  416

Query  280  TRWRGLLYDYIRFEGPDQ  333
            + ++G+LYDYIR EGP +
Sbjct  417  SPFQGVLYDYIRLEGPPK  434



>ref|XP_011019318.1| PREDICTED: rhamnogalacturonate lyase B-like [Populus euphratica]
Length=674

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++RFN   ++ P F+TG +G DNA+ARHGIHGLYWL+   V GS LV G NTI++T   
Sbjct  594  IQVRFNYPSSDRPLFTTGAVGKDNAIARHGIHGLYWLYGIDVPGSQLVEGKNTIYLTQAR  653

Query  274  AFTRWRGLLYDYIRFEGP  327
            +   + G++YDYIR EGP
Sbjct  654  SDGPFHGVMYDYIRLEGP  671



>ref|XP_009406080.1| PREDICTED: probable rhamnogalacturonate lyase B [Musa acuminata 
subsp. malaccensis]
Length=639

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++RFN+   +  HF+T +IG DN++AR GIHGLYWLFS  V  SWL+ G+N IF+T   
Sbjct  550  LQVRFNNPRVQPAHFTTRLIGRDNSIARQGIHGLYWLFSVDVESSWLLEGDNIIFLTQTR  609

Query  274  AFTRWRGLLYDYIRFEGP  327
              + ++G++YDYIR E P
Sbjct  610  CQSPFQGVMYDYIRMEAP  627



>gb|KHN08234.1| Rhamnogalacturonate lyase [Glycine soja]
Length=653

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R N+ +A  P FS+G+IG +N +ARHGIHGLYWLFS  ++G+ LV GNNTIF+T   
Sbjct  575  LEIRINNLEANPPLFSSGVIGKENTIARHGIHGLYWLFSIHIQGTLLVQGNNTIFLTQTR  634

Query  274  AFTRWRGLLYDYIRFE  321
              + + G++YDYIR E
Sbjct  635  DTSPFIGIMYDYIRLE  650



>ref|XP_011011722.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Populus 
euphratica]
Length=675

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND+ A+ PHF T +IG DNA+ARHGIHGLYW +S  V    L  GNNT+++T   
Sbjct  590  LQVRLNDRRAKRPHFRTRLIGRDNAIARHGIHGLYWFYSINVPSRLLRQGNNTVYLTQSR  649

Query  274  AFTRWRGLLYDYIRFEGPDQ  333
            + +   G++YDYIR EGP +
Sbjct  650  SKSPVGGIMYDYIRLEGPPE  669



>ref|XP_008219219.1| PREDICTED: probable rhamnogalacturonate lyase B [Prunus mume]
Length=668

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 63/109 (58%), Gaps = 7/109 (6%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMT---  264
             ++R ND  A+ P F+TG+IG DN + RHGIHGLYWL+S  +  + LV GNN +F+T   
Sbjct  560  LQIRINDPKADPPLFTTGVIGKDNTILRHGIHGLYWLYSIDIPATLLVEGNNILFLTQPI  619

Query  265  NGGAFTRWRGLLYDYIRFEGPDQFKVSM*YVTIIPPGMMLHTTT*ISNI  411
            +      + GL+YDYIR EGP     S      + P  M   T  ISN+
Sbjct  620  SNSPLAAFHGLMYDYIRLEGP----PSSTSTRRVKPANMAPNTKRISNV  664



>ref|XP_009366369.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X3 [Pyrus 
x bretschneideri]
Length=639

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = +1

Query  85   FLVFKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMT  264
            F   ++R ND  A  P F++G+IG DN++ARHGIHGLYWL++  V  S LV G+N I++T
Sbjct  553  FSELQVRVNDPKANRPLFTSGMIGRDNSIARHGIHGLYWLYNVDVPSSRLVEGDNIIYLT  612

Query  265  NGGAFTRWRGLLYDYIRFEGP  327
               +   ++G++YDY+RFEGP
Sbjct  613  QPRSTGPFQGIMYDYLRFEGP  633



>gb|KHG04596.1| Rhamnogalacturonate lyase [Gossypium arboreum]
Length=680

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 54/81 (67%), Gaps = 0/81 (0%)
 Frame = +1

Query  85   FLVFKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMT  264
            +   ++R N+ DA LPHF+T  IG DNAV RHGIHGLY L+S  V G+    GNNTIF+T
Sbjct  598  YAEVQVRINNPDANLPHFTTERIGYDNAVPRHGIHGLYRLYSINVPGNRFQRGNNTIFLT  657

Query  265  NGGAFTRWRGLLYDYIRFEGP  327
                   +  ++YDYIRFEGP
Sbjct  658  QTRCHDSFEAVMYDYIRFEGP  678



>ref|XP_009346851.1| PREDICTED: rhamnogalacturonate lyase B-like [Pyrus x bretschneideri]
Length=683

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 58/81 (72%), Gaps = 1/81 (1%)
 Frame = +1

Query  85   FLVFKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMT  264
            +   ++RFN+++ + PHFSTG+IG DNA+ARHGIHGLYWLFS  V    L  G NTI++T
Sbjct  601  YAELQVRFNNQN-DAPHFSTGLIGKDNAIARHGIHGLYWLFSVDVPSYRLHKGYNTIYLT  659

Query  265  NGGAFTRWRGLLYDYIRFEGP  327
                +  + GL+YDYIR EGP
Sbjct  660  QSRNWGPFAGLMYDYIRLEGP  680



>ref|XP_003522745.2| PREDICTED: rhamnogalacturonate lyase B-like [Glycine max]
Length=705

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R N+ +A  P FS+G+IG +N +ARHGIHGLYWLFS  ++G+ LV GNNTIF+T   
Sbjct  627  LEIRINNLEANPPLFSSGVIGKENTIARHGIHGLYWLFSIHIQGTLLVQGNNTIFLTQTR  686

Query  274  AFTRWRGLLYDYIRFE  321
              + + G++YDYIR E
Sbjct  687  DTSPFIGIMYDYIRLE  702



>ref|XP_010104583.1| hypothetical protein L484_025562 [Morus notabilis]
 gb|EXC01184.1| hypothetical protein L484_025562 [Morus notabilis]
Length=1156

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 60/81 (74%), Gaps = 0/81 (0%)
 Frame = +1

Query  85    FLVFKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMT  264
             F   ++R ND  A  P F++G+IG DN++ARHGIHGLY L++  ++G+ LV G+NTIF+T
Sbjct  1070  FSELQVRVNDPKANPPLFTSGLIGRDNSIARHGIHGLYRLYNVNIKGTRLVGGDNTIFLT  1129

Query  265   NGGAFTRWRGLLYDYIRFEGP  327
                + + ++G++YDYIR EGP
Sbjct  1130  QPRSSSPFQGIMYDYIRLEGP  1150


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND     P F+TG+IG DN+VARHGIHGLYWL S  + G  LV G+NT+F+T   
Sbjct  451  LQVRVNDPKTRRPLFTTGLIGRDNSVARHGIHGLYWLHSINIPGDKLVEGDNTLFLTQPR  510

Query  274  AFTRWRGLL  300
              + ++G++
Sbjct  511  CTSPFQGIM  519



>ref|XP_004509710.1| PREDICTED: probable rhamnogalacturonate lyase B-like [Cicer arietinum]
Length=674

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +1

Query  97   KLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGGA  276
            ++RFND     PHF+TG IG DNA+ARHGIHGL+WLFS  V  + LV G N I++    A
Sbjct  595  QVRFNDPSVYPPHFATGHIGGDNAIARHGIHGLHWLFSIDVPSNLLVKGKNIIYLRQSRA  654

Query  277  FTRWRGLLYDYIRFEGP  327
              +++G++YDYIR E P
Sbjct  655  INQFQGVMYDYIRLERP  671



>ref|XP_006466349.1| PREDICTED: rhamnogalacturonate lyase B-like [Citrus sinensis]
Length=616

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = +1

Query  100  LRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGGAF  279
            +RFN+ +A+ PHF+TG IG DNA+ARHGIHGLY L+S  V    L  G NTI++T   + 
Sbjct  538  VRFNNPNADPPHFATGTIGKDNAIARHGIHGLYRLYSIDVPSVLLNGGKNTIYLTQSRSR  597

Query  280  TRWRGLLYDYIRFEGPDQ  333
            + ++G+LYDYIR EGP +
Sbjct  598  SPFQGVLYDYIRLEGPPK  615



>ref|XP_006426234.1| hypothetical protein CICLE_v10025074mg [Citrus clementina]
 gb|ESR39474.1| hypothetical protein CICLE_v10025074mg [Citrus clementina]
Length=670

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +1

Query  100  LRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGGAF  279
            +RFN+ +A+ PHF+TG IG DNA+ARHGIHGLY L+S  V    L  G NTI++T   + 
Sbjct  592  VRFNNPNADPPHFATGTIGKDNAIARHGIHGLYRLYSIDVPSVLLNRGRNTIYLTQSRSR  651

Query  280  TRWRGLLYDYIRFEGP  327
            + ++G+LYDYIR EGP
Sbjct  652  SPFQGVLYDYIRLEGP  667



>ref|XP_003519207.1| PREDICTED: rhamnogalacturonate lyase B-like [Glycine max]
Length=651

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 55/84 (65%), Gaps = 3/84 (4%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTN--  267
             ++R ND   + P F+TG+IG DNA+ARHGIHGLYWLFS  V G  L    N IF+T   
Sbjct  562  LQVRVNDPKQDPPLFTTGVIGKDNAIARHGIHGLYWLFSIDVPGLLLEKSVNIIFLTQTM  621

Query  268  -GGAFTRWRGLLYDYIRFEGPDQF  336
              G    ++G++YDYIR EGP+ F
Sbjct  622  ASGPLALFQGIMYDYIRLEGPNPF  645



>gb|KDP37921.1| hypothetical protein JCGZ_05360 [Jatropha curcas]
Length=352

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++RFND  A+ PHF+TG IG DNA+ARHGIHG+Y  ++  V    LV G NTI++T   
Sbjct  272  IQVRFNDPSAKRPHFTTGRIGKDNAIARHGIHGIYRFYTVDVPNDVLVDGKNTIYLTQTR  331

Query  274  AFTRWRGLLYDYIRFEGP  327
                ++G++YDYIR EGP
Sbjct  332  ITAIFQGVMYDYIRLEGP  349



>ref|XP_004287322.1| PREDICTED: rhamnogalacturonate lyase-like isoform 1 [Fragaria 
vesca subsp. vesca]
Length=676

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 40/80 (50%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R N+ +A+ P FSTG+IG DNA+ARHGIHGLYW +S ++  + L  G+NTI++T   
Sbjct  595  LEVRVNNANAKPPLFSTGLIGDDNAIARHGIHGLYWFWSIKIPSTSLHKGSNTIYLTQTR  654

Query  274  AFTRWRGLLYDYIRFEGPDQ  333
              T  +G++YDYIR EGP +
Sbjct  655  GGTPLQGVMYDYIRLEGPAE  674



>ref|XP_002527356.1| lyase, putative [Ricinus communis]
 gb|EEF35028.1| lyase, putative [Ricinus communis]
Length=755

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND++A+   FSTG  G DN +ARHGIHGLY LF+  V G+ L+ GNNTIF+T   
Sbjct  669  LQVRVNDRNADSSLFSTGKFGKDNTIARHGIHGLYRLFNVDVPGTQLLEGNNTIFLTQAN  728

Query  274  AFTRWRGLLYDYIRFEGP  327
              + ++G++YDYIR EGP
Sbjct  729  HVSPFQGIMYDYIRLEGP  746



>ref|XP_009618923.1| PREDICTED: LOW QUALITY PROTEIN: probable rhamnogalacturonate 
lyase B [Nicotiana tomentosiformis]
Length=733

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 57/82 (70%), Gaps = 2/82 (2%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTD--NAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTN  267
             +++FND D + PH++TG+IG D  NA+ARHGIHGLY L++  V GS LV G N + +  
Sbjct  147  LQVQFNDPDTDAPHYTTGLIGKDKDNAIARHGIHGLYRLYTINVPGSLLVFGTNVMHLKQ  206

Query  268  GGAFTRWRGLLYDYIRFEGPDQ  333
              +   WRG++YDYIR EGP +
Sbjct  207  NRSEMPWRGIMYDYIRLEGPPE  228


 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 44/80 (55%), Gaps = 0/80 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++  N      P F T  IG  NA+ARHGIHGLY  F  +  G+ L  G N I++    
Sbjct  654  LQVWINTPSKPRPWFDTLQIGQSNAIARHGIHGLYMTFDIQFPGNILQIGENIIYLKQAS  713

Query  274  AFTRWRGLLYDYIRFEGPDQ  333
            A   + GL+YDYIR EGP Q
Sbjct  714  ANGPFNGLMYDYIRLEGPPQ  733



>gb|KHN26157.1| Rhamnogalacturonate lyase [Glycine soja]
Length=635

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 55/84 (65%), Gaps = 3/84 (4%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTN--  267
             ++R ND   + P F+TG+IG DNA+ARHGIHGLYWLFS  V G  L    N IF+T   
Sbjct  546  LQVRVNDPKQDPPLFTTGVIGKDNAIARHGIHGLYWLFSIDVPGLLLEKSVNIIFLTQTM  605

Query  268  -GGAFTRWRGLLYDYIRFEGPDQF  336
              G    ++G++YDYIR EGP+ F
Sbjct  606  ASGPLALFQGIMYDYIRLEGPNPF  629



>ref|XP_006433777.1| hypothetical protein CICLE_v10003131mg [Citrus clementina]
 gb|ESR47017.1| hypothetical protein CICLE_v10003131mg [Citrus clementina]
Length=635

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 57/80 (71%), Gaps = 1/80 (1%)
 Frame = +1

Query  91   VFKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPG-NNTIFMTN  267
            V ++R ND   E P FSTG IG +N +ARHGI+GLYWLF+  V G+  V G NNTI++T 
Sbjct  545  VLQVRINDPSTEPPLFSTGQIGKENTIARHGIYGLYWLFNVDVPGALFVKGNNNTIYLTQ  604

Query  268  GGAFTRWRGLLYDYIRFEGP  327
              + + +RG++YDYIR EGP
Sbjct  605  ALSGSPFRGVMYDYIRLEGP  624



>ref|XP_004287323.1| PREDICTED: rhamnogalacturonate lyase-like isoform 2 [Fragaria 
vesca subsp. vesca]
Length=654

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +1

Query  85   FLVFKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMT  264
            +   ++R N+ +A+ P FSTG+IG DNA+ARHGIHGLYW +S ++  + L  G+NTI++T
Sbjct  570  YAELEVRVNNANAKPPLFSTGLIGDDNAIARHGIHGLYWFWSIKIPSTSLHKGSNTIYLT  629

Query  265  NGGAFTRWRGLLYDYIRFEGPDQ  333
                 T  +G++YDYIR EGP +
Sbjct  630  QTRGGTPLQGVMYDYIRLEGPAE  652



>gb|EYU29460.1| hypothetical protein MIMGU_mgv1a002710mg [Erythranthe guttata]
Length=644

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R N+  A  P FS+G+IG DN++ARHGIHGL+WL++  + G  LV G+NTI+++   
Sbjct  563  LQVRVNNPKANRPLFSSGLIGRDNSIARHGIHGLHWLYNIEINGDLLVEGDNTIYLSQPR  622

Query  274  AFTRWRGLLYDYIRFEGPDQF  336
            + + ++GL+YDYIR E P  F
Sbjct  623  SQSPFQGLMYDYIRLEAPGDF  643



>ref|XP_009338020.1| PREDICTED: probable rhamnogalacturonate lyase B [Pyrus x bretschneideri]
Length=678

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 58/81 (72%), Gaps = 1/81 (1%)
 Frame = +1

Query  85   FLVFKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMT  264
            +   ++RFN+++ + PHFSTG+IG DNA+ARHGIHGLYWLFS  V    L  G NTI++T
Sbjct  596  YAELEVRFNNQN-DTPHFSTGLIGKDNAIARHGIHGLYWLFSVDVPSYRLQEGYNTIYLT  654

Query  265  NGGAFTRWRGLLYDYIRFEGP  327
                +  + G++YDYIR EGP
Sbjct  655  QSRNWGPFAGVMYDYIRLEGP  675



>ref|XP_010671338.1| PREDICTED: rhamnogalacturonate lyase B [Beta vulgaris subsp. 
vulgaris]
Length=659

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = +1

Query  97   KLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGGA  276
            ++R ND  A  P F+TG++G DN++ARHGIHGLYWL++  ++GS LV G+N +++T    
Sbjct  577  QVRVNDPKANRPVFTTGLMGRDNSIARHGIHGLYWLYNVDIQGSKLVQGDNVLYLTQPRN  636

Query  277  FTRWRGLLYDYIRFEGP  327
             + ++G+LYDY+R EGP
Sbjct  637  QSPFQGILYDYLRLEGP  653



>ref|XP_006472414.1| PREDICTED: uncharacterized protein LOC102607519 isoform X1 [Citrus 
sinensis]
 ref|XP_006472415.1| PREDICTED: uncharacterized protein LOC102607519 isoform X2 [Citrus 
sinensis]
Length=664

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 57/80 (71%), Gaps = 1/80 (1%)
 Frame = +1

Query  91   VFKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPG-NNTIFMTN  267
            V ++R ND   E P FSTG IG +N +ARHGI+GLYWLF+  V G+  V G NNTI++T 
Sbjct  574  VLQVRINDPSTEPPLFSTGQIGKENTIARHGIYGLYWLFNVDVPGALFVKGNNNTIYLTQ  633

Query  268  GGAFTRWRGLLYDYIRFEGP  327
              + + +RG++YDYIR EGP
Sbjct  634  ALSGSPFRGVMYDYIRLEGP  653



>gb|KDO81264.1| hypothetical protein CISIN_1g007269mg [Citrus sinensis]
Length=610

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 57/80 (71%), Gaps = 1/80 (1%)
 Frame = +1

Query  91   VFKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPG-NNTIFMTN  267
            V ++R ND   E P FSTG IG +N +ARHGI+GLYWLF+  V G+  V G NNTI++T 
Sbjct  520  VLQVRINDPSTEPPLFSTGQIGKENTIARHGIYGLYWLFNVDVPGALFVKGNNNTIYLTQ  579

Query  268  GGAFTRWRGLLYDYIRFEGP  327
              + + +RG++YDYIR EGP
Sbjct  580  ALSGSPFRGVMYDYIRLEGP  599



>gb|KDP29802.1| hypothetical protein JCGZ_18737 [Jatropha curcas]
Length=667

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++RFN+  A+ P F+TG++G DNA+ARHGIHGLYW +S  V    LV G+NTI++T   
Sbjct  587  LQVRFNNAGADQPFFTTGLVGKDNAIARHGIHGLYWSYSINVPNDQLVNGDNTIYLTQSR  646

Query  274  AFTRWRGLLYDYIRFEGP  327
                + G++YDYIR EGP
Sbjct  647  DDGPFHGVMYDYIRLEGP  664



>ref|XP_004490463.1| PREDICTED: rhamnogalacturonate lyase-like isoform X2 [Cicer arietinum]
Length=607

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 44/85 (52%), Positives = 57/85 (67%), Gaps = 4/85 (5%)
 Frame = +1

Query  94   FKLRFND-KDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNG  270
             ++R ND K  + P F+TG+IG DNA+ARHGIHGLYWLF+  V    L  G+NTIF+T  
Sbjct  520  LQVRVNDLKQLDPPLFTTGVIGKDNAIARHGIHGLYWLFNIDVPSLLLSKGDNTIFLTQN  579

Query  271  ---GAFTRWRGLLYDYIRFEGPDQF  336
               G    ++G++YDYIR EGP  F
Sbjct  580  MAIGPLALFQGIMYDYIRLEGPGPF  604



>ref|XP_002301114.1| hypothetical protein POPTR_0002s11090g [Populus trichocarpa]
 gb|EEE80387.1| hypothetical protein POPTR_0002s11090g [Populus trichocarpa]
Length=640

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND   + PHFSTG IG DN +ARHG+HGLY L++  V G+ LV G NT+F+T   
Sbjct  554  LQVRINDPKIDPPHFSTGEIGHDNTIARHGVHGLYRLYNVDVPGTTLVEGENTVFLTQTP  613

Query  274  AFTRWRGLLYDYIRFEGP  327
              +  +G++YDYIR EGP
Sbjct  614  RTSPLQGIMYDYIRLEGP  631



>ref|XP_002892532.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68791.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=664

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND  A+ P F+TG IG DN +ARHGIHGLYWL++  V  + L  GNNTI++T   
Sbjct  578  LQVRVNDLSADPPLFTTGQIGRDNTIARHGIHGLYWLYNVNVPAASLHLGNNTIYLTQPL  637

Query  274  AFTRWRGLLYDYIRFEGPD  330
            A + ++GL+YDYIR E PD
Sbjct  638  ATSPFQGLMYDYIRLEYPD  656



>ref|XP_003603709.1| Rhamnogalacturonate lyase [Medicago truncatula]
Length=651

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 60/88 (68%), Gaps = 3/88 (3%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPG-NNTIFMTNG  270
             ++R ND     P FS+G+IG DN++ARHGIHGLYWL++  + GS LV G NNTIF+T  
Sbjct  560  LQVRVNDPKTNRPLFSSGLIGKDNSIARHGIHGLYWLYNVNIPGSLLVEGDNNTIFLTQA  619

Query  271  GAFTRWRGLLYDYIRFEGP--DQFKVSM  348
                 ++ ++YDYIR EGP    F++++
Sbjct  620  RGNIPFQAIMYDYIRLEGPATSSFRITL  647



>ref|XP_006346801.1| PREDICTED: probable rhamnogalacturonate lyase B-like [Solanum 
tuberosum]
Length=656

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 54/79 (68%), Gaps = 1/79 (1%)
 Frame = +1

Query  94   FKLRFNDKDAE-LPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNG  270
             ++R ND++ E  PHF+TG IG DNA+ARHGIHGLY ++S  V    L  G+NT+F+   
Sbjct  574  LQIRINDQNPEHAPHFTTGSIGKDNAIARHGIHGLYRMYSIDVPSDLLAIGSNTMFLKQN  633

Query  271  GAFTRWRGLLYDYIRFEGP  327
               + W GL+YDYIR EGP
Sbjct  634  RGSSSWSGLMYDYIRLEGP  652



>gb|AES73960.2| rhamnogalacturonate lyase B-like protein [Medicago truncatula]
Length=648

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 60/88 (68%), Gaps = 3/88 (3%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPG-NNTIFMTNG  270
             ++R ND     P FS+G+IG DN++ARHGIHGLYWL++  + GS LV G NNTIF+T  
Sbjct  557  LQVRVNDPKTNRPLFSSGLIGKDNSIARHGIHGLYWLYNVNIPGSLLVEGDNNTIFLTQA  616

Query  271  GAFTRWRGLLYDYIRFEGP--DQFKVSM  348
                 ++ ++YDYIR EGP    F++++
Sbjct  617  RGNIPFQAIMYDYIRLEGPATSSFRITL  644



>ref|XP_008219212.1| PREDICTED: probable rhamnogalacturonate lyase B [Prunus mume]
Length=624

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 38/78 (49%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND  A  P FS+G+IG DN++ARHGIHGLYWLF+  +  S ++ G+N I++T   
Sbjct  538  LQVRVNDPKAYHPLFSSGLIGKDNSIARHGIHGLYWLFNVDIPSSRIIEGDNIIYLTQPR  597

Query  274  AFTRWRGLLYDYIRFEGP  327
            + + ++G++YDYIR EGP
Sbjct  598  STSPFQGIMYDYIRLEGP  615



>ref|XP_008368110.1| PREDICTED: uncharacterized protein LOC103431713 [Malus domestica]
Length=1262

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = +1

Query  85    FLVFKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMT  264
             F   ++R ND  A  P F++G+IG DN++ARHGIHGLYWL++  V  S LV G+N I++T
Sbjct  1176  FSELQVRVNDPKANRPLFTSGMIGRDNSIARHGIHGLYWLYNVDVPSSRLVEGDNIIYLT  1235

Query  265   NGGAFTRWRGLLYDYIRFEGP  327
                +   ++G++YDY+RFEGP
Sbjct  1236  QPRSTGPFQGIMYDYLRFEGP  1256


 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIF  258
             ++R N+ D+  P F++G+IG +N+VARHGIHG+YWL++  V G+ LV GNNT F
Sbjct  534  LQVRINNPDSRRPLFTSGLIGRENSVARHGIHGIYWLYNINVPGAQLVEGNNTFF  588



>ref|XP_009595414.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Nicotiana 
tomentosiformis]
Length=670

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 38/77 (49%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = +1

Query  97   KLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGGA  276
            ++R ND +   P FSTG+IG DN++ARHGIHGLYWL++  ++G+ LV G+NTI++     
Sbjct  592  QVRVNDPNTNRPLFSTGLIGRDNSIARHGIHGLYWLYNIDIQGNLLVQGDNTIYLGQPRN  651

Query  277  FTRWRGLLYDYIRFEGP  327
             + ++G++YDYIR E P
Sbjct  652  QSPFQGIMYDYIRLEAP  668



>ref|XP_009366368.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X2 [Pyrus 
x bretschneideri]
Length=1179

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = +1

Query  85    FLVFKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMT  264
             F   ++R ND  A  P F++G+IG DN++ARHGIHGLYWL++  V  S LV G+N I++T
Sbjct  1093  FSELQVRVNDPKANRPLFTSGMIGRDNSIARHGIHGLYWLYNVDVPSSRLVEGDNIIYLT  1152

Query  265   NGGAFTRWRGLLYDYIRFEGP  327
                +   ++G++YDY+RFEGP
Sbjct  1153  QPRSTGPFQGIMYDYLRFEGP  1173



>ref|XP_010060118.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X2 [Eucalyptus 
grandis]
Length=655

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND  A  P F++G+IG DN++ARHGI GLYWLF+  V G+ L  G NTIF+T   
Sbjct  578  LQVRVNDPKARRPLFTSGLIGRDNSIARHGIQGLYWLFNVNVPGTLLNEGENTIFLTQPR  637

Query  274  AFTRWRGLLYDYIRFEGP  327
              + ++GL+YDY+R EGP
Sbjct  638  CDSPFQGLMYDYLRLEGP  655



>ref|XP_009366367.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Pyrus 
x bretschneideri]
Length=1198

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = +1

Query  85    FLVFKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMT  264
             F   ++R ND  A  P F++G+IG DN++ARHGIHGLYWL++  V  S LV G+N I++T
Sbjct  1112  FSELQVRVNDPKANRPLFTSGMIGRDNSIARHGIHGLYWLYNVDVPSSRLVEGDNIIYLT  1171

Query  265   NGGAFTRWRGLLYDYIRFEGP  327
                +   ++G++YDY+RFEGP
Sbjct  1172  QPRSTGPFQGIMYDYLRFEGP  1192



>ref|XP_004288875.1| PREDICTED: rhamnogalacturonate lyase-like [Fragaria vesca subsp. 
vesca]
Length=640

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 39/78 (50%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R N+  A  P F++G+IG DN++ARHGIHGLYWL+   +  S LV G+NTIF+T   
Sbjct  557  LQVRVNNPKANPPLFTSGLIGKDNSIARHGIHGLYWLYKVDIPNSQLVQGDNTIFLTQPR  616

Query  274  AFTRWRGLLYDYIRFEGP  327
            +   ++G++YDYIR EGP
Sbjct  617  STGPFQGIMYDYIRLEGP  634



>ref|XP_009795926.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Nicotiana 
sylvestris]
Length=669

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 38/77 (49%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = +1

Query  97   KLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGGA  276
            ++R ND +   P FSTG+IG DN++ARHGIHGLYWL++  ++G+ LV G+NTI++     
Sbjct  591  QVRVNDPNTNRPLFSTGLIGRDNSIARHGIHGLYWLYNIDIQGNLLVQGDNTIYLGQPRN  650

Query  277  FTRWRGLLYDYIRFEGP  327
             + ++G++YDYIR E P
Sbjct  651  QSPFQGIMYDYIRLEAP  667



>ref|XP_010458309.1| PREDICTED: uncharacterized protein LOC104739595 [Camelina sativa]
Length=205

 Score = 85.9 bits (211),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND +A  P F+TG+IG DN++ARHGIHG+Y L+   + G+ LV G+NTIF+    
Sbjct  127  LQIRVNDAEAVRPLFTTGLIGRDNSIARHGIHGVYMLYEVNIPGNRLVQGDNTIFLRQPR  186

Query  274  AFTRWRGLLYDYIRFEGP  327
                ++G++YDYIR EGP
Sbjct  187  CNGPFQGIMYDYIRLEGP  204



>ref|XP_008370921.1| PREDICTED: probable rhamnogalacturonate lyase B [Malus domestica]
Length=680

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 57/81 (70%), Gaps = 1/81 (1%)
 Frame = +1

Query  85   FLVFKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMT  264
            +   ++RFN++  + PHFSTG+IG DNA+ARHGIHGLYWLFS  V    L  G NTI++T
Sbjct  598  YAELQVRFNNQ-XDTPHFSTGLIGKDNAIARHGIHGLYWLFSVDVPSYRLQQGYNTIYLT  656

Query  265  NGGAFTRWRGLLYDYIRFEGP  327
                +  + G++YDYIR EGP
Sbjct  657  QSRNWGPFAGVMYDYIRLEGP  677



>ref|XP_009595415.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X2 [Nicotiana 
tomentosiformis]
Length=637

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 38/77 (49%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = +1

Query  97   KLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGGA  276
            ++R ND +   P FSTG+IG DN++ARHGIHGLYWL++  ++G+ LV G+NTI++     
Sbjct  559  QVRVNDPNTNRPLFSTGLIGRDNSIARHGIHGLYWLYNIDIQGNLLVQGDNTIYLGQPRN  618

Query  277  FTRWRGLLYDYIRFEGP  327
             + ++G++YDYIR E P
Sbjct  619  QSPFQGIMYDYIRLEAP  635



>ref|XP_010060117.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Eucalyptus 
grandis]
 gb|KCW66666.1| hypothetical protein EUGRSUZ_F00442 [Eucalyptus grandis]
Length=675

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND  A  P F++G+IG DN++ARHGI GLYWLF+  V G+ L  G NTIF+T   
Sbjct  598  LQVRVNDPKARRPLFTSGLIGRDNSIARHGIQGLYWLFNVNVPGTLLNEGENTIFLTQPR  657

Query  274  AFTRWRGLLYDYIRFEGP  327
              + ++GL+YDY+R EGP
Sbjct  658  CDSPFQGLMYDYLRLEGP  675



>ref|XP_010935407.1| PREDICTED: rhamnogalacturonate lyase B-like [Elaeis guineensis]
Length=701

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++RFN+  A+  HF+    G DNA+ARHGIHGLYWL+   V   WLV G+NTIF+T   
Sbjct  621  LQVRFNNLKADPTHFTANPNGRDNAIARHGIHGLYWLYDITVSNIWLVQGDNTIFITQPM  680

Query  274  AFTRWRGLLYDYIRFEGP  327
            + + + G++YDYIR EGP
Sbjct  681  SQSPFSGIMYDYIRMEGP  698



>emb|CDP01610.1| unnamed protein product [Coffea canephora]
Length=517

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +1

Query  97   KLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGGA  276
            ++R ND +A  P FSTG+IG DNA+ARHGIHGLY LFS  + G+ LV G NTIF+     
Sbjct  439  QVRVNDPNASSPQFSTGLIGKDNAIARHGIHGLYQLFSVNIPGNRLVSGPNTIFLRQSRG  498

Query  277  FTRWRGLLYDYIRFEGP  327
               + G++YDY+R EGP
Sbjct  499  GYIFSGVMYDYLRLEGP  515



>ref|XP_007224652.1| hypothetical protein PRUPE_ppa026307mg [Prunus persica]
 gb|EMJ25851.1| hypothetical protein PRUPE_ppa026307mg [Prunus persica]
Length=642

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 38/78 (49%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND  A  P FS+G+IG DN++ARHGIHGLYWLF+  +  S ++ G+N I++T   
Sbjct  556  LQVRVNDPKAYPPLFSSGMIGKDNSIARHGIHGLYWLFNVDIPSSRIIEGDNIIYLTQPR  615

Query  274  AFTRWRGLLYDYIRFEGP  327
            + + ++G++YDYIR EGP
Sbjct  616  STSPFQGIMYDYIRLEGP  633



>ref|XP_010060119.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X3 [Eucalyptus 
grandis]
 gb|KCW66667.1| hypothetical protein EUGRSUZ_F00442 [Eucalyptus grandis]
Length=631

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND  A  P F++G+IG DN++ARHGI GLYWLF+  V G+ L  G NTIF+T   
Sbjct  554  LQVRVNDPKARRPLFTSGLIGRDNSIARHGIQGLYWLFNVNVPGTLLNEGENTIFLTQPR  613

Query  274  AFTRWRGLLYDYIRFEGP  327
              + ++GL+YDY+R EGP
Sbjct  614  CDSPFQGLMYDYLRLEGP  631



>ref|XP_011074281.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X2 [Sesamum 
indicum]
Length=619

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R N+ D +   F++G+IG DNA+ARHGIHGLYWLF+  +  + LV G+NTI++T   
Sbjct  542  LQVRINNPDQDPALFTSGLIGKDNAIARHGIHGLYWLFNVELPAASLVEGDNTIYLTQAN  601

Query  274  AFTRWRGLLYDYIRFEGP  327
              + ++G++YDYIR E P
Sbjct  602  TTSPFQGIMYDYIRLESP  619



>ref|XP_011016984.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105120478 
[Populus euphratica]
Length=1290

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 58/78 (74%), Gaps = 1/78 (1%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND  A+ P FS+G+IG DN++ARHGIHGLYWL+   V G+ LV G+N +F+T   
Sbjct  554  LQVRINDPKAK-PLFSSGLIGKDNSIARHGIHGLYWLYGIDVPGARLVEGDNAVFLTQPR  612

Query  274  AFTRWRGLLYDYIRFEGP  327
            + + ++G++YDYIR EGP
Sbjct  613  STSPFQGIMYDYIRLEGP  630


 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 57/78 (73%), Gaps = 1/78 (1%)
 Frame = +1

Query  94    FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
              ++R N+ +A  P FSTG IG DN +ARHGIHGLY LF+  + G+ L+ GNNTIF+T   
Sbjct  1210  LEVRVNEPNAN-PQFSTGEIGKDNTIARHGIHGLYRLFNVDIPGAQLLIGNNTIFLTQTA  1268

Query  274   AFTRWRGLLYDYIRFEGP  327
             + + ++G++YDYIR EGP
Sbjct  1269  SISPFQGVMYDYIRLEGP  1286



>ref|XP_007156454.1| hypothetical protein PHAVU_003G287300g [Phaseolus vulgaris]
 gb|ESW28448.1| hypothetical protein PHAVU_003G287300g [Phaseolus vulgaris]
Length=482

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = +1

Query  100  LRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGGAF  279
            +RFN+     PHFSTG IG DNAVARHGIHGLYW +S  VR + LV G NTI++      
Sbjct  405  IRFNNPLDRPPHFSTGSIGQDNAVARHGIHGLYWPYSVEVRSNVLVEGVNTIYLRQPKVT  464

Query  280  TRWRGLLYDYIRFEGPD  330
            + ++ ++YDYIR E P+
Sbjct  465  SPFQAIMYDYIRLERPE  481



>ref|XP_011074280.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Sesamum 
indicum]
Length=635

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R N+ D +   F++G+IG DNA+ARHGIHGLYWLF+  +  + LV G+NTI++T   
Sbjct  558  LQVRINNPDQDPALFTSGLIGKDNAIARHGIHGLYWLFNVELPAASLVEGDNTIYLTQAN  617

Query  274  AFTRWRGLLYDYIRFEGP  327
              + ++G++YDYIR E P
Sbjct  618  TTSPFQGIMYDYIRLESP  635



>ref|XP_009795927.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X2 [Nicotiana 
sylvestris]
Length=650

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = +1

Query  97   KLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGGA  276
            ++R ND +   P FSTG+IG DN++ARHGIHGLYWL++  ++G+ LV G+NTI++     
Sbjct  572  QVRVNDPNTNRPLFSTGLIGRDNSIARHGIHGLYWLYNIDIQGNLLVQGDNTIYLGQPRN  631

Query  277  FTRWRGLLYDYIRFEGP  327
             + ++G++YDYIR E P
Sbjct  632  QSPFQGIMYDYIRLEAP  648



>ref|XP_009795928.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X3 [Nicotiana 
sylvestris]
Length=637

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = +1

Query  97   KLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGGA  276
            ++R ND +   P FSTG+IG DN++ARHGIHGLYWL++  ++G+ LV G+NTI++     
Sbjct  559  QVRVNDPNTNRPLFSTGLIGRDNSIARHGIHGLYWLYNIDIQGNLLVQGDNTIYLGQPRN  618

Query  277  FTRWRGLLYDYIRFEGP  327
             + ++G++YDYIR E P
Sbjct  619  QSPFQGIMYDYIRLEAP  635



>ref|XP_010106796.1| hypothetical protein L484_009236 [Morus notabilis]
 gb|EXC11824.1| hypothetical protein L484_009236 [Morus notabilis]
Length=629

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++RFN   +  P FST  IG DN++ARHGIHGLYWL+S  + G WL+ GNNT+++T   
Sbjct  546  LQVRFNYPPSYPPMFSTHRIGRDNSIARHGIHGLYWLYSVNIPGFWLLEGNNTLYLTQAR  605

Query  274  AFTRWRGLLYDYIRFEGP  327
            +   + GL+YDYIRFE P
Sbjct  606  SQGPFGGLMYDYIRFEAP  623



>ref|XP_006364644.1| PREDICTED: probable rhamnogalacturonate lyase B-like [Solanum 
tuberosum]
Length=680

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++RFND + + PH+STG+IG DNA+ARHGIHG+Y L++  V GS L  G N +++    
Sbjct  598  LQVRFNDPEIDAPHYSTGLIGKDNAIARHGIHGIYRLYTINVPGSLLGFGTNIMYLKQSR  657

Query  274  AFTRWRGLLYDYIRFEGP  327
                +RGL+YDYIR EGP
Sbjct  658  GDRPFRGLMYDYIRLEGP  675



>gb|KDP41512.1| hypothetical protein JCGZ_15919 [Jatropha curcas]
Length=626

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 58/78 (74%), Gaps = 1/78 (1%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R N+  A  P FS+G+IG DN++ARHGIHGLYWL++  V  + LV G+N IF+T   
Sbjct  540  LQVRINNPKAN-PVFSSGVIGKDNSIARHGIHGLYWLYNINVAATLLVEGDNIIFLTQPR  598

Query  274  AFTRWRGLLYDYIRFEGP  327
            + + ++G++YDYIRFEGP
Sbjct  599  SNSPFQGIMYDYIRFEGP  616



>ref|XP_003615341.1| LG27/30-like gene [Medicago truncatula]
Length=661

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 41/81 (51%), Positives = 56/81 (69%), Gaps = 3/81 (4%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTN--  267
             ++R ND+  + P F+TG+IG DNA+ARHGIHGLYWLF+  V    L+ G+NTIF+T   
Sbjct  580  LQVRVNDEKQDPPLFTTGVIGKDNAIARHGIHGLYWLFNIGVPSILLIKGDNTIFLTQTM  639

Query  268  -GGAFTRWRGLLYDYIRFEGP  327
              G    ++G++YDYIR E P
Sbjct  640  ATGPLPLFQGIMYDYIRLESP  660



>gb|AES98299.2| rhamnogalacturonate lyase B-like protein [Medicago truncatula]
Length=644

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 41/81 (51%), Positives = 56/81 (69%), Gaps = 3/81 (4%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTN--  267
             ++R ND+  + P F+TG+IG DNA+ARHGIHGLYWLF+  V    L+ G+NTIF+T   
Sbjct  563  LQVRVNDEKQDPPLFTTGVIGKDNAIARHGIHGLYWLFNIGVPSILLIKGDNTIFLTQTM  622

Query  268  -GGAFTRWRGLLYDYIRFEGP  327
              G    ++G++YDYIR E P
Sbjct  623  ATGPLPLFQGIMYDYIRLESP  643



>ref|XP_008466140.1| PREDICTED: probable rhamnogalacturonate lyase C [Cucumis melo]
Length=651

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND  A  P F+TG+IG DN VARHGIHGLY L++  + G  LV GNNTI +T   
Sbjct  569  LQVRLNDAQALPPLFTTGLIGKDNTVARHGIHGLYRLYTVDIPGGELVVGNNTILLTQAS  628

Query  274  AFTRWRGLLYDYIRFEGP  327
            + + + G++YDYIR EGP
Sbjct  629  SNSPFVGIMYDYIRLEGP  646



>ref|XP_008378659.1| PREDICTED: probable rhamnogalacturonate lyase B [Malus domestica]
Length=1231

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 60/88 (68%), Gaps = 0/88 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND ++  P F++G+IG DN+VAR GIHG+YWL++  V G+ LV GNNT F     
Sbjct  553  LQVRINDPNSRRPLFTSGLIGRDNSVARLGIHGIYWLYNINVPGNQLVEGNNTFFFRQPR  612

Query  274  AFTRWRGLLYDYIRFEGPDQFKVSM*YV  357
              + ++G++YDYIRFEGP    +S  Y+
Sbjct  613  CTSPFQGIMYDYIRFEGPPPCNLSSSYL  640


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 54/74 (73%), Gaps = 1/74 (1%)
 Frame = +1

Query  109   NDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGGAFT-R  285
             ND  A  P F++G+IG DN++ARHGIHGLYWL++  V  S LV G+N I++T   + T  
Sbjct  1152  NDPKANRPLFTSGMIGKDNSIARHGIHGLYWLYNVDVPSSRLVEGDNIIYLTQPRSTTGP  1211

Query  286   WRGLLYDYIRFEGP  327
             ++G++YDY+R EGP
Sbjct  1212  FQGIMYDYLRLEGP  1225



>ref|XP_004161761.1| PREDICTED: probable rhamnogalacturonate lyase B-like [Cucumis 
sativus]
Length=566

 Score = 89.0 bits (219),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND  ++ P F++G+IG DN++ARHGIHG+YW++   V G  LV G NTIF+T   
Sbjct  486  LQVRVNDPRSKRPLFTSGLIGRDNSIARHGIHGIYWVYGVGVAGCHLVEGENTIFLTQPR  545

Query  274  AFTRWRGLLYDYIRFEGP  327
              + ++G++YDYIR EGP
Sbjct  546  CTSPFQGIMYDYIRLEGP  563



>ref|XP_008357559.1| PREDICTED: LOW QUALITY PROTEIN: probable rhamnogalacturonate 
lyase B [Malus domestica]
Length=646

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 45/96 (47%), Positives = 60/96 (63%), Gaps = 8/96 (8%)
 Frame = +1

Query  64   TLKLYIFFLV-----FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGS  228
            TLKL I          ++R ND  A+ P F+TG+IG DN +ARHGIHGLY L++  + G+
Sbjct  542  TLKLRIALATANIAELQIRINDSKADPPLFTTGVIGNDNTIARHGIHGLYRLYNIDIPGT  601

Query  229  WLVPGNNTIFMT---NGGAFTRWRGLLYDYIRFEGP  327
             LV G NT+F+T   +      + GL+YDYIR EGP
Sbjct  602  LLVEGANTLFLTQPMSSSPLAPFHGLMYDYIRLEGP  637



>ref|XP_010490407.1| PREDICTED: rhamnogalacturonate lyase B-like isoform X1 [Camelina 
sativa]
Length=722

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 54/79 (68%), Gaps = 0/79 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND  A  P F+T  IG DN +ARHGIHGLYWL++  V  S L  GNNTI++T   
Sbjct  636  LQVRVNDPSANPPLFTTEQIGKDNTIARHGIHGLYWLYNVNVPDSSLRLGNNTIYLTQPL  695

Query  274  AFTRWRGLLYDYIRFEGPD  330
            A + ++GL+YDYIR E PD
Sbjct  696  ATSPFQGLMYDYIRLECPD  714



>ref|XP_010490414.1| PREDICTED: rhamnogalacturonate lyase B-like isoform X2 [Camelina 
sativa]
Length=715

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 54/79 (68%), Gaps = 0/79 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND  A  P F+T  IG DN +ARHGIHGLYWL++  V  S L  GNNTI++T   
Sbjct  629  LQVRVNDPSANPPLFTTEQIGKDNTIARHGIHGLYWLYNVNVPDSSLRLGNNTIYLTQPL  688

Query  274  AFTRWRGLLYDYIRFEGPD  330
            A + ++GL+YDYIR E PD
Sbjct  689  ATSPFQGLMYDYIRLECPD  707



>gb|ABK22261.1| unknown [Picea sitchensis]
Length=222

 Score = 85.9 bits (211),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = +1

Query  91   VFKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNG  270
              ++RFND++   PHF T   G DNA+ARHGIHGLY LF+  V G+WLV G NT+++T  
Sbjct  142  AIQIRFNDENIYKPHFDTMQFGKDNAIARHGIHGLYHLFNIDVSGNWLVEGENTLYLTQR  201

Query  271  GAFTRWRGLLYDYIRFE  321
               + + G++YDY+R E
Sbjct  202  KVTSPFTGVMYDYLRLE  218



>ref|XP_004490462.1| PREDICTED: rhamnogalacturonate lyase-like isoform X1 [Cicer arietinum]
Length=648

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 44/85 (52%), Positives = 57/85 (67%), Gaps = 4/85 (5%)
 Frame = +1

Query  94   FKLRFND-KDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNG  270
             ++R ND K  + P F+TG+IG DNA+ARHGIHGLYWLF+  V    L  G+NTIF+T  
Sbjct  561  LQVRVNDLKQLDPPLFTTGVIGKDNAIARHGIHGLYWLFNIDVPSLLLSKGDNTIFLTQN  620

Query  271  ---GAFTRWRGLLYDYIRFEGPDQF  336
               G    ++G++YDYIR EGP  F
Sbjct  621  MAIGPLALFQGIMYDYIRLEGPGPF  645



>ref|XP_011099950.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Sesamum 
indicum]
Length=672

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 57/78 (73%), Gaps = 1/78 (1%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND+ + LPHF+T +IG DNA+ARHGIHGLY L+S  + GS L+ G NTIF+T   
Sbjct  594  LQVRVNDQKS-LPHFTTRLIGRDNALARHGIHGLYHLYSIDITGSRLINGTNTIFLTQAR  652

Query  274  AFTRWRGLLYDYIRFEGP  327
            +   +R ++YDYIR EGP
Sbjct  653  SQGPFREVMYDYIRLEGP  670



>ref|XP_011099951.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X2 [Sesamum 
indicum]
Length=666

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 57/78 (73%), Gaps = 1/78 (1%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND+ + LPHF+T +IG DNA+ARHGIHGLY L+S  + GS L+ G NTIF+T   
Sbjct  588  LQVRVNDQKS-LPHFTTRLIGRDNALARHGIHGLYHLYSIDITGSRLINGTNTIFLTQAR  646

Query  274  AFTRWRGLLYDYIRFEGP  327
            +   +R ++YDYIR EGP
Sbjct  647  SQGPFREVMYDYIRLEGP  664



>ref|XP_010490418.1| PREDICTED: rhamnogalacturonate lyase B-like isoform X3 [Camelina 
sativa]
Length=696

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 54/79 (68%), Gaps = 0/79 (0%)
 Frame = +1

Query  94   FKLRFNDKDAELPHFSTGIIGTDNAVARHGIHGLYWLFSFRVRGSWLVPGNNTIFMTNGG  273
             ++R ND  A  P F+T  IG DN +ARHGIHGLYWL++  V  S L  GNNTI++T   
Sbjct  610  LQVRVNDPSANPPLFTTEQIGKDNTIARHGIHGLYWLYNVNVPDSSLRLGNNTIYLTQPL  669

Query  274  AFTRWRGLLYDYIRFEGPD  330
            A + ++GL+YDYIR E PD
Sbjct  670  ATSPFQGLMYDYIRLECPD  688



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 729814547172