BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7700_g1_i1 len=620 path=[1:0-392 526:393-619]

Length=620
                                                                      Score     E

ref|XP_006441781.1|  hypothetical protein CICLE_v10023084mg           75.1    4e-14   
ref|XP_006478342.1|  PREDICTED: filamin A-interacting protein 1-like  77.8    5e-14   
ref|XP_008348722.1|  PREDICTED: uncharacterized protein LOC103411885  75.9    2e-13   
ref|XP_004290260.1|  PREDICTED: uncharacterized protein LOC101310565  76.3    2e-13   
ref|XP_008365796.1|  PREDICTED: uncharacterized protein LOC103429423  75.1    3e-13   
ref|XP_008237829.1|  PREDICTED: kinesin-related protein 4             75.1    5e-13   
ref|XP_009786843.1|  PREDICTED: tropomyosin isoform X2                75.1    5e-13   
ref|XP_009366871.1|  PREDICTED: uncharacterized protein LOC103956576  75.1    5e-13   
ref|XP_009786834.1|  PREDICTED: tropomyosin, muscle isoform X1        74.7    6e-13   
ref|XP_002521745.1|  hypothetical protein RCOM_1329260                74.3    1e-12   Ricinus communis
gb|KCW70968.1|  hypothetical protein EUGRSUZ_F04078                   71.6    2e-12   
ref|XP_010063721.1|  PREDICTED: uncharacterized protein LOC104450...  72.0    4e-12   
gb|EYU22700.1|  hypothetical protein MIMGU_mgv1a011935mg              72.0    6e-12   
ref|XP_010063719.1|  PREDICTED: myosin heavy chain, clone 203-lik...  72.0    6e-12   
ref|XP_006837914.1|  hypothetical protein AMTR_s03150p00001340        70.9    6e-12   
ref|XP_010063720.1|  PREDICTED: myosin heavy chain, clone 203-lik...  72.0    7e-12   
ref|XP_010063718.1|  PREDICTED: myosin heavy chain, clone 203-lik...  72.0    7e-12   
ref|XP_009415444.1|  PREDICTED: switch-associated protein 70          72.0    7e-12   
ref|XP_009607706.1|  PREDICTED: tropomyosin                           70.5    2e-11   
ref|XP_010112057.1|  hypothetical protein L484_012643                 70.5    2e-11   
ref|XP_011095239.1|  PREDICTED: uncharacterized protein LOC105174747  70.1    3e-11   
gb|KDP31603.1|  hypothetical protein JCGZ_14828                       69.3    6e-11   
ref|XP_010646426.1|  PREDICTED: uncharacterized protein LOC100248...  67.4    2e-10   
ref|XP_010646424.1|  PREDICTED: uncharacterized protein LOC100248...  67.4    3e-10   
ref|XP_010646425.1|  PREDICTED: uncharacterized protein LOC100248...  67.4    3e-10   
ref|XP_006352068.1|  PREDICTED: intermediate filament protein ifa...  66.6    5e-10   
ref|XP_010252397.1|  PREDICTED: uncharacterized protein LOC104593...  65.9    6e-10   
ref|XP_008441195.1|  PREDICTED: protein hook isoform X3               65.1    1e-09   
ref|XP_010252395.1|  PREDICTED: uncharacterized protein LOC104593...  65.5    1e-09   
ref|XP_010313096.1|  PREDICTED: uncharacterized protein LOC101255...  65.1    1e-09   
gb|KEH42347.1|  hypothetical protein MTR_1g067710                     63.5    1e-09   
ref|XP_004513401.1|  PREDICTED: myosin-10-like                        65.5    1e-09   
ref|XP_002319864.2|  hypothetical protein POPTR_0013s09040g           65.1    2e-09   Populus trichocarpa [western balsam poplar]
ref|XP_004250760.1|  PREDICTED: intermediate filament protein ifa...  65.1    2e-09   
ref|XP_008441194.1|  PREDICTED: centromere-associated protein E i...  65.1    2e-09   
ref|XP_008441193.1|  PREDICTED: myosin heavy chain, clone 203 iso...  65.1    2e-09   
gb|KGN63085.1|  hypothetical protein Csa_2G401450                     65.5    3e-09   
ref|XP_010542660.1|  PREDICTED: uncharacterized protein LOC104815798  63.5    5e-09   
ref|XP_011011066.1|  PREDICTED: uncharacterized protein LOC105115...  63.9    5e-09   
ref|XP_011011067.1|  PREDICTED: uncharacterized protein LOC105115...  63.9    6e-09   
ref|XP_011011068.1|  PREDICTED: uncharacterized protein LOC105115...  63.2    7e-09   
ref|XP_008797749.1|  PREDICTED: uveal autoantigen with coiled-coi...  62.8    1e-08   
ref|XP_008797747.1|  PREDICTED: uveal autoantigen with coiled-coi...  62.8    1e-08   
gb|AAG51223.1|AC051630_20  hypothetical protein; 76532-78443          62.0    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007133868.1|  hypothetical protein PHAVU_011G215700g           62.4    2e-08   
ref|XP_006415080.1|  hypothetical protein EUTSA_v10008295mg           62.4    2e-08   
gb|EEC83360.1|  hypothetical protein OsI_28766                        62.0    2e-08   Oryza sativa Indica Group [Indian rice]
gb|EEE68465.1|  hypothetical protein OsJ_26861                        62.0    3e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010942579.1|  PREDICTED: LOW QUALITY PROTEIN: CAP-Gly doma...  61.6    4e-08   
gb|KDO42451.1|  hypothetical protein CISIN_1g045404mg                 58.9    5e-08   
ref|XP_010042590.1|  PREDICTED: uncharacterized protein LOC104431698  58.9    6e-08   
ref|XP_009151474.1|  PREDICTED: uncharacterized protein LOC103874785  59.7    1e-07   
ref|XP_010677115.1|  PREDICTED: centrosomal protein of 128 kDa is...  58.5    4e-07   
gb|KHN19413.1|  hypothetical protein glysoja_026028                   58.2    5e-07   
ref|XP_006592981.1|  PREDICTED: flagellar attachment zone protein...  58.2    5e-07   
ref|XP_003573710.1|  PREDICTED: uncharacterized protein LOC100834418  57.4    1e-06   
ref|XP_007019752.1|  Uncharacterized protein TCM_036062               56.6    2e-06   
ref|XP_008660345.1|  PREDICTED: uncharacterized protein LOC103639...  55.5    4e-06   
ref|XP_008660341.1|  PREDICTED: uncharacterized protein LOC103639...  55.1    6e-06   
ref|XP_008660334.1|  PREDICTED: uncharacterized protein LOC103639...  55.1    7e-06   
emb|CDX73281.1|  BnaC05g28250D                                        54.3    1e-05   
ref|XP_004973205.1|  PREDICTED: nuclear mitotic apparatus protein...  54.3    1e-05   
ref|XP_004973204.1|  PREDICTED: nuclear mitotic apparatus protein...  54.3    1e-05   
gb|EMS45578.1|  hypothetical protein TRIUR3_26172                     51.6    7e-05   
ref|XP_007201883.1|  hypothetical protein PRUPE_ppa009717mg           51.6    1e-04   
ref|XP_002438488.1|  hypothetical protein SORBIDRAFT_10g020510        51.6    1e-04   Sorghum bicolor [broomcorn]



>ref|XP_006441781.1| hypothetical protein CICLE_v10023084mg [Citrus clementina]
 gb|ESR55021.1| hypothetical protein CICLE_v10023084mg [Citrus clementina]
Length=89

 Score = 75.1 bits (183),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = -2

Query  517  QPELREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKIEMD  338
            +PEL EMD+K LE+EH  L  D     EY+QSLQ QI KL+GISH I C CG+EYK+++ 
Sbjct  27   KPELMEMDIKTLEEEHGTLLSDIAGEAEYLQSLQHQIEKLEGISHVIKCACGQEYKVKVS  86

Query  337  CSA  329
             SA
Sbjct  87   LSA  89



>ref|XP_006478342.1| PREDICTED: filamin A-interacting protein 1-like [Citrus sinensis]
Length=283

 Score = 77.8 bits (190),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -2

Query  520  LQPELREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKIEM  341
             +PEL EMD+K LE+EH  L  D     EY+QSLQ QI KL+GISH I C CG+EYK+E+
Sbjct  220  FKPELMEMDIKTLEEEHGTLQSDIAGEAEYLQSLQHQIEKLEGISHVIKCVCGQEYKVEV  279

Query  340  DCSA  329
              SA
Sbjct  280  SLSA  283



>ref|XP_008348722.1| PREDICTED: uncharacterized protein LOC103411885 [Malus domestica]
Length=198

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -2

Query  520  LQPELREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKIEM  341
             +PELR MD+K LE+E+ AL  DK   TEY+++LQ QI KL+GISH + C CGEEYK+E+
Sbjct  135  FKPELRAMDIKTLEEEYDALLSDKAGETEYLKTLQDQIEKLRGISHVVICTCGEEYKVEV  194



>ref|XP_004290260.1| PREDICTED: uncharacterized protein LOC101310565 [Fragaria vesca 
subsp. vesca]
Length=285

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = -2

Query  520  LQPELREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKIEM  341
             +PELR +D+K LEDE+ AL  D     EY++SLQ QI KLKGISH + C CG EYK+E+
Sbjct  222  FKPELRALDIKTLEDEYNALVSDNAGEAEYLKSLQDQIEKLKGISHVLKCSCGVEYKVEL  281

Query  340  D  338
            D
Sbjct  282  D  282



>ref|XP_008365796.1| PREDICTED: uncharacterized protein LOC103429423 [Malus domestica]
Length=230

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -2

Query  520  LQPELREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKIEM  341
             +PELR MD+K LE+E+ AL  DK   TEY+++LQ QI KL+GISH + C CGEEYK+E+
Sbjct  167  FKPELRAMDIKTLEEEYDALLSDKAGETEYLKTLQDQIEKLRGISHVVICTCGEEYKVEV  226



>ref|XP_008237829.1| PREDICTED: kinesin-related protein 4 [Prunus mume]
Length=281

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = -2

Query  520  LQPELREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKIEM  341
             +PELR MDV  LE+E+ AL  DK  +TEY++SLQ QI KLK ISH + C CGEEYK+ +
Sbjct  218  FKPELRAMDVDTLEEEYDALLSDKAGVTEYLKSLQDQIEKLKEISHVVKCACGEEYKVVV  277

Query  340  D  338
            D
Sbjct  278  D  278



>ref|XP_009786843.1| PREDICTED: tropomyosin isoform X2 [Nicotiana sylvestris]
Length=273

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -2

Query  508  LREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKIEMDCSA  329
            LREMD K LE+E++AL  DK    EY+QSLQ QI KL  ISH+I C CGEE+KI+MD  A
Sbjct  214  LREMDSKSLEEEYEALLSDKAGEAEYLQSLQLQIAKLMRISHSIKCSCGEEFKIDMDLCA  273



>ref|XP_009366871.1| PREDICTED: uncharacterized protein LOC103956576 [Pyrus x bretschneideri]
Length=285

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = -2

Query  514  PELREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKIEM  341
            PELR M++K LE+E+ AL  DK   TEY+ +LQ QI KL+GISH + C CGEEYK+E+
Sbjct  224  PELRAMNIKTLEEEYNALLSDKAGETEYLNTLQDQIEKLRGISHVVKCACGEEYKVEV  281



>ref|XP_009786834.1| PREDICTED: tropomyosin, muscle isoform X1 [Nicotiana sylvestris]
Length=277

 Score = 74.7 bits (182),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -2

Query  520  LQPELREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKIEM  341
             +  LREMD K LE+E++AL  DK    EY+QSLQ QI KL  ISH+I C CGEE+KI+M
Sbjct  214  FKAPLREMDSKSLEEEYEALLSDKAGEAEYLQSLQLQIAKLMRISHSIKCSCGEEFKIDM  273

Query  340  DCSA  329
            D  A
Sbjct  274  DLCA  277



>ref|XP_002521745.1| hypothetical protein RCOM_1329260 [Ricinus communis]
 gb|EEF40555.1| hypothetical protein RCOM_1329260 [Ricinus communis]
Length=293

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -2

Query  520  LQPELREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKIEM  341
             +PEL  MD   LE+E++AL  DK    EY+QSLQ QI KLKGISH I C CG EYK+EM
Sbjct  230  FKPELLAMDTTTLEEEYKALLSDKAGEFEYLQSLQDQIDKLKGISHMIKCACGMEYKVEM  289

Query  340  DCSA  329
            D  A
Sbjct  290  DLCA  293



>gb|KCW70968.1| hypothetical protein EUGRSUZ_F04078, partial [Eucalyptus grandis]
Length=140

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = -2

Query  520  LQPELREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKIEM  341
             Q ELR MD K LE E +AL  D V  TE+ QSLQ QI KLKGIS  + C CG+EYKIE+
Sbjct  79   FQEELRAMDYKTLEKEQKALLADIVGETEFQQSLQNQIEKLKGISQLVKCACGQEYKIEL  138

Query  340  D  338
            D
Sbjct  139  D  139



>ref|XP_010063721.1| PREDICTED: uncharacterized protein LOC104450736 isoform X4 [Eucalyptus 
grandis]
 ref|XP_010063722.1| PREDICTED: uncharacterized protein LOC104450736 isoform X4 [Eucalyptus 
grandis]
Length=224

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = -2

Query  520  LQPELREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKIEM  341
             Q ELR MD K LE E +AL  D V  TE+ QSLQ QI KLKGIS  + C CG+EYKIE+
Sbjct  163  FQEELRAMDYKTLEKEQKALLADIVGETEFQQSLQNQIEKLKGISQLVKCACGQEYKIEL  222

Query  340  D  338
            D
Sbjct  223  D  223



>gb|EYU22700.1| hypothetical protein MIMGU_mgv1a011935mg [Erythranthe guttata]
Length=266

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = -2

Query  520  LQPELREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKIEM  341
             +PELREMD K L  E Q L  DK    EYVQSLQ QI+++K ISH I C CGE+Y + +
Sbjct  205  FKPELREMDEKSLAKELQELLSDKTRQAEYVQSLQLQIMRIKEISHEIRCSCGEKYHVRL  264

Query  340  DC  335
            D 
Sbjct  265  DI  266



>ref|XP_010063719.1| PREDICTED: myosin heavy chain, clone 203-like isoform X2 [Eucalyptus 
grandis]
Length=285

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = -2

Query  520  LQPELREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKIEM  341
             Q ELR MD K LE E +AL  D V  TE+ QSLQ QI KLKGIS  + C CG+EYKIE+
Sbjct  224  FQEELRAMDYKTLEKEQKALLADIVGETEFQQSLQNQIEKLKGISQLVKCACGQEYKIEL  283

Query  340  D  338
            D
Sbjct  284  D  284



>ref|XP_006837914.1| hypothetical protein AMTR_s03150p00001340 [Amborella trichopoda]
 gb|ERN00483.1| hypothetical protein AMTR_s03150p00001340 [Amborella trichopoda]
Length=193

 Score = 70.9 bits (172),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = -2

Query  514  PELREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKIEM  341
            PEL+ MD+  LE+EH+AL  DK     Y+QSLQ +I +LKGIS ++ C CGEEYK+E+
Sbjct  133  PELKAMDISALEEEHKALISDKAGEISYLQSLQERIEQLKGISQSVKCACGEEYKVEI  190



>ref|XP_010063720.1| PREDICTED: myosin heavy chain, clone 203-like isoform X3 [Eucalyptus 
grandis]
Length=285

 Score = 72.0 bits (175),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = -2

Query  520  LQPELREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKIEM  341
             Q ELR MD K LE E +AL  D V  TE+ QSLQ QI KLKGIS  + C CG+EYKIE+
Sbjct  224  FQEELRAMDYKTLEKEQKALLADIVGETEFQQSLQNQIEKLKGISQLVKCACGQEYKIEL  283

Query  340  D  338
            D
Sbjct  284  D  284



>ref|XP_010063718.1| PREDICTED: myosin heavy chain, clone 203-like isoform X1 [Eucalyptus 
grandis]
Length=292

 Score = 72.0 bits (175),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = -2

Query  520  LQPELREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKIEM  341
             Q ELR MD K LE E +AL  D V  TE+ QSLQ QI KLKGIS  + C CG+EYKIE+
Sbjct  231  FQEELRAMDYKTLEKEQKALLADIVGETEFQQSLQNQIEKLKGISQLVKCACGQEYKIEL  290

Query  340  D  338
            D
Sbjct  291  D  291



>ref|XP_009415444.1| PREDICTED: switch-associated protein 70 [Musa acuminata subsp. 
malaccensis]
Length=287

 Score = 72.0 bits (175),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = -2

Query  514  PELREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKIEM  341
            P LREMDVK LE+EH++L  DK    EY+QSL+ +I +LK ISH I C CG+EY +E+
Sbjct  228  PALREMDVKALEEEHRSLVADKAGELEYLQSLKERIKQLKNISHIIKCRCGKEYNVEL  285



>ref|XP_009607706.1| PREDICTED: tropomyosin [Nicotiana tomentosiformis]
Length=273

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = -2

Query  508  LREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKIEMDCSA  329
            L EMD K L++E+QAL  DK    EY+QSLQ QI KL  ISH+I C CGEE+KI+MD  A
Sbjct  214  LTEMDSKSLKEEYQALLSDKDGEAEYLQSLQLQIAKLMRISHSIKCSCGEEFKIDMDLCA  273



>ref|XP_010112057.1| hypothetical protein L484_012643 [Morus notabilis]
 gb|EXC32476.1| hypothetical protein L484_012643 [Morus notabilis]
Length=281

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -2

Query  520  LQPELREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKIEM  341
             +P LR +D+K LE E+  L  DK  +TEY+QSLQ Q+  LKGISH + C CGEEY++  
Sbjct  218  FEPLLRAVDLKTLEKEYNTLLSDKAGVTEYLQSLQAQVDILKGISHVVKCACGEEYRVGT  277

Query  340  DCSA  329
            D  A
Sbjct  278  DLCA  281



>ref|XP_011095239.1| PREDICTED: uncharacterized protein LOC105174747 [Sesamum indicum]
Length=264

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = -2

Query  520  LQPELREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKIEM  341
             + ELR+MD K LE++ QAL  DK    EYVQSLQ QI ++K ISH + C CGEEY +++
Sbjct  203  FKSELRDMDEKSLEEDLQALLSDKSGEAEYVQSLQLQITRVKEISHIVRCSCGEEYNVKL  262

Query  340  D  338
            D
Sbjct  263  D  263



>gb|KDP31603.1| hypothetical protein JCGZ_14828 [Jatropha curcas]
Length=285

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = -2

Query  520  LQPELREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKIEM  341
             +PEL  MD+  LE+E++AL  DK    EY+QSLQ QI KLKGISH I C CG EYK+ M
Sbjct  222  FKPELLVMDIMTLEEEYKALLSDKDGEFEYLQSLQGQIGKLKGISHMIKCACGTEYKVAM  281

Query  340  D  338
            +
Sbjct  282  E  282



>ref|XP_010646426.1| PREDICTED: uncharacterized protein LOC100248648 isoform X3 [Vitis 
vinifera]
Length=254

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = -2

Query  520  LQPELREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKIEM  341
             + ELR MD+K +E+E+ AL  DK    EY+ SLQ QI KLKG+SH I C CG EYK+ +
Sbjct  191  FKSELRAMDMKNMEEEYNALLSDKAGEAEYLHSLQGQIEKLKGLSHKIKCACGTEYKVGL  250

Query  340  D  338
            +
Sbjct  251  E  251



>ref|XP_010646424.1| PREDICTED: uncharacterized protein LOC100248648 isoform X1 [Vitis 
vinifera]
Length=289

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = -2

Query  520  LQPELREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKIEM  341
             + ELR MD+K +E+E+ AL  DK    EY+ SLQ QI KLKG+SH I C CG EYK+ +
Sbjct  226  FKSELRAMDMKNMEEEYNALLSDKAGEAEYLHSLQGQIEKLKGLSHKIKCACGTEYKVGL  285

Query  340  D  338
            +
Sbjct  286  E  286



>ref|XP_010646425.1| PREDICTED: uncharacterized protein LOC100248648 isoform X2 [Vitis 
vinifera]
Length=285

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = -2

Query  520  LQPELREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKIEM  341
             + ELR MD+K +E+E+ AL  DK    EY+ SLQ QI KLKG+SH I C CG EYK+ +
Sbjct  222  FKSELRAMDMKNMEEEYNALLSDKAGEAEYLHSLQGQIEKLKGLSHKIKCACGTEYKVGL  281

Query  340  D  338
            +
Sbjct  282  E  282



>ref|XP_006352068.1| PREDICTED: intermediate filament protein ifa-3-like isoform X1 
[Solanum tuberosum]
Length=273

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = -2

Query  520  LQPELREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKIEM  341
             + +L +MD K L++E+QAL  DK    EY+ SLQ QI KL  ISH+I C CG E+KI+M
Sbjct  210  FKAQLGDMDSKSLQEEYQALLSDKAGEAEYLHSLQLQIAKLMIISHSIKCSCGNEFKIDM  269

Query  340  D  338
            D
Sbjct  270  D  270



>ref|XP_010252397.1| PREDICTED: uncharacterized protein LOC104593970 isoform X2 [Nelumbo 
nucifera]
Length=243

 Score = 65.9 bits (159),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = -2

Query  517  QPELREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKIEMD  338
            +P L  MD+K LE+EH+AL  D     EY Q LQ +I ++KGISH I C CG EYK+E++
Sbjct  181  KPALITMDMKALEEEHKALLSDNAAEVEYFQCLQHRIEQIKGISHVIKCPCGVEYKVELE  240

Query  337  CSA  329
             S 
Sbjct  241  NSG  243



>ref|XP_008441195.1| PREDICTED: protein hook isoform X3 [Cucumis melo]
Length=235

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = -2

Query  520  LQPELREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYK  350
             +PELR MD   LE+E++AL  D+   TEY +SLQ +I KLKGIS  I C CG+EYK
Sbjct  172  FKPELRAMDDVTLEEEYKALLSDQAGETEYSRSLQDKIAKLKGISSVIKCTCGKEYK  228



>ref|XP_010252395.1| PREDICTED: uncharacterized protein LOC104593970 isoform X1 [Nelumbo 
nucifera]
Length=259

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = -2

Query  514  PELREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKIEMDC  335
            P L  MD+K LE+EH+AL  D     EY Q LQ +I ++KGISH I C CG EYK+E++ 
Sbjct  198  PALITMDMKALEEEHKALLSDNAAEVEYFQCLQHRIEQIKGISHVIKCPCGVEYKVELEN  257

Query  334  SA  329
            S 
Sbjct  258  SG  259



>ref|XP_010313096.1| PREDICTED: uncharacterized protein LOC101255855 isoform X3 [Solanum 
lycopersicum]
Length=229

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = -2

Query  520  LQPELREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKIEM  341
             + +L +MD K L++E+QAL  DK    EY+ SLQ QI KL  ISH+I C CG E+KI+M
Sbjct  166  FKAQLGDMDSKSLQEEYQALLSDKAGEAEYLHSLQLQIAKLMIISHSIKCSCGNEFKIDM  225

Query  340  D  338
            +
Sbjct  226  N  226



>gb|KEH42347.1| hypothetical protein MTR_1g067710 [Medicago truncatula]
Length=136

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = -2

Query  520  LQPELREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKIEM  341
             +PEL+  D+  LE+E+ AL  D+   TEY+QS++ Q+ KLK I+  I C CGEEYK+ +
Sbjct  70   FKPELKAADITALEEEYNALLSDRAGETEYLQSMEKQVGKLKEINQVIKCACGEEYKVAL  129

Query  340  D  338
            +
Sbjct  130  N  130



>ref|XP_004513401.1| PREDICTED: myosin-10-like [Cicer arietinum]
Length=283

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = -2

Query  520  LQPELREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKIEM  341
             +PEL+  D+  LE+E+ AL  DK   TEY+QS++ Q+ KLK I H I C CGEEY +E+
Sbjct  221  FKPELKAADISALEEEYNALLSDKAGETEYLQSIEKQVEKLKEICHVIKCACGEEYTVEL  280



>ref|XP_002319864.2| hypothetical protein POPTR_0013s09040g [Populus trichocarpa]
 gb|EEE95787.2| hypothetical protein POPTR_0013s09040g [Populus trichocarpa]
Length=258

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -2

Query  520  LQPELREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKIEM  341
             + E  EMD+K LE+E++AL  D+    EY+QSLQ QI +LK ISH + C CG EYK+ M
Sbjct  195  FKTEFLEMDIKTLEEEYKALLSDRAGEIEYLQSLQKQIKQLKDISHMVKCACGVEYKVAM  254

Query  340  DCSA  329
            +  A
Sbjct  255  ELCA  258



>ref|XP_004250760.1| PREDICTED: intermediate filament protein ifa-3 isoform X1 [Solanum 
lycopersicum]
Length=268

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = -2

Query  520  LQPELREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKIEM  341
             + +L +MD K L++E+QAL  DK    EY+ SLQ QI KL  ISH+I C CG E+KI+M
Sbjct  205  FKAQLGDMDSKSLQEEYQALLSDKAGEAEYLHSLQLQIAKLMIISHSIKCSCGNEFKIDM  264

Query  340  D  338
            +
Sbjct  265  N  265



>ref|XP_008441194.1| PREDICTED: centromere-associated protein E isoform X2 [Cucumis 
melo]
Length=274

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = -2

Query  517  QPELREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYK  350
            +PELR MD   LE+E++AL  D+   TEY +SLQ +I KLKGIS  I C CG+EYK
Sbjct  212  KPELRAMDDVTLEEEYKALLSDQAGETEYSRSLQDKIAKLKGISSVIKCTCGKEYK  267



>ref|XP_008441193.1| PREDICTED: myosin heavy chain, clone 203 isoform X1 [Cucumis 
melo]
Length=290

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = -2

Query  520  LQPELREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYK  350
             +PELR MD   LE+E++AL  D+   TEY +SLQ +I KLKGIS  I C CG+EYK
Sbjct  227  FKPELRAMDDVTLEEEYKALLSDQAGETEYSRSLQDKIAKLKGISSVIKCTCGKEYK  283



>gb|KGN63085.1| hypothetical protein Csa_2G401450 [Cucumis sativus]
Length=405

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = -2

Query  520  LQPELREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYK  350
             +PELR MD   LE+E++AL  D+   TEY QSLQ +I KLKGIS  I C CG+EYK
Sbjct  342  FKPELRAMDDVTLEEEYKALLSDQAGETEYSQSLQDKIAKLKGISSVIKCTCGKEYK  398



>ref|XP_010542660.1| PREDICTED: uncharacterized protein LOC104815798 [Tarenaya hassleriana]
Length=257

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -2

Query  520  LQPELREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKI  347
             +PEL  MD K LE+E+ ALS D+   TEY+ SL+ Q  KLKG+S+   C CGEEY +
Sbjct  194  FKPELSSMDTKILEEEYTALSSDESGETEYLHSLRGQTEKLKGVSYISKCGCGEEYTV  251



>ref|XP_011011066.1| PREDICTED: uncharacterized protein LOC105115758 isoform X1 [Populus 
euphratica]
Length=285

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -2

Query  520  LQPELREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKIEM  341
            ++ EL +MD+K LE+E++AL  D+    EY+QSLQ QI +LK ISH + C CG EYK+ M
Sbjct  222  VKTELFDMDIKTLEEEYKALLSDRDGEIEYLQSLQKQIKQLKDISHMVKCACGVEYKVAM  281

Query  340  DCSA  329
            +  A
Sbjct  282  ELCA  285



>ref|XP_011011067.1| PREDICTED: uncharacterized protein LOC105115758 isoform X2 [Populus 
euphratica]
Length=284

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -2

Query  520  LQPELREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKIEM  341
            ++ EL +MD+K LE+E++AL  D+    EY+QSLQ QI +LK ISH + C CG EYK+ M
Sbjct  221  VKTELFDMDIKTLEEEYKALLSDRDGEIEYLQSLQKQIKQLKDISHMVKCACGVEYKVAM  280

Query  340  DCSA  329
            +  A
Sbjct  281  ELCA  284



>ref|XP_011011068.1| PREDICTED: uncharacterized protein LOC105115758 isoform X3 [Populus 
euphratica]
Length=269

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = -2

Query  517  QPELREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKIEMD  338
            + EL +MD+K LE+E++AL  D+    EY+QSLQ QI +LK ISH + C CG EYK+ M+
Sbjct  207  KTELFDMDIKTLEEEYKALLSDRDGEIEYLQSLQKQIKQLKDISHMVKCACGVEYKVAME  266

Query  337  CSA  329
              A
Sbjct  267  LCA  269



>ref|XP_008797749.1| PREDICTED: uveal autoantigen with coiled-coil domains and ankyrin 
repeats isoform X2 [Phoenix dactylifera]
Length=279

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = -2

Query  508  LREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKIEM  341
            L+EMD   LE+E++AL  DK    EY+QSL+ QI +L+GIS  + C CGEEY++E+
Sbjct  215  LKEMDDNALEEEYKALMADKAREMEYLQSLKDQINQLEGISQVVTCQCGEEYRVEL  270



>ref|XP_008797747.1| PREDICTED: uveal autoantigen with coiled-coil domains and ankyrin 
repeats isoform X1 [Phoenix dactylifera]
 ref|XP_008797748.1| PREDICTED: uveal autoantigen with coiled-coil domains and ankyrin 
repeats isoform X1 [Phoenix dactylifera]
Length=295

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = -2

Query  508  LREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKIEM  341
            L+EMD   LE+E++AL  DK    EY+QSL+ QI +L+GIS  + C CGEEY++E+
Sbjct  231  LKEMDDNALEEEYKALMADKAREMEYLQSLKDQINQLEGISQVVTCQCGEEYRVEL  286



>gb|AAG51223.1|AC051630_20 hypothetical protein; 76532-78443 [Arabidopsis thaliana]
Length=254

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = -2

Query  520  LQPELREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKIEM  341
             +PEL  +D+K LE+E+ AL  D+    EY+ SLQ Q  KLKGIS+   C CGEEY + +
Sbjct  194  FKPELMSVDIKILEEEYTALLSDESGEAEYLSSLQSQAEKLKGISYIAKCGCGEEYSVGL  253

Query  340  D  338
            D
Sbjct  254  D  254



>ref|XP_007133868.1| hypothetical protein PHAVU_011G215700g [Phaseolus vulgaris]
 gb|ESW05862.1| hypothetical protein PHAVU_011G215700g [Phaseolus vulgaris]
Length=284

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = -2

Query  520  LQPELREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKIEM  341
             +PEL+  D+  LE+E++AL  DK   TEY+QSL+ Q+ +LK I H + C CGEEY + +
Sbjct  223  FKPELKAADLTALEEEYKALLSDKDGETEYLQSLEKQVERLKEIRHVVKCACGEEYTVAL  282

Query  340  D  338
            +
Sbjct  283  N  283



>ref|XP_006415080.1| hypothetical protein EUTSA_v10008295mg [Eutrema salsugineum]
 gb|ESQ33433.1| hypothetical protein EUTSA_v10008295mg [Eutrema salsugineum]
Length=305

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -2

Query  520  LQPELREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKI  347
            ++PEL  +D+K LE+E+ AL  D+    EY+QSLQ Q  KLKGIS+   C CGEEY +
Sbjct  245  IKPELMSVDIKVLEEEYTALLSDESGEAEYLQSLQSQAEKLKGISYIAKCGCGEEYSV  302



>gb|EEC83360.1| hypothetical protein OsI_28766 [Oryza sativa Indica Group]
Length=290

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 44/64 (69%), Gaps = 1/64 (2%)
 Frame = -2

Query  520  LQPELREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKIEM  341
            L P L++MD+K LE+EH+AL  DK    EY QSL+ +I ++KG+S  + C CG EYK+E+
Sbjct  224  LAP-LQQMDMKSLEEEHKALQADKAGEIEYFQSLEERINEMKGVSDAVKCRCGLEYKVEL  282

Query  340  DCSA  329
               A
Sbjct  283  GGEA  286



>gb|EEE68465.1| hypothetical protein OsJ_26861 [Oryza sativa Japonica Group]
Length=290

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 44/64 (69%), Gaps = 1/64 (2%)
 Frame = -2

Query  520  LQPELREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKIEM  341
            L P L++MD+K LE+EH+AL  DK    EY QSL+ +I ++KG+S  + C CG EYK+E+
Sbjct  224  LAP-LQQMDMKSLEEEHKALQADKAGEIEYFQSLEERINEMKGVSDAVKCRCGLEYKVEL  282

Query  340  DCSA  329
               A
Sbjct  283  GGEA  286



>ref|XP_010942579.1| PREDICTED: LOW QUALITY PROTEIN: CAP-Gly domain-containing linker 
protein 1 [Elaeis guineensis]
Length=322

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = -2

Query  508  LREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKIEMD  338
            L+EMD   LE+E+QAL GDK    EY+ SL+ QI +L+ IS  + C CGEEY++E D
Sbjct  231  LKEMDDNALEEEYQALMGDKSREMEYLHSLEDQINQLEDISQVVTCQCGEEYRVEXD  287



>gb|KDO42451.1| hypothetical protein CISIN_1g045404mg [Citrus sinensis]
Length=122

 Score = 58.9 bits (141),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 45/97 (46%), Gaps = 33/97 (34%)
 Frame = -2

Query  520  LQPELREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLK------------------  395
             +PEL EMD+K LE+EH  L  D     EY+QSLQ QI KL+                  
Sbjct  26   FKPELMEMDIKTLEEEHGTLQSDIAGEAEYLQSLQHQIEKLEVNMVIHFCFLLLKNEALY  85

Query  394  ---------------GISHTINCCCGEEYKIEMDCSA  329
                           GISH I C CG+EYK+++  SA
Sbjct  86   NLLHLRMTFSCSQSNGISHVIKCACGQEYKVKVSLSA  122



>ref|XP_010042590.1| PREDICTED: uncharacterized protein LOC104431698, partial [Eucalyptus 
grandis]
Length=143

 Score = 58.9 bits (141),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = -2

Query  520  LQPELREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKIEM  341
             Q ELR MD++ LE E + L  D V  T++ QSL+ QI KL+GIS  + C C +E+KIE+
Sbjct  25   FQEELRAMDIETLEKEQKVLLADLVGETKFQQSLRNQIEKLRGISQLVKCTCTQEHKIEL  84

Query  340  D  338
            D
Sbjct  85   D  85



>ref|XP_009151474.1| PREDICTED: uncharacterized protein LOC103874785 [Brassica rapa]
 emb|CDY26927.1| BnaA05g17850D [Brassica napus]
Length=254

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -2

Query  520  LQPELREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKI  347
             +PEL  +D+K LE+E+ AL  D+    EY+ SLQ Q  KLKGIS+   C CGEEY +
Sbjct  194  FKPELMPLDIKILEEEYTALLSDESGEAEYLHSLQRQAEKLKGISYIAKCGCGEEYSV  251



>ref|XP_010677115.1| PREDICTED: centrosomal protein of 128 kDa isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=279

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = -2

Query  520  LQPELREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKIE  344
            L+PEL   ++  LE+EH+AL  +K    EY++SL   + KLKGISH I C CG +YK++
Sbjct  213  LKPELSATELSTLEEEHKALLSEKDGELEYMRSLDTNLEKLKGISHVIRCACGGDYKVD  271



>gb|KHN19413.1| hypothetical protein glysoja_026028 [Glycine soja]
Length=289

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = -2

Query  520  LQPELREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKIEM  341
             +PEL+  D+  LE+E  AL  DK    EY+QSL+ Q+ KL+ I H + C CGEEY + +
Sbjct  228  FKPELKAADITALEEECTALISDKAGEAEYLQSLEKQVEKLEQIRHVVKCACGEEYTVAV  287

Query  340  D  338
            +
Sbjct  288  N  288



>ref|XP_006592981.1| PREDICTED: flagellar attachment zone protein 1-like [Glycine 
max]
Length=283

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = -2

Query  520  LQPELREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKIEM  341
             +PEL+  D+  LE+E  AL  DK    EY+QSL+ Q+ KL+ I H + C CGEEY + +
Sbjct  222  FKPELKAADITALEEECTALISDKAGEAEYLQSLEKQVEKLEQIRHVVKCACGEEYTVAV  281

Query  340  D  338
            +
Sbjct  282  N  282



>ref|XP_003573710.1| PREDICTED: uncharacterized protein LOC100834418 [Brachypodium 
distachyon]
 ref|XP_010234585.1| PREDICTED: uncharacterized protein LOC100834418 [Brachypodium 
distachyon]
 ref|XP_010234586.1| PREDICTED: uncharacterized protein LOC100834418 [Brachypodium 
distachyon]
Length=290

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = -2

Query  508  LREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKIEM  341
            L+EM++K LE+E++AL GDK    E+ Q+L+ +  ++KG+S  I C CG EYK+E+
Sbjct  227  LQEMNMKSLEEEYKALQGDKAGEVEFFQTLEERTNEMKGVSDPIKCNCGLEYKVEL  282



>ref|XP_007019752.1| Uncharacterized protein TCM_036062 [Theobroma cacao]
 gb|EOY16977.1| Uncharacterized protein TCM_036062 [Theobroma cacao]
Length=283

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = -2

Query  520  LQPELREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKIEM  341
             +PE+ EM    LE+E++ L  +K   TEY+ SLQ Q+ ++KGIS+ I C CGEEY +++
Sbjct  222  FKPEVLEMSTDALEEEYKVLLSEKDGETEYLCSLQNQVERMKGISNVIKCACGEEYTVKL  281



>ref|XP_008660345.1| PREDICTED: uncharacterized protein LOC103639340 isoform X4 [Zea 
mays]
Length=238

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = -2

Query  508  LREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKIEMDCSA  329
            L++MD+K LE+E++AL GDK    EY QSL   I  +KGI   + C CG EY +++D  A
Sbjct  175  LQQMDMKSLEEEYKALQGDKSGEVEYFQSLDETINGMKGILDPVKCQCGLEYNLKLDGEA  234



>ref|XP_008660341.1| PREDICTED: uncharacterized protein LOC103639340 isoform X3 [Zea 
mays]
 tpg|DAA46957.1| TPA: hypothetical protein ZEAMMB73_213389 [Zea mays]
Length=286

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = -2

Query  508  LREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKIEMDCSA  329
            L++MD+K LE+E++AL GDK    EY QSL   I  +KGI   + C CG EY +++D  A
Sbjct  223  LQQMDMKSLEEEYKALQGDKSGEVEYFQSLDETINGMKGILDPVKCQCGLEYNLKLDGEA  282



>ref|XP_008660334.1| PREDICTED: uncharacterized protein LOC103639340 isoform X2 [Zea 
mays]
Length=291

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = -2

Query  508  LREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKIEMDCSA  329
            L++MD+K LE+E++AL GDK    EY QSL   I  +KGI   + C CG EY +++D  A
Sbjct  228  LQQMDMKSLEEEYKALQGDKSGEVEYFQSLDETINGMKGILDPVKCQCGLEYNLKLDGEA  287



>emb|CDX73281.1| BnaC05g28250D [Brassica napus]
Length=254

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = -2

Query  520  LQPELREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKI  347
             +PEL  +D+K LE+E  AL  D+    EY+ SLQ Q  KLK IS+   C CGE+Y +
Sbjct  194  FKPELMSLDIKILEEESTALLSDESGEAEYLHSLQSQAEKLKEISYIAKCGCGEKYSV  251



>ref|XP_004973205.1| PREDICTED: nuclear mitotic apparatus protein 1-like isoform X2 
[Setaria italica]
Length=279

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = -2

Query  508  LREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCG  362
            L++MD+K LE+E++AL GDK    EY  SL+  I  +KGIS  + CCCG
Sbjct  229  LQQMDMKSLEEEYKALQGDKAVEIEYFHSLEETISGMKGISEPVKCCCG  277



>ref|XP_004973204.1| PREDICTED: nuclear mitotic apparatus protein 1-like isoform X1 
[Setaria italica]
Length=285

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = -2

Query  508  LREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCG  362
            L++MD+K LE+E++AL GDK    EY  SL+  I  +KGIS  + CCCG
Sbjct  235  LQQMDMKSLEEEYKALQGDKAVEIEYFHSLEETISGMKGISEPVKCCCG  283



>gb|EMS45578.1| hypothetical protein TRIUR3_26172 [Triticum urartu]
Length=227

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = -2

Query  475  EHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKIEMDCSA  329
            E++AL GD     EY QSL  +I+K+KG+S  I C CG EY +E+D  A
Sbjct  175  EYKALLGDGAGEVEYFQSLDERIIKMKGVSDPIKCHCGLEYNVELDRDA  223



>ref|XP_007201883.1| hypothetical protein PRUPE_ppa009717mg [Prunus persica]
 gb|EMJ03082.1| hypothetical protein PRUPE_ppa009717mg [Prunus persica]
Length=281

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -2

Query  520  LQPELREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCC  365
             +PELR MDV  LE+E+ AL  DK  +TEY++SLQ QI KLK   + ++  C
Sbjct  218  FKPELRAMDVNTLEEEYDALLSDKAGVTEYLKSLQDQIEKLKVTVYQVSPWC  269



>ref|XP_002438488.1| hypothetical protein SORBIDRAFT_10g020510 [Sorghum bicolor]
 gb|EER89855.1| hypothetical protein SORBIDRAFT_10g020510 [Sorghum bicolor]
Length=291

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = -2

Query  508  LREMDVKFLEDEHQALSGDKVELTEYVQSLQFQIVKLKGISHTINCCCGEEYKIEM  341
            L++M +K LE+E++AL GDK    EY QSL   I  +KG+S  + C CG EY +++
Sbjct  228  LKQMGMKSLEEEYKALQGDKSGEVEYFQSLDETINVMKGVSDPVKCRCGLEYDVKL  283



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 801610136576