BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7693_g1_i1 len=1852 path=[1830:0-160 1991:161-1851]

Length=1852
                                                                      Score     E

ref|XP_009758350.1|  PREDICTED: pectate lyase-like                      593   0.0      
ref|XP_009599232.1|  PREDICTED: pectate lyase-like                      592   0.0      
ref|XP_004228388.1|  PREDICTED: pectate lyase                           578   0.0      
ref|XP_006363934.1|  PREDICTED: pectate lyase-like                      578   0.0      
ref|XP_006357289.1|  PREDICTED: probable pectate lyase 3-like           575   0.0      
emb|CDP00293.1|  unnamed protein product                                572   0.0      
ref|XP_009797403.1|  PREDICTED: pectate lyase-like                      570   0.0      
ref|XP_009627245.1|  PREDICTED: pectate lyase-like                      562   0.0      
ref|XP_011086389.1|  PREDICTED: pectate lyase-like                      539   0.0      
gb|EYU28712.1|  hypothetical protein MIMGU_mgv1a006498mg                538   0.0      
gb|EYU22437.1|  hypothetical protein MIMGU_mgv1a006496mg                535   0.0      
ref|XP_009342871.1|  PREDICTED: pectate lyase-like                      526   2e-178   
ref|XP_008357758.1|  PREDICTED: pectate lyase-like                      525   5e-178   
ref|XP_010066949.1|  PREDICTED: pectate lyase                           523   2e-177   
ref|XP_002311599.2|  pectate lyase family protein                       523   2e-177   Populus trichocarpa [western balsam poplar]
ref|XP_010112093.1|  putative pectate lyase 7                           522   3e-177   
ref|XP_008443432.1|  PREDICTED: probable pectate lyase 19               522   4e-177   
ref|XP_004147462.1|  PREDICTED: probable pectate lyase 7-like           521   5e-177   
gb|KGN59593.1|  hypothetical protein Csa_3G827350                       521   8e-177   
ref|XP_011087066.1|  PREDICTED: pectate lyase                           521   9e-177   
ref|XP_008446316.1|  PREDICTED: probable pectate lyase P59              520   2e-176   
ref|XP_011071024.1|  PREDICTED: pectate lyase-like                      520   2e-176   
ref|XP_002282500.3|  PREDICTED: pectate lyase                           520   3e-176   Vitis vinifera
emb|CAN79927.1|  hypothetical protein VITISV_042447                     520   3e-176   Vitis vinifera
emb|CBI22159.3|  unnamed protein product                                520   5e-176   
ref|XP_010033216.1|  PREDICTED: pectate lyase-like                      518   1e-175   
ref|XP_002520133.1|  Pectate lyase precursor, putative                  517   3e-175   Ricinus communis
ref|XP_011025954.1|  PREDICTED: probable pectate lyase P59              516   8e-175   
ref|XP_008341537.1|  PREDICTED: pectate lyase-like                      515   2e-174   
ref|XP_011097774.1|  PREDICTED: pectate lyase-like                      512   3e-173   
ref|XP_008230729.1|  PREDICTED: pectate lyase                           511   9e-173   
ref|XP_004135462.1|  PREDICTED: probable pectate lyase P59-like         510   9e-173   
ref|XP_004155392.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    510   1e-172   
gb|KCW52797.1|  hypothetical protein EUGRSUZ_J02132                     509   7e-172   
ref|XP_004165454.1|  PREDICTED: pectate lyase-like                      507   2e-171   
ref|XP_008456459.1|  PREDICTED: pectate lyase-like                      507   2e-171   
ref|XP_010105747.1|  putative pectate lyase P59                         506   2e-171   
ref|XP_004162547.1|  PREDICTED: probable pectate lyase P59-like         506   4e-171   
ref|XP_004146792.1|  PREDICTED: probable pectate lyase P59-like         506   9e-171   
gb|EPS73633.1|  hypothetical protein M569_01123                         506   1e-170   
ref|XP_010256490.1|  PREDICTED: pectate lyase-like                      505   1e-170   
ref|XP_007046218.1|  Pectate lyase family protein, putative             505   1e-170   
ref|XP_007215366.1|  hypothetical protein PRUPE_ppa005602mg             505   2e-170   
ref|XP_007227702.1|  hypothetical protein PRUPE_ppa005744mg             505   2e-170   
ref|XP_002272638.2|  PREDICTED: pectate lyase-like                      503   9e-170   Vitis vinifera
ref|XP_010242445.1|  PREDICTED: pectate lyase                           503   2e-169   
ref|XP_007037229.1|  Pectate lyase family protein                       501   3e-169   
ref|XP_002270089.1|  PREDICTED: pectate lyase                           501   1e-168   Vitis vinifera
ref|XP_010925369.1|  PREDICTED: pectate lyase                           499   3e-168   
emb|CDP14850.1|  unnamed protein product                                498   7e-168   
ref|XP_002270112.1|  PREDICTED: pectate lyase                           498   1e-167   Vitis vinifera
ref|XP_008221660.1|  PREDICTED: probable pectate lyase 3                497   2e-167   
ref|XP_006374492.1|  hypothetical protein POPTR_0015s07590g             496   3e-167   
emb|CAN69904.1|  hypothetical protein VITISV_001006                     496   5e-167   Vitis vinifera
ref|XP_010320663.1|  PREDICTED: probable pectate lyase 3                493   1e-166   
ref|XP_010068708.1|  PREDICTED: pectate lyase-like                      494   2e-166   
ref|XP_009788285.1|  PREDICTED: pectate lyase-like                      493   6e-166   
ref|XP_003554335.1|  PREDICTED: pectate lyase-like                      493   1e-165   
ref|XP_003530685.1|  PREDICTED: probable pectate lyase 3-like           492   2e-165   
ref|XP_004152537.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    491   2e-165   
ref|XP_008365507.1|  PREDICTED: pectate lyase-like                      490   3e-165   
ref|XP_011013803.1|  PREDICTED: pectate lyase-like                      490   5e-165   
ref|XP_007224275.1|  hypothetical protein PRUPE_ppa019055mg             491   6e-165   
ref|XP_009408830.1|  PREDICTED: pectate lyase-like                      491   6e-165   
gb|AAQ62997.1|  oil palm polygalacturonase allergen PEST411             490   1e-164   Elaeis guineensis
ref|XP_007032453.1|  Pectate lyase family protein                       489   3e-164   
ref|XP_009381244.1|  PREDICTED: pectate lyase-like                      487   8e-164   
ref|XP_009389712.1|  PREDICTED: pectate lyase-like                      488   8e-164   
ref|XP_008786760.1|  PREDICTED: pectate lyase-like                      489   1e-163   
ref|XP_008389523.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    486   4e-163   
ref|XP_009598230.1|  PREDICTED: pectate lyase-like                      486   4e-163   
ref|XP_008339935.1|  PREDICTED: probable pectate lyase 3                486   5e-163   
ref|XP_004514773.1|  PREDICTED: probable pectate lyase 3-like           486   5e-163   
ref|XP_008446067.1|  PREDICTED: pectate lyase-like                      483   9e-163   
ref|XP_009360393.1|  PREDICTED: probable pectate lyase 3                485   1e-162   
ref|XP_008374522.1|  PREDICTED: pectate lyase-like                      484   3e-162   
ref|XP_006842121.1|  hypothetical protein AMTR_s00078p00106380          484   3e-162   
ref|XP_009369346.1|  PREDICTED: pectate lyase-like                      484   4e-162   
ref|XP_004489168.1|  PREDICTED: pectate lyase-like                      483   6e-162   
ref|XP_011005067.1|  PREDICTED: probable pectate lyase P59              483   7e-162   
ref|XP_011087217.1|  PREDICTED: pectate lyase-like                      482   1e-161   
ref|XP_007138209.1|  hypothetical protein PHAVU_009G189800g             482   1e-161   
ref|XP_008221658.1|  PREDICTED: pectate lyase-like                      482   1e-161   
ref|XP_003543726.1|  PREDICTED: pectate lyase                           482   2e-161   
gb|KDP45476.1|  hypothetical protein JCGZ_09725                         482   3e-161   
gb|ACU23277.1|  unknown                                                 481   6e-161   Glycine max [soybeans]
ref|XP_009380431.1|  PREDICTED: pectate lyase-like                      480   6e-161   
ref|XP_009615547.1|  PREDICTED: probable pectate lyase P59              480   6e-161   
ref|XP_004490003.1|  PREDICTED: probable pectate lyase 3-like iso...    480   1e-160   
ref|XP_002323835.1|  hypothetical protein POPTR_0017s11450g             480   1e-160   Populus trichocarpa [western balsam poplar]
ref|XP_008339934.1|  PREDICTED: probable pectate lyase 3                480   2e-160   
gb|KHG08055.1|  putative pectate lyase P59                              479   3e-160   
ref|XP_002306040.1|  hypothetical protein POPTR_0004s12300g             478   3e-160   Populus trichocarpa [western balsam poplar]
gb|AES91206.2|  pectate lyase P59-like protein                          478   4e-160   
ref|XP_006354795.1|  PREDICTED: pectate lyase-like                      477   1e-159   
emb|CAN77957.1|  hypothetical protein VITISV_021245                     476   1e-159   Vitis vinifera
ref|XP_004508770.1|  PREDICTED: probable pectate lyase P59-like         476   3e-159   
ref|XP_004302354.1|  PREDICTED: probable pectate lyase P59-like         476   4e-159   
ref|XP_009617495.1|  PREDICTED: probable pectate lyase P59              476   5e-159   
ref|XP_003552513.1|  PREDICTED: pectate lyase-like                      475   6e-159   
ref|XP_009802165.1|  PREDICTED: probable pectate lyase P59              476   7e-159   
gb|KHN13652.1|  Pectate lyase                                           475   8e-159   
ref|XP_009403112.1|  PREDICTED: pectate lyase-like                      475   8e-159   
ref|XP_009599825.1|  PREDICTED: probable pectate lyase P59 isofor...    475   1e-158   
gb|EYU34111.1|  hypothetical protein MIMGU_mgv1a006386mg                475   1e-158   
ref|XP_010670318.1|  PREDICTED: pectate lyase-like                      474   4e-158   
gb|KHN13240.1|  Putative pectate lyase 3                                474   4e-158   
gb|EPS66620.1|  hypothetical protein M569_08154                         474   4e-158   
ref|XP_009599826.1|  PREDICTED: probable pectate lyase P59 isofor...    473   6e-158   
gb|KHN08855.1|  Putative pectate lyase P59                              473   7e-158   
ref|XP_006477525.1|  PREDICTED: pectate lyase-like                      472   1e-157   
ref|XP_011009454.1|  PREDICTED: pectate lyase-like                      473   3e-157   
ref|XP_006344502.1|  PREDICTED: probable pectate lyase P59-like         471   3e-157   
ref|XP_007153840.1|  hypothetical protein PHAVU_003G069100g             471   3e-157   
ref|XP_010915114.1|  PREDICTED: LOW QUALITY PROTEIN: pectate lyas...    471   4e-157   
ref|XP_009779191.1|  PREDICTED: probable pectate lyase P59              470   9e-157   
ref|XP_003609009.1|  Pectate lyase                                      470   1e-156   
ref|XP_007209148.1|  hypothetical protein PRUPE_ppa005859mg             469   1e-156   
ref|XP_009789921.1|  PREDICTED: probable pectate lyase P59              469   2e-156   
emb|CDP02198.1|  unnamed protein product                                470   2e-156   
ref|XP_004236194.1|  PREDICTED: probable pectate lyase P59              469   2e-156   
gb|KHG16093.1|  hypothetical protein F383_07683                         469   2e-156   
gb|AAA86241.1|  pectate lyase homolog                                   469   3e-156   Medicago sativa [alfalfa]
ref|XP_006439649.1|  hypothetical protein CICLE_v10020193mg             469   3e-156   
ref|XP_008793504.1|  PREDICTED: pectate lyase-like                      469   3e-156   
ref|XP_011085780.1|  PREDICTED: probable pectate lyase P59              469   3e-156   
gb|KDO76053.1|  hypothetical protein CISIN_1g013757mg                   468   4e-156   
gb|KHG05193.1|  hypothetical protein F383_30875                         466   7e-156   
gb|EYU36839.1|  hypothetical protein MIMGU_mgv1a006379mg                468   9e-156   
ref|XP_010683249.1|  PREDICTED: pectate lyase-like                      467   9e-156   
ref|XP_004489374.1|  PREDICTED: pectate lyase-like                      467   1e-155   
ref|NP_197015.4|  putative pectate lyase 19                             468   1e-155   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008239834.1|  PREDICTED: pectate lyase-like                      467   1e-155   
gb|ABK28696.1|  unknown                                                 468   1e-155   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011098575.1|  PREDICTED: probable pectate lyase P59              467   1e-155   
ref|XP_003613596.1|  Pectate lyase                                      466   2e-155   
ref|XP_007151201.1|  hypothetical protein PHAVU_004G026400g             466   3e-155   
ref|XP_004232242.1|  PREDICTED: probable pectate lyase P59              466   3e-155   
ref|XP_009761969.1|  PREDICTED: probable pectate lyase P59              466   3e-155   
gb|KHG23093.1|  hypothetical protein F383_29772                         464   4e-155   
ref|XP_006361835.1|  PREDICTED: probable pectate lyase P59-like         465   7e-155   
gb|KHN13490.1|  Putative pectate lyase 3                                462   8e-155   
ref|XP_009587689.1|  PREDICTED: probable pectate lyase P59              464   1e-154   
ref|XP_003519771.2|  PREDICTED: probable pectate lyase 3-like           464   1e-154   
ref|XP_003621115.1|  Pectate lyase                                      464   2e-154   
gb|KHN08706.1|  Putative pectate lyase 3                                464   2e-154   
ref|XP_006338480.1|  PREDICTED: probable pectate lyase P59-like         462   7e-154   
ref|XP_004234779.1|  PREDICTED: probable pectate lyase P59              462   8e-154   
gb|KEH19822.1|  pectate lyase-like protein                              462   1e-153   
ref|XP_010527872.1|  PREDICTED: probable pectate lyase 3 isoform X2     462   1e-153   
ref|XP_004490004.1|  PREDICTED: probable pectate lyase 3-like iso...    459   1e-153   
ref|XP_010528323.1|  PREDICTED: probable pectate lyase 19               462   1e-153   
gb|AAQ62996.1|  oil palm polygalacturonase allergen PEST361             462   2e-153   Elaeis guineensis
sp|P15722.1|PLY59_SOLLC  RecName: Full=Probable pectate lyase P59...    461   2e-153   Solanum lycopersicum
ref|XP_003613595.1|  Pectate lyase                                      461   4e-153   
ref|XP_007139601.1|  hypothetical protein PHAVU_008G043600g             461   5e-153   
ref|XP_007137422.1|  hypothetical protein PHAVU_009G125800g             460   5e-153   
ref|XP_002511525.1|  Pectate lyase precursor, putative                  460   5e-153   Ricinus communis
emb|CDX85564.1|  BnaA02g02490D                                          461   1e-152   
ref|XP_006656188.1|  PREDICTED: pectate lyase-like                      459   2e-152   
ref|XP_009110541.1|  PREDICTED: probable pectate lyase 3                459   3e-152   
ref|XP_006573090.1|  PREDICTED: probable pectate lyase 3-like           458   3e-152   
gb|KHN01171.1|  Putative pectate lyase 3                                458   4e-152   
ref|XP_006357122.1|  PREDICTED: probable pectate lyase P59-like         458   4e-152   
ref|XP_010678579.1|  PREDICTED: pectate lyase-like                      457   6e-152   
ref|XP_008366366.1|  PREDICTED: pectate lyase-like                      458   1e-151   
emb|CDX96854.1|  BnaA08g23970D                                          457   2e-151   
ref|XP_006826355.1|  hypothetical protein AMTR_s00004p00123190          457   2e-151   
ref|XP_010523445.1|  PREDICTED: probable pectate lyase 3                456   4e-151   
emb|CDY68729.1|  BnaCnng60280D                                          456   5e-151   
gb|KEH24975.1|  pectate lyase P59-like protein                          454   2e-150   
gb|AAM60924.1|  putative pectate lyase                                  455   2e-150   Arabidopsis thaliana [mouse-ear cress]
ref|NP_186776.1|  putative pectate lyase 7                              454   3e-150   Arabidopsis thaliana [mouse-ear cress]
gb|KFK33456.1|  hypothetical protein AALP_AA5G015800                    454   3e-150   
ref|XP_010463548.1|  PREDICTED: probable pectate lyase 7                454   3e-150   
ref|XP_006480843.1|  PREDICTED: probable pectate lyase 19-like          453   4e-150   
ref|XP_010435229.1|  PREDICTED: probable pectate lyase 15               454   4e-150   
ref|XP_010440536.1|  PREDICTED: probable pectate lyase 15 isoform X2    454   4e-150   
gb|AAX88800.1|  ripening-related pectate lyase                          452   5e-150   Mangifera indica
ref|XP_010440534.1|  PREDICTED: probable pectate lyase 15 isoform X1    453   5e-150   
ref|XP_010485518.1|  PREDICTED: probable pectate lyase 7                454   6e-150   
ref|XP_010532807.1|  PREDICTED: probable pectate lyase 15               452   7e-150   
ref|XP_010513594.1|  PREDICTED: probable pectate lyase 7                453   7e-150   
ref|XP_010514040.1|  PREDICTED: probable pectate lyase 6                452   8e-150   
ref|XP_002892805.1|  hypothetical protein ARALYDRAFT_471616             452   1e-149   
ref|XP_006428983.1|  hypothetical protein CICLE_v10013750mg             451   2e-149   
ref|XP_009126031.1|  PREDICTED: probable pectate lyase 19               452   2e-149   
ref|XP_010106682.1|  hypothetical protein L484_004616                   449   2e-149   
ref|XP_009117903.1|  PREDICTED: probable pectate lyase 3                451   3e-149   
ref|XP_010450167.1|  PREDICTED: probable pectate lyase 15 isoform X1    451   3e-149   
ref|XP_010450168.1|  PREDICTED: probable pectate lyase 15 isoform X2    451   4e-149   
gb|EPS62426.1|  hypothetical protein M569_12361                         448   1e-148   
ref|XP_010096345.1|  putative pectate lyase 7                           447   1e-148   
ref|XP_008460726.1|  PREDICTED: probable pectate lyase 8 isoform X1     449   1e-148   
ref|XP_003535958.1|  PREDICTED: probable pectate lyase 1-like           449   1e-148   
ref|XP_010425041.1|  PREDICTED: probable pectate lyase 6                449   2e-148   
ref|XP_010502279.1|  PREDICTED: probable pectate lyase 6                449   2e-148   
ref|XP_011085777.1|  PREDICTED: probable pectate lyase P59              448   3e-148   
ref|XP_009391056.1|  PREDICTED: probable pectate lyase 8                448   6e-148   
emb|CDX74293.1|  BnaA03g27540D                                          448   6e-148   
emb|CDY53564.1|  BnaC04g55760D                                          447   7e-148   
ref|XP_007145412.1|  hypothetical protein PHAVU_007G236800g             447   7e-148   
emb|CDX70590.1|  BnaC03g06740D                                          448   7e-148   
ref|XP_002297822.1|  pectate lyase family protein                       447   8e-148   Populus trichocarpa [western balsam poplar]
gb|KGN47799.1|  hypothetical protein Csa_6G404140                       446   8e-148   
ref|XP_008460727.1|  PREDICTED: probable pectate lyase 1 isoform X2     446   9e-148   
ref|XP_002871648.1|  pectate lyase family protein                       448   9e-148   
ref|XP_004134015.1|  PREDICTED: probable pectate lyase 15-like          447   1e-147   
ref|XP_006292606.1|  hypothetical protein CARUB_v10018855mg             447   1e-147   
emb|CDX91953.1|  BnaC03g32550D                                          447   1e-147   
ref|XP_002884619.1|  pectate lyase family protein                       446   1e-147   
gb|KHG07401.1|  putative pectate lyase P59                              446   1e-147   
gb|KFK43687.1|  hypothetical protein AALP_AA1G160000                    447   1e-147   
ref|XP_006282594.1|  hypothetical protein CARUB_v10004736mg             447   2e-147   
sp|Q9LFP5.1|PLY19_ARATH  RecName: Full=Probable pectate lyase 19;...    447   2e-147   Arabidopsis thaliana [mouse-ear cress]
ref|NP_172894.1|  putative pectate lyase 3                              446   2e-147   Arabidopsis thaliana [mouse-ear cress]
gb|AAF19196.1|AF206320_1  pectate lyase 2                               446   3e-147   Musa acuminata [banana]
ref|XP_010447044.1|  PREDICTED: probable pectate lyase 8                444   3e-147   
ref|XP_010496063.1|  PREDICTED: probable pectate lyase 3                446   3e-147   
ref|XP_009385867.1|  PREDICTED: probable pectate lyase 8 isoform X2     446   3e-147   
ref|NP_001057945.1|  Os06g0583900                                       446   3e-147   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010243989.1|  PREDICTED: probable pectate lyase 8                445   4e-147   
ref|XP_010486231.1|  PREDICTED: probable pectate lyase 8                444   4e-147   
gb|ACF87417.1|  unknown                                                 445   4e-147   Zea mays [maize]
ref|XP_007157384.1|  hypothetical protein PHAVU_002G065800g             445   4e-147   
ref|XP_004966014.1|  PREDICTED: pectate lyase-like                      447   4e-147   
ref|XP_002437204.1|  hypothetical protein SORBIDRAFT_10g022830          446   4e-147   Sorghum bicolor [broomcorn]
ref|XP_008679844.1|  PREDICTED: pectate lyase                           445   5e-147   
ref|XP_002265100.1|  PREDICTED: probable pectate lyase 8                445   5e-147   Vitis vinifera
ref|XP_010264036.1|  PREDICTED: probable pectate lyase 8                445   5e-147   
emb|CAN75298.1|  hypothetical protein VITISV_008675                     445   5e-147   Vitis vinifera
emb|CBI15265.3|  unnamed protein product                                443   5e-147   
ref|XP_009139602.1|  PREDICTED: probable pectate lyase 15               445   5e-147   
ref|XP_008667903.1|  PREDICTED: pectate lyase 8 isoform X1              446   6e-147   
ref|NP_187357.1|  putative pectate lyase 8                              444   7e-147   Arabidopsis thaliana [mouse-ear cress]
sp|P40973.1|PLY_LILLO  RecName: Full=Pectate lyase; Flags: Precursor    444   7e-147   Lilium longiflorum [Easter lily]
gb|KDP33375.1|  hypothetical protein JCGZ_12924                         445   7e-147   
ref|XP_010464311.1|  PREDICTED: probable pectate lyase 8                444   7e-147   
emb|CDX81636.1|  BnaC08g39650D                                          446   8e-147   
ref|XP_003555714.2|  PREDICTED: probable pectate lyase 1-like           446   8e-147   
emb|CDY53552.1|  BnaA09g57110D                                          446   8e-147   
emb|CDY01151.1|  BnaA04g06680D                                          445   8e-147   
ref|XP_007034463.1|  Pectin lyase-like superfamily protein              444   9e-147   
gb|KHG06252.1|  hypothetical protein F383_10745                         444   9e-147   
ref|XP_002453531.1|  hypothetical protein SORBIDRAFT_04g007450          444   1e-146   Sorghum bicolor [broomcorn]
ref|XP_010476496.1|  PREDICTED: probable pectate lyase 3                444   1e-146   
ref|XP_006297767.1|  hypothetical protein CARUB_v10013802mg             443   1e-146   
gb|AAM61584.1|  putative pectate lyase                                  443   1e-146   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011020694.1|  PREDICTED: probable pectate lyase 8                444   1e-146   
ref|XP_003563707.1|  PREDICTED: pectate lyase-like                      444   1e-146   
ref|XP_004951474.1|  PREDICTED: pectate lyase-like                      444   1e-146   
ref|XP_004497757.1|  PREDICTED: probable pectate lyase 15-like          444   1e-146   
ref|XP_007201029.1|  hypothetical protein PRUPE_ppa006229mg             443   1e-146   
gb|KDP26417.1|  hypothetical protein JCGZ_17575                         444   2e-146   
ref|XP_009131435.1|  PREDICTED: probable pectate lyase 19               445   2e-146   
ref|XP_010532870.1|  PREDICTED: putative pectate lyase 14               443   2e-146   
ref|XP_006297766.1|  hypothetical protein CARUB_v10013802mg             441   2e-146   
ref|XP_009385866.1|  PREDICTED: probable pectate lyase 8 isoform X1     445   2e-146   
gb|KHG30349.1|  hypothetical protein F383_15991                         445   2e-146   
ref|XP_010935685.1|  PREDICTED: probable pectate lyase 8 isoform X1     444   2e-146   
gb|AAB69759.1|  putative pectate lyase                                  444   2e-146   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004171543.1|  PREDICTED: probable pectate lyase 15-like          443   3e-146   
ref|XP_009148818.1|  PREDICTED: probable pectate lyase 3                444   3e-146   
ref|XP_002521130.1|  Pectate lyase precursor, putative                  443   3e-146   Ricinus communis
ref|XP_004138973.1|  PREDICTED: probable pectate lyase 15-like          443   3e-146   
gb|ACB12931.1|  pectate lyase 1-27                                      443   3e-146   Populus tremula x Populus tremuloides
ref|XP_002870357.1|  pectate lyase family protein                       444   3e-146   
ref|XP_006306515.1|  hypothetical protein CARUB_v10012514mg             443   4e-146   
ref|XP_011073763.1|  PREDICTED: probable pectate lyase 8                443   4e-146   
ref|XP_008438392.1|  PREDICTED: probable pectate lyase 8                443   4e-146   
ref|NP_567409.1|  probable pectate lyase 15                             444   4e-146   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009134622.1|  PREDICTED: probable pectate lyase 7                444   5e-146   
ref|NP_178375.1|  putative pectate lyase 6                              443   5e-146   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010935686.1|  PREDICTED: probable pectate lyase 8 isoform X2     442   5e-146   
ref|NP_001190720.1|  probable pectate lyase 15                          442   5e-146   
ref|XP_011002172.1|  PREDICTED: probable pectate lyase 8                442   6e-146   
gb|AAK66161.1|  pectate lyase                                           439   7e-146   Fragaria x ananassa
ref|XP_006484673.1|  PREDICTED: probable pectate lyase 19-like          442   7e-146   
ref|XP_008460728.1|  PREDICTED: probable pectate lyase 1 isoform X3     439   8e-146   
ref|XP_006482544.1|  PREDICTED: probable pectate lyase 19-like          441   8e-146   
ref|NP_001147553.1|  pectate lyase 8                                    442   9e-146   
ref|XP_004298448.1|  PREDICTED: probable pectate lyase 3-like           442   1e-145   
ref|XP_002304700.1|  pectate lyase family protein                       442   1e-145   
ref|XP_010453638.1|  PREDICTED: probable pectate lyase 19               443   1e-145   
gb|AFW87059.1|  pectate lyase                                           442   1e-145   
emb|CDY45254.1|  BnaA06g09240D                                          442   2e-145   
ref|XP_010420164.1|  PREDICTED: probable pectate lyase 19 isoform X2    442   2e-145   
ref|XP_006437462.1|  hypothetical protein CICLE_v10031653mg             440   2e-145   
ref|XP_003571658.1|  PREDICTED: pectate lyase-like                      441   2e-145   
ref|XP_004975048.1|  PREDICTED: probable pectate lyase 15-like is...    441   2e-145   
ref|NP_001150723.1|  pectate lyase precursor                            441   2e-145   
ref|NP_001141589.1|  uncharacterized protein LOC100273705               442   2e-145   
emb|CDY39314.1|  BnaC05g10650D                                          441   2e-145   
ref|XP_009107745.1|  PREDICTED: probable pectate lyase 15               441   3e-145   
ref|XP_009775177.1|  PREDICTED: probable pectate lyase 8                441   3e-145   
dbj|BAF43573.1|  pectate lyase                                          440   3e-145   
gb|EEE60442.1|  hypothetical protein OsJ_13660                          440   3e-145   
ref|XP_006579282.1|  PREDICTED: probable pectate lyase P59-like         439   4e-145   
ref|XP_010023767.1|  PREDICTED: probable pectate lyase 8 isoform X1     440   5e-145   
gb|KFK38096.1|  hypothetical protein AALP_AA3G068900                    439   6e-145   
gb|EEC76710.1|  hypothetical protein OsI_14719                          441   6e-145   
ref|XP_007222160.1|  hypothetical protein PRUPE_ppa005761mg             440   6e-145   
ref|XP_006431087.1|  hypothetical protein CICLE_v10011762mg             439   7e-145   
gb|EYU46355.1|  hypothetical protein MIMGU_mgv1a007094mg                439   7e-145   
gb|KFK37588.1|  hypothetical protein AALP_AA3G002600                    440   8e-145   
ref|XP_004289729.1|  PREDICTED: probable pectate lyase 15-like          439   8e-145   
emb|CDO99404.1|  unnamed protein product                                439   9e-145   
emb|CBI33346.3|  unnamed protein product                                439   1e-144   
emb|CDY18738.1|  BnaC08g08780D                                          440   1e-144   
ref|XP_003622996.1|  Pectate lyase 1-27                                 439   1e-144   
gb|KEH41255.1|  pectate lyase family protein                            439   1e-144   
ref|XP_008235520.1|  PREDICTED: probable pectate lyase 8                439   1e-144   
ref|XP_004975047.1|  PREDICTED: probable pectate lyase 15-like is...    440   1e-144   
emb|CAE02420.2|  OSJNBa0095E20.8                                        440   1e-144   
ref|XP_010023768.1|  PREDICTED: probable pectate lyase 1 isoform X2     438   1e-144   
emb|CAB36835.1|  putative pectate lyase A11 (fragment)                  436   1e-144   
gb|KDO65869.1|  hypothetical protein CISIN_1g013239mg                   439   2e-144   
ref|XP_006480190.1|  PREDICTED: probable pectate lyase 8-like           439   2e-144   
gb|AFZ78654.1|  pectate lyase                                           439   2e-144   
ref|XP_008812405.1|  PREDICTED: probable pectate lyase 8                439   2e-144   
ref|XP_002285639.2|  PREDICTED: probable pectate lyase 8                439   2e-144   
ref|XP_002875142.1|  pectate lyase family protein                       439   2e-144   
gb|KHN45481.1|  Putative pectate lyase 3                                436   3e-144   
ref|XP_010527219.1|  PREDICTED: probable pectate lyase 10               436   3e-144   
ref|XP_010038352.1|  PREDICTED: probable pectate lyase 8                438   3e-144   
ref|XP_008223974.1|  PREDICTED: probable pectate lyase 8                438   4e-144   
emb|CDY09356.1|  BnaA02g26540D                                          438   4e-144   
gb|KDO49230.1|  hypothetical protein CISIN_1g036607mg                   437   4e-144   
emb|CDY05305.1|  BnaC05g44980D                                          436   4e-144   
ref|XP_009111860.1|  PREDICTED: probable pectate lyase 20               436   5e-144   
ref|XP_010239620.1|  PREDICTED: probable pectate lyase 8 isoform X2     437   5e-144   
ref|XP_009593549.1|  PREDICTED: probable pectate lyase 8                437   5e-144   
ref|XP_009114192.1|  PREDICTED: probable pectate lyase 6                438   6e-144   
ref|XP_009400924.1|  PREDICTED: probable pectate lyase 8 isoform X2     437   6e-144   
ref|XP_009129128.1|  PREDICTED: probable pectate lyase 6                437   6e-144   
emb|CDY04133.1|  BnaA09g19110D                                          437   7e-144   
ref|XP_008800563.1|  PREDICTED: probable pectate lyase 8 isoform X1     437   7e-144   
emb|CDY17432.1|  BnaC09g21050D                                          437   8e-144   
ref|XP_010940647.1|  PREDICTED: probable pectate lyase 8                437   9e-144   
emb|CDY24654.1|  BnaA05g30530D                                          436   9e-144   
ref|XP_008800564.1|  PREDICTED: probable pectate lyase 8 isoform X2     437   1e-143   
ref|XP_009408120.1|  PREDICTED: probable pectate lyase 8                436   1e-143   
ref|XP_009121613.1|  PREDICTED: probable pectate lyase 19               438   1e-143   
ref|XP_010239619.1|  PREDICTED: probable pectate lyase 8 isoform X1     436   1e-143   
ref|XP_004975046.1|  PREDICTED: probable pectate lyase 15-like is...    438   2e-143   
ref|XP_009799817.1|  PREDICTED: probable pectate lyase 8                436   2e-143   
ref|NP_189110.1|  probable pectate lyase 10                             436   2e-143   
ref|XP_007140561.1|  hypothetical protein PHAVU_008G123000g             436   2e-143   
ref|XP_004501839.1|  PREDICTED: probable pectate lyase 5-like           434   2e-143   
emb|CDY19932.1|  BnaA09g03190D                                          435   2e-143   
dbj|BAK06965.1|  predicted protein                                      435   3e-143   
ref|XP_009400922.1|  PREDICTED: probable pectate lyase 8 isoform X1     436   3e-143   
ref|XP_008391438.1|  PREDICTED: probable pectate lyase 8                435   3e-143   
ref|XP_009384552.1|  PREDICTED: probable pectate lyase 8                436   3e-143   
ref|XP_010545988.1|  PREDICTED: probable pectate lyase 22               434   4e-143   
ref|XP_009609746.1|  PREDICTED: probable pectate lyase 8                435   4e-143   
ref|XP_008360481.1|  PREDICTED: probable pectate lyase 8                435   4e-143   
emb|CDY56668.1|  BnaCnng30870D                                          434   4e-143   
ref|XP_004299169.1|  PREDICTED: probable pectate lyase 18-like          434   5e-143   
gb|EMT28700.1|  hypothetical protein F775_17439                         433   5e-143   
gb|KCW57296.1|  hypothetical protein EUGRSUZ_H00093                     435   6e-143   
ref|XP_003530885.1|  PREDICTED: probable pectate lyase 20-like          435   6e-143   
ref|XP_010684949.1|  PREDICTED: probable pectate lyase 8                434   6e-143   
gb|EPS68938.1|  hypothetical protein M569_05827                         432   6e-143   
ref|XP_008351757.1|  PREDICTED: probable pectate lyase 18               433   7e-143   
ref|XP_010492335.1|  PREDICTED: probable pectate lyase 19               436   7e-143   
ref|XP_009370039.1|  PREDICTED: probable pectate lyase 8                434   8e-143   
dbj|BAH20311.1|  AT3G01270                                              431   8e-143   
ref|XP_007209185.1|  hypothetical protein PRUPE_ppa006392mg             433   9e-143   
ref|XP_010672089.1|  PREDICTED: probable pectate lyase 1                434   9e-143   
ref|XP_009349844.1|  PREDICTED: probable pectate lyase 8                434   9e-143   
ref|XP_011091390.1|  PREDICTED: probable pectate lyase 8                434   1e-142   
ref|XP_004489554.1|  PREDICTED: probable pectate lyase 5-like           432   1e-142   
ref|XP_010102919.1|  hypothetical protein L484_018936                   432   1e-142   
ref|XP_003552152.2|  PREDICTED: probable pectate lyase 20-like          434   1e-142   
ref|XP_009147117.1|  PREDICTED: probable pectate lyase 8                433   1e-142   
gb|EYU43815.1|  hypothetical protein MIMGU_mgv1a006554mg                434   1e-142   
emb|CDP03845.1|  unnamed protein product                                433   1e-142   
ref|XP_010317101.1|  PREDICTED: probable pectate lyase P59              431   2e-142   
emb|CDY41679.1|  BnaC02g34750D                                          434   2e-142   
ref|XP_010527871.1|  PREDICTED: probable pectate lyase 3 isoform X1     442   2e-142   
dbj|BAI94495.1|  pectate lyase                                          432   2e-142   
ref|XP_009362042.1|  PREDICTED: probable pectate lyase 8                433   2e-142   
ref|XP_010069078.1|  PREDICTED: probable pectate lyase 8                433   2e-142   
ref|XP_010918897.1|  PREDICTED: probable pectate lyase 8 isoform X2     432   2e-142   
emb|CDP02199.1|  unnamed protein product                                429   2e-142   
ref|XP_008372438.1|  PREDICTED: probable pectate lyase 8                433   2e-142   
ref|XP_006854398.1|  hypothetical protein AMTR_s00039p00189000          433   2e-142   
ref|XP_010918895.1|  PREDICTED: probable pectate lyase 8 isoform X1     433   3e-142   
gb|AGC94753.1|  putative pectate lyase                                  431   3e-142   
dbj|BAB01216.1|  pectate lyase                                          433   3e-142   
ref|XP_004152502.1|  PREDICTED: probable pectate lyase 22-like          431   3e-142   
ref|XP_007155507.1|  hypothetical protein PHAVU_003G207400g             431   3e-142   
ref|XP_004157771.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    431   3e-142   
ref|XP_011024740.1|  PREDICTED: probable pectate lyase 20               432   4e-142   
ref|XP_011080166.1|  PREDICTED: probable pectate lyase 8                431   4e-142   
ref|XP_006299938.1|  hypothetical protein CARUB_v10016149mg             434   4e-142   
ref|XP_006443655.1|  hypothetical protein CICLE_v10019202mg             440   4e-142   
ref|XP_009397895.1|  PREDICTED: probable pectate lyase 8                432   4e-142   
ref|XP_004247823.1|  PREDICTED: probable pectate lyase 8                432   4e-142   
emb|CDY66593.1|  BnaCnng51570D                                          434   5e-142   
ref|XP_008447332.1|  PREDICTED: probable pectate lyase 8                432   5e-142   
ref|XP_010250930.1|  PREDICTED: probable pectate lyase 5                431   6e-142   
emb|CDY56220.1|  BnaAnng14170D                                          431   6e-142   
gb|AAA16476.1|  pectate lyase homolog                                   432   7e-142   
ref|XP_002301766.2|  hypothetical protein POPTR_0002s23990g             432   7e-142   
gb|AAM67091.1|  putative pectate lyase                                  430   8e-142   
ref|XP_009371193.1|  PREDICTED: probable pectate lyase 8                432   9e-142   
ref|XP_010933172.1|  PREDICTED: probable pectate lyase 8 isoform X2     431   9e-142   
ref|NP_001280201.1|  probable pectate lyase 18 precursor                430   1e-141   
ref|XP_003523121.1|  PREDICTED: probable pectate lyase 18-like          430   1e-141   
ref|XP_009382167.1|  PREDICTED: probable pectate lyase 8                431   1e-141   
ref|XP_009628975.1|  PREDICTED: probable pectate lyase 18               430   1e-141   
ref|XP_010109687.1|  hypothetical protein L484_015172                   431   2e-141   
ref|XP_008804450.1|  PREDICTED: probable pectate lyase 8 isoform X2     430   2e-141   
ref|XP_004515610.1|  PREDICTED: probable pectate lyase 8-like           431   2e-141   
ref|XP_008339288.1|  PREDICTED: probable pectate lyase 8                431   2e-141   
ref|XP_010420163.1|  PREDICTED: probable pectate lyase 19 isoform X1    432   2e-141   
ref|XP_006360328.1|  PREDICTED: probable pectate lyase 15-like          431   2e-141   
gb|EPS63108.1|  hypothetical protein M569_11679                         428   2e-141   
ref|XP_011086701.1|  PREDICTED: probable pectate lyase 5                429   2e-141   
ref|NP_564906.1|  putative pectate lyase 5                              429   2e-141   
ref|XP_011098576.1|  PREDICTED: probable pectate lyase P56              431   3e-141   
ref|XP_004301165.1|  PREDICTED: probable pectate lyase P59-like         430   3e-141   
ref|XP_002437815.1|  hypothetical protein SORBIDRAFT_10g003090          430   3e-141   
gb|EYU32621.1|  hypothetical protein MIMGU_mgv1a006198mg                431   3e-141   
ref|XP_008804449.1|  PREDICTED: probable pectate lyase 8 isoform X1     431   3e-141   
ref|XP_006854397.1|  hypothetical protein AMTR_s00039p00186640          430   3e-141   
ref|XP_010933171.1|  PREDICTED: probable pectate lyase 8 isoform X1     431   3e-141   
emb|CDY01846.1|  BnaC06g28860D                                          429   4e-141   
dbj|BAK05605.1|  predicted protein                                      430   4e-141   
dbj|BAK06362.1|  predicted protein                                      431   4e-141   
ref|XP_006653139.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    431   4e-141   
ref|XP_009359518.1|  PREDICTED: probable pectate lyase 18               429   4e-141   
gb|EYU30593.1|  hypothetical protein MIMGU_mgv1a007569mg                428   4e-141   
emb|CAN76500.1|  hypothetical protein VITISV_004734                     428   5e-141   
ref|XP_009105097.1|  PREDICTED: probable pectate lyase 5                428   6e-141   
ref|XP_010663062.1|  PREDICTED: probable pectate lyase 5                428   6e-141   
ref|XP_004152014.1|  PREDICTED: probable pectate lyase 8-like           429   6e-141   
ref|XP_010556943.1|  PREDICTED: probable pectate lyase 1                429   7e-141   
ref|XP_004964534.1|  PREDICTED: pectate lyase-like                      429   7e-141   
ref|XP_004290232.1|  PREDICTED: probable pectate lyase 8-like           429   8e-141   
gb|KDO49831.1|  hypothetical protein CISIN_1g044170mg                   426   8e-141   
gb|EAY99626.1|  hypothetical protein OsI_21605                          429   8e-141   
ref|XP_004515847.1|  PREDICTED: probable pectate lyase 22-like          428   9e-141   
ref|XP_006302330.1|  hypothetical protein CARUB_v10020387mg             427   9e-141   
ref|XP_004163042.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    427   9e-141   
ref|XP_009105327.1|  PREDICTED: probable pectate lyase 5                427   1e-140   
ref|XP_011040439.1|  PREDICTED: probable pectate lyase 18               427   1e-140   
ref|NP_001289258.1|  probable pectate lyase 18 precursor                427   1e-140   
ref|XP_006487597.1|  PREDICTED: probable pectate lyase 1-like           429   1e-140   
ref|NP_001052103.1|  Os04g0137100                                       431   1e-140   
gb|KFK41187.1|  hypothetical protein AALP_AA2G097000                    427   1e-140   
ref|XP_010547043.1|  PREDICTED: probable pectate lyase 8                427   2e-140   
emb|CDY66697.1|  BnaAnng22760D                                          428   2e-140   
ref|XP_011086987.1|  PREDICTED: probable pectate lyase 22               427   2e-140   
gb|KHN34377.1|  Putative pectate lyase 22                               427   2e-140   
ref|XP_010457526.1|  PREDICTED: probable pectate lyase 1                427   2e-140   
ref|XP_007049844.1|  Pectin lyase-like superfamily protein              428   2e-140   
ref|XP_009111089.1|  PREDICTED: probable pectate lyase 1                427   3e-140   
ref|XP_006280540.1|  hypothetical protein CARUB_v10026482mg             427   3e-140   
ref|XP_011009338.1|  PREDICTED: probable pectate lyase 8                427   3e-140   
ref|XP_010475133.1|  PREDICTED: probable pectate lyase 1                427   3e-140   
ref|NP_563715.1|  putative pectate lyase 1                              427   3e-140   
ref|XP_003618787.1|  Pectate lyase                                      426   3e-140   
dbj|BAB10560.1|  pectate lyase                                          426   3e-140   
gb|AEN70985.1|  pectate lyase                                           426   4e-140   
ref|NP_568967.1|  putative pectate lyase 22                             427   4e-140   
ref|XP_010484103.1|  PREDICTED: probable pectate lyase 1                427   4e-140   
emb|CDX86615.1|  BnaC08g00880D                                          427   4e-140   
gb|EYU17974.1|  hypothetical protein MIMGU_mgv1a006571mg                427   5e-140   
gb|KHG19997.1|  hypothetical protein F383_02891                         426   5e-140   
ref|XP_009411363.1|  PREDICTED: probable pectate lyase 8                427   5e-140   
ref|XP_002318694.1|  pectate lyase 22 precursor family protein          426   5e-140   
ref|XP_006307575.1|  hypothetical protein CARUB_v10009197mg             426   6e-140   
ref|XP_010550068.1|  PREDICTED: probable pectate lyase 19               427   6e-140   
ref|XP_002892236.1|  pectate lyase family protein                       426   6e-140   
gb|ADB90475.1|  pectate lyase                                           425   8e-140   
gb|AEN70981.1|  pectate lyase                                           425   9e-140   
gb|AEN70964.1|  pectate lyase                                           425   1e-139   
gb|AEN70963.1|  pectate lyase                                           425   1e-139   
ref|XP_007037815.1|  Pectin lyase-like superfamily protein isoform 1    425   1e-139   
ref|XP_002887143.1|  pectate lyase family protein                       425   1e-139   
ref|XP_010320956.1|  PREDICTED: probable pectate lyase 5                424   1e-139   
emb|CDX77470.1|  BnaA07g06080D                                          427   1e-139   
ref|XP_006341783.1|  PREDICTED: probable pectate lyase 5-like           424   1e-139   
ref|XP_009586995.1|  PREDICTED: probable pectate lyase 5                424   1e-139   
ref|XP_006420567.1|  hypothetical protein CICLE_v10004783mg             428   1e-139   
gb|KFK31278.1|  hypothetical protein AALP_AA6G091900                    425   1e-139   
gb|AAG28907.1|AC008113_23  F12A21.12                                    424   2e-139   
ref|XP_009102560.1|  PREDICTED: probable pectate lyase 9                426   2e-139   
gb|AFK44189.1|  unknown                                                 424   2e-139   
ref|XP_010442341.1|  PREDICTED: probable pectate lyase 20               424   2e-139   
ref|XP_002285340.1|  PREDICTED: probable pectate lyase 5                424   2e-139   
ref|XP_010439830.1|  PREDICTED: probable pectate lyase 20               424   2e-139   
ref|XP_002321242.2|  pectate lyase family protein                       422   2e-139   
emb|CDY65626.1|  BnaC03g74840D                                          426   2e-139   
ref|XP_008439105.1|  PREDICTED: probable pectate lyase 22               424   2e-139   
emb|CDX89799.1|  BnaA10g02830D                                          425   2e-139   
ref|XP_002863927.1|  pectate lyase family protein                       424   3e-139   



>ref|XP_009758350.1| PREDICTED: pectate lyase-like [Nicotiana sylvestris]
Length=445

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/425 (69%), Positives = 351/425 (83%), Gaps = 15/425 (4%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH-  1502
             A+IAE+D YL+KKA+EAL+SSL AY  NPEE+TD FN+EVG+TI N    TRRHL+    
Sbjct  27    ANIAEFDPYLEKKAEEALKSSLAAYNENPEELTDTFNKEVGETIFN---GTRRHLKEEDK  83

Query  1501  --------CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDK  1346
                     CKA N ID+CWRCD++WA +RK LA CARGFG GTTGG  G+FYVVTD SD 
Sbjct  84    DDKDDNDGCKAYNPIDKCWRCDKNWANNRKALADCARGFGHGTTGGKDGKFYVVTDPSDD  143

Query  1345  DMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLT  1166
             ++E PKPGTLRHAVIQEEPLWIIF+KSM+I L+QEL+IN+DKTIDGRGVSVH+AYGAGLT
Sbjct  144   NVEEPKPGTLRHAVIQEEPLWIIFEKSMIIKLQQELMINNDKTIDGRGVSVHVAYGAGLT  203

Query  1165  IQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSR  986
             IQFV NVI+H I++HHIL   GGMIRDS++HIGLRT+SDGD ISIFG+N +W+DH T+++
Sbjct  204   IQFVHNVIVHNIRVHHILSTSGGMIRDSIDHIGLRTVSDGDAISIFGANRIWIDHCTLTK  263

Query  985   CSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRM  806
              +DGLIDAIMASTAITISNCKFNHHN V+LLGA+D F +D IMQVTVAFNRFGKG IQRM
Sbjct  264   GADGLIDAIMASTAITISNCKFNHHNDVMLLGANDAFPQDKIMQVTVAFNRFGKGCIQRM  323

Query  805   PRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVW  626
             PRCRWGFFH+VNNDY KWEMYAIGG++ PTI+SQGNRFKAS+NP TK+VT R    +++W
Sbjct  324   PRCRWGFFHVVNNDYAKWEMYAIGGTANPTIISQGNRFKASNNPNTKEVTNRNGAPESLW  383

Query  625   KNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCK  446
             +NWQWRSEGDLFLNGAYF ESG ++ H   T F     I+  PA +VGRLTR +G +KCK
Sbjct  384   RNWQWRSEGDLFLNGAYFRESGPDIKH---TPFTEHTSIKFEPAKFVGRLTRKAGVIKCK  440

Query  445   VGRFC  431
             +G+ C
Sbjct  441   IGKAC  445



>ref|XP_009599232.1| PREDICTED: pectate lyase-like [Nicotiana tomentosiformis]
Length=445

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/426 (69%), Positives = 350/426 (82%), Gaps = 15/426 (4%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH  1502
              A+IAE+D YL+KKA+EAL+SSL AY  NPEE+TD FN+EVG+TI N    TRRHL+   
Sbjct  26    HANIAEFDPYLEKKAEEALKSSLAAYNENPEELTDTFNKEVGETIFN---GTRRHLKEED  82

Query  1501  ---------CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSD  1349
                      CKA N ID+CWRCD++WA +RK LA CARGFG GTTGG  G+FYVVTD SD
Sbjct  83    KDDKDDNDGCKAYNPIDKCWRCDKNWANNRKALADCARGFGHGTTGGKDGKFYVVTDPSD  142

Query  1348  KDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGL  1169
              ++E P PGTLRHAVIQEEPLWIIF+KSM+I LKQEL+IN+DKTIDGRGVSVH+AYGAGL
Sbjct  143   DNVEEPNPGTLRHAVIQEEPLWIIFEKSMIIRLKQELMINNDKTIDGRGVSVHVAYGAGL  202

Query  1168  TIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMS  989
             TIQFV NVI+H I++HHIL   GGMIRDS++HIGLRT+SDGD ISIFG+N +W+DH T++
Sbjct  203   TIQFVHNVIVHNIRVHHILSTSGGMIRDSIDHIGLRTVSDGDAISIFGANRIWIDHCTLT  262

Query  988   RCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQR  809
             + +DGLIDAIMASTAITISNCKFNHHN V+LLGA+D F +D IMQVTVAFNRFGKG IQR
Sbjct  263   KGADGLIDAIMASTAITISNCKFNHHNDVMLLGANDAFPQDKIMQVTVAFNRFGKGCIQR  322

Query  808   MPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNV  629
             MPRCRWGFFH+VNNDY KWEMYAIGG++ PTI+SQGNRFKAS+NP TK+VT R    +++
Sbjct  323   MPRCRWGFFHVVNNDYAKWEMYAIGGTANPTIISQGNRFKASNNPNTKEVTNRNGAPESL  382

Query  628   WKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKC  449
             W+NWQWRSEGDLFLNGAYF ESG ++ H   T F     I+  PA +VGRLTR +G +KC
Sbjct  383   WRNWQWRSEGDLFLNGAYFRESGPDIKH---TPFTEHTSIKFEPAKFVGRLTRKAGVIKC  439

Query  448   KVGRFC  431
             K+G+ C
Sbjct  440   KIGKAC  445



>ref|XP_004228388.1| PREDICTED: pectate lyase [Solanum lycopersicum]
Length=439

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/417 (69%), Positives = 344/417 (82%), Gaps = 4/417 (1%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR-GSH  1502
             A IAE+D YL+K+A EAL SSL+AY +NPEE+T+ FN+EVG+ ++ +  + RRHL+    
Sbjct  26    ARIAEFDPYLEKQALEALNSSLEAYTNNPEEITNAFNKEVGNALLKY-KSLRRHLKEKDK  84

Query  1501  CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPG  1322
             C ATN IDRCWRCD++WA++R  L  CARGFG  TTGG  G++YVVTD SD +++ PKPG
Sbjct  85    CMATNPIDRCWRCDKNWAENRMDLEECARGFGHKTTGGKNGKYYVVTDESDDNVQEPKPG  144

Query  1321  TLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVI  1142
             TLRHAVIQEEPLWIIF+KSMVI L+QEL+I  DKTIDGRGV+VHIAYGAGL IQFV NVI
Sbjct  145   TLRHAVIQEEPLWIIFEKSMVIKLRQELMITSDKTIDGRGVAVHIAYGAGLMIQFVHNVI  204

Query  1141  IHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDA  962
             IH I+I +I+   GGMIRDS+NHIGLRT+SDGDGISIFGSNH+W+DH T+S C+DGLIDA
Sbjct  205   IHNIRIQNIISTNGGMIRDSINHIGLRTVSDGDGISIFGSNHIWIDHCTLSECTDGLIDA  264

Query  961   IMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFF  782
             IMASTAITISNCKFN+HN V+LLGA+D F +DAIMQVTVAFNRFG+GLIQRMPRCRWGFF
Sbjct  265   IMASTAITISNCKFNYHNDVMLLGATDAFPQDAIMQVTVAFNRFGEGLIQRMPRCRWGFF  324

Query  781   HIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRSE  602
             H+VNNDYT W+MYAIGGS+ PTI+SQGNRFKAS NP TKQVTKR+  +++ WK WQW SE
Sbjct  325   HVVNNDYTHWQMYAIGGSAHPTIISQGNRFKASDNPNTKQVTKRDYATESEWKKWQWVSE  384

Query  601   GDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             GD FLNGAYFVESG +      T     ++I+ +P S+ GRLTR +G LKCK G  C
Sbjct  385   GDSFLNGAYFVESGPQ--DKKKTALTKNHKIKFKPGSHAGRLTRFAGVLKCKPGIPC  439



>ref|XP_006363934.1| PREDICTED: pectate lyase-like [Solanum tuberosum]
Length=439

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/416 (69%), Positives = 340/416 (82%), Gaps = 2/416 (0%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSHC  1499
             A IAE+DAYL+K+A E L SSL+AY HNPEEVT+ FN+EVG+ ++ + +  R     + C
Sbjct  26    ARIAEFDAYLEKQALEDLNSSLEAYTHNPEEVTNAFNKEVGNALLKYKSLRRNLKEKNKC  85

Query  1498  KATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGT  1319
              ATN IDRCWRCD++WA++R  L  CARGFG  TTGG  G++YVVTD SD +++ PKPGT
Sbjct  86    MATNPIDRCWRCDKNWAENRMDLEECARGFGHKTTGGKNGKYYVVTDESDDNVQEPKPGT  145

Query  1318  LRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVII  1139
             LRHAVIQEEPLWIIF+KSMVI L+QEL+I  DKTIDGRGV+VHIA GAGLTIQFV NVII
Sbjct  146   LRHAVIQEEPLWIIFEKSMVIKLQQELMITSDKTIDGRGVAVHIANGAGLTIQFVHNVII  205

Query  1138  HGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAI  959
             H I+I +I+   GGMIRDSVNHIGLRT+SDGDGISIFGSNH+W+DH T+S C+DGL+DAI
Sbjct  206   HNIRIQNIISTNGGMIRDSVNHIGLRTVSDGDGISIFGSNHIWIDHCTLSECTDGLVDAI  265

Query  958   MASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFH  779
             MASTAITISNCKFNHHN V+LLGA+D F +D+IMQVTVAFNRFG+GLIQRMPRCRWGFFH
Sbjct  266   MASTAITISNCKFNHHNDVMLLGATDAFPQDSIMQVTVAFNRFGEGLIQRMPRCRWGFFH  325

Query  778   IVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRSEG  599
             +VNNDYT W+MYAIGGS+ PTI+SQGNRFKA+ NP TKQVTKR+   ++ WK WQW SEG
Sbjct  326   VVNNDYTHWQMYAIGGSAHPTIISQGNRFKAADNPNTKQVTKRDYAPESEWKKWQWVSEG  385

Query  598   DLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             D FLNGAYFVESG +      T     ++I+ +P S+ GRLTR +G LKCK G  C
Sbjct  386   DSFLNGAYFVESGPQ--DKKKTALTKNHKIKFKPGSHAGRLTRFAGVLKCKPGIPC  439



>ref|XP_006357289.1| PREDICTED: probable pectate lyase 3-like [Solanum tuberosum]
Length=459

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/438 (66%), Positives = 346/438 (79%), Gaps = 28/438 (6%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH-  1502
             A+IA++D YL+K+A+EALQSSL AY  NPE VT  FN+EVG+TI+N    TRRHL+    
Sbjct  28    ANIADFDPYLEKRAEEALQSSLAAYNENPEAVTQIFNKEVGETILN---GTRRHLKEEDK  84

Query  1501  ---------------------CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttggl  1385
                                  CKA N ID+CWRCD++WA +RK LA CARGFG GTTGG 
Sbjct  85    EDKNEKVEKDDKEGDEKSVDICKAYNPIDKCWRCDKNWANNRKALADCARGFGHGTTGGK  144

Query  1384  kgrFYVVTDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGR  1205
              G+FYVVTD SD ++E P PGTLRHAVIQEEPLWIIF+KSM+I LKQEL+IN+DKTIDGR
Sbjct  145   DGKFYVVTDPSDNNVEEPVPGTLRHAVIQEEPLWIIFEKSMIIKLKQELMINNDKTIDGR  204

Query  1204  GVSVHIAYGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFG  1025
             G+SVH+AYGAGLT+QFV NVI+H I++HHIL K GGMIRDSV HIGLRT+SDGD IS+FG
Sbjct  205   GISVHVAYGAGLTLQFVHNVIVHNIRVHHILSKDGGMIRDSVKHIGLRTVSDGDAISLFG  264

Query  1024  SNHVWLDHLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTV  845
             +N +W+DH T+++ +DGL+DAIMASTAITISNCKFNHHN V+LLGA+D F +D IMQVTV
Sbjct  265   ANRIWIDHCTLTKGADGLVDAIMASTAITISNCKFNHHNDVMLLGANDAFPQDKIMQVTV  324

Query  844   AFNRFGKGLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTK  665
             AFNRFGKG IQRMPRCRWGFFH+VNNDY KWEMYAIGG++ PTI+SQGNRFKA+ NP TK
Sbjct  325   AFNRFGKGCIQRMPRCRWGFFHVVNNDYAKWEMYAIGGTANPTIISQGNRFKAADNPNTK  384

Query  664   QVTKREIVSKNVWKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYV  485
             +VT R    + +W+NWQWRSEGDLF NGA+F ESG E+    +T F     I+  PA +V
Sbjct  385   EVTNRNGAPEALWRNWQWRSEGDLFKNGAFFRESGPEIK---STPFTEHTTIQFEPAKFV  441

Query  484   GRLTRTSGALKCKVGRFC  431
             GRLTR +G ++CK+G+ C
Sbjct  442   GRLTRKAGVIQCKIGKAC  459



>emb|CDP00293.1| unnamed protein product [Coffea canephora]
Length=445

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/416 (70%), Positives = 347/416 (83%), Gaps = 4/416 (1%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSHC  1499
             A I E+D +L+K+A++ALQ+SL+AY  +PE VTDNF  +VG  ++   N TRR L+   C
Sbjct  34    AHIGEFDDFLRKRAEDALQASLRAYNPDPEAVTDNFTRQVG-KMLEGGNETRRQLKAGGC  92

Query  1498  KATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGT  1319
              ATN IDRCWRCD +WAK+RKRLA CARGFG  T GG+ G++YVV D SD ++++P+PGT
Sbjct  93    VATNPIDRCWRCDPNWAKNRKRLAKCARGFGRQTKGGMHGKYYVVVDPSDDNVQDPEPGT  152

Query  1318  LRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVII  1139
             LRHAVIQ+EPLWIIF  SMVI L QEL+IN DKTIDGRGV VHIAYGAGL+IQFV+NVII
Sbjct  153   LRHAVIQQEPLWIIFDTSMVIKLNQELLINSDKTIDGRGVEVHIAYGAGLSIQFVQNVII  212

Query  1138  HGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAI  959
             H IKIHHI+PK GG++RDS +HIGLRT SDGDGISIFGSNHVW+DH+++S+CSDGLIDAI
Sbjct  213   HNIKIHHIVPKNGGLVRDSTSHIGLRTRSDGDGISIFGSNHVWIDHVSLSKCSDGLIDAI  272

Query  958   MASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFH  779
             MASTAITISNCKFN+HN V+LLGASD  SEDAIMQVTVAFNRFGKGL+QRMPRCRWGFFH
Sbjct  273   MASTAITISNCKFNNHNDVILLGASDEHSEDAIMQVTVAFNRFGKGLVQRMPRCRWGFFH  332

Query  778   IVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRSEG  599
             IVNNDY++W+MYAIGGS+ PTI+SQGNRFKAS N FTK+VTKR+   K+ W  WQWRSEG
Sbjct  333   IVNNDYSQWQMYAIGGSAHPTIISQGNRFKASKNQFTKEVTKRDYAEKSQWMGWQWRSEG  392

Query  598   DLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             D FLNGA+FVESG  L     + F   N+++ +P SY GRLTR +GALKC+ G+ C
Sbjct  393   DKFLNGAFFVESGPPLKK---SPFTGKNKLQFKPGSYAGRLTRYAGALKCREGKPC  445



>ref|XP_009797403.1| PREDICTED: pectate lyase-like [Nicotiana sylvestris]
Length=439

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/417 (72%), Positives = 354/417 (85%), Gaps = 4/417 (1%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR-GSH  1502
             A IAE+DAYL+K+A EAL SSL AY  +PEE+TD FN EVGDT++N T + RRHL+  S 
Sbjct  26    AGIAEFDAYLEKQAKEALNSSLAAYNEHPEEITDTFNREVGDTLLNIT-SLRRHLKEKSS  84

Query  1501  CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPG  1322
             C  TN IDRCWRCD++WAK+RK+LA CARGFG  TTGG  GR+YVVTD SD D+++PKPG
Sbjct  85    CMTTNPIDRCWRCDENWAKNRKKLAECARGFGHKTTGGKAGRYYVVTDDSDDDVKDPKPG  144

Query  1321  TLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVI  1142
             TLRHAVIQEEPLWIIF+KSMVI LK+EL+I  DKTIDGRGVS++IAYGAGLTIQFV NVI
Sbjct  145   TLRHAVIQEEPLWIIFEKSMVIKLKEELMITSDKTIDGRGVSIYIAYGAGLTIQFVHNVI  204

Query  1141  IHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDA  962
             IH I+IHHI+   GGMIRDSV HIG+RT+SDGDGISIFGSNH+W+DH T+S+C+DGLIDA
Sbjct  205   IHNIRIHHIISTSGGMIRDSVKHIGIRTLSDGDGISIFGSNHIWIDHCTLSQCTDGLIDA  264

Query  961   IMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFF  782
             IMASTAITISNCKFNHHN V+LLGA+D F +D+IMQVTVAFNRFGKGLIQRMPRCRWGFF
Sbjct  265   IMASTAITISNCKFNHHNDVMLLGATDAFPQDSIMQVTVAFNRFGKGLIQRMPRCRWGFF  324

Query  781   HIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRSE  602
             H+VNNDY+ W+MYAIGGS+ PTI+SQGNRFKA++NP TKQVTKR+   ++VWKNWQW SE
Sbjct  325   HVVNNDYSHWQMYAIGGSANPTIISQGNRFKAANNPNTKQVTKRDYAPESVWKNWQWVSE  384

Query  601   GDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             GDLFLNGAYFVESG +  +   +     +RI+ +P SY GRLTR +G  KCK+G  C
Sbjct  385   GDLFLNGAYFVESGPQ--NKKKSALTKPHRIKFKPGSYAGRLTRYAGVRKCKIGTPC  439



>ref|XP_009627245.1| PREDICTED: pectate lyase-like [Nicotiana tomentosiformis]
Length=440

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/418 (72%), Positives = 352/418 (84%), Gaps = 5/418 (1%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR-GSH  1502
             A IAE+DAYL+ KA EAL SSL AY  +PE+VT+ FN EVGDT++N T + RRHL+  S 
Sbjct  26    AQIAEFDAYLENKAKEALNSSLAAYNEHPEQVTNTFNREVGDTLLNIT-SLRRHLKEKSS  84

Query  1501  CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPG  1322
             C ATN IDRCWRCD++WAK+RK+LA CARGFG  TTGG  GR+YVVTD SD D+++PKPG
Sbjct  85    CMATNPIDRCWRCDENWAKNRKKLADCARGFGHKTTGGKAGRYYVVTDDSDDDVKDPKPG  144

Query  1321  TLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVI  1142
             TLRHAVIQEEPLWIIF+KSM+I LKQEL+I  DKTIDGRGVS+HIAYGAG TIQFV NVI
Sbjct  145   TLRHAVIQEEPLWIIFEKSMIIRLKQELMITSDKTIDGRGVSLHIAYGAGFTIQFVHNVI  204

Query  1141  IHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDA  962
             IH I+IHHI+   GGMIRDS  HIG+RT+SDGDGISIFGSNH+W+DH T+S+C+DGLIDA
Sbjct  205   IHNIRIHHIISTSGGMIRDSGKHIGIRTVSDGDGISIFGSNHIWIDHCTLSQCTDGLIDA  264

Query  961   IMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFF  782
             IMASTAITISNCKFNHHN V+LLGA+D F +D+IMQVTVAFNRFGKGLIQRMPRCRWGFF
Sbjct  265   IMASTAITISNCKFNHHNDVMLLGATDAFPQDSIMQVTVAFNRFGKGLIQRMPRCRWGFF  324

Query  781   HIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRSE  602
             H+VNNDY+ W+MYAIGGS+ PTI+SQGNRFKA++NP TKQVTKR+   ++VWKNWQW SE
Sbjct  325   HVVNNDYSHWQMYAIGGSANPTIISQGNRFKAANNPNTKQVTKRDYAPESVWKNWQWVSE  384

Query  601   GDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGAL-KCKVGRFC  431
             GDLFLNGAYFVESG +  +   +     +RI+ +P SY GRLTR +G L KCK G  C
Sbjct  385   GDLFLNGAYFVESGPQ--NKKKSALTKPHRIKFKPGSYAGRLTRYAGVLIKCKAGTPC  440



>ref|XP_011086389.1| PREDICTED: pectate lyase-like [Sesamum indicum]
Length=442

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/416 (64%), Positives = 327/416 (79%), Gaps = 3/416 (1%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSHC  1499
             A IA+YD YLKK+A  +L+ S +A+  NPEE+ D+ N++V +T+       +R+LR   C
Sbjct  30    AAIAKYDEYLKKRAQASLEESRKAFNPNPEELADDLNDQVSETLTR--EGGKRNLRQGGC  87

Query  1498  KATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGT  1319
             KATN IDRCWRCD +W K+RK+LA CARGFG   TGG  GR+YVVTD SD DM+ PKPGT
Sbjct  88    KATNPIDRCWRCDPNWDKNRKQLAECARGFGHRATGGKSGRYYVVTDPSDNDMDKPKPGT  147

Query  1318  LRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVII  1139
             LRHAVIQ +PLWIIF ++MVITLK+ELI   DKT+DGRG  VHIAYGAG+T+QFV NVII
Sbjct  148   LRHAVIQPQPLWIIFGRNMVITLKEELIFASDKTVDGRGAEVHIAYGAGITLQFVHNVII  207

Query  1138  HGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAI  959
             H I IH I+P+ GGMIRD+V+HIGLRT SDGDGIS+FGSN++W+DH+++S+ +DGLID I
Sbjct  208   HNIWIHDIVPEPGGMIRDAVDHIGLRTQSDGDGISVFGSNNIWIDHVSLSKGTDGLIDVI  267

Query  958   MASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFH  779
               STA+TISNCKFN+HN V+LLGA D  ++D+IMQVTVAFN+FG+GLIQRMPRCR GF H
Sbjct  268   EGSTAVTISNCKFNNHNDVMLLGAHDGSNKDSIMQVTVAFNQFGEGLIQRMPRCRLGFVH  327

Query  778   IVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRSEG  599
             ++NNDY  W +YAIGGS+  TI+SQGNRFKAS+NP TKQVT+R   S++ WK WQWRSEG
Sbjct  328   VINNDYDSWGLYAIGGSAHSTIISQGNRFKASNNPDTKQVTRRAYASESEWKKWQWRSEG  387

Query  598   DLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             D+FLNGAYFVESG  + H         N I+ RP S+ GRLTR +GA  C  G+ C
Sbjct  388   DMFLNGAYFVESGPPIKH-TKLPLRKKNSIKFRPGSFAGRLTRYAGARMCFPGKLC  442



>gb|EYU28712.1| hypothetical protein MIMGU_mgv1a006498mg [Erythranthe guttata]
Length=442

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/417 (67%), Positives = 338/417 (81%), Gaps = 4/417 (1%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH-  1502
             A IA+YD YL+KKA+E+   SL+A+  NPE+V D  NE+VG+T+++  N +RRHL+  + 
Sbjct  29    AAIAKYDDYLRKKANESFAESLKAFDPNPEKVADELNEQVGETLVH-ENLSRRHLKEEND  87

Query  1501  CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPG  1322
             CKATN IDRCWRCD DW+K+RK+LA C RGFG  TTGG  GR+Y+VTD SD DM+ PK G
Sbjct  88    CKATNPIDRCWRCDGDWSKNRKKLAECVRGFGHRTTGGKDGRYYLVTDPSDDDMDKPKNG  147

Query  1321  TLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVI  1142
             TLRHAVIQ EPLWIIF +SMVI LKQELI   DKT+DGRGV V IAYGAGLT+QFV NVI
Sbjct  148   TLRHAVIQSEPLWIIFARSMVIRLKQELIFASDKTVDGRGVRVRIAYGAGLTLQFVHNVI  207

Query  1141  IHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDA  962
             IH I+IH+I+   GGMIRD+V+HIGLRT+SDGDGI++F SN++W+DH+++S+ +DGLID 
Sbjct  208   IHNIRIHNIVSTPGGMIRDAVDHIGLRTVSDGDGINVFSSNNIWIDHVSLSKGTDGLIDV  267

Query  961   IMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFF  782
             I  STAITISNCKFN+HN V+LLGA D  ++D IMQVTVAFNRFGKGL+QRMPRCRWGFF
Sbjct  268   IEGSTAITISNCKFNNHNTVMLLGAHDNSTKDTIMQVTVAFNRFGKGLVQRMPRCRWGFF  327

Query  781   HIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRSE  602
             H++NNDY+KW MYAIGGSS PTI+SQGNRFKAS NPFTKQVTKRE  +++ WK WQWRSE
Sbjct  328   HVINNDYSKWLMYAIGGSSNPTIISQGNRFKASDNPFTKQVTKRE-STESEWKKWQWRSE  386

Query  601   GDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             GD F+NGAYF ESG ++ H   +     N I+ +P SY GRLTR +GAL C  G+ C
Sbjct  387   GDKFVNGAYFRESGPKVKH-TISPLKEKNLIKFKPGSYAGRLTRYAGALNCVAGKSC  442



>gb|EYU22437.1| hypothetical protein MIMGU_mgv1a006496mg [Erythranthe guttata]
Length=442

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/417 (66%), Positives = 334/417 (80%), Gaps = 3/417 (1%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGS-H  1502
             A  A  D YL+KKA+EA Q SLQAY  +PEE+T+ FNE VG+T++   N TRR L+ +  
Sbjct  28    AQNATMDEYLQKKAEEAYQESLQAYNPHPEELTEEFNELVGETLIG-QNATRRQLKQTGE  86

Query  1501  CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPG  1322
             C ATN IDRCWRCD++WAK+RK+LA CARGFG  TTGG KGR+Y+VTD SD DM++PKPG
Sbjct  87    CMATNPIDRCWRCDRNWAKNRKKLADCARGFGHQTTGGKKGRYYLVTDPSDNDMDHPKPG  146

Query  1321  TLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVI  1142
             TLRHAVIQ EPLWIIF  SMVI LKQELI   DKT+DGRGV VHIAYGAGLT+QFV NVI
Sbjct  147   TLRHAVIQTEPLWIIFAHSMVIRLKQELIFTSDKTVDGRGVQVHIAYGAGLTLQFVHNVI  206

Query  1141  IHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDA  962
             IH I IH+I+P+ GG+IRD++NH+G RT SDGD ISI+ SN +W+DH+++SR +DGLID 
Sbjct  207   IHNIWIHNIIPRNGGLIRDAINHLGFRTQSDGDAISIYSSNRIWIDHVSLSRATDGLIDI  266

Query  961   IMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFF  782
             I  STAITISNCK NHHN V+LLGA D  S DAIMQVTVAFNRFG GLIQRMPRCRWGFF
Sbjct  267   IEGSTAITISNCKLNHHNDVMLLGAHDAQSRDAIMQVTVAFNRFGIGLIQRMPRCRWGFF  326

Query  781   HIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRSE  602
             H+VNNDY  WE+YAIGGS+ PTI+SQGNRF+A+   +TK+VTKR+  +K+ W  WQWRSE
Sbjct  327   HVVNNDYQHWELYAIGGSAHPTIISQGNRFRAADYQYTKEVTKRDYATKDEWMKWQWRSE  386

Query  601   GDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             GDLF+NGA+F ESG  + H   +  N  N I+ +  S+VGRLTR++GA+KC+ G+ C
Sbjct  387   GDLFMNGAFFTESGPAIKH-VRSPLNGRNMIKFKHGSFVGRLTRSAGAIKCRPGKLC  442



>ref|XP_009342871.1| PREDICTED: pectate lyase-like [Pyrus x bretschneideri]
Length=454

 Score =   526 bits (1354),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 261/427 (61%), Positives = 329/427 (77%), Gaps = 15/427 (4%)
 Frame = -1

Query  1675  DIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIM--------NWTNTTRR  1520
             +IA +DA  +++  +A +++L+AY  NPE+VT++FNE V  T++        +  N+TRR
Sbjct  31    NIANFDAVWQERGMKAQKAALKAYQPNPEQVTEDFNESVEQTVVEEDLEDDQSAGNSTRR  90

Query  1519  HLRGSH----CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSS  1352
             HLRG H    CKATN IDRCWRC  +WA +RK+LA C +GFG  T GG KG +Y+VTDSS
Sbjct  91    HLRGKHNKGPCKATNPIDRCWRCRANWANNRKKLASCVKGFGRKTRGGKKGAYYIVTDSS  150

Query  1351  DKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAG  1172
             D ++ +PKPGTLRHAVIQ +PLWIIF +SMVI L QELI+   KTID RG +VHIA+GAG
Sbjct  151   DDNVHDPKPGTLRHAVIQTQPLWIIFARSMVIRLSQELIVTSHKTIDARGANVHIAHGAG  210

Query  1171  LTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTM  992
             +T+QFV+NVIIHG++IH  +P  GGMIRDS++HIG+RT SDGDGISI+GS+++WLDHL+M
Sbjct  211   ITLQFVQNVIIHGLRIHDTVPGSGGMIRDSLSHIGIRTQSDGDGISIYGSSNIWLDHLSM  270

Query  991   SRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQ  812
               C+DGLIDAI  STAITISNC F  HN V+L GASD F+ DAIMQ+TVAFN FGKGLIQ
Sbjct  271   WNCADGLIDAIQGSTAITISNCHFTRHNDVMLFGASDAFAGDAIMQITVAFNHFGKGLIQ  330

Query  811   RMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKN  632
             RMPRCRWGF H+VNNDYT W MYAIGGSS PTI+SQGNRF A  N   K+VTKR+   ++
Sbjct  331   RMPRCRWGFVHVVNNDYTHWIMYAIGGSSHPTIISQGNRFIAPPNQAAKEVTKRDYAPES  390

Query  631   VWKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALK  452
             VWK+WQWRSEGDL +NGA+FV+SG     +    F   + I+ +P ++V RLTR +G+L 
Sbjct  391   VWKSWQWRSEGDLMMNGAFFVQSGVPNRKH---GFGKLDMIKAKPGTFVTRLTRFAGSLN  447

Query  451   CKVGRFC  431
             CKVG+ C
Sbjct  448   CKVGKKC  454



>ref|XP_008357758.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=459

 Score =   525 bits (1352),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 261/429 (61%), Positives = 331/429 (77%), Gaps = 19/429 (4%)
 Frame = -1

Query  1675  DIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIM--------NWTNTTRR  1520
             +IA +DA  +++A +A +++L+AY  NPE+VT++FNE V  T++        +  N+TRR
Sbjct  36    NIANFDAVWQERAMKAQKAALKAYQPNPEQVTEDFNESVEQTVVEEDLEDDQSAGNSTRR  95

Query  1519  HLRGSH----CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSS  1352
             +LRG      CKATN IDRCWRC  +WA +RK+LA C +GFG  T GG KG +Y+VTDSS
Sbjct  96    NLRGKXYKGPCKATNPIDRCWRCRANWANNRKKLASCVKGFGRKTRGGKKGAYYIVTDSS  155

Query  1351  DKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAG  1172
             D ++ +PKPGTLRHAVIQ +PLWIIF +SMVI L QELI+   KTID RG +VHIA+GAG
Sbjct  156   DDNVHDPKPGTLRHAVIQTQPLWIIFARSMVIRLSQELIVTSHKTIDARGANVHIAHGAG  215

Query  1171  LTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTM  992
             +T+QFV+NVIIHG++IH  +P  GGMIRDS++HIG+RT SDGDGISI+GS+++WLDHL+M
Sbjct  216   ITLQFVQNVIIHGLRIHDTVPGSGGMIRDSLSHIGIRTQSDGDGISIYGSSNIWLDHLSM  275

Query  991   SRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQ  812
               C+DGLIDAI  STAITISNC F HHN V+L GASD F+ DAIMQ+TVAFN FGKGLIQ
Sbjct  276   WNCADGLIDAIQGSTAITISNCHFTHHNDVMLFGASDAFAGDAIMQITVAFNHFGKGLIQ  335

Query  811   RMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKN  632
             RMPRCRWGF H+VNNDYT W MYAIGGSS PTI+SQGNRF A  N   K+VTKR+   ++
Sbjct  336   RMPRCRWGFVHVVNNDYTHWIMYAIGGSSHPTIISQGNRFIAPPNQAAKEVTKRDYAPES  395

Query  631   VWKNWQWRSEGDLFLNGAYFVESG--EELHHYnntrfnntnRIRHRPASYVGRLTRTSGA  458
             VWK+WQWRSEGDL +NGA+FV+SG   + H +        + I+ +P ++V RLTR +G+
Sbjct  396   VWKSWQWRSEGDLMMNGAFFVQSGVPNKKHGF-----GKLDMIKAKPGTFVRRLTRFAGS  450

Query  457   LKCKVGRFC  431
             L CKVG+ C
Sbjct  451   LNCKVGKKC  459



>ref|XP_010066949.1| PREDICTED: pectate lyase [Eucalyptus grandis]
 gb|KCW65002.1| hypothetical protein EUGRSUZ_G02541 [Eucalyptus grandis]
Length=436

 Score =   523 bits (1346),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 262/419 (63%), Positives = 322/419 (77%), Gaps = 6/419 (1%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG--  1508
             QA+I E+D Y  K+A+EA + +L+AY  +PE VT  FN +V D  +   N+TRR L+   
Sbjct  22    QANIEEFDEYWAKRAEEAQKDALKAYDPHPETVTSLFNAKV-DKAVRGNNSTRRQLKKYK  80

Query  1507  SHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPK  1328
               C ATN IDRCWRC+++WA++RKRLA C  GFG  T GG +G FYVVTDSSD DM NPK
Sbjct  81    GPCLATNPIDRCWRCNRNWARNRKRLANCVLGFGRKTRGGKRGWFYVVTDSSDNDMVNPK  140

Query  1327  PGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRN  1148
             PGTLRHAV+Q+ PLWIIF  SMVI L QELI+  DKTID RG +VHIAYGAG+T+QF+RN
Sbjct  141   PGTLRHAVVQKGPLWIIFAGSMVIRLNQELIMTSDKTIDARGANVHIAYGAGITLQFIRN  200

Query  1147  VIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLI  968
             VIIHG+ IH I+   GG+IRD+ +H+GLRT SDGDGISIFGS+H+W+DH++MS CSDGLI
Sbjct  201   VIIHGLHIHDIVRGSGGLIRDAHDHVGLRTASDGDGISIFGSSHLWIDHVSMSACSDGLI  260

Query  967   DAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWG  788
             DAI  STAITISNC F HHN V+L GASD +S+D IMQ+TVAFN FG+GL+QRMPRCRWG
Sbjct  261   DAIQGSTAITISNCHFTHHNEVMLFGASDGYSQDQIMQITVAFNHFGRGLVQRMPRCRWG  320

Query  787   FFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWR  608
             FFH+VNNDYT W MYAIGGS  PTI+SQGNRF A  N   K+VTKR+  +++ WKNW W+
Sbjct  321   FFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPPNIAAKEVTKRDYATEDQWKNWLWK  380

Query  607   SEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             SEGDL +NGA+FV SG     +    F+  + I+ +P +YV RLTR +G L C+VGR C
Sbjct  381   SEGDLMMNGAFFVNSGNPRARF---PFSRRDVIKAKPGTYVRRLTRFAGKLGCRVGRPC  436



>ref|XP_002311599.2| pectate lyase family protein [Populus trichocarpa]
 gb|EEE88966.2| pectate lyase family protein [Populus trichocarpa]
Length=441

 Score =   523 bits (1346),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 257/420 (61%), Positives = 321/420 (76%), Gaps = 6/420 (1%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHL---R  1511
             Q  I E+D Y KKKADEAL+++ +A+Y +P  VT+ FN +V + +M  TN+TRR L   R
Sbjct  25    QGHIGEFDEYWKKKADEALKAAQEAFYPDPMNVTNQFNFQV-NKVMTETNSTRRSLVSKR  83

Query  1510  GSHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENP  1331
             G  C ATN IDRCWRCD +WA HR++LA C  GFG  T GG  G+ YVVTD+SD DM NP
Sbjct  84    GGRCMATNPIDRCWRCDPNWASHRQKLADCVLGFGHKTVGGKYGKIYVVTDASDNDMLNP  143

Query  1330  KPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVR  1151
             KPGTLRHAVIQ+EPLWIIF  SMVI L QEL++  +KTID RG  VHIAYGAG+T+QFV+
Sbjct  144   KPGTLRHAVIQKEPLWIIFSGSMVIRLNQELMVASNKTIDSRGAKVHIAYGAGITLQFVQ  203

Query  1150  NVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGL  971
             NVIIHG++IH I+   GG++RDSV+H G RT SDGDGISIFGS+++W+DH++MS C DGL
Sbjct  204   NVIIHGLRIHDIVIGSGGLVRDSVDHYGFRTKSDGDGISIFGSSNIWIDHVSMSNCQDGL  263

Query  970   IDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRW  791
             ID IM S AITISN  F  HN V+L GASD +S D+IMQ+TVAFN FG+GL+QRMPRCRW
Sbjct  264   IDVIMGSNAITISNSHFTRHNEVMLFGASDSYSGDSIMQITVAFNHFGRGLVQRMPRCRW  323

Query  790   GFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQW  611
             GFFH+VNNDYT W MYAIGGS  PTIVSQGNRF A +N F K+VTKR+   ++ WKNW W
Sbjct  324   GFFHVVNNDYTHWMMYAIGGSHNPTIVSQGNRFIAPNNTFAKEVTKRDYAVESEWKNWNW  383

Query  610   RSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             RS+ DL +NGA+FV+SG  +   ++ R +  + ++ +P ++V RLTR SG+L C  G+ C
Sbjct  384   RSDNDLMMNGAFFVQSGSPI--TSSRRISRFHVMKSKPGTFVTRLTRFSGSLGCFKGKPC  441



>ref|XP_010112093.1| putative pectate lyase 7 [Morus notabilis]
 gb|EXC32626.1| putative pectate lyase 7 [Morus notabilis]
Length=437

 Score =   522 bits (1345),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 262/419 (63%), Positives = 318/419 (76%), Gaps = 6/419 (1%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR--G  1508
             QA+I ++D   +++A+EA +++L+AY  NPEEVTD+FNEEV D +++ +N+TRR LR   
Sbjct  23    QANIGDFDESWQQRAEEAHKAALEAYDPNPEEVTDSFNEEV-DKVIDGSNSTRRELRRYS  81

Query  1507  SHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPK  1328
               C ATN IDRCWRC  +WA +RKRLA C  GFG  TTGG  GR+YVVTD SD D++NP+
Sbjct  82    GPCAATNPIDRCWRCRSNWASNRKRLARCVLGFGRKTTGGRSGRYYVVTDPSDNDVQNPR  141

Query  1327  PGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRN  1148
             PGTLRHAVIQ++PLWIIF  SM+I L QEL+I   KTID RG ++HIA GAG+TIQF RN
Sbjct  142   PGTLRHAVIQKQPLWIIFAHSMIIRLSQELLITSHKTIDARGANIHIANGAGITIQFARN  201

Query  1147  VIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLI  968
             VIIHG+ IH I+   GGMIRDSV+H G RT +DGDGISIFGS ++WLDH++MS C DGLI
Sbjct  202   VIIHGLHIHDIVASGGGMIRDSVDHFGFRTPADGDGISIFGSTNIWLDHISMSNCQDGLI  261

Query  967   DAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWG  788
             DAI  STAITISNC F HHN V+L GASD F  D IMQVTVAFN FG+GL+QRMPRCRWG
Sbjct  262   DAIQGSTAITISNCHFTHHNDVMLFGASDSFEGDKIMQVTVAFNHFGRGLVQRMPRCRWG  321

Query  787   FFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWR  608
             FFH+VNNDYT W MYAIGGSS PTI+SQGNRF A  N   KQVTKR+  ++  WK W WR
Sbjct  322   FFHVVNNDYTHWLMYAIGGSSHPTIISQGNRFIAPPNNAAKQVTKRDYAAEWEWKRWTWR  381

Query  607   SEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             SEGDL +NGA+FV+SG          F   + I+ +P ++V RLTR +GAL C  G+ C
Sbjct  382   SEGDLMMNGAFFVQSGNR---SKKRPFTRHDMIKAKPGTFVTRLTRFAGALNCYAGKKC  437



>ref|XP_008443432.1| PREDICTED: probable pectate lyase 19 [Cucumis melo]
Length=441

 Score =   522 bits (1344),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 259/421 (62%), Positives = 320/421 (76%), Gaps = 7/421 (2%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTI--MNWTNTTRRHLRG  1508
             +A IAE+D YL +KA+EA Q+SL+A++ +P  VTD+FN+ V   +  +  +N+TRR L  
Sbjct  24    RAGIAEFDDYLLQKAEEAKQASLEAFHPDPMNVTDHFNQHVHLALEGIEGSNSTRRSLAK  83

Query  1507  --SHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMEN  1334
                 C ATN IDRCWRCD +WAK+RK+LA C  GFG  TTGG KGR YVVTD SD D+ N
Sbjct  84    YKGPCLATNPIDRCWRCDPNWAKNRKKLAKCVLGFGRKTTGGKKGRIYVVTDPSDNDVVN  143

Query  1333  PKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFV  1154
             PKPGTLR+  +Q+ PLWIIF +SM+I L +EL++   KTID RG +VHIAYGAGL+IQF 
Sbjct  144   PKPGTLRYGALQKRPLWIIFARSMIIRLSKELMVTSHKTIDARGSNVHIAYGAGLSIQFA  203

Query  1153  RNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDG  974
             RNVIIHG++IHH++   GGMIRD+ NH+GLRT+SDGDGISIFGS+++WLDHL+MS C DG
Sbjct  204   RNVIIHGLRIHHVISTGGGMIRDTANHVGLRTVSDGDGISIFGSSNIWLDHLSMSNCQDG  263

Query  973   LIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCR  794
             LIDAI  STAITISN  F HHN V+L GASD +  D+IMQVTVAFN FGKGL+QRMPRCR
Sbjct  264   LIDAIQGSTAITISNSHFTHHNDVMLFGASDSYQGDSIMQVTVAFNHFGKGLVQRMPRCR  323

Query  793   WGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQ  614
             WGFFH+VNNDYT W MYAIGGS  PTI+SQGNRF A  NP  +Q+T R    ++VWK W 
Sbjct  324   WGFFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPPNPAARQITNRNYAPESVWKTWT  383

Query  613   WRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRF  434
             WRSEGDL +NGAYF++SG          ++  + I+ +P ++V RLTR SG+L C VGR 
Sbjct  384   WRSEGDLMMNGAYFIQSGNP---SKRRPYSRFDMIKAKPGTFVRRLTRFSGSLNCFVGRP  440

Query  433   C  431
             C
Sbjct  441   C  441



>ref|XP_004147462.1| PREDICTED: probable pectate lyase 7-like [Cucumis sativus]
 ref|XP_004163529.1| PREDICTED: probable pectate lyase 7-like [Cucumis sativus]
Length=431

 Score =   521 bits (1342),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 258/421 (61%), Positives = 321/421 (76%), Gaps = 7/421 (2%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTI--MNWTNTTRRHLR-  1511
             +A IAE+D +L +K++EA Q+SL+A++ +P  VTD+FN+ V   +  +  +N+TRR L  
Sbjct  14    RAGIAEFDDFLLQKSEEAKQASLEAFHPDPMNVTDHFNQHVHLALEGIEGSNSTRRSLSK  73

Query  1510  -GSHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMEN  1334
                 C ATN IDRCWRCD +WAK+RK+LA C  GFG  TTGG KGR YVVTD SD D+ N
Sbjct  74    YNGPCLATNPIDRCWRCDPNWAKNRKKLAKCVLGFGRKTTGGKKGRIYVVTDPSDNDVIN  133

Query  1333  PKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFV  1154
             P+PGTLR+  +Q++PLWIIF +SM+I L +EL+I   KTID RG +VHIAYGAGL+IQF 
Sbjct  134   PRPGTLRYGALQKKPLWIIFARSMIIRLSKELMITSHKTIDARGANVHIAYGAGLSIQFA  193

Query  1153  RNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDG  974
             RNVIIHG++IHH++   GGMIRD+ NH+GLRT+SDGDGISIFGS ++WLDHL+MS C DG
Sbjct  194   RNVIIHGLRIHHVISTGGGMIRDTANHVGLRTVSDGDGISIFGSTNIWLDHLSMSNCQDG  253

Query  973   LIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCR  794
             LIDAI  STAITISN  F HHN V+L GASD +  D+IMQVTVAFN FGKGL+QRMPRCR
Sbjct  254   LIDAIQGSTAITISNSHFTHHNDVMLFGASDSYQGDSIMQVTVAFNHFGKGLVQRMPRCR  313

Query  793   WGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQ  614
             WGFFH+VNNDYT W MYAIGGS  PTI+SQGNRF A  NP  +Q+T R   +++VWK W 
Sbjct  314   WGFFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPPNPAARQITNRNYATESVWKTWT  373

Query  613   WRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRF  434
             WRSEGDL +NGAYFV+SG          ++  + I+ +P ++V RLTR SG+L C VGR 
Sbjct  374   WRSEGDLMMNGAYFVQSGNP---SKRRPYSRFDMIKAKPGTFVRRLTRFSGSLNCYVGRP  430

Query  433   C  431
             C
Sbjct  431   C  431



>gb|KGN59593.1| hypothetical protein Csa_3G827350 [Cucumis sativus]
Length=441

 Score =   521 bits (1342),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 258/421 (61%), Positives = 321/421 (76%), Gaps = 7/421 (2%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTI--MNWTNTTRRHLR-  1511
             +A IAE+D +L +K++EA Q+SL+A++ +P  VTD+FN+ V   +  +  +N+TRR L  
Sbjct  24    RAGIAEFDDFLLQKSEEAKQASLEAFHPDPMNVTDHFNQHVHLALEGIEGSNSTRRSLSK  83

Query  1510  -GSHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMEN  1334
                 C ATN IDRCWRCD +WAK+RK+LA C  GFG  TTGG KGR YVVTD SD D+ N
Sbjct  84    YNGPCLATNPIDRCWRCDPNWAKNRKKLAKCVLGFGRKTTGGKKGRIYVVTDPSDNDVIN  143

Query  1333  PKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFV  1154
             P+PGTLR+  +Q++PLWIIF +SM+I L +EL+I   KTID RG +VHIAYGAGL+IQF 
Sbjct  144   PRPGTLRYGALQKKPLWIIFARSMIIRLSKELMITSHKTIDARGANVHIAYGAGLSIQFA  203

Query  1153  RNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDG  974
             RNVIIHG++IHH++   GGMIRD+ NH+GLRT+SDGDGISIFGS ++WLDHL+MS C DG
Sbjct  204   RNVIIHGLRIHHVISTGGGMIRDTANHVGLRTVSDGDGISIFGSTNIWLDHLSMSNCQDG  263

Query  973   LIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCR  794
             LIDAI  STAITISN  F HHN V+L GASD +  D+IMQVTVAFN FGKGL+QRMPRCR
Sbjct  264   LIDAIQGSTAITISNSHFTHHNDVMLFGASDSYQGDSIMQVTVAFNHFGKGLVQRMPRCR  323

Query  793   WGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQ  614
             WGFFH+VNNDYT W MYAIGGS  PTI+SQGNRF A  NP  +Q+T R   +++VWK W 
Sbjct  324   WGFFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPPNPAARQITNRNYATESVWKTWT  383

Query  613   WRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRF  434
             WRSEGDL +NGAYFV+SG          ++  + I+ +P ++V RLTR SG+L C VGR 
Sbjct  384   WRSEGDLMMNGAYFVQSGNP---SKRRPYSRFDMIKAKPGTFVRRLTRFSGSLNCYVGRP  440

Query  433   C  431
             C
Sbjct  441   C  441



>ref|XP_011087066.1| PREDICTED: pectate lyase [Sesamum indicum]
Length=431

 Score =   521 bits (1341),  Expect = 9e-177, Method: Compositional matrix adjust.
 Identities = 257/417 (62%), Positives = 322/417 (77%), Gaps = 14/417 (3%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH  1502
             +A IA+YD YL+KKA+ A + +L+A+  NPE++ D+ N +V +T  ++            
Sbjct  29    RAAIAKYDEYLQKKAEVASEEALKAFDPNPEKLADDLNYQVSETEDDF------------  76

Query  1501  CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPG  1322
              KATN IDRCWRCD++WA++R++LA CARGFG   TGG  GR+YVVTD SD DM+ PKPG
Sbjct  77    -KATNPIDRCWRCDRNWAQNRQKLADCARGFGHRATGGKGGRYYVVTDPSDDDMDKPKPG  135

Query  1321  TLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVI  1142
             TLRHA IQ+EPLWIIF   MVI LK+EL+   +KT+DGRG  VHIAYGAG+T+QFV NVI
Sbjct  136   TLRHAAIQKEPLWIIFANHMVIKLKEELLFASNKTLDGRGAKVHIAYGAGITLQFVHNVI  195

Query  1141  IHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDA  962
             IH I+IH I P  GGMIRD+V+HIGLRT SDGDGIS+F SN++W+DH+++S+ +DGLID 
Sbjct  196   IHNIRIHDIHPAPGGMIRDAVDHIGLRTRSDGDGISVFNSNNIWIDHVSLSKGTDGLIDV  255

Query  961   IMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFF  782
             I  STAITISNCKFNHHN V+LLGA D  ++D+IMQ+TVAFNRFGKGLIQRMPR RWGF 
Sbjct  256   IEGSTAITISNCKFNHHNDVMLLGAHDSTAKDSIMQITVAFNRFGKGLIQRMPRIRWGFV  315

Query  781   HIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRSE  602
             H++NNDY+ WEMYAIGGS+ PTI+SQGNRFKA++N  TK+VTKR    K+ W+ WQWRSE
Sbjct  316   HVINNDYSHWEMYAIGGSAHPTIISQGNRFKAANNQHTKEVTKRMFAEKSEWEKWQWRSE  375

Query  601   GDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             GD F NGAYFVESG  +    N      + I+ +P S+ GRLTR +GALKC+ G+ C
Sbjct  376   GDKFTNGAYFVESGPAIRR-TNLPLTEKSLIKFKPGSFAGRLTRYAGALKCREGKLC  431



>ref|XP_008446316.1| PREDICTED: probable pectate lyase P59 [Cucumis melo]
Length=432

 Score =   520 bits (1338),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 264/418 (63%), Positives = 321/418 (77%), Gaps = 6/418 (1%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR--GS  1505
             ADI ++D Y K +A EA Q++  AY  NPE + D+ N EVG  +   +N+TRR+L+    
Sbjct  19    ADIGDFDDYWKARAAEAEQAAADAYEPNPETIADSLNAEVGQALSG-SNSTRRNLKKYTG  77

Query  1504  HCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKP  1325
              C+ATN IDRCWRCD +WA++RK+LA C  GFG  T GG  G +YVV DSSD D+ NPKP
Sbjct  78    PCRATNPIDRCWRCDPNWAQNRKKLADCVLGFGRKTIGGKLGPYYVVNDSSDSDLMNPKP  137

Query  1324  GTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNV  1145
             GTLRHAVIQ+ PLWI F  +M I L QELI+  DKTID RG +V IAYGAG+T+Q+VRNV
Sbjct  138   GTLRHAVIQKGPLWITFSTNMAIRLTQELIVTSDKTIDARGANVQIAYGAGITLQYVRNV  197

Query  1144  IIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLID  965
             IIHG++IHHI+   GGMIRD+V+H+GLRTMSDGDGISIFGS++VW+DH++MS C DGLID
Sbjct  198   IIHGLRIHHIVVGNGGMIRDAVDHVGLRTMSDGDGISIFGSSNVWIDHVSMSNCQDGLID  257

Query  964   AIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGF  785
             AIM STAITISNC F HHN V+L GASD +S D IMQVTVAFN FG+GL+QRMPRCRWGF
Sbjct  258   AIMGSTAITISNCHFTHHNEVMLFGASDGYSNDQIMQVTVAFNHFGQGLVQRMPRCRWGF  317

Query  784   FHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRS  605
             FH+VNNDYT W MYAIGGS  PTIVSQGNRF A  N + K+VTKRE   + VWK+W WRS
Sbjct  318   FHVVNNDYTHWLMYAIGGSQHPTIVSQGNRFIAPPNVYAKEVTKREYSPEQVWKSWTWRS  377

Query  604   EGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             EGDL +NGA+FV SG++        F++ + I ++P +YV R+TR SGAL C VGR C
Sbjct  378   EGDLMMNGAFFVTSGDQRKR---RPFSSKDMISYKPGTYVKRMTRFSGALACFVGRPC  432



>ref|XP_011071024.1| PREDICTED: pectate lyase-like [Sesamum indicum]
Length=441

 Score =   520 bits (1339),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 277/416 (67%), Positives = 332/416 (80%), Gaps = 2/416 (0%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSHC  1499
             A IA +D  L+K+A E+ Q SLQ Y  NP+++TD FNE VG T+MN  N TRR+L    C
Sbjct  28    AKIATFDEDLQKRAAESYQESLQEYNPNPQDLTDEFNELVGKTLMN-ENVTRRNLGEDDC  86

Query  1498  KATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGT  1319
             KATN IDRCWRCD+DWAKHRKRLA C RGFG  TTGG  GR+Y+V D SD DM++PKPGT
Sbjct  87    KATNPIDRCWRCDRDWAKHRKRLADCVRGFGHLTTGGKAGRYYLVDDPSDDDMDHPKPGT  146

Query  1318  LRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVII  1139
             LRHA++Q EPLWIIFK SMVI LK ELI+  DKTIDGRGV VHIAYGAG+TIQFV N+II
Sbjct  147   LRHAILQTEPLWIIFKHSMVIKLKNELIMTSDKTIDGRGVLVHIAYGAGITIQFVHNIII  206

Query  1138  HGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAI  959
             H I IH+I+P  GGMIRD+++HIGLRT SDGD I+I+ SN +W+DH+++S+  DGLID I
Sbjct  207   HNIWIHNIVPTSGGMIRDTLSHIGLRTKSDGDAINIYSSNRIWIDHVSLSKGYDGLIDVI  266

Query  958   MASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFH  779
               STAITISNCKFNHHN V+LLGA D  S DAIMQVTVAFNRFGKGLIQRMPR RWGF H
Sbjct  267   EGSTAITISNCKFNHHNDVMLLGAHDSHSIDAIMQVTVAFNRFGKGLIQRMPRVRWGFAH  326

Query  778   IVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRSEG  599
             +VNNDY+ WE+YAIGGS+ PTI+SQGNRF+AS+  +TK+VTKR+  +K+ W  WQWRSEG
Sbjct  327   VVNNDYSHWELYAIGGSAHPTIISQGNRFRASNYRYTKEVTKRDYATKDQWMKWQWRSEG  386

Query  598   DLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             DLF NGA+F ESG+ L H + +     N IR+RP S+VG LT+ +GALKC+ G+ C
Sbjct  387   DLFKNGAFFTESGQPLEH-SKSPLVGMNLIRYRPGSFVGTLTKYAGALKCRKGKLC  441



>ref|XP_002282500.3| PREDICTED: pectate lyase [Vitis vinifera]
Length=443

 Score =   520 bits (1339),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 261/419 (62%), Positives = 323/419 (77%), Gaps = 6/419 (1%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH  1502
             +A I E+D   +K+A+EA +++L+AY  NPEEVT+ FN+ V  + M  TNTTRR+LR ++
Sbjct  29    RAHIGEFDEVWQKRAEEAQKAALEAYQPNPEEVTNQFNKNVRKS-MQGTNTTRRNLRSNN  87

Query  1501  --CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPK  1328
               C ATN IDRCWRC QDWAK+RK+LA C  GFG  TTGG  G FYVVTD+SD DM +PK
Sbjct  88    GPCMATNPIDRCWRCKQDWAKNRKKLADCVLGFGRRTTGGKDGEFYVVTDASDNDMIDPK  147

Query  1327  PGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRN  1148
             PGTLRHAVIQ+EPLWIIF + M+I LKQELI+  +KTIDGRG +VHIAYG G+TIQFV+N
Sbjct  148   PGTLRHAVIQKEPLWIIFARDMIIRLKQELIMAGNKTIDGRGANVHIAYGCGITIQFVKN  207

Query  1147  VIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLI  968
             +IIH + IH I+P  GGMIRDSV+H GLRT SDGDG+SIFGS++VW+DHL+MS C DGL+
Sbjct  208   IIIHNLHIHDIVPAQGGMIRDSVDHYGLRTASDGDGVSIFGSSNVWVDHLSMSNCKDGLV  267

Query  967   DAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWG  788
             D IMASTAITISNC F +HN V+L G S+ F  D IMQVTVAFN +G+GL+QRMPRCR+G
Sbjct  268   DVIMASTAITISNCHFTNHNEVMLFGGSNNFQGDKIMQVTVAFNHYGRGLVQRMPRCRYG  327

Query  787   FFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWR  608
             F H+VNNDYT W MYAIGGS  PTI+SQGNRF A  N   K+VTKR+  S + WK+W W 
Sbjct  328   FVHVVNNDYTHWLMYAIGGSQNPTIISQGNRFIAPPNMACKEVTKRDYASPDEWKSWTWI  387

Query  607   SEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             S+GDL  NGA+FV+SG+    +    F   + I+ +P ++V RLTR SG+L CKV + C
Sbjct  388   SQGDLLQNGAFFVQSGDPKKKH---PFTRYDMIKAKPGTFVNRLTRFSGSLGCKVNQPC  443



>emb|CAN79927.1| hypothetical protein VITISV_042447 [Vitis vinifera]
Length=439

 Score =   520 bits (1338),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 261/419 (62%), Positives = 323/419 (77%), Gaps = 6/419 (1%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH  1502
             +A I E+D   +K+A+EA +++L+AY  NPEEVT+ FN+ V  + M  TNTTRR+LR ++
Sbjct  25    RAHIGEFDEVWQKRAEEAQKAALEAYQPNPEEVTNQFNKNVRKS-MQGTNTTRRNLRSNN  83

Query  1501  --CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPK  1328
               C ATN IDRCWRC QDWAK+RK+LA C  GFG  TTGG  G FYVVTD+SD DM +PK
Sbjct  84    GPCMATNPIDRCWRCKQDWAKNRKKLADCVLGFGRRTTGGKDGEFYVVTDASDNDMIDPK  143

Query  1327  PGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRN  1148
             PGTLRHAVIQ+EPLWIIF + M+I LKQELI+  +KTIDGRG +VHIAYG G+TIQFV+N
Sbjct  144   PGTLRHAVIQKEPLWIIFARDMIIRLKQELIMAGNKTIDGRGANVHIAYGCGITIQFVKN  203

Query  1147  VIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLI  968
             +IIH + IH I+P  GGMIRDSV+H GLRT SDGDG+SIFGS++VW+DHL+MS C DGL+
Sbjct  204   IIIHNLHIHDIVPAQGGMIRDSVDHYGLRTASDGDGVSIFGSSNVWVDHLSMSNCKDGLV  263

Query  967   DAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWG  788
             D IMASTAITISNC F +HN V+L G S+ F  D IMQVTVAFN +G+GL+QRMPRCR+G
Sbjct  264   DVIMASTAITISNCHFTNHNEVMLFGGSNNFQGDKIMQVTVAFNHYGRGLVQRMPRCRYG  323

Query  787   FFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWR  608
             F H+VNNDYT W MYAIGGS  PTI+SQGNRF A  N   K+VTKR+  S + WK+W W 
Sbjct  324   FVHVVNNDYTHWLMYAIGGSQNPTIISQGNRFIAPPNMACKEVTKRDYASPDEWKSWTWI  383

Query  607   SEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             S+GDL  NGA+FV+SG+    +    F   + I+ +P ++V RLTR SG+L CKV + C
Sbjct  384   SQGDLLQNGAFFVQSGDPKKKH---PFTRYDMIKAKPGTFVNRLTRFSGSLGCKVNQPC  439



>emb|CBI22159.3| unnamed protein product [Vitis vinifera]
Length=468

 Score =   520 bits (1339),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 261/419 (62%), Positives = 323/419 (77%), Gaps = 6/419 (1%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH  1502
             +A I E+D   +K+A+EA +++L+AY  NPEEVT+ FN+ V  + M  TNTTRR+LR ++
Sbjct  54    RAHIGEFDEVWQKRAEEAQKAALEAYQPNPEEVTNQFNKNVRKS-MQGTNTTRRNLRSNN  112

Query  1501  --CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPK  1328
               C ATN IDRCWRC QDWAK+RK+LA C  GFG  TTGG  G FYVVTD+SD DM +PK
Sbjct  113   GPCMATNPIDRCWRCKQDWAKNRKKLADCVLGFGRRTTGGKDGEFYVVTDASDNDMIDPK  172

Query  1327  PGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRN  1148
             PGTLRHAVIQ+EPLWIIF + M+I LKQELI+  +KTIDGRG +VHIAYG G+TIQFV+N
Sbjct  173   PGTLRHAVIQKEPLWIIFARDMIIRLKQELIMAGNKTIDGRGANVHIAYGCGITIQFVKN  232

Query  1147  VIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLI  968
             +IIH + IH I+P  GGMIRDSV+H GLRT SDGDG+SIFGS++VW+DHL+MS C DGL+
Sbjct  233   IIIHNLHIHDIVPAQGGMIRDSVDHYGLRTASDGDGVSIFGSSNVWVDHLSMSNCKDGLV  292

Query  967   DAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWG  788
             D IMASTAITISNC F +HN V+L G S+ F  D IMQVTVAFN +G+GL+QRMPRCR+G
Sbjct  293   DVIMASTAITISNCHFTNHNEVMLFGGSNNFQGDKIMQVTVAFNHYGRGLVQRMPRCRYG  352

Query  787   FFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWR  608
             F H+VNNDYT W MYAIGGS  PTI+SQGNRF A  N   K+VTKR+  S + WK+W W 
Sbjct  353   FVHVVNNDYTHWLMYAIGGSQNPTIISQGNRFIAPPNMACKEVTKRDYASPDEWKSWTWI  412

Query  607   SEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             S+GDL  NGA+FV+SG+    +    F   + I+ +P ++V RLTR SG+L CKV + C
Sbjct  413   SQGDLLQNGAFFVQSGDPKKKH---PFTRYDMIKAKPGTFVNRLTRFSGSLGCKVNQPC  468



>ref|XP_010033216.1| PREDICTED: pectate lyase-like [Eucalyptus grandis]
Length=435

 Score =   518 bits (1333),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 259/421 (62%), Positives = 323/421 (77%), Gaps = 9/421 (2%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR---  1511
             +A I E+D Y +K+A+EA Q++L+A+   PE VT  FN  V + +++  N+TRR L    
Sbjct  20    EAHIKEFDEYWQKRAEEASQAALEAFNPEPENVTAQFNANV-NKVLDGNNSTRRQLHMHK  78

Query  1510  -GSHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMEN  1334
                 C ATN IDRCWRC ++WAK RKRLA C  GFG  TTGGLKG++YVV D SD D+ N
Sbjct  79    YSGPCLATNPIDRCWRCRKNWAKDRKRLAKCVLGFGRKTTGGLKGKYYVVYDCSDNDVVN  138

Query  1333  PKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFV  1154
             PKPGTLRHAVIQ+ PLWIIF +SMVI L QEL++   KTIDGRG +VHIA+GAG+TIQFV
Sbjct  139   PKPGTLRHAVIQKRPLWIIFARSMVIRLNQELMVASHKTIDGRGANVHIAFGAGITIQFV  198

Query  1153  RNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDG  974
             RNVIIH I+IH I+ + GG+IRD+V+H+G+RTMSDGDGISIFGS ++W+DH++M RC DG
Sbjct  199   RNVIIHNIRIHDIVTRPGGIIRDAVDHVGIRTMSDGDGISIFGSTNIWIDHVSMKRCQDG  258

Query  973   LIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCR  794
             LIDAI  STAITISN  + HHN V+L GASDL+  D IMQVTVAFN FGKGLIQRMPRCR
Sbjct  259   LIDAIEGSTAITISNGHYTHHNDVMLFGASDLYPRDKIMQVTVAFNHFGKGLIQRMPRCR  318

Query  793   WGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQ  614
             WGFFH+VNNDYT W MYAIGGSS+PTI+SQGNRF A  N   K+VTKR+  + +VW++W 
Sbjct  319   WGFFHVVNNDYTHWLMYAIGGSSQPTIISQGNRFIAPPNLAAKEVTKRDYATPDVWRSWT  378

Query  613   WRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRF  434
             WRS+GDL +NGA+FV+SG+ L      ++   + I+ +P ++V RLTR SG L CK  + 
Sbjct  379   WRSQGDLLINGAFFVQSGQPL----KKKYGRKDMIKAKPGTFVRRLTRFSGTLNCKPKKR  434

Query  433   C  431
             C
Sbjct  435   C  435



>ref|XP_002520133.1| Pectate lyase precursor, putative [Ricinus communis]
 gb|EEF42188.1| Pectate lyase precursor, putative [Ricinus communis]
Length=440

 Score =   517 bits (1331),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 259/420 (62%), Positives = 321/420 (76%), Gaps = 9/420 (2%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR----  1511
             A+I ++D Y K+KAD A +++ ++Y  NP  V++  N +V   +   TN+TRR+L     
Sbjct  26    ANIGDFDEYWKQKADIAREAAYRSYNPNPFNVSNQLNYQVNKAVSG-TNSTRRNLMRRKG  84

Query  1510  GSHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENP  1331
             G  CKATN IDRCWRCD  WA +RKRL  C  GFG  TTGG  G+FY+VTD SD DM NP
Sbjct  85    GGPCKATNPIDRCWRCDPKWALNRKRLVECVLGFGHSTTGGKDGKFYIVTDPSDNDMVNP  144

Query  1330  KPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVR  1151
             KPGTLRHAVIQ EPLWIIF +SM+I L QEL+I+ +KTID RG +VHIA GAGLT+QFV+
Sbjct  145   KPGTLRHAVIQNEPLWIIFARSMIIRLNQELMISSNKTIDARGANVHIAGGAGLTLQFVQ  204

Query  1150  NVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGL  971
             NVIIHGI+IH I+   GG++RDSV+H G RT SDGDGISIFGS+++W+DH++MS C DGL
Sbjct  205   NVIIHGIRIHDIVSGSGGLVRDSVDHYGFRTKSDGDGISIFGSSNIWIDHVSMSNCQDGL  264

Query  970   IDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRW  791
             IDAIM ST+ITISNC F +HN V+L GASD +S D IMQ+TVAFN FG+GL+QRMPRCRW
Sbjct  265   IDAIMGSTSITISNCHFTNHNEVMLFGASDGYSADTIMQITVAFNHFGRGLVQRMPRCRW  324

Query  790   GFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQW  611
             GFFH+VNNDYT W MYAIGGS +PTI+SQGNRF A +N F+K+VTKRE   ++ WKNW W
Sbjct  325   GFFHVVNNDYTHWLMYAIGGSRKPTIISQGNRFIAPNNIFSKEVTKREYSLESEWKNWNW  384

Query  610   RSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             RS+ DL +NGA FVESG+ + H     F+    I+ +P ++V RLTR SGAL C VG+ C
Sbjct  385   RSDRDLMMNGAVFVESGKPITH----DFSRLQLIKAKPGTFVTRLTRYSGALDCFVGKPC  440



>ref|XP_011025954.1| PREDICTED: probable pectate lyase P59 [Populus euphratica]
Length=441

 Score =   516 bits (1329),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 255/420 (61%), Positives = 317/420 (75%), Gaps = 6/420 (1%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHL---R  1511
             Q  I E+D Y KKKADEA +++ +A+Y +P  VT  FN +V + ++  TN+TRR L   R
Sbjct  25    QGHIGEFDEYWKKKADEARKAAQEAFYPDPLNVTSQFNFQV-NKVLTETNSTRRSLVRKR  83

Query  1510  GSHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENP  1331
             G  C ATN IDRCWRCD +WA HR++LA C  GFG  T GG  G+ YVVTD+SD DM NP
Sbjct  84    GGRCIATNPIDRCWRCDPNWASHRQKLADCVLGFGHKTVGGKYGKIYVVTDASDNDMLNP  143

Query  1330  KPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVR  1151
             KPGTLRHAVIQ+EPLWIIF  SMVI L QEL++  +KTID RG  VHIAYGAG+T+QF +
Sbjct  144   KPGTLRHAVIQKEPLWIIFSGSMVIRLNQELMVASNKTIDSRGFKVHIAYGAGITLQFAQ  203

Query  1150  NVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGL  971
             NVIIHG++IH I+   GG+IRDSV+H G RT SDGDGISIFGS+++W+DH++MS C DGL
Sbjct  204   NVIIHGLRIHDIVSGSGGLIRDSVDHYGFRTKSDGDGISIFGSSNIWIDHVSMSNCQDGL  263

Query  970   IDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRW  791
             ID IM S AITISN  F  HN V+L GASD +S D+IMQ+TV+FN FGKGL+QRMPRCRW
Sbjct  264   IDVIMGSNAITISNSHFTRHNEVMLFGASDSYSGDSIMQITVSFNHFGKGLVQRMPRCRW  323

Query  790   GFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQW  611
             GFFH+VNNDYT W MYAIGGS  PTIVSQGNRF A  N F K+VTKR+   ++ WKNW W
Sbjct  324   GFFHVVNNDYTHWMMYAIGGSHNPTIVSQGNRFIAPGNTFAKEVTKRDYAVESEWKNWNW  383

Query  610   RSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             RS+ DL +NGA+FV+SG  +   ++ R +  + ++ +P ++V RLTR SG+L C  G+ C
Sbjct  384   RSDNDLMMNGAFFVQSGSPI--TSSRRISRFHVMKSKPGTFVTRLTRFSGSLGCFKGKPC  441



>ref|XP_008341537.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=454

 Score =   515 bits (1327),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 262/427 (61%), Positives = 325/427 (76%), Gaps = 15/427 (4%)
 Frame = -1

Query  1675  DIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWT--------NTTRR  1520
             +IAE+D+  +++A +A +++L+AY  NPE+VT++FNE V  TI+           N+T R
Sbjct  31    NIAEFDSVWQQRALKAQKAALKAYQPNPEQVTEDFNESVEMTIIEDDHDDDHAAGNSTGR  90

Query  1519  HLRGSH----CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSS  1352
             HL G      CKATN IDRCWRC  +WA +RK LA C +GFG  T GG KG +Y+VTDSS
Sbjct  91    HLLGKRYTGPCKATNPIDRCWRCQANWADNRKHLASCVKGFGRKTRGGKKGAYYIVTDSS  150

Query  1351  DKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAG  1172
             D ++ +PKPGTLRHAVIQ++PLWIIF +SMVI L QELI+   KTID RG +VHIA+GAG
Sbjct  151   DDNIHDPKPGTLRHAVIQKQPLWIIFARSMVIRLTQELIVTSHKTIDARGANVHIAHGAG  210

Query  1171  LTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTM  992
             +T+QFV+NVIIHG+ IH  +P  GGMIRDSV+HIG+RT SDGDGISI+GS+++WLDHL+M
Sbjct  211   ITLQFVQNVIIHGLHIHDTVPGNGGMIRDSVDHIGIRTHSDGDGISIYGSSNIWLDHLSM  270

Query  991   SRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQ  812
               C+DGLIDAI  STAITISN  F  HN V+L GASD FS DAIMQ+TVAFN FGKGLIQ
Sbjct  271   WNCADGLIDAIQGSTAITISNSHFTRHNDVMLFGASDGFSGDAIMQITVAFNHFGKGLIQ  330

Query  811   RMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKN  632
             RMPRCRWGF H+VNNDYT W MYAIGGSS PTI+SQGNRF A  N   K+VTKR+   ++
Sbjct  331   RMPRCRWGFIHVVNNDYTHWLMYAIGGSSHPTIISQGNRFIAPPNQAAKEVTKRDYAPES  390

Query  631   VWKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALK  452
             VWK+WQWRSEGDL +NGA+FV+SG    ++    F   + ++ RP +YV RLTR +G+L 
Sbjct  391   VWKSWQWRSEGDLMINGAFFVQSGVPSKNH---GFGRLDVMKARPGTYVTRLTRFAGSLN  447

Query  451   CKVGRFC  431
             CKVG  C
Sbjct  448   CKVGHPC  454



>ref|XP_011097774.1| PREDICTED: pectate lyase-like [Sesamum indicum]
Length=435

 Score =   512 bits (1318),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 263/416 (63%), Positives = 318/416 (76%), Gaps = 9/416 (2%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSHC  1499
             A IAE+D  L+++A E+ Q SL+AY  NP  +T       G++ +      RR ++   C
Sbjct  29    AKIAEFDEDLRRRAAESYQESLKAYNPNPLNLT-------GESYL--FAEQRRDMKEDDC  79

Query  1498  KATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGT  1319
             KA N IDRCWRCD DW K+RK+LA CARGFG  T+GG  G++YVV D SD DM+ PKPGT
Sbjct  80    KAENPIDRCWRCDPDWDKNRKKLADCARGFGHTTSGGKDGKYYVVDDPSDDDMDLPKPGT  139

Query  1318  LRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVII  1139
             LRHAV+Q EPLWIIFK SMVI LK EL++  DKTIDGRGV VHIAYGAG+TIQFV NVII
Sbjct  140   LRHAVLQTEPLWIIFKHSMVIKLKNELLMTSDKTIDGRGVLVHIAYGAGITIQFVHNVII  199

Query  1138  HGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAI  959
             H I +H+I+P  GGMIRD++ HIGLRT +DGD ISI+ SNHVW+DH ++S+ +DGLID I
Sbjct  200   HNIWVHNIVPTSGGMIRDTMTHIGLRTQADGDAISIYSSNHVWIDHCSLSKATDGLIDVI  259

Query  958   MASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFH  779
               STAITISNCKFN HN V+LLGA D  S+DAIMQVTVAFN+FGKGLIQRMPR RWGF H
Sbjct  260   EGSTAITISNCKFNRHNDVMLLGAHDSNSKDAIMQVTVAFNKFGKGLIQRMPRVRWGFAH  319

Query  778   IVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRSEG  599
             +VNNDY +WE+YAIGGS+ PTIVSQGNRF+AS+ P+TK+VTKR+  +K  W  WQWRSEG
Sbjct  320   VVNNDYQQWELYAIGGSAHPTIVSQGNRFRASNYPYTKEVTKRDYATKEEWMKWQWRSEG  379

Query  598   DLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             DLF NGAYF ESG  L           N I++RP S+VG+LTR +GAL+C+ G+ C
Sbjct  380   DLFKNGAYFRESGPPLSQNKANPLEGQNLIKYRPGSFVGKLTRWAGALRCRKGKLC  435



>ref|XP_008230729.1| PREDICTED: pectate lyase [Prunus mume]
Length=452

 Score =   511 bits (1316),  Expect = 9e-173, Method: Compositional matrix adjust.
 Identities = 261/427 (61%), Positives = 317/427 (74%), Gaps = 14/427 (3%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTI-MNW------TNTTRR  1520
             +++ ++DA  K++  +A +++L+AY  NPE+VTD+FNE V +   +N+      +N T R
Sbjct  29    SNVGQFDAVWKERELKAEKTALKAYQRNPEKVTDDFNESVQEVDDLNFEDDDQVSNITGR  88

Query  1519  HLRGSH----CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSS  1352
             HL G      CKATN IDRCWRC +DWA  RK+LA C +GFG  T GG +G FYVVTD S
Sbjct  89    HLLGKKYKGPCKATNPIDRCWRCRKDWANDRKKLANCVKGFGRRTRGGKRGEFYVVTDPS  148

Query  1351  DKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAG  1172
             D ++  PKPGTLRHAVIQ +PLWIIF +SM I L QELI+   KTID RG +VHIA+GAG
Sbjct  149   DSNVVEPKPGTLRHAVIQPQPLWIIFARSMTIRLTQELIMTSHKTIDARGANVHIAHGAG  208

Query  1171  LTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTM  992
             LT+QFV+NVIIHG+ IH I+P  GG IRDSV+H G RT SDGDGISIFGS+HVWLDHL+M
Sbjct  209   LTLQFVQNVIIHGLHIHDIVPGSGGTIRDSVDHFGTRTQSDGDGISIFGSSHVWLDHLSM  268

Query  991   SRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQ  812
               C+DGLID I  STA+TISNC F  HN VLL GASD F+ DAIMQ+TVAFN FGKGL+Q
Sbjct  269   WNCADGLIDVIQGSTAVTISNCHFTRHNDVLLFGASDSFAGDAIMQITVAFNHFGKGLVQ  328

Query  811   RMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKN  632
             RMPRCRWGF H+VNNDYT W MYAIGGSS PTI+SQGNRF A  N   K+VTKR+     
Sbjct  329   RMPRCRWGFIHVVNNDYTHWLMYAIGGSSHPTIISQGNRFIAPPNQAAKEVTKRDYAPMG  388

Query  631   VWKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALK  452
             VWKNWQWRSEGDL LNGA+FVESG    ++    F   + +  +P ++V RLTR +G L 
Sbjct  389   VWKNWQWRSEGDLMLNGAFFVESGVAKKNH---GFGKLDMMTAKPGTFVSRLTRFAGTLG  445

Query  451   CKVGRFC  431
             C+VG+ C
Sbjct  446   CRVGQKC  452



>ref|XP_004135462.1| PREDICTED: probable pectate lyase P59-like [Cucumis sativus]
 gb|KGN51889.1| hypothetical protein Csa_5G604340 [Cucumis sativus]
Length=432

 Score =   510 bits (1314),  Expect = 9e-173, Method: Compositional matrix adjust.
 Identities = 257/418 (61%), Positives = 319/418 (76%), Gaps = 6/418 (1%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR--GS  1505
             ADI ++D Y K +A  A +++  AY  +PE V ++ N E+     +  N+TRR+L+    
Sbjct  19    ADIGDFDDYWKARAAAAEKAAADAYDPDPETVANSVNAEIAHA-SSGRNSTRRNLKKYAG  77

Query  1504  HCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKP  1325
              C ATN IDRCWRCD +WA++RK+LA C  GFG  TTGG  G +YVV DSSD D+ NPKP
Sbjct  78    PCLATNPIDRCWRCDPNWAQNRKKLADCVLGFGRKTTGGKLGPYYVVNDSSDSDLMNPKP  137

Query  1324  GTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNV  1145
             GTLRHAVIQ+ PLWIIF  +M I L QELI+  DKTID RG +V IAYGAG+T+Q++RNV
Sbjct  138   GTLRHAVIQKGPLWIIFSTNMAIRLSQELIMTSDKTIDARGANVQIAYGAGITLQYIRNV  197

Query  1144  IIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLID  965
             IIHG++IHHI+   GGMIRD+V+H+GLRTMSDGDGISIFGS++VW+DH++MS C DGLID
Sbjct  198   IIHGLRIHHIVVGSGGMIRDAVDHVGLRTMSDGDGISIFGSSNVWIDHVSMSNCHDGLID  257

Query  964   AIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGF  785
             AIM STAITISNC F HHN V+L GASD +S+D IMQ+TVAFN FG+GL+QRMPRCRWGF
Sbjct  258   AIMGSTAITISNCHFTHHNEVMLFGASDGYSQDQIMQITVAFNHFGQGLVQRMPRCRWGF  317

Query  784   FHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRS  605
             FH+VNNDYT W MYAIGGS  PTIVSQGNRF A  N + K+VTKRE   + VWK+W WRS
Sbjct  318   FHVVNNDYTHWLMYAIGGSQHPTIVSQGNRFIAPPNVYAKEVTKREYSPEQVWKSWTWRS  377

Query  604   EGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             EGDL +NGA+FV SG++        F+  + I ++P +YV R+TR +G+L C VGR C
Sbjct  378   EGDLMMNGAFFVTSGDQSKR---RPFSRMDMISYKPGTYVKRMTRFAGSLACFVGRPC  432



>ref|XP_004155392.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase P59-like 
[Cucumis sativus]
Length=432

 Score =   510 bits (1314),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 257/418 (61%), Positives = 319/418 (76%), Gaps = 6/418 (1%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR--GS  1505
             ADI ++D Y K +A  A +++  AY  +PE V ++ N E+     +  N+TRR+L+    
Sbjct  19    ADIGDFDDYWKARAAAAEKAAADAYDPDPETVANSVNAEIAHA-SSGRNSTRRNLKKYAG  77

Query  1504  HCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKP  1325
              C ATN IDRCWRCD +WA++RK+LA C  GFG  TTGG  G +YVV DSSD D+ NPKP
Sbjct  78    PCLATNPIDRCWRCDPNWAQNRKKLADCVLGFGRKTTGGKLGPYYVVNDSSDSDLMNPKP  137

Query  1324  GTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNV  1145
             GTLRHAVIQ+ PLWIIF  +M I L QELI+  DKTID RG +V IAYGAG+T+Q++RNV
Sbjct  138   GTLRHAVIQKGPLWIIFSXNMAIRLSQELIMTSDKTIDARGANVQIAYGAGITLQYIRNV  197

Query  1144  IIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLID  965
             IIHG++IHHI+   GGMIRD+V+H+GLRTMSDGDGISIFGS++VW+DH++MS C DGLID
Sbjct  198   IIHGLRIHHIVVGSGGMIRDAVDHVGLRTMSDGDGISIFGSSNVWIDHVSMSNCHDGLID  257

Query  964   AIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGF  785
             AIM STAITISNC F HHN V+L GASD +S+D IMQ+TVAFN FG+GL+QRMPRCRWGF
Sbjct  258   AIMGSTAITISNCHFTHHNEVMLFGASDGYSQDQIMQITVAFNHFGQGLVQRMPRCRWGF  317

Query  784   FHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRS  605
             FH+VNNDYT W MYAIGGS  PTIVSQGNRF A  N + K+VTKRE   + VWK+W WRS
Sbjct  318   FHVVNNDYTHWLMYAIGGSQHPTIVSQGNRFIAPPNVYAKEVTKREYSPEQVWKSWTWRS  377

Query  604   EGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             EGDL +NGA+FV SG++        F+  + I ++P +YV R+TR +G+L C VGR C
Sbjct  378   EGDLMMNGAFFVTSGDQSKR---RPFSRMDMISYKPGTYVKRMTRFAGSLACFVGRPC  432



>gb|KCW52797.1| hypothetical protein EUGRSUZ_J02132 [Eucalyptus grandis]
Length=451

 Score =   509 bits (1310),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 259/434 (60%), Positives = 323/434 (74%), Gaps = 22/434 (5%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR---  1511
             +A I E+D Y +K+A+EA Q++L+A+   PE VT  FN  V + +++  N+TRR L    
Sbjct  23    EAHIKEFDEYWQKRAEEASQAALEAFNPEPENVTAQFNANV-NKVLDGNNSTRRQLHMHK  81

Query  1510  -GSHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMEN  1334
                 C ATN IDRCWRC ++WAK RKRLA C  GFG  TTGGLKG++YVV D SD D+ N
Sbjct  82    YSGPCLATNPIDRCWRCRKNWAKDRKRLAKCVLGFGRKTTGGLKGKYYVVYDCSDNDVVN  141

Query  1333  PKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFV  1154
             PKPGTLRHAVIQ+ PLWIIF +SMVI L QEL++   KTIDGRG +VHIA+GAG+TIQFV
Sbjct  142   PKPGTLRHAVIQKRPLWIIFARSMVIRLNQELMVASHKTIDGRGANVHIAFGAGITIQFV  201

Query  1153  RNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDG  974
             RNVIIH I+IH I+ + GG+IRD+V+H+G+RTMSDGDGISIFGS ++W+DH++M RC DG
Sbjct  202   RNVIIHNIRIHDIVTRPGGIIRDAVDHVGIRTMSDGDGISIFGSTNIWIDHVSMKRCQDG  261

Query  973   LIDAIMASTAITISNCKFNHHN-------------HVLLLGASDLFSEDAIMQVTVAFNR  833
             LIDAI  STAITISN  + HHN              V+L GASDL+  D IMQVTVAFN 
Sbjct  262   LIDAIEGSTAITISNGHYTHHNDTLMFNLHPGTYVQVMLFGASDLYPRDKIMQVTVAFNH  321

Query  832   FGKGLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTK  653
             FGKGLIQRMPRCRWGFFH+VNNDYT W MYAIGGSS+PTI+SQGNRF A  N   K+VTK
Sbjct  322   FGKGLIQRMPRCRWGFFHVVNNDYTHWLMYAIGGSSQPTIISQGNRFIAPPNLAAKEVTK  381

Query  652   REIVSKNVWKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLT  473
             R+  + +VW++W WRS+GDL +NGA+FV+SG+ L      ++   + I+ +P ++V RLT
Sbjct  382   RDYATPDVWRSWTWRSQGDLLINGAFFVQSGQPL----KKKYGRKDMIKAKPGTFVRRLT  437

Query  472   RTSGALKCKVGRFC  431
             R SG L CK  + C
Sbjct  438   RFSGTLNCKPKKRC  451



>ref|XP_004165454.1| PREDICTED: pectate lyase-like [Cucumis sativus]
 gb|KGN64253.1| hypothetical protein Csa_1G045510 [Cucumis sativus]
Length=439

 Score =   507 bits (1306),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 253/419 (60%), Positives = 317/419 (76%), Gaps = 8/419 (2%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG--  1508
             +A+IA++D   +K+A EA ++S +AY  +PEE T+NFN++V  + ++  N TRRHLR   
Sbjct  27    KANIADFDEVWQKRAIEAQKASFEAYEPHPEEETNNFNKQVHRS-LDGGNNTRRHLRKYT  85

Query  1507  SHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPK  1328
               C ATN IDRCWRCD++WA++RK+LA CA GFG  TTGG  G+ YVV DSSD D+ NPK
Sbjct  86    GPCLATNPIDRCWRCDRNWARNRKKLADCALGFGRRTTGGKDGKIYVVRDSSDNDLVNPK  145

Query  1327  PGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRN  1148
             PGTLRHAVIQE PLWIIF   MVI L +ELI+  DKT+DGRG +VHIA G  +T+QFV+N
Sbjct  146   PGTLRHAVIQERPLWIIFAHDMVIRLSEELIVTDDKTLDGRGANVHIANGGQITLQFVKN  205

Query  1147  VIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLI  968
             +IIH + IH I    GGMIRDSV+H G RT SDGDGIS+FG++ VW+DH++MS C DGLI
Sbjct  206   IIIHNLHIHDIKAGNGGMIRDSVSHYGFRTRSDGDGISMFGASRVWIDHVSMSNCQDGLI  265

Query  967   DAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWG  788
             DA+MASTAITISNC F HHN V+LLGAS+ +S D IMQVT+AFN FGKGL+QRMPRCRWG
Sbjct  266   DAVMASTAITISNCHFTHHNDVILLGASNGYSNDQIMQVTLAFNHFGKGLVQRMPRCRWG  325

Query  787   FFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWR  608
             F H+VNNDYT W MYAIGGS  PTI+SQGNRF A  NP  K+VTKR    ++ W++W WR
Sbjct  326   FIHVVNNDYTHWLMYAIGGSHNPTIISQGNRFIAPPNPNCKEVTKRVYAPESEWRSWNWR  385

Query  607   SEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             SEGDL +NGA+F++SG  +  Y     +  + I  +P ++V RLTR +G LKCK  + C
Sbjct  386   SEGDLMMNGAFFIQSGNPIKRY-----SKKDVIHSKPGTFVTRLTRFAGPLKCKKNQPC  439



>ref|XP_008456459.1| PREDICTED: pectate lyase-like [Cucumis melo]
Length=434

 Score =   507 bits (1305),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 255/412 (62%), Positives = 305/412 (74%), Gaps = 4/412 (1%)
 Frame = -1

Query  1660  DAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG--SHCKATN  1487
             D Y   +A EA + +  A+  NPE VTDN N  V   ++   N+TRR L+     C ATN
Sbjct  25    DEYWNTRATEAKKVAKSAFNPNPEIVTDNLNAAVSRAMVG-RNSTRRSLKKYRGPCLATN  83

Query  1486  SIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHA  1307
              IDRCWRCD++WAK+RK+LA C  GFG  T GG +G  YVVTD+SD D+ NPKPGTLR+ 
Sbjct  84    PIDRCWRCDRNWAKNRKKLAECPLGFGHQTIGGKRGPIYVVTDASDDDLVNPKPGTLRYG  143

Query  1306  VIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIK  1127
             VIQ+ PLWIIF +SM+I L QEL+I+ DKTID RG +VHIA+GAGLTIQFV NVIIH + 
Sbjct  144   VIQKGPLWIIFGRSMIIRLSQELMISSDKTIDARGANVHIAFGAGLTIQFVNNVIIHNLH  203

Query  1126  IHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMAST  947
             IH I+ K GGMIRDSV+H G RT SDGDGISIFGS+HVW+DH++MS C DGLIDAIM ST
Sbjct  204   IHDIISKSGGMIRDSVDHYGFRTQSDGDGISIFGSSHVWIDHVSMSNCEDGLIDAIMGST  263

Query  946   AITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNN  767
             AITISNC F HHN V+L GASD ++ED IMQVT+AFN FG+GL+QRMPRCRWGFFH+VNN
Sbjct  264   AITISNCHFTHHNEVMLFGASDSYAEDEIMQVTLAFNHFGRGLVQRMPRCRWGFFHVVNN  323

Query  766   DYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRSEGDLFL  587
             DYT W MYAIGGS  PTIVSQGNRF A  NP  KQVTKRE   ++ WK+W WRSEGD  +
Sbjct  324   DYTHWLMYAIGGSQHPTIVSQGNRFIAPPNPNAKQVTKREYAMEDEWKHWSWRSEGDELM  383

Query  586   NGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             NGA F+ SG++         +  + I  +P +YV RL R SG L+C  G+ C
Sbjct  384   NGAVFIPSGDQTKG-KKKGLSRYDMISFKPGTYVRRLARFSGTLECTPGKPC  434



>ref|XP_010105747.1| putative pectate lyase P59 [Morus notabilis]
 gb|EXC05967.1| putative pectate lyase P59 [Morus notabilis]
Length=421

 Score =   506 bits (1304),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 266/422 (63%), Positives = 324/422 (77%), Gaps = 10/422 (2%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH-  1502
             A IAE+D Y K +A++A + +LQAY+ +PEEVT+  N +V +  +   N+TRR LRG   
Sbjct  4     AHIAEFDDYWKSRAEQAQKDALQAYHPHPEEVTNQLNYDV-EEALTVKNSTRRVLRGKKN  62

Query  1501  -----CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDME  1337
                  C ATN IDRCWRCD +WA +RKRLA CARGFG  + GG  GR+YVVTDSSD D+ 
Sbjct  63    KKGGPCMATNPIDRCWRCDPNWASNRKRLADCARGFGRNSVGGKFGRYYVVTDSSDTDLV  122

Query  1336  NPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQF  1157
             NPKPGTLRHAVIQ+ PLWIIF +SM+I L +ELI+  DKTIDGRG +V IAYGAG+TIQF
Sbjct  123   NPKPGTLRHAVIQKAPLWIIFARSMIIRLSEELIMTGDKTIDGRGANVRIAYGAGITIQF  182

Query  1156  VRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSD  977
             V+NVIIH I IH I    GG IRDS+NHIG RT SDGDGISIFGS+H+W+DH++MS C D
Sbjct  183   VKNVIIHNIHIHDINAGSGGNIRDSINHIGFRTKSDGDGISIFGSSHIWIDHVSMSNCQD  242

Query  976   GLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRC  797
             GLIDAIM STAITISNC F HHN V+L GASD +S+D  MQVTVAFN FG+GL+QRMPRC
Sbjct  243   GLIDAIMGSTAITISNCHFTHHNEVMLFGASDSYSDDQRMQVTVAFNHFGQGLVQRMPRC  302

Query  796   RWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNW  617
             RWGFFH+VNNDYT W MYAIGGS  PTI+SQGNRF A  +   KQVTKR+   ++ WKNW
Sbjct  303   RWGFFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPLDLNAKQVTKRDYAPESDWKNW  362

Query  616   QWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGR  437
             +WRSEGDL +NGA+FV+SG+ L   +  R++    I+++P ++V RLTR +G L C +GR
Sbjct  363   RWRSEGDLLMNGAFFVQSGKRL---SKRRYSRPGMIKYKPGTFVTRLTRYAGTLVCGIGR  419

Query  436   FC  431
              C
Sbjct  420   PC  421



>ref|XP_004162547.1| PREDICTED: probable pectate lyase P59-like [Cucumis sativus]
Length=435

 Score =   506 bits (1304),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 255/413 (62%), Positives = 306/413 (74%), Gaps = 5/413 (1%)
 Frame = -1

Query  1660  DAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH---CKAT  1490
             D Y + +A EA + +  A+  NPE VTD  N  V  T++   N+TRR LR  +   C AT
Sbjct  25    DEYWETRATEAKKVAQGAFNANPEIVTDTLNAAVSRTMLG-HNSTRRSLRKKYRGPCLAT  83

Query  1489  NSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRH  1310
             N IDRCWRCD++WAK+R++LA C  GFG  T GG +G  YVVTD+SD D+ NPKPGTLRH
Sbjct  84    NPIDRCWRCDRNWAKNRRKLAECPLGFGHQTIGGKRGPIYVVTDASDDDLVNPKPGTLRH  143

Query  1309  AVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGI  1130
              VIQ+ PLWIIF +SMVI L QEL+I+  KTID RG +VHIA+GAGLTIQFV NVIIH +
Sbjct  144   GVIQKGPLWIIFGRSMVIRLSQELMISSHKTIDARGANVHIAFGAGLTIQFVNNVIIHNL  203

Query  1129  KIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMAS  950
              IH I+ K GGMIRDSV+H G RT SDGDGISIFGS+HVW+DH++MS C DGLIDAIM S
Sbjct  204   HIHDIVSKSGGMIRDSVDHYGFRTQSDGDGISIFGSSHVWIDHVSMSNCQDGLIDAIMGS  263

Query  949   TAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVN  770
             TAITISNC F HHN V+L GASD ++ED IMQVT+AFN FG+GL+QRMPRCRWGFFH+VN
Sbjct  264   TAITISNCHFTHHNEVMLFGASDSYAEDEIMQVTLAFNHFGRGLVQRMPRCRWGFFHVVN  323

Query  769   NDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRSEGDLF  590
             NDYT W MYAIGGS  PTIVSQGNRF A  NP  KQVTKRE   ++ WK+W WRSEGD  
Sbjct  324   NDYTHWLMYAIGGSQHPTIVSQGNRFIAPPNPNAKQVTKREYAMEDEWKHWSWRSEGDEL  383

Query  589   LNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             +NGA F+ SG++         +  + I  +P +YV RL R SG ++C  G+ C
Sbjct  384   MNGAVFIASGDQTKG-KKKGLSRYDMISFKPGTYVRRLVRLSGTIECTPGKPC  435



>ref|XP_004146792.1| PREDICTED: probable pectate lyase P59-like, partial [Cucumis 
sativus]
Length=442

 Score =   506 bits (1302),  Expect = 9e-171, Method: Compositional matrix adjust.
 Identities = 254/415 (61%), Positives = 307/415 (74%), Gaps = 5/415 (1%)
 Frame = -1

Query  1666  EYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH---CK  1496
             + D Y + +A EA + +  A+  NPE VTD  N  V  T++   N+TRR LR  +   C 
Sbjct  30    DEDEYWQTRATEAKKVAQGAFNANPEIVTDTLNAAVSRTMLG-HNSTRRSLRKKYRGPCL  88

Query  1495  ATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGTL  1316
             ATN IDRCWRCD++WAK+R++LA C  GFG  T GG +G  YVVTD+SD D+ NPKPGTL
Sbjct  89    ATNPIDRCWRCDRNWAKNRRKLAECPLGFGHQTIGGKRGPIYVVTDASDDDLVNPKPGTL  148

Query  1315  RHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIH  1136
             RH VIQ+ PLWIIF +SMVI L QEL+I+  KTID RG +VHIA+GAGLTIQFV NVIIH
Sbjct  149   RHGVIQKGPLWIIFGRSMVIRLSQELMISSHKTIDARGANVHIAFGAGLTIQFVNNVIIH  208

Query  1135  GIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIM  956
              + IH I+ K GGMIRDSV+H G RT SDGDGISIFGS+HVW+DH++MS C DGLIDAIM
Sbjct  209   NLHIHDIVSKSGGMIRDSVDHYGFRTQSDGDGISIFGSSHVWIDHVSMSNCQDGLIDAIM  268

Query  955   ASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHI  776
              STAITISNC F HHN V+L GASD ++ED IMQVT+AFN FG+GL+QRMPRCRWGFFH+
Sbjct  269   GSTAITISNCHFTHHNEVMLFGASDSYAEDEIMQVTLAFNHFGRGLVQRMPRCRWGFFHV  328

Query  775   VNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRSEGD  596
             VNNDYT W MYAIGGS  PTIVSQGNRF A  NP  KQ+TKRE   ++ WK+W WRSEGD
Sbjct  329   VNNDYTHWLMYAIGGSQHPTIVSQGNRFIAPPNPNAKQITKREYAMEDEWKHWSWRSEGD  388

Query  595   LFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
               +NGA F+ SG++         +  + I  +P +YV RL R SG ++C  G+ C
Sbjct  389   ELMNGAVFIASGDQTKG-KKKGLSRYDMISFKPGTYVRRLVRLSGTIECTPGKPC  442



>gb|EPS73633.1| hypothetical protein M569_01123, partial [Genlisea aurea]
Length=455

 Score =   506 bits (1303),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 268/438 (61%), Positives = 320/438 (73%), Gaps = 27/438 (6%)
 Frame = -1

Query  1669  AEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG--SHCK  1496
             A+ D Y+K +A+EA + SL+AY  NPE+V + FN+ V D+++   N+TRR LRG    C+
Sbjct  20    AQLDEYMKSRAEEARRESLKAYKDNPEDVAEQFNQLVSDSLIG-ANSTRRDLRGVGGGCR  78

Query  1495  ATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGTL  1316
             ATN IDRCWRCD DWAK+RK+LA C RGFG  TTGG  GR+Y+VTD SD DM NPKPGTL
Sbjct  79    ATNPIDRCWRCDNDWAKNRKKLADCVRGFGHDTTGGKNGRYYLVTDPSDNDMANPKPGTL  138

Query  1315  RHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIH  1136
             RHAVIQ+EPLWIIF  SM+I L QELI    KTIDGRGV VHIA GAGLTIQFV NVIIH
Sbjct  139   RHAVIQKEPLWIIFAHSMIIRLNQELIFTSHKTIDGRGVQVHIANGAGLTIQFVTNVIIH  198

Query  1135  GIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIM  956
              I IH+I P  GGMIRDS++HIGLRTMSDGD ISI+GS+ VW+DH+++S+  DGLIDAI 
Sbjct  199   NIWIHNIAPAGGGMIRDSIDHIGLRTMSDGDAISIYGSSRVWIDHVSLSKAYDGLIDAIQ  258

Query  955   ASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHI  776
              STAITISNCKFNHHN V+LLGA D    DAIMQVTVAFNRFG G IQRMPR RWGF H+
Sbjct  259   GSTAITISNCKFNHHNDVMLLGAHDDNPGDAIMQVTVAFNRFGIGCIQRMPRVRWGFVHV  318

Query  775   VNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTK-----------------------  665
             VNNDY  WE+YAIGGS+ PTI+SQGNR++AS   +TK                       
Sbjct  319   VNNDYQHWELYAIGGSAHPTIISQGNRYRASDYRYTKEVRNPNYSLSPLPPKSHRKTQNL  378

Query  664   QVTKREIVSKNVWKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYV  485
             QVTKR+   K+ W  W+WRSEGD F+NGA+F +SG              N I+++P +YV
Sbjct  379   QVTKRDYAPKSEWSKWKWRSEGDFFMNGAFFTQSGSPF-SVGTKPLTKRNVIKYKPGTYV  437

Query  484   GRLTRTSGALKCKVGRFC  431
             GRLTR +GA+KC+ G +C
Sbjct  438   GRLTRNAGAMKCRKGSYC  455



>ref|XP_010256490.1| PREDICTED: pectate lyase-like [Nelumbo nucifera]
Length=441

 Score =   505 bits (1301),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 249/421 (59%), Positives = 317/421 (75%), Gaps = 8/421 (2%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR---  1511
             +A IAE+D   +K+A+EA ++++ AY+ NP+EV ++ N  V    M  +N TRR L+   
Sbjct  25    RAHIAEFDEVWQKRAEEAKKNAMDAYHPNPDEVINHLNMNV-HLAMQESNGTRRSLKTKP  83

Query  1510  -GSHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMEN  1334
              G  C ATN IDRCWRC ++W+++RK+LA C  GFG  T GG  G+FYVVTD SD DM N
Sbjct  84    YGGPCLATNPIDRCWRCQKNWSRNRKKLADCVVGFGRKTIGGKLGKFYVVTDGSDNDMLN  143

Query  1333  PKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFV  1154
             PKPGTLRHAVIQ+EPLWIIF + MVI L QEL++  DKTID RG +VH+AYGAG+TIQFV
Sbjct  144   PKPGTLRHAVIQKEPLWIIFARDMVIRLNQELLMAGDKTIDARGANVHVAYGAGITIQFV  203

Query  1153  RNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDG  974
             +NVIIHG+ +H I+P  GG+IRDSV+H GLRT SDGDGIS+FG+ +VW+DH++MS C DG
Sbjct  204   KNVIIHGLHVHDIVPGSGGLIRDSVDHYGLRTQSDGDGISLFGATNVWIDHISMSNCKDG  263

Query  973   LIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCR  794
             LIDAIM++TA+T+SNC F HHN V+L GAS  +S DA+MQ+TVAFN FG+GL+QRMPRCR
Sbjct  264   LIDAIMSTTAVTVSNCHFTHHNEVMLFGASGSYSGDAVMQITVAFNHFGRGLVQRMPRCR  323

Query  793   WGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQ  614
             WGF H+VNNDYT W MYAIGGS  PTI+SQGNRF A      K+VTKR+   ++ WK+W 
Sbjct  324   WGFAHVVNNDYTHWIMYAIGGSEHPTIISQGNRFIAPPTLAAKEVTKRDYAPESEWKHWT  383

Query  613   WRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRF  434
             WRSE DL +NGA+FV+SG     +    F+  + I  +P +YV  LTR SGAL CK+ + 
Sbjct  384   WRSEDDLMMNGAFFVQSGNPSRKH---PFSKKDMIPAKPGTYVSTLTRFSGALGCKINKP  440

Query  433   C  431
             C
Sbjct  441   C  441



>ref|XP_007046218.1| Pectate lyase family protein, putative [Theobroma cacao]
 gb|EOY02050.1| Pectate lyase family protein, putative [Theobroma cacao]
Length=441

 Score =   505 bits (1301),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 258/420 (61%), Positives = 308/420 (73%), Gaps = 8/420 (2%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH-  1502
             A IAEYD Y +++  EA +   +AY  NPEEVT +FN  V  T+M + N+TRR LRG   
Sbjct  26    AHIAEYDDYWRQREAEAKEHFNKAYNPNPEEVTQHFNHHVARTLMGF-NSTRRSLRGKRR  84

Query  1501  ---CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENP  1331
                C+ATN ID+CWRCD +W ++RKRLA C+ GFG GT GG  GR+Y+VTD SD DM NP
Sbjct  85    TGPCQATNPIDQCWRCDPNWHRNRKRLADCSLGFGRGTIGGKNGRYYIVTDPSDNDMVNP  144

Query  1330  KPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVR  1151
             KPGTLRHAVIQ+ PLWIIF +SM+I L QELI+  DKTID RG +VH+AYGAG+TIQF R
Sbjct  145   KPGTLRHAVIQKRPLWIIFARSMIIKLNQELIMTSDKTIDARGANVHVAYGAGITIQFAR  204

Query  1150  NVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGL  971
             N+IIHG+ IH I+   GGMIRDSV+H G RT SDGDG+S+FG+ ++WLDHL+M  C DGL
Sbjct  205   NIIIHGLHIHDIVQGSGGMIRDSVDHYGFRTKSDGDGVSLFGATNIWLDHLSMYNCYDGL  264

Query  970   IDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRW  791
             IDAI  STAITISNC F +HN V+L GASD +SED  MQ+TVAF  FGKGL+QRMPRCRW
Sbjct  265   IDAIQGSTAITISNCHFTNHNEVMLFGASDSYSEDQKMQITVAFTHFGKGLVQRMPRCRW  324

Query  790   GFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQW  611
             GF H+VNNDYT W MYAIGGSS PTI+SQGNRF A  N   K+VTKR+     VWKNW W
Sbjct  325   GFIHVVNNDYTHWLMYAIGGSSHPTIISQGNRFVAPPNAAAKEVTKRDYAPPEVWKNWSW  384

Query  610   RSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             RSEGDL +NGA+F +SG+      + RF     I  +P   V  LTR SG+L C   R C
Sbjct  385   RSEGDLMVNGAFFTQSGDP---RASRRFLGNFMISAKPGQMVSLLTRYSGSLDCVRRRPC  441



>ref|XP_007215366.1| hypothetical protein PRUPE_ppa005602mg [Prunus persica]
 gb|EMJ16565.1| hypothetical protein PRUPE_ppa005602mg [Prunus persica]
Length=452

 Score =   505 bits (1300),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 259/427 (61%), Positives = 317/427 (74%), Gaps = 14/427 (3%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGD-TIMNW------TNTTRR  1520
             +++ ++DA  K++  +A +++L+AY  NPE+VTD+FNE V +   +N+      +N T R
Sbjct  29    SNVGQFDAVWKERELKAEKAALKAYQPNPEKVTDDFNESVQEFDDLNFEDDDQVSNITGR  88

Query  1519  HLRGSH----CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSS  1352
             HL G      CKATN IDRCWRC +DWA  RK+LA C +GFG  T GG +G FYVVTD S
Sbjct  89    HLLGKKYKGPCKATNPIDRCWRCRKDWANDRKKLANCVKGFGRRTRGGKRGGFYVVTDPS  148

Query  1351  DKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAG  1172
             D ++ +PKPGTLRHAVIQ +PLWIIF +SM I L QELI+   KTID RG +V IA+GAG
Sbjct  149   DSNVVDPKPGTLRHAVIQPQPLWIIFARSMTIRLTQELILTSHKTIDARGANVRIAHGAG  208

Query  1171  LTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTM  992
             +T+QFV+NVIIHG+ IH I+P  GG IRDSV+H G RT SDGDGISIFGS+H+WLDHL+M
Sbjct  209   ITLQFVQNVIIHGLHIHDIVPGSGGTIRDSVDHFGTRTQSDGDGISIFGSSHIWLDHLSM  268

Query  991   SRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQ  812
               C DGLID I  STAITISNC F  HN VLL GASD F+ DAIMQ+TVAFN FGKGL+Q
Sbjct  269   WNCGDGLIDVIQGSTAITISNCHFTRHNDVLLFGASDSFAGDAIMQITVAFNHFGKGLVQ  328

Query  811   RMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKN  632
             RMPRCRWGF H+VNNDYT W MYAIGGSS PTI+SQGNRF A  N   K+VTKR+    +
Sbjct  329   RMPRCRWGFIHVVNNDYTHWLMYAIGGSSHPTIISQGNRFIAPPNHAAKEVTKRDYAPVD  388

Query  631   VWKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALK  452
             VWKNWQWRSEGDL LNGA+FVESG    ++    F   + +  +P ++V RLTR +G L 
Sbjct  389   VWKNWQWRSEGDLMLNGAFFVESGVAKKNH---GFGKLDMMTAKPGTFVTRLTRFAGTLG  445

Query  451   CKVGRFC  431
             C+VG+ C
Sbjct  446   CRVGQKC  452



>ref|XP_007227702.1| hypothetical protein PRUPE_ppa005744mg [Prunus persica]
 gb|EMJ28901.1| hypothetical protein PRUPE_ppa005744mg [Prunus persica]
Length=446

 Score =   505 bits (1300),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 250/417 (60%), Positives = 316/417 (76%), Gaps = 10/417 (2%)
 Frame = -1

Query  1666  EYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH-----  1502
             + D Y K++A+EA + ++Q++  +PE+VT+ FN  VG+ +M   N TRRHLRG+      
Sbjct  35    QLDIYWKQRAEEAKKEAMQSFETDPEQVTEEFNSNVGELLMK-QNGTRRHLRGNKKYNGP  93

Query  1501  CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPG  1322
             C ATN +D CWRCD++WAK+RKRLA C +GFG  TTGG  G  YVVTD SD D+ NPKPG
Sbjct  94    CMATNPMDACWRCDKNWAKNRKRLADCVQGFGKKTTGGKAGPIYVVTDPSDLDLVNPKPG  153

Query  1321  TLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVI  1142
             TLRHAVIQ+ PLWIIF ++MVI L+QEL++  DKTIDGRG +V+I  GAG+T+QFV+NVI
Sbjct  154   TLRHAVIQKGPLWIIFARNMVIRLQQELLVTSDKTIDGRGANVNIHNGAGITLQFVKNVI  213

Query  1141  IHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDA  962
             I  + I  I+PK GGMIRDSV+HIG RT SDGDGISIFGS++VW+DH++M  C+DGLIDA
Sbjct  214   ITNLHIKKIVPKQGGMIRDSVDHIGRRTKSDGDGISIFGSSNVWIDHVSMENCADGLIDA  273

Query  961   IMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFF  782
             IM STAITISN  F HHN V+L GAS+ +++D IMQ+TVAFN FG+GL+QRMPRCR GFF
Sbjct  274   IMGSTAITISNSHFTHHNDVMLFGASNSYTQDKIMQITVAFNHFGQGLVQRMPRCRHGFF  333

Query  781   HIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRSE  602
             H+VNNDYT W MYAIGGS  PTI+SQGNRF A  N   K+VTKR+  ++  WKNW+WRSE
Sbjct  334   HVVNNDYTHWLMYAIGGSMNPTIISQGNRFIAPPNQGAKEVTKRDHTAEAEWKNWEWRSE  393

Query  601   GDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             GDL +NGA FV+SG     +        + +  +P +YV +LT+ SGAL C VG+ C
Sbjct  394   GDLMMNGAVFVQSGSGKSKH----PAKMDLMPFKPGTYVAKLTKFSGALDCFVGKPC  446



>ref|XP_002272638.2| PREDICTED: pectate lyase-like [Vitis vinifera]
Length=434

 Score =   503 bits (1295),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 255/418 (61%), Positives = 313/418 (75%), Gaps = 8/418 (2%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR--GS  1505
             A+I ++D   + +A+EA +++LQAY  +PE+VTDNFN++V  +  + TN TRR+L     
Sbjct  23    ANIGDFDEVWQTRAEEARKAALQAYNPHPEKVTDNFNKKVHKS-FDSTNHTRRNLSKFSG  81

Query  1504  HCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKP  1325
              C ATN IDRCWRC  DWA +R +LA C  GFG  TTGG  G+ YVVTD SD DM NPKP
Sbjct  82    LCMATNPIDRCWRCRSDWASNRMKLADCVLGFGQKTTGGKGGKIYVVTDPSDNDMVNPKP  141

Query  1324  GTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNV  1145
             GTLRHA IQEEPLWIIF  SM I L +ELI+  +KTID RG +VHIA GAGLT+QFV N+
Sbjct  142   GTLRHAAIQEEPLWIIFAHSMAIRLNEELIMTSNKTIDARGANVHIANGAGLTLQFVHNI  201

Query  1144  IIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLID  965
             IIHG+ IH I    GG+IRDS +H G RT SDGDGISIFG+ ++W+DH++MS C+DGLID
Sbjct  202   IIHGLHIHDIKVGNGGLIRDSASHYGFRTRSDGDGISIFGATNIWIDHISMSNCADGLID  261

Query  964   AIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGF  785
             AIMASTAITISNC F HHN V+L GASD +S DAIMQ+T+ FN FG+GL QRMPRCRWGF
Sbjct  262   AIMASTAITISNCHFTHHNEVMLFGASDGYSGDAIMQITITFNHFGQGLTQRMPRCRWGF  321

Query  784   FHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRS  605
             FH+VNNDYT W MYAIGGS  PTI+SQGNRF A  +   K+VTKR+   ++VWK+W WRS
Sbjct  322   FHVVNNDYTHWLMYAIGGSHHPTILSQGNRFIAPPDINCKEVTKRDYSPESVWKSWTWRS  381

Query  604   EGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             +GDL +NGA+FVESG+    +     +N   IR +P ++V RLTR SGAL C+ G  C
Sbjct  382   QGDLMMNGAFFVESGDPNFDF-----SNKYVIRAKPGAFVTRLTRFSGALSCREGMPC  434



>ref|XP_010242445.1| PREDICTED: pectate lyase [Nelumbo nucifera]
Length=443

 Score =   503 bits (1294),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 251/424 (59%), Positives = 309/424 (73%), Gaps = 14/424 (3%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEV---GDTIMNWTNTTRRHLR  1511
             +A I ++D   +K+A+EA  ++L+AY+ +P+EV ++FN  V      + +  ++TRR LR
Sbjct  27    RAHIGDFDEVWQKRAEEAKSNALEAYHPDPDEVINHFNHHVHLATAEVRSGNSSTRRSLR  86

Query  1510  GSH----CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKD  1343
                    C ATN IDRCWRC   W K+RK+LA C  GFG  T GG  G+FYVVTD SD D
Sbjct  87    NKEYKGPCMATNPIDRCWRCRSKWGKNRKKLADCVLGFGRKTVGGKYGKFYVVTDGSDDD  146

Query  1342  MENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTI  1163
             MENPKPGTLRHAVIQ EPLWIIF+  M+I LKQELI+  DKT+DGRG  VHIAYGAG+TI
Sbjct  147   MENPKPGTLRHAVIQTEPLWIIFEHDMIIRLKQELIMTSDKTLDGRGARVHIAYGAGITI  206

Query  1162  QFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRC  983
             QF++NVIIH +  H I+ + GGMIRDSVNH+G RT SDGD ISIFGS +VW+DH +MS C
Sbjct  207   QFIKNVIIHNLHFHDIVAREGGMIRDSVNHLGFRTASDGDAISIFGSTNVWIDHNSMSNC  266

Query  982   SDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMP  803
              DGL+DAIM STAITISN    HHN V+L GASD + +D+ MQ+TVAFN FG+GL+QRMP
Sbjct  267   KDGLVDAIMGSTAITISNNHLTHHNEVMLFGASDSYPDDSKMQITVAFNHFGRGLVQRMP  326

Query  802   RCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWK  623
             RCRWGFFH+VNNDYT W MYAIGGSS PTI+SQGNRF A      KQVT R    ++VWK
Sbjct  327   RCRWGFFHVVNNDYTHWLMYAIGGSSNPTIISQGNRFIAPPTEAAKQVTNRNYAPESVWK  386

Query  622   NWQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKV  443
             +W WRSEGDL +NGAYF++SG+ +           + I  +  ++V RL R SGAL CKV
Sbjct  387   HWTWRSEGDLMMNGAYFIQSGKPI-------KKKRDMITAKKGTFVKRLVRFSGALNCKV  439

Query  442   GRFC  431
             G+ C
Sbjct  440   GKRC  443



>ref|XP_007037229.1| Pectate lyase family protein [Theobroma cacao]
 gb|EOY21730.1| Pectate lyase family protein [Theobroma cacao]
Length=434

 Score =   501 bits (1291),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 258/420 (61%), Positives = 317/420 (75%), Gaps = 10/420 (2%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHL---R  1511
             +A+I E+D   +K+A+EA +++L+AY  NPE+VTDN N+E G  +   +N+TRR+L   R
Sbjct  22    KANIGEFDEVWQKRAEEAKKAALRAYEPNPEKVTDNLNKETGKALKG-SNSTRRNLGRYR  80

Query  1510  GSHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENP  1331
             G  C ATN IDRCWRCD  WA++RK+LA C  GFG  TTGG  GRFYVVTD SD DM NP
Sbjct  81    GP-CLATNPIDRCWRCDPHWAENRKKLATCVLGFGRRTTGGKDGRFYVVTDPSDNDMINP  139

Query  1330  KPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVR  1151
             KPGT+RHAVIQ+EPLWIIF   MVI L +ELI+  DKTIDGRG +VH   GA +T+Q+++
Sbjct  140   KPGTIRHAVIQKEPLWIIFAHDMVIRLNEELIMTSDKTIDGRGANVHFFRGAQITLQYIQ  199

Query  1150  NVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGL  971
             NVIIHGI I   +   GGMIRDSV+H G RT SDGDGISIFGS+++W+DH++MSRCSDGL
Sbjct  200   NVIIHGIHIRLSVEANGGMIRDSVDHFGFRTKSDGDGISIFGSHNIWIDHVSMSRCSDGL  259

Query  970   IDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRW  791
             ID I ASTAITISNC F  HN V+L GASD FS+D IMQVTVAFN FG+GL+QRMPRCRW
Sbjct  260   IDVIQASTAITISNCHFTDHNDVMLFGASDSFSDDKIMQVTVAFNHFGQGLVQRMPRCRW  319

Query  790   GFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQW  611
             GF H+VNNDYT W MYAIGGS++PTI+SQGNRF A  N   K+VTKRE   ++ WK+W W
Sbjct  320   GFIHVVNNDYTHWLMYAIGGSNQPTILSQGNRFIAPPNIACKEVTKREYAPESEWKSWNW  379

Query  610   RSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             RSE DL +NGA+FV+SG  +        N  + I+ +P ++V RLTR SGAL C   + C
Sbjct  380   RSENDLMMNGAFFVQSGSPIGR-----GNRQDVIKAKPGTFVTRLTRFSGALHCFKNKPC  434



>ref|XP_002270089.1| PREDICTED: pectate lyase [Vitis vinifera]
 emb|CBI32015.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   501 bits (1289),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 259/423 (61%), Positives = 310/423 (73%), Gaps = 10/423 (2%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR--G  1508
             +A IAEYD Y K++ +EA +++L+A++  P+EV D+FN  V D +   +N TRR LR   
Sbjct  25    RAHIAEYDDYWKEREEEAKKAALEAFHPTPQEVNDHFNLHVEDELTG-SNGTRRSLRVNK  83

Query  1507  SHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPK  1328
               CKATN IDRCWRC  +WA  RKRLA C  GFG  T GG  G++Y VTD SD DM NPK
Sbjct  84    GPCKATNPIDRCWRCRPNWASQRKRLADCVLGFGRNTVGGKYGKYYFVTDPSDNDMVNPK  143

Query  1327  PGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRN  1148
              GTLRHAVIQ  PLWI+F +SM+I L QELI+  DKTIDGRGV+VHIAYGAG+TIQFV+N
Sbjct  144   KGTLRHAVIQPRPLWIVFARSMIIRLNQELIMTSDKTIDGRGVNVHIAYGAGITIQFVKN  203

Query  1147  VIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLI  968
             VIIHG+ IH I+   GG+IRDSVNH G R+ SDGDGISI+GS+HVW+DH +MS C DGLI
Sbjct  204   VIIHGLHIHDIVSGSGGLIRDSVNHFGYRSRSDGDGISIYGSSHVWIDHNSMSNCKDGLI  263

Query  967   DAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWG  788
             DAI  STAITISN  F  HN V+L GASD  S D IMQ+TVAFN FG+GLIQRMPRCRWG
Sbjct  264   DAIQGSTAITISNNHFTKHNEVMLFGASDSNSADEIMQITVAFNHFGRGLIQRMPRCRWG  323

Query  787   FFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASS--NPF--TKQVTKREIVSKNVWKN  620
             FFH+VNNDYT W MYAIGGS+ PTI+SQGNR+ A    +P    KQVTKR+   ++ WK 
Sbjct  324   FFHVVNNDYTHWNMYAIGGSAHPTIISQGNRYTAPHLVDPKHDAKQVTKRDYAMESEWKK  383

Query  619   WQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVG  440
             W WRSEGDL  NGA+FV SG          ++  + I+ +P +YV RLTR SGAL C+ G
Sbjct  384   WTWRSEGDLMRNGAFFVPSGNP---SKRMPYSRLDMIKAKPGTYVSRLTRFSGALTCRRG  440

Query  439   RFC  431
               C
Sbjct  441   GPC  443



>ref|XP_010925369.1| PREDICTED: pectate lyase [Elaeis guineensis]
Length=444

 Score =   499 bits (1286),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 258/423 (61%), Positives = 306/423 (72%), Gaps = 11/423 (3%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG---  1508
             ADI E D + +KKA+EAL  S  AY+ +PE VT++FN+ V   +    N+TRR LR    
Sbjct  26    ADIPELDDHWQKKAEEALARSRAAYHPDPEAVTNHFNKAVHLALAEARNSTRRSLRAVGV  85

Query  1507  ----SHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDM  1340
                   C ATN IDRCWRC ++W KHRK+LA C +GFG   TGG  G FYVVTD SD D+
Sbjct  86    KKFKGKCVATNPIDRCWRCQKNWIKHRKKLATCGKGFGRHATGGKAGDFYVVTDPSDDDL  145

Query  1339  ENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQ  1160
              NPK GTLR  VIQ+ PLWI+F + M+I L +EL+IN +KTID RG +VHIAYGA +TIQ
Sbjct  146   VNPKFGTLRWGVIQDRPLWIVFARDMIIRLSEELMINSNKTIDARGANVHIAYGAQITIQ  205

Query  1159  FVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCS  980
             FV NVIIHG+ IH I P  GGMIRDS++H GLRT SDGDGISI+GS+ VW+DH +M  C+
Sbjct  206   FVNNVIIHGLHIHDIKPSNGGMIRDSLHHFGLRTKSDGDGISIYGSSDVWIDHCSMRNCA  265

Query  979   DGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPR  800
             DGLIDAI  STAITISNC F HHN VLL GASD    D+IMQ TVAFN FGKGL+QRMPR
Sbjct  266   DGLIDAIEGSTAITISNCHFTHHNDVLLFGASDSNENDSIMQATVAFNHFGKGLVQRMPR  325

Query  799   CRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKN  620
             CRWGFFH+VNNDYT W MYAIGGS  PTI+SQGNRF A    F K+VTKR+  +++VWK 
Sbjct  326   CRWGFFHVVNNDYTHWMMYAIGGSKHPTIISQGNRFIAPPLRFAKEVTKRDYATEDVWKQ  385

Query  619   WQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVG  440
             W WRSEGDL  NGA+F ESG      N   F+  + IR +P ++V RLTR +G L CK G
Sbjct  386   WTWRSEGDLMQNGAFFRESGTP----NTRTFHRKDFIRAKPGTWVRRLTRFAGPLGCKAG  441

Query  439   RFC  431
             R C
Sbjct  442   RAC  444



>emb|CDP14850.1| unnamed protein product [Coffea canephora]
Length=435

 Score =   498 bits (1282),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 248/419 (59%), Positives = 314/419 (75%), Gaps = 7/419 (2%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRR--HLRG  1508
             +A IAE+D   +K+A+EA +++ QAY+ NPE VT +FNEEV  +I +  N+ RR  H   
Sbjct  22    EAHIAEFDEVWQKRAEEAKKAARQAYHPNPENVTSHFNEEVHRSI-DGHNSRRRDLHKYN  80

Query  1507  SHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPK  1328
               C ATN ID+CWRC ++W K+R +LA CA GFG   TGG  GR Y VTD SD D+ NPK
Sbjct  81    GPCTATNPIDQCWRCQKNWRKNRMKLADCALGFGRHATGGKGGRIYKVTDPSDNDLVNPK  140

Query  1327  PGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRN  1148
             PGTLRHA+IQ EPLW+IF K+MVI L QELI+  +KTIDGRGV VHIAYGAG T+QFV N
Sbjct  141   PGTLRHALIQPEPLWVIFTKNMVIRLSQELIMTSNKTIDGRGVQVHIAYGAGFTLQFVHN  200

Query  1147  VIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLI  968
             +IIH + IH I    GGMIRDSVNH G+R+ SDGDGISI+GS ++W+DH++MS C+DGLI
Sbjct  201   IIIHNLHIHDIKSGNGGMIRDSVNHYGIRSRSDGDGISIYGSTNIWIDHISMSNCNDGLI  260

Query  967   DAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWG  788
             DA+ ASTAITISN  F HHN  +L GASD +S+D+IMQ+T+AFN FG+G+ QRMPR RWG
Sbjct  261   DAVQASTAITISNGHFTHHNEAMLFGASDSYSDDSIMQITLAFNHFGQGIEQRMPRARWG  320

Query  787   FFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWR  608
             F H+VNNDYT W MYAIGGS  PTI+SQGNRF A  NP+ K+VTKR+   ++VWK+W W+
Sbjct  321   FVHVVNNDYTHWLMYAIGGSQHPTILSQGNRFIAPENPYAKEVTKRDYAPESVWKDWVWK  380

Query  607   SEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             S+GDL +NGA+FV+SG+  H++     +N + I  +P  +  RLTR +GAL C   R C
Sbjct  381   SQGDLMMNGAFFVQSGDPNHNF----GSNADLIGPKPGEFANRLTRFAGALNCIAKRPC  435



>ref|XP_002270112.1| PREDICTED: pectate lyase [Vitis vinifera]
 emb|CBI32014.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   498 bits (1281),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 256/417 (61%), Positives = 312/417 (75%), Gaps = 10/417 (2%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR--G  1508
             +A IAEYD Y K +  EA   ++ A+  +PE+V D+FN+ V  +I    N TRR+L+   
Sbjct  25    RAHIAEYDDYWKAREKEAKTVAIDAFDPSPEDVNDDFNKNVEKSIFG-KNGTRRNLKVNK  83

Query  1507  SHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPK  1328
               CKATN IDRCWRC ++WA  R+RLA C  GFG  T GG  GR Y+VTD SD DM NPK
Sbjct  84    GPCKATNPIDRCWRCRRNWAMDRRRLADCVLGFGRRTVGGKHGRLYIVTDPSDNDMLNPK  143

Query  1327  PGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRN  1148
             PGTLR+AVIQ +PLWI+F +SM+I LKQEL++  DKTIDGRGV+VHIAYGAG+TIQF RN
Sbjct  144   PGTLRYAVIQPQPLWIVFGRSMIIKLKQELMVTSDKTIDGRGVNVHIAYGAGITIQFARN  203

Query  1147  VIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLI  968
             VIIHG+ IH I+ + GG+IRDSV+H GLRT SDGDGISIFGS+HVW+DH +MS+C DGL+
Sbjct  204   VIIHGLHIHDIVSRPGGLIRDSVHHFGLRTRSDGDGISIFGSSHVWIDHNSMSKCEDGLV  263

Query  967   DAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWG  788
             DAI  STAITISN  F  HN  +LLGASD +S D IMQVTVAFN FG+GLIQRMPRCRWG
Sbjct  264   DAIQGSTAITISNNHFTKHNETMLLGASDGYSGDIIMQVTVAFNHFGRGLIQRMPRCRWG  323

Query  787   FFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASS--NPF--TKQVTKREIVSKNVWKN  620
             FFH+VNNDYT W MYA+GGS+ PTIVSQGNR+ A+   +P    K+VTKR+  +K  W  
Sbjct  324   FFHVVNNDYTHWNMYAVGGSAHPTIVSQGNRYVAAPLMDPKHDAKEVTKRDHATKAEWSK  383

Query  619   WQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKC  449
             W WRSEGDL +NGA+FV+SG     +    F+  + I+ +P  +V RLTR SGAL C
Sbjct  384   WTWRSEGDLMVNGAFFVQSGVP---FKKKPFSRYDMIKAKPGKFVPRLTRYSGALTC  437



>ref|XP_008221660.1| PREDICTED: probable pectate lyase 3 [Prunus mume]
Length=443

 Score =   497 bits (1280),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 250/417 (60%), Positives = 313/417 (75%), Gaps = 10/417 (2%)
 Frame = -1

Query  1666  EYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG-----SH  1502
             + DAY K++A+EA + ++Q++  +PE VT+ FN  VG+ +M   N TRR+LRG       
Sbjct  32    QLDAYWKQRAEEAEKVAMQSFQTDPELVTEEFNSNVGELLMK-LNGTRRNLRGVKKYNGP  90

Query  1501  CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPG  1322
             C ATN ID CWRCD++WAK+RKRLA C +GFG  TTGG  G  YVVTD SD D+ NPKPG
Sbjct  91    CMATNPIDACWRCDKNWAKNRKRLANCVQGFGRKTTGGKGGPIYVVTDPSDLDLVNPKPG  150

Query  1321  TLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVI  1142
             TLRHAVIQ+ PLWIIF +SMVI L+QELI+  DKTIDGRG +V+I  GAG+T+QFV+NVI
Sbjct  151   TLRHAVIQKGPLWIIFARSMVIRLQQELIVTSDKTIDGRGANVNIHDGAGITLQFVKNVI  210

Query  1141  IHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDA  962
             I  + I  I+PK GGMIRDSV+H+G RT SDGDGISIFGS++VW+DH++M  C+DGLIDA
Sbjct  211   ITNLHIKRIVPKGGGMIRDSVDHLGQRTRSDGDGISIFGSSNVWIDHVSMENCADGLIDA  270

Query  961   IMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFF  782
             IM STAITISN  F HHN V+L GAS+ +++D IMQ+TVAFN FG+GL+QRMPRCR GFF
Sbjct  271   IMGSTAITISNSHFTHHNDVMLFGASNSYTQDKIMQITVAFNHFGQGLVQRMPRCRHGFF  330

Query  781   HIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRSE  602
             H+VNNDYT W MYAIGGS  PTI+SQGNRF A  N   K+VTKR+   +  WK W+WRSE
Sbjct  331   HVVNNDYTHWLMYAIGGSMNPTIISQGNRFIAPPNQGAKEVTKRDHTPEAEWKKWEWRSE  390

Query  601   GDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             GDL +NGA FV+SG    ++        + +  +P +YV  LT+ +GAL C VG+ C
Sbjct  391   GDLMMNGAIFVQSGSGKSNH----PAKMDLMPFKPGTYVAELTKFAGALDCFVGKPC  443



>ref|XP_006374492.1| hypothetical protein POPTR_0015s07590g [Populus trichocarpa]
 gb|ERP52289.1| hypothetical protein POPTR_0015s07590g [Populus trichocarpa]
Length=435

 Score =   496 bits (1278),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 251/419 (60%), Positives = 308/419 (74%), Gaps = 8/419 (2%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHL--RG  1508
             +A IA +D Y KK+A+EA ++S +AY  NP +VT +FN+EV  ++    N+TRR+L    
Sbjct  23    KAGIANFDEYWKKRAEEAKEASREAYEPNPAKVTKHFNDEVHKSLEG-GNSTRRNLGKNK  81

Query  1507  SHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPK  1328
               C ATN IDRCWRCD++WAK+RK+L  CA GFG  T GG  G++Y VTD SD DM NPK
Sbjct  82    GPCLATNPIDRCWRCDKNWAKNRKKLGGCALGFGRKTIGGKHGKYYRVTDPSDNDMVNPK  141

Query  1327  PGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRN  1148
              GTLR+ VIQ++PLWIIF   MVI L +EL++  +KTIDGRGV+VHI  GA +T+QFV+N
Sbjct  142   AGTLRYGVIQDKPLWIIFAHDMVIRLSEELMVASNKTIDGRGVNVHIYNGAQITLQFVKN  201

Query  1147  VIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLI  968
             VIIHGI IH      GGMIRDSV+H G R+ SDGDGISIFGS  +W+DH+++S C DGLI
Sbjct  202   VIIHGIHIHDAKAGNGGMIRDSVDHYGFRSRSDGDGISIFGSTDIWIDHISLSNCEDGLI  261

Query  967   DAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWG  788
             DAIM S AITISNC F  HN V+L GASD +S D++MQ+TVAFN FG+GL+QRMPR RWG
Sbjct  262   DAIMGSNAITISNCHFTKHNDVMLFGASDSYSGDSVMQITVAFNHFGRGLVQRMPRVRWG  321

Query  787   FFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWR  608
             F H+VNNDYT WEMYAIGGS  PTI+SQGNRF A  +P  K+VTKR+   ++VWK+W WR
Sbjct  322   FVHVVNNDYTHWEMYAIGGSQHPTIISQGNRFVAPPDPACKEVTKRDYAVESVWKSWNWR  381

Query  607   SEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             SEGDL LNGA+FV+SG  +        N    I  +P  YV RLTR SGAL C  GR C
Sbjct  382   SEGDLMLNGAFFVQSGNAI-----KTMNKQAVISAKPGRYVSRLTRFSGALNCVRGRPC  435



>emb|CAN69904.1| hypothetical protein VITISV_001006 [Vitis vinifera]
Length=443

 Score =   496 bits (1277),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 256/417 (61%), Positives = 311/417 (75%), Gaps = 10/417 (2%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR--G  1508
             +A IAEYD Y K +  EA   ++ A+  +PE+V D+FN+ V  +I    N TRR+L+   
Sbjct  25    RAHIAEYDDYWKAREKEAKTVAIDAFDPSPEDVNDDFNKNVEKSIFG-KNGTRRNLKVNK  83

Query  1507  SHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPK  1328
               CKATN IDRCWRC ++WA  R+RLA C  GFG  T GG  GR Y+VTD SD DM NPK
Sbjct  84    GPCKATNPIDRCWRCRRNWAMDRRRLADCVLGFGRRTVGGKHGRLYIVTDPSDNDMLNPK  143

Query  1327  PGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRN  1148
             PGTLR+AVIQ +PLWI+F +SM+I LKQEL++  DKTIDGRGV+VHIAYGAG+TIQF RN
Sbjct  144   PGTLRYAVIQPQPLWIVFGRSMIIKLKQELMVTSDKTIDGRGVNVHIAYGAGITIQFARN  203

Query  1147  VIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLI  968
             VIIHG+ IH I+   GG+IRDSV+H GLRT SDGDGISIFGS+HVW+DH +MS+C DGL+
Sbjct  204   VIIHGLHIHDIVSHPGGLIRDSVHHFGLRTRSDGDGISIFGSSHVWIDHNSMSKCEDGLV  263

Query  967   DAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWG  788
             DAI  STAITISN  F  HN  +LLGASD +S D IMQVTVAFN FG+GLIQRMPRCRWG
Sbjct  264   DAIQGSTAITISNNHFTKHNETMLLGASDGYSGDIIMQVTVAFNHFGRGLIQRMPRCRWG  323

Query  787   FFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASS--NPF--TKQVTKREIVSKNVWKN  620
             FFH+VNNDYT W MYA+GGS+ PTIVSQGNR+ A+   +P    K+VTKR+  +K  W  
Sbjct  324   FFHVVNNDYTHWNMYAVGGSAHPTIVSQGNRYVAAPLMDPKHDAKEVTKRDHATKAEWSK  383

Query  619   WQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKC  449
             W WRSEGDL +NGA+FV+SG     +    F+  + I+ +P  +V RLTR SGAL C
Sbjct  384   WTWRSEGDLMVNGAFFVQSGVP---FKKKPFSRYDMIKAKPGKFVPRLTRYSGALTC  437



>ref|XP_010320663.1| PREDICTED: probable pectate lyase 3 [Solanum lycopersicum]
Length=386

 Score =   493 bits (1269),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 248/359 (69%), Positives = 293/359 (82%), Gaps = 22/359 (6%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH-  1502
             A+IA++D YL+K+A+EALQSSL AY  NPE VT  FN+EVG+T++N    TRRHL+    
Sbjct  28    ANIADFDPYLEKRAEEALQSSLAAYNENPEGVTQIFNKEVGETLLN---GTRRHLKEKDK  84

Query  1501  ------------------CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgr  1376
                               CKA N ID+CWRCD++WA +RK LA CARGFG GTTGG  GR
Sbjct  85    EDKNDKDDKEGDEKSVDGCKAYNPIDKCWRCDKNWANNRKALADCARGFGHGTTGGKDGR  144

Query  1375  FYVVTDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVS  1196
             FYVVTD SD ++E P PGTLRHAVIQEEPLWIIF+KSM+I LKQEL+IN +KTIDGRGVS
Sbjct  145   FYVVTDPSDNNVEEPVPGTLRHAVIQEEPLWIIFEKSMIIRLKQELMINSNKTIDGRGVS  204

Query  1195  VHIAYGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNH  1016
             VH+AYG GLT+QFV NVI+H I++HHIL K GGMIRDSV HIGLRT+SDGD IS+FG+N 
Sbjct  205   VHVAYGGGLTLQFVHNVIVHNIRVHHILSKNGGMIRDSVKHIGLRTVSDGDAISLFGANR  264

Query  1015  VWLDHLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFN  836
             +W+DH T+++ +DGL+DAIMASTAITISNCKFNHHN V+LLGA+D F +D IMQVTVAFN
Sbjct  265   IWIDHCTLTKGADGLLDAIMASTAITISNCKFNHHNDVMLLGANDAFPQDKIMQVTVAFN  324

Query  835   RFGKGLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQV  659
             RFGKG IQRMPRCRWGFFH+VNNDY KWEMYAIGG++ PTI+SQGNRFKA+ NP TK+V
Sbjct  325   RFGKGCIQRMPRCRWGFFHVVNNDYAKWEMYAIGGTANPTIISQGNRFKAADNPNTKEV  383



>ref|XP_010068708.1| PREDICTED: pectate lyase-like [Eucalyptus grandis]
 gb|KCW64557.1| hypothetical protein EUGRSUZ_G02162 [Eucalyptus grandis]
Length=435

 Score =   494 bits (1272),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 250/419 (60%), Positives = 314/419 (75%), Gaps = 8/419 (2%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH  1502
             +A+IA++D   +K+A+EA +++++AY  +P +V ++FN  V +  M  +N TRR L+ + 
Sbjct  23    RANIADFDEVWQKRAEEAKKATIKAYEPDPAKVAEDFNHRVHED-MQRSNNTRRSLKRTK  81

Query  1501  --CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPK  1328
               C ATN IDRCWRC +DWA HRKRLA CA GFG GTTGG  G+ Y VTD SD ++ NPK
Sbjct  82    GGCLATNPIDRCWRCRKDWASHRKRLANCALGFGRGTTGGKAGKIYKVTDPSDDNLMNPK  141

Query  1327  PGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRN  1148
             PGTLRHAVIQ EPLWIIF  +MVI L +ELI+  +KTIDGRG +VHI  GA +T+QFVRN
Sbjct  142   PGTLRHAVIQPEPLWIIFAHNMVIRLSEELIVTDNKTIDGRGANVHICDGAQITLQFVRN  201

Query  1147  VIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLI  968
             VIIHG+ IH   P  GG+IRDS+ H G RT SDGDGIS+FG+ +VW+DH++MS C DGLI
Sbjct  202   VIIHGLHIHDTHPGNGGLIRDSLEHYGFRTGSDGDGISLFGATNVWIDHVSMSHCYDGLI  261

Query  967   DAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWG  788
             D I ASTAITISNC F  HN V+L G SD +S+DA MQ+TVAFN FG+GL+QRMPRCRWG
Sbjct  262   DVIQASTAITISNCHFTRHNEVMLFGGSDTYSDDAHMQITVAFNHFGQGLVQRMPRCRWG  321

Query  787   FFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWR  608
             F H+VNNDYT W MYAIGGS  PTI+SQGNRF A  +P  K+VTKR+  +++VWK+W WR
Sbjct  322   FVHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPLDPNCKEVTKRDYAAEDVWKSWSWR  381

Query  607   SEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             SE DL LNGA+FV+SG  + +      N  N I+ +P S+V RLTR +GAL C  G+ C
Sbjct  382   SEDDLMLNGAFFVQSGSPIRNV-----NKNNVIKAKPGSFVTRLTRFAGALNCVKGKPC  435



>ref|XP_009788285.1| PREDICTED: pectate lyase-like [Nicotiana sylvestris]
Length=434

 Score =   493 bits (1269),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 250/419 (60%), Positives = 303/419 (72%), Gaps = 7/419 (2%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRR--HLRG  1508
             +A+I+E+D   + +A +A +++  +Y  +PE V DN N+ V  T    +N+TRR  H   
Sbjct  21    EANISEFDEVWQTRATQAKKTAQDSYNPHPETVADNLNKHV-HTSEEGSNSTRRDLHKYN  79

Query  1507  SHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPK  1328
               C +TN IDRCWRCD +WAK R +LA C  GFG  TTGG  G+ YVVTD SD DM NPK
Sbjct  80    GPCMSTNPIDRCWRCDPNWAKTRMKLADCVLGFGHHTTGGKGGKIYVVTDPSDDDMVNPK  139

Query  1327  PGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRN  1148
             PGTLRHAVIQ EPLWIIFK  MVI L QELI+  +KTID RG  VHIA+GA   +QF+ N
Sbjct  140   PGTLRHAVIQPEPLWIIFKHHMVIRLNQELIMTSNKTIDARGQQVHIAFGASFMLQFINN  199

Query  1147  VIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLI  968
             VIIHG+ IH I    GG+IRDS+NH G R+ SDGDGISIFGS ++W+DH++MS C DGLI
Sbjct  200   VIIHGLHIHDIKAGNGGLIRDSINHYGFRSRSDGDGISIFGSTNIWIDHVSMSNCDDGLI  259

Query  967   DAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWG  788
             DA+ ASTAITISNC F +HN V+L GASD +SED+I+Q+T+AFN FG+GLIQRMPR RWG
Sbjct  260   DAVQASTAITISNCHFTNHNDVMLFGASDSYSEDSILQITLAFNHFGQGLIQRMPRVRWG  319

Query  787   FFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWR  608
             F H VNNDYT W MYAIGGS  PTI+SQGNRF A  NP  K+VTKRE   ++VWKNW WR
Sbjct  320   FVHAVNNDYTHWLMYAIGGSQHPTILSQGNRFIAPPNPNAKEVTKREYSPESVWKNWVWR  379

Query  607   SEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             S+GDL +NGA+FVESG   H +        + I  RP SY  RLTR SG+L C  G+ C
Sbjct  380   SQGDLMMNGAFFVESGNPNHIF----MKGPDMIHPRPGSYASRLTRFSGSLNCIEGKPC  434



>ref|XP_003554335.1| PREDICTED: pectate lyase-like [Glycine max]
Length=443

 Score =   493 bits (1269),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 251/423 (59%), Positives = 308/423 (73%), Gaps = 13/423 (3%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR---  1511
             +A IAE+D +LK +ADEA + +L+AY   PE+VTD  N  V    ++  N+TRR LR   
Sbjct  28    EAGIAEFDDFLKAQADEAQKIALEAYVPVPEDVTDELNFHVH---LSLENSTRRELRQRK  84

Query  1510  ---GSHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDM  1340
                G  C A+N ID CWRC+++WA  R RLA C +GFG   TGGL G  YVVTD+SD DM
Sbjct  85    GRSGKKCVASNPIDTCWRCNKNWANDRYRLAKCGKGFGRRATGGLGGPIYVVTDNSDDDM  144

Query  1339  ENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQ  1160
              NPKPGT+RHAV Q  PLWIIF++SM+I L QEL+I+ DKTIDGRG +V    GAGLTIQ
Sbjct  145   VNPKPGTIRHAVTQRGPLWIIFQRSMMIKLNQELMISSDKTIDGRGANVVFRDGAGLTIQ  204

Query  1159  FVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCS  980
             FV NVIIHG++I +I+PK GGMIRDS NH+GLRT SDGD ISIFG+++VW+DH+++S C+
Sbjct  205   FVNNVIIHGVRIKNIVPKEGGMIRDSYNHVGLRTKSDGDAISIFGASNVWIDHVSLSNCA  264

Query  979   DGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPR  800
             DGLID I  STAITISNC    HN V+L GASD +S D IMQ+TVAFN FG+GL+QRMPR
Sbjct  265   DGLIDVIQGSTAITISNCHMTKHNDVMLFGASDSYSGDKIMQITVAFNHFGQGLVQRMPR  324

Query  799   CRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKN  620
             CRWGF H++NNDYT W MYAIGGSS PTI+SQGNRF A +N   K +T R+     VWKN
Sbjct  325   CRWGFVHVLNNDYTHWMMYAIGGSSGPTILSQGNRFIAPNNNAAKLITHRDYAEPQVWKN  384

Query  619   WQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVG  440
             WQW+SE DLF+NGA F+ SG  +     T +     ++ R  ++  RLTR SGAL C VG
Sbjct  385   WQWQSEMDLFINGAQFIPSGSPIK----TTYKKGLLMKPRDGTHASRLTRNSGALNCIVG  440

Query  439   RFC  431
             R C
Sbjct  441   RPC  443



>ref|XP_003530685.1| PREDICTED: probable pectate lyase 3-like [Glycine max]
Length=451

 Score =   492 bits (1267),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 251/423 (59%), Positives = 312/423 (74%), Gaps = 10/423 (2%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH  1502
             Q+ + E+D+Y +++A  A   S  AY+ +P  V+ NF   V +  +      RR+L+G +
Sbjct  33    QSHVYEFDSYWQERAKAAKVDSQAAYFEDPYSVSSNFTSSVSELTIG-KKDLRRNLKGKY  91

Query  1501  -----CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDME  1337
                  C ATN IDRCWRCD +WA +R++LA C +GFG  T GG  G FYVVTD SD DM 
Sbjct  92    RGDGPCIATNPIDRCWRCDPNWANNRQKLADCVQGFGRNTVGGKGGPFYVVTDPSDDDMV  151

Query  1336  NPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQF  1157
             NPKPGTLRHAV ++ PLWIIF +SM ITL+QELI+N +KTIDGRGV V+IA GAG+T+QF
Sbjct  152   NPKPGTLRHAVTRDGPLWIIFARSMFITLQQELIMNSNKTIDGRGVDVYIAKGAGITVQF  211

Query  1156  VRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSD  977
             V+N+IIHGIK+  I+ + GGMIRDS  H G RT SDGDGISIFGS++VW+DH++M  CSD
Sbjct  212   VKNIIIHGIKVFDIVIREGGMIRDSETHYGFRTKSDGDGISIFGSSNVWIDHVSMRNCSD  271

Query  976   GLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRC  797
             GLIDAIM STAITISN  F  HN V+L GASD +S+D IMQ+T+AFN FGK L+QRMPR 
Sbjct  272   GLIDAIMGSTAITISNSHFTDHNEVMLFGASDSYSDDKIMQITLAFNHFGKRLVQRMPRV  331

Query  796   RWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNW  617
             R+GF H VNNDYT WEMYAIGGS  PTI+S+GNRF A  N F KQ+TKRE   +NVW NW
Sbjct  332   RYGFVHSVNNDYTHWEMYAIGGSKNPTIISEGNRFIAPDNQFAKQITKREYAPENVWANW  391

Query  616   QWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSG-ALKCKVG  440
             QWRS  D+++NGA+FV+SG EL    +  F+  + I  +  +YVGRLTR SG  LKC+VG
Sbjct  392   QWRSINDVYMNGAFFVQSGPEL---ASRPFSREDMITAKVGNYVGRLTRYSGNLLKCRVG  448

Query  439   RFC  431
             R C
Sbjct  449   RPC  451



>ref|XP_004152537.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase P59-like 
[Cucumis sativus]
Length=434

 Score =   491 bits (1265),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 249/419 (59%), Positives = 312/419 (74%), Gaps = 13/419 (3%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG--  1508
             +A+IA++D   +K+A EA ++S +AY  +PEE T+NFN++V  + ++  N TRRHLR   
Sbjct  27    KANIADFDEVWQKRAIEAQKASFEAYEPHPEEETNNFNKQVHRS-LDGGNNTRRHLRKYT  85

Query  1507  SHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPK  1328
               C ATN IDRCWRCD++WA++RK+LA CA GFG  TTGG  G+ YVV DSSD D+ NPK
Sbjct  86    GPCLATNPIDRCWRCDRNWARNRKKLADCALGFGRRTTGGKDGKIYVVRDSSDNDLVNPK  145

Query  1327  PGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRN  1148
             PGTLRHAVIQE PLWIIF   MVI L +ELI+  DKT+DGRG +VHIA G  +T+QFV+N
Sbjct  146   PGTLRHAVIQERPLWIIFAHDMVIRLSEELIVTDDKTLDGRGANVHIANGGQITLQFVKN  205

Query  1147  VIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLI  968
             +IIH + IH I    GGMIRDSV+H G RT SDGDGIS+FG++ VW+DH++MS C DGLI
Sbjct  206   IIIHNLHIHDIKAGNGGMIRDSVSHYGFRTRSDGDGISMFGASRVWIDHVSMSNCQDGLI  265

Query  967   DAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWG  788
             DA+MASTAITISNC F HHN V+LLGAS+ +S D IMQVT+AFN FGKGL+QRMPRCRWG
Sbjct  266   DAVMASTAITISNCHFTHHNDVILLGASNGYSNDQIMQVTLAFNHFGKGLVQRMPRCRWG  325

Query  787   FFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWR  608
             F H+VNNDYT W MYAIGGS       QGNRF A  NP  K+VTKR    ++ W++W WR
Sbjct  326   FIHVVNNDYTHWLMYAIGGSH-----XQGNRFIAPPNPNCKEVTKRVYAPESEWRSWNWR  380

Query  607   SEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             SEGDL +NGA+F++SG  +  Y     +  + I  +P ++V RLTR +G LKCK  + C
Sbjct  381   SEGDLMMNGAFFIQSGNPIKRY-----SKKDVIHSKPGTFVTRLTRFAGPLKCKKNQPC  434



>ref|XP_008365507.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=396

 Score =   490 bits (1261),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 242/374 (65%), Positives = 296/374 (79%), Gaps = 11/374 (3%)
 Frame = -1

Query  1534  NTTRRHLRGSH----CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYV  1367
             N+TRR+LRG      CKATN IDRCWRC  +WA +RK+LA C +GFG  T GG KG +Y+
Sbjct  28    NSTRRNLRGKQYKGPCKATNPIDRCWRCRANWANNRKKLASCVKGFGRKTRGGKKGAYYI  87

Query  1366  VTDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHI  1187
             VTDSSD ++ +PKPGTLRHAVIQ +PLWIIF +SMVI L QELI+   KTID RG +VHI
Sbjct  88    VTDSSDDNVHDPKPGTLRHAVIQTQPLWIIFARSMVIRLSQELIVTSHKTIDARGANVHI  147

Query  1186  AYGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWL  1007
             A+GAG+T+QFV+NVIIHG++IH  +P  GGMIRDS++HIG+RT SDGDGISI+GS+++WL
Sbjct  148   AHGAGITLQFVQNVIIHGLRIHDTVPGSGGMIRDSLSHIGIRTQSDGDGISIYGSSNIWL  207

Query  1006  DHLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFG  827
             DHL+M  C+DGLIDAI  STAITISNC F HHN V+L GASD F+ DAIMQ+TVAFN FG
Sbjct  208   DHLSMWNCADGLIDAIQGSTAITISNCHFTHHNDVMLFGASDAFAGDAIMQITVAFNHFG  267

Query  826   KGLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKRE  647
             KGLIQRMPRCRWGF H+VNNDYT W MYAIGGSS PTI+SQGNRF A  N   K+VTKR+
Sbjct  268   KGLIQRMPRCRWGFVHVVNNDYTHWIMYAIGGSSHPTIISQGNRFIAPPNQAAKEVTKRD  327

Query  646   IVSKNVWKNWQWRSEGDLFLNGAYFVESG--EELHHYnntrfnntnRIRHRPASYVGRLT  473
                ++VWK+WQWRSEGDL +NGA+FV+SG   + H +        + I+ +P ++V RLT
Sbjct  328   YAPESVWKSWQWRSEGDLMMNGAFFVQSGVPNKKHGF-----GKLDMIKAKPGTFVRRLT  382

Query  472   RTSGALKCKVGRFC  431
             R +G+L CKVG+ C
Sbjct  383   RFAGSLNCKVGKKC  396



>ref|XP_011013803.1| PREDICTED: pectate lyase-like [Populus euphratica]
Length=419

 Score =   490 bits (1261),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 250/420 (60%), Positives = 309/420 (74%), Gaps = 10/420 (2%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHL---R  1511
             +A IA +D Y KK+A+EA ++S +AY  NPE+V  +FN+EV  ++    N+TRR+L   +
Sbjct  7     KAGIANFDEYWKKRAEEAKEASREAYEPNPEKVAKHFNDEVHKSLEG-GNSTRRNLGKYK  65

Query  1510  GSHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENP  1331
             G  C ATN IDRCWRCD++WAK+RK+L  CA GFG  T GG  G++Y VTD SD DM NP
Sbjct  66    GP-CLATNPIDRCWRCDKNWAKNRKKLGGCALGFGRKTIGGKNGKYYRVTDPSDNDMVNP  124

Query  1330  KPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVR  1151
             KPGTLR+ VIQ++PLWIIF   MVI L +EL++  +KTIDGRGV+VHI  GA +T+QFV+
Sbjct  125   KPGTLRYGVIQDKPLWIIFAHDMVIRLSEELMVASNKTIDGRGVNVHIYNGAQITLQFVK  184

Query  1150  NVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGL  971
             NVIIHGI IH      GGMIRDSV+H G R+ SDGDGISIFGS  +W+DH+++S C DGL
Sbjct  185   NVIIHGIHIHDAKAGNGGMIRDSVDHYGFRSRSDGDGISIFGSTDIWIDHISLSNCEDGL  244

Query  970   IDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRW  791
             IDA+M S AITISNC F  HN V+L GASD +S D++MQ+TVAFN FG+GL+QRMPR RW
Sbjct  245   IDAVMGSNAITISNCHFTKHNDVMLFGASDGYSGDSVMQITVAFNHFGRGLVQRMPRVRW  304

Query  790   GFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQW  611
             GF H+VNNDYT WEMYAIGGS  PTI+SQGNRF A  +   K+VTKR+   ++VWK+W W
Sbjct  305   GFAHVVNNDYTHWEMYAIGGSQHPTIISQGNRFIAPPDLACKEVTKRDYAVESVWKSWNW  364

Query  610   RSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             RSEGDL LNGA+FV+SG  +        N    I   P  +V RLTR SGAL C  GR C
Sbjct  365   RSEGDLMLNGAFFVQSGNAI-----KTMNKQGVINAMPGRHVSRLTRFSGALDCVRGRPC  419



>ref|XP_007224275.1| hypothetical protein PRUPE_ppa019055mg [Prunus persica]
 gb|EMJ25474.1| hypothetical protein PRUPE_ppa019055mg [Prunus persica]
Length=443

 Score =   491 bits (1264),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 245/417 (59%), Positives = 309/417 (74%), Gaps = 10/417 (2%)
 Frame = -1

Query  1666  EYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH-----  1502
             + D Y KK+A++A   ++++Y  NP+ VTD FN EVG+ IM   N TRR+L+G       
Sbjct  32    QLDEYWKKRAEQAENYTMESYEPNPQRVTDEFNAEVGELIMG-KNETRRNLKGQKKYVGP  90

Query  1501  CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPG  1322
             CK TN ID CWRCD +WA +R ++  C +GFG  TTGG  G  YVVTD SD D+ NP+PG
Sbjct  91    CKVTNPIDSCWRCDPNWANNRMKIVDCIQGFGRKTTGGKGGPIYVVTDPSDGDLVNPRPG  150

Query  1321  TLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVI  1142
             TLRHAVIQ+ PLWI F ++MVI L+QEL++  DKTIDGRG +V+I  GAG+TIQFV+NVI
Sbjct  151   TLRHAVIQKGPLWITFARNMVIKLQQELMVASDKTIDGRGANVNIFDGAGITIQFVKNVI  210

Query  1141  IHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDA  962
             I  + I  I  K GG+IRDSV+H G RT SDGDGISIFGS+++W+DH++M  C+DGLIDA
Sbjct  211   ITNLHIKQIKAKEGGIIRDSVDHFGQRTKSDGDGISIFGSSNIWIDHVSMENCTDGLIDA  270

Query  961   IMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFF  782
             IM ST ITISNC F  HN VLL GAS+ +++D +MQ+TVAFN FGKGL+QRMPRCR GFF
Sbjct  271   IMGSTGITISNCHFTKHNEVLLFGASNSYTQDKMMQITVAFNHFGKGLVQRMPRCRHGFF  330

Query  781   HIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRSE  602
             H+VNNDYT W MYAIGGS  PTI+SQGNRF A  N  TK+VTKRE  ++  WKNW W+SE
Sbjct  331   HVVNNDYTHWLMYAIGGSMNPTIISQGNRFIAGLNSATKEVTKREYTAEAEWKNWLWKSE  390

Query  601   GDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             GDLF+NGA+FVESG   +     R +  + I  +P +YV ++T+ +GAL C VG+ C
Sbjct  391   GDLFMNGAFFVESGSPAN----LRADKLDMIPFKPGTYVTKMTKFAGALDCFVGKPC  443



>ref|XP_009408830.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=436

 Score =   491 bits (1263),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 255/422 (60%), Positives = 301/422 (71%), Gaps = 14/422 (3%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG---  1508
             A IA+YD Y +KKA  A   +  AY  NPE VT +FNE V   +   +N+TRR LRG   
Sbjct  23    AHIADYDEYWQKKAALARSHANNAYNPNPESVTHHFNEAVMRDLA--SNSTRRGLRGKMR  80

Query  1507  ---SHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDME  1337
                  C+ATN IDRC+RC  +W  HRK+LA CA+GFG   TGG  G FYVVTDSSD D+ 
Sbjct  81    NEDGACQATNPIDRCFRCQSNWVHHRKKLATCAKGFGRHATGGKNGDFYVVTDSSDADLV  140

Query  1336  NPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQF  1157
             NP+ GTLRHAVIQ+ PLWI+F   M+I L +ELIIN +KTIDGRG +V IAYGAGLTIQF
Sbjct  141   NPRNGTLRHAVIQDRPLWIVFAHDMLIRLTEELIINSNKTIDGRGANVQIAYGAGLTIQF  200

Query  1156  VRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSD  977
             V NVI+H I+IH I    GGMIRDS  H GLRT SDGDGISIFG++++W+DH++MS C D
Sbjct  201   VHNVIVHNIRIHDIKAGNGGMIRDSEEHYGLRTRSDGDGISIFGASNIWIDHVSMSNCMD  260

Query  976   GLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRC  797
             GLIDAI  STAITISN  F  HN V+L GASD FS DAIMQ+TVAFN FGKGL+QRMPRC
Sbjct  261   GLIDAIEGSTAITISNSHFTQHNDVMLFGASDAFSGDAIMQITVAFNHFGKGLVQRMPRC  320

Query  796   RWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNW  617
             RWGF H+VNNDYT W MYA+GGS  PTI+SQGNRF A    F K+VTKRE   + VWK W
Sbjct  321   RWGFVHVVNNDYTHWMMYAVGGSQHPTILSQGNRFIAPPTLFAKEVTKREYSPEPVWKQW  380

Query  616   QWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGR  437
              WRSEGDL  NGA+FVESG  +           + I+ +P S+V RLTR +G+  C   +
Sbjct  381   SWRSEGDLMANGAFFVESGAPI------TKPYADLIKAKPGSFVTRLTRFAGSRPCIPNQ  434

Query  436   FC  431
              C
Sbjct  435   PC  436



>gb|AAQ62997.1| oil palm polygalacturonase allergen PEST411 [Elaeis guineensis]
Length=447

 Score =   490 bits (1261),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 256/430 (60%), Positives = 306/430 (71%), Gaps = 22/430 (5%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG---  1508
             ADI E D + +KKA+EAL  S  AY+ +PE VT++FN+ V   +    N+TRR LR    
Sbjct  26    ADIPELDDHWQKKAEEALARSRAAYHPDPEAVTNHFNKAVHLALAEARNSTRRSLRAVGV  85

Query  1507  ----SHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDM  1340
                   C ATN IDRCWRC ++W KHRK+LA C +GFG   TGG  G FYVVTD SD D+
Sbjct  86    KKFKGKCVATNPIDRCWRCQKNWIKHRKKLATCGKGFGRHATGGKAGDFYVVTDPSDDDL  145

Query  1339  ENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQ  1160
              NPK GTLR  VIQ+ PLWI+F + M+I L +EL+IN +KTID RG +VHIAYGA +TIQ
Sbjct  146   VNPKFGTLRWGVIQDRPLWIVFARDMIIRLSEELMINSNKTIDARGANVHIAYGAQITIQ  205

Query  1159  FVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCS  980
             FV NVIIHG+ IH I P  GGMIRDS++H GLRT SDGDGISI+GS+ VW+DH +M  C+
Sbjct  206   FVNNVIIHGLHIHDIKPSNGGMIRDSLHHFGLRTKSDGDGISIYGSSDVWIDHCSMRNCA  265

Query  979   DGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPR  800
             DGLIDAI  STAITISNC F HHN VLL GASD    D+IMQ TVAFN FGKGL+QRMPR
Sbjct  266   DGLIDAIEGSTAITISNCHFTHHNDVLLFGASDSNENDSIMQATVAFNHFGKGLVQRMPR  325

Query  799   CRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPF----TKQVTKREIVSKN  632
             CRWGFFH+VNNDYT W MYAIGGS  PTI+SQGNRF A    F    TK+VTKR+  +++
Sbjct  326   CRWGFFHVVNNDYTHWMMYAIGGSKHPTIISQGNRFIAPPLRFAKEVTKEVTKRDYATED  385

Query  631   VWKNWQWRSEGDLFLNGAYF---VESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSG  461
             VWK W WRSEGDL  NGA+F   V   +++H          + IR +P ++V RLTR +G
Sbjct  386   VWKQWTWRSEGDLMQNGAFFASLVLKHKDVHR--------KDFIRAKPGTWVRRLTRFAG  437

Query  460   ALKCKVGRFC  431
              L CK GR C
Sbjct  438   PLGCKAGRAC  447



>ref|XP_007032453.1| Pectate lyase family protein [Theobroma cacao]
 gb|EOY03379.1| Pectate lyase family protein [Theobroma cacao]
Length=454

 Score =   489 bits (1260),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 256/429 (60%), Positives = 318/429 (74%), Gaps = 20/429 (5%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNW------------T  1535
             ADIAE+D   K++A++A +++L+AY   PE VT N N  V   ++              T
Sbjct  23    ADIAEFDEVWKQRAEQAWKNALEAYEPMPENVTSNLNYNVNKALLKGRANKTRAFEGVTT  82

Query  1534  NTTRRHLRGSH------CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrF  1373
             N+TRR+LRG+H      C ATN IDRCWRC ++WA++RK+LA C  GFG  T GG +G +
Sbjct  83    NSTRRNLRGNHKKYIGPCMATNPIDRCWRCRKNWARNRKQLANCVLGFGHKTEGGKQGGY  142

Query  1372  YVVTDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSV  1193
             Y+VTD+SD ++ NP+PGTLRHAVIQ+EPLWIIF   M I L QELI+   KTIDGRG +V
Sbjct  143   YLVTDNSDDNVLNPRPGTLRHAVIQKEPLWIIFAHDMNIKLSQELIVQSKKTIDGRGANV  202

Query  1192  HIAYGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHV  1013
             HIAYGAG+T+QFV NVIIH + IHHI    GG+IRDSV+H G RT+ DGDGISIFGS ++
Sbjct  203   HIAYGAGITLQFVDNVIIHNLHIHHIRKSSGGLIRDSVDHYGFRTVGDGDGISIFGSTNI  262

Query  1012  WLDHLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNR  833
             WLDHL+MS C DGLIDAI  STAITISNC F HHN V+LLGASD +S D +MQVTVAFN 
Sbjct  263   WLDHLSMSECEDGLIDAIQGSTAITISNCHFTHHNDVILLGASDSYSRDKLMQVTVAFNH  322

Query  832   FGKGLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTK  653
             FGK LIQRMPRCRWGFFH+VNNDYT W+MYAIGGS  PTI+SQGNRF A ++P+ K++T 
Sbjct  323   FGKELIQRMPRCRWGFFHVVNNDYTHWKMYAIGGSQHPTIISQGNRFIAPNDPWAKEITN  382

Query  652   REIVSKNVWKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLT  473
             R    ++VW++W WRSEGDLF+NGA+F  SG     +   ++N    I+ +PA++V RLT
Sbjct  383   RNYAPESVWRHWVWRSEGDLFMNGAFFRTSGPPAPPH--LKYNKLQMIKAKPATFVRRLT  440

Query  472   RTSGALKCK  446
             R SGAL CK
Sbjct  441   RFSGALNCK  449



>ref|XP_009381244.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=423

 Score =   487 bits (1254),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 254/421 (60%), Positives = 300/421 (71%), Gaps = 11/421 (3%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH-  1502
             A IAE+D Y +KK   A  +   AY  NPE VT +FN+ V   +    N TRR LRG   
Sbjct  9     AHIAEFDEYWQKKEAMARANVQNAYNPNPESVTKHFNDAVLKDLEK--NNTRRGLRGKRR  66

Query  1501  ----CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMEN  1334
                 C ATN IDRCWRC ++WA HRKRLA CA+GFG   TGG  G FYVVTD SD D+ N
Sbjct  67    YDGPCMATNPIDRCWRCQENWAHHRKRLATCAKGFGRHVTGGKNGDFYVVTDPSDLDLVN  126

Query  1333  PKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFV  1154
             P+ GTLR+ VIQ+ PLWI+F + MVI L +ELI+N +KTIDGRGV V I  GAG+TIQ+V
Sbjct  127   PRKGTLRYGVIQDRPLWIVFARDMVIRLTEELIVNSNKTIDGRGVDVQIMNGAGITIQYV  186

Query  1153  RNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDG  974
              N+IIH ++IH I    GGMIRDS +H GLRT SDGDGISIFG+++VW+DH++MS C DG
Sbjct  187   DNIIIHNLRIHDIKAGNGGMIRDSEHHYGLRTRSDGDGISIFGASNVWIDHVSMSNCMDG  246

Query  973   LIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCR  794
             LIDAI  STAITISN  F  HN V+L GASD FS DA+MQ+TVAFN FGKGL+QRMPRCR
Sbjct  247   LIDAIQGSTAITISNSHFTQHNDVMLFGASDAFSGDAVMQITVAFNHFGKGLVQRMPRCR  306

Query  793   WGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQ  614
             WGF H+VNNDYT W MYAIGGS  PTI+SQGNRF A    F K+VTKRE   + VWK+WQ
Sbjct  307   WGFVHVVNNDYTHWMMYAIGGSQHPTILSQGNRFIAPPTLFAKEVTKREYSPEEVWKSWQ  366

Query  613   WRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRF  434
             WRSEGDL  NGA+FV SG           +  + I+ +P ++V RLTR SGALKC   R 
Sbjct  367   WRSEGDLLKNGAFFVPSGAG----KLGNVSYKDLIKAKPGTFVTRLTRFSGALKCVPNRP  422

Query  433   C  431
             C
Sbjct  423   C  423



>ref|XP_009389712.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=438

 Score =   488 bits (1255),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 255/423 (60%), Positives = 310/423 (73%), Gaps = 14/423 (3%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG---  1508
             A IA++D Y +KKA+ A   +  +Y  +PE VT +FNE V +     TN TRR LRG   
Sbjct  23    AHIADFDEYWQKKAEVAQSKARNSYNPDPESVTRHFNEAVYEDAQ--TNVTRRGLRGQKR  80

Query  1507  SH--CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMEN  1334
             SH  C ATN IDRCWRC+++W  HRK+LA CA+GFG  T GG  G+FYVVTD+SD D+ N
Sbjct  81    SHGPCLATNPIDRCWRCNENWIHHRKQLATCAKGFGRHTIGGKNGKFYVVTDASDDDLVN  140

Query  1333  PKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFV  1154
             PK GTLR+ VIQ+ PLWI+F   MVI L +ELI+N  KTIDGRG +V I  GAG+TIQ+V
Sbjct  141   PKKGTLRYGVIQDRPLWIVFAHDMVIRLTEELIVNSYKTIDGRGANVQIMGGAGVTIQYV  200

Query  1153  RNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDG  974
              NVI+H + I  I    GGMIRDS +H GLRT SDGDGISI+GS+++W+DH++MS C DG
Sbjct  201   HNVIVHNLHIQDIKAGNGGMIRDSEHHYGLRTRSDGDGISIYGSSNIWIDHVSMSNCMDG  260

Query  973   LIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCR  794
             LIDAI  STAITISN  F  HN  +L GASD +S DAIMQ+TVAFN FGKGL+QRMPRCR
Sbjct  261   LIDAIEGSTAITISNSHFTRHNEAMLFGASDAYSPDAIMQITVAFNHFGKGLVQRMPRCR  320

Query  793   WGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQ  614
             WGF H+VNNDYT WEMYA+GGS  PTI+SQGNR+ A SNPF K+VTKR+  +++VWK W 
Sbjct  321   WGFVHVVNNDYTHWEMYAVGGSQHPTIISQGNRYIAPSNPFAKEVTKRDYATESVWKQWT  380

Query  613   WRSEGDLFLNGAYFVES--GEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVG  440
             WRSEGDL LNGA+FV+S  G  L  Y     + T+ I+ +P S+V RLTR SGAL C   
Sbjct  381   WRSEGDLMLNGAFFVKSGGGGGLQKY-----DKTDIIKAKPGSFVTRLTRYSGALDCFPQ  435

Query  439   RFC  431
             R C
Sbjct  436   RPC  438



>ref|XP_008786760.1| PREDICTED: pectate lyase-like [Phoenix dactylifera]
Length=467

 Score =   489 bits (1258),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 249/424 (59%), Positives = 305/424 (72%), Gaps = 12/424 (3%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHL-----  1514
             A++AE D + +KKA+EA   S  AY+ +PE VT++FN+ V   +    N+TRR L     
Sbjct  48    ANVAELDDHWQKKAEEAFARSRAAYHPDPEGVTNHFNQAVHLALAQARNSTRRGLKAVRA  107

Query  1513  ---RGSHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKD  1343
                R   C A+N IDRCWRC +DW K RK+LA C +GFG    GG  G FYVVTD SD D
Sbjct  108   DKFRQGQCVASNPIDRCWRCQKDWIKDRKKLASCGKGFGRNAVGGRDGDFYVVTDPSDND  167

Query  1342  MENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTI  1163
             + NPK GTLR  VIQ+ PLWIIF + M+I L +ELIIN +KTID RG +VHIA+GA ++I
Sbjct  168   LVNPKYGTLRWGVIQDRPLWIIFARDMIIRLSEELIINSNKTIDARGANVHIAFGAQISI  227

Query  1162  QFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRC  983
             QFV+NVIIHG+ IH I P  GGMIRDS+ H G RT SDGDGISI+GS+ +W+DH +M  C
Sbjct  228   QFVQNVIIHGLHIHDIKPGNGGMIRDSLRHYGFRTKSDGDGISIYGSSDIWIDHCSMRNC  287

Query  982   SDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMP  803
             +DGLIDAI ASTAITISNC F  HN VLL GASD    D+IMQVTVAFN FGKGL+QRMP
Sbjct  288   ADGLIDAIEASTAITISNCHFARHNDVLLFGASDSNERDSIMQVTVAFNHFGKGLVQRMP  347

Query  802   RCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWK  623
             RCRWGFFH+VNNDYT W MYAIGGS  PTI+SQGNRF A    F K++TKR+  +++VWK
Sbjct  348   RCRWGFFHVVNNDYTHWMMYAIGGSQHPTIISQGNRFLAPPMRFAKEITKRDYATEDVWK  407

Query  622   NWQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKV  443
             +W WRSEGDL  NGA+F ESG    +     F+  + I+ +P ++V RLTR +G L C+ 
Sbjct  408   HWTWRSEGDLMQNGAFFRESGAPAKN----NFDKKDFIKAKPGTWVKRLTRYAGPLGCRA  463

Query  442   GRFC  431
             GR C
Sbjct  464   GRAC  467



>ref|XP_008389523.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase 3 [Malus 
domestica]
Length=452

 Score =   486 bits (1252),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 238/419 (57%), Positives = 313/419 (75%), Gaps = 10/419 (2%)
 Frame = -1

Query  1672  IAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH---  1502
             + + DAY K++A EAL+ ++++Y+ NPE+VT+ FN  V + +++  NTTRR+LRG+    
Sbjct  39    VLDLDAYWKERAQEALKEAMESYHKNPEQVTEEFNTGVAE-LLSKENTTRRNLRGNKGYN  97

Query  1501  --CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPK  1328
               C ATN ID CWRCD +WA +RK++  CA+GFG   TGG  G  YVVT  +D D++NPK
Sbjct  98    GPCMATNPIDACWRCDPNWADNRKKIVGCAQGFGKKATGGKDGPIYVVTVGTDDDVQNPK  157

Query  1327  PGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRN  1148
             PGTLRHAVIQ+ PLWIIF +SMVI L+QEL++  DKTIDGRG +V I  G G+T+QFV+N
Sbjct  158   PGTLRHAVIQKGPLWIIFARSMVIRLQQELMVTSDKTIDGRGANVVIEEGGGITLQFVKN  217

Query  1147  VIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLI  968
             VI+  + I  I+ K GGMIRDSV+H+GLRT SDGDGIS+FG+++VW+DH++MSRC+DGLI
Sbjct  218   VILTNLHIKMIVSKTGGMIRDSVDHMGLRTKSDGDGISLFGASNVWIDHMSMSRCADGLI  277

Query  967   DAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWG  788
             DA+MASTAITISN  F  H+ V+L GA++  ++D IMQ+T+AFN FG+GL+QRMPR R G
Sbjct  278   DAVMASTAITISNSHFTDHDDVMLFGANNAHTQDKIMQITLAFNHFGRGLVQRMPRVRHG  337

Query  787   FFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWR  608
             FFH+VNNDY  W MYAIGG+  PTI+SQGNRF A  N  TKQVT RE   ++ WKNW+WR
Sbjct  338   FFHLVNNDYNHWIMYAIGGNMNPTIISQGNRFIAPVNEATKQVTHREHTPESEWKNWEWR  397

Query  607   SEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             SEGDL +NGA+FVESG              + +  +P ++  +LT+ SGAL C VG+ C
Sbjct  398   SEGDLMMNGAFFVESGSRASQ----NPAKLDMMPFQPGTFATKLTKFSGALSCVVGKPC  452



>ref|XP_009598230.1| PREDICTED: pectate lyase-like [Nicotiana tomentosiformis]
Length=434

 Score =   486 bits (1250),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 248/422 (59%), Positives = 302/422 (72%), Gaps = 13/422 (3%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNW---TNTTRR--H  1517
             +A+I+E+D   + +A +A +++  +Y  +PE V DN N+ V      W   +N+TRR  H
Sbjct  21    EANISEFDEVWQTRATQAKKTAQDSYNPHPETVADNLNKHV----HKWEEGSNSTRRDLH  76

Query  1516  LRGSHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDME  1337
                  C +TN IDRCWRCD +W K+R +LA C  GFG  TTGG  G+ YVVTD SD DM 
Sbjct  77    KYDGPCMSTNPIDRCWRCDPNWVKNRMKLADCVLGFGHHTTGGKGGKIYVVTDPSDDDMV  136

Query  1336  NPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQF  1157
             NPKPGTLRHAVIQ EPLWIIFK  MVI L QELI+  +KTID RG  VHIA+GA   +QF
Sbjct  137   NPKPGTLRHAVIQPEPLWIIFKHHMVIRLNQELIMTSNKTIDARGQKVHIAFGASFMLQF  196

Query  1156  VRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSD  977
             + NVIIHG+ IH I    GG+IRDS+NH G R+ SDGDGISIFGS ++W+DH++MS C D
Sbjct  197   INNVIIHGLHIHDIKAGNGGLIRDSINHYGFRSRSDGDGISIFGSTNIWIDHVSMSNCDD  256

Query  976   GLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRC  797
             GLIDA+ ASTAITISN  F +HN V+L GASD +SED+I+Q+T+AFN FG+GLIQRMPR 
Sbjct  257   GLIDAVQASTAITISNSHFTNHNDVMLFGASDSYSEDSILQITLAFNHFGQGLIQRMPRV  316

Query  796   RWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNW  617
             RWGF H VNNDYT W MYAIGGS  PTI+SQGNRF A  NP  K+VTKRE   ++VWKNW
Sbjct  317   RWGFVHAVNNDYTHWLMYAIGGSQHPTILSQGNRFIAPPNPNAKEVTKREYSPESVWKNW  376

Query  616   QWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGR  437
              WRS+GDL +NGA+FVESG   H +        + I  RP SY  RLTR SG+L C  G+
Sbjct  377   VWRSQGDLMMNGAFFVESGNPNHIF----MKGPDMIHPRPGSYASRLTRFSGSLNCIEGK  432

Query  436   FC  431
              C
Sbjct  433   PC  434



>ref|XP_008339935.1| PREDICTED: probable pectate lyase 3 [Malus domestica]
Length=452

 Score =   486 bits (1252),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 244/419 (58%), Positives = 313/419 (75%), Gaps = 10/419 (2%)
 Frame = -1

Query  1672  IAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH---  1502
             + + DAY K++A+EA + ++++Y  NPE+VT+ FN EVG  +M+  NTTRR+LRG+    
Sbjct  39    VLDLDAYWKERAEEAEKVAMESYNKNPEKVTEEFNTEVGK-LMSKENTTRRNLRGNKAYT  97

Query  1501  --CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPK  1328
               C ATN +D CWRCD +WA +RK++  CA+GFG  TTGG  G FYVVT  +D D++NPK
Sbjct  98    GPCMATNPMDACWRCDPNWANNRKKIVGCAQGFGKKTTGGKDGPFYVVTMGTDDDVQNPK  157

Query  1327  PGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRN  1148
             PGTLRHAVIQ+ PLWIIF KSMVI L+QEL++  DKTID RG +V I  GAG+T+QFV+N
Sbjct  158   PGTLRHAVIQKGPLWIIFTKSMVIRLQQELMVTSDKTIDARGANVVIEEGAGITLQFVKN  217

Query  1147  VIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLI  968
             VII  + I  I+ K GG+IRDSV+HIGLRT SDGDGIS+FG+++VW+DH++MSRC+DGLI
Sbjct  218   VIITNLHIKMIVTKPGGLIRDSVDHIGLRTQSDGDGISLFGASNVWIDHVSMSRCADGLI  277

Query  967   DAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWG  788
             DAIM STAITISN  F  H+  +L GA++  ++D IMQ+T+AFN FG+GL+QRMPR R G
Sbjct  278   DAIMGSTAITISNSHFTDHDEAMLFGANNAHTQDKIMQITLAFNHFGQGLVQRMPRVRHG  337

Query  787   FFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWR  608
             FFH+VNNDYT W MYAIGG+  PTI+SQGNRF A  N  TKQVT RE   +  WKNW+WR
Sbjct  338   FFHVVNNDYTHWIMYAIGGNMNPTIISQGNRFIAPINGVTKQVTHRENTPEAEWKNWEWR  397

Query  607   SEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             SEGDL +NGA+FVESG     +        + +  +P + V  LT+ SGAL C VG+ C
Sbjct  398   SEGDLMMNGAFFVESGSGASKH----PAKLDXMPFKPGTXVXTLTKFSGALNCAVGKPC  452



>ref|XP_004514773.1| PREDICTED: probable pectate lyase 3-like [Cicer arietinum]
Length=454

 Score =   486 bits (1252),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 247/424 (58%), Positives = 314/424 (74%), Gaps = 15/424 (4%)
 Frame = -1

Query  1672  IAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH---  1502
             + E+D+Y +++A  A +++  AY+ +P  V+ NF   V + I     + RR LRG++   
Sbjct  36    VPEFDSYWQERAKVAKEANQAAYFVDPYAVSGNFTATVSEIIA--AKSARRSLRGNNNGT  93

Query  1501  CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPG  1322
             C ATN IDRCWRCD +WA +R++LA C +GFG  T GG  G FYVVTD SD ++ +PKPG
Sbjct  94    CMATNPIDRCWRCDPNWANNRQKLADCVQGFGRNTRGGKGGPFYVVTDPSDNELLDPKPG  153

Query  1321  TLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVI  1142
             TLRHAV +  PLWI F +SMVITL+QELI++ DKTIDGRGV V+IA GAG+T+QFV+N+I
Sbjct  154   TLRHAVTRNGPLWITFARSMVITLQQELIMSSDKTIDGRGVEVYIANGAGITVQFVKNII  213

Query  1141  IHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDA  962
             IHGIKI++I  K GGMIRDS +H G RT SDGDGISIFG+++VW+DH++M  C+DGLIDA
Sbjct  214   IHGIKIYNIKVKEGGMIRDSESHYGFRTKSDGDGISIFGASNVWIDHVSMRNCTDGLIDA  273

Query  961   IMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFF  782
             IM STAITISN  F  HN V+L GASD +S+D IMQ+T+AFN FGK L+QRMPR R+GF 
Sbjct  274   IMGSTAITISNGHFTDHNEVMLFGASDDYSDDKIMQITLAFNHFGKRLVQRMPRARFGFV  333

Query  781   HIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFT-------KQVTKREIVSKNVWK  623
             H+VNNDYT WEMYA+GGS  PTI+S+GNRF    N          K+VTKRE   ++VWK
Sbjct  334   HVVNNDYTHWEMYAMGGSQNPTIISEGNRFIGPDNVMVGGNQLNLKEVTKREYTDESVWK  393

Query  622   NWQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKV  443
             NWQWRS  D FLNGAYF++SG EL +     F+  + I  +P SYVGRLTR SG L+C+V
Sbjct  394   NWQWRSINDEFLNGAYFIQSGPELKN---RPFSKKDMITAKPGSYVGRLTRYSGNLQCRV  450

Query  442   GRFC  431
             G+ C
Sbjct  451   GKPC  454



>ref|XP_008446067.1| PREDICTED: pectate lyase-like, partial [Cucumis melo]
Length=381

 Score =   483 bits (1243),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 243/387 (63%), Positives = 296/387 (76%), Gaps = 8/387 (2%)
 Frame = -1

Query  1585  VTDNFNEEVGDTIMNWTNTTRRHLRG--SHCKATNSIDRCWRCDQDWAKHRKRLAFCArg  1412
             VT+NFN++V  + ++  N TRRHLR     C ATN IDRCWRCD++WA++RK+LA CA G
Sbjct  1     VTNNFNKQVHRS-LDGANNTRRHLRKYTGPCLATNPIDRCWRCDRNWARNRKKLADCALG  59

Query  1411  fgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELII  1232
             FG GTTGG  G+ YVV DSSD D+ NPKPGTLRHAVIQE PLWIIF   MVI L +ELI+
Sbjct  60    FGRGTTGGKDGKIYVVRDSSDNDLVNPKPGTLRHAVIQERPLWIIFAHDMVIRLSEELIM  119

Query  1231  NHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMS  1052
               +KT+DGRG +VHIA G  +T+QFVRN+IIH + IH I    GG IRDSV+H G RT S
Sbjct  120   TDNKTLDGRGANVHIANGGQITLQFVRNIIIHNLHIHDIKAGNGGFIRDSVSHYGYRTQS  179

Query  1051  DGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFS  872
             DGDGIS+FGS+ VW+DH++MS C DGLIDA+MASTAITISNC F HHN V+LLGASD +S
Sbjct  180   DGDGISMFGSSRVWIDHVSMSNCQDGLIDAVMASTAITISNCHFTHHNDVILLGASDSYS  239

Query  871   EDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRF  692
              D IMQVT+AFN FGKGL+QRMPRCRWGF H+VNNDYT W MYAIGGS  PTI+SQGNRF
Sbjct  240   NDKIMQVTLAFNHFGKGLVQRMPRCRWGFIHVVNNDYTHWLMYAIGGSHNPTIISQGNRF  299

Query  691   KASSNPFTKQVTKREIVSKNVWKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnR  512
              A  NP +K+VTKR   S+  W++W WRSEGDL +NGA+F++SG  +  Y     +  + 
Sbjct  300   IAPPNPNSKEVTKRVYASEREWRSWNWRSEGDLMMNGAFFIQSGNPIRRY-----SKKDV  354

Query  511   IRHRPASYVGRLTRTSGALKCKVGRFC  431
             I  +P ++V RLTR +G LKCK+ + C
Sbjct  355   IHSKPGTFVTRLTRFAGPLKCKMNQPC  381



>ref|XP_009360393.1| PREDICTED: probable pectate lyase 3 [Pyrus x bretschneideri]
Length=452

 Score =   485 bits (1249),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 237/419 (57%), Positives = 314/419 (75%), Gaps = 10/419 (2%)
 Frame = -1

Query  1672  IAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH---  1502
             + + DAY K++A EAL+ ++++Y+ NPE+  + F+  V + +++  NTTRR+LRG+    
Sbjct  39    VLDLDAYWKERAQEALKEAMESYHKNPEQAAEEFHTGVAE-LLSKENTTRRNLRGNKGYN  97

Query  1501  --CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPK  1328
               C ATN ID CWRCD +WA +RK++  CA+GFG   TGG  G  YVVT  +D D++NPK
Sbjct  98    GPCMATNPIDACWRCDANWANNRKKIVGCAQGFGKKATGGKDGPIYVVTVGTDNDVQNPK  157

Query  1327  PGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRN  1148
             PGTLRHAVIQ+ PLWIIF +SMVI L+QEL++  DKTIDGRG +V I  G G+T+QFV+N
Sbjct  158   PGTLRHAVIQKGPLWIIFARSMVIRLEQELMVTSDKTIDGRGANVVIEEGGGITLQFVKN  217

Query  1147  VIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLI  968
             VII  + I  I+ K GGMIRDSV+H+GLRT SDGDGIS+FG+++VW+DH++MSRC+DGLI
Sbjct  218   VIITNLHIKMIVSKPGGMIRDSVDHMGLRTKSDGDGISLFGASNVWIDHVSMSRCADGLI  277

Query  967   DAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWG  788
             DA+MASTAITISN  F  H+ V+L GA++  ++D IMQ+T+AFN FG+GL+QRMPR R G
Sbjct  278   DAVMASTAITISNSHFTDHDDVMLFGANNAHTQDKIMQITLAFNHFGQGLVQRMPRVRHG  337

Query  787   FFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWR  608
             FFH+VNNDYT W MYAIGG+  PTI+SQGNRF A +N  TKQVT RE   ++ WKNW+WR
Sbjct  338   FFHVVNNDYTHWIMYAIGGNMNPTIISQGNRFIAPANAATKQVTHREHTPESEWKNWEWR  397

Query  607   SEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             SEGDL +NGA+FVESG     +        + +  +P ++  +LT+ SGAL C VG+ C
Sbjct  398   SEGDLMMNGAFFVESGSGASQH----PAKLDMMPFQPGTFATKLTKFSGALNCVVGKPC  452



>ref|XP_008374522.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=441

 Score =   484 bits (1245),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 242/419 (58%), Positives = 307/419 (73%), Gaps = 9/419 (2%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH-  1502
             A+IA +D + + +A EA Q++ +AY  NP EVT +FN+EV +T  +  N TRR+L+  + 
Sbjct  29    ANIAVFDEHWQGRAKEAKQAANKAYNKNPAEVTGSFNKEVHNT-FDSMNNTRRNLKEKYK  87

Query  1501  --CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPK  1328
               C ATN IDRCWRCD +W  +RK+LA CA+GFG  TTGG  G  YVVTD+SD D+ NPK
Sbjct  88    GPCVATNPIDRCWRCDPNWETNRKKLADCAKGFGHKTTGGKAGEIYVVTDNSDNDLVNPK  147

Query  1327  PGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRN  1148
             PGTLRHAVIQ  PLWIIF   M I L +EL++  DKTID RG +VHI  G  +T+QFV+N
Sbjct  148   PGTLRHAVIQTGPLWIIFAHDMKIKLSEELMVTSDKTIDARGANVHIQDGGQITLQFVKN  207

Query  1147  VIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLI  968
             VIIH + IH      GGMIRDSVNH G RT SDGDGIS++G+++VW+DH++ S C DGLI
Sbjct  208   VIIHNLHIHDNKAGNGGMIRDSVNHYGQRTRSDGDGISMYGASNVWIDHVSASNCEDGLI  267

Query  967   DAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWG  788
             DAI  STAITISNC F +HN V+L G+SD  S+D +MQ+T+AFN FG+GL QRMPRCRWG
Sbjct  268   DAIQGSTAITISNCHFTNHNDVMLFGSSDSNSQDEVMQITIAFNHFGQGLTQRMPRCRWG  327

Query  787   FFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWR  608
             FFH+VNNDYT W MYAIGGS  PTI+SQGNRF A  N  +K+VTKRE  ++NVWK+W WR
Sbjct  328   FFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPXNEASKEVTKREYAAENVWKSWNWR  387

Query  607   SEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             SE DL +NGA+F+ESG  + +         + I+ +P ++V +LTR +G LKC  G+ C
Sbjct  388   SENDLMVNGAFFIESGSPIRNL-----PEADMIQAKPGTFVAKLTRFAGPLKCIKGKPC  441



>ref|XP_006842121.1| hypothetical protein AMTR_s00078p00106380 [Amborella trichopoda]
 gb|ERN03796.1| hypothetical protein AMTR_s00078p00106380 [Amborella trichopoda]
Length=438

 Score =   484 bits (1245),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 252/419 (60%), Positives = 308/419 (74%), Gaps = 8/419 (2%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHL--RG  1508
             +A IA++D   + ++  A Q +L+AY H P  VTD+ N  V   +    N+TRRHL    
Sbjct  26    EAHIADFDETWQNRSAIARQVALEAYVHEPHNVTDHVNHMVHKALEG--NSTRRHLGKYT  83

Query  1507  SHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPK  1328
               C ATN IDRCWRC ++WA+ RKRLA CA GFG  TTGGLKGRFYVVTD+SD+ + +PK
Sbjct  84    GACMATNPIDRCWRCQRNWARDRKRLAKCALGFGRKTTGGLKGRFYVVTDASDESLTDPK  143

Query  1327  PGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRN  1148
             PGTLRHAVIQ+ PLWI FK  M+I L +EL++N  KTIDGRG +VHIAYGAG+TIQ+ +N
Sbjct  144   PGTLRHAVIQDRPLWITFKHDMIIRLTEELLVNSHKTIDGRGTNVHIAYGAGITIQYQKN  203

Query  1147  VIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLI  968
             VIIHG+ IH I    GGMIRDS  H GLRT SDGD ISIF S+ VW+DH +MS C DGLI
Sbjct  204   VIIHGLHIHDIKAGNGGMIRDSPEHYGLRTKSDGDAISIFASSFVWIDHNSMSNCMDGLI  263

Query  967   DAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWG  788
             DAIM STAITISN  F +HN V L+GASD FS+D IMQVT AFN FG+GLIQRMPRCRWG
Sbjct  264   DAIMGSTAITISNNHFTNHNEVSLMGASDSFSDDKIMQVTFAFNHFGRGLIQRMPRCRWG  323

Query  787   FFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWR  608
             FFH+VNNDYT W MYA+GGS  PTI+SQGNR+ A +  + K+VTKR+  S++VWK W WR
Sbjct  324   FFHVVNNDYTHWGMYAVGGSQHPTIISQGNRYIAPTANYAKEVTKRDYASEDVWKQWTWR  383

Query  607   SEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             SEGD+  NGA+F ESG      +  ++   ++I  +P ++VGRLTR +GAL CK    C
Sbjct  384   SEGDVMKNGAFFRESGPP----STDKYTRQDKITAKPGTFVGRLTRFAGALVCKRKSPC  438



>ref|XP_009369346.1| PREDICTED: pectate lyase-like [Pyrus x bretschneideri]
Length=441

 Score =   484 bits (1245),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 243/419 (58%), Positives = 307/419 (73%), Gaps = 9/419 (2%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH-  1502
             A+IA +D + + +A EA Q++ +AY  NP EVT +FN+EV +T  +  N TRR+L+  + 
Sbjct  29    ANIAVFDEHWQGRAKEAKQAANKAYNKNPAEVTGSFNKEVHNT-FDSMNNTRRNLKEKYK  87

Query  1501  --CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPK  1328
               C ATN IDRCWRCD +W  +RK+LA CA+GFG  TTGG  G  YVVTD+SD D+ NPK
Sbjct  88    GPCLATNPIDRCWRCDPNWETNRKKLADCAQGFGHKTTGGKAGEIYVVTDNSDNDLVNPK  147

Query  1327  PGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRN  1148
             PGTLRHAVIQ  PLWIIF   M I L +EL++  DKTID RG +VHI  G  +T+QFV+N
Sbjct  148   PGTLRHAVIQTGPLWIIFAHDMKIKLSEELMVTSDKTIDARGANVHIQDGGQITLQFVKN  207

Query  1147  VIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLI  968
             VIIH + IH      GGMIRDSVNH G RT SDGDGIS++G+++VW+DH++ S C DGLI
Sbjct  208   VIIHNLHIHDNKAGNGGMIRDSVNHYGQRTRSDGDGISMYGASNVWIDHVSASNCEDGLI  267

Query  967   DAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWG  788
             DAI  STAITISNC F +HN V+L G+SD  S+D +MQ+T+AFN FG+GL QRMPRCRWG
Sbjct  268   DAIQGSTAITISNCHFTNHNDVMLFGSSDSNSQDEVMQITLAFNHFGQGLTQRMPRCRWG  327

Query  787   FFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWR  608
             FFH+VNNDYT W MYAIGGS  PTI+SQGNRF A  N  +K+VTKRE  ++NVWK+W WR
Sbjct  328   FFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPLNEASKEVTKREYAAENVWKSWNWR  387

Query  607   SEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             SE DL +NGA+FVESG  + +         + I+ +P ++V +LTR +G LKC  G+ C
Sbjct  388   SENDLMMNGAFFVESGSPIRNL-----PEADMIQAKPGTFVAKLTRFAGPLKCIKGKPC  441



>ref|XP_004489168.1| PREDICTED: pectate lyase-like [Cicer arietinum]
Length=444

 Score =   483 bits (1244),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 240/425 (56%), Positives = 309/425 (73%), Gaps = 11/425 (3%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMN-WTNTTRRHLR--  1511
             +A IAE+D YLK++AD A Q +L++Y  NPE +T   N  V   +   ++N+TRR LR  
Sbjct  23    EAGIAEFDDYLKEQADLARQIALKSYVPNPENITTELNLHVNMAMEEAYSNSTRRELRQR  82

Query  1510  -----GSHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDK  1346
                   S C ++N ID CWRC +DWA++R++LA C +GFG    GGL G+FYVVTD SD 
Sbjct  83    QKHGGSSACMSSNPIDNCWRCKKDWAQNRQQLAQCGKGFGRKAVGGLGGKFYVVTDESDN  142

Query  1345  DMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLT  1166
             D+  PK GTLR+  +Q+ PLWIIF +SM+I L QEL+++ DKTIDGRG +VHI  GAG+T
Sbjct  143   DLVTPKFGTLRYGAVQKGPLWIIFARSMIIRLNQELLVSSDKTIDGRGANVHIRDGAGIT  202

Query  1165  IQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSR  986
             +QFV NVIIHG+ I +I  + GGMIRDS NH+GLRT SDGD +S+FGS+++W+DH+++S 
Sbjct  203   MQFVNNVIIHGLHIRNIKARSGGMIRDSYNHVGLRTRSDGDALSVFGSSNIWIDHISLSE  262

Query  985   CSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRM  806
               DGLID I  STAITISNC    HN V+L GASD +S+D IMQ+TVAFN FG+GLIQRM
Sbjct  263   SEDGLIDVIQGSTAITISNCHMTKHNDVMLFGASDSYSDDKIMQITVAFNHFGQGLIQRM  322

Query  805   PRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVW  626
             PRCRWGFFH++NNDYT W MYAIGGSS PTI+SQGNRF A +N   K +T R+  S++VW
Sbjct  323   PRCRWGFFHVLNNDYTHWLMYAIGGSSGPTILSQGNRFIAPNNNAAKTITHRDYASQDVW  382

Query  625   KNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCK  446
               WQWRSE DLF+NGA F+ESG  + +     F     ++ RP +   RLTR +GAL C+
Sbjct  383   SKWQWRSENDLFMNGATFIESGAPIKNL---PFKKGYLMKPRPGTQANRLTRYAGALNCQ  439

Query  445   VGRFC  431
             +GR C
Sbjct  440   IGRPC  444



>ref|XP_011005067.1| PREDICTED: probable pectate lyase P59 [Populus euphratica]
Length=452

 Score =   483 bits (1244),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 261/434 (60%), Positives = 320/434 (74%), Gaps = 22/434 (5%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNW------------T  1535
             ADIA +D   +K+A+EA + +L +Y  NPE+ TD+FN EV +T++++             
Sbjct  23    ADIAFFDEVWQKRAEEAKKVTLNSYVPNPEDATDDFNFEVNNTLVDFDDDGNDAGFELLA  82

Query  1534  NTTRRHLRGSH------CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrF  1373
             N+TRR+L+         CK TN ID+CWRC ++WA++RKRLA CA GFG   TGGLKGR 
Sbjct  83    NSTRRNLKQGKKKYLGPCKVTNPIDKCWRCRRNWARNRKRLAKCALGFGRRATGGLKGRV  142

Query  1372  YVVTDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSV  1193
             YVVT++SD D+ NPKPGTLRHAVIQ+EPLWIIF K+M I L +ELI+   KTIDGRG  +
Sbjct  143   YVVTENSDDDVMNPKPGTLRHAVIQKEPLWIIFSKNMNIRLSKELIMTSHKTIDGRGHHI  202

Query  1192  HIAYGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHV  1013
             HIAYGAG+TIQF++NVIIHGI+IHHI+   GG IRDSV H G+RT SDGDGISIFGS+++
Sbjct  203   HIAYGAGITIQFIQNVIIHGIRIHHIVATSGGNIRDSVGHYGIRTNSDGDGISIFGSSNI  262

Query  1012  WLDHLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNR  833
             W+DH++MSRC+DGLIDAIM STAITISN  F HHN  +LLGASD FS D +MQVTVAFN 
Sbjct  263   WIDHVSMSRCTDGLIDAIMGSTAITISNSHFTHHNDAILLGASDSFSGDELMQVTVAFNH  322

Query  832   FGKGLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTK  653
             FG+GL+QRMPRCRWGFFH+VNNDYT W MYAIGGS  PTIVSQGNRF A      KQVTK
Sbjct  323   FGQGLVQRMPRCRWGFFHVVNNDYTHWRMYAIGGSKHPTIVSQGNRFIAPPELHLKQVTK  382

Query  652   REIVSKNVWKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLT  473
             R+   ++ WK W WRSE DL +NGA+F+ESG+        R +    I  +P S   R+T
Sbjct  383   RDYAPESEWKTWTWRSENDLMMNGAFFIESGKP----RTKRPHKKFMITAKPGSLATRMT  438

Query  472   RTSGALKCKVGRFC  431
               +GAL CK GR C
Sbjct  439   LFAGALDCKSGRKC  452



>ref|XP_011087217.1| PREDICTED: pectate lyase-like [Sesamum indicum]
Length=436

 Score =   482 bits (1241),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 244/419 (58%), Positives = 306/419 (73%), Gaps = 8/419 (2%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHL---RG  1508
              +I  +DA  +++ + A +++ QAY  NP EV D+ NE V  ++   +N  RR L   +G
Sbjct  23    GNIGVHDAVWQERREAAKKAARQAYQPNPGEVLDHLNENVHKSVEG-SNNQRRGLSKYKG  81

Query  1507  SHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPK  1328
             S C ATN ID+CWRC  +WA +RK+L  CA GFG  TTGG  G+ YVVTD SD D+ +PK
Sbjct  82    S-CLATNPIDQCWRCQPNWANNRKKLVDCALGFGRHTTGGKAGKMYVVTDPSDSDLVSPK  140

Query  1327  PGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRN  1148
              GTLRHAVIQ EPLWIIFK +M I L +ELI+  +KTIDGRG  VHIA GAG+T+Q++ N
Sbjct  141   KGTLRHAVIQPEPLWIIFKNNMNIRLSEELIMTSNKTIDGRGAQVHIANGAGITLQYIHN  200

Query  1147  VIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLI  968
             VIIH I++H I    GGMIRDS  H G RT SDGDGIS+FGS ++W+DH+++SRC DGLI
Sbjct  201   VIIHNIRVHDIKTGNGGMIRDSATHYGFRTRSDGDGISLFGSTNIWIDHVSLSRCDDGLI  260

Query  967   DAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWG  788
             DAI ASTAITISNC F HHN VLL GASD  SED IMQ+TVAFN FGKGLIQRMPR RWG
Sbjct  261   DAIEASTAITISNCHFAHHNDVLLFGASDSRSEDHIMQITVAFNHFGKGLIQRMPRVRWG  320

Query  787   FFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWR  608
             F HIVNNDYT+W+MYAIGGS +PTI+SQGNRF A  NPF K+VTKR+  +++VWKNW W+
Sbjct  321   FVHIVNNDYTRWQMYAIGGSQQPTILSQGNRFVAPDNPFAKEVTKRDYATESVWKNWVWK  380

Query  607   SEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             SEGD+  NGA+FV+SG+  HH         + +  +P  +  +L++ +G L C  G+ C
Sbjct  381   SEGDVMNNGAFFVQSGDVAHH---KFAKGPDMVTPKPGGFASKLSQFAGPLNCIPGKPC  436



>ref|XP_007138209.1| hypothetical protein PHAVU_009G189800g [Phaseolus vulgaris]
 gb|ESW10203.1| hypothetical protein PHAVU_009G189800g [Phaseolus vulgaris]
Length=434

 Score =   482 bits (1241),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 244/419 (58%), Positives = 306/419 (73%), Gaps = 9/419 (2%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHL--RG  1508
             QA+I ++D    ++  EA +++ QAY  NP +VT  FN  V    M  +N+TRR L  + 
Sbjct  23    QANIGQFDHVWHRRLKEAREAAKQAYKPNPMKVTAEFNTHVMRA-MKGSNSTRRGLGKKN  81

Query  1507  SHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPK  1328
               C+A N ID+CWRCD DW K+RK+LA CA GFG GTTGG  G+ YVV D+SDKD+ NPK
Sbjct  82    DECEAANPIDKCWRCDPDWEKNRKKLADCAIGFGHGTTGGKDGKIYVVGDNSDKDLVNPK  141

Query  1327  PGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRN  1148
             PGTLRHAVIQ EPLWIIF ++M I L  EL+I  +KTID RG +VHI  GA +TIQFV+N
Sbjct  142   PGTLRHAVIQTEPLWIIFSRNMNIRLTAELLITDNKTIDARGANVHILDGAQMTIQFVKN  201

Query  1147  VIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLI  968
             +IIHG+ IH I P  GG+IRDS++H G+R MSDGDGIS+FGS H+W+DH++M+ CSDGLI
Sbjct  202   IIIHGLHIHDIQPISGGLIRDSMSHYGVRAMSDGDGISVFGSTHIWIDHVSMTNCSDGLI  261

Query  967   DAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWG  788
             D + ASTA+TISNC F  HN VLL GA+D FS D +MQVT+AFN FGKGL+QRMPRCRWG
Sbjct  262   DVVSASTAVTISNCHFVKHNDVLLFGATDSFSRDKVMQVTLAFNHFGKGLVQRMPRCRWG  321

Query  787   FFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWR  608
             FFHIVNNDYT W MYA+GGS +PTI+SQGNRF A  +   K+VTKR+   ++ WKNW WR
Sbjct  322   FFHIVNNDYTHWLMYAVGGSQQPTIISQGNRFVAPKDRNAKEVTKRDYAPESEWKNWNWR  381

Query  607   SEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             SEGDLF NGA+FVESG+++  +  T     +      A  V  LT+ +G +KC   + C
Sbjct  382   SEGDLFENGAFFVESGKKVTKFPKTDAKAVS------AKSVAFLTKDAGPIKCIPNKPC  434



>ref|XP_008221658.1| PREDICTED: pectate lyase-like [Prunus mume]
Length=443

 Score =   482 bits (1241),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 243/417 (58%), Positives = 304/417 (73%), Gaps = 10/417 (2%)
 Frame = -1

Query  1666  EYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH-----  1502
             E D Y KK+AD+A   ++++Y  NPE VTD FN +VG+ IM   N TRR+L+G       
Sbjct  32    ELDEYWKKRADQAENYTMESYEPNPERVTDEFNAQVGELIMG-KNETRRNLKGQKKYVGP  90

Query  1501  CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPG  1322
             C  TN ID CWRCD +WA +R ++  C +GFG  TTGG  G  YVVTD SD D+ NP+PG
Sbjct  91    CTVTNPIDACWRCDPNWANNRMKIVDCIQGFGRKTTGGKGGPIYVVTDPSDGDLVNPRPG  150

Query  1321  TLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVI  1142
             TLRHAVIQ+ PLWI F ++MVI L+QEL++  DKTIDGRG +V+I  GA +TIQFV+NVI
Sbjct  151   TLRHAVIQKGPLWITFARNMVIKLQQELMVASDKTIDGRGANVNIFDGACITIQFVKNVI  210

Query  1141  IHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDA  962
             I  I I  I  K GGMIRDSV+H G RT SDGDGISI+GS+++W+DH++M  C+DGLID 
Sbjct  211   ITNIHIKQIKAKEGGMIRDSVDHFGQRTKSDGDGISIYGSSNIWIDHVSMENCTDGLIDV  270

Query  961   IMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFF  782
             IM ST ITISN  F  HN V+L GAS+ +++D +MQ+TVAFN FGKGL+QRMPRCR GFF
Sbjct  271   IMGSTGITISNSHFTKHNEVMLFGASNSYTQDKMMQITVAFNHFGKGLVQRMPRCRHGFF  330

Query  781   HIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRSE  602
             H+VNNDYT W MYAIGGS  PTI+SQGNRF A  N   K+VTKRE  ++  WKNW W+SE
Sbjct  331   HVVNNDYTHWLMYAIGGSMNPTIISQGNRFIAGLNSAAKEVTKREYTAEAEWKNWLWKSE  390

Query  601   GDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             GDLF+NGA+FVESG   +     R +  + I  +P +YV +LT+ +GAL C VG+ C
Sbjct  391   GDLFMNGAFFVESGSPAN----LRADKLDMIPFKPGTYVTKLTKFAGALDCFVGKPC  443



>ref|XP_003543726.1| PREDICTED: pectate lyase [Glycine max]
Length=443

 Score =   482 bits (1240),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 246/423 (58%), Positives = 303/423 (72%), Gaps = 13/423 (3%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR---  1511
             +A IAE+D +LK +ADEA + +L +Y   P +V    N  V    M   N+TRR LR   
Sbjct  28    EAGIAEFDDFLKAQADEAHKIALDSYVPEPHDVAHELNFHVH---MALENSTRRELRQRK  84

Query  1510  ---GSHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDM  1340
                G  C+A+N ID CWRC++DWA  R RLA C +GFG   TGGL G  YVVTD+SD DM
Sbjct  85    LRGGGKCQASNPIDACWRCNKDWANDRFRLAKCGKGFGRRATGGLGGPIYVVTDNSDDDM  144

Query  1339  ENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQ  1160
              NPKPGT+RHAV Q+ PLWIIF  SM+I+L+QEL+I+ DKTIDGRG +V    GAGLTIQ
Sbjct  145   VNPKPGTIRHAVTQKGPLWIIFGHSMIISLRQELMISSDKTIDGRGANVQFRGGAGLTIQ  204

Query  1159  FVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCS  980
             FV NVIIHG++I  I+PK GGMIRDS +H GLRT SDGD ISIFGS ++W+DH+++S C+
Sbjct  205   FVNNVIIHGVRIKDIVPKDGGMIRDSADHYGLRTRSDGDAISIFGSTNIWIDHVSLSNCA  264

Query  979   DGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPR  800
             DGLID I  STAITISNC    HN V L GASD ++ D IMQ+TVAFN FG+GL+QRMPR
Sbjct  265   DGLIDIIQGSTAITISNCHMTKHNDVFLFGASDSYNGDKIMQITVAFNHFGQGLVQRMPR  324

Query  799   CRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKN  620
             CRWGF H++NNDYT W MYAIGGSS PTI+SQGNRF A +N   K++T R+    +VWKN
Sbjct  325   CRWGFVHVLNNDYTHWLMYAIGGSSGPTILSQGNRFIAPNNDNAKEITHRDYAGPDVWKN  384

Query  619   WQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVG  440
             WQW+SE DLF+NGA FV SG  +       +     ++ R  ++V RLTR +GAL C VG
Sbjct  385   WQWQSEMDLFMNGAKFVTSGSPI----KMTYKKGLIMKPRDGTHVSRLTRHAGALNCFVG  440

Query  439   RFC  431
             + C
Sbjct  441   KPC  443



>gb|KDP45476.1| hypothetical protein JCGZ_09725 [Jatropha curcas]
Length=462

 Score =   482 bits (1241),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 250/443 (56%), Positives = 312/443 (70%), Gaps = 30/443 (7%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEV-----GDTIMNWT-------  1535
             AD+ +YD   +++++EA ++ ++AY  +P  VT   NE+V     G+   N T       
Sbjct  23    ADMKKYDKVWQERSEEARKNMMEAYDPDPIAVTAEVNEQVNHQIDGNAKTNSTINHTKGT  82

Query  1534  ---------NTTRRHLR------GSHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsg  1400
                      N TRR L+         C+A N ID+CWRC ++W K R+RLA CA GFG  
Sbjct  83    NNFETGAEANNTRRSLKQKKQKYNGPCQANNPIDKCWRCRKNWVKDRQRLASCALGFGRR  142

Query  1399  ttgglkgrFYVVTDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDK  1220
             TTGG  G+ YVVTD+SD D   PKPGTLRHAVIQ+EPLWIIF   M I L QELI+ H+K
Sbjct  143   TTGGKGGKIYVVTDNSDHDCVEPKPGTLRHAVIQKEPLWIIFACDMNIKLSQELIMAHNK  202

Query  1219  TIDGRGVSVHIAYGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDG  1040
             TIDGRG +VHI++GAG+TIQFV N+IIHG++IHHI    GGMIRDSV+H+GLRT SDGDG
Sbjct  203   TIDGRGFNVHISHGAGITIQFVSNIIIHGLRIHHICSTCGGMIRDSVDHVGLRTASDGDG  262

Query  1039  ISIFGSNHVWLDHLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAI  860
             ISIFGS +VW+DH++MS C DGLIDAI  STAITISNC F++HN  +LLGASD FS D  
Sbjct  263   ISIFGSTNVWIDHVSMSNCQDGLIDAIQGSTAITISNCHFSNHNDAILLGASDSFSGDQF  322

Query  859   MQVTVAFNRFGKGLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASS  680
             MQ+TVAFN FG+GL+QRMPRCRWGFFH+VNNDYT W +YAIGGS  PTIVSQGN+F A  
Sbjct  323   MQITVAFNHFGQGLVQRMPRCRWGFFHVVNNDYTHWLLYAIGGSMHPTIVSQGNQFVAPD  382

Query  679   NPFTKQVTKREIVSKNVWKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHR  500
             + + K+VTKR+    + WK W WRSEGDL +NGA+FVESGE   H    R +    I+ +
Sbjct  383   DKYIKEVTKRDYAPMSEWKKWNWRSEGDLMVNGAFFVESGEPALHL---RPSKKFMIKAK  439

Query  499   PASYVGRLTRTSGALKCKVGRFC  431
                +  ++TR +GAL CK G+ C
Sbjct  440   HGRFATQMTRFAGALDCKYGKKC  462



>gb|ACU23277.1| unknown [Glycine max]
Length=443

 Score =   481 bits (1237),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 245/423 (58%), Positives = 302/423 (71%), Gaps = 13/423 (3%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR---  1511
             +A IAE+D +LK +ADEA + +L +Y   P +V    N  V    M   N+TRR LR   
Sbjct  28    EAGIAEFDDFLKAQADEAHKIALDSYVPEPHDVAHELNFHVH---MALENSTRRELRQRK  84

Query  1510  ---GSHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDM  1340
                G  C+A+N ID CWRC++DWA  R RLA C +GFG   TGGL G  Y VTD+SD DM
Sbjct  85    LRGGGKCQASNPIDACWRCNKDWANDRFRLAKCGKGFGRRATGGLGGPIYAVTDNSDDDM  144

Query  1339  ENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQ  1160
              NPKPGT+RHAV Q+ PLWIIF  SM+I+L+QEL+I+ DKTIDGRG +V    GAGLTIQ
Sbjct  145   VNPKPGTIRHAVTQKGPLWIIFGHSMIISLRQELMISSDKTIDGRGANVQFRGGAGLTIQ  204

Query  1159  FVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCS  980
             FV NVIIHG++I  I+PK GGMIRDS +H GLRT SDGD ISIFGS ++W+DH+++S C+
Sbjct  205   FVNNVIIHGVRIKDIVPKDGGMIRDSADHYGLRTRSDGDAISIFGSTNIWIDHVSLSNCA  264

Query  979   DGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPR  800
             DGLID I  STAITISNC    HN V L GASD ++ D IMQ+TVAFN FG+GL+QRMPR
Sbjct  265   DGLIDIIQGSTAITISNCHMTKHNDVFLFGASDSYNGDKIMQITVAFNHFGQGLVQRMPR  324

Query  799   CRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKN  620
             CRWGF H++NNDYT W MYAIGGSS PTI+SQGNRF A +N   K++T R+    +VWKN
Sbjct  325   CRWGFVHVLNNDYTHWLMYAIGGSSGPTILSQGNRFIAPNNDNAKEITHRDYAGPDVWKN  384

Query  619   WQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVG  440
             WQW+SE DLF+NGA FV SG  +       +     ++ R  ++V RLTR +GAL C VG
Sbjct  385   WQWQSEMDLFMNGAKFVTSGSPI----KMTYKKGLIMKPRDGTHVSRLTRHAGALNCFVG  440

Query  439   RFC  431
             + C
Sbjct  441   KPC  443



>ref|XP_009380431.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=436

 Score =   480 bits (1236),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 245/420 (58%), Positives = 300/420 (71%), Gaps = 12/420 (3%)
 Frame = -1

Query  1675  DIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR-----  1511
             +I +YD Y  K+  EAL + +QAY   PE V ++FN      I    N+TRR LR     
Sbjct  24    NITDYDEYWVKREAEALSNIMQAYVSEPESVVNHFNTP---DIFQVFNSTRRSLRHGKGK  80

Query  1510  GSHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENP  1331
             G  C ATN IDRCWRC  DWA +RK LA CA+GFG    GGL G  YVVT+ SD ++ +P
Sbjct  81    GRKCVATNPIDRCWRCRSDWASNRKLLAKCAKGFGRHAEGGLSGSIYVVTNPSDDNLLDP  140

Query  1330  KPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVR  1151
             +PGTLR+ V ++ PLWIIF + MVI L+QEL+IN+ KTIDGRG +VHIAYGAGLTIQFV+
Sbjct  141   RPGTLRYGVTRDRPLWIIFARDMVIKLQQELMINNYKTIDGRGANVHIAYGAGLTIQFVK  200

Query  1150  NVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGL  971
             +VI+H + IH I P  GG IRDS  H G+RT SDGDG+SIFG++HVW+DHL+MS C+DGL
Sbjct  201   HVIVHNLHIHDIKPGAGGNIRDSEGHWGIRTRSDGDGVSIFGASHVWVDHLSMSNCADGL  260

Query  970   IDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRW  791
             IDA+ ASTAITISNC    HN V+LLGASD   EDA+MQVTVA+N FGKGL+QRMPRCRW
Sbjct  261   IDAVKASTAITISNCHLTRHNDVILLGASDKSQEDAVMQVTVAYNHFGKGLVQRMPRCRW  320

Query  790   GFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQW  611
             GFFH+VNNDYT W MYA+GGS  PTI+SQGNRF      F K+VT RE   ++ WKNW W
Sbjct  321   GFFHVVNNDYTHWMMYAVGGSQHPTIISQGNRFVGPPIQFAKEVTHREYAPESEWKNWIW  380

Query  610   RSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
              SE D F +GA+F++SG    H    + +  + I+ +P S  GRLTR SGAL+C   R C
Sbjct  381   TSEDDEFKSGAFFIQSG----HKYQGKHSRYDVIKAKPGSIAGRLTRFSGALQCSPNRPC  436



>ref|XP_009615547.1| PREDICTED: probable pectate lyase P59 [Nicotiana tomentosiformis]
Length=434

 Score =   480 bits (1236),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 243/419 (58%), Positives = 303/419 (72%), Gaps = 7/419 (2%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRR--HLRG  1508
             +A I E+D   +K+A +A +++  AY+ NP+ V D+ N +V D  +  +N+ RR  H   
Sbjct  21    EAHIGEFDEVWRKRAQQAKKAARHAYHPNPKIVADHLNNQV-DKAVRGSNSRRRDLHRYN  79

Query  1507  SHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPK  1328
               CKATN ID+CWRCD +WA++R +LA C  GFG  TTGG  G+ YVVTD+SD D+ NPK
Sbjct  80    GQCKATNPIDQCWRCDPNWARNRMKLADCVLGFGRKTTGGKGGKSYVVTDNSDNDLVNPK  139

Query  1327  PGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRN  1148
             PGTLRHAVIQ +PLWIIF K+MVI L +ELI+  +KTID RG  VHIA+G GL +QF+ N
Sbjct  140   PGTLRHAVIQPQPLWIIFAKNMVIRLNEELIMTSNKTIDARGKQVHIAHGGGLMLQFIHN  199

Query  1147  VIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLI  968
             VII  ++IH      GG+IRDSVNH G RT SDGDGISIFGS +VW+DH++MS C DGLI
Sbjct  200   VIISNLRIHDTKAGNGGLIRDSVNHYGYRTKSDGDGISIFGSTNVWIDHVSMSNCQDGLI  259

Query  967   DAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWG  788
             DA+ ASTAITISNC F  HN V+L GASD  S D+IMQ+T+AFN FG+GL QRMPR RWG
Sbjct  260   DAVEASTAITISNCHFTKHNEVMLFGASDSSSRDSIMQITLAFNHFGQGLRQRMPRVRWG  319

Query  787   FFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWR  608
             F H VNNDYT W MYAIGGS  PTI+SQGNRF A  NP  K+VTKR+   ++VWKNW W+
Sbjct  320   FVHAVNNDYTHWLMYAIGGSMHPTILSQGNRFIAPPNPNAKEVTKRDYAPESVWKNWVWK  379

Query  607   SEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             S+GDL +NGA+FVESG   H +      + + I  +P S+V  LTR SG+L C  G+ C
Sbjct  380   SQGDLMMNGAFFVESGNPNHAF----LRSPDMISSKPGSFVSSLTRFSGSLNCIEGKPC  434



>ref|XP_004490003.1| PREDICTED: probable pectate lyase 3-like isoform X1 [Cicer arietinum]
Length=450

 Score =   480 bits (1236),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 244/414 (59%), Positives = 303/414 (73%), Gaps = 8/414 (2%)
 Frame = -1

Query  1660  DAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG----SHCKA  1493
             D+Y K+KA+ A +++ +AY  +P  V+ N    + + I+      RR+LRG      C A
Sbjct  41    DSYWKEKAEIAAKANEEAYTPDPYAVSGNLTSTISEMIIG-GKKGRRNLRGRKTAGPCMA  99

Query  1492  TNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLR  1313
             TN IDRCWRCD +WA +RK+LA C +GFG  TTGG  G FYVVTD SD DM NP+PGTLR
Sbjct  100   TNPIDRCWRCDPNWANNRKKLADCVQGFGRKTTGGKAGPFYVVTDPSDSDMVNPRPGTLR  159

Query  1312  HAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHG  1133
             HAV +  PLWIIF +SM I L QELI+  DKTIDGRG  + IA GAG+TIQ++RNVIIHG
Sbjct  160   HAVTRNGPLWIIFARSMNIRLNQELIMTSDKTIDGRGADIVIANGAGITIQYIRNVIIHG  219

Query  1132  IKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMA  953
             IK+  I+   GG++RDS NH GLRTMSDGDGISIFGS+++W+DH++M  C DGLIDAIM 
Sbjct  220   IKVFDIVVGSGGLVRDSENHYGLRTMSDGDGISIFGSSNIWIDHVSMRNCRDGLIDAIMG  279

Query  952   STAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIV  773
             STAITISN  F  HN V+L GASD +  D  MQ+TVAFN FGK LIQRMPRCR+GF H+V
Sbjct  280   STAITISNSHFTDHNEVMLFGASDGYDADQKMQITVAFNHFGKRLIQRMPRCRFGFIHVV  339

Query  772   NNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRSEGDL  593
             NNDYT WEMYAIGGS  PTI+S+GNRF A  N + K++TKRE   ++ WKNWQWRS  D+
Sbjct  340   NNDYTHWEMYAIGGSKHPTIISEGNRFIAPDNGYAKEITKREYSPESEWKNWQWRSINDV  399

Query  592   FLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             ++NGA+F + G EL +     F+  + I  +P +YVGRLTR SG+LKC VG+ C
Sbjct  400   YMNGAFFRQGGSELTN---RPFSKKDMITAKPGAYVGRLTRYSGSLKCIVGKPC  450



>ref|XP_002323835.1| hypothetical protein POPTR_0017s11450g [Populus trichocarpa]
 gb|EEF03968.1| hypothetical protein POPTR_0017s11450g [Populus trichocarpa]
Length=452

 Score =   480 bits (1236),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 259/434 (60%), Positives = 320/434 (74%), Gaps = 22/434 (5%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNW------------T  1535
             ADIA +D   +K+A+EA + +L +Y  NPE+ TD+FN EV +T++++             
Sbjct  23    ADIAFFDEVWQKRAEEAKKVTLNSYIPNPEDATDDFNFEVNNTLVDFDDDRNDAGFELHA  82

Query  1534  NTTRRHLRGSH------CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrF  1373
             N+TRR+L+         CK TN ID+CWRC ++WA++RKRLA CA GFG   TGGLKGR 
Sbjct  83    NSTRRNLKQGKKKYLGPCKVTNPIDKCWRCRRNWARNRKRLAKCALGFGRRATGGLKGRV  142

Query  1372  YVVTDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSV  1193
             YVVT++SD D+ NPKPGTLRHAVIQ+ PLWIIF K+M I L +ELI+   KTIDGRG  +
Sbjct  143   YVVTENSDDDVMNPKPGTLRHAVIQKGPLWIIFSKNMNIRLSKELIMTSHKTIDGRGHHI  202

Query  1192  HIAYGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHV  1013
             HIAYGAG+TIQF++NVIIHGI+IHHI+   GG IRDSV H G+RT SDGDGISIFGS+++
Sbjct  203   HIAYGAGITIQFIQNVIIHGIRIHHIVATSGGNIRDSVEHYGIRTNSDGDGISIFGSSNI  262

Query  1012  WLDHLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNR  833
             W+DH++MSRC+DGLIDAIM STAITISN  F HHN  +LLGASD FS D +MQVTVAFN 
Sbjct  263   WIDHVSMSRCTDGLIDAIMGSTAITISNSHFTHHNDAILLGASDSFSGDELMQVTVAFNH  322

Query  832   FGKGLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTK  653
             FG+GL+QRMPRCRWGFFH+VNNDYT W MYAIGGS  PTI+SQGNRF A      KQVTK
Sbjct  323   FGQGLVQRMPRCRWGFFHVVNNDYTHWRMYAIGGSKHPTIISQGNRFIAPPELHLKQVTK  382

Query  652   REIVSKNVWKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLT  473
             R+  +++ WK W WRSE DL +NGA+F+ESG+        R +    I  +P S   R+T
Sbjct  383   RDYATESEWKTWTWRSENDLMMNGAFFIESGKP----RTKRPHKKFMITAKPGSLATRMT  438

Query  472   RTSGALKCKVGRFC  431
               +GAL CK GR C
Sbjct  439   LFAGALDCKSGRKC  452



>ref|XP_008339934.1| PREDICTED: probable pectate lyase 3 [Malus domestica]
Length=452

 Score =   480 bits (1235),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 244/419 (58%), Positives = 312/419 (74%), Gaps = 10/419 (2%)
 Frame = -1

Query  1672  IAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH---  1502
             + + DAY K++A+EA + +L++Y  NPE+VT+ FN EVG  ++   NTTRR+LRG+    
Sbjct  39    VLDLDAYWKQRAEEAEKEALESYNKNPEQVTEEFNNEVGKLMLK-ENTTRRNLRGNKAYK  97

Query  1501  --CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPK  1328
               C ATN ID CWRCD  WA +RK++  CA+GFG   TGG  G FYVVT  +D D++NPK
Sbjct  98    GPCMATNPIDACWRCDPYWANNRKKIVGCAQGFGKKATGGKDGPFYVVTMGTDDDVQNPK  157

Query  1327  PGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRN  1148
             PGTLRHAVIQ+ PLWIIF KSMVI L+QEL++  DKTID RG +V I  GAG+T+QFV+N
Sbjct  158   PGTLRHAVIQKGPLWIIFAKSMVIRLQQELMVTSDKTIDARGANVVIEEGAGITLQFVKN  217

Query  1147  VIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLI  968
             VII  + I  I+PK GGMIRDSV+HIGLRT SDGDGIS+FG+++VW+DH++MSRC+DGLI
Sbjct  218   VIITNLHIKMIVPKPGGMIRDSVDHIGLRTQSDGDGISLFGASNVWIDHVSMSRCADGLI  277

Query  967   DAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWG  788
             DA+M ST+ITISN  F  H+  +L GA++  ++D IMQ+T+AFN FG+GL+QRMPR R G
Sbjct  278   DAVMGSTSITISNSHFTDHDEAMLFGANNAHTQDKIMQITLAFNHFGQGLVQRMPRVRHG  337

Query  787   FFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWR  608
             FFH+VNNDYT W MYAIGG+  PTI+SQGNRF A  N  TKQVT RE   +  WKNW+WR
Sbjct  338   FFHVVNNDYTHWIMYAIGGNMNPTIISQGNRFIAPINGVTKQVTHRENTPEAEWKNWEWR  397

Query  607   SEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             SEGDL +NGA+FVESG     +        + +  +P ++V  LT+ SGAL C VG+ C
Sbjct  398   SEGDLMMNGAFFVESGSGASKH----PAKLDMMPFKPGTFVATLTKFSGALNCAVGKPC  452



>gb|KHG08055.1| putative pectate lyase P59 [Gossypium arboreum]
 gb|KHG08558.1| putative pectate lyase P59 [Gossypium arboreum]
Length=440

 Score =   479 bits (1232),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 253/421 (60%), Positives = 311/421 (74%), Gaps = 8/421 (2%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR---  1511
             Q  I EYD   K++  EA +++ QAY  NPEEVT + N  V  ++M   N+TRRHLR   
Sbjct  24    QGHIGEYDENWKQRELEAKENTEQAYNPNPEEVTQHVNHLVSRSLMG-LNSTRRHLRARK  82

Query  1510  -GSHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMEN  1334
              G  C  TN ID+CWRCD++W K+R+RLA CA GF  GT GG  GR YVVTD SD D+ N
Sbjct  83    KGGPCDPTNPIDQCWRCDRNWEKNRQRLADCAIGFARGTIGGKYGRIYVVTDPSDDDLLN  142

Query  1333  PKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFV  1154
             PKPGTLRHAVIQ+EPLWIIF ++M+I LK+ELI++ +KTID RG +VH+AYGAG+TIQ+V
Sbjct  143   PKPGTLRHAVIQKEPLWIIFARAMIIRLKEELIMSGNKTIDARGANVHVAYGAGITIQYV  202

Query  1153  RNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDG  974
             RNVIIHG+ IHHI+P  GGMIRDSVNH G RT SDGDGIS+FG+ +VWLDHL+M +C DG
Sbjct  203   RNVIIHGLHIHHIVPGNGGMIRDSVNHYGFRTKSDGDGISLFGATNVWLDHLSMYKCRDG  262

Query  973   LIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCR  794
             LIDAI  STAITISNC F HH+ V+L GA+D    D  MQ+T+ FN FGKGL+QRMPRCR
Sbjct  263   LIDAIQGSTAITISNCHFTHHDQVMLFGANDNHKMDEKMQITLVFNHFGKGLVQRMPRCR  322

Query  793   WGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQ  614
             WGF H+VNNDYT W MYAIGGSS PT++SQGNR+ A  +  +K+VTKR+     VWK W 
Sbjct  323   WGFIHVVNNDYTHWLMYAIGGSSHPTVISQGNRYIARRHVASKEVTKRDYAPPEVWKTWN  382

Query  613   WRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRF  434
             WRSEGDL LNGA+F +SG+      +++F    ++  +PA  V  LT+ SG L C  GR 
Sbjct  383   WRSEGDLLLNGAFFSQSGDP---KASSKFKGDTKVSAKPAYKVDLLTKDSGTLICIRGRA  439

Query  433   C  431
             C
Sbjct  440   C  440



>ref|XP_002306040.1| hypothetical protein POPTR_0004s12300g [Populus trichocarpa]
 gb|EEE86551.1| hypothetical protein POPTR_0004s12300g [Populus trichocarpa]
Length=432

 Score =   478 bits (1231),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 257/422 (61%), Positives = 310/422 (73%), Gaps = 18/422 (4%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR----  1511
             ADI  +D   +K+A +A + +L+AY  +PEE TD FN EV        N TRR+LR    
Sbjct  23    ADIGIFDDVWQKRAQDAKKMTLEAYVPDPEEATDAFNVEV--------NNTRRNLRQGRK  74

Query  1510  --GSHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDME  1337
                  C+ TN IDRCWRC ++WAK+RK+LA CA GFG  TTGG+ GR YVVTDSSD ++ 
Sbjct  75    KYAGPCQVTNPIDRCWRCQRNWAKNRKQLAKCALGFGRRTTGGMAGRIYVVTDSSDNNVM  134

Query  1336  NPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQF  1157
              PKPGTLRHAVIQ+EPLWIIF K+M I L +ELI++  KTIDGRG  VHI+YG G+TIQF
Sbjct  135   KPKPGTLRHAVIQKEPLWIIFSKNMNIKLSKELIMSSHKTIDGRGHHVHISYGGGITIQF  194

Query  1156  VRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSD  977
             + NVIIHGI+IHHI+   GG IRDSV+H G+RT SDGDGISIFGS  VW+DH++MSRC+D
Sbjct  195   IHNVIIHGIRIHHIIATSGGNIRDSVDHYGIRTNSDGDGISIFGSTDVWIDHVSMSRCTD  254

Query  976   GLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRC  797
             GLIDAIM STAITISNC F HHN  +LLGASD +S D +MQVTVAFN FG+GL+QRMPRC
Sbjct  255   GLIDAIMGSTAITISNCHFTHHNDAILLGASDSYSGDHLMQVTVAFNHFGQGLVQRMPRC  314

Query  796   RWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNW  617
             RWGFFH+VNNDYT W +YAIGGS  PTI+SQGNRF A      KQVTKR+  +K  W  W
Sbjct  315   RWGFFHVVNNDYTHWRLYAIGGSKHPTIISQGNRFIAPPESHLKQVTKRDYATKGEWSKW  374

Query  616   QWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGR  437
              WRSE DL +NGA+FV+SG+        + N    I+ +P +   R+TR +GAL CK GR
Sbjct  375   TWRSENDLMMNGAFFVQSGQP----RTKKPNRKFMIKAKPGAVATRMTRFAGALDCKPGR  430

Query  436   FC  431
              C
Sbjct  431   KC  432



>gb|AES91206.2| pectate lyase P59-like protein [Medicago truncatula]
Length=434

 Score =   478 bits (1231),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 238/419 (57%), Positives = 303/419 (72%), Gaps = 9/419 (2%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG--  1508
             +A+I  +D Y + ++D+A +++ QAY  NP+E+T N N  V   +   +N+TRR L    
Sbjct  23    EANIVHFDQYWQNRSDDAKKAAQQAYKPNPQEITSNLNMHVHKALSG-SNSTRRELAKYK  81

Query  1507  SHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPK  1328
               C ATN ID CWRCD +W K+RK+LA C  GFG GTTGG  G+ YVVTDSSD D+  PK
Sbjct  82    GPCSATNPIDSCWRCDPNWEKNRKKLADCVLGFGHGTTGGKAGKIYVVTDSSDNDLVTPK  141

Query  1327  PGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRN  1148
             PGTLR A IQ+EPLWIIFK +M I LK EL++  DKTID RG +VHI+ GA +T+Q+V+N
Sbjct  142   PGTLRFAAIQKEPLWIIFKHNMNIKLKAELLLTSDKTIDARGANVHISEGAQITLQYVKN  201

Query  1147  VIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLI  968
             +IIHG+ IH      GG IRDS++H G R+ SDGD IS+FG++HVW+DH++M  C+DGL+
Sbjct  202   IIIHGLHIHDTKKTSGGQIRDSMDHYGSRSASDGDAISMFGASHVWIDHISMWNCADGLV  261

Query  967   DAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWG  788
             DA+  STAITISNC    HN V+L GA+D FS D I Q+TVAFN FGKGLIQRMPRCRWG
Sbjct  262   DAVAGSTAITISNCHMTRHNDVMLFGANDGFSGDQISQITVAFNHFGKGLIQRMPRCRWG  321

Query  787   FFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWR  608
             FFHIVNNDYT W MYAIGGS+ PTI+SQGNRF A  NP  K+VTKR+   ++VWK W WR
Sbjct  322   FFHIVNNDYTHWLMYAIGGSTHPTILSQGNRFIAPPNPNAKEVTKRDYAPESVWKAWSWR  381

Query  607   SEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             SE DL +NGA+F +SG +  ++        + I+ +P S+   LTR SG LKC+VG+ C
Sbjct  382   SENDLMMNGAFFKQSGTKAANF------PKSDIKAKPGSFAAALTRFSGCLKCEVGKPC  434



>ref|XP_006354795.1| PREDICTED: pectate lyase-like [Solanum tuberosum]
Length=435

 Score =   477 bits (1228),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 244/419 (58%), Positives = 298/419 (71%), Gaps = 7/419 (2%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRR--HLRG  1508
             +A+I E+D   + +A +A +++ ++Y  +PE+V  N N+ V  +    +N+TRR  H   
Sbjct  22    EANIGEFDEVWRTRATQANKNAKESYNPHPEKVAANLNKHVHRS-EEGSNSTRRDLHKYN  80

Query  1507  SHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPK  1328
               C ATN IDRCWRCD  WAK+R++LA C  GFG  TTGG  G+ Y+VTD  D DM NPK
Sbjct  81    GPCVATNPIDRCWRCDPHWAKNRQKLADCVLGFGHHTTGGKGGKIYIVTDPGDNDMVNPK  140

Query  1327  PGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRN  1148
             PGTLRHAVIQ  PLWIIF   MVI L QELI+  DKTID RG  VHI  GA L +Q++ N
Sbjct  141   PGTLRHAVIQPGPLWIIFAHHMVIKLNQELIMTGDKTIDARGQQVHITGGASLMLQYINN  200

Query  1147  VIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLI  968
             VIIHG+ IH I    GG+IRDS+NH G RT SDGDGISIFGS ++W+DH++MS C DGLI
Sbjct  201   VIIHGLHIHDIKSGNGGLIRDSINHYGFRTRSDGDGISIFGSTNIWIDHVSMSNCDDGLI  260

Query  967   DAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWG  788
             DA+ ASTAITISNC F HHN V+L GASD + +DAI+Q+T+AFN FG+GLIQRMPR RWG
Sbjct  261   DAVQASTAITISNCHFTHHNDVMLFGASDSYKQDAILQITLAFNHFGQGLIQRMPRVRWG  320

Query  787   FFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWR  608
             F H VNNDYT W MYAIGGS  PTI+SQGNRF A  NP  K+VTKR+   ++VWKNW WR
Sbjct  321   FVHAVNNDYTHWIMYAIGGSQHPTILSQGNRFIAPPNPNAKEVTKRDYSPESVWKNWVWR  380

Query  607   SEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             S+GDL +NGA+FVESG   H +        + I  R  S  GRLTR SG+L C  G+ C
Sbjct  381   SQGDLMMNGAFFVESGNRNHKF----MTGPDMIHPRAGSDAGRLTRFSGSLNCIEGKPC  435



>emb|CAN77957.1| hypothetical protein VITISV_021245 [Vitis vinifera]
Length=407

 Score =   476 bits (1225),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 242/416 (58%), Positives = 298/416 (72%), Gaps = 31/416 (7%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSHC  1499
             A+I ++D   + +A+EA +++LQAY  +PE+VTDNFN++V                    
Sbjct  23    ANIGDFDEVWQTRAEEARKAALQAYNPHPEKVTDNFNKKV--------------------  62

Query  1498  KATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGT  1319
                    +CWRC  DWA +R +LA C  GFG  TTGG  G+ YVVTD SD DM NPKPGT
Sbjct  63    ------HKCWRCRSDWASNRMKLADCVLGFGQKTTGGKGGKIYVVTDPSDNDMVNPKPGT  116

Query  1318  LRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVII  1139
             LRHA IQEEPLWIIF  SM I L +ELI+  +KTID RG +VHIA GAGLT+QFV N+II
Sbjct  117   LRHAAIQEEPLWIIFAHSMAIRLNEELIMTSNKTIDARGANVHIANGAGLTLQFVHNIII  176

Query  1138  HGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAI  959
             HG+ IH I    GG+IRDS +H G RT SDGDGISIFG+ ++W+DH++MS C+DGLIDAI
Sbjct  177   HGLHIHDIKVGNGGLIRDSASHYGFRTRSDGDGISIFGATNIWIDHISMSNCADGLIDAI  236

Query  958   MASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFH  779
             MASTAITISNC F HHN V+L GASD +S DAIMQ+T+ FN FG+GL QRMPRCRWGFFH
Sbjct  237   MASTAITISNCHFTHHNEVMLFGASDGYSGDAIMQITITFNHFGQGLTQRMPRCRWGFFH  296

Query  778   IVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRSEG  599
             +VNNDYT W MYAIGGS  PTI+SQGNRF A  +   K+VTKR+   ++VWK+W WRS+G
Sbjct  297   VVNNDYTHWLMYAIGGSHHPTILSQGNRFIAPPDINCKEVTKRDYSPESVWKSWTWRSQG  356

Query  598   DLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             DL +NGA+FVESG+    +     +N   IR +P ++V RLTR SGAL C+ G  C
Sbjct  357   DLMMNGAFFVESGDPNFDF-----SNKYVIRAKPGAFVTRLTRFSGALSCREGMPC  407



>ref|XP_004508770.1| PREDICTED: probable pectate lyase P59-like [Cicer arietinum]
Length=434

 Score =   476 bits (1225),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 244/419 (58%), Positives = 302/419 (72%), Gaps = 9/419 (2%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG--  1508
             +A IA    + + +A EA Q++ +AY  NP ++   FN+ V D     +N TRR L    
Sbjct  23    RASIAHDAQFWQTRAREAKQAAQKAYKPNPHDIALTFNKHV-DKSFKSSNGTRRGLSKYT  81

Query  1507  SHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPK  1328
               C ATN ID+CWRCD +W K+RK+LA CA GFG GTTGG  G+ YVVTDSSD D+ NPK
Sbjct  82    GPCLATNPIDKCWRCDPNWEKNRKKLANCALGFGHGTTGGKNGKIYVVTDSSDHDLINPK  141

Query  1327  PGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRN  1148
             PGTLRHAVIQ EPLWIIFK SM I L  ELI   +KTID RG +VHI+ GA +T+Q+V+N
Sbjct  142   PGTLRHAVIQNEPLWIIFKHSMNIKLSSELIFTDNKTIDARGANVHISNGAQMTLQYVKN  201

Query  1147  VIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLI  968
             +IIHG+ IH I    GG+IRDSVNH G R+ SDGD IS+FGS+HVW+DH+++  C DGLI
Sbjct  202   IIIHGLHIHDIKKGGGGLIRDSVNHYGYRSSSDGDAISLFGSSHVWIDHISLWNCDDGLI  261

Query  967   DAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWG  788
             D +  STAITISNC    HN V+L GASD +S D ++QVTVAFN FGKGLIQRMPRCRWG
Sbjct  262   DVVEGSTAITISNCHMTRHNDVMLFGASDGYSGDKVLQVTVAFNHFGKGLIQRMPRCRWG  321

Query  787   FFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWR  608
             FFHIVNNDYT+W MYAIGGS +PTI+SQGNRF A +NP  K+VTKR+  +++VWK W W 
Sbjct  322   FFHIVNNDYTQWVMYAIGGSQQPTILSQGNRFIAPNNPNAKEVTKRDYAAESVWKTWSWT  381

Query  607   SEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             SE DL  NGA+FV+SG++  ++          I+ +P SY   LTR SGA+KC V + C
Sbjct  382   SENDLMRNGAFFVQSGKKSGNF------PKTDIKAKPGSYAASLTRFSGAIKCVVNKPC  434



>ref|XP_004302354.1| PREDICTED: probable pectate lyase P59-like [Fragaria vesca subsp. 
vesca]
Length=447

 Score =   476 bits (1225),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 254/418 (61%), Positives = 307/418 (73%), Gaps = 7/418 (2%)
 Frame = -1

Query  1672  IAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG---SH  1502
             IA +D  L+++   A  ++L+AY  +PE VTD   ++V +T +  +NTTRRHL     + 
Sbjct  33    IAVFDPVLQEREKRAEIAALKAYQPDPESVTDELIKDV-ETSIERSNTTRRHLAKKIKAE  91

Query  1501  CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPG  1322
             C ATN IDRCWRC+ DWAK+RK+LA C  GFG  T GG +G  YVV DSSD DM NPKPG
Sbjct  92    CTATNPIDRCWRCNPDWAKNRKQLANCVLGFGRRTRGGKRGPIYVVHDSSDNDMANPKPG  151

Query  1321  TLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVI  1142
             TLRHAVIQ  PLWIIFK SM I L +ELI+   KTIDGRG +VHIA+GAG+TIQFV NVI
Sbjct  152   TLRHAVIQTGPLWIIFKHSMTIKLNKELIMTSHKTIDGRGANVHIAHGAGITIQFVENVI  211

Query  1141  IHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDA  962
             IHGI IH I+   GG+IRDS++HIGLR  SDGDGI++FGS+H+WLDHL+M  C DGL D 
Sbjct  212   IHGIHIHDIVSVGGGLIRDSLDHIGLRGQSDGDGITVFGSSHIWLDHLSMWNCYDGLTDV  271

Query  961   IMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFF  782
             +  STAITISNC F  HN V+L GA+DL+  D IMQ+TVAFN FGKGLIQRMPRCR+GFF
Sbjct  272   VQGSTAITISNCHFTRHNDVMLFGANDLYERDQIMQITVAFNHFGKGLIQRMPRCRFGFF  331

Query  781   HIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREI-VSKNVWKNWQWRS  605
             H+VNNDYT W+MYAIGGSS PTI+SQGNR+ A  +P  K++T R     + VWK WQWRS
Sbjct  332   HVVNNDYTHWQMYAIGGSSHPTIISQGNRYVAPPDPKLKEITSRAYSTPEAVWKTWQWRS  391

Query  604   EGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             EGDL  NGAYF ESGE         F+  + I  +P S+V RLTR +G L C+VG+ C
Sbjct  392   EGDLMENGAYFRESGEP--RKGRGHFSRFDVINAKPGSFVRRLTRFAGTLGCRVGKAC  447



>ref|XP_009617495.1| PREDICTED: probable pectate lyase P59 [Nicotiana tomentosiformis]
Length=451

 Score =   476 bits (1225),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 252/427 (59%), Positives = 307/427 (72%), Gaps = 16/427 (4%)
 Frame = -1

Query  1672  IAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNW-------TNTTRRHL  1514
             I ++D   +++A EA + +L+AY  +P  VT  F ++  +++          TN TRR L
Sbjct  28    IGDFDEVWRRRAQEAEEWALKAYEPDPVNVTLAFAKQTKESMKELKEVKKLATNDTRREL  87

Query  1513  RGSH------CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSS  1352
             RG H      C  TN IDRCWRC  +WA +RKRLA CA GFG GTTGG  GRFYVVTDSS
Sbjct  88    RGFHKNYAGPCLVTNPIDRCWRCQGNWADNRKRLADCALGFGKGTTGGKAGRFYVVTDSS  147

Query  1351  DKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAG  1172
             D D  NPKPGTLRHAVIQ+EPLWIIF KSM I L QELI+  DKTIDGRGV+VHIAYGAG
Sbjct  148   D-DSSNPKPGTLRHAVIQKEPLWIIFAKSMNIRLHQELIMQSDKTIDGRGVNVHIAYGAG  206

Query  1171  LTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTM  992
             +T+Q+V+NVIIHG+ IH I+   GGM+  +V+H+G+RT SDGDGISIFGS+++W+DH++M
Sbjct  207   ITLQYVKNVIIHGLHIHDIVVGNGGMVISAVDHVGIRTQSDGDGISIFGSSNIWIDHVSM  266

Query  991   SRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQ  812
              RCSDGLIDA+  STAITISN  F  HN V+L GASD  S D  MQ+TVAFN FGK L+Q
Sbjct  267   WRCSDGLIDAVEGSTAITISNGHFTDHNEVMLFGASDSSSIDQRMQITVAFNHFGKRLVQ  326

Query  811   RMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKN  632
             RMPRCRWGF H+VNNDYT W MYAIGGS  PTI+SQGNRF A    F K++TKR+   ++
Sbjct  327   RMPRCRWGFIHVVNNDYTHWNMYAIGGSQHPTIISQGNRFIAPPEMFKKEITKRDYAPES  386

Query  631   VWKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALK  452
             VWK W WRS+GDLF+NGA+FVESG+    +     N  + I   P   V  +TR +GAL 
Sbjct  387   VWKQWTWRSQGDLFMNGAFFVESGDP--DWTKKHQNLFDGISSAPGEQVTWITRFAGALN  444

Query  451   CKVGRFC  431
             CK G  C
Sbjct  445   CKQGHAC  451



>ref|XP_003552513.1| PREDICTED: pectate lyase-like [Glycine max]
Length=440

 Score =   475 bits (1223),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 241/420 (57%), Positives = 300/420 (71%), Gaps = 6/420 (1%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH  1502
             +A IAE+D +LK +ADEA + +L++Y  +P  VT  FN  V   +M  +N TRR L+  +
Sbjct  24    EAGIAEFDDFLKAQADEAHEIALRSYEPDPINVTAEFNIHVHRALMEESNDTRRELKQKY  83

Query  1501  ---CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENP  1331
                C ATN IDRCWRC +DWA+ R RLA C +GFG    GGL G+ YVVTDSSD +  NP
Sbjct  84    RGPCLATNPIDRCWRCRKDWAQDRYRLASCGKGFGRRAVGGLHGKIYVVTDSSDDEPINP  143

Query  1330  KPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVR  1151
             +PGTLR+ V+Q EPLWIIF +SMVITLK EL+I+ DKTIDGRG +V I  GAGL +QFV 
Sbjct  144   RPGTLRYGVLQREPLWIIFAQSMVITLKFELLISSDKTIDGRGANVVIKGGAGLAMQFVN  203

Query  1150  NVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGL  971
             N+IIHGI+I+ I    G M+RD  NH+G+RT  DGD +SIFGS+++WLDHL++S C DGL
Sbjct  204   NIIIHGIRINKIKSMEGTMLRDLWNHVGIRTRCDGDAVSIFGSSNIWLDHLSLSECEDGL  263

Query  970   IDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRW  791
             ID +  ST ITISNC    HN V+L GASD ++ D IMQVTVAFN FG+GLIQRMPRCRW
Sbjct  264   IDIVQGSTGITISNCHMTKHNDVMLFGASDTYAGDKIMQVTVAFNHFGQGLIQRMPRCRW  323

Query  790   GFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQW  611
             GF H++NNDYT W MYAIGGSS PTI+SQGNRF A +N   K++T R+      W  WQW
Sbjct  324   GFVHVINNDYTHWLMYAIGGSSEPTILSQGNRFIAPNNNAAKEITHRDYAPPEEWSKWQW  383

Query  610   RSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             +SE DLF+NGA F++SG  L       FN    ++ RP +   RLTR +GAL CKVG+ C
Sbjct  384   KSENDLFMNGATFLQSGSPLGKL---PFNKGLMMKPRPGAEANRLTRFAGALNCKVGKPC  440



>ref|XP_009802165.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=451

 Score =   476 bits (1224),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 250/427 (59%), Positives = 307/427 (72%), Gaps = 16/427 (4%)
 Frame = -1

Query  1672  IAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNW-------TNTTRRHL  1514
             I  +D   +++A EA + +L+AY  +P  VT  F ++  +++          TN TRR L
Sbjct  28    IGNFDEVWRRRAQEAEEWALKAYEPDPVNVTLAFAKQTRESMKELKEVNKLSTNETRREL  87

Query  1513  RGSH------CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSS  1352
             RG H      C  TN IDRCWRC  +WA +RKRLA CA GFG GTTGG  G+FYVVTDSS
Sbjct  88    RGFHKIYAGPCLVTNPIDRCWRCQGNWADNRKRLADCAMGFGKGTTGGKAGQFYVVTDSS  147

Query  1351  DKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAG  1172
             D D  NPKPGTLRHAVIQ+EPLWIIF KSM I L QELI+  DKTIDGRGV+VHIAYGAG
Sbjct  148   D-DSSNPKPGTLRHAVIQKEPLWIIFAKSMTIRLHQELIMQSDKTIDGRGVNVHIAYGAG  206

Query  1171  LTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTM  992
             +T+Q+V+NVIIHG+ IH I+   GGM+  +V+H+G+RT SDGDGISIFGS+++W+DH++M
Sbjct  207   ITLQYVKNVIIHGLHIHDIVVGNGGMVISAVDHVGIRTQSDGDGISIFGSSNIWIDHVSM  266

Query  991   SRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQ  812
              RCSDGLIDA+  STAITISN  F  HN V+L GASD  S D  MQ+TVAFN FGK L+Q
Sbjct  267   WRCSDGLIDAVEGSTAITISNGHFTDHNEVMLFGASDSSSIDQRMQITVAFNHFGKRLVQ  326

Query  811   RMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKN  632
             RMPRCRWGF H+VNNDYT W MYAIGGS  PTI+SQGNRF A  + F K++TKR+   ++
Sbjct  327   RMPRCRWGFIHVVNNDYTHWNMYAIGGSQHPTIISQGNRFIAPPDMFKKEITKRDYAPES  386

Query  631   VWKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALK  452
             VWK W WRS+GDLF+NGA+FVESG+    +     N  + I   P   V  +TR +GAL 
Sbjct  387   VWKQWTWRSQGDLFMNGAFFVESGDP--DWTKKHQNLFDGISSAPGEQVTWITRFAGALN  444

Query  451   CKVGRFC  431
             C+ G  C
Sbjct  445   CRPGHAC  451



>gb|KHN13652.1| Pectate lyase [Glycine soja]
Length=440

 Score =   475 bits (1223),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 241/420 (57%), Positives = 300/420 (71%), Gaps = 6/420 (1%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH  1502
             +A IAE+D +LK +ADEA + +L++Y  +P  VT  FN  V   +M  +N TRR L+  +
Sbjct  24    EAGIAEFDDFLKAQADEAHEIALRSYEPDPINVTAEFNIHVHRALMEESNDTRRELKQKY  83

Query  1501  ---CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENP  1331
                C ATN IDRCWRC +DWA+ R RLA C +GFG    GGL G+ YVVTDSSD +  NP
Sbjct  84    RGPCLATNPIDRCWRCRKDWAQDRYRLASCGKGFGRRAVGGLHGKIYVVTDSSDDEPINP  143

Query  1330  KPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVR  1151
             +PGTLR+ V+Q EPLWIIF +SMVITLK EL+I+ DKTIDGRG +V I  GAGL +QFV 
Sbjct  144   RPGTLRYGVLQREPLWIIFAQSMVITLKFELLISSDKTIDGRGANVVIKGGAGLAMQFVN  203

Query  1150  NVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGL  971
             N+IIHGI+I+ I    G M+RD  NH+G+RT  DGD +SIFGS+++WLDHL++S C DGL
Sbjct  204   NIIIHGIRINKIKSMEGTMLRDLWNHVGIRTRCDGDAVSIFGSSNIWLDHLSLSECEDGL  263

Query  970   IDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRW  791
             ID +  ST ITISNC    HN V+L GASD ++ D IMQVTVAFN FG+GLIQRMPRCRW
Sbjct  264   IDIVQGSTGITISNCHMTKHNDVMLFGASDTYAGDKIMQVTVAFNHFGQGLIQRMPRCRW  323

Query  790   GFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQW  611
             GF H++NNDYT W MYAIGGSS PTI+SQGNRF A +N   K++T R+      W  WQW
Sbjct  324   GFVHVINNDYTHWLMYAIGGSSEPTILSQGNRFIAPNNNAAKEITHRDYAPPEEWSKWQW  383

Query  610   RSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             +SE DLF+NGA F++SG  L       FN    ++ RP +   RLTR +GAL CKVG+ C
Sbjct  384   KSENDLFMNGATFLQSGAPLGKL---PFNKGLMMKPRPGAEANRLTRFAGALNCKVGKPC  440



>ref|XP_009403112.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=437

 Score =   475 bits (1222),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 245/421 (58%), Positives = 300/421 (71%), Gaps = 11/421 (3%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH-  1502
             A I ++D Y +KKA+ A   +  +Y  +PE VT +FNE V   +    N TRR LRG H 
Sbjct  23    AHIGDFDEYWQKKAEAARDRAQGSYNPDPESVTQSFNEAVSKDLEG--NVTRRSLRGKHK  80

Query  1501  ----CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMEN  1334
                 C ATN IDRCWRC +DW ++RKRLA CA+GFG  T GG  G  YVVTD+SD D+ +
Sbjct  81    FNGPCVATNPIDRCWRCKKDWMQNRKRLAKCAKGFGRHTIGGKNGDLYVVTDASDNDLIS  140

Query  1333  PKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFV  1154
             PK GTLR+ VIQ+ PLWI+F   M+I L +EL++  DKTID RG +VHI  GAG+ +QFV
Sbjct  141   PKKGTLRYGVIQDRPLWIVFASDMIIRLNEELLVTSDKTIDARGSNVHIMGGAGIMLQFV  200

Query  1153  RNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDG  974
              NVIIHG+ IH I    GGMIRDS +H GLRT SDGDGISI+GS+++W+DH++MS C DG
Sbjct  201   HNVIIHGLHIHDIKAGNGGMIRDSEHHFGLRTRSDGDGISIYGSSNIWIDHVSMSNCMDG  260

Query  973   LIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCR  794
             LID I  STAITISN  F  HN V+L GASD +  DA+MQ+TVAFN FGKGL+QRMPRCR
Sbjct  261   LIDVIQGSTAITISNSHFTKHNDVMLFGASDSYQGDAMMQITVAFNHFGKGLVQRMPRCR  320

Query  793   WGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQ  614
             WGF H+VNNDYT W MYA+GGS  PTI+SQGNR+ A  +   K+VTKR+   + VWK+W 
Sbjct  321   WGFVHVVNNDYTHWLMYAVGGSQHPTILSQGNRYIAPHSLAAKEVTKRDYAPQAVWKDWT  380

Query  613   WRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRF  434
             WRSEGDL  NGA+FVESG      N  +FN  + I+ +P S+V RLTR SGAL C  GR 
Sbjct  381   WRSEGDLMQNGAFFVESGPP----NRMKFNTKDLIKAKPGSFVTRLTRFSGALNCFPGRP  436

Query  433   C  431
             C
Sbjct  437   C  437



>ref|XP_009599825.1| PREDICTED: probable pectate lyase P59 isoform X1 [Nicotiana tomentosiformis]
Length=445

 Score =   475 bits (1222),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 242/423 (57%), Positives = 309/423 (73%), Gaps = 10/423 (2%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWT---NTTRRHL--  1514
             A I ++D   +++A+EA + + Q Y  NPE VT  FN++V D++   T   N+TRR L  
Sbjct  26    AHIGDFDEVWRRRAEEAREYARQIYEPNPENVTLAFNQKVRDSMKEVTVSNNSTRRGLGT  85

Query  1513  --RGSHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDM  1340
                   C  TN IDRCWRCD +WA +RKRLA CA GFGS  TGG  G  Y+VTD+SD D 
Sbjct  86    KKYKGPCMVTNPIDRCWRCDPNWADNRKRLADCAMGFGSKATGGKDGEIYIVTDNSD-DY  144

Query  1339  ENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQ  1160
               PKPGTLR+AVIQ+EPLWIIF++SM I L QELI+  DKTID RG +VHIA GAG+T+Q
Sbjct  145   AEPKPGTLRYAVIQKEPLWIIFERSMTIRLHQELIMQSDKTIDARGANVHIAKGAGITLQ  204

Query  1159  FVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCS  980
             +++NVIIHG+ IH I+   GGM+RD+V+HIG+RT+SDGDGISIFG++++W+DH++M +C 
Sbjct  205   YIKNVIIHGLHIHDIVEGSGGMVRDAVDHIGIRTVSDGDGISIFGASNIWIDHVSMRKCY  264

Query  979   DGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPR  800
             DG+IDA+  STAITISN  F  HN V+L GASD  S D +MQ+T+AFN FGK L+QRMPR
Sbjct  265   DGIIDAVEGSTAITISNGHFTDHNEVMLFGASDSSSIDQVMQITLAFNHFGKRLVQRMPR  324

Query  799   CRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKN  620
             CRWG+ H+VNNDYT W MYAIGGS  PTI++QGNRF A  + F KQVTKRE   + VWK+
Sbjct  325   CRWGYIHVVNNDYTHWNMYAIGGSMHPTIITQGNRFIAPPDIFKKQVTKREYNPEEVWKH  384

Query  619   WQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVG  440
             W WRSEG+LF+NGAYF+ESG+    ++       + I   PA  V  +TR +GAL CK G
Sbjct  385   WTWRSEGNLFMNGAYFIESGDP--DWSKKHKELYDGISAAPAEEVTWITRFAGALGCKKG  442

Query  439   RFC  431
             + C
Sbjct  443   KAC  445



>gb|EYU34111.1| hypothetical protein MIMGU_mgv1a006386mg [Erythranthe guttata]
Length=446

 Score =   475 bits (1222),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 244/427 (57%), Positives = 306/427 (72%), Gaps = 14/427 (3%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFN-------EEVGDTIMNWTNTTRR  1520
             A+ A++D Y  K++ +A  ++LQ+Y  +P ++  + N       +E+ D I   +N++RR
Sbjct  23    ANFADFDDYWLKRSVQAWNNTLQSYESHPAKIVSHLNLHSKRALKEIKD-INLVSNSSRR  81

Query  1519  HLRGSH---CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSD  1349
              L   +   C ATN IDRCWRC  +WA +R RLA C  GFG    GG  GR YVV DSSD
Sbjct  82    QLAHGYEGPCMATNPIDRCWRCQANWADNRFRLADCGLGFGYKAKGGKGGRIYVVNDSSD  141

Query  1348  KDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGL  1169
              DM NPKPGTLRHAVIQ EPLWIIF +SMVI L QELI+  DKTIDGRGV VHI  GAG+
Sbjct  142   GDMVNPKPGTLRHAVIQTEPLWIIFSRSMVIRLSQELIMQSDKTIDGRGVRVHITGGAGI  201

Query  1168  TIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMS  989
             TIQFV+N+IIHGI IH I+P  GG+IRDSV+H GLRT SDGDGISI+G+  +W+DH++M+
Sbjct  202   TIQFVKNIIIHGILIHDIVPGNGGLIRDSVDHYGLRTRSDGDGISIYGAQDIWIDHVSMT  261

Query  988   RCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQR  809
             +CSDGLIDAIM ST ITISN  F  HN  +L GASD  ++D  MQ+TVAFN FGK ++QR
Sbjct  262   KCSDGLIDAIMGSTGITISNGHFTDHNEAMLFGASDSHTQDVKMQITVAFNHFGKRMVQR  321

Query  808   MPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASS-NPFTKQVTKREIVSKN  632
             MPRCR+G+ H+VNNDYT W MYAIGGS  P I+SQGNRF A   NPF K+VTKRE   ++
Sbjct  322   MPRCRFGYIHVVNNDYTHWNMYAIGGSKNPIIISQGNRFIAPPDNPFAKEVTKREYSPES  381

Query  631   VWKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALK  452
             VW  W WRSEGD+FL GA+FV+SG+    Y +      + I+   A+ VG +T+ +GAL 
Sbjct  382   VWSQWIWRSEGDIFLRGAFFVQSGDAT--YTSKHPEKYDLIQAASATQVGIMTKFAGALG  439

Query  451   CKVGRFC  431
             CKVG+ C
Sbjct  440   CKVGQPC  446



>ref|XP_010670318.1| PREDICTED: pectate lyase-like [Beta vulgaris subsp. vulgaris]
Length=450

 Score =   474 bits (1219),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 243/414 (59%), Positives = 294/414 (71%), Gaps = 7/414 (2%)
 Frame = -1

Query  1666  EYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG--SHCKA  1493
             E+D + ++K  EA  +SL AY+H+P EV ++FN  V    +  TN+TRR L      CKA
Sbjct  42    EHDEWFQRKLAEAYNASLLAYHHDPIEVMNHFNYHV-HRALEGTNSTRRGLNKYQGECKA  100

Query  1492  TNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLR  1313
              N IDRCWRC  DWA  RK+LA C +GFG  TTGG KG +Y VTD SD D+ NPKPGTLR
Sbjct  101   QNPIDRCWRCKADWAVDRKKLADCVKGFGRQTTGGKKGAYYTVTDPSDNDVVNPKPGTLR  160

Query  1312  HAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHG  1133
              AV+Q +PLWIIF K M I LK EL+I  DKTIDGRG  V IA GAG+TIQF  NVIIH 
Sbjct  161   FAVLQPQPLWIIFAKDMTIKLKAELMITSDKTIDGRGAQVQIADGAGITIQFANNVIIHN  220

Query  1132  IKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMA  953
             IKIH I+P  GGMIRD+ NH+G+R   DGDGI++F S+++WLDHL+M  C DGLID + A
Sbjct  221   IKIHDIVPSTGGMIRDTNNHVGIRGADDGDGINVFASSNIWLDHLSMWNCKDGLIDIVKA  280

Query  952   STAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIV  773
             STAIT+SN  F  H+HVLL GA D    D IMQ+++AFN FGKGL+QRMPRCR+GFFH++
Sbjct  281   STAITLSNNHFTRHDHVLLFGADDKDPADEIMQISLAFNHFGKGLVQRMPRCRFGFFHVL  340

Query  772   NNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRSEGDL  593
             NNDYT W MYAIGG+S PTI+SQGNRF A  NP  K +T R  V  + WK W WRSE D 
Sbjct  341   NNDYTHWIMYAIGGTSHPTIISQGNRFIAPPNPTAKMITNRNNVVGDDWKKWIWRSENDQ  400

Query  592   FLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             F+NGAYFVESG  L           + I+ +P +YV RLTR SG L+C+VG+ C
Sbjct  401   FVNGAYFVESGHPLDE----TRFKKDFIKAKPGTYVRRLTRFSGQLRCRVGQSC  450



>gb|KHN13240.1| Putative pectate lyase 3 [Glycine soja]
Length=446

 Score =   474 bits (1219),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 246/430 (57%), Positives = 303/430 (70%), Gaps = 20/430 (5%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR---  1511
             +A IAE+D +LK +ADEA + +L +Y   P +V    N  V    M   N+TRR LR   
Sbjct  24    EAGIAEFDDFLKAQADEAHKIALDSYVPEPHDVAHELNFHVH---MALENSTRRELRQRK  80

Query  1510  ---GSHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDM  1340
                G  C+A+N ID CWRC++DWA  R RLA C +GFG   TGGL G  YVVTD+SD DM
Sbjct  81    LRGGGKCQASNPIDACWRCNKDWANDRFRLAKCGKGFGRRATGGLGGPIYVVTDNSDDDM  140

Query  1339  ENPKPGTLRHA-------VIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAY  1181
              NPKPGT+RHA       V Q+ PLWIIF  SM+I+L+QEL+I+ DKTIDGRG +V    
Sbjct  141   VNPKPGTIRHAPGTIRHAVTQKGPLWIIFGHSMIISLRQELMISSDKTIDGRGANVVFRD  200

Query  1180  GAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDH  1001
             GAGLTIQFV NVIIHG++I  I+PK GGMIRDS +H GLRT SDGD ISIFGS ++W+DH
Sbjct  201   GAGLTIQFVNNVIIHGVRIKDIVPKDGGMIRDSADHYGLRTRSDGDAISIFGSTNIWIDH  260

Query  1000  LTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKG  821
             +++S C+DGLID I  STAITISNC    HN V L GASD ++ D IMQ+TVAFN FG+G
Sbjct  261   VSLSNCADGLIDIIQGSTAITISNCHMTKHNDVFLFGASDSYNGDKIMQITVAFNHFGQG  320

Query  820   LIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIV  641
             L+QRMPRCRWGF H++NNDYT W MYAIGGSS PTI+SQGNRF A +N   K++T R+  
Sbjct  321   LVQRMPRCRWGFVHVLNNDYTHWLMYAIGGSSGPTILSQGNRFIAPNNDNAKEITHRDYA  380

Query  640   SKNVWKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSG  461
               +VWKNWQW+SE DLF+NGA FV SG  +       +     ++ R  ++V RLTR +G
Sbjct  381   GPDVWKNWQWQSEMDLFMNGAKFVTSGSPI----KMTYKKGLIMKPRDGTHVSRLTRHAG  436

Query  460   ALKCKVGRFC  431
             AL C VG+ C
Sbjct  437   ALNCFVGKPC  446



>gb|EPS66620.1| hypothetical protein M569_08154, partial [Genlisea aurea]
Length=451

 Score =   474 bits (1219),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 248/432 (57%), Positives = 298/432 (69%), Gaps = 18/432 (4%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTI--MNWT-------NTT  1526
             A IAEYD + KK+  EA   +L +Y  NP ++  + N      +  +N T       N T
Sbjct  22    ARIAEYDDFWKKRRAEAWNRTLLSYEPNPAKIVTHLNLHSHRLLHELNATDHFHLVGNHT  81

Query  1525  RRHLRGSH----CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTD  1358
             RR LRG      C  TN IDRCWRC  DWA +R RLA C  GFG    GG  G  YVVTD
Sbjct  82    RRSLRGRRYNGPCTVTNPIDRCWRCRSDWATNRFRLADCGLGFGYKAKGGKNGPIYVVTD  141

Query  1357  SSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYG  1178
             SSD DM NPKPGTLRHAVIQ  PLWI+F +SMVI L QEL++  DKTIDGRG  VH+AYG
Sbjct  142   SSDNDMVNPKPGTLRHAVIQPGPLWIVFARSMVIRLSQELLVTSDKTIDGRGARVHVAYG  201

Query  1177  AGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHL  998
             AG+T+QFV NVIIHG+ IH I+   GGMIRDSV+H G RT SDGDGISIFGS  +W+DH+
Sbjct  202   AGITLQFVSNVIIHGLHIHDIVQGSGGMIRDSVDHYGFRTRSDGDGISIFGSQDLWIDHV  261

Query  997   TMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGL  818
             +M RC DGLIDAIM ST ITISN  F  HN V+L GASD +S DA MQ+TVAFN FGK L
Sbjct  262   SMRRCYDGLIDAIMGSTGITISNSHFTDHNEVMLFGASDGYSPDAKMQMTVAFNHFGKRL  321

Query  817   IQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASS---NPFTKQVTKRE  647
             IQRMPRCRWG+ H+VNNDYT W MYAIGGSS PTI+SQGNR+ A     N + K+VTKR+
Sbjct  322   IQRMPRCRWGYIHVVNNDYTHWNMYAIGGSSAPTIISQGNRYIAPPDDVNMYAKEVTKRD  381

Query  646   IVSKNVWKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRT  467
                ++VW++W WRS+GD+F+ GAYF +SG+   +Y +      + ++    S V  +TR 
Sbjct  382   YAPESVWQSWTWRSDGDVFMRGAYFTQSGDP--NYMSKHPERYDLMQAADGSNVAAITRF  439

Query  466   SGALKCKVGRFC  431
             +GAL CKVG  C
Sbjct  440   AGALLCKVGAPC  451



>ref|XP_009599826.1| PREDICTED: probable pectate lyase P59 isoform X2 [Nicotiana tomentosiformis]
Length=444

 Score =   473 bits (1217),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 243/424 (57%), Positives = 309/424 (73%), Gaps = 13/424 (3%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGD----TIMNWTNTTRRHL-  1514
             A I ++D   +++A+EA + + Q Y  NPE VT  FN++V D    T+ N  N+TRR L 
Sbjct  26    AHIGDFDEVWRRRAEEAREYARQIYEPNPENVTLAFNQKVRDMKEVTVSN--NSTRRGLG  83

Query  1513  ---RGSHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKD  1343
                    C  TN IDRCWRCD +WA +RKRLA CA GFGS  TGG  G  Y+VTD+SD D
Sbjct  84    TKKYKGPCMVTNPIDRCWRCDPNWADNRKRLADCAMGFGSKATGGKDGEIYIVTDNSD-D  142

Query  1342  MENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTI  1163
                PKPGTLR+AVIQ+EPLWIIF++SM I L QELI+  DKTID RG +VHIA GAG+T+
Sbjct  143   YAEPKPGTLRYAVIQKEPLWIIFERSMTIRLHQELIMQSDKTIDARGANVHIAKGAGITL  202

Query  1162  QFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRC  983
             Q+++NVIIHG+ IH I+   GGM+RD+V+HIG+RT+SDGDGISIFG++++W+DH++M +C
Sbjct  203   QYIKNVIIHGLHIHDIVEGSGGMVRDAVDHIGIRTVSDGDGISIFGASNIWIDHVSMRKC  262

Query  982   SDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMP  803
              DG+IDA+  STAITISN  F  HN V+L GASD  S D +MQ+T+AFN FGK L+QRMP
Sbjct  263   YDGIIDAVEGSTAITISNGHFTDHNEVMLFGASDSSSIDQVMQITLAFNHFGKRLVQRMP  322

Query  802   RCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWK  623
             RCRWG+ H+VNNDYT W MYAIGGS  PTI++QGNRF A  + F KQVTKRE   + VWK
Sbjct  323   RCRWGYIHVVNNDYTHWNMYAIGGSMHPTIITQGNRFIAPPDIFKKQVTKREYNPEEVWK  382

Query  622   NWQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKV  443
             +W WRSEG+LF+NGAYF+ESG+    ++       + I   PA  V  +TR +GAL CK 
Sbjct  383   HWTWRSEGNLFMNGAYFIESGDP--DWSKKHKELYDGISAAPAEEVTWITRFAGALGCKK  440

Query  442   GRFC  431
             G+ C
Sbjct  441   GKAC  444



>gb|KHN08855.1| Putative pectate lyase P59 [Glycine soja]
Length=435

 Score =   473 bits (1216),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 241/420 (57%), Positives = 301/420 (72%), Gaps = 10/420 (2%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH  1502
              A+I  +D    ++  EA +++ QAY  NP +VT  FN  V    M  +N +RR L   +
Sbjct  23    NANIGHFDHVWHRRLKEAREAAKQAYKPNPMKVTAEFNTHV-IRAMRGSNNSRRGLSNQY  81

Query  1501  ---CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENP  1331
                CKATN ID+CWRCD +W K+RKRLA CA GFG GTTGG  G+ YVV DSSD D+ NP
Sbjct  82    DGPCKATNPIDKCWRCDPNWEKNRKRLADCALGFGHGTTGGKDGKIYVVNDSSDNDLVNP  141

Query  1330  KPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVR  1151
             KPGTLRHA IQ EPLWIIF ++M I L  EL++  +KTID RG +VHI+ GA +T+Q+V+
Sbjct  142   KPGTLRHAAIQREPLWIIFDRNMNIKLHAELMLTDNKTIDARGANVHISEGAQITLQYVK  201

Query  1150  NVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGL  971
             N+IIHG+ IH I    GG+IRDS++H G+R MSDGD IS+FGS +VW+DH++ + C DGL
Sbjct  202   NIIIHGLHIHDIKKCSGGLIRDSMDHYGVRAMSDGDAISVFGSTYVWIDHVSFTNCDDGL  261

Query  970   IDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRW  791
             ID + ASTA+TISNC    HN VLL GASD +S D IMQVT+AFN FGKGLIQRMPRCRW
Sbjct  262   IDVVSASTAVTISNCHLTKHNDVLLFGASDSYSGDKIMQVTLAFNHFGKGLIQRMPRCRW  321

Query  790   GFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQW  611
             GFFHIVNNDYT W MYAIGGS +PTI+SQGNRF A ++   K+VTKR+   ++VWKNW W
Sbjct  322   GFFHIVNNDYTHWLMYAIGGSQQPTIISQGNRFIAPNDRNAKEVTKRDYAPESVWKNWNW  381

Query  610   RSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             RSEGDL +NGA+FV+SG+ +        N    I  +P   V  LTR +G LKC+V + C
Sbjct  382   RSEGDLLMNGAFFVQSGKNV------AKNPKAEIIAKPGKAVSSLTRFAGPLKCEVNKSC  435



>ref|XP_006477525.1| PREDICTED: pectate lyase-like [Citrus sinensis]
Length=437

 Score =   472 bits (1214),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 241/421 (57%), Positives = 309/421 (73%), Gaps = 10/421 (2%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG--  1508
             +A+I ++D   +K+A+ A + +L+AY+ NPEEV  +FN+ V     N  N+TRR+LRG  
Sbjct  23    KANIHDFDEVWQKRAENARRHALEAYHPNPEEVVSSFNKHVHMMFEN-GNSTRRYLRGRP  81

Query  1507  --SHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMEN  1334
                 C ATN ID+CWRCD++WA +RKRLA CA+GFG GT GG  G FYVVT+ +D D+ N
Sbjct  82    YTGRCAATNPIDQCWRCDRNWANNRKRLADCAQGFGRGTIGGKNGPFYVVTNPADDDLVN  141

Query  1333  PKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFV  1154
             PKPGTLRHAVIQE PLWI F   MVI L +EL+I  DKTID RG +V I  GA +T+QFV
Sbjct  142   PKPGTLRHAVIQERPLWITFAHDMVIRLSEELLITSDKTIDARGSNVQIYNGAQITMQFV  201

Query  1153  RNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDG  974
             +N+IIHG+ I       GGMIRDSV+H G R+ SDGDGIS+FG++H+W+DH++MS C DG
Sbjct  202   KNIIIHGLHIRKTKAGKGGMIRDSVSHYGFRSSSDGDGISMFGASHIWIDHVSMSGCQDG  261

Query  973   LIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCR  794
             LIDA+M STAIT+SN  F H +HV+LLGASD   +D+IMQVTVAFN FGK L+QRMPR R
Sbjct  262   LIDAVMGSTAITVSNSHFTHQDHVMLLGASDGHPQDSIMQVTVAFNHFGKQLVQRMPRVR  321

Query  793   WGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQ  614
             +GF H+VNNDYT W MYAIGGS  PTI+SQGNRF AS++  +K+VTKR+   ++VWK W 
Sbjct  322   FGFAHVVNNDYTHWLMYAIGGSQHPTILSQGNRFLASNSHHSKEVTKRDSSPQSVWKTWN  381

Query  613   WRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRF  434
             WRSE DL +NGA+FVESG ++ +      N  + I  +P  +  ++TR SGAL C V + 
Sbjct  382   WRSEMDLMMNGAFFVESGSDVRNV-----NRQDVIPAKPGKFASQMTRFSGALNCYVNKP  436

Query  433   C  431
             C
Sbjct  437   C  437



>ref|XP_011009454.1| PREDICTED: pectate lyase-like [Populus euphratica]
Length=474

 Score =   473 bits (1216),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 260/456 (57%), Positives = 316/456 (69%), Gaps = 44/456 (10%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEV----------------GDT-  1550
             AD+  +D   +K+A+EA + +L+AY  +PEE TD FN EV                G T 
Sbjct  23    ADLGIFDDVWRKRAEEAKKMTLEAYVPDPEEATDAFNVEVNKYSLAKNSSSLYGAFGSTN  82

Query  1549  -----------------IMNWTNTTRRHLR------GSHCKATNSIDRCWRCDQDWAKHR  1439
                                 + N+TRR+LR         C+ TN IDRCWRC ++WAK+R
Sbjct  83    ITNLDLDDIDDNDNDADFEQFANSTRRNLRQGRKKYAGPCQVTNPIDRCWRCQRNWAKNR  142

Query  1438  KRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMV  1259
             K+LA CA GFG  TTGG+ GR YVVTDSSD ++  PKPGTLRHAVIQ+EPLWIIF K+M 
Sbjct  143   KQLAKCALGFGRRTTGGMAGRIYVVTDSSDNNVMKPKPGTLRHAVIQKEPLWIIFSKNMN  202

Query  1258  ITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSV  1079
             I L +ELI++  KTIDGRG  VHI+YGAG+TIQF+ NVIIHGI+IHHI+   GG IRDSV
Sbjct  203   IKLSKELIMSSHKTIDGRGHHVHISYGAGITIQFIHNVIIHGIRIHHIIATSGGNIRDSV  262

Query  1078  NHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVL  899
             +H G+RT SDGDGISIFGS  VW+DH++MSRC+DGLIDAIM STAITISNC F HHN  +
Sbjct  263   DHYGIRTNSDGDGISIFGSTDVWIDHVSMSRCTDGLIDAIMGSTAITISNCHFTHHNDAI  322

Query  898   LLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRP  719
             LLGASD +S D +MQVTVAFN FG+GL+QRMPRCRWGFFH+VNNDYT W +YAIGGS  P
Sbjct  323   LLGASDSYSGDHLMQVTVAFNHFGQGLVQRMPRCRWGFFHVVNNDYTHWRLYAIGGSKHP  382

Query  718   TIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRSEGDLFLNGAYFVESGEELHHYn  539
             TI+SQGNRF A      KQVTKR+  +K  W  W WRSE DL +NGA+FV+SG+      
Sbjct  383   TIISQGNRFIAPPESHLKQVTKRDYATKGEWSKWTWRSENDLMMNGAFFVQSGQP----R  438

Query  538   ntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
               + N    I+ +P +   R+TR +GAL CK GR C
Sbjct  439   TKKPNRKFMIKAKPGAVATRMTRFAGALDCKPGREC  474



>ref|XP_006344502.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=435

 Score =   471 bits (1212),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 241/419 (58%), Positives = 297/419 (71%), Gaps = 7/419 (2%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRR--HLRG  1508
             +A I E+D   KK+A +A +++  AY  NP+ V D+ N +V D  +  +N+ RR  H   
Sbjct  22    EAHIKEFDEVWKKRAQQAKKAARHAYNPNPKIVADHLNYQV-DKAVRGSNSRRRDLHRYS  80

Query  1507  SHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPK  1328
               C ATN ID+CWRCD +WA++R +L  C  GFG  TTGG  G+ YVV D+SD ++ NPK
Sbjct  81    GKCMATNPIDQCWRCDPNWARNRMKLTDCVLGFGRKTTGGKGGKIYVVMDNSDNELVNPK  140

Query  1327  PGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRN  1148
             PGTLRHAVIQ EPLWIIF K+MVI L QELI+  +KTID RG  VHIA+G GL +QFV N
Sbjct  141   PGTLRHAVIQPEPLWIIFAKNMVIRLNQELIMTSNKTIDARGRQVHIAHGGGLMLQFVHN  200

Query  1147  VIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLI  968
             V+I  + IH      GG+IRDSV+H G R+ SDGDGISIFGS +VW+DH++MS C DGLI
Sbjct  201   VLISNLHIHDTKAGSGGLIRDSVSHYGYRSKSDGDGISIFGSTNVWIDHISMSNCQDGLI  260

Query  967   DAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWG  788
             DA+  STAITISNC F  HN V+L GASD  S D++MQ+T+AFN FG GL QRMPR RWG
Sbjct  261   DAVEGSTAITISNCHFTKHNDVMLFGASDTASGDSVMQITLAFNHFGHGLTQRMPRIRWG  320

Query  787   FFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWR  608
             F H VNNDYT W MYAIGGS  PTI+SQGNRF A  NP  K+VTKR+   +NVWKNW W+
Sbjct  321   FVHAVNNDYTHWLMYAIGGSMHPTILSQGNRFIAPPNPNAKEVTKRDYAPENVWKNWVWK  380

Query  607   SEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             S+GDL +NGA+FVESG+  H +        + I  +P S+V  LTR SG+LKC  GR C
Sbjct  381   SQGDLMMNGAFFVESGDPKHAF----LKGPDMITSKPGSFVSSLTRFSGSLKCIEGRPC  435



>ref|XP_007153840.1| hypothetical protein PHAVU_003G069100g [Phaseolus vulgaris]
 gb|ESW25834.1| hypothetical protein PHAVU_003G069100g [Phaseolus vulgaris]
Length=447

 Score =   471 bits (1212),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 239/416 (57%), Positives = 302/416 (73%), Gaps = 9/416 (2%)
 Frame = -1

Query  1666  EYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH----C  1499
             E+D Y K +A+ A   +  AY+ +P  V+ N +  V + I+      RR+L+G      C
Sbjct  37    EFDPYWKGRAETAAVDNNAAYFPDPYSVSGNLSSSVSELIVG--KDKRRNLKGQRYTGPC  94

Query  1498  KATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGT  1319
              ATN IDRCWRCD +WA +R++LA C +GFG  T GG  G FYVVTD SD +M + KPGT
Sbjct  95    MATNPIDRCWRCDPNWANNRQKLADCVQGFGRNTVGGKGGPFYVVTDPSDDNMVDLKPGT  154

Query  1318  LRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVII  1139
             LRHAV +  PLWIIF++SM+I LKQELI+  DKTIDGRGV V+IA GAG+T+QF+RNVII
Sbjct  155   LRHAVTRTGPLWIIFERSMMIKLKQELIMTSDKTIDGRGVEVYIASGAGITVQFIRNVII  214

Query  1138  HGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAI  959
             HGIK++ I    GGMIRDS  H GLRT SDGDGISIFGS+++W+DH++M  C DGLIDAI
Sbjct  215   HGIKVYDIQVHGGGMIRDSETHYGLRTQSDGDGISIFGSSNIWIDHVSMRNCYDGLIDAI  274

Query  958   MASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFH  779
             M STAITISN  F  HN  +L GASD + +D IMQ+T+AFN FGK L+QRMPRCR+GF H
Sbjct  275   MGSTAITISNSHFTDHNEAMLFGASDSYDKDKIMQITLAFNHFGKRLVQRMPRCRYGFVH  334

Query  778   IVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRSEG  599
             +VNNDYT WEMYAIGGS  PTI+S+GNRF    N   K++TKRE   ++ W +WQWRS  
Sbjct  335   VVNNDYTHWEMYAIGGSKHPTIISEGNRFIGPDNVHAKEITKREYSPESEWSSWQWRSIN  394

Query  598   DLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             D ++NGA+FV+SG EL    +  F+  + I+ +P SYVGRLTR +G+L C+VG  C
Sbjct  395   DEYMNGAFFVQSGPEL---VDRPFSRQDMIKAKPGSYVGRLTRYAGSLSCRVGLPC  447



>ref|XP_010915114.1| PREDICTED: LOW QUALITY PROTEIN: pectate lyase-like [Elaeis guineensis]
Length=444

 Score =   471 bits (1212),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 252/423 (60%), Positives = 309/423 (73%), Gaps = 11/423 (3%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH-  1502
             A+I E+D + +KKA+EAL  S  AY  +PE VT +FN+ V   +    N+TRR LR  H 
Sbjct  26    ANIVEFDDHWQKKAEEALARSRAAYNPDPEGVTHDFNKAVHLALSEARNSTRRTLRSVHR  85

Query  1501  ------CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDM  1340
                   C ATN IDRCWRC ++W  HRK+LA CA+GFG    GG  G FYVVTD SD D+
Sbjct  86    NKFKGPCVATNPIDRCWRCQKNWINHRKKLATCAKGFGRNAIGGKNGDFYVVTDPSDDDL  145

Query  1339  ENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQ  1160
              NPK GTLR  VIQ+ PLWIIF + M+I L +EL+IN +KTIDGRG +VHIA+GA +TIQ
Sbjct  146   VNPKYGTLRWGVIQDRPLWIIFARDMIIRLSEELMINSNKTIDGRGANVHIAFGAQITIQ  205

Query  1159  FVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCS  980
             FV +VIIHGI IH I P  GG+IRDS+ H G+RT SDGDGISI+GS+ +W+DH ++  C+
Sbjct  206   FVHDVIIHGIHIHDIRPSNGGIIRDSLQHFGIRTKSDGDGISIYGSSDIWIDHCSLRNCA  265

Query  979   DGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPR  800
             DGLIDAI ASTAITISNC F HHN VLL GASD    D++MQ TVAFN FGKGL+QRMPR
Sbjct  266   DGLIDAIEASTAITISNCHFTHHNDVLLFGASDSNEHDSMMQATVAFNHFGKGLVQRMPR  325

Query  799   CRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKN  620
             CRWGFFH+VNNDYT+W MYAIGGS  PTI+SQGNRF A    F+K+VTKR+  +++VWK 
Sbjct  326   CRWGFFHVVNNDYTQWIMYAIGGSQHPTIISQGNRFVAPRMLFSKEVTKRDYATEDVWKQ  385

Query  619   WQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVG  440
             W WRSEGDL  NGA+F ESG      N  +F+  + I+ +P ++V RLTR +G L C+ G
Sbjct  386   WTWRSEGDLMQNGAFFRESGNP----NARKFDRKDFIKAKPGTWVRRLTRFAGPLGCRAG  441

Query  439   RFC  431
             R C
Sbjct  442   RPC  444



>ref|XP_009779191.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=447

 Score =   470 bits (1210),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 238/425 (56%), Positives = 306/425 (72%), Gaps = 12/425 (3%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTI-----MNWTNTTRRHL  1514
             A I ++D   +++A+EA + + Q Y  NPE VT  FN++V DT+     +  +N+TRR L
Sbjct  26    AHIGDFDEVWRRRAEEAREYARQIYEPNPENVTLAFNQKVRDTMKELRQVTVSNSTRRGL  85

Query  1513  RGSH----CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDK  1346
                     C  TN IDRCWRCD +WA +RKRLA CA GFG   TGG  G  Y+VTD+SD 
Sbjct  86    GTKKYKGPCMVTNPIDRCWRCDPNWADNRKRLADCAMGFGYKATGGKDGEIYIVTDNSD-  144

Query  1345  DMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLT  1166
             D   PKPGTLR+AVIQ+EPLWIIF++SM I L QE+I+  DKTID RG +VHIA GAG+T
Sbjct  145   DYAEPKPGTLRYAVIQKEPLWIIFERSMTIRLHQEMIMQSDKTIDARGANVHIAKGAGIT  204

Query  1165  IQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSR  986
             +Q+++NVIIHG+ IH I+   GGM+RD+V+HIG+RT+SDGDGISIFG++++W+DH++M +
Sbjct  205   LQYIKNVIIHGLHIHDIVEGSGGMVRDAVDHIGIRTVSDGDGISIFGASNIWIDHVSMKK  264

Query  985   CSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRM  806
             C DG+IDA+  ST ITISN  F  HN V+L GASD  S D +MQ+T+AFN FGK L+QRM
Sbjct  265   CYDGIIDAVEGSTGITISNGHFTDHNEVMLFGASDSSSIDQVMQITLAFNHFGKRLVQRM  324

Query  805   PRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVW  626
             PRCRWG+ H+VNNDYT W MYAIGGS  PTI++QGNRF A  + F KQVTKRE   + VW
Sbjct  325   PRCRWGYIHVVNNDYTHWNMYAIGGSMHPTIITQGNRFIAPPDIFKKQVTKREYNPEEVW  384

Query  625   KNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCK  446
             K W WRSEG+LF+NGAYF+ESG+    ++       + I    A  V  +TR +GAL CK
Sbjct  385   KQWTWRSEGNLFMNGAYFIESGDP--DWSKKHKELYDGISAASAEEVTWITRFAGALGCK  442

Query  445   VGRFC  431
              G+ C
Sbjct  443   EGKAC  447



>ref|XP_003609009.1| Pectate lyase [Medicago truncatula]
Length=445

 Score =   470 bits (1209),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 238/430 (55%), Positives = 303/430 (70%), Gaps = 20/430 (5%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG--  1508
             +A+I  +D Y + ++D+A +++ QAY  NP+E+T N N  V   +   +N+TRR L    
Sbjct  23    EANIVHFDQYWQNRSDDAKKAAQQAYKPNPQEITSNLNMHVHKALSG-SNSTRRELAKYK  81

Query  1507  SHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPK  1328
               C ATN ID CWRCD +W K+RK+LA C  GFG GTTGG  G+ YVVTDSSD D+  PK
Sbjct  82    GPCSATNPIDSCWRCDPNWEKNRKKLADCVLGFGHGTTGGKAGKIYVVTDSSDNDLVTPK  141

Query  1327  PGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRN  1148
             PGTLR A IQ+EPLWIIFK +M I LK EL++  DKTID RG +VHI+ GA +T+Q+V+N
Sbjct  142   PGTLRFAAIQKEPLWIIFKHNMNIKLKAELLLTSDKTIDARGANVHISEGAQITLQYVKN  201

Query  1147  VIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLI  968
             +IIHG+ IH      GG IRDS++H G R+ SDGD IS+FG++HVW+DH++M  C+DGL+
Sbjct  202   IIIHGLHIHDTKKTSGGQIRDSMDHYGSRSASDGDAISMFGASHVWIDHISMWNCADGLV  261

Query  967   DAIMASTAITISNCKFNHHN-----------HVLLLGASDLFSEDAIMQVTVAFNRFGKG  821
             DA+  STAITISNC    HN            V+L GA+D FS D I Q+TVAFN FGKG
Sbjct  262   DAVAGSTAITISNCHMTRHNDVINNISSTYSFVMLFGANDGFSGDQISQITVAFNHFGKG  321

Query  820   LIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIV  641
             LIQRMPRCRWGFFHIVNNDYT W MYAIGGS+ PTI+SQGNRF A  NP  K+VTKR+  
Sbjct  322   LIQRMPRCRWGFFHIVNNDYTHWLMYAIGGSTHPTILSQGNRFIAPPNPNAKEVTKRDYA  381

Query  640   SKNVWKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSG  461
              ++VWK W WRSE DL +NGA+F +SG +  ++        + I+ +P S+   LTR SG
Sbjct  382   PESVWKAWSWRSENDLMMNGAFFKQSGTKAANF------PKSDIKAKPGSFAAALTRFSG  435

Query  460   ALKCKVGRFC  431
              LKC+VG+ C
Sbjct  436   CLKCEVGKPC  445



>ref|XP_007209148.1| hypothetical protein PRUPE_ppa005859mg [Prunus persica]
 gb|EMJ10347.1| hypothetical protein PRUPE_ppa005859mg [Prunus persica]
Length=440

 Score =   469 bits (1208),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 237/420 (56%), Positives = 309/420 (74%), Gaps = 9/420 (2%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH  1502
             +A+IA++D + +++A EA +++ +AY+ +P  VT++FN++V DT  ++ N TRR+L   +
Sbjct  27    RANIADFDEHWQQRAAEAKKAAHEAYHDDPIAVTEHFNKQVLDT-FDYANNTRRNLNQKY  85

Query  1501  ---CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENP  1331
                C ATN IDRCWRCD +W K+RKRLA CA GFG   TGG  G  YVVTD++D D+ NP
Sbjct  86    KGPCMATNPIDRCWRCDPNWEKNRKRLADCALGFGRKATGGKLGPIYVVTDNTDADLVNP  145

Query  1330  KPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVR  1151
             KPGTLRHAVIQ  PLWIIF + M I L +EL++  DKTID RG +VHI  GA +++QFV+
Sbjct  146   KPGTLRHAVIQNGPLWIIFARDMRIKLTEELLVASDKTIDARGANVHILDGAQISLQFVK  205

Query  1150  NVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGL  971
             NVII  + IH+  P  GGMIRDS+NH G RT SDGDGIS+FG+ +VW+DH+++S C+DGL
Sbjct  206   NVIITNLHIHNNKPGNGGMIRDSINHFGQRTRSDGDGISMFGATNVWIDHVSLSNCADGL  265

Query  970   IDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRW  791
             IDAI  STAITISNC   +HN V+L G+SD  S+D +MQ+T+AFN FGKGL+QRMPRCRW
Sbjct  266   IDAIQGSTAITISNCHLTNHNDVMLFGSSDSNSQDQVMQITLAFNHFGKGLVQRMPRCRW  325

Query  790   GFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQW  611
             GFFH+VNNDYT W MYAIGGS  PTI+SQGNRF A SN  TK+VT R    +  W++W W
Sbjct  326   GFFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPSNQATKEVTHRNNAQEGEWRSWNW  385

Query  610   RSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             RSE DL +NGA+FV+SG  + +         + I+ +P S+V RLTR +G LKC   + C
Sbjct  386   RSENDLMMNGAFFVQSGSPIRNL-----PKADMIQAKPGSFVTRLTRFAGPLKCVKNKPC  440



>ref|XP_009789921.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=447

 Score =   469 bits (1208),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 245/425 (58%), Positives = 303/425 (71%), Gaps = 12/425 (3%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWT-----NTTRRHL  1514
             A I E+D   +++A+EA + +LQ Y   PE VT  FN++V D +   +     N TRR L
Sbjct  26    AHIGEFDEVWRRRAEEARKVALQTYESEPENVTLAFNKQVRDAMKELSEVIPKNDTRREL  85

Query  1513  ----RGSHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDK  1346
                     C  TN ID+CWRCD +WA +RK+LA CA GFGS  TGG  GRFYVV DSSD 
Sbjct  86    GTKKYTGPCMVTNPIDKCWRCDPNWADNRKKLADCAMGFGSKATGGKAGRFYVVNDSSD-  144

Query  1345  DMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLT  1166
             D  +PKPGTLRHAVIQ+EPLWIIF + M I L QELI+  DKTID RG +VHIA GAG+ 
Sbjct  145   DYTDPKPGTLRHAVIQKEPLWIIFDRGMTIRLHQELIMQSDKTIDARGANVHIAGGAGIM  204

Query  1165  IQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSR  986
             IQ+ +NVIIHG+ IH I+   GGM+RD+V+HIGLRTMSDGDGISIFG++++W+DH++M  
Sbjct  205   IQYTKNVIIHGLHIHDIVQGNGGMVRDAVDHIGLRTMSDGDGISIFGASNIWIDHVSMWN  264

Query  985   CSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRM  806
             C DG+IDA+  ST ITISN  F  HN V+L GASD  S D  MQ+T+AFN FGK L+QRM
Sbjct  265   CYDGIIDAVEGSTGITISNGHFTDHNEVMLFGASDSSSIDQQMQITLAFNHFGKRLVQRM  324

Query  805   PRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVW  626
             PRCRWG+ H+VNNDYT W MYAIGGS  PTI+SQGNRF A  + F KQ+TKRE   ++VW
Sbjct  325   PRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRFIAPPDIFKKQITKREYSPESVW  384

Query  625   KNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCK  446
               W WRSEGDL++NGAYFV+SG+    ++    N  + I   PA  V  +TR +GAL CK
Sbjct  385   MQWTWRSEGDLYMNGAYFVQSGDP--DWSKKHQNLYDGISAAPADQVTWITRFAGALGCK  442

Query  445   VGRFC  431
             VG+ C
Sbjct  443   VGQAC  447



>emb|CDP02198.1| unnamed protein product [Coffea canephora]
Length=476

 Score =   470 bits (1210),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 254/451 (56%), Positives = 307/451 (68%), Gaps = 36/451 (8%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIM--------------  1544
             Q   +  + Y + +A+EA   +L+AY  NP  V   FN++  +  M              
Sbjct  28    QGSGSAEEEYWRIRAEEAWNHTLKAYEANPHTVIGAFNKQASENEMPGKTAAQDDKLTKL  87

Query  1543  ------------NWTNTTRRHLRGSH----CKATNSIDRCWRCDQDWAKHRKRLAFCArg  1412
                         +  N+TRR LRG      C ATN IDRCWRC  +WA +RKRLA C  G
Sbjct  88    NLPPCCHTQQFLSEKNSTRRELRGKKWGGGCLATNPIDRCWRCQPNWADNRKRLADCVVG  147

Query  1411  fgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELII  1232
             FG GTTGG  G FYVVTDSSD  +  PKPGTLRHAVIQ+EPLWIIF++ MVI L QELI+
Sbjct  148   FGRGTTGGKNGAFYVVTDSSDDSILAPKPGTLRHAVIQKEPLWIIFERDMVIRLTQELIM  207

Query  1231  NHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMS  1052
               DKTIDGRGVSVHIAYGAG+TIQFV+NVIIHG+ IH I    GG++RDSV+H G+RTMS
Sbjct  208   QGDKTIDGRGVSVHIAYGAGITIQFVKNVIIHGLHIHDIHQGSGGLVRDSVDHFGIRTMS  267

Query  1051  DGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFS  872
             DGDGISIFGS++VW+DH++M +C DGLIDA+ ASTAITISN  F  HN V+L GASD  S
Sbjct  268   DGDGISIFGSSNVWIDHVSMWKCYDGLIDAVEASTAITISNSHFTDHNEVMLFGASDSQS  327

Query  871   EDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRF  692
             +DA+MQ+TVAFN FGK LIQRMPRCRWGF H+VNNDYT WEMYAIGGS  P I+SQGNRF
Sbjct  328   KDAVMQITVAFNHFGKRLIQRMPRCRWGFIHVVNNDYTHWEMYAIGGSQHPIIISQGNRF  387

Query  691   KASSNPFTKQ----VTKREIVSKNVWKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfn  524
              A  + F K+    VTKR+   +  WK W WRSEGDLF+NGA+FV+SG+    +      
Sbjct  388   IAPPDIFKKEVRRTVTKRDYAEEARWKEWTWRSEGDLFMNGAFFVQSGDP--DFTKKHPE  445

Query  523   ntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
               + I    +S V  +TR +GAL C+ G  C
Sbjct  446   IFDGIAPADSSEVTWITRFAGALMCRPGSPC  476



>ref|XP_004236194.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=435

 Score =   469 bits (1206),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 239/419 (57%), Positives = 297/419 (71%), Gaps = 7/419 (2%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR--G  1508
             +A I E+D   KK+A +A +++  AY  NP+ V D+ N +V D  +  + + RR L+   
Sbjct  22    EAHIKEFDEVWKKRAQQAKKAARHAYNPNPKIVADHLNYQV-DKAVRGSKSRRRDLQRYS  80

Query  1507  SHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPK  1328
               C ATN ID+CWRCD +WA++R +L  C  GFG  TTGG  G+ YVV D+SD ++ NPK
Sbjct  81    GKCMATNPIDQCWRCDPNWARNRMKLTDCVLGFGRKTTGGKGGKIYVVMDNSDNELVNPK  140

Query  1327  PGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRN  1148
             PGTLRHAVIQ EPLWIIF K+MVI L QELI+  +KTID RG  VHIA+G GL +QF+ N
Sbjct  141   PGTLRHAVIQPEPLWIIFAKNMVIKLNQELIMTSNKTIDARGRQVHIAHGGGLMLQFIHN  200

Query  1147  VIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLI  968
             VII  + IH      GG+IRDSV+H G R+ SDGDGISIFGS +VW+DH++MS C DGLI
Sbjct  201   VIISNLHIHDTKAGAGGLIRDSVSHYGYRSKSDGDGISIFGSTNVWIDHISMSNCQDGLI  260

Query  967   DAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWG  788
             DA+  STAITISNC F  HN V+L GASD  S D++MQ+T+AFN FG GL QRMPR RWG
Sbjct  261   DAVEGSTAITISNCHFTKHNDVMLFGASDTASGDSVMQITLAFNHFGHGLTQRMPRVRWG  320

Query  787   FFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWR  608
             F H+VNNDYT W MYAIGGS  PTI+SQGNRF A  NP  K+VTKR+   +NVWKNW W+
Sbjct  321   FVHVVNNDYTHWLMYAIGGSMHPTILSQGNRFIAPPNPNAKEVTKRDYAPENVWKNWVWK  380

Query  607   SEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             S+GDL +NGA+FVESG+  H +        + I  +P S V  LT+ SG+LKC  GR C
Sbjct  381   SQGDLMMNGAFFVESGDPKHAF----LKGPDMITSKPGSSVSSLTQFSGSLKCIEGRPC  435



>gb|KHG16093.1| hypothetical protein F383_07683 [Gossypium arboreum]
Length=454

 Score =   469 bits (1208),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 254/431 (59%), Positives = 306/431 (71%), Gaps = 17/431 (4%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIM-NWTNTT--------  1526
              +IA++D   K++AD+A +++L AY  +PE VT  FNE V   ++ N +N T        
Sbjct  26    GNIADFDDVWKRRADQAWKNTLAAYEPSPENVTSKFNENVHKALVANKSNKTKDLEGSED  85

Query  1525  RRHLRGSH------CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVV  1364
             RR+LRG H      C ATN IDRCWRC  DWA++RKRL  C  GFG  T GG KG++Y V
Sbjct  86    RRNLRGKHKKYTGPCMATNPIDRCWRCRPDWAENRKRLTQCVIGFGHRTEGGEKGKYYEV  145

Query  1363  TDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIA  1184
             TD+SD D  NPKPGTLR AVIQ+ PLWIIF   M I L +ELI+   KTIDGRG +VHIA
Sbjct  146   TDNSDDDPVNPKPGTLRFAVIQKRPLWIIFAHDMHIKLSRELIVQSKKTIDGRGANVHIA  205

Query  1183  YGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLD  1004
             +GAG+T+QFV +VIIH I IHHI P   G+IRDSV+HIGLRT  DGDGI+IFGS ++WLD
Sbjct  206   HGAGITLQFVDDVIIHSIHIHHIGPSKAGLIRDSVDHIGLRTTGDGDGINIFGSTNIWLD  265

Query  1003  HLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGK  824
             HL+MS C DGLIDAI  STAITISNC F HHN V+LLGASD +  D +MQVTVAFN FGK
Sbjct  266   HLSMSECQDGLIDAIQGSTAITISNCHFTHHNDVILLGASDTYERDKLMQVTVAFNHFGK  325

Query  823   GLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREI  644
              LIQRMPRCRWGFFH+VNNDYT W+MYAIGGS  PTI+SQGNRF A  +P  K++T R  
Sbjct  326   ELIQRMPRCRWGFFHVVNNDYTHWKMYAIGGSMHPTIISQGNRFIAPDDPKAKEITNRNY  385

Query  643   VSKNVWKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTS  464
               ++ W  W WRSEGDL LNGA F +SG +        F     I+ +PA++V RLTR +
Sbjct  386   APQSEWSKWVWRSEGDLLLNGARFTKSGPD--KSPQFDFTKMQMIKAKPATFVRRLTRFA  443

Query  463   GALKCKVGRFC  431
             GAL C+ G  C
Sbjct  444   GALDCEKGNKC  454



>gb|AAA86241.1| pectate lyase homolog [Medicago sativa]
Length=450

 Score =   469 bits (1207),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 242/431 (56%), Positives = 301/431 (70%), Gaps = 17/431 (4%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEV----GDTIMNWTNTTRRHL  1514
             +  I E+D YLK +AD A Q + ++Y  NPE +T   N  V       +    N TRR L
Sbjct  23    EGRIGEFDDYLKAQADLARQIAFKSYVPNPENITTEINIHVHLAMEAAMKAEANDTRREL  82

Query  1513  ----------RGSHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVV  1364
                       R + C ATN ID CWRC +DWA++R+ LA CA+GFG  TTGGL GR YVV
Sbjct  83    MSQKSRGGKGRRARCMATNPIDSCWRCRKDWAENRQLLAKCAKGFGRRTTGGLGGRIYVV  142

Query  1363  TDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIA  1184
             TD SD DM NP+PGTLR   +Q  PLWIIF++SMVITL QEL+++ DKTIDGRG +V I 
Sbjct  143   TDPSDNDMVNPRPGTLRFGAVQRGPLWIIFQRSMVITLTQELMVSSDKTIDGRGANVQIR  202

Query  1183  YGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLD  1004
              GAG+T+QFV NVIIHG++I +I  + GG+IRDS +HIG+RT SDGD IS+FGS+++W+D
Sbjct  203   DGAGITMQFVNNVIIHGLRIKNIKARNGGLIRDSFDHIGVRTRSDGDAISVFGSSNIWID  262

Query  1003  HLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGK  824
             H+++S C DGL+D I  STA+TISNC    HN V+L GASD + +D IMQ+TVAFN FG+
Sbjct  263   HISLSDCEDGLVDVIQGSTAVTISNCHMTKHNDVMLFGASDTYQDDKIMQITVAFNHFGQ  322

Query  823   GLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREI  644
             GLIQRMPRCRWGFFH++NNDYT W MYAIGGSS PTI+SQGNRF A  N   K VT R+ 
Sbjct  323   GLIQRMPRCRWGFFHVLNNDYTHWIMYAIGGSSAPTILSQGNRFIAPHNNAAKTVTHRDY  382

Query  643   VSKNVWKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTS  464
               ++VW  WQWRSEGD F+NGA F++SG  + +     F     ++ R  S   RLTR S
Sbjct  383   APESVWSKWQWRSEGDHFMNGATFIQSGPPIKNL---PFKKGFLMKPRHGSQANRLTRFS  439

Query  463   GALKCKVGRFC  431
             GAL C VGR C
Sbjct  440   GALNCVVGRPC  450



>ref|XP_006439649.1| hypothetical protein CICLE_v10020193mg [Citrus clementina]
 gb|ESR52889.1| hypothetical protein CICLE_v10020193mg [Citrus clementina]
Length=437

 Score =   469 bits (1206),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 239/421 (57%), Positives = 308/421 (73%), Gaps = 10/421 (2%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG--  1508
             +A+  ++D   +K+A+ A + +L+AY+ NPEEV  +FN+ V     N + +TRR+LRG  
Sbjct  23    KANTHDFDEVWQKRAENARRHALEAYHPNPEEVVSSFNKHVHMMFENGS-STRRYLRGRP  81

Query  1507  --SHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMEN  1334
                 C ATN ID+CWRCD++WA +RKRLA CA+GFG GT GG  G FYVVT+ +D D+ N
Sbjct  82    YTGRCAATNPIDQCWRCDRNWANNRKRLADCAQGFGRGTIGGKNGPFYVVTNPADDDLVN  141

Query  1333  PKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFV  1154
             PKPGTLRHAVIQE PLWI F   MVI L +EL+I  DKTID RG +V I  GA +T+QFV
Sbjct  142   PKPGTLRHAVIQERPLWITFAHDMVIRLSEELLITSDKTIDARGSNVQIYNGAQITMQFV  201

Query  1153  RNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDG  974
             +N+IIHG+ I       GGMIRDSV+H G R+ SDGDGIS+FG++H+W+DH++MS C DG
Sbjct  202   KNIIIHGLHIRKTKAGKGGMIRDSVSHHGFRSSSDGDGISMFGASHIWIDHVSMSGCQDG  261

Query  973   LIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCR  794
             LIDA+M STAIT+SN  F H +HV+LLGASD   +D+IMQVTVAFN FGK L+QRMPR R
Sbjct  262   LIDAVMGSTAITVSNSHFTHQDHVMLLGASDSHPQDSIMQVTVAFNHFGKQLVQRMPRVR  321

Query  793   WGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQ  614
             +GF H+VNNDYT W MYAIGGS  PTI+SQGNRF AS++  +K+VTKR+   ++VWK W 
Sbjct  322   FGFAHVVNNDYTHWLMYAIGGSQHPTILSQGNRFLASNSHHSKEVTKRDSSPQSVWKTWN  381

Query  613   WRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRF  434
             WRSE DL +NGA+FVESG ++ +      N  + I  +P  +  ++TR SGAL C V + 
Sbjct  382   WRSEMDLMMNGAFFVESGSDVRNV-----NRQDVIPAKPGKFASQMTRFSGALNCYVNKP  436

Query  433   C  431
             C
Sbjct  437   C  437



>ref|XP_008793504.1| PREDICTED: pectate lyase-like [Phoenix dactylifera]
Length=446

 Score =   469 bits (1206),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 248/423 (59%), Positives = 307/423 (73%), Gaps = 11/423 (3%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGS--  1505
             A++AE+D + +KKA+EA   S  AY+ +PE VT+ FN+ V   +    N+TRR LR +  
Sbjct  28    ANMAEFDDHWQKKAEEAFARSRAAYHPDPEAVTNKFNKAVHLAVSQARNSTRRALRSAGV  87

Query  1504  -----HCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDM  1340
                   C ATN IDRCWRC ++W ++RK+LA CA+GFG    GG  G FYVVTD SD D+
Sbjct  88    NKFKGPCVATNPIDRCWRCRENWMENRKKLAGCAKGFGRNAVGGKDGDFYVVTDPSDNDL  147

Query  1339  ENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQ  1160
              NPK GTLR  VIQ+ PLWIIF + M+I L +EL+IN +KTIDGRG +V IAYGA +T+Q
Sbjct  148   VNPKYGTLRWGVIQDRPLWIIFARDMIIRLSEELMINSNKTIDGRGANVRIAYGAQITLQ  207

Query  1159  FVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCS  980
             FV NVIIHGI IH I P  GG+IRDS+ H G+RT SDGDGISI+GS+ +W+DH ++  C+
Sbjct  208   FVHNVIIHGIHIHDIKPSNGGIIRDSLQHFGIRTKSDGDGISIYGSSDIWIDHCSLRNCA  267

Query  979   DGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPR  800
             DGLIDAI  STAITISNC F HHN VLL GASD    D+IMQ+TVAFN FGKGL+QRMPR
Sbjct  268   DGLIDAIEGSTAITISNCHFTHHNDVLLFGASDSNEHDSIMQITVAFNHFGKGLVQRMPR  327

Query  799   CRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKN  620
             CRWGF H+VNNDYT+W MYAIGGS  PTI+SQGNRF A    F K+VTKR+  +++VWK 
Sbjct  328   CRWGFVHVVNNDYTQWIMYAIGGSQHPTIISQGNRFIAPLMQFAKEVTKRDYATEDVWKQ  387

Query  619   WQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVG  440
             W WRSEGDL  NGA+F ESG      N   F+  + I+ +P ++V RLTR +G L C+ G
Sbjct  388   WTWRSEGDLMQNGAFFRESGSP----NTKSFHRKDFIKAKPGTWVRRLTRFAGPLGCRAG  443

Query  439   RFC  431
             R C
Sbjct  444   RPC  446



>ref|XP_011085780.1| PREDICTED: probable pectate lyase P59 [Sesamum indicum]
Length=447

 Score =   469 bits (1206),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 243/429 (57%), Positives = 310/429 (72%), Gaps = 17/429 (4%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVG---------DTIMNWTNT  1529
             +ADIAEYD   +++A EA   ++QAY+ +P +V  +FN+ V          D +M   NT
Sbjct  24    RADIAEYDEVWRRRAAEAYNRTVQAYHPDPLKVVMHFNKHVNKHVEESGGLDDVM-MLNT  82

Query  1528  TRRHLRGSH---CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTD  1358
             TRRHL  ++   CK TN ID CWRC+  W  +R RLA C  GFGS  TGG  GR Y+VTD
Sbjct  83    TRRHLGKAYKGPCKVTNPIDACWRCNPKWHLNRFRLADCGMGFGSKATGGKGGRIYMVTD  142

Query  1357  SSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYG  1178
              SD D+ NPKPGTLRHAVIQEEPLWI F+++MVI LKQEL++  DKTIDGRG  V IAYG
Sbjct  143   KSDDDVLNPKPGTLRHAVIQEEPLWITFRRNMVIKLKQELMVTSDKTIDGRGAIVQIAYG  202

Query  1177  AGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHL  998
             AG+TIQFV+NVIIH +KIHHI+ K GG+IRDS +H GLRT SDGDGISIFGS  +W+DH+
Sbjct  203   AGITIQFVKNVIIHNLKIHHIVEKDGGLIRDSASHTGLRTQSDGDGISIFGSQDIWIDHV  262

Query  997   TMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGL  818
             +M+RC+DGLID I  ST ITISN  F  H+H +L G +D +  D  MQ+TVAFN FGK +
Sbjct  263   SMTRCADGLIDIIQGSTGITISNSHFTDHDHAMLFGGNDKYPGDEKMQITVAFNHFGKRM  322

Query  817   IQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVS  638
             +QRMPRCR+GFFH+VNNDYT W+MYAIGGSS PTI+SQGNR+ A  +P+ KQVTKRE   
Sbjct  323   VQRMPRCRYGFFHVVNNDYTHWKMYAIGGSSHPTIISQGNRYIA-DHPYAKQVTKRE-CP  380

Query  637   KNVWKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGA  458
             ++ WK+W W ++GDLFL GAYF+ SG++   + +     ++ I+   A  V ++T+ +G 
Sbjct  381   ESEWKHWTWVTDGDLFLRGAYFIPSGDQ--DWPSKHPEKSDNIKPASAKLVSQMTKFAGR  438

Query  457   LKCKVGRFC  431
             L CK+   C
Sbjct  439   LGCKLKYAC  447



>gb|KDO76053.1| hypothetical protein CISIN_1g013757mg [Citrus sinensis]
Length=437

 Score =   468 bits (1204),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 239/421 (57%), Positives = 308/421 (73%), Gaps = 10/421 (2%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG--  1508
             +A+  ++D   +K+A+ A + +L+AY+ NPEEV  +FN+ V     N + +TRR+LRG  
Sbjct  23    KANTHDFDEVWQKRAENARRHALEAYHPNPEEVVSSFNKHVHMMFENGS-STRRYLRGRP  81

Query  1507  --SHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMEN  1334
                 C ATN ID+CWRCD++WA +RKRLA CA+GFG GT GG  G FYVVT+ +D D+ N
Sbjct  82    YTGRCAATNPIDQCWRCDRNWANNRKRLADCAQGFGRGTIGGKNGPFYVVTNPADDDLVN  141

Query  1333  PKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFV  1154
             PKPGTLRHAVIQE PLWI F   MVI L +EL+I  DKTID RG +V I  GA +T+QFV
Sbjct  142   PKPGTLRHAVIQERPLWITFAHDMVIRLSEELLITSDKTIDARGSNVQIYNGAQITMQFV  201

Query  1153  RNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDG  974
             +N+IIHG+ I       GGMIRDSV+H G R+ SDGDGIS+FG++H+W+DH++MS C DG
Sbjct  202   KNIIIHGLHIRKTKAGKGGMIRDSVSHHGFRSSSDGDGISMFGASHIWIDHVSMSGCQDG  261

Query  973   LIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCR  794
             LIDA+M STAIT+SN  F H +HV+LLGASD   +D+IMQVTVAFN FGK L+QRMPR R
Sbjct  262   LIDAVMGSTAITVSNSHFTHQDHVMLLGASDGHPQDSIMQVTVAFNHFGKQLVQRMPRVR  321

Query  793   WGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQ  614
             +GF H+VNNDYT W MYAIGGS  PTI+SQGNRF AS++  +K+VTKR+   ++VWK W 
Sbjct  322   FGFAHVVNNDYTHWLMYAIGGSQHPTILSQGNRFLASNSHHSKEVTKRDSSPQSVWKTWN  381

Query  613   WRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRF  434
             WRSE DL +NGA+FVESG ++ +      N  + I  +P  +  ++TR SGAL C V + 
Sbjct  382   WRSEMDLMMNGAFFVESGSDVRNV-----NRQDVIPAKPGKFASQMTRFSGALNCYVNKP  436

Query  433   C  431
             C
Sbjct  437   C  437



>gb|KHG05193.1| hypothetical protein F383_30875 [Gossypium arboreum]
Length=385

 Score =   466 bits (1198),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 233/375 (62%), Positives = 283/375 (75%), Gaps = 8/375 (2%)
 Frame = -1

Query  1537  TNTTRRHLRGSH------CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgr  1376
             TN+TRR LRG H      C A N IDRCWRC ++WAK+RKRLA C  GFG  T GG KG 
Sbjct  13    TNSTRRSLRGKHKKYTGPCMAINPIDRCWRCKKNWAKNRKRLAKCVLGFGHKTRGGKKGE  72

Query  1375  FYVVTDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVS  1196
             +Y+VTD+SD D+ NPKPGTLRHAVIQ+ PLWIIF   M I L +EL++   KTIDGRGV+
Sbjct  73    YYLVTDNSDDDVVNPKPGTLRHAVIQKRPLWIIFAHDMNIKLSKELMVQSHKTIDGRGVN  132

Query  1195  VHIAYGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNH  1016
             VHIAYG G+T+QFV NVIIH I IH ++   GG+IRDS +H G RT+ DGDGISIFGS+ 
Sbjct  133   VHIAYGCGITLQFVHNVIIHNIHIHRVVRSSGGLIRDSEDHYGYRTVGDGDGISIFGSSK  192

Query  1015  VWLDHLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFN  836
             +WLDH++MS C DGLIDAI  STAITISNC F HH+HV+LLGASD +S+D  MQVT+AFN
Sbjct  193   IWLDHISMSECQDGLIDAIQGSTAITISNCHFTHHDHVILLGASDTYSKDQYMQVTLAFN  252

Query  835   RFGKGLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVT  656
              FGK LIQRMPRCRWG+FH+VNNDYT W++YAIGGS+ PTI+SQGNRF A  +P TK++T
Sbjct  253   HFGKELIQRMPRCRWGYFHVVNNDYTHWKLYAIGGSTHPTIISQGNRFIAPDDPLTKEIT  312

Query  655   KREIVSKNVWKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRL  476
              R    ++ W+NW WRSEGD F+NGA+FV SG     +   +  +  +   +PA +VGRL
Sbjct  313   HRNYAPESEWRNWIWRSEGDRFMNGAFFVTSGPPSPPHLKLKKKDIIKA--KPAIFVGRL  370

Query  475   TRTSGALKCKVGRFC  431
             T+ SG LKCK G  C
Sbjct  371   TKFSGTLKCKEGVKC  385



>gb|EYU36839.1| hypothetical protein MIMGU_mgv1a006379mg [Erythranthe guttata]
Length=446

 Score =   468 bits (1203),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 240/427 (56%), Positives = 301/427 (70%), Gaps = 14/427 (3%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFN-------EEVGDTIMNWTNTTRR  1520
             A+  + D Y  K++ +A  ++L++Y  +P ++  + N       EE+ D  +  +N++RR
Sbjct  23    ANFLDSDEYWVKRSVQAWNNTLESYEPHPAKIVSHLNLHSTRALEEIKDLELV-SNSSRR  81

Query  1519  HLRGSH---CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSD  1349
             HL   +   C ATN IDRCWRC  +WA +R RLA C  GFG    GG  GR YVV DSSD
Sbjct  82    HLAHGYDGPCMATNPIDRCWRCQANWADNRFRLADCGLGFGYKAKGGKGGRIYVVNDSSD  141

Query  1348  KDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGL  1169
              DM NP PGTLRHAVIQ EPLWIIF +SMVI L QELI+  DKTIDGRGV VHI  GAG+
Sbjct  142   SDMVNPIPGTLRHAVIQTEPLWIIFSRSMVIRLSQELIMQSDKTIDGRGVRVHITGGAGI  201

Query  1168  TIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMS  989
             TIQFV+N+IIHG+ IH I+P  GGMIRDSV+H G RT SDGDGISI+G+  +W+DH++M+
Sbjct  202   TIQFVKNIIIHGLLIHDIVPGDGGMIRDSVDHYGFRTRSDGDGISIYGAQDIWIDHVSMT  261

Query  988   RCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQR  809
              CSDGLIDAIM ST ITISN  F  HN  +L GASD  ++D  MQ+TVAFN FGK L+QR
Sbjct  262   NCSDGLIDAIMGSTGITISNGHFTDHNEAMLFGASDSHTQDVKMQITVAFNHFGKRLVQR  321

Query  808   MPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASS-NPFTKQVTKREIVSKN  632
             MPRCR+G+ H+VNNDYT W MYAIGGS  P I+SQGNRF A   NPF K+VTKRE   ++
Sbjct  322   MPRCRFGYIHVVNNDYTHWNMYAIGGSKNPIIISQGNRFIAPPDNPFAKEVTKREYSPES  381

Query  631   VWKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALK  452
             VW  W WRSEGD+FL GA+FV+SG+    Y +      + I+   A+ V  +T+ +GAL 
Sbjct  382   VWSQWIWRSEGDIFLRGAFFVQSGDPT--YTSKHPEKYDLIQAASATQVEIMTKFAGALG  439

Query  451   CKVGRFC  431
             CK+G+ C
Sbjct  440   CKIGQVC  446



>ref|XP_010683249.1| PREDICTED: pectate lyase-like [Beta vulgaris subsp. vulgaris]
Length=444

 Score =   467 bits (1202),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 248/422 (59%), Positives = 300/422 (71%), Gaps = 10/422 (2%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWT--NTTRRHLRG-  1508
             A+IAE+D Y  K+  EA++   +AY+  P  VT++FN +V     N    N+TRR L G 
Sbjct  27    ANIAEFDEYWHKRRLEAVKYFEEAYHPEPYNVTNHFNHQVHLHARNMKKLNSTRRGLLGK  86

Query  1507  ---SHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDME  1337
                  C ATN ID CWRC  +WA++RKRLA CA GFG GTTGG  GR YVVTDSSD DM+
Sbjct  87    GHIGPCVATNPIDACWRCQPNWAENRKRLADCAIGFGKGTTGGKDGRIYVVTDSSDNDMQ  146

Query  1336  NPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQF  1157
             NPKPGTLRHAVIQ EPLWIIF +SM I L QELI+  DKTID RG +VHIA+GAG+TIQF
Sbjct  147   NPKPGTLRHAVIQTEPLWIIFARSMNIRLTQELIMTGDKTIDARGANVHIAHGAGITIQF  206

Query  1156  VRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSD  977
             ++NVIIHG+ IH I P  GG+IRDS NH GLRT SDGD ISIFG++++W+DH++M+R +D
Sbjct  207   IKNVIIHGLHIHQIYPGDGGLIRDSANHFGLRTRSDGDAISIFGASNIWIDHVSMARGTD  266

Query  976   GLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRC  797
             GLID I  STAITISNC    HN V L GA++ +++D  MQVTVAFN FGKGL+QRMPR 
Sbjct  267   GLIDIIQGSTAITISNCHMTDHNEVFLFGATNDYTDDQKMQVTVAFNHFGKGLVQRMPRA  326

Query  796   RWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNW  617
             R+GF H+VNNDYT W+MYAIGGS  PTI+SQGNRF A  NPF K+VTKRE   ++ WK+W
Sbjct  327   RFGFIHVVNNDYTHWQMYAIGGSQHPTIISQGNRFVAPFNPFAKEVTKRE-APESEWKSW  385

Query  616   QWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGR  437
              W S+ D FLNGA+F +SG           N          + VG LTR SG  KC  G+
Sbjct  386   TWLSDKDWFLNGAFFRDSGRG---NAIDSKNKAQMFSAMAGTKVGELTRCSGPRKCTPGK  442

Query  436   FC  431
              C
Sbjct  443   PC  444



>ref|XP_004489374.1| PREDICTED: pectate lyase-like [Cicer arietinum]
Length=447

 Score =   467 bits (1202),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 236/422 (56%), Positives = 300/422 (71%), Gaps = 9/422 (2%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH  1502
             +A IAE+D +L+ +A+EA + +L +Y   P +V  + N  V    +   N TRR L+  H
Sbjct  30    EAGIAEFDDFLRAQAEEAHKLALASYVPIPGDVAHDLNFHV-HLALEGANDTRRELKQKH  88

Query  1501  -----CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDME  1337
                  C+ATN ID CWRC +DWA  R +LA C++GFG   TGGL G  YVVTD SD DM+
Sbjct  89    AAGEACEATNPIDSCWRCQKDWANDRFKLAKCSKGFGRRATGGLGGPIYVVTDESDNDMQ  148

Query  1336  NPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQF  1157
             NPKPGTLR+  +Q+ PLWI F++SM+I L QEL+++ DKTIDGRG +V I  G G+T+QF
Sbjct  149   NPKPGTLRYGAVQKGPLWITFQRSMIIRLNQELLVSSDKTIDGRGANVQIRDGGGITMQF  208

Query  1156  VRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSD  977
             V NVIIHG+ I +I  K G MIRDS NH+G RT SDGD +SIFGS+++W+DH+++S+C D
Sbjct  209   VNNVIIHGLHISNIKSKPGAMIRDSYNHVGQRTRSDGDALSIFGSSNIWIDHVSLSQCED  268

Query  976   GLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRC  797
             GLID I  STAITISNC    HN V+L GASD ++ D +MQ+TVAFN FG+GLIQRMPRC
Sbjct  269   GLIDVIQGSTAITISNCHMTKHNDVMLFGASDTYNGDKLMQITVAFNHFGQGLIQRMPRC  328

Query  796   RWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNW  617
             R+GF H+VNNDYT W+MYAIGGSS PTI+SQGNRF A  N   K++T R+     VWKNW
Sbjct  329   RFGFVHVVNNDYTHWQMYAIGGSSGPTILSQGNRFIAPDNDAAKEITHRDYAEPEVWKNW  388

Query  616   QWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGR  437
             QW+SE DLF+NGA FV SG  ++      F     ++ R  S+V RLTR SGAL C VG+
Sbjct  389   QWQSEMDLFMNGAKFVTSGSPIN---KAPFKKGFIMKPRDGSHVSRLTRHSGALNCVVGK  445

Query  436   FC  431
              C
Sbjct  446   PC  447



>ref|NP_197015.4| putative pectate lyase 19 [Arabidopsis thaliana]
 gb|AED92118.1| putative pectate lyase 19 [Arabidopsis thaliana]
Length=472

 Score =   468 bits (1205),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 245/453 (54%), Positives = 313/453 (69%), Gaps = 39/453 (9%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNE-------------EVGDT---  1550
             + +I+E D Y  ++ADEA + +LQAY+ +P E+ D+F+E             E GD    
Sbjct  23    RGNISELDEYWSQRADEAREFTLQAYHSDPYEIVDHFHERHYDNSTDVTTPEEDGDAKPE  82

Query  1549  ---------IMNWTNTTRRHLRG----------SHCKATNSIDRCWRCDQDWAKHRKRLA  1427
                      + + TN+TRR LRG            C A+N ID+CWRC  DWAK RK+L 
Sbjct  83    EEEKEFIEMLGSSTNSTRRSLRGKGKGKWSKLKGPCTASNPIDKCWRCRSDWAKRRKKLT  142

Query  1426  FCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLK  1247
              C RGFG  TTGG +GR YVVT + D+DM NPKPGTLRHAVIQ+EPLWIIFK  M I L 
Sbjct  143   RCVRGFGHRTTGGKRGRIYVVTSNLDEDMVNPKPGTLRHAVIQKEPLWIIFKNDMSIRLN  202

Query  1246  QELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIG  1067
             QEL+IN  KTID RG +VH+A+GAG+T+QFV+NV+IHG+ IHHI    GGMIRDSV+H G
Sbjct  203   QELLINSHKTIDARGANVHVAHGAGITMQFVKNVVIHGLHIHHISESSGGMIRDSVDHFG  262

Query  1066  LRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGA  887
             +RT +DGDG+SI+GS+++WLDH++MS+C DGLIDAI+ ST ITISN  F HHN V+LLGA
Sbjct  263   MRTRADGDGLSIYGSSNIWLDHISMSKCQDGLIDAIVGSTGITISNSHFTHHNDVMLLGA  322

Query  886   SDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVS  707
              +    D  MQVTVA+N FGKGL+QRMPR RWGF H+VNNDYT WE+YAIGGS  PTI+S
Sbjct  323   QNTNEADKHMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILS  382

Query  706   QGNRFKASSN-PFTKQVTKREIVSKNVWKNWQWRSEGDLFLNGAYFVESGEELHHYnntr  530
              GNRF A  + P  ++VTKR+  S++ WK+W WRS+ D+F+NGAYF +SG   +      
Sbjct  383   HGNRFIAPPHKPHYREVTKRDYASEDEWKHWNWRSDKDVFMNGAYFRQSGNPQY---KCA  439

Query  529   fnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
                   I+ +    V +LT+ +GAL C+VGR C
Sbjct  440   HTRQQMIKPKNGLAVSKLTKYAGALDCRVGRRC  472



>ref|XP_008239834.1| PREDICTED: pectate lyase-like [Prunus mume]
Length=438

 Score =   467 bits (1201),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 235/420 (56%), Positives = 309/420 (74%), Gaps = 9/420 (2%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH  1502
             +A+IA++D + +++A EA +++ +AY+ +P  VT++FN++V DT  ++ N TRR+L   +
Sbjct  25    RANIADFDEHWQQRAAEAKKAAHEAYHDDPIAVTEHFNKQVLDT-FDYANNTRRNLNQKY  83

Query  1501  ---CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENP  1331
                C ATN IDRCWRCD +W K+RKRLA CA GFG   TGG  G  YVVTD++D D+ NP
Sbjct  84    KGPCMATNPIDRCWRCDPNWEKNRKRLADCALGFGRKATGGKLGPIYVVTDNTDADLVNP  143

Query  1330  KPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVR  1151
             KPGTLRHAVIQ  PLWIIF + M I L +EL++  DKTID RG +VHI  GA +++QFV+
Sbjct  144   KPGTLRHAVIQNGPLWIIFARDMRIKLTEELLVASDKTIDARGANVHILDGAQISLQFVK  203

Query  1150  NVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGL  971
             NVII  + IH+  P  GG+IRDS+NH G RT SDGDGIS++G+ +VW+DH+++S C+DGL
Sbjct  204   NVIITNLHIHNNKPGNGGLIRDSINHFGQRTRSDGDGISMYGATNVWIDHVSLSNCADGL  263

Query  970   IDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRW  791
             IDAI  STAITISNC   +HN V+L G+SD  S+D +MQ+T+AFN FGKGL+QRMPRCRW
Sbjct  264   IDAIQGSTAITISNCHLTNHNDVMLFGSSDSNSQDQVMQITLAFNHFGKGLVQRMPRCRW  323

Query  790   GFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQW  611
             GFFH+VNNDYT W MYAIGGS  PTI+SQGNRF A SN  TK+VT R    +  W++W W
Sbjct  324   GFFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPSNQATKEVTHRNNAQEGEWRSWNW  383

Query  610   RSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             RSE DL +NGA+FV+SG  + +         + I+ +P S+V RLTR +G LKC   + C
Sbjct  384   RSENDLMMNGAFFVQSGSPIRNL-----PKADMIQAKPGSFVTRLTRFAGPLKCIKNKPC  438



>gb|ABK28696.1| unknown [Arabidopsis thaliana]
Length=473

 Score =   468 bits (1204),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 245/453 (54%), Positives = 313/453 (69%), Gaps = 39/453 (9%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNE-------------EVGDT---  1550
             + +I+E D Y  ++ADEA + +LQAY+ +P E+ D+F+E             E GD    
Sbjct  23    RGNISELDEYWSQRADEAREFTLQAYHSDPYEIVDHFHERHYDNSTDVTTPEEDGDAKPE  82

Query  1549  ---------IMNWTNTTRRHLRG----------SHCKATNSIDRCWRCDQDWAKHRKRLA  1427
                      + + TN+TRR LRG            C A+N ID+CWRC  DWAK RK+L 
Sbjct  83    EEEKEFIEMLGSSTNSTRRSLRGKGKGKWSKLKGPCTASNPIDKCWRCRSDWAKRRKKLT  142

Query  1426  FCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLK  1247
              C RGFG  TTGG +GR YVVT + D+DM NPKPGTLRHAVIQ+EPLWIIFK  M I L 
Sbjct  143   RCVRGFGHRTTGGKRGRIYVVTSNLDEDMVNPKPGTLRHAVIQKEPLWIIFKNDMSIRLN  202

Query  1246  QELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIG  1067
             QEL+IN  KTID RG +VH+A+GAG+T+QFV+NV+IHG+ IHHI    GGMIRDSV+H G
Sbjct  203   QELLINSHKTIDARGANVHVAHGAGITMQFVKNVVIHGLHIHHISESSGGMIRDSVDHFG  262

Query  1066  LRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGA  887
             +RT +DGDG+SI+GS+++WLDH++MS+C DGLIDAI+ ST ITISN  F HHN V+LLGA
Sbjct  263   MRTRADGDGLSIYGSSNIWLDHISMSKCQDGLIDAIVGSTGITISNSHFTHHNDVMLLGA  322

Query  886   SDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVS  707
              +    D  MQVTVA+N FGKGL+QRMPR RWGF H+VNNDYT WE+YAIGGS  PTI+S
Sbjct  323   QNTNEADKHMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILS  382

Query  706   QGNRFKASSN-PFTKQVTKREIVSKNVWKNWQWRSEGDLFLNGAYFVESGEELHHYnntr  530
              GNRF A  + P  ++VTKR+  S++ WK+W WRS+ D+F+NGAYF +SG   +      
Sbjct  383   HGNRFIAPPHKPHYREVTKRDYASEDEWKHWNWRSDKDVFMNGAYFRQSGNPQY---KCA  439

Query  529   fnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
                   I+ +    V +LT+ +GAL C+VGR C
Sbjct  440   HTRQQMIKPKNGLAVSKLTKYAGALDCRVGRRC  472



>ref|XP_011098575.1| PREDICTED: probable pectate lyase P59 [Sesamum indicum]
Length=449

 Score =   467 bits (1202),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 235/428 (55%), Positives = 304/428 (71%), Gaps = 14/428 (3%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFN-------EEVGDTIMNWTNTTR  1523
             +A IAE+D   +++A+EA   +L++Y   P ++  + N       +EV +  ++  N+TR
Sbjct  25    RAHIAEFDEVWQRRAEEAWNRTLESYEPAPAKIVSHLNLNVHRALKEVKEEELS-LNSTR  83

Query  1522  RHLRGSH---CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSS  1352
             R L   +   C+ TN IDRCWRC  +WA++R RLA C  GFG    GG  G+ YVVTD S
Sbjct  84    RQLSHGYDGPCRVTNPIDRCWRCQANWAQNRFRLADCVLGFGYKAKGGKNGKIYVVTDPS  143

Query  1351  DKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAG  1172
             D DM NPKPGTLRHAVIQ+EPLWIIF++ M+I L QELI+  DKTIDGRG  V IA GAG
Sbjct  144   DNDMVNPKPGTLRHAVIQKEPLWIIFQRDMLIRLSQELIVQSDKTIDGRGARVLIANGAG  203

Query  1171  LTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTM  992
             +T+QFV+NVIIHGIKI++I P  GGMIRD+V+H GLRT SDGDGISIFGS  +W+DH++M
Sbjct  204   ITLQFVKNVIIHGIKIYNISPGQGGMIRDAVDHYGLRTRSDGDGISIFGSQDIWIDHVSM  263

Query  991   SRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQ  812
               C+DGLID IM ST +T+SN  F  HN  +L GASD  ++D  MQVTVAFN FGK ++Q
Sbjct  264   LNCADGLIDVIMGSTGVTVSNSHFTDHNEAMLFGASDSHTQDVKMQVTVAFNHFGKRMVQ  323

Query  811   RMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKA-SSNPFTKQVTKREIVSK  635
             RMPR R+G+ H+VNNDYT W MYA+GGS  P I+SQGNR+ A  +NP+ K+VTKRE   +
Sbjct  324   RMPRARYGYIHVVNNDYTHWNMYAVGGSKNPIIISQGNRYIAPPTNPYAKEVTKREYSPE  383

Query  634   NVWKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGAL  455
             +VWK+W WRSEGD+F  GA+FV+SG+    Y +      + I+  PA  V  +T+ +GAL
Sbjct  384   SVWKSWVWRSEGDIFQGGAFFVQSGDPT--YTSKHPEKYDLIQAAPAQNVAEITKFAGAL  441

Query  454   KCKVGRFC  431
              CKVG  C
Sbjct  442   GCKVGVPC  449



>ref|XP_003613596.1| Pectate lyase [Medicago truncatula]
 gb|AES96554.1| pectate lyase P59-like protein [Medicago truncatula]
Length=449

 Score =   466 bits (1200),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 241/411 (59%), Positives = 302/411 (73%), Gaps = 7/411 (2%)
 Frame = -1

Query  1654  YLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG---SHCKATNS  1484
             Y +KKA  A +++ +AY  +P  V+ N +  V + I+   N  RR+L G   S C ATN 
Sbjct  43    YWQKKASIAAKANDKAYTPDPYAVSGNLSSTVSEMIIGGING-RRNLVGLGNSSCMATNP  101

Query  1483  IDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHAV  1304
             IDRCWRCD +WA +RK+LA C +GFG  TTGG  G  YVVTD SD D+ NP+PGTLRHAV
Sbjct  102   IDRCWRCDPNWANNRKKLADCVQGFGRKTTGGKDGPIYVVTDPSDSDLVNPRPGTLRHAV  161

Query  1303  IQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIKI  1124
              +  PLWIIF +SM I L QELI+  +KTIDGRG  V IA GAG+TIQF+ NVIIHGIKI
Sbjct  162   TRNGPLWIIFARSMKIRLNQELIMAGNKTIDGRGADVTIANGAGITIQFIENVIIHGIKI  221

Query  1123  HHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMASTA  944
             + I+   GG++RDS +H GLRT+SDGDGISIFGS+H+W+DH++M  C DGLIDAIM STA
Sbjct  222   YDIMVGSGGLVRDSEDHYGLRTISDGDGISIFGSSHIWIDHVSMRNCRDGLIDAIMGSTA  281

Query  943   ITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNND  764
             ITISN  F  HN V+L GASD +  D  MQ+TV FNRFGK LIQRMPRCR+GF H++NN 
Sbjct  282   ITISNSHFTDHNEVMLFGASDTYDGDQKMQITVVFNRFGKKLIQRMPRCRFGFIHVLNNF  341

Query  763   YTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRSEGDLFLN  584
             Y +WEMYAIGG+  PTI+S+GN+F A +N   K++TKR +V +  WK WQWRS  DL+LN
Sbjct  342   YNRWEMYAIGGTMHPTIISEGNKFIAPNNGHAKEITKRTLVPEAEWKTWQWRSINDLYLN  401

Query  583   GAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             GA+F +SG EL    N  F+N + I+ +P SYVGRLTR S +L+C+VG+ C
Sbjct  402   GAFFRQSGAEL---INRPFSNKDMIKAKPGSYVGRLTRYSRSLRCRVGKPC  449



>ref|XP_007151201.1| hypothetical protein PHAVU_004G026400g [Phaseolus vulgaris]
 gb|ESW23195.1| hypothetical protein PHAVU_004G026400g [Phaseolus vulgaris]
Length=441

 Score =   466 bits (1199),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 233/423 (55%), Positives = 306/423 (72%), Gaps = 13/423 (3%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR---  1511
             +A IAE+D +L+ ++++A + +LQ+Y   PE VT++ N  V    ++  N TRR L+   
Sbjct  26    EAGIAEFDEFLRAQSEKAHEIALQSYVPTPEFVTNDLNYHVH---LSMQNVTRRGLKEGN  82

Query  1510  ---GSHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDM  1340
                G  C+++N ID CWRC++DWAK R RLA C +GFG    GGL G  YVVTD+SD+DM
Sbjct  83    NAIGKPCESSNPIDNCWRCNKDWAKDRYRLAKCGKGFGRRAVGGLGGPIYVVTDNSDEDM  142

Query  1339  ENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQ  1160
              NPKPGTLR+AV Q+ PLWI F++SM+I+L+QEL+I+ DKTIDGRG +V I  G GLT+Q
Sbjct  143   INPKPGTLRYAVTQKGPLWITFERSMIISLQQELMISSDKTIDGRGANVQIRDGGGLTMQ  202

Query  1159  FVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCS  980
             FV NVIIHGI++  I+PK GG+IRDS NHIG RT SDGD IS+FG++++W+DH+++S  +
Sbjct  203   FVNNVIIHGIRVKDIVPKEGGLIRDSYNHIGQRTRSDGDAISVFGASNIWIDHVSLSNSA  262

Query  979   DGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPR  800
             DGLID I  STAITISNC    HN V+L GA+D ++ D IMQ+TVAFN FG+GLIQRMPR
Sbjct  263   DGLIDVIQGSTAITISNCHMTRHNDVMLFGAADSYTGDKIMQITVAFNHFGQGLIQRMPR  322

Query  799   CRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKN  620
             CR GFFH++NNDYT W MYAIGGS+ PTI+SQGNRF A +N   K++T R+  +   WKN
Sbjct  323   CRMGFFHVLNNDYTHWMMYAIGGSAGPTILSQGNRFIAPNNDAAKEITHRDYATPEEWKN  382

Query  619   WQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVG  440
             WQW+S+ DL +NGA F  SG  +      +      ++ R  ++V RLTR SGAL C VG
Sbjct  383   WQWQSDMDLLMNGATFNSSGSPI----AMKHKKGFIMKPRDGTHVSRLTRHSGALNCFVG  438

Query  439   RFC  431
               C
Sbjct  439   LPC  441



>ref|XP_004232242.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=446

 Score =   466 bits (1199),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 242/426 (57%), Positives = 296/426 (69%), Gaps = 15/426 (4%)
 Frame = -1

Query  1672  IAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMN------WTNTTRRHLR  1511
             I E+D   +++A EA + +++AY  +P  VT  F +E G  +          N TRR L+
Sbjct  24    IGEFDEVWRRRAQEADEWAIKAYKPDPINVTLAFAKETGQALKEIKEAKLAVNGTRRELK  83

Query  1510  GS------HCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSD  1349
             G        C  TN IDRCWRC  DWA +RKRLA CA GF  GTTGG  G  YVVTDSSD
Sbjct  84    GGGKKYDGPCSVTNPIDRCWRCQPDWADNRKRLADCAMGFAKGTTGGKAGEIYVVTDSSD  143

Query  1348  KDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGL  1169
              D  +PKPGTLR+ VIQ+EPLWIIF KSM I L QELI+  DKTIDGRGV+VHIA GAG 
Sbjct  144   -DTSDPKPGTLRYGVIQKEPLWIIFAKSMTIRLHQELIVQSDKTIDGRGVNVHIANGAGF  202

Query  1168  TIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMS  989
              +Q+V+NVIIHG++IH I+   GGMIRD+++H+G RT SDGDGISIFGS+++W+DH++M 
Sbjct  203   MLQYVKNVIIHGLRIHDIVVGSGGMIRDAMDHVGQRTQSDGDGISIFGSSNIWVDHVSMW  262

Query  988   RCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQR  809
              C DGL+DAI  STA+TISN  F  HN V+L GASD  S D  MQ+TVA+N FGK LIQR
Sbjct  263   SCYDGLVDAIEGSTAVTISNSHFTDHNEVMLFGASDSSSIDQRMQITVAYNHFGKRLIQR  322

Query  808   MPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNV  629
             MPRCRWGF H+VNNDYT W MYAIGGS  PTI+SQGNRF A  + F K+VTKR+   ++V
Sbjct  323   MPRCRWGFIHVVNNDYTHWNMYAIGGSQHPTIISQGNRFIAPPDMFKKEVTKRDYSPESV  382

Query  628   WKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKC  449
             WK W WRS+GDLF+NGA+FVESG+    +        + +       V  +TR SGAL C
Sbjct  383   WKQWSWRSQGDLFMNGAFFVESGDP--DWTQKHIQLFDGVVSASGDQVTWITRFSGALNC  440

Query  448   KVGRFC  431
             K G  C
Sbjct  441   KPGEAC  446



>ref|XP_009761969.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=434

 Score =   466 bits (1198),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 241/419 (58%), Positives = 304/419 (73%), Gaps = 7/419 (2%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRR--HLRG  1508
             +A I E+D   +K+A++A +++  AY+ NP+ V D+ N +V D  +  +N+ RR  H   
Sbjct  21    EAHIGEFDEVWRKRAEKAKKAARHAYHPNPKIVADHLNNQV-DKAVRGSNSRRRDLHRYN  79

Query  1507  SHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPK  1328
               CKATN ID+CWRCD +WA++R +LA C  GFG  TTGG  G+ YVVTD+SD D+ NPK
Sbjct  80    GQCKATNPIDQCWRCDPNWARNRMKLADCVLGFGRKTTGGKGGKIYVVTDNSDSDLVNPK  139

Query  1327  PGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRN  1148
             PGTLRHAVIQ +PLWIIF K+MVI L +ELI+  +KTID RG  VHIA+G GL +QF+ N
Sbjct  140   PGTLRHAVIQPQPLWIIFAKNMVIRLNEELIMTSNKTIDARGKQVHIAHGGGLMLQFIHN  199

Query  1147  VIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLI  968
             VII  ++IH      GG+IRDSV+H G RT SDGDGISIFGS +VW+DH++MS C DGLI
Sbjct  200   VIISNLRIHDTKAGNGGLIRDSVDHYGYRTKSDGDGISIFGSTNVWIDHVSMSNCQDGLI  259

Query  967   DAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWG  788
             DA+ ASTAITISN  F  HN V+L GASD  S D+IMQ+T+AFN FG+GL+QRMPR RWG
Sbjct  260   DAVEASTAITISNSHFTKHNEVMLFGASDSSSRDSIMQITLAFNHFGQGLMQRMPRVRWG  319

Query  787   FFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWR  608
             F H VNNDYT W MYAIGGS  PTI+SQGNRF A  NP  K+VTKR+   ++VWKNW W+
Sbjct  320   FVHAVNNDYTHWLMYAIGGSMHPTILSQGNRFIAPPNPNAKEVTKRDYAPESVWKNWVWK  379

Query  607   SEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             S+GDL +NGA+FVESG   H +      + + I  +P S+V  LTR SG+L C  G+ C
Sbjct  380   SQGDLMMNGAFFVESGNPNHAF----LRSPDMISSKPGSFVSSLTRFSGSLNCIEGKPC  434



>gb|KHG23093.1| hypothetical protein F383_29772 [Gossypium arboreum]
Length=385

 Score =   464 bits (1193),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 236/375 (63%), Positives = 284/375 (76%), Gaps = 8/375 (2%)
 Frame = -1

Query  1537  TNTTRRHLRGSH------CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgr  1376
             TN+TRR LRG H      C A N IDRCWRC ++WAK+RKRLA C  GFG  T GG KG 
Sbjct  13    TNSTRRDLRGKHKKYTGPCMAINPIDRCWRCRKNWAKNRKRLAKCVLGFGHKTRGGKKGE  72

Query  1375  FYVVTDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVS  1196
             +Y+VTD+SD D+ NPKPGTLRHAVIQ+ PLWIIF   M I L QEL++   KTIDGRG +
Sbjct  73    YYLVTDNSDDDVVNPKPGTLRHAVIQKRPLWIIFAHDMNIKLSQELMVQSHKTIDGRGAN  132

Query  1195  VHIAYGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNH  1016
             VHIAYG G+T+QFV NVIIH I IH ++   GG+IRDS +H G RT+ DGDGISIFGS+ 
Sbjct  133   VHIAYGCGITLQFVHNVIIHNIHIHRVVRSSGGLIRDSEDHYGFRTVGDGDGISIFGSSK  192

Query  1015  VWLDHLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFN  836
             +WLDH++MS C DGLIDAI  STAITISNC F HH+HV+LLGASD +S D  MQVT+AFN
Sbjct  193   IWLDHISMSECQDGLIDAIQGSTAITISNCHFTHHDHVILLGASDTYSRDQFMQVTLAFN  252

Query  835   RFGKGLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVT  656
              FGK LIQRMPRCRWG+FH+VNNDYT W++YAIGGS+ PTI+SQGNRF A  +P TK++T
Sbjct  253   HFGKELIQRMPRCRWGYFHVVNNDYTHWKLYAIGGSTHPTIISQGNRFIAPDDPLTKEIT  312

Query  655   KREIVSKNVWKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRL  476
              R   S++ W++W WRSEGD F+NGA+FV SG   H     +F   + I+ +PA +VGRL
Sbjct  313   NRNYASESEWRHWVWRSEGDRFMNGAFFVTSGP--HSPPRLKFKKKDIIKPKPAIFVGRL  370

Query  475   TRTSGALKCKVGRFC  431
             T+ SG LKCK G  C
Sbjct  371   TKFSGTLKCKEGVKC  385



>ref|XP_006361835.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=447

 Score =   465 bits (1197),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 241/425 (57%), Positives = 306/425 (72%), Gaps = 12/425 (3%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTI-----MNWTNTTRRHL  1514
             A I  YD   +++A+EA + + Q Y  +PE VT  FN+++ +T+     +  TN+TRR L
Sbjct  26    AHIGHYDEVWRRRAEEAKEYARQIYERHPENVTLAFNQKLRNTMKELKEVKGTNSTRRGL  85

Query  1513  RGSH----CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDK  1346
                     C  TN IDRCWRCD +WA +RKRLA CA GFGS  TGG  G FYVVTD+SD 
Sbjct  86    GTKKYCGPCIVTNPIDRCWRCDPNWADNRKRLADCAMGFGSKVTGGKNGEFYVVTDNSD-  144

Query  1345  DMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLT  1166
             D  +PKPGTLR+AVIQ+EPLWIIFK+ M I L QE+I+  DKTID RGV+VHI  GAG+T
Sbjct  145   DYNDPKPGTLRYAVIQKEPLWIIFKRGMNIRLHQEMIMQSDKTIDARGVNVHITKGAGIT  204

Query  1165  IQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSR  986
             +Q+++NVIIHG+ IH I+   GGM+RD+V+HIG+RT SDGDGISIFG++++W+DH++M R
Sbjct  205   LQYIKNVIIHGLHIHDIVEGNGGMVRDAVDHIGIRTKSDGDGISIFGASNIWIDHVSMQR  264

Query  985   CSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRM  806
             C DGLIDA+  ST ITISN  F  HN V+L GASD  S D +MQ+T+AFN FGK L+QRM
Sbjct  265   CYDGLIDAVEGSTGITISNGHFTDHNEVMLFGASDSSSIDQVMQITLAFNHFGKRLVQRM  324

Query  805   PRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVW  626
             PRCRWG+ H+VNNDYT W MYAIGGS  PTI++QGNRF A  + F KQVTKRE   ++VW
Sbjct  325   PRCRWGYIHVVNNDYTHWNMYAIGGSMHPTIITQGNRFIAPPDIFKKQVTKREYNPESVW  384

Query  625   KNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCK  446
               W WRSEG+LF+NGAYF ESG+    ++    +  + I   PA  V  +TR +G L CK
Sbjct  385   MQWTWRSEGNLFMNGAYFTESGDP--DWSKKHKDLYDGISAAPAEDVTWMTRFAGVLACK  442

Query  445   VGRFC  431
              G+ C
Sbjct  443   PGKPC  447



>gb|KHN13490.1| Putative pectate lyase 3, partial [Glycine soja]
Length=364

 Score =   462 bits (1188),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 232/358 (65%), Positives = 279/358 (78%), Gaps = 4/358 (1%)
 Frame = -1

Query  1501  CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPG  1322
             C ATN IDRCWRCD +WA +R++LA C +GFG  T GG  G FYVVTD SD DM NPKPG
Sbjct  10    CIATNPIDRCWRCDPNWANNRQKLADCVQGFGRNTVGGKGGPFYVVTDPSDDDMVNPKPG  69

Query  1321  TLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVI  1142
             TLRHAV ++ PLWIIF +SM ITL+QELI+N +KTIDGRGV V+IA GAG+T+QFV+N+I
Sbjct  70    TLRHAVTRDGPLWIIFARSMFITLQQELIMNSNKTIDGRGVDVYIAKGAGITVQFVKNII  129

Query  1141  IHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDA  962
             IHGIK+  I+ + GGMIRDS  H G RT SDGDGISIFGS+++W+DH++M  CSDGLIDA
Sbjct  130   IHGIKVFDIVIREGGMIRDSETHYGFRTKSDGDGISIFGSSNIWIDHVSMRNCSDGLIDA  189

Query  961   IMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFF  782
             IM STAITISN  F  HN V+L GASD +S+D IMQ+T+AFN FGK L+QRMPR R+GF 
Sbjct  190   IMGSTAITISNSHFTDHNEVMLFGASDSYSDDKIMQITLAFNHFGKRLVQRMPRVRYGFV  249

Query  781   HIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRSE  602
             H VNNDYT WEMYAIGGS  PTI+S+GNRF A  N F KQ+TKRE   +NVW NWQWRS 
Sbjct  250   HSVNNDYTHWEMYAIGGSKNPTIISEGNRFIAPDNQFAKQITKREYAPENVWANWQWRSI  309

Query  601   GDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSG-ALKCKVGRFC  431
              D+++NGA+FV+SG EL    +  F+  + I  +  +YVGRLTR SG  LKC+VGR C
Sbjct  310   NDVYMNGAFFVQSGPEL---ASRPFSREDMITAKVGNYVGRLTRYSGNLLKCRVGRPC  364



>ref|XP_009587689.1| PREDICTED: probable pectate lyase P59 [Nicotiana tomentosiformis]
Length=447

 Score =   464 bits (1195),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 242/425 (57%), Positives = 301/425 (71%), Gaps = 12/425 (3%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWT-----NTTRRHL  1514
             A I E+D   +++A+EA + +LQ Y   PE VT  FN++V D +   +     N TRR L
Sbjct  26    AHIGEFDEVWRRRAEEARKVALQTYESEPENVTLAFNKQVRDAMKELSEVIPKNDTRREL  85

Query  1513  ----RGSHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDK  1346
                     C  TN ID+CWRCD +WA +RK+LA CA GFGS  TGG  GRFYVV D SD 
Sbjct  86    GTKKYTGPCMVTNPIDKCWRCDPNWADNRKKLADCAMGFGSKATGGKAGRFYVVNDPSD-  144

Query  1345  DMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLT  1166
             D  +PKPGTLRHAVIQ+EPLWIIF + M I L QELI+  DKTID RG +VHI+ GAG+ 
Sbjct  145   DYTDPKPGTLRHAVIQKEPLWIIFDRGMTIRLHQELIMQSDKTIDARGANVHISGGAGIM  204

Query  1165  IQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSR  986
             IQ+ +NVIIHG+ IH I+   GGM+RD+V+HIGLRTMSDGDGISIFG++++W+DH++M  
Sbjct  205   IQYTKNVIIHGLHIHDIVQGNGGMVRDAVDHIGLRTMSDGDGISIFGASNIWIDHVSMWN  264

Query  985   CSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRM  806
             C DG+IDA+  ST ITISN  F  HN V+L GASD  S D  MQ+T+AFN FGK L+QRM
Sbjct  265   CYDGIIDAVEGSTGITISNGHFTDHNEVMLFGASDSSSIDQQMQITLAFNHFGKRLVQRM  324

Query  805   PRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVW  626
             PRCRWG+ H+VNNDYT W MYAIGGS  PTI+SQGNRF A  + F KQ+TKRE   ++VW
Sbjct  325   PRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRFIAPPDIFKKQITKREYSPESVW  384

Query  625   KNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCK  446
               W WRSEGDL++NGAYFV+SG+    ++    N  + I   PA  V  +TR +GAL C 
Sbjct  385   MQWTWRSEGDLYMNGAYFVQSGDP--DWSKKHQNLYDGISAAPADQVTWITRFAGALGCM  442

Query  445   VGRFC  431
             VG+ C
Sbjct  443   VGQAC  447



>ref|XP_003519771.2| PREDICTED: probable pectate lyase 3-like [Glycine max]
Length=447

 Score =   464 bits (1195),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 240/412 (58%), Positives = 296/412 (72%), Gaps = 6/412 (1%)
 Frame = -1

Query  1660  DAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG--SHCKATN  1487
             D+Y K+KA  A + + QAY  +P  +T N    V + I+   N  RR+L+G   +C ATN
Sbjct  40    DSYWKQKASVAEKENKQAYTSDPYSLTKNLTYSVSEIIVGEQNG-RRNLKGKGGNCMATN  98

Query  1486  SIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHA  1307
              IDRCWRCD +WA +RK+LA C +GFG  T GG  G FYVVT + D DM NP PGTLRHA
Sbjct  99    PIDRCWRCDPNWANNRKKLANCVQGFGRNTVGGKNGPFYVVTSNLDNDMVNPVPGTLRHA  158

Query  1306  VIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIK  1127
             V +  PLWIIF  SM I L QELI+  DKTIDGRGV V++A GAG+TIQF++NVIIHG+K
Sbjct  159   VTRTGPLWIIFAHSMKIRLNQELIMASDKTIDGRGVDVYLAGGAGITIQFIKNVIIHGVK  218

Query  1126  IHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMAST  947
             I  I    GG+I DS NH GLRTMSDGDGISIFGS+++W+DH++M +C DGLIDAI  ST
Sbjct  219   IFDIQVGNGGLIIDSENHYGLRTMSDGDGISIFGSSNIWIDHVSMRKCKDGLIDAIQGST  278

Query  946   AITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNN  767
             AITISN  F  HN V+L GASD +  D IMQ+T+AFN FGK L+QRMPRCR+GF H+VNN
Sbjct  279   AITISNSHFTDHNEVMLFGASDSYDGDTIMQITLAFNHFGKRLVQRMPRCRYGFVHVVNN  338

Query  766   DYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRSEGDLFL  587
             DYT WEMYAIGGS  PTI+S+GNRF A  N   K++TKRE   +  WK+WQWRS  D +L
Sbjct  339   DYTHWEMYAIGGSKHPTIISEGNRFIAPDNINAKEITKREYSPEQEWKSWQWRSINDEYL  398

Query  586   NGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             NG +F E G +L    +  ++  + +  RP SYVGRLTR +G+LKC VG+ C
Sbjct  399   NGGFFREGGAQL---TDRPYSRHDMMTARPGSYVGRLTRYAGSLKCMVGKPC  447



>ref|XP_003621115.1| Pectate lyase [Medicago truncatula]
 gb|AES77333.1| pectate lyase P59-like protein [Medicago truncatula]
Length=451

 Score =   464 bits (1194),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 239/432 (55%), Positives = 297/432 (69%), Gaps = 18/432 (4%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEV----GDTIMNWTNTTRRHL  1514
             +  I E+D YLK +A+ A Q + ++Y  NPE +T   N  V       +    N TRR L
Sbjct  23    EGRIGEFDDYLKAQAEMARQIAFKSYVPNPENITTEINIHVHLAMEAAMKAEANDTRREL  82

Query  1513  RGSH-----------CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYV  1367
                            C ATN ID CWRC  DWAK+R+ LA CA+GFG  TTGGL GR YV
Sbjct  83    MSQKSRGGKGRRRARCMATNPIDSCWRCRNDWAKNRQLLATCAKGFGRRTTGGLGGRIYV  142

Query  1366  VTDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHI  1187
             VTD SD D+ NP+PGTLR   +Q+ PLWIIF+++MVITL QEL+++ DKTIDGRG +V I
Sbjct  143   VTDPSDNDLVNPRPGTLRFGAVQKGPLWIIFQRNMVITLTQELMVSSDKTIDGRGANVQI  202

Query  1186  AYGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWL  1007
               GAG+T+QFV NVIIHG++I +I  K GG+IRDS +H+G+RT SDGD IS+FGS+++W+
Sbjct  203   REGAGITMQFVNNVIIHGLRIKNIKAKNGGLIRDSFDHLGVRTRSDGDAISVFGSSNIWI  262

Query  1006  DHLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFG  827
             DH+++S C DGL+D I  STA+TISNC    HN V+L GASD + +D IMQVTVAFN FG
Sbjct  263   DHISLSNCEDGLVDVIQGSTAVTISNCHMTKHNDVMLFGASDTYQDDKIMQVTVAFNHFG  322

Query  826   KGLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKRE  647
             +GLIQRMPRCRWGFFH++NNDYT W MYAIGGSS PTI+SQGNRF A  N   K +T R+
Sbjct  323   QGLIQRMPRCRWGFFHVLNNDYTHWIMYAIGGSSAPTILSQGNRFIAPHNNAAKTITHRD  382

Query  646   IVSKNVWKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRT  467
                + VW  WQWRSEGD F+NGA F++SG  +       F     ++ R  S   RLTR 
Sbjct  383   YAPEAVWSKWQWRSEGDHFMNGANFIQSGPPIKSL---PFKKGFLMKPRHGSQANRLTRF  439

Query  466   SGALKCKVGRFC  431
             SGAL C VGR C
Sbjct  440   SGALNCVVGRPC  451



>gb|KHN08706.1| Putative pectate lyase 3 [Glycine soja]
Length=444

 Score =   464 bits (1193),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 240/412 (58%), Positives = 296/412 (72%), Gaps = 6/412 (1%)
 Frame = -1

Query  1660  DAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG--SHCKATN  1487
             D+Y K+KA  A + + QAY  +P  +T N    V + I+   N  RR+L+G   +C ATN
Sbjct  37    DSYWKQKASVAEKENKQAYTSDPYSLTKNLTYSVSEIIVGEQNG-RRNLKGKGGNCMATN  95

Query  1486  SIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHA  1307
              IDRCWRCD +WA +RK+LA C +GFG  T GG  G FYVVT + D DM NP PGTLRHA
Sbjct  96    PIDRCWRCDPNWANNRKKLANCVQGFGRNTVGGKNGPFYVVTSNLDNDMVNPVPGTLRHA  155

Query  1306  VIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIK  1127
             V +  PLWIIF  SM I L QELI+  DKTIDGRGV V++A GAG+TIQF++NVIIHG+K
Sbjct  156   VTRTGPLWIIFAHSMKIRLNQELIMASDKTIDGRGVDVYLAGGAGITIQFIKNVIIHGVK  215

Query  1126  IHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMAST  947
             I  I    GG+I DS NH GLRTMSDGDGISIFGS+++W+DH++M +C DGLIDAI  ST
Sbjct  216   IFDIQVGNGGLIIDSENHYGLRTMSDGDGISIFGSSNIWIDHVSMRKCKDGLIDAIQGST  275

Query  946   AITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNN  767
             AITISN  F  HN V+L GASD +  D IMQ+T+AFN FGK L+QRMPRCR+GF H+VNN
Sbjct  276   AITISNSHFTDHNEVMLFGASDSYDGDTIMQITLAFNHFGKRLVQRMPRCRYGFVHVVNN  335

Query  766   DYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRSEGDLFL  587
             DYT WEMYAIGGS  PTI+S+GNRF A  N   K++TKRE   +  WK+WQWRS  D +L
Sbjct  336   DYTHWEMYAIGGSKHPTIISEGNRFIAPDNINAKEITKREYSPEQEWKSWQWRSINDEYL  395

Query  586   NGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             NG +F E G +L    +  ++  + +  RP SYVGRLTR +G+LKC VG+ C
Sbjct  396   NGGFFREGGAQL---TDRPYSRHDMMTARPGSYVGRLTRYAGSLKCMVGKPC  444



>ref|XP_006338480.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=446

 Score =   462 bits (1190),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 241/426 (57%), Positives = 296/426 (69%), Gaps = 15/426 (4%)
 Frame = -1

Query  1672  IAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMN------WTNTTRRHLR  1511
             I E+D   +++A EA + +++AY  +P  VT  F ++ G  +          N TRR L+
Sbjct  24    IGEFDEVWRRRAQEADEWAIKAYKPDPINVTLAFAKQTGQALKEIKEAKLAINGTRRELK  83

Query  1510  GS------HCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSD  1349
             G        C  TN IDRCWRC  +WA +RKRLA CA GF  GTTGG  G  YVVTDSSD
Sbjct  84    GGGKKYNGPCLVTNPIDRCWRCQPNWADNRKRLADCAMGFAKGTTGGKAGEIYVVTDSSD  143

Query  1348  KDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGL  1169
              D  +PKPGTLR+ VIQ+EPLWIIF KSM I L QELI+  DKTIDGRGV+VHIA GAG 
Sbjct  144   -DTSDPKPGTLRYGVIQKEPLWIIFAKSMTIRLHQELIVQSDKTIDGRGVNVHIANGAGF  202

Query  1168  TIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMS  989
              +Q+V+NVIIHG++IH I+   GGMIRD+++HIG RT SDGDGISIFGS+++W+DH++M 
Sbjct  203   MLQYVKNVIIHGLRIHDIVVGSGGMIRDAMDHIGQRTQSDGDGISIFGSSNIWVDHVSMW  262

Query  988   RCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQR  809
              C DGL+DA+  STA+TISN  F  HN V+L GASD  S D  MQ+TVA+N FGK LIQR
Sbjct  263   SCYDGLVDAVEGSTAVTISNSHFTDHNEVMLFGASDSSSIDQRMQITVAYNHFGKRLIQR  322

Query  808   MPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNV  629
             MPRCRWGF H+VNNDYT W MYAIGGS  PTI+SQGNRF A  + F K+VTKR+   ++V
Sbjct  323   MPRCRWGFIHVVNNDYTHWNMYAIGGSQHPTIISQGNRFIAPPDMFKKEVTKRDYSPESV  382

Query  628   WKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKC  449
             WK W WRS+GDLF+NGA+FVESG+    +        + I       V  +TR SGAL C
Sbjct  383   WKQWSWRSQGDLFMNGAFFVESGDP--DWTKKHTELFDGIVSASGDQVTWITRFSGALNC  440

Query  448   KVGRFC  431
             K G  C
Sbjct  441   KPGEAC  446



>ref|XP_004234779.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=449

 Score =   462 bits (1190),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 239/427 (56%), Positives = 304/427 (71%), Gaps = 14/427 (3%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNW-------TNTTRR  1520
             A I  YD   +++A+EA + + + Y  +PE VT  FN+++ DT+           N+TRR
Sbjct  26    AHIGHYDEVWRRRAEEAKEYARKIYEPHPENVTLAFNQKLRDTMKELKKVKGTHNNSTRR  85

Query  1519  HL----RGSHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSS  1352
              L        C  TN ID+CWRCD +WA +RK+LA CA GFGS   GG  G FYVVTD+S
Sbjct  86    GLGTKKYTGPCMVTNPIDKCWRCDPNWADNRKKLADCAMGFGSKAIGGKDGEFYVVTDNS  145

Query  1351  DKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAG  1172
             D D  +PKPGTLRHAVIQ+EPLWIIFK+ M I L QE+I+  DKTID RGV+VHI  GAG
Sbjct  146   D-DYNDPKPGTLRHAVIQKEPLWIIFKRGMNIRLHQEMIMQSDKTIDARGVNVHITKGAG  204

Query  1171  LTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTM  992
             +T+Q+++NVIIHG+ IH I+   GGM+RD+V+HIG+RT SDGDGISIFG++++W+DH++M
Sbjct  205   ITLQYIKNVIIHGLHIHDIVEGNGGMVRDAVDHIGIRTKSDGDGISIFGASNIWIDHVSM  264

Query  991   SRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQ  812
              RC DGLIDA+  ST ITISN  F  HN V+L GASD  S D +MQ+T+AFN FGK LIQ
Sbjct  265   QRCYDGLIDAVEGSTGITISNGHFTDHNEVMLFGASDSSSIDQVMQITLAFNHFGKRLIQ  324

Query  811   RMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKN  632
             RMPRCRWG+ H+VNNDYT W MYAIGGS  PTI++QGNRF A  + F KQVTKRE   ++
Sbjct  325   RMPRCRWGYIHVVNNDYTHWNMYAIGGSMHPTIITQGNRFIAPPDIFKKQVTKREYNPES  384

Query  631   VWKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALK  452
             VW  W WRSEG+LF+NGAYF ESG+    +++   +  + I   PA  V  +TR +G L 
Sbjct  385   VWMQWTWRSEGNLFMNGAYFTESGDP--EWSSKHKDLYDGISAAPAEDVTWMTRFAGVLG  442

Query  451   CKVGRFC  431
             CK G+ C
Sbjct  443   CKPGKPC  449



>gb|KEH19822.1| pectate lyase-like protein [Medicago truncatula]
Length=455

 Score =   462 bits (1190),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 238/423 (56%), Positives = 300/423 (71%), Gaps = 16/423 (4%)
 Frame = -1

Query  1666  EYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG----SHC  1499
             E+D+Y +++A  A Q +  AY+ +P  ++ NF   + + I        R+L G      C
Sbjct  38    EFDSYWQERAKVAKQENKAAYFKDPYAISGNFTASISEIIA--VKEKGRNLGGLKDDGTC  95

Query  1498  KATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGT  1319
              ATN IDRCWRCD +WA +R++LA C +GFG  T GG  G  YVVTD SD DM NPKPGT
Sbjct  96    LATNPIDRCWRCDPNWANNRQKLADCVQGFGRNTRGGQGGPIYVVTDPSDDDMMNPKPGT  155

Query  1318  LRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVII  1139
             LR+AV +   LWI F +SM ITL+QELI++ DKTIDGRGV V+I+ GAG+TIQFV+NVII
Sbjct  156   LRYAVTRNGSLWITFARSMAITLQQELIMSGDKTIDGRGVDVYISNGAGITIQFVKNVII  215

Query  1138  HGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAI  959
             HGIKI+ I  + GGMIRDS  H G RT SDGDGISIFG+++VW+DH++M  C+DGLIDAI
Sbjct  216   HGIKIYDIQVRDGGMIRDSEAHYGFRTKSDGDGISIFGASNVWIDHVSMRNCTDGLIDAI  275

Query  958   MASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFH  779
             M STAITISN  F  HN V+L GAS+ +SED IMQ+T+AFN FGK L+QRMPR R+GF H
Sbjct  276   MGSTAITISNSHFTDHNEVMLFGASNDYSEDKIMQITLAFNHFGKRLVQRMPRARFGFVH  335

Query  778   IVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPF-------TKQVTKREIVSKNVWKN  620
              VNNDYT WEMYAIGGS  PTI+S+GNRF    N         +K++TKRE   ++ WK 
Sbjct  336   CVNNDYTHWEMYAIGGSQNPTIISEGNRFIGPYNKMLGNDLINSKEITKREYTEESEWKT  395

Query  619   WQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVG  440
             WQWRS  D ++NGA+FV+SG EL       F+  + I+ +P S+VGRLTR SG L+C+VG
Sbjct  396   WQWRSINDEYINGAFFVQSGPELKD---RPFSQKDMIKAKPGSFVGRLTRYSGNLRCRVG  452

Query  439   RFC  431
               C
Sbjct  453   EPC  455



>ref|XP_010527872.1| PREDICTED: probable pectate lyase 3 isoform X2 [Tarenaya hassleriana]
Length=461

 Score =   462 bits (1190),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 245/435 (56%), Positives = 294/435 (68%), Gaps = 21/435 (5%)
 Frame = -1

Query  1672  IAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVG----DTIMNWTNTTRRHL---  1514
             +A +D Y  ++ D+AL+ +L+ Y  NP  VTD+FN  V     +T+    N TRR L   
Sbjct  27    VAVFDEYWTQRQDKALRQTLRFYDPNPFNVTDHFNYHVNLAVEETMKTGNNGTRRELLQV  86

Query  1513  ---RGSH---------CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFY  1370
                RG H         C A N IDRCWRCD  W+K+RK+LA CA GFG  TTGG  G +Y
Sbjct  87    GQSRGQHPKRRNLGGKCVAYNPIDRCWRCDPGWSKNRKKLADCALGFGRKTTGGKAGPYY  146

Query  1369  VVTDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVH  1190
             VVTD+SD D+ NPK GTLRHAV +EEPLWI+F KSMVI L+QELI+  DKTIDGRGV VH
Sbjct  147   VVTDASDDDLLNPKAGTLRHAVTREEPLWIVFAKSMVIKLQQELIMTSDKTIDGRGVRVH  206

Query  1189  IAYGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVW  1010
             I  GAG T+QFV NVIIH I I +I+P  GG+IRDS  H GLRT SDGDGI+IFG+ +VW
Sbjct  207   ITGGAGFTLQFVNNVIIHNIYIKNIVPGNGGLIRDSETHFGLRTRSDGDGINIFGATNVW  266

Query  1009  LDHLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRF  830
             +DH++MS CSDG+IDAI  ST ITISNC    H  V+L G +D    D  MQ+TVAFN F
Sbjct  267   IDHVSMSHCSDGMIDAIQGSTGITISNCHLTDHQEVMLFGGTDKDVIDKKMQITVAFNHF  326

Query  829   GKGLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKR  650
             GK L+QRMPRCR+G  H+VNNDYT WEMYAIGG+  PTI+SQGNRF A  N   KQVTKR
Sbjct  327   GKRLVQRMPRCRYGLIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNEEAKQVTKR  386

Query  649   EIVSKNVWKNWQWRSEGDLFLNGAYFVESGE--ELHHYnntrfnntnRIRHRPASYVGRL  476
             E      WK+W W+SEGD FLNGAYFV+SG    L         +   IR +P + V +L
Sbjct  387   EYTPFTEWKSWNWQSEGDYFLNGAYFVQSGRANALSAAPKNPVPSKFAIRPQPGTLVRKL  446

Query  475   TRTSGALKCKVGRFC  431
             T  +G L CK  + C
Sbjct  447   TMDAGVLSCKKRKPC  461



>ref|XP_004490004.1| PREDICTED: probable pectate lyase 3-like isoform X2 [Cicer arietinum]
Length=376

 Score =   459 bits (1181),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 232/369 (63%), Positives = 279/369 (76%), Gaps = 7/369 (2%)
 Frame = -1

Query  1525  RRHLRG----SHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTD  1358
             RR+LRG      C ATN IDRCWRCD +WA +RK+LA C +GFG  TTGG  G FYVVTD
Sbjct  11    RRNLRGRKTAGPCMATNPIDRCWRCDPNWANNRKKLADCVQGFGRKTTGGKAGPFYVVTD  70

Query  1357  SSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYG  1178
              SD DM NP+PGTLRHAV +  PLWIIF +SM I L QELI+  DKTIDGRG  + IA G
Sbjct  71    PSDSDMVNPRPGTLRHAVTRNGPLWIIFARSMNIRLNQELIMTSDKTIDGRGADIVIANG  130

Query  1177  AGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHL  998
             AG+TIQ++RNVIIHGIK+  I+   GG++RDS NH GLRTMSDGDGISIFGS+++W+DH+
Sbjct  131   AGITIQYIRNVIIHGIKVFDIVVGSGGLVRDSENHYGLRTMSDGDGISIFGSSNIWIDHV  190

Query  997   TMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGL  818
             +M  C DGLIDAIM STAITISN  F  HN V+L GASD +  D  MQ+TVAFN FGK L
Sbjct  191   SMRNCRDGLIDAIMGSTAITISNSHFTDHNEVMLFGASDGYDADQKMQITVAFNHFGKRL  250

Query  817   IQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVS  638
             IQRMPRCR+GF H+VNNDYT WEMYAIGGS  PTI+S+GNRF A  N + K++TKRE   
Sbjct  251   IQRMPRCRFGFIHVVNNDYTHWEMYAIGGSKHPTIISEGNRFIAPDNGYAKEITKREYSP  310

Query  637   KNVWKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGA  458
             ++ WKNWQWRS  D+++NGA+F + G EL +     F+  + I  +P +YVGRLTR SG+
Sbjct  311   ESEWKNWQWRSINDVYMNGAFFRQGGSELTN---RPFSKKDMITAKPGAYVGRLTRYSGS  367

Query  457   LKCKVGRFC  431
             LKC VG+ C
Sbjct  368   LKCIVGKPC  376



>ref|XP_010528323.1| PREDICTED: probable pectate lyase 19 [Tarenaya hassleriana]
Length=458

 Score =   462 bits (1189),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 254/438 (58%), Positives = 312/438 (71%), Gaps = 24/438 (5%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAY------------YHNPEEVTDNFNEEVGDTIMNW  1538
             +  I EYD YL+K+  EA + +L+AY            +++P       + + G      
Sbjct  24    RGKIGEYDDYLRKQEAEAQEQALRAYDPEFDQTVKKFDHNDPSHQNATISIKGGYRPNKN  83

Query  1537  TNTTRRHLRG--------SHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglk  1382
             T +TRR LRG          CKATN +D+CWRC  DWA++RKRL  C RGFG  TTGG  
Sbjct  84    TTSTRRSLRGRGNWKKIAGPCKATNPVDKCWRCQADWAQNRKRLVSCVRGFGHKTTGGFS  143

Query  1381  grFYVVTDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRG  1202
             G+FY VTD SD DM+NPKPGT+RHAVIQ+ PLWIIF +SM I LKQEL+I  +KTID RG
Sbjct  144   GKFYKVTDPSDDDMQNPKPGTIRHAVIQKVPLWIIFARSMHIRLKQELMITSNKTIDARG  203

Query  1201  VSVHIAYGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGS  1022
              +VHIA+GAG+TIQF +NVIIHG+ IHHI+   GGMIRDSV+HIG+RT +DGDGIS+FGS
Sbjct  204   ANVHIAFGAGITIQFAQNVIIHGLHIHHIVTSNGGMIRDSVDHIGIRTQADGDGISVFGS  263

Query  1021  NHVWLDHLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVA  842
             ++VWLDHL+MSRC DGLID I  STAITISNC F HHN V+LLGASD FS D+IMQVT+A
Sbjct  264   SNVWLDHLSMSRCQDGLIDVIQGSTAITISNCHFTHHNDVILLGASDQFSGDSIMQVTIA  323

Query  841   FNRFGKGLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSN-PFTK  665
             +N FGKGL+QRMPRCRWGF H+VNNDYT WEMYAIGGS  PTI+SQGNRF A  +  + K
Sbjct  324   YNHFGKGLVQRMPRCRWGFVHVVNNDYTHWEMYAIGGSQHPTILSQGNRFIAPPHISWAK  383

Query  664   QVTKREIVSKNVWKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYV  485
             QVTKR+    + WK W W+SE D+F+NGAYFVESG+    +   +F   + IR +     
Sbjct  384   QVTKRDYAQPSEWKRWTWQSEMDVFMNGAYFVESGDPNFKH---KFTRQDIIRAKHGMAA  440

Query  484   GRLTRTSGALKCKVGRFC  431
               LTR +G+L C  G+ C
Sbjct  441   SMLTRYAGSLHCFAGKPC  458



>gb|AAQ62996.1| oil palm polygalacturonase allergen PEST361 [Elaeis guineensis]
Length=447

 Score =   462 bits (1188),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 248/415 (60%), Positives = 304/415 (73%), Gaps = 11/415 (3%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH-  1502
             A+I E+D + +KKA+EAL  S  AY  +PE VT +FN+ V   +    N+TRR LR  H 
Sbjct  26    ANIVEFDDHWQKKAEEALARSRAAYNPDPEAVTHDFNKAVHLALSEARNSTRRTLRSVHR  85

Query  1501  ------CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDM  1340
                   C ATN IDRCWRC ++W  HRK+LA CA+GFG    GG  G FYVVTD SD D+
Sbjct  86    NKFKGPCVATNPIDRCWRCQKNWINHRKKLATCAKGFGRNAIGGKNGDFYVVTDPSDDDL  145

Query  1339  ENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQ  1160
              NPK GTLR  VIQ+ PLWIIF + M+I L +EL+IN +KTIDGRG +VHIA+GA +TIQ
Sbjct  146   VNPKYGTLRWGVIQDRPLWIIFARDMIIRLSEELMINSNKTIDGRGANVHIAFGAQITIQ  205

Query  1159  FVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCS  980
             FV +VIIHGI IH I P  GG+IRDS+ H G+RT SDGDGISI+GS+ +W+DH ++  C+
Sbjct  206   FVHDVIIHGIHIHDIRPSNGGIIRDSLQHFGIRTKSDGDGISIYGSSDIWIDHCSLRNCA  265

Query  979   DGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPR  800
             DGLIDAI ASTAITISNC F HHN VLL GASD    D++MQ TVAFN FGKGL+QRMPR
Sbjct  266   DGLIDAIEASTAITISNCHFTHHNDVLLFGASDSNEHDSMMQATVAFNHFGKGLVQRMPR  325

Query  799   CRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKN  620
             CRWGFFH+VNNDYT+W MYAIGGS  PTI+SQGNRF A    F+K+VTKR+  +++VWK 
Sbjct  326   CRWGFFHVVNNDYTQWIMYAIGGSQHPTIISQGNRFVAPRMLFSKEVTKRDYATEDVWKQ  385

Query  619   WQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGAL  455
             W WRSEGDL  NGA+F ESG      N  +F+  + I+ +P ++V RLTR +G L
Sbjct  386   WTWRSEGDLMQNGAFFRESGNP----NARKFDRKDFIKAKPGTWVRRLTRFAGPL  436



>sp|P15722.1|PLY59_SOLLC RecName: Full=Probable pectate lyase P59; Flags: Precursor [Solanum 
lycopersicum]
 emb|CAA33523.1| P59 protein [Solanum lycopersicum]
Length=449

 Score =   461 bits (1187),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 239/427 (56%), Positives = 302/427 (71%), Gaps = 14/427 (3%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNW-------TNTTRR  1520
             A I  YD   +++A+EA + +   Y  +PE VT  FN+++ DT+           N+TRR
Sbjct  26    AHIGHYDEVWRRRAEEAKEYARNIYEPHPENVTLAFNQKLRDTMKELKKVKGTHNNSTRR  85

Query  1519  HL----RGSHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSS  1352
              L        C  TN ID+CWRCD +WA +RK+LA CA GFGS   GG  G FYVVTD+S
Sbjct  86    GLGTKKYTGPCMVTNPIDKCWRCDPNWADNRKKLADCAMGFGSKAIGGKDGEFYVVTDNS  145

Query  1351  DKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAG  1172
             D D  +PKPGTLRHAVIQ+EPLWIIFK+ M I L QE+I+  DKTID RGV+VHI  GAG
Sbjct  146   D-DYNDPKPGTLRHAVIQKEPLWIIFKRGMNIRLHQEMIMQSDKTIDARGVNVHITKGAG  204

Query  1171  LTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTM  992
             +T+Q+++NVIIHG+ IH I+   GGM+RD+V+HIG+RT SDGDGISIFG++++W+DH++M
Sbjct  205   ITLQYIKNVIIHGLHIHDIVEGNGGMVRDAVDHIGIRTKSDGDGISIFGASYIWIDHVSM  264

Query  991   SRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQ  812
              RC DGLIDA+  ST ITISN  F  HN V+L GASD  S D +MQ+T+AFN FGK LIQ
Sbjct  265   QRCYDGLIDAVEGSTGITISNGHFTDHNEVMLFGASDSSSIDQVMQITLAFNHFGKRLIQ  324

Query  811   RMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKN  632
             RMPRCRWG+ H+VNNDYT W MYAIGGS  PTI+ QGNRF A  + F KQVTKRE   ++
Sbjct  325   RMPRCRWGYIHVVNNDYTHWNMYAIGGSMHPTIIHQGNRFIAPPDIFKKQVTKREYNPES  384

Query  631   VWKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALK  452
             VW  W WRSEG+LF+NGAYF ESG+    +++   +  + I   PA  V  +TR +G L 
Sbjct  385   VWMQWTWRSEGNLFMNGAYFTESGDP--EWSSKHKDLYDGISAAPAEDVTWMTRFAGVLG  442

Query  451   CKVGRFC  431
             CK G+ C
Sbjct  443   CKPGKPC  449



>ref|XP_003613595.1| Pectate lyase [Medicago truncatula]
 gb|AES96553.1| pectate lyase P59-like protein [Medicago truncatula]
Length=449

 Score =   461 bits (1186),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 237/412 (58%), Positives = 293/412 (71%), Gaps = 9/412 (2%)
 Frame = -1

Query  1654  YLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH----CKATN  1487
             Y ++KA  A   + +AY  +P  V+ N +  V + I+   N  RR+L G      C ATN
Sbjct  43    YWQQKASAAAMKNDKAYTPDPYAVSGNLSHSVSEMIIG--NQGRRNLAGGKARGPCMATN  100

Query  1486  SIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHA  1307
              IDRCWRCD +WA +R++LA C +GFG  TTGG  G  YVVTD SD DM NP+PGTLR  
Sbjct  101   PIDRCWRCDPNWANNRQKLADCVKGFGRKTTGGKGGPIYVVTDPSDSDMVNPRPGTLRFG  160

Query  1306  VIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIK  1127
             V +  PLWI F +SM I L QELI+   KTIDGRG  V IA GAG+TIQF+ NVIIHGIK
Sbjct  161   VTRNGPLWITFARSMTIRLNQELIMTSHKTIDGRGADVTIASGAGITIQFIENVIIHGIK  220

Query  1126  IHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMAST  947
             I  I+   GG+IRD  +H G RTMSDGDGISIFGS+++W+DH++M  C DGL+DAIM ST
Sbjct  221   IFDIVVGSGGLIRDGQDHFGQRTMSDGDGISIFGSSNIWIDHVSMRNCRDGLVDAIMGST  280

Query  946   AITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNN  767
             AITISN  F  HN V+L GASD +  D  MQ+TVAFN FGK LIQRMPRCR+GF H++NN
Sbjct  281   AITISNSHFTDHNEVMLFGASDGYGGDEKMQITVAFNHFGKRLIQRMPRCRFGFIHVLNN  340

Query  766   DYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRSEGDLFL  587
             DYT WEMYAIGGS  PTI+S+GNRF A +N   K++TKRE V ++VWK+WQWRS  D++L
Sbjct  341   DYTHWEMYAIGGSMHPTIISEGNRFIAPNNGHAKEITKREYVDESVWKSWQWRSINDVYL  400

Query  586   NGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             NGA+F + G EL       F+  + I+ RP +YVGRLTR SG+L+C VG+ C
Sbjct  401   NGAFFRQGGPELKD---RPFSRKDMIKSRPGTYVGRLTRYSGSLRCIVGKPC  449



>ref|XP_007139601.1| hypothetical protein PHAVU_008G043600g [Phaseolus vulgaris]
 gb|ESW11595.1| hypothetical protein PHAVU_008G043600g [Phaseolus vulgaris]
Length=444

 Score =   461 bits (1185),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 241/443 (54%), Positives = 306/443 (69%), Gaps = 10/443 (2%)
 Frame = -1

Query  1738  SHQISIfvfflllvfaatLQADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEV  1559
             S ++SI +     +    L+  I E+D +LK +A EA + +L++Y  +P  +TD+ N  V
Sbjct  5     SSKVSIIILVAFAITIPCLEGGIGEFDDFLKGQALEAHEIALESYVPDPVNMTDDLNINV  64

Query  1558  ----GDTIMNWTNTTRRHLR---GSHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsg  1400
                  +     +N TRR L+   G  C A N IDRCWRC + WAK+R +LA CA+GFG  
Sbjct  65    HGALTEVFKEESNHTRRELKQKYGGPCLALNPIDRCWRCKKGWAKNRFKLAHCAKGFGRK  124

Query  1399  ttgglkgrFYVVTDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDK  1220
              TGGL+G+ Y+V D SD D  NPKPGTLR  V+Q+EPLWIIF +SM+I L  EL+I+ DK
Sbjct  125   ATGGLEGKMYIVNDPSDDDPINPKPGTLRFGVLQKEPLWIIFARSMIIKLNYELLISSDK  184

Query  1219  TIDGRGVSVHIAYGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDG  1040
             TIDGRG +V I  G+GLT+QFV NVIIHG+++ +I    GG IRDS NH+G+RT +DGD 
Sbjct  185   TIDGRGANVMIKDGSGLTMQFVNNVIIHGLRLQNIKSTPGGTIRDSWNHVGIRTKADGDA  244

Query  1039  ISIFGSNHVWLDHLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAI  860
             ISIFGS+++W+DHL++S C DGL+D I  ST ITISNC    HN V+L GASD F+ D I
Sbjct  245   ISIFGSSNIWIDHLSLSDCEDGLVDIIQGSTGITISNCHMTKHNDVMLFGASDTFTGDKI  304

Query  859   MQVTVAFNRFGKGLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASS  680
             MQVTVAFN FG+GLIQRMPRCRWGFFH++NNDYT W MYAIGGSS PTI+SQGNRF A +
Sbjct  305   MQVTVAFNHFGQGLIQRMPRCRWGFFHVLNNDYTHWLMYAIGGSSAPTILSQGNRFIAPN  364

Query  679   NPFTKQVTKREIVSKNVWKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHR  500
             N   K+VT R+    +VW+ WQWRSE D+F+NGA FV+SG  L       FN    ++ R
Sbjct  365   NNAAKEVTHRDYAEPSVWEKWQWRSENDVFMNGANFVQSGPPLGKL---PFNKGFLMKPR  421

Query  499   PASYVGRLTRTSGALKCKVGRFC  431
               S   RLTR +GAL CK    C
Sbjct  422   HGSQANRLTRFAGALNCKANSPC  444



>ref|XP_007137422.1| hypothetical protein PHAVU_009G125800g [Phaseolus vulgaris]
 gb|ESW09416.1| hypothetical protein PHAVU_009G125800g [Phaseolus vulgaris]
Length=439

 Score =   460 bits (1184),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 233/423 (55%), Positives = 303/423 (72%), Gaps = 13/423 (3%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR---  1511
             +A IAE+D +LK ++++A + +L++Y   PE V    N  V  +++N   +TRR L+   
Sbjct  24    EAGIAEFDDFLKAQSEKAHKIALESYVPTPEFVASELNYHVHLSMLN---STRRGLKAGN  80

Query  1510  ---GSHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDM  1340
                G+ C ++N ID CWRC++DWA  R RLA C +GFG    GGL G  YVVTD+SD+DM
Sbjct  81    NDAGAPCDSSNPIDNCWRCNKDWANDRYRLAKCGKGFGRRAVGGLGGPIYVVTDNSDEDM  140

Query  1339  ENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQ  1160
              NPK GTLR+ V Q+ PLWI F +SM+ITL+QEL+I+ DKTIDGRG +V I  GAGLT+Q
Sbjct  141   VNPKEGTLRYGVTQKGPLWITFARSMIITLQQELLISSDKTIDGRGANVQIRDGAGLTMQ  200

Query  1159  FVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCS  980
             FV NVIIHGI++ +I+ K GGMIRDS NH+GLRT SDGD IS+FG++++W+DH+++S   
Sbjct  201   FVNNVIIHGIRVKNIVSKEGGMIRDSYNHVGLRTRSDGDAISVFGASNIWIDHVSLSNSD  260

Query  979   DGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPR  800
             DGLID I  STAITISNC    HN V+L GA+D +S D IMQ+TVAFN FG+GLIQRMPR
Sbjct  261   DGLIDVIQGSTAITISNCHMTRHNDVMLFGATDTYSGDKIMQITVAFNHFGQGLIQRMPR  320

Query  799   CRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKN  620
             CR GFFH++NNDYT W MYAIGGS+ PTI+SQGNRF A +N   K++T R      VWKN
Sbjct  321   CRMGFFHVLNNDYTHWMMYAIGGSAAPTILSQGNRFIAPNNDAAKEITHRVDAEPEVWKN  380

Query  619   WQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVG  440
             WQW+S+ DL +NGA F  SG  +     T++     ++ R  ++V RLTR +GAL C VG
Sbjct  381   WQWQSDMDLLMNGATFNTSGSPI----TTQYKKGLLMKPRDGTHVSRLTRHAGALNCFVG  436

Query  439   RFC  431
               C
Sbjct  437   LPC  439



>ref|XP_002511525.1| Pectate lyase precursor, putative [Ricinus communis]
 gb|EEF52127.1| Pectate lyase precursor, putative [Ricinus communis]
Length=433

 Score =   460 bits (1183),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 242/420 (58%), Positives = 308/420 (73%), Gaps = 11/420 (3%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRR---HLR  1511
             +A+IA +D   +++A EA  ++LQAY+ NPE++ ++FN+EV  ++ ++++T+ +   H R
Sbjct  22    KANIAHFDKVWQQRAKEASHAALQAYHPNPEDIVNHFNKEVAKSLNDFSSTSSQLSQHKR  81

Query  1510  GSHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENP  1331
                C ATN IDRCWRCD +WA +RK+LA CA GFG  TTGG  G +YVVTD SD D+ NP
Sbjct  82    P--CHATNPIDRCWRCDANWASNRKKLAGCALGFGRMTTGGKDGDYYVVTDPSDDDLVNP  139

Query  1330  KPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVR  1151
             + GTLR+ VIQ+ PLWI F   MVITL QELIIN +KTIDGRG +VHI+ GA +TIQ+ R
Sbjct  140   REGTLRYGVIQDRPLWITFAGDMVITLSQELIINSNKTIDGRGANVHISCGAQITIQYAR  199

Query  1150  NVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGL  971
             N+IIHGI IH I    GG IRDS  H G RT SDGDGISI+GSN++W+DH+++S C+DGL
Sbjct  200   NIIIHGIHIHDIRGGSGGKIRDSETHFGKRTASDGDGISIYGSNNIWIDHVSISNCTDGL  259

Query  970   IDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRW  791
             IDAIMASTAITISNC F  HN V+LLG ++ FS D++MQVTVAFN F + L+QRMPR R+
Sbjct  260   IDAIMASTAITISNCHFTRHNTVMLLGGNNKFSADSVMQVTVAFNHFDRKLVQRMPRVRY  319

Query  790   GFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQW  611
             G  H+VNNDYT WEMYAIGGS  PTI+SQGNRF A  +P  KQVTKR +  ++ WK+W W
Sbjct  320   GLAHVVNNDYTSWEMYAIGGSEHPTIISQGNRFLAPPDPDCKQVTKRNVEPESEWKSWNW  379

Query  610   RSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             RSEGDL LNGA+FVESG  +  +          +   P + V RLTR +GAL CK  + C
Sbjct  380   RSEGDLMLNGAFFVESGSPIETH------GKEEVHAMPGTLVHRLTRYAGALHCKKQKPC  433



>emb|CDX85564.1| BnaA02g02490D [Brassica napus]
Length=473

 Score =   461 bits (1185),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 249/457 (54%), Positives = 310/457 (68%), Gaps = 46/457 (10%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNE---------------------  1565
             +A+++E D Y  K+A EA + +LQAY+ NP EV D+F+E                     
Sbjct  23    RANLSELDEYWSKRAGEAREFTLQAYHSNPYEVVDHFHERHYDNSTDVKETEEDSDDEKP  82

Query  1564  -EVGDTIM----NWTNTTRRHLRGSH----------CKATNSIDRCWRCDQDWAKHRKRL  1430
              EV D ++    N  N+TRR LRG            C A+N ID+CWRC  +WAK RK L
Sbjct  83    EEVEDDVIEMVGNEMNSTRRILRGKRKGKWSKLKGPCTASNPIDKCWRCRSNWAKRRKNL  142

Query  1429  AFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITL  1250
               C RGFG  T GG +GR YVVT + D+DM NPKPGTLRHAVIQ+EPLWIIFK  M I L
Sbjct  143   VKCVRGFGHSTIGGKRGRIYVVTSNLDEDMVNPKPGTLRHAVIQKEPLWIIFKNDMHIRL  202

Query  1249  KQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHI  1070
              QEL+I   KTID RG  VHIA+GAG+TIQFVR+VIIHG++IHHI    GGMIRDS +H 
Sbjct  203   SQELMICSFKTIDARGTDVHIAHGAGITIQFVRHVIIHGLRIHHICQSNGGMIRDSTDHF  262

Query  1069  GLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLG  890
             G+RT +DGDGISI+GS+ +WLDH++MS+C DGLIDAI+ STAITISN  F HHN V+LLG
Sbjct  263   GMRTKADGDGISIYGSSMIWLDHISMSKCQDGLIDAIVGSTAITISNSHFTHHNDVMLLG  322

Query  889   ASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIV  710
             A +    D  MQVTVA+N FGKGL+QRMPR RWGF H+VNNDYT WE+YAIGGS  PTI+
Sbjct  323   AQNDNQGDKKMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQAPTIL  382

Query  709   SQGNRFKASSN-PFTKQVTKREIVSKNVWKNWQWRSEGDLFLNGAYFVESGE---ELHHY  542
             S GNRF A  + P  ++VTKR+  S++ WK+W WRS+ D+F+NGAYF +SG    + HH 
Sbjct  383   SHGNRFIAPPHKPHYREVTKRDYASEHEWKHWNWRSDKDMFMNGAYFRQSGNPHFKCHH-  441

Query  541   nntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
                       I+ +    V  LT+ +GAL C+VG+ C
Sbjct  442   -----TRKQMIKPKHGIAVSMLTKYAGALDCRVGKRC  473



>ref|XP_006656188.1| PREDICTED: pectate lyase-like [Oryza brachyantha]
Length=446

 Score =   459 bits (1181),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 237/422 (56%), Positives = 295/422 (70%), Gaps = 9/422 (2%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEV-----GDTIMNWTNTTRRH  1517
             +A+I +YD + +K+   A  ++   Y  +P EVT++FN  V      +T       ++R 
Sbjct  29    EANIGDYDEHWQKRKLMADAAAEATYKRDPFEVTNDFNRAVHRSEEKETARRSLMLSKRK  88

Query  1516  LRGSHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDME  1337
                  CKATN IDRCWRC  DWA  RKRLA CA+GFG  TTGGL G+FYVVTD +D D+ 
Sbjct  89    KFAGPCKATNPIDRCWRCRDDWATDRKRLARCAQGFGRNTTGGLAGKFYVVTDGTDDDVV  148

Query  1336  NPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQF  1157
             NP+PGTLR  VIQ+EPLWIIF K+M+I LK+EL+I +DKT+DGRG  V I  GA +T+Q 
Sbjct  149   NPRPGTLRWGVIQDEPLWIIFGKNMIINLKEELMIGNDKTVDGRGAQVRITNGAQVTVQN  208

Query  1156  VRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSD  977
               NVIIH I +H I+   GGMIRDS  H G RT SDGDGI+IFGS +VWLDHL++S C D
Sbjct  209   SNNVIIHNIHVHDIVLGKGGMIRDSPEHFGFRTQSDGDGITIFGSTNVWLDHLSLSNCQD  268

Query  976   GLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRC  797
             GLID I  ST +TISNC   +HN V+L G+SD FSED IMQ+TVAFN FG+GL+QRMPRC
Sbjct  269   GLIDVIAKSTGVTISNCHLTNHNDVMLFGSSDSFSEDQIMQITVAFNHFGRGLVQRMPRC  328

Query  796   RWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNW  617
             RWGFFH+VNNDYT W MYAIGGS  PTI+SQGNR+ A  N   KQ+TK+    ++ WKNW
Sbjct  329   RWGFFHVVNNDYTHWLMYAIGGSKNPTIISQGNRYIAPPNLAAKQITKQLGAEESEWKNW  388

Query  616   QWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGR  437
              W SE DLF+ GAYF  SG  +     T  N  + I+ +P SYV RLTR +G++ C+ G+
Sbjct  389   VWHSEEDLFMEGAYFTTSGGAIR----TSINKKDLIKPKPGSYVTRLTRFAGSIPCRPGK  444

Query  436   FC  431
              C
Sbjct  445   PC  446



>ref|XP_009110541.1| PREDICTED: probable pectate lyase 3 [Brassica rapa]
Length=458

 Score =   459 bits (1181),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 239/430 (56%), Positives = 294/430 (68%), Gaps = 14/430 (3%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTI--MNWTNTTRRHL---  1514
             A++A +D Y  ++  +AL+ ++ ++  NP  VTD+ N  V   +     TN+TRR L   
Sbjct  29    ANVAVFDNYWLQRQGDALKQTIASFDPNPLNVTDHLNYHVALAVDATESTNSTRRELSQV  88

Query  1513  -------RGSHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDS  1355
                    R   C A N IDRCWRC+ DW K+RK+LA C  GFG  TTGG  G  YVV D+
Sbjct  89    RNGRKLKRSGKCVAYNPIDRCWRCNGDWEKNRKKLADCVLGFGRRTTGGKDGPIYVVNDA  148

Query  1354  SDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGA  1175
             SD D+ NPKPGTLRHAV ++ PLWIIF  SM+I L+QELII  DKTIDGRG  V+I  GA
Sbjct  149   SDDDLINPKPGTLRHAVTRDGPLWIIFGSSMIINLQQELIITSDKTIDGRGARVYIMEGA  208

Query  1174  GLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLT  995
             GLT+QFV NVIIH I + H++PK GG+IRDS  HIGLRT+SDGDGIS+FG+ +VW+DH++
Sbjct  209   GLTLQFVNNVIIHNIYVKHVVPKSGGLIRDSEQHIGLRTVSDGDGISLFGATNVWIDHVS  268

Query  994   MSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLI  815
             M+RCSDG+IDAI+ STAITISN  F  H  V+L GA+D    D  MQ+TVAFN FGK L 
Sbjct  269   MTRCSDGMIDAILGSTAITISNSHFTDHEEVMLFGANDKHVIDKKMQITVAFNHFGKRLD  328

Query  814   QRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSK  635
             QRMPRCR+G  H+VNNDYT WEMYAIGG+  PTI+SQGNRF A  N   KQ+TKRE    
Sbjct  329   QRMPRCRFGTIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNEQAKQITKREYTPY  388

Query  634   NVWKNWQWRSEGDLFLNGAYFVESGEE--LHHYnntrfnntnRIRHRPASYVGRLTRTSG  461
               WK W W+SEGD FLNGAYFV+SG++                IR +P + V +LT  +G
Sbjct  389   VNWKMWNWQSEGDYFLNGAYFVQSGKQNAWSPKPINPVPKKFAIRPQPGTMVRKLTMDAG  448

Query  460   ALKCKVGRFC  431
             AL CK G  C
Sbjct  449   ALGCKPGTPC  458



>ref|XP_006573090.1| PREDICTED: probable pectate lyase 3-like [Glycine max]
Length=448

 Score =   458 bits (1179),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 237/418 (57%), Positives = 296/418 (71%), Gaps = 4/418 (1%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNW-TNTTRRHLRGS  1505
             Q+++   D+Y +++A  A + + QAY  +P  +T N    V + I+   +       RG 
Sbjct  34    QSEVLLVDSYWQERASIAEKENQQAYTSDPYSLTKNLTFSVSEIIIGEKSGRRNLRGRGG  93

Query  1504  HCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKP  1325
              C ATN IDRCWRCD +WA +RK+LA C +GFG  T GG  G FYVV  S D DM NP P
Sbjct  94    KCMATNPIDRCWRCDPNWANNRKKLADCVQGFGRNTIGGKNGPFYVVNSSLDNDMVNPAP  153

Query  1324  GTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNV  1145
             GTLRHAV +  PLWIIF +SM I L QELI+  DKTIDGRGV V+IA GAG+TIQF++NV
Sbjct  154   GTLRHAVTRSGPLWIIFARSMNIRLSQELIMTSDKTIDGRGVDVYIANGAGITIQFIKNV  213

Query  1144  IIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLID  965
             IIHGIKI +I    GG+IRDS  H G RT SDGDGISIFGS++VW+DH++M  C DGLID
Sbjct  214   IIHGIKIFNIQVGNGGLIRDSETHYGFRTYSDGDGISIFGSSNVWIDHVSMRNCKDGLID  273

Query  964   AIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGF  785
             AI  STAITISN  F  HN V+L GASD +  D IMQ+T+AFN FGK L+QRMPRCR+GF
Sbjct  274   AIQGSTAITISNGHFTDHNEVMLFGASDSYDGDKIMQITLAFNHFGKRLVQRMPRCRYGF  333

Query  784   FHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRS  605
              H+VNNDYT WEMYAIGGS  PTI+S+GNRF A +N + K++TKRE   +  WKNWQWRS
Sbjct  334   VHVVNNDYTHWEMYAIGGSKHPTIISEGNRFIAPNNVYAKEITKREYSPEQEWKNWQWRS  393

Query  604   EGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
               D ++NGA+F E G ++    +  F+  + I  +P SYVGRLTR +G+L+C VG+ C
Sbjct  394   INDEYMNGAFFREGGSQI---TDRPFSRQDMITAKPGSYVGRLTRYAGSLRCIVGKPC  448



>gb|KHN01171.1| Putative pectate lyase 3 [Glycine soja]
Length=433

 Score =   458 bits (1178),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 237/418 (57%), Positives = 295/418 (71%), Gaps = 4/418 (1%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNW-TNTTRRHLRGS  1505
             Q+++   D+Y +++A  A + + QAY  +P  +T N    V + I+           RG 
Sbjct  19    QSEVLLVDSYWQERASIAEKENQQAYTSDPYSLTKNLTFSVSEIIIGEKNGRRNLRGRGG  78

Query  1504  HCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKP  1325
              C ATN IDRCWRCD +WA +RK+LA C +GFG  T GG  G FYVV  S D DM NP P
Sbjct  79    KCMATNPIDRCWRCDPNWANNRKKLADCVQGFGRNTIGGKNGPFYVVNSSLDNDMVNPAP  138

Query  1324  GTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNV  1145
             GTLRHAV +  PLWIIF +SM I L QELI+  DKTIDGRGV V+IA GAG+TIQF++NV
Sbjct  139   GTLRHAVTRSGPLWIIFARSMNIRLSQELIMTSDKTIDGRGVDVYIANGAGITIQFIKNV  198

Query  1144  IIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLID  965
             IIHGIKI +I    GG+IRDS  H G RT SDGDGISIFGS++VW+DH++M  C DGLID
Sbjct  199   IIHGIKIFNIQVGNGGLIRDSETHYGFRTYSDGDGISIFGSSNVWIDHVSMRNCKDGLID  258

Query  964   AIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGF  785
             AI  STAITISN  F  HN V+L GASD +  D IMQ+T+AFN FGK L+QRMPRCR+GF
Sbjct  259   AIQGSTAITISNGHFTDHNEVMLFGASDSYDGDKIMQITLAFNHFGKRLVQRMPRCRYGF  318

Query  784   FHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRS  605
              H+VNNDYT WEMYAIGGS  PTI+S+GNRF A +N + K++TKRE   +  WKNWQWRS
Sbjct  319   VHVVNNDYTHWEMYAIGGSKHPTIISEGNRFIAPNNVYAKEITKREYSPEQEWKNWQWRS  378

Query  604   EGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
               D ++NGA+F E G ++    +  F+  + I  +P SYVGRLTR +G+L+C VG+ C
Sbjct  379   INDEYMNGAFFREGGSQI---TDRPFSRQDMITAKPGSYVGRLTRYAGSLRCIVGKPC  433



>ref|XP_006357122.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=448

 Score =   458 bits (1179),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 232/425 (55%), Positives = 300/425 (71%), Gaps = 12/425 (3%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWT-----NTTRRHL  1514
             A I ++D   +++A+EA++ ++Q Y   P  +T  FN++  D++   +     N TRR L
Sbjct  27    AHIGDFDEVWRRRAEEAMKFTIQTYESEPANITLAFNQKTRDSVKELSAVVSKNETRREL  86

Query  1513  RGSH----CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDK  1346
                     C  TN ID+CWRCD +WA +RK+L  C+ GFG  TTGG  G++YVV+DSSD 
Sbjct  87    GTKKYEGPCTVTNPIDKCWRCDPNWADNRKKLVECSMGFGYKTTGGRDGKYYVVSDSSD-  145

Query  1345  DMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLT  1166
             D   PKPGTLRHAVIQ+EPLWIIF ++M I L QELI+  DKTIDGRG +VHI  GA + 
Sbjct  146   DYTTPKPGTLRHAVIQKEPLWIIFDRNMKIKLHQELIMQGDKTIDGRGATVHITGGASIM  205

Query  1165  IQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSR  986
             IQ+ +NVIIHG+ IH I+   GGM+RD+V+HIG RT SDGDGISIFGS+++W+DH++M  
Sbjct  206   IQYTKNVIIHGLHIHDIVEGNGGMVRDAVDHIGFRTKSDGDGISIFGSSNIWIDHMSMEN  265

Query  985   CSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRM  806
             C DG+IDA+  ST ITISN  +  HN V+L GASD  S D  MQ+T+AFN FGK L+QRM
Sbjct  266   CYDGIIDAVEGSTGITISNGHYTDHNEVMLFGASDSSSIDQKMQITLAFNHFGKRLVQRM  325

Query  805   PRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVW  626
             PRCRWG+ H+VNNDYT W MYAIGGS  PTI+SQGNRF A  + F KQ+TKRE   ++VW
Sbjct  326   PRCRWGYIHVVNNDYTHWNMYAIGGSKNPTIISQGNRFIAPPDIFKKQITKREYSPESVW  385

Query  625   KNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCK  446
               W WRSEGDL++NGAYFV++G+    ++    N  + I   PA  V  +TR +GAL CK
Sbjct  386   MQWTWRSEGDLYMNGAYFVQAGDP--DWSKKHQNLYDGIAAAPADQVTWMTRFAGALNCK  443

Query  445   VGRFC  431
             VG+ C
Sbjct  444   VGKAC  448



>ref|XP_010678579.1| PREDICTED: pectate lyase-like [Beta vulgaris subsp. vulgaris]
Length=443

 Score =   457 bits (1177),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 240/423 (57%), Positives = 298/423 (70%), Gaps = 9/423 (2%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR---  1511
             +A+I  YD + K++   A  ++ +AY  +P  +T   N+ V +  MN TN T  + R   
Sbjct  24    EANIGNYDDHWKQREQAAKANAARAYNTDPHGITHQTNQRVHNMGMNRTNRTNNYARRGL  83

Query  1510  GSH---CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDM  1340
             G +   C+A N IDRCWRCD +W+K R++LA C  GFG  TTGG KG  YVVTD SD ++
Sbjct  84    GKYEGPCQADNPIDRCWRCDDNWSKDRQKLADCVVGFGHKTTGGKKGNIYVVTDDSDNEL  143

Query  1339  ENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQ  1160
              +PKPGTLRHAVIQ+ PLWIIFK  MVI LK+EL+++ +KTIDGRG  VHIA GAG+ +Q
Sbjct  144   LDPKPGTLRHAVIQDGPLWIIFKHGMVIKLKEELLVSSNKTIDGRGGHVHIAGGAGIMLQ  203

Query  1159  FVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCS  980
             FV NVIIH + IH I    GG IRDSV+H G RT SDGDGISIFGS ++W+DH++MS C 
Sbjct  204   FVDNVIIHNVHIHDIKTGGGGFIRDSVSHFGFRTASDGDGISIFGSTNIWIDHVSMSNCM  263

Query  979   DGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPR  800
             DGLIDAI ASTAIT+SNC F  HN V+L GA D  S+D IMQVT+AFN FGK LIQRMPR
Sbjct  264   DGLIDAIEASTAITVSNCHFTDHNDVMLFGARDSSSQDEIMQVTIAFNHFGKRLIQRMPR  323

Query  799   CRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKN  620
             CR+GFFH++NNDYT WEMYAIGGS  PTI+ QGNRF A  N F K+VTKRE    +VWK+
Sbjct  324   CRFGFFHVLNNDYTHWEMYAIGGSQHPTIICQGNRFIAPPNIFAKEVTKREYAPYSVWKD  383

Query  619   WQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVG  440
             W W SE D+ +NGA+F +SG+         +   + I+ +P S V  LTR +GAL CK G
Sbjct  384   WLWTSEDDIMMNGAFFNQSGDT---SKKPSYAKKDMIKAKPGSEVTHLTRFAGALNCKEG  440

Query  439   RFC  431
               C
Sbjct  441   TAC  443



>ref|XP_008366366.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=479

 Score =   458 bits (1179),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 227/379 (60%), Positives = 283/379 (75%), Gaps = 8/379 (2%)
 Frame = -1

Query  1558  GDTIMNWTNTTRRHLRGSH---CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgg  1388
             G +  +  N TRR+L+  +   C ATN IDRCWRCD +W  +RK+LA CA+GFG  TTGG
Sbjct  106   GSSTFDAANKTRRNLKQKYKGPCLATNPIDRCWRCDPNWETNRKKLADCAKGFGHKTTGG  165

Query  1387  lkgrFYVVTDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDG  1208
               G+ YVVTD+SD DM NPKPGTLRHAVIQ  PLWIIF + M I L++EL++  DKTID 
Sbjct  166   KAGKIYVVTDNSDNDMVNPKPGTLRHAVIQTGPLWIIFARDMRIKLREELMVTSDKTIDA  225

Query  1207  RGVSVHIAYGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIF  1028
             RG +VHI  GA +T+QFV NVIIH + IH   P  GGMIRDSVNH G RT SDGDGIS++
Sbjct  226   RGANVHIEDGAQITLQFVXNVIIHNLHIHDTKPGNGGMIRDSVNHYGQRTRSDGDGISMY  285

Query  1027  GSNHVWLDHLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVT  848
             G+++VW+DH++ S C+DGL+DAI  STAITISNC F +HN V+L G+SD  S+D +MQ+T
Sbjct  286   GASNVWIDHVSGSNCADGLVDAIQGSTAITISNCHFTNHNDVMLFGSSDSNSQDEVMQIT  345

Query  847   VAFNRFGKGLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFT  668
             +AFN FG+GLIQRMPRCRWGFFH+VNNDYT W MYAIGGS  PTI+SQGNRF A SN  +
Sbjct  346   LAFNHFGQGLIQRMPRCRWGFFHVVNNDYTHWIMYAIGGSQHPTIISQGNRFIAPSNNAS  405

Query  667   KQVTKREIVSKNVWKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASY  488
             K+VTKR   ++N WK+W WRSE DL +NGA+FVESG  + +         + I+ +P ++
Sbjct  406   KEVTKRTSGAENEWKSWNWRSENDLMMNGAFFVESGSPIRNL-----PKADMIKAKPGTF  460

Query  487   VGRLTRTSGALKCKVGRFC  431
             V RLTR +G LKC  G+ C
Sbjct  461   VTRLTRFAGPLKCIKGKPC  479



>emb|CDX96854.1| BnaA08g23970D [Brassica napus]
Length=458

 Score =   457 bits (1176),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 238/430 (55%), Positives = 293/430 (68%), Gaps = 14/430 (3%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTI--MNWTNTTRRHL---  1514
             A++A +D Y  ++  +AL+ ++ ++  NP  VTD+ N  V   +      N+TRR L   
Sbjct  29    ANVAVFDNYWLQRQGDALKQTIASFDPNPLNVTDHLNYHVALAVDATESINSTRRELSQV  88

Query  1513  -------RGSHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDS  1355
                    R   C A N IDRCWRC+ DW K+RK+LA C  GFG  TTGG  G  YVV D+
Sbjct  89    RNGRKLKRSGKCVAYNPIDRCWRCNGDWEKNRKKLADCVLGFGRRTTGGKDGPIYVVNDA  148

Query  1354  SDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGA  1175
             SD D+ NPKPGTLRHAV ++ PLWIIF  SM+I L+QELII  DKTIDGRG  V+I  GA
Sbjct  149   SDDDLINPKPGTLRHAVTRDGPLWIIFGSSMIINLQQELIITSDKTIDGRGARVYIMEGA  208

Query  1174  GLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLT  995
             GLT+QFV NVIIH I + H++PK GG+IRDS  HIGLRT+SDGDGIS+FG+ +VW+DH++
Sbjct  209   GLTLQFVNNVIIHNIYVKHVVPKSGGLIRDSEQHIGLRTVSDGDGISLFGATNVWIDHVS  268

Query  994   MSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLI  815
             M+RCSDG+IDAI+ STAITISN  F  H  V+L GA+D    D  MQ+TVAFN FGK L 
Sbjct  269   MTRCSDGMIDAILGSTAITISNSHFTDHEEVMLFGANDKHVIDKKMQITVAFNHFGKRLD  328

Query  814   QRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSK  635
             QRMPRCR+G  H+VNNDYT WEMYAIGG+  PTI+SQGNRF A  N   KQ+TKRE    
Sbjct  329   QRMPRCRFGTIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNEQAKQITKREYTPY  388

Query  634   NVWKNWQWRSEGDLFLNGAYFVESGEE--LHHYnntrfnntnRIRHRPASYVGRLTRTSG  461
               WK W W+SEGD FLNGAYFV+SG++                IR +P + V +LT  +G
Sbjct  389   VDWKMWNWQSEGDYFLNGAYFVQSGKQNAWSPKPVNPVPKKFAIRPQPGTMVRKLTMDAG  448

Query  460   ALKCKVGRFC  431
             AL CK G  C
Sbjct  449   ALGCKPGTPC  458



>ref|XP_006826355.1| hypothetical protein AMTR_s00004p00123190 [Amborella trichopoda]
 gb|ERM93592.1| hypothetical protein AMTR_s00004p00123190 [Amborella trichopoda]
Length=479

 Score =   457 bits (1177),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 239/412 (58%), Positives = 292/412 (71%), Gaps = 9/412 (2%)
 Frame = -1

Query  1660  DAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH--CKATN  1487
             D+ L+ +A ++   +  AY  +PE V+ N    V   + +  +  R+  R  H  C ATN
Sbjct  75    DSVLEARAHQSWLEAQAAYEPDPEAVSRNLTHLVHMELPSGNHMRRQLGRRWHGPCVATN  134

Query  1486  SIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHA  1307
              IDRCWRCDQ W  +RK+LA CA GFG    GG  GR+YVVTD SD D+ NPKPGTLRHA
Sbjct  135   PIDRCWRCDQKWHTNRKKLADCAMGFGQQALGGKYGRYYVVTDPSDNDLLNPKPGTLRHA  194

Query  1306  VIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIK  1127
             VIQ EPLWIIF++ MVI L +EL++N  KT+DGRG +VHIAYGA +TIQ+V+NVIIHG+ 
Sbjct  195   VIQNEPLWIIFQRDMVIKLTEELMVNSFKTVDGRGANVHIAYGACITIQYVKNVIIHGLH  254

Query  1126  IHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMAST  947
             IH      GGMIRDS +H G+RT SDGDGISI+GS +VW+DH T+S+C DGL+DAIM ST
Sbjct  255   IHDCKAGNGGMIRDSEDHFGIRTRSDGDGISIYGSTNVWVDHNTLSKCQDGLVDAIMGST  314

Query  946   AITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNN  767
             AITISN  F+ H+ VLLLG SDL+  D +MQVTVAFN FGKGL QRMPRCR+G+FH+VNN
Sbjct  315   AITISNNHFSKHDEVLLLGGSDLYPMDKVMQVTVAFNHFGKGLSQRMPRCRFGYFHVVNN  374

Query  766   DYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRSEGDLFL  587
             DYT W  YAIGGS  PTI+SQGNRF A  +P+ K++TKR     + W +W W+SEGDLF 
Sbjct  375   DYTHWGKYAIGGSMNPTILSQGNRFVAPLDPYFKEITKRFGPDLD-WGSWNWKSEGDLFK  433

Query  586   NGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             NGA F +SG    +           IR +P SYVG LTR SGALKCK G  C
Sbjct  434   NGAIFTQSGNGRKY------ERKISIRAKPGSYVGILTRFSGALKCKTGTPC  479



>ref|XP_010523445.1| PREDICTED: probable pectate lyase 3 [Tarenaya hassleriana]
Length=464

 Score =   456 bits (1174),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 244/435 (56%), Positives = 293/435 (67%), Gaps = 18/435 (4%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWT---NTTRRHL-  1514
             +A +A +D Y  ++   AL+ +L+ Y  NP  VTD+FN  V   +   T   N TRR L 
Sbjct  30    KAHVAVFDEYWTQRQAHALRQTLRFYDPNPFNVTDHFNHHVNLAVEEATEASNGTRRELW  89

Query  1513  ----RGSH--------CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFY  1370
                  G H        C A N IDRCWRC  +WAK RK+LA C  GFG  TTGG  GR+Y
Sbjct  90    QVGSGGKHLKRRNTGKCVAYNPIDRCWRCQPNWAKDRKKLADCVLGFGRRTTGGKAGRYY  149

Query  1369  VVTDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVH  1190
             VVTD+SD D+ NP+PGTLRHAV ++EPLWI+F++SMVI L QELII  +KTIDGRGV VH
Sbjct  150   VVTDASDTDLINPRPGTLRHAVTRDEPLWIVFERSMVIRLAQELIITSNKTIDGRGVRVH  209

Query  1189  IAYGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVW  1010
             I  GAGLT+QFV NVIIH I I  I+P  GG+IRDS  H GLRT SDGDGI+IFG+ +VW
Sbjct  210   ITGGAGLTVQFVNNVIIHNIYIKDIVPGNGGLIRDSETHFGLRTRSDGDGINIFGATNVW  269

Query  1009  LDHLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRF  830
             +DH++M+ CSDG+IDAI  ST ITISNC    H  V+L GA+D    D  MQ+TVAFN F
Sbjct  270   IDHVSMAHCSDGMIDAIQGSTGITISNCHLTDHGEVMLFGATDKDEIDTKMQITVAFNHF  329

Query  829   GKGLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKR  650
             GK L+QRMPRCR+G  H+VNNDYT WEMYAIGG+  PTI+SQGNRF A  N   KQVTKR
Sbjct  330   GKRLVQRMPRCRYGLIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNEQAKQVTKR  389

Query  649   EIVSKNVWKNWQWRSEGDLFLNGAYFVESGE--ELHHYnntrfnntnRIRHRPASYVGRL  476
             E      WK+W W+SEGD FLNGAYFV+SG              +   IR +P + V +L
Sbjct  390   EYTPYPEWKSWNWQSEGDYFLNGAYFVQSGRANAWSVAPKNPVPSKFAIRPQPGTLVRKL  449

Query  475   TRTSGALKCKVGRFC  431
             T  SG L CK G+ C
Sbjct  450   TMNSGVLGCKKGKPC  464



>emb|CDY68729.1| BnaCnng60280D [Brassica napus]
Length=458

 Score =   456 bits (1173),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 239/430 (56%), Positives = 292/430 (68%), Gaps = 14/430 (3%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTI--MNWTNTTRRHL---  1514
             A++A +D Y  ++  +AL+ ++ ++  NP  VTD+ N  V   +      N+TRR L   
Sbjct  29    ANVAVFDNYWLQRQGDALKQTIASFDPNPLNVTDHLNYHVALAVGATESINSTRRELSQV  88

Query  1513  -------RGSHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDS  1355
                    R   C A N IDRCWRC  DW K+RK+LA C  GFG  TTGG  G  YVV D+
Sbjct  89    RNGRKLKRSGKCVAYNPIDRCWRCHGDWEKNRKKLADCVLGFGRRTTGGKDGPIYVVNDA  148

Query  1354  SDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGA  1175
             SD D+ NPKPGTLRHAV ++ PLWIIF  SM+I L+QELII  DKTIDGRG  V+I  GA
Sbjct  149   SDDDLINPKPGTLRHAVTRDGPLWIIFGSSMIINLQQELIITSDKTIDGRGARVYIMEGA  208

Query  1174  GLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLT  995
             GLT+QFV NVIIH I I H++PK GG+IRDS  HIGLRT+SDGDGIS+FG+ +VW+DH++
Sbjct  209   GLTLQFVNNVIIHNIYIKHVVPKSGGLIRDSEQHIGLRTVSDGDGISLFGATNVWIDHVS  268

Query  994   MSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLI  815
             M+RCSDG+IDAI+ STAITISN  F  H  V+L GA+D    D  MQ+TVAFN FGK L 
Sbjct  269   MTRCSDGMIDAILGSTAITISNSHFTDHEEVMLFGANDKHVIDKKMQITVAFNHFGKRLD  328

Query  814   QRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSK  635
             QRMPRCR+G  H+VNNDYT WEMYAIGG+  PTI+SQGNRF A  N   KQ+TKRE    
Sbjct  329   QRMPRCRFGTIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNEQAKQITKREYTPY  388

Query  634   NVWKNWQWRSEGDLFLNGAYFVESGEE--LHHYnntrfnntnRIRHRPASYVGRLTRTSG  461
               WK W W+SEGD FLNGAYFV+SG++                IR +P + V +LT  +G
Sbjct  389   VDWKMWNWQSEGDYFLNGAYFVQSGKQNAWSPKPVNPVPRKFAIRPQPGTMVRKLTMDAG  448

Query  460   ALKCKVGRFC  431
             AL CK G  C
Sbjct  449   ALGCKPGTPC  458



>gb|KEH24975.1| pectate lyase P59-like protein [Medicago truncatula]
Length=453

 Score =   454 bits (1168),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 232/419 (55%), Positives = 292/419 (70%), Gaps = 9/419 (2%)
 Frame = -1

Query  1669  AEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR------G  1508
             AE D ++K +A+EA + +++ Y   PE V  + N  V  ++    N TRR +R       
Sbjct  38    AEIDDFVKARAEEAHKVAVETYVPIPEGVAHDLNVAVHMSMEAEENNTRREMRQKGKKHD  97

Query  1507  SHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPK  1328
               C+ATN ID CWRC  DWA +R +LA C++GFG  TTGGL G  YVVTD SD DM NPK
Sbjct  98    GPCEATNPIDSCWRCKADWAANRFQLAKCSKGFGRKTTGGLGGPIYVVTDESDNDMVNPK  157

Query  1327  PGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRN  1148
             PGTLR   +Q+ PLWI F +SMVI L QEL+++ DKTIDGRG +V I  GAG+T+QFV N
Sbjct  158   PGTLRFGAVQKGPLWITFARSMVIRLNQELMVSSDKTIDGRGANVQIRDGAGITMQFVNN  217

Query  1147  VIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLI  968
             VIIHG+ I +I  K GG+IRDS +H G RT SDGD ISI+GS+++W+DHL++S C DGL+
Sbjct  218   VIIHGLHIQNIKAKPGGLIRDSFDHTGQRTRSDGDAISIYGSSNIWIDHLSLSECEDGLV  277

Query  967   DAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWG  788
             D I  ST ITISNC    HN V+L GASD ++ D +MQ+TVAFN FG+GLIQRMPRCR+G
Sbjct  278   DIIQGSTGITISNCHMTKHNDVMLFGASDSYTGDKLMQITVAFNHFGQGLIQRMPRCRYG  337

Query  787   FFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWR  608
             F H++NNDYT W MYAIGGSS PTI+SQGNRF A  N   K+VT R+    +VWKNWQW 
Sbjct  338   FVHVLNNDYTHWIMYAIGGSSSPTILSQGNRFIAPDNGAAKEVTHRDYAPPDVWKNWQWS  397

Query  607   SEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             SE D+F+NGA FV SG  ++      F     ++ R  S+V RLTR +GAL C VG+ C
Sbjct  398   SELDVFMNGAKFVPSGAPINR---KPFKKAYMMQPRDGSHVSRLTRNAGALNCVVGKPC  453



>gb|AAM60924.1| putative pectate lyase [Arabidopsis thaliana]
Length=475

 Score =   455 bits (1170),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 240/456 (53%), Positives = 307/456 (67%), Gaps = 42/456 (9%)
 Frame = -1

Query  1681  QADIAE-YDAYLKKKADEALQSSLQAYYHNPEEVTDNFNE--------------------  1565
             +A++AE  D Y   KA+EA + +L AY+ +P E+ D+F+E                    
Sbjct  23    RANVAEETDEYWVNKANEARKHTLMAYHPDPYEIVDHFHERHYDNSTDVEGTEEEKAIAS  82

Query  1564  ---EVGDTIMNWTNTTRRHLRG--------------SHCKATNSIDRCWRCDQDWAKHRK  1436
                +V + I + TN+TRR L G                C A+N ID+CWRC  DWA+ RK
Sbjct  83    EEEDVIEMISSPTNSTRRSLTGRGKGKGKGKWSKLTGPCTASNPIDKCWRCQPDWARRRK  142

Query  1435  RLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVI  1256
             +L  C RGFG  TTGG +GR YVVT   D DM NP+PGTLRHAVIQ+EPLWI+FK  M I
Sbjct  143   KLVHCVRGFGYRTTGGKRGRIYVVTSPRDDDMVNPRPGTLRHAVIQKEPLWIVFKHDMSI  202

Query  1255  TLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVN  1076
              L QEL+I  DKTID RG +VHIAYGAG+T+Q+V N+IIHG+ +HHI+   GG+IRDS+N
Sbjct  203   RLSQELMITSDKTIDARGANVHIAYGAGITMQYVHNIIIHGLHVHHIVKSSGGLIRDSIN  262

Query  1075  HIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLL  896
             H G R  +DGDGISIFG+ ++WLDH++MS+C DGLIDAIM STAITISN  F HHN V+L
Sbjct  263   HFGHRGEADGDGISIFGATNIWLDHISMSKCQDGLIDAIMGSTAITISNSHFTHHNDVML  322

Query  895   LGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPT  716
             LGA +   +D  MQVTVA+N FGKGL+QRMPR RWGF H+VNNDYT WE+YAIGGS  PT
Sbjct  323   LGAQNNNMDDKKMQVTVAYNHFGKGLVQRMPRVRWGFVHVVNNDYTHWELYAIGGSQGPT  382

Query  715   IVSQGNRFKASSNP-FTKQVTKREIVSKNVWKNWQWRSEGDLFLNGAYFVESGEELHHYn  539
             I+S GNRF A  +    ++VTKR+  S++ WKNW WRSE D+F+N AYF +SG     + 
Sbjct  383   ILSHGNRFIAPPHKQHYREVTKRDYASESEWKNWNWRSEKDVFMNNAYFRQSGNP---HF  439

Query  538   ntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
                 +    I+ +    V +LT+ +GAL C+VG+ C
Sbjct  440   KCSHSRQQMIKPKNGMAVSKLTKYAGALDCRVGKAC  475



>ref|NP_186776.1| putative pectate lyase 7 [Arabidopsis thaliana]
 sp|Q9SRH4.1|PLY7_ARATH RecName: Full=Probable pectate lyase 7; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF03499.1|AC010676_9 putative pectate lyase [Arabidopsis thaliana]
 gb|AAF26147.1|AC008261_4 putative pectate lyase [Arabidopsis thaliana]
 gb|ABI93918.1| At3g01270 [Arabidopsis thaliana]
 gb|AEE73631.1| putative pectate lyase 7 [Arabidopsis thaliana]
Length=475

 Score =   454 bits (1169),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 240/456 (53%), Positives = 307/456 (67%), Gaps = 42/456 (9%)
 Frame = -1

Query  1681  QADIA-EYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNE--------------------  1565
             +A++A E D Y   KA+EA + +L AY+ +P E+ D+F+E                    
Sbjct  23    RANVADETDEYWVNKANEARKHTLMAYHPDPYEIVDHFHERHYDNSTDVEGTEEEKAVAS  82

Query  1564  ---EVGDTIMNWTNTTRRHLRG--------------SHCKATNSIDRCWRCDQDWAKHRK  1436
                +V + I + TN+TRR L G                C A+N ID+CWRC  DWA+ RK
Sbjct  83    EEEDVIEMISSPTNSTRRSLTGRGKGKGKGKWSKLTGPCTASNPIDKCWRCQPDWARRRK  142

Query  1435  RLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVI  1256
             +L  C RGFG  TTGG +GR YVVT   D DM NP+PGTLRHAVIQ+EPLWI+FK  M I
Sbjct  143   KLVHCVRGFGYRTTGGKRGRIYVVTSPRDDDMVNPRPGTLRHAVIQKEPLWIVFKHDMSI  202

Query  1255  TLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVN  1076
              L QEL+I  DKTID RG +VHIAYGAG+T+Q+V N+IIHG+ +HHI+   GG+IRDS+N
Sbjct  203   RLSQELMITSDKTIDARGANVHIAYGAGITMQYVHNIIIHGLHVHHIVKSSGGLIRDSIN  262

Query  1075  HIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLL  896
             H G R  +DGDGISIFG+ ++WLDH++MS+C DGLIDAIM STAITISN  F HHN V+L
Sbjct  263   HFGHRGEADGDGISIFGATNIWLDHISMSKCQDGLIDAIMGSTAITISNSHFTHHNDVML  322

Query  895   LGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPT  716
             LGA +   +D  MQVTVA+N FGKGL+QRMPR RWGF H+VNNDYT WE+YAIGGS  PT
Sbjct  323   LGAQNNNMDDKKMQVTVAYNHFGKGLVQRMPRVRWGFVHVVNNDYTHWELYAIGGSQGPT  382

Query  715   IVSQGNRFKASSNP-FTKQVTKREIVSKNVWKNWQWRSEGDLFLNGAYFVESGEELHHYn  539
             I+S GNRF A  +    ++VTKR+  S++ WKNW WRSE D+F+N AYF +SG     + 
Sbjct  383   ILSHGNRFIAPPHKQHYREVTKRDYASESEWKNWNWRSEKDVFMNNAYFRQSGNP---HF  439

Query  538   ntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
                 +    I+ +    V +LT+ +GAL C+VG+ C
Sbjct  440   KCSHSRQQMIKPKNGMAVSKLTKYAGALDCRVGKAC  475



>gb|KFK33456.1| hypothetical protein AALP_AA5G015800 [Arabis alpina]
Length=460

 Score =   454 bits (1168),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 241/433 (56%), Positives = 293/433 (68%), Gaps = 16/433 (4%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFN--EEVGDTIMNWTNTTRRHLR-  1511
             QA IA YD Y  ++  EAL+ +L++Y  +P  VTD+FN    +        N TRR LR 
Sbjct  28    QAHIAVYDEYWTQRQTEALRRTLESYEPDPLNVTDHFNYHSALAMETTEAVNGTRRELRV  87

Query  1510  -----------GSHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVV  1364
                        G   ++ N+ID+CWR D++WAK+RK+LA C  GFG  TTGG  G  Y V
Sbjct  88    VGGGRKTIKKRGGRFQSLNAIDKCWRGDKNWAKNRKKLADCVLGFGRKTTGGKAGPIYEV  147

Query  1363  TDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIA  1184
             TD+SD D+ NP+PGTLRHAV ++ PLWIIF KSMVI L+QELII +DKTIDGRGVSVHI 
Sbjct  148   TDASDNDVMNPRPGTLRHAVTRDRPLWIIFAKSMVIKLQQELIITNDKTIDGRGVSVHIT  207

Query  1183  YGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLD  1004
              GAGLTIQFV+NVIIH I +  I  + GGMIRDS NH GLRT SDGDGI+IFG+ +VW+D
Sbjct  208   GGAGLTIQFVKNVIIHNIHMKFIERRAGGMIRDSENHFGLRTESDGDGINIFGATNVWID  267

Query  1003  HLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGK  824
             H++M  CSDG+IDAIM STAITISNC F  H  V+L GA +    D  MQ+TVAFN FGK
Sbjct  268   HVSMRNCSDGMIDAIMGSTAITISNCHFTDHEEVMLFGAKNGDVIDKKMQITVAFNHFGK  327

Query  823   GLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREI  644
              L QRMPR R+G  H+VNNDYT W+MYAIGG+  PTI+SQGNRF A      KQ+TKRE 
Sbjct  328   RLDQRMPRVRYGMVHVVNNDYTHWQMYAIGGNMNPTIISQGNRFIAPPEEDKKQITKREY  387

Query  643   VSKNVWKNWQWRSEGDLFLNGAYFVESGEE--LHHYnntrfnntnRIRHRPASYVGRLTR  470
                  WK+W W+SE D FLNGAYFV+SG+                 IR +P + V RLT+
Sbjct  388   TPYPEWKSWNWQSERDYFLNGAYFVQSGKSNAWSSTPKNPIPRKFTIRPQPGTKVRRLTK  447

Query  469   TSGALKCKVGRFC  431
              +G L CK G+ C
Sbjct  448   DAGTLGCKPGKSC  460



>ref|XP_010463548.1| PREDICTED: probable pectate lyase 7 [Camelina sativa]
Length=473

 Score =   454 bits (1169),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 239/454 (53%), Positives = 302/454 (67%), Gaps = 40/454 (9%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNF-----------------------  1571
             +A++AE D Y   KA+EA + +L AY+ +P ++ D+F                       
Sbjct  23    RANVAETDEYWVNKANEARKHTLMAYHPDPYDIVDHFHERHYDNSTDVEGTEEDKAVDSA  82

Query  1570  -NEEVGDTIMNWTNTTRRHLRGSH------------CKATNSIDRCWRCDQDWAKHRKRL  1430
              +E+V +   + TN+TRR L G              C A+N ID+CWRC  DWA+ RKRL
Sbjct  83    EDEDVIEMTSSPTNSTRRSLSGKRRGRGKWSKLKGPCTASNPIDKCWRCQPDWARRRKRL  142

Query  1429  AFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITL  1250
               C RGFG  TTGG +GR YVVT   D D  NP+PGTLRHAVIQ+EPLWIIFK  M I L
Sbjct  143   VRCVRGFGYRTTGGKRGRIYVVTSPRDDDTVNPRPGTLRHAVIQKEPLWIIFKHDMSIRL  202

Query  1249  KQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHI  1070
              QEL+I   KTID RG +VHIAYGAG+T+Q+V+N+IIHG+ +HHI+   GG+IRDS++H 
Sbjct  203   SQELMIASHKTIDARGANVHIAYGAGITMQYVKNIIIHGLHVHHIVTSSGGLIRDSIDHF  262

Query  1069  GLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLG  890
             G R  +DGDGISIFG+  +WLDH++MS+C DGLIDAIM STAITISN  F HHN V+LLG
Sbjct  263   GQRGQADGDGISIFGATDIWLDHISMSKCQDGLIDAIMGSTAITISNSHFTHHNDVMLLG  322

Query  889   ASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIV  710
             A D   +D  MQVTVA+N FGKGL+QRMPR RWGF H+VNNDYT WE+YAIGGS  PTI+
Sbjct  323   AQDHNQDDKKMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTIL  382

Query  709   SQGNRFKASSNP-FTKQVTKREIVSKNVWKNWQWRSEGDLFLNGAYFVESGEELHHYnnt  533
             S GNRF A  +    ++VTKR+   +  WKNW WRSE D FLNGAYF +SG     +   
Sbjct  383   SHGNRFIAPPHKQHYREVTKRDYAPEAEWKNWNWRSEKDYFLNGAYFRQSGNP---HFKC  439

Query  532   rfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
               +    I+ +    V +LT+ +GAL C+VG+ C
Sbjct  440   SHSRQQMIKPKHGVAVSKLTKYAGALDCRVGKAC  473



>ref|XP_006480843.1| PREDICTED: probable pectate lyase 19-like [Citrus sinensis]
Length=436

 Score =   453 bits (1165),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 244/419 (58%), Positives = 303/419 (72%), Gaps = 8/419 (2%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHL---RG  1508
             A+I+E D   +++A+EA+Q++ Q Y  NP  +  + N +V D  ++     RR L     
Sbjct  23    ANISEVDEVWRRRAEEAMQTTEQYYDPNPVAIASHLNMKVQD--LSKQTAARRGLLNAES  80

Query  1507  SHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPK  1328
               C+ATN ID CWRC ++WA++R+ LA CA GFG   TGG  G+ Y VTD SD DMENPK
Sbjct  81    GQCEATNPIDNCWRCKENWAENRQALAGCALGFGIKATGGKGGKIYEVTDPSDNDMENPK  140

Query  1327  PGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRN  1148
              GTLRHAVIQ+EPLWIIF K M I L+QELI+   KTIDGRG +VHIA GAG  +QFV+N
Sbjct  141   VGTLRHAVIQKEPLWIIFAKDMNIKLQQELIVQGKKTIDGRGANVHIANGAGFMLQFVQN  200

Query  1147  VIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLI  968
             VIIHGI IH+I P+ GGMIRDSV+H+G R  SDGD +SIFGS+++WLDHLT+S+  DGLI
Sbjct  201   VIIHGIHIHNISPRSGGMIRDSVDHVGKRGQSDGDAVSIFGSSNIWLDHLTLSQAHDGLI  260

Query  967   DAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWG  788
             DAI ASTAITISNC F++H+  +LLGASD F+ED  MQVTVAFNRF KGL+QRMP  R+G
Sbjct  261   DAIQASTAITISNCHFSNHDKAILLGASDTFTEDKKMQVTVAFNRFDKGLVQRMPCVRFG  320

Query  787   FFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWR  608
             F H+VNNDY +WEMYAIGG   PTI+SQGNRF AS N  TK+VTKR   S    KNW WR
Sbjct  321   FAHVVNNDYNQWEMYAIGGLKGPTILSQGNRFFASDNQNTKEVTKRMNCSPEEGKNWIWR  380

Query  607   SEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             SEGD+FLNGAYF  SG+         +   + I+ +P + V R+T+ +GAL CK G+ C
Sbjct  381   SEGDVFLNGAYFNSSGDPKKQI---EYQMDDVIKPKPGTEVERITKFAGALVCKPGQKC  436



>ref|XP_010435229.1| PREDICTED: probable pectate lyase 15 [Camelina sativa]
Length=461

 Score =   454 bits (1167),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 227/389 (58%), Positives = 281/389 (72%), Gaps = 6/389 (2%)
 Frame = -1

Query  1597  NPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSHCKATNSIDRCWRCDQDWAKHRKRLAFCA  1418
             +PE+V D   + V  +  N   T RR L    C   N ID CWRCD +W K+RKRLA C 
Sbjct  79    DPEKVADEVAKLVQMSEQN--RTARRKLGFFSCGTGNPIDDCWRCDPNWHKNRKRLADCG  136

Query  1417  rgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQEL  1238
              GFG    GG  GRFYVVTD +D+D+ NPKPGTLRHAVIQEEPLWI+FK+ MVI LKQEL
Sbjct  137   IGFGRNAIGGRDGRFYVVTDPTDEDVVNPKPGTLRHAVIQEEPLWIVFKRDMVIELKQEL  196

Query  1237  IINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRT  1058
             I+N  KTIDGRG +VHIA GA +TIQF+ NVIIHG+ IH   P    M+R S +H G RT
Sbjct  197   IMNSFKTIDGRGANVHIANGACITIQFITNVIIHGLHIHDCKPTGNAMVRSSPSHFGWRT  256

Query  1057  MSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDL  878
             M+DGD +SIFGS+H+W+DH ++S C+DGL+DA+M STAIT+SN  F HHN V+LLG SD 
Sbjct  257   MADGDAVSIFGSSHIWIDHNSLSHCADGLVDAVMGSTAITVSNNHFTHHNEVMLLGHSDS  316

Query  877   FSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGN  698
             +++D +MQVT+A+N FG+GL+QRMPRCR G+FH+VNNDYT WEMYAIGGS+ PTI SQGN
Sbjct  317   YTKDKLMQVTIAYNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQGN  376

Query  697   RFKASSNPFTKQVTKREIVSKNVWKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnnt  518
             R+ A  + F K+VTKR     + WK W WRSEGDL LNGAYF  SGEE     +  +   
Sbjct  377   RYAAPMDRFAKEVTKRVETDASEWKKWNWRSEGDLLLNGAYFRSSGEE----ASASYGRA  432

Query  517   nRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             + +  +P+S V  +T T+GAL C+ GR C
Sbjct  433   SSLAAKPSSMVDTITSTAGALGCRKGRPC  461



>ref|XP_010440536.1| PREDICTED: probable pectate lyase 15 isoform X2 [Camelina sativa]
Length=462

 Score =   454 bits (1167),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 228/393 (58%), Positives = 282/393 (72%), Gaps = 6/393 (2%)
 Frame = -1

Query  1609  AYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSHCKATNSIDRCWRCDQDWAKHRKRL  1430
             A   +PE+V D   + V  +  N   T RR L    C   N ID CWRCD +W K+RKRL
Sbjct  76    AVAADPEKVADEVAKLVQMSEQN--RTARRKLGFFSCGTGNPIDDCWRCDPNWHKNRKRL  133

Query  1429  AFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITL  1250
             A C  GFG    GG  GRFYVVTD +D+D+ NPKPGTLRHAVIQEEPLWI+FK+ MVI L
Sbjct  134   ADCGIGFGRNAIGGRDGRFYVVTDPTDEDVVNPKPGTLRHAVIQEEPLWIVFKRDMVIEL  193

Query  1249  KQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHI  1070
             KQELI+N  KTIDGRG +VHIA GA +TIQF+ NVIIHG+ IH   P    M+R S +H 
Sbjct  194   KQELIMNSFKTIDGRGANVHIANGACITIQFITNVIIHGLHIHDCKPTGNAMVRSSPSHF  253

Query  1069  GLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLG  890
             G RTM+DGD +SIFGS+H+W+DH ++S C+DGL+DA+M STAIT+SN  F HHN V+LLG
Sbjct  254   GWRTMADGDAVSIFGSSHIWIDHNSLSHCADGLVDAVMGSTAITVSNNHFTHHNEVMLLG  313

Query  889   ASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIV  710
              SD +++D +MQVT+A+N FG+GL+QRMPRCR G+FH+VNNDYT WEMYAIGGS+ PTI 
Sbjct  314   HSDSYTKDKLMQVTIAYNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTIN  373

Query  709   SQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRSEGDLFLNGAYFVESGEELHHYnntr  530
             SQGNR+ A  + F K+VTKR     + WK W WRSEGDL LNGAYF  SGEE     +  
Sbjct  374   SQGNRYAAPMDRFAKEVTKRVETDASEWKKWNWRSEGDLLLNGAYFRSSGEE----ASAS  429

Query  529   fnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             +   + +  +P+S V  +T T+GAL C+ GR C
Sbjct  430   YGRASSLAAKPSSMVDTITSTAGALGCRKGRPC  462



>gb|AAX88800.1| ripening-related pectate lyase [Mangifera indica]
Length=437

 Score =   452 bits (1164),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 235/403 (58%), Positives = 286/403 (71%), Gaps = 10/403 (2%)
 Frame = -1

Query  1639  ADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSHCKATNSIDRCWRCD  1460
             AD +  S  Q    NPEEV    +  + ++      T RR L    C+  N ID CWRCD
Sbjct  45    ADSSDDSWSQHAVDNPEEVAAMVDISIRNS------TERRRLGYFSCETGNPIDDCWRCD  98

Query  1459  QDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHAVIQEEPLWI  1280
               W  HRK LA CA GFG    GG  G+FYVV+DSSD +  +PKPGTLRHAVIQ+ PLWI
Sbjct  99    PKWHLHRKHLADCAIGFGRNAIGGRDGKFYVVSDSSDDNPVDPKPGTLRHAVIQDRPLWI  158

Query  1279  IFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIKIHHILPKMG  1100
             +FK+ M ITLKQELI+N  KTIDGRGV+VHIA GA +TIQ++ NVIIHGI IH   P   
Sbjct  159   VFKQDMAITLKQELIMNSFKTIDGRGVNVHIANGACITIQYITNVIIHGIHIHDCKPTGN  218

Query  1099  GMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMASTAITISNCKF  920
              M+R S +H G RTM+DGDGISIFG++H+W+DH ++S C+DGLIDAIMASTAITISN  F
Sbjct  219   AMVRSSPSHYGWRTMADGDGISIFGASHIWIDHNSLSNCADGLIDAIMASTAITISNNYF  278

Query  919   NHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNNDYTKWEMYA  740
              HHN V+LLG SD ++ D  MQVT+A+N FG+GLIQRMPRCR G+FH+VNNDYT WEM+A
Sbjct  279   THHNEVMLLGHSDSYTRDKQMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMFA  338

Query  739   IGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRSEGDLFLNGAYFVESG  560
             IGGS+ PTI SQGNR+ A SNPF K+VTKR   S  VWK+W WRSEGDL LNGAYF+ SG
Sbjct  339   IGGSADPTINSQGNRYLAPSNPFAKEVTKRVDTSDGVWKSWNWRSEGDLLLNGAYFISSG  398

Query  559   EELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
                       +   + +  + +S VG LT ++GA+ C+VGR C
Sbjct  399   ARS----AASYARASSLGAKSSSLVGALTSSAGAMSCRVGRQC  437



>ref|XP_010440534.1| PREDICTED: probable pectate lyase 15 isoform X1 [Camelina sativa]
Length=466

 Score =   453 bits (1166),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 228/393 (58%), Positives = 282/393 (72%), Gaps = 6/393 (2%)
 Frame = -1

Query  1609  AYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSHCKATNSIDRCWRCDQDWAKHRKRL  1430
             A   +PE+V D   + V  +  N   T RR L    C   N ID CWRCD +W K+RKRL
Sbjct  80    AVAADPEKVADEVAKLVQMSEQN--RTARRKLGFFSCGTGNPIDDCWRCDPNWHKNRKRL  137

Query  1429  AFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITL  1250
             A C  GFG    GG  GRFYVVTD +D+D+ NPKPGTLRHAVIQEEPLWI+FK+ MVI L
Sbjct  138   ADCGIGFGRNAIGGRDGRFYVVTDPTDEDVVNPKPGTLRHAVIQEEPLWIVFKRDMVIEL  197

Query  1249  KQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHI  1070
             KQELI+N  KTIDGRG +VHIA GA +TIQF+ NVIIHG+ IH   P    M+R S +H 
Sbjct  198   KQELIMNSFKTIDGRGANVHIANGACITIQFITNVIIHGLHIHDCKPTGNAMVRSSPSHF  257

Query  1069  GLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLG  890
             G RTM+DGD +SIFGS+H+W+DH ++S C+DGL+DA+M STAIT+SN  F HHN V+LLG
Sbjct  258   GWRTMADGDAVSIFGSSHIWIDHNSLSHCADGLVDAVMGSTAITVSNNHFTHHNEVMLLG  317

Query  889   ASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIV  710
              SD +++D +MQVT+A+N FG+GL+QRMPRCR G+FH+VNNDYT WEMYAIGGS+ PTI 
Sbjct  318   HSDSYTKDKLMQVTIAYNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTIN  377

Query  709   SQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRSEGDLFLNGAYFVESGEELHHYnntr  530
             SQGNR+ A  + F K+VTKR     + WK W WRSEGDL LNGAYF  SGEE     +  
Sbjct  378   SQGNRYAAPMDRFAKEVTKRVETDASEWKKWNWRSEGDLLLNGAYFRSSGEE----ASAS  433

Query  529   fnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             +   + +  +P+S V  +T T+GAL C+ GR C
Sbjct  434   YGRASSLAAKPSSMVDTITSTAGALGCRKGRPC  466



>ref|XP_010485518.1| PREDICTED: probable pectate lyase 7 [Camelina sativa]
Length=473

 Score =   454 bits (1167),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 239/454 (53%), Positives = 302/454 (67%), Gaps = 40/454 (9%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNF-----------------------  1571
             +A++AE D Y   KA+EA + +L AY+ +P ++ D+F                       
Sbjct  23    RANVAETDEYWVNKANEARKHTLMAYHPDPYDIVDHFHERHYDNSTDVEGTEEDTAVDSA  82

Query  1570  -NEEVGDTIMNWTNTTRRHLRGSH------------CKATNSIDRCWRCDQDWAKHRKRL  1430
              +E+V +   + TN+TRR L G              C A+N ID+CWRC  DWAK RKRL
Sbjct  83    EDEDVIEMTSSPTNSTRRSLSGKRRGRGKWSKLKGPCTASNPIDKCWRCQPDWAKRRKRL  142

Query  1429  AFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITL  1250
               C RGFG  TTGG +GR YVVT   D D  NP+PGTLRHAVIQ+EPLWIIFK  M I L
Sbjct  143   VRCVRGFGYRTTGGKRGRIYVVTSPRDDDTVNPRPGTLRHAVIQKEPLWIIFKHDMSIRL  202

Query  1249  KQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHI  1070
              QEL+I   KTID RG +VHIAYGAG+T+Q+V N+IIHG+ +HHI+   GG+IRDS++H 
Sbjct  203   SQELMIASHKTIDARGANVHIAYGAGITMQYVHNIIIHGLHVHHIVTSSGGLIRDSIDHF  262

Query  1069  GLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLG  890
             G R  +DGDGISIFG+ ++WLDH++MS+C DGLIDAIM STAITISN  F HHN V+LLG
Sbjct  263   GQRGQADGDGISIFGATNIWLDHISMSKCQDGLIDAIMGSTAITISNSHFTHHNDVMLLG  322

Query  889   ASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIV  710
             A D   +D  MQVTVA+N FGKGL+QRMPR RWGF H+VNNDYT WE+YAIGGS  PTI+
Sbjct  323   AQDHNQDDKKMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTIL  382

Query  709   SQGNRFKASSNP-FTKQVTKREIVSKNVWKNWQWRSEGDLFLNGAYFVESGEELHHYnnt  533
             S GNRF A  +    ++VTKR+   +  WKNW WRS+ D FLNGAYF +SG     +   
Sbjct  383   SHGNRFIAPPHKQHYREVTKRDYAPEAEWKNWNWRSDKDYFLNGAYFRQSGNP---HFKC  439

Query  532   rfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
               +    I+ +    V +LT+ +GAL C+VG+ C
Sbjct  440   SHSRQQMIKPKHGVAVSKLTKYAGALDCRVGKAC  473



>ref|XP_010532807.1| PREDICTED: probable pectate lyase 15 [Tarenaya hassleriana]
Length=452

 Score =   452 bits (1164),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 229/389 (59%), Positives = 278/389 (71%), Gaps = 6/389 (2%)
 Frame = -1

Query  1597  NPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSHCKATNSIDRCWRCDQDWAKHRKRLAFCA  1418
             +P++V D     V   I    NT RR L    C   N ID CWRCD  W K+RKRLA C 
Sbjct  70    DPDKVADEVAALV--EISEQNNTARRKLGYFSCGTGNPIDDCWRCDTKWHKNRKRLADCG  127

Query  1417  rgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQEL  1238
              GFG    GG  GRFYVVTD SD D+ NPKPGTLRHAVIQEEPLWI+FK+ MVI LKQEL
Sbjct  128   IGFGRNAIGGRDGRFYVVTDPSDDDVVNPKPGTLRHAVIQEEPLWIVFKRDMVIQLKQEL  187

Query  1237  IINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRT  1058
             I+N  KTIDGRGV+VHIA GA +TIQF+ NVIIHG+ IH   P    M+R S  H G RT
Sbjct  188   IMNSFKTIDGRGVNVHIANGACITIQFITNVIIHGLHIHDCKPTGNAMVRSSPTHYGWRT  247

Query  1057  MSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDL  878
             ++DGD ISIFGS+H+W+DH ++S C+DGL+DA+M STAITISN  F HHN V+LLG SD 
Sbjct  248   IADGDAISIFGSSHIWVDHNSLSNCADGLVDAVMGSTAITISNNHFTHHNEVMLLGHSDS  307

Query  877   FSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGN  698
             +++D  MQVT+A+N FG+GL+QRMPRCR G+FH+VNNDYT WEMYAIGGS+ PTI SQGN
Sbjct  308   YTKDKQMQVTIAYNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGN  367

Query  697   RFKASSNPFTKQVTKREIVSKNVWKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnnt  518
             R+ A  NPF K+VTKR    +  WK+W WRSEGDL LNGA+F+ SG       +  +   
Sbjct  368   RYNAPKNPFAKEVTKRVETDEGKWKSWNWRSEGDLLLNGAFFMASGTG----ASGSYARA  423

Query  517   nRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             + +  +P+S VG +T  +GAL C+ GR C
Sbjct  424   SSLAAKPSSMVGTITSAAGALGCRRGRAC  452



>ref|XP_010513594.1| PREDICTED: probable pectate lyase 7 [Camelina sativa]
Length=473

 Score =   453 bits (1166),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 239/453 (53%), Positives = 301/453 (66%), Gaps = 40/453 (9%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNF------------------------  1571
             A++AE D Y   KA+EA + +L AY+ +P ++ D+F                        
Sbjct  24    ANVAETDEYWVNKANEARKHTLMAYHPDPYDIVDHFHERHYDNSTDVEGTEEDKAVDSTE  83

Query  1570  NEEVGDTIMNWTNTTRRHLRGSH------------CKATNSIDRCWRCDQDWAKHRKRLA  1427
             +E+V +   + TN+TRR L G              C A+N ID+CWRC  DWA+ RKRL 
Sbjct  84    DEDVIEMTSSPTNSTRRSLSGKRRGRGKWSKLKGPCTASNPIDKCWRCQPDWARRRKRLV  143

Query  1426  FCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLK  1247
              C RGFG  TTGG +GR YVVT   D D  NP+PGTLRHAVIQ+EPLWIIFK  M I L 
Sbjct  144   RCVRGFGYRTTGGKRGRIYVVTSPRDDDTVNPRPGTLRHAVIQKEPLWIIFKHDMSIRLS  203

Query  1246  QELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIG  1067
             QEL+I   KTID RG +VHIAYGAG+T+Q+V N+IIHG+ +HHI+   GG+IRDS++H G
Sbjct  204   QELMIASHKTIDARGANVHIAYGAGITMQYVHNIIIHGLHVHHIVSSSGGLIRDSIDHFG  263

Query  1066  LRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGA  887
              R  +DGDGISIFG+ ++WLDH++MS+C DGLIDAIM STAITISN  F HHN V+LLGA
Sbjct  264   QRGQADGDGISIFGATNIWLDHISMSKCQDGLIDAIMGSTAITISNSHFTHHNDVMLLGA  323

Query  886   SDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVS  707
              D   +D  MQVTVA+N FGKGL+QRMPR RWGF H+VNNDYT WE+YAIGGS  PTI+S
Sbjct  324   QDHNQDDKKMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILS  383

Query  706   QGNRFKASSNP-FTKQVTKREIVSKNVWKNWQWRSEGDLFLNGAYFVESGEELHHYnntr  530
              GNRF A  +    ++VTKR+   +  WKNW WRSE D FLNGAYF +SG     +    
Sbjct  384   HGNRFIAPPHKQHYREVTKRDYAPEAEWKNWNWRSEKDYFLNGAYFRQSGNP---HFKCS  440

Query  529   fnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
              +    I+ +    V +LT+ +GAL C+VG+ C
Sbjct  441   HSRQQMIKPKHGVAVSKLTKYAGALDCRVGKAC  473



>ref|XP_010514040.1| PREDICTED: probable pectate lyase 6 [Camelina sativa]
Length=453

 Score =   452 bits (1164),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 238/429 (55%), Positives = 291/429 (68%), Gaps = 13/429 (3%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTI--MNWTNTTRRHLR--  1511
             A +AEYD Y  ++  EAL  +L++Y   P  VTD+FN      +      N TRR LR  
Sbjct  25    AHVAEYDEYWTQRQTEALHQTLESYDPEPLNVTDHFNYHAALAMETTGIANETRRDLRQV  84

Query  1510  -------GSHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSS  1352
                    G   ++ N+ID+CWR D++W K+RK+LA C  GFG  TTGG  G  YVVTD S
Sbjct  85    KSGKKRRGGRYESLNAIDKCWRGDKNWDKNRKKLADCVLGFGRKTTGGKNGPIYVVTDPS  144

Query  1351  DKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAG  1172
             D D+ NPKPGTLRHAV ++ PLWIIF + M+I L+QELII +DKTIDGRGVSV+I  GAG
Sbjct  145   DNDLLNPKPGTLRHAVTRDRPLWIIFARHMIIKLQQELIITNDKTIDGRGVSVYITGGAG  204

Query  1171  LTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTM  992
             LT+Q+VRNVIIH I I  I    GG+IRDS +H GLRTMSDGDGISIFG+ ++W+DH++M
Sbjct  205   LTLQYVRNVIIHNIYIKQIKKGPGGLIRDSEHHFGLRTMSDGDGISIFGATNIWIDHVSM  264

Query  991   SRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQ  812
             + CSDG+IDAIM STAITISN  F  H+ V+L G  +    D  MQ+TVAFN FGK L Q
Sbjct  265   TDCSDGMIDAIMGSTAITISNSHFTDHDEVMLFGGKNTDVIDKKMQITVAFNHFGKRLKQ  324

Query  811   RMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKN  632
             RMPR R+G  H+VNNDYT WEMYAIGG+  PTI+SQGNRF A  N  +KQVTKRE     
Sbjct  325   RMPRARYGLVHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNEDSKQVTKREYTPYP  384

Query  631   VWKNWQWRSEGDLFLNGAYFVESGE--ELHHYnntrfnntnRIRHRPASYVGRLTRTSGA  458
              WK W W+SE D FLNGAYFV+SG+                 IR +P + V RLT+ +GA
Sbjct  385   EWKTWNWQSEKDYFLNGAYFVQSGKANAWSTAPKNPIPRKFAIRPQPGTKVRRLTKDAGA  444

Query  457   LKCKVGRFC  431
             L CK G+ C
Sbjct  445   LGCKAGKSC  453



>ref|XP_002892805.1| hypothetical protein ARALYDRAFT_471616 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69064.1| hypothetical protein ARALYDRAFT_471616 [Arabidopsis lyrata subsp. 
lyrata]
Length=459

 Score =   452 bits (1164),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 234/432 (54%), Positives = 295/432 (68%), Gaps = 15/432 (3%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTI--MNWTNTTRRHL--  1514
             +A++A +D+Y  ++  +AL+ ++ +Y  NP  VT++FN  V   +      N TRR L  
Sbjct  28    RANVAVFDSYWTQRQSDALKQTMGSYDPNPINVTNHFNYHVNIAVDVSESNNDTRRELTQ  87

Query  1513  ---------RGSHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVT  1361
                          C A N ID+CWRCD++WAK+RK+LA C  GFG  TTGG  G  YVV 
Sbjct  88    VRSGRKTKKHSGKCLAYNPIDKCWRCDRNWAKNRKKLADCVLGFGRRTTGGKDGPIYVVK  147

Query  1360  DSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAY  1181
             D+SD D+ NPKPGTLRHAV +  PLWIIF +SM+I L+QEL+I  DKTIDGRG  V+I  
Sbjct  148   DASDDDLINPKPGTLRHAVTRNGPLWIIFARSMIIKLQQELMITSDKTIDGRGARVYIME  207

Query  1180  GAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDH  1001
             GAGLT+Q+V NVIIH I + HI+P  GG+IRDS +HIGLRT SDGDGIS+FG+ ++W+DH
Sbjct  208   GAGLTLQYVNNVIIHNIYVKHIVPGNGGLIRDSEDHIGLRTKSDGDGISLFGATNIWIDH  267

Query  1000  LTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKG  821
             ++M+RC+DG+IDAI  STA+TISN  F  H  V+L GA D    D  MQ+TVAFN FGK 
Sbjct  268   VSMTRCADGMIDAIDGSTAVTISNSHFTDHQEVMLFGARDEHVIDKKMQITVAFNHFGKR  327

Query  820   LIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIV  641
             L QRMPRCR+G  H+VNNDYT WEMYAIGG+  PTI+SQGNRF A  N   KQ+TKRE  
Sbjct  328   LEQRMPRCRYGTIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNEQAKQITKREYT  387

Query  640   SKNVWKNWQWRSEGDLFLNGAYFVESGE--ELHHYnntrfnntnRIRHRPASYVGRLTRT  467
                 WK+W W+SEGD FLNGAYFV+SG+             N   IR +P + V +LT  
Sbjct  388   PYTEWKSWNWQSEGDYFLNGAYFVQSGKANAWSSKPKNPLPNKFAIRPKPGTMVRKLTMD  447

Query  466   SGALKCKVGRFC  431
             +GAL CK G+ C
Sbjct  448   AGALGCKQGKAC  459



>ref|XP_006428983.1| hypothetical protein CICLE_v10013750mg [Citrus clementina]
 gb|ESR42223.1| hypothetical protein CICLE_v10013750mg [Citrus clementina]
Length=438

 Score =   451 bits (1160),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 243/419 (58%), Positives = 303/419 (72%), Gaps = 8/419 (2%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHL---RG  1508
             A+I+E D   +++A+EA+Q++ Q Y  NP  +  + N +V D  ++     RR L     
Sbjct  25    ANISEVDEVWRRRAEEAMQTTEQYYDPNPVAIASHLNMKVQD--LSKQTAARRGLLNAES  82

Query  1507  SHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPK  1328
               C+ATN ID CWRC ++WA++R+ LA CA GFG   TGG  G+ Y VTD SD DMENPK
Sbjct  83    GQCEATNPIDNCWRCKENWAENRQALAGCALGFGIKATGGKGGKIYEVTDPSDNDMENPK  142

Query  1327  PGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRN  1148
              GTLRHAVIQ+EPLWIIF K M I L+QELI+   KTIDGRG +VHIA GAG  +QFV+N
Sbjct  143   VGTLRHAVIQKEPLWIIFAKDMNIKLQQELIVQGKKTIDGRGANVHIANGAGFMLQFVQN  202

Query  1147  VIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLI  968
             VIIHGI IH+I P+ GGMIRDSV+H+G R  SDGD +SIFGS+++WLDHLT+S+  DGLI
Sbjct  203   VIIHGIHIHNISPRSGGMIRDSVDHVGKRGQSDGDAVSIFGSSNIWLDHLTLSQAHDGLI  262

Query  967   DAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWG  788
             DAI ASTAITISNC F++H+  +LLGASD F+ED  MQVTVAFNRF KGL+QRMP  R+G
Sbjct  263   DAIQASTAITISNCHFSNHDKAILLGASDTFTEDKKMQVTVAFNRFDKGLVQRMPCVRFG  322

Query  787   FFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWR  608
             F H+VNNDY +WEMYAIGG   PTI+SQGNRF AS N  TK+VTKR   S    K+W WR
Sbjct  323   FAHVVNNDYNQWEMYAIGGLKGPTILSQGNRFFASDNQNTKEVTKRMNCSPEEGKSWIWR  382

Query  607   SEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             SEGD+FLNGAYF  SG+         +   + I+ +P + V R+T+ +GAL CK G+ C
Sbjct  383   SEGDVFLNGAYFNSSGDPKKQI---EYQMDDVIKPKPGTEVERITKFAGALVCKPGQKC  438



>ref|XP_009126031.1| PREDICTED: probable pectate lyase 19 [Brassica rapa]
Length=481

 Score =   452 bits (1164),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 248/466 (53%), Positives = 310/466 (67%), Gaps = 56/466 (12%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNE---------------------  1565
             +A+++E D Y  K+A EA + +LQAY+ NP EV D+F+E                     
Sbjct  23    RANLSELDEYWSKRAGEAREFTLQAYHSNPYEVVDHFHERHYDNSTDVKETEEDSDDEKP  82

Query  1564  -EVGDTIM----NWTNTTRR-------------------HLRGSHCKATNSIDRCWRCDQ  1457
              EV D ++    N  N+TRR                    L+G  C A+N ID+CWRC  
Sbjct  83    EEVEDDVIEMVGNEMNSTRRILRGKPKGKGKGKRKGKWSKLKGP-CTASNPIDKCWRCRS  141

Query  1456  DWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHAVIQEEPLWII  1277
             +WAK RK L  C RGFG  T GG +GR YVVT + D+DM NPKPGTLRHAVIQ+EPLWII
Sbjct  142   NWAKRRKNLVKCVRGFGHSTIGGKRGRIYVVTSNLDEDMVNPKPGTLRHAVIQKEPLWII  201

Query  1276  FKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIKIHHILPKMGG  1097
             FK  M I L QEL+I   KTID RG  VHIA+GAG+TIQFVR+VIIHG++IHHI    GG
Sbjct  202   FKNDMHIRLSQELMICSFKTIDARGADVHIAHGAGITIQFVRHVIIHGLRIHHICQSNGG  261

Query  1096  MIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMASTAITISNCKFN  917
             MIRDS +H G+RT +DGDGISI+GS+ +WLDH++MS+C DGLIDAI+ STAITISN  F 
Sbjct  262   MIRDSTDHFGMRTKADGDGISIYGSSMIWLDHISMSKCQDGLIDAIVGSTAITISNSHFT  321

Query  916   HHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNNDYTKWEMYAI  737
             HHN V+LLGA +    D  MQVTVA+N FGKGL+QRMPR RWGF H+VNNDYT WE+YAI
Sbjct  322   HHNDVMLLGAQNDNQGDKKMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAI  381

Query  736   GGSSRPTIVSQGNRFKASSN-PFTKQVTKREIVSKNVWKNWQWRSEGDLFLNGAYFVESG  560
             GGS  PTI+S GNRF A  + P  ++VTKR+  S++ WK+W WRS+ D+F+NGAYF +SG
Sbjct  382   GGSQAPTILSHGNRFIAPPHKPHYREVTKRDYASEHEWKHWNWRSDKDMFMNGAYFRQSG  441

Query  559   E---ELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
                 + HH           I+ +    V  LT+ +GAL C+VG+ C
Sbjct  442   NPHFKCHH------TRKQMIKPKHGIAVSMLTKYAGALDCRVGKRC  481



>ref|XP_010106682.1| hypothetical protein L484_004616 [Morus notabilis]
 gb|EXC11270.1| hypothetical protein L484_004616 [Morus notabilis]
Length=397

 Score =   449 bits (1155),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 235/402 (58%), Positives = 281/402 (70%), Gaps = 13/402 (3%)
 Frame = -1

Query  1636  DEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSHCKATNSIDRCWRCDQ  1457
             DE L    +    +PEEV      E+ ++      T RR L    C   N ID CWRCD 
Sbjct  9     DEGLN---EHAVEDPEEVASMVEMEITNS------TERRKLGFFSCATGNPIDDCWRCDP  59

Query  1456  DWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHAVIQEEPLWII  1277
             +W K+RKRLA C  GFG    GG  GRFYVVTD  D D  NPKPGTLRHAVIQEEPLWI+
Sbjct  60    NWHKNRKRLADCGIGFGRNAIGGRDGRFYVVTDPRDDDPVNPKPGTLRHAVIQEEPLWIV  119

Query  1276  FKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIKIHHILPKMGG  1097
             FK+ MVI LKQELI+N  KTIDGRGV+VHIA GA +TIQF+ NVIIHG+ IH   P    
Sbjct  120   FKRDMVIQLKQELIMNSFKTIDGRGVNVHIANGACITIQFITNVIIHGLHIHDCKPTGNA  179

Query  1096  MIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMASTAITISNCKFN  917
             M+R S +H G RTMSDGD ISIFGS+H+W+DH ++S C+DGL+DA+M STAITISN  F 
Sbjct  180   MVRSSPSHFGWRTMSDGDAISIFGSSHIWVDHNSLSNCADGLVDAVMGSTAITISNNHFT  239

Query  916   HHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNNDYTKWEMYAI  737
             HHN V+LLG SD ++ D +MQVT+A+N FG+GLIQRMPRCR G+FH+VNNDYT WEMYAI
Sbjct  240   HHNEVMLLGHSDSYTRDKLMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAI  299

Query  736   GGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRSEGDLFLNGAYFVESGE  557
             GGS+ PTI SQGNR+ A +N F K+VTKR   S  VWKNW WRSEGDL +NGAYF  SG 
Sbjct  300   GGSANPTINSQGNRYAAPNNRFAKEVTKRVDTSTGVWKNWNWRSEGDLLVNGAYFTPSGA  359

Query  556   ELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
                   +  +   + +  + +S VG +T TSGAL C+ G  C
Sbjct  360   GA----SASYARASSLGAKSSSMVGAITATSGALGCRRGHQC  397



>ref|XP_009117903.1| PREDICTED: probable pectate lyase 3 [Brassica rapa]
Length=452

 Score =   451 bits (1160),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 233/428 (54%), Positives = 290/428 (68%), Gaps = 11/428 (3%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTI--MNWTNTTRRHLRG  1508
             Q+++A +D Y  ++  +AL+ ++ +Y  NP  VTD+ N  V   +     TN TRR L G
Sbjct  25    QSNVAVFDNYWTQRQGDALKQTIASYDPNPLNVTDHLNYHVALAVDATESTNNTRRELIG  84

Query  1507  -------SHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSD  1349
                      C A N ID+CWRCD +W K+RK+LA C  GFG  TTGG  G  YVV DSSD
Sbjct  85    RKTQEGSGKCIAYNPIDKCWRCDPNWEKNRKKLAECVLGFGRKTTGGKDGPIYVVNDSSD  144

Query  1348  KDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGL  1169
              D+ NPKPGTLRHAV ++ PLWIIF  SMVI L+QEL+I  +KTIDGRG  V+I  G GL
Sbjct  145   DDLVNPKPGTLRHAVTRDGPLWIIFANSMVIKLQQELMITSNKTIDGRGAKVYIMEGVGL  204

Query  1168  TIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMS  989
             T+QFV NVII+ I + HI+P  GG+IRDS  H+G+RT SDGDGIS+FG+ +VW+DH++M+
Sbjct  205   TLQFVNNVIINNIYVKHIIPGNGGLIRDSEEHVGIRTKSDGDGISLFGATNVWIDHVSMT  264

Query  988   RCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQR  809
             RC+DG+IDAI  STA+TISN  F  H  V+L GA D    D  MQ+TVAFN FGK L QR
Sbjct  265   RCTDGMIDAIEGSTAVTISNSHFTDHQEVMLFGAKDEHVIDKNMQITVAFNHFGKRLEQR  324

Query  808   MPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNV  629
             MPRCR+G  H+VNNDYT WEMYAIGG+  PTI+SQGNRF A  N   K+VTKRE  S   
Sbjct  325   MPRCRFGTIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNEQAKEVTKREYTSYTD  384

Query  628   WKNWQWRSEGDLFLNGAYFVESGEE--LHHYnntrfnntnRIRHRPASYVGRLTRTSGAL  455
             WK+W W+SEGD FLNGAYFV+SG              +   IR +P + V  LT  +GAL
Sbjct  385   WKSWNWQSEGDYFLNGAYFVQSGRPNAWSPKPKNPVPSKFAIRPKPGTMVRELTMDAGAL  444

Query  454   KCKVGRFC  431
              C+ G+ C
Sbjct  445   GCEAGKAC  452



>ref|XP_010450167.1| PREDICTED: probable pectate lyase 15 isoform X1 [Camelina sativa]
Length=465

 Score =   451 bits (1161),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 226/389 (58%), Positives = 280/389 (72%), Gaps = 6/389 (2%)
 Frame = -1

Query  1597  NPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSHCKATNSIDRCWRCDQDWAKHRKRLAFCA  1418
             +PE+  D   + V  +  N   T RR L    C   N ID CWRCD +W K+RKRLA C 
Sbjct  83    DPEKGADEVAKLVQMSEQN--RTARRKLGFFSCGTGNPIDDCWRCDPNWHKNRKRLADCG  140

Query  1417  rgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQEL  1238
              GFG    GG  GRFYVVTD +D+D+ NPKPGTLRHAVIQEEPLWI+FK+ MVI LKQEL
Sbjct  141   IGFGRNAIGGRDGRFYVVTDPTDEDVVNPKPGTLRHAVIQEEPLWIVFKRDMVIELKQEL  200

Query  1237  IINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRT  1058
             I+N  KTIDGRG +VHIA GA +TIQF+ NVIIHG+ IH   P    M+R S +H G RT
Sbjct  201   IMNSFKTIDGRGANVHIANGACITIQFITNVIIHGLHIHDCKPTGNAMVRSSPSHFGWRT  260

Query  1057  MSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDL  878
             M+DGD +SIFGS+H+W+DH ++S C+DGL+DA+M STAIT+SN  F HHN V+LLG SD 
Sbjct  261   MADGDAVSIFGSSHIWIDHNSLSHCADGLVDAVMGSTAITVSNNHFTHHNEVMLLGHSDS  320

Query  877   FSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGN  698
             +++D +MQVT+A+N FG+GL+QRMPRCR G+FH+VNNDYT WEMYAIGGS+ PTI SQGN
Sbjct  321   YTKDKLMQVTIAYNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQGN  380

Query  697   RFKASSNPFTKQVTKREIVSKNVWKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnnt  518
             R+ A  + F K+VTKR     + WK W WRSEGDL LNGAYF  SGEE     +  +   
Sbjct  381   RYAAPMDRFAKEVTKRVETDASEWKKWNWRSEGDLLLNGAYFRSSGEE----ASASYGRA  436

Query  517   nRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             + +  +P+S V  +T T+GAL C+ GR C
Sbjct  437   SSLAAKPSSMVDTITSTAGALGCRKGRPC  465



>ref|XP_010450168.1| PREDICTED: probable pectate lyase 15 isoform X2 [Camelina sativa]
Length=461

 Score =   451 bits (1160),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 226/389 (58%), Positives = 280/389 (72%), Gaps = 6/389 (2%)
 Frame = -1

Query  1597  NPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSHCKATNSIDRCWRCDQDWAKHRKRLAFCA  1418
             +PE+  D   + V  +  N   T RR L    C   N ID CWRCD +W K+RKRLA C 
Sbjct  79    DPEKGADEVAKLVQMSEQN--RTARRKLGFFSCGTGNPIDDCWRCDPNWHKNRKRLADCG  136

Query  1417  rgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQEL  1238
              GFG    GG  GRFYVVTD +D+D+ NPKPGTLRHAVIQEEPLWI+FK+ MVI LKQEL
Sbjct  137   IGFGRNAIGGRDGRFYVVTDPTDEDVVNPKPGTLRHAVIQEEPLWIVFKRDMVIELKQEL  196

Query  1237  IINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRT  1058
             I+N  KTIDGRG +VHIA GA +TIQF+ NVIIHG+ IH   P    M+R S +H G RT
Sbjct  197   IMNSFKTIDGRGANVHIANGACITIQFITNVIIHGLHIHDCKPTGNAMVRSSPSHFGWRT  256

Query  1057  MSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDL  878
             M+DGD +SIFGS+H+W+DH ++S C+DGL+DA+M STAIT+SN  F HHN V+LLG SD 
Sbjct  257   MADGDAVSIFGSSHIWIDHNSLSHCADGLVDAVMGSTAITVSNNHFTHHNEVMLLGHSDS  316

Query  877   FSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGN  698
             +++D +MQVT+A+N FG+GL+QRMPRCR G+FH+VNNDYT WEMYAIGGS+ PTI SQGN
Sbjct  317   YTKDKLMQVTIAYNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQGN  376

Query  697   RFKASSNPFTKQVTKREIVSKNVWKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnnt  518
             R+ A  + F K+VTKR     + WK W WRSEGDL LNGAYF  SGEE     +  +   
Sbjct  377   RYAAPMDRFAKEVTKRVETDASEWKKWNWRSEGDLLLNGAYFRSSGEE----ASASYGRA  432

Query  517   nRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             + +  +P+S V  +T T+GAL C+ GR C
Sbjct  433   SSLAAKPSSMVDTITSTAGALGCRKGRPC  461



>gb|EPS62426.1| hypothetical protein M569_12361, partial [Genlisea aurea]
Length=410

 Score =   448 bits (1152),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 229/416 (55%), Positives = 287/416 (69%), Gaps = 14/416 (3%)
 Frame = -1

Query  1654  YLKKKADEALQSSLQAYYHNPEEVTDN--------FNEEVGDTIMNWTNTTRRHLRGSHC  1499
             Y +++ ++A + ++ A+  NP +V+++         NE      ++   + R       C
Sbjct  1     YWEQRGNQARRDAVLAFDSNPYQVSNDRFFFFSYYLNENRSVMELDLKRSRRSLKEDGGC  60

Query  1498  KATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGT  1319
              ATN IDRCWRC  DW+ +R+RLA CA GFG  TTGG  GR Y V DSSD D+ NPK GT
Sbjct  61    TATNPIDRCWRCRDDWSDNRQRLADCAIGFGRKTTGGKGGRIYTVNDSSDGDLVNPKEGT  120

Query  1318  LRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVII  1139
             LRHAVIQ EPLWI+F   M I L +ELI+  +KTIDGRG  + IA GAG+T+Q+V NVI+
Sbjct  121   LRHAVIQSEPLWIVFSSDMTIRLSEELIMTSNKTIDGRGRRITIAGGAGITLQYVSNVIL  180

Query  1138  HGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAI  959
             H ++IH I P  GG IRDS  H G RT SDGD IS+FG+ ++W+DH++ +RCSDGLIDAI
Sbjct  181   HNLRIHDIKPGSGGTIRDSPTHFGFRTPSDGDAISMFGATNIWIDHVSAARCSDGLIDAI  240

Query  958   MASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFH  779
              ASTAITISNC F  HN V+LLGASD  SED I+QVT+AFN FG GLIQRMPR RWGF H
Sbjct  241   QASTAITISNCHFAQHNDVMLLGASDKSSEDQILQVTLAFNHFGTGLIQRMPRIRWGFVH  300

Query  778   IVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRSEG  599
             IVNNDYTKWEMYAIGGS  PTI+SQGNRF A  N   K+VTKRE   ++VWKNW W+S+G
Sbjct  301   IVNNDYTKWEMYAIGGSQHPTILSQGNRFHAPDNAAAKEVTKREYSPESVWKNWNWKSQG  360

Query  598   DLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             D F NGA+FVESG++  +Y       ++ +  +    VG LT  +G L C  G+ C
Sbjct  361   DSFSNGAFFVESGDKNFNY------VSDSVGAKSGKEVGELTEFAGPLACFAGKAC  410



>ref|XP_010096345.1| putative pectate lyase 7 [Morus notabilis]
 gb|EXB63820.1| putative pectate lyase 7 [Morus notabilis]
Length=399

 Score =   447 bits (1151),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 237/420 (56%), Positives = 291/420 (69%), Gaps = 32/420 (8%)
 Frame = -1

Query  1672  IAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG-----  1508
             IAE+D Y K +A+EA + +LQAY  +P EVTD  N +V + +    N TRR LRG     
Sbjct  6     IAEFDDYWKSRAEEARKDALQAYSPHPHEVTDQLNYDVQEALTA-KNNTRRQLRGRKNKK  64

Query  1507  -SHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENP  1331
                C ATN IDRCWRCD +WA +RKRLA C  GFG  T GG  G +Y+VTD SD D+ NP
Sbjct  65    GGPCMATNPIDRCWRCDPNWANNRKRLADCTLGFGRNTVGGKFGPYYIVTDPSDTDLINP  124

Query  1330  KPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVR  1151
             KPGTLRHAVIQ++PLWIIF +SM+I L +ELI+  DKTID RG +V IAYGAG+TIQFV+
Sbjct  125   KPGTLRHAVIQKKPLWIIFARSMIIRLSEELIMTGDKTIDARGANVRIAYGAGITIQFVK  184

Query  1150  NVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGL  971
             NVIIH + IH I+   GG IRDS +H+G RT SDGDGISIFGS++VW+DH++MS C DGL
Sbjct  185   NVIIHNLHIHDIVASGGGNIRDSADHVGFRTKSDGDGISIFGSSNVWIDHVSMSNCQDGL  244

Query  970   IDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRW  791
             IDAIM STAITISNC F HHN     G + + +     Q+                   W
Sbjct  245   IDAIMGSTAITISNCHFTHHNES---GFNSMHTSKFRGQI-------------------W  282

Query  790   GFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQW  611
             GFFH+VNNDYT W MYAIGGS  PTI+SQGNRF A  N   KQVTKR+   ++ WKNWQW
Sbjct  283   GFFHVVNNDYTHWLMYAIGGSQHPTIISQGNRFIAPPNDAAKQVTKRDYAPESEWKNWQW  342

Query  610   RSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             RSEGDL +NGA+FV+SG+ L   +  RF+  + I+++P ++V RLTR +G L C VGR C
Sbjct  343   RSEGDLLMNGAFFVQSGKRL---SKRRFSRLDMIKYKPGTFVTRLTRYAGTLLCGVGRPC  399



>ref|XP_008460726.1| PREDICTED: probable pectate lyase 8 isoform X1 [Cucumis melo]
Length=449

 Score =   449 bits (1156),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 231/414 (56%), Positives = 289/414 (70%), Gaps = 9/414 (2%)
 Frame = -1

Query  1657  AYLKKKADEALQSSLQAY----YHNPEEVTDNFNEEVGDTIMNWTNTT-RRHLRGSHCKA  1493
             A  +  +D ++ + ++ Y      N E   DN +E      M+  N+T RR L    C  
Sbjct  40    AEFQSSSDSSMATRVENYDVEQELNNEHAVDNPDEIAASVEMSIRNSTERRKLGFFSCGT  99

Query  1492  TNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLR  1313
              N ID CWRCD +W ++RKRLA C  GFG    GG  GRFYVVTDSSD D  NPKPGTLR
Sbjct  100   GNPIDDCWRCDSNWHRNRKRLAECGIGFGRNAIGGRDGRFYVVTDSSDNDPVNPKPGTLR  159

Query  1312  HAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHG  1133
             HAVIQE+PLWI+FK+ MVI LKQELI+N  KTID RGV+VHIA GA +TIQFV N+IIHG
Sbjct  160   HAVIQEKPLWIVFKRDMVIRLKQELIMNSFKTIDARGVNVHIANGACITIQFVTNIIIHG  219

Query  1132  IKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMA  953
             + IH   P    M+R S +H G RTM+DGD ISIFGS+H+W+DH ++S C+DGL+DA+M 
Sbjct  220   LHIHDCKPTGNAMVRSSPSHFGWRTMADGDAISIFGSSHIWIDHNSLSNCADGLVDAVMG  279

Query  952   STAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIV  773
             STAITISN  F HHN V+LLG SD +++D  MQVT+A+N FG+GLIQRMPRCR G+FH+V
Sbjct  280   STAITISNNHFTHHNEVMLLGHSDSYTKDKQMQVTIAYNHFGEGLIQRMPRCRHGYFHVV  339

Query  772   NNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRSEGDL  593
             NNDYT WEMYAIGGS+ PTI SQGNR+ A +NPF K+VTKR    ++ WK W WRSEGD+
Sbjct  340   NNDYTHWEMYAIGGSANPTINSQGNRYAAPTNPFAKEVTKRVETPESEWKGWNWRSEGDM  399

Query  592   FLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
              LNGAYF  SG       +  +   + +  + AS VG +T ++G+L C+ G  C
Sbjct  400   LLNGAYFTPSGAGA----SASYARASSLGAKSASMVGSITSSAGSLPCRRGHPC  449



>ref|XP_003535958.1| PREDICTED: probable pectate lyase 1-like [Glycine max]
 gb|KHN24365.1| Putative pectate lyase 15 [Glycine soja]
Length=450

 Score =   449 bits (1156),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 230/410 (56%), Positives = 284/410 (69%), Gaps = 10/410 (2%)
 Frame = -1

Query  1660  DAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSHCKATNSI  1481
             ++ + ++A EA + + QA   NPEEV       + ++      T RR L    C   N I
Sbjct  51    NSSMVERAKEADKLNEQAAVANPEEVVSMVEMSIQNS------TERRKLGYFSCGTGNPI  104

Query  1480  DRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHAVI  1301
             D CWRCD +W ++RKRLA C  GFG    GG  G+FYVVTD  D D  NPKPGTLRHAVI
Sbjct  105   DDCWRCDPNWQRNRKRLADCGIGFGRNAIGGRDGKFYVVTDPRDDDPVNPKPGTLRHAVI  164

Query  1300  QEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIKIH  1121
             Q+ PLWI+FK+ MVI LKQELI+N  KTID RGV+VHIA GA +TIQFV NVIIHG+ IH
Sbjct  165   QDRPLWIVFKRDMVIQLKQELIMNSFKTIDARGVNVHIANGACITIQFVTNVIIHGLHIH  224

Query  1120  HILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMASTAI  941
                P    M+R S  H G RTM+DGD ISIFGS+H+W+DH ++S C+DGL+DA+M STAI
Sbjct  225   DCKPTGNAMVRSSPTHFGWRTMADGDAISIFGSSHIWVDHNSLSHCADGLVDAVMGSTAI  284

Query  940   TISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNNDY  761
             TISN  F HHN V+LLG SD ++ D +MQVT+A+N FG+GLIQRMPRCR G+FH+VNNDY
Sbjct  285   TISNNHFTHHNEVILLGHSDSYTRDKLMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDY  344

Query  760   TKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRSEGDLFLNG  581
             T WEMYAIGGS+ PTI SQGNR+ A +NPF K+VTKR   ++  WK W WRSEGDL LNG
Sbjct  345   THWEMYAIGGSANPTINSQGNRYNAPTNPFAKEVTKRVETAETQWKGWNWRSEGDLLLNG  404

Query  580   AYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             AYF  SG       +  +   + +  + +S V  +T  +GAL CK GR C
Sbjct  405   AYFTPSGAGA----SASYARASSLGAKSSSMVDSMTSNAGALGCKRGRQC  450



>ref|XP_010425041.1| PREDICTED: probable pectate lyase 6 [Camelina sativa]
Length=453

 Score =   449 bits (1155),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 237/429 (55%), Positives = 293/429 (68%), Gaps = 13/429 (3%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTI--MNWTNTTRRHLR--  1511
             A +AEYD Y  ++  EAL  +L++Y   P  VTD+FN      +     +N TRR LR  
Sbjct  25    AHVAEYDEYWTQRQTEALHQTLESYDPEPLNVTDHFNYHAALAMETTGISNETRRDLRQV  84

Query  1510  -------GSHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSS  1352
                    G   ++ N+ID+CWR +++W K+RK+LA C  GFG  TTGG  G  YVVTD S
Sbjct  85    KSGKKRRGGRYESLNAIDKCWRGNKNWDKNRKKLADCVLGFGRKTTGGKNGPIYVVTDPS  144

Query  1351  DKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAG  1172
             D D+ NPKPGTLR+AV ++ PLWIIF + M+I L+QELII +DKTIDGRGVSV+I  GAG
Sbjct  145   DNDLLNPKPGTLRYAVTRDRPLWIIFARHMIIKLQQELIITNDKTIDGRGVSVYITGGAG  204

Query  1171  LTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTM  992
             LT+Q+VRNVIIH I I  I    GG+IRDS +H GLRTMSDGDGISIFG+ +VW+DH++M
Sbjct  205   LTLQYVRNVIIHNIYIKQIKKGPGGLIRDSEHHFGLRTMSDGDGISIFGATNVWIDHVSM  264

Query  991   SRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQ  812
             + CSDG+IDAIM STAITISN  F  H+ V+L G  +    D  MQ+TVAFN FGK L Q
Sbjct  265   TDCSDGMIDAIMGSTAITISNSHFTDHDEVMLFGGKNTDVIDKKMQITVAFNHFGKRLKQ  324

Query  811   RMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKN  632
             RMPR R+G  H+VNNDYT WEMYAIGG+  PTI+SQGNRF A  N  +KQVTKRE     
Sbjct  325   RMPRARYGLVHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNEDSKQVTKREYTPYP  384

Query  631   VWKNWQWRSEGDLFLNGAYFVESGE--ELHHYnntrfnntnRIRHRPASYVGRLTRTSGA  458
              WK+W W+SE D FLNGAYFV+SG+                 IR +P + V RLT+ +GA
Sbjct  385   EWKSWNWQSEKDYFLNGAYFVQSGKANAWSTAPKNPIPRKFAIRPQPGTKVRRLTKDAGA  444

Query  457   LKCKVGRFC  431
             L CK G+ C
Sbjct  445   LGCKPGKSC  453



>ref|XP_010502279.1| PREDICTED: probable pectate lyase 6 [Camelina sativa]
Length=453

 Score =   449 bits (1154),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 237/429 (55%), Positives = 291/429 (68%), Gaps = 13/429 (3%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTI--MNWTNTTRRHLR--  1511
             A +AEYD Y  ++  EAL  +L++Y   P  VTD+FN      +      N TRR LR  
Sbjct  25    AHVAEYDEYWTQRQTEALHQTLESYDPEPLNVTDHFNYHAALAMETTGTANETRRDLRQV  84

Query  1510  -------GSHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSS  1352
                    G   ++ N+ID+CWR D++W K+RK+LA C  GFG  TTGG  G  YVVTD S
Sbjct  85    KSGKKRRGGRYESLNAIDKCWRGDKNWDKNRKKLADCVLGFGRKTTGGKNGPIYVVTDPS  144

Query  1351  DKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAG  1172
             D D+ +PKPGTLRHAV ++ PLWIIF + M+I L+QELII +DKTIDGRGVSV+I  GAG
Sbjct  145   DNDLLDPKPGTLRHAVTRDRPLWIIFARHMIIKLQQELIITNDKTIDGRGVSVYITGGAG  204

Query  1171  LTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTM  992
             LT+Q+VRNVIIH I I  I    GG+IRDS +H GLRTMSDGDGI+IFG+ +VW+DH++M
Sbjct  205   LTLQYVRNVIIHNIYIKQIKRGPGGLIRDSEHHFGLRTMSDGDGINIFGATNVWIDHVSM  264

Query  991   SRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQ  812
             + CSDG+IDAIM STAITISN  F  H+ V+L G  +    D  MQ+TVAFN FGK L Q
Sbjct  265   TDCSDGMIDAIMGSTAITISNSHFTDHDEVMLFGGKNTDVIDKKMQITVAFNHFGKRLKQ  324

Query  811   RMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKN  632
             RMPR R+G  H+VNNDYT WEMYAIGG+  PTI+SQGNRF A  N  +KQVTKRE     
Sbjct  325   RMPRARYGLVHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNEDSKQVTKREYTPYP  384

Query  631   VWKNWQWRSEGDLFLNGAYFVESGE--ELHHYnntrfnntnRIRHRPASYVGRLTRTSGA  458
              WK W W+SE D FLNGAYFV+SG+                 IR +P + V RLT+ +GA
Sbjct  385   EWKTWNWQSEKDYFLNGAYFVQSGKANAWSTAPKNPIPRKFAIRPQPGTKVRRLTKDAGA  444

Query  457   LKCKVGRFC  431
             L CK G+ C
Sbjct  445   LGCKPGKSC  453



>ref|XP_011085777.1| PREDICTED: probable pectate lyase P59 [Sesamum indicum]
Length=446

 Score =   448 bits (1153),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 247/428 (58%), Positives = 310/428 (72%), Gaps = 16/428 (4%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEV-------GDTIMNWTNTTR  1523
             +A+IAEYD   +++A EA   +LQAY  +P +V  +FNE V       G   M   N+TR
Sbjct  24    RANIAEYDEVWRRRAAEAYNRTLQAYEPDPLKVVMHFNENVHRHIKESGGVDMMMLNSTR  83

Query  1522  RHL----RGSHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDS  1355
             R L    RG  CK TN ID CWRCD +W  +R +LA C+ GFG   TGG  GR YVVTD 
Sbjct  84    RRLGKKYRGP-CKVTNPIDACWRCDPNWHLNRFKLADCSLGFGRKATGGKGGRIYVVTDP  142

Query  1354  SDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGA  1175
             SD D+  PKPGTLRHAVIQEEPLWI FK+SMVITL QELI+  DKTIDGRGV V IA+GA
Sbjct  143   SDDDILTPKPGTLRHAVIQEEPLWITFKRSMVITLAQELIMTSDKTIDGRGVKVQIAHGA  202

Query  1174  GLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLT  995
             G+T+Q+VRN+IIH IKIH+I+ K GG+IRDS  H GLRT SDGDGISIFG+  +W+DH++
Sbjct  203   GITVQYVRNIIIHNIKIHNIVEKKGGIIRDSTTHSGLRTQSDGDGISIFGAQDIWIDHVS  262

Query  994   MSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLI  815
             M+RC DGLIDAI  STAITISN  F  H+H +L GA+D +  D  MQ+TVAFN FGK ++
Sbjct  263   MTRCDDGLIDAIQGSTAITISNGHFTDHDHAMLFGANDKYPGDEKMQITVAFNHFGKRMV  322

Query  814   QRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSK  635
             QRMPRCR+GFFH+VNNDYT W+MYAIGGSS PTI+SQGNR+ A  +P+ KQVTKRE   +
Sbjct  323   QRMPRCRYGFFHVVNNDYTHWKMYAIGGSSHPTIISQGNRYIA-DHPYAKQVTKRE-CPE  380

Query  634   NVWKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGAL  455
             + W++W W ++GD+FLNGAYF  SG++  H+       ++ I+  PA+ V ++T+ +G L
Sbjct  381   SEWRHWTWVTDGDIFLNGAYFRASGDQDWHH--KHPEKSDGIKPGPATLVAQMTQFAGRL  438

Query  454   KCKVGRFC  431
              CK    C
Sbjct  439   DCKKKYAC  446



>ref|XP_009391056.1| PREDICTED: probable pectate lyase 8 [Musa acuminata subsp. malaccensis]
Length=453

 Score =   448 bits (1152),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 225/394 (57%), Positives = 276/394 (70%), Gaps = 10/394 (3%)
 Frame = -1

Query  1612  QAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSHCKATNSIDRCWRCDQDWAKHRKR  1433
             +A   +PEEV    +  + ++      T RR L    C   N ID CWRCD DW  +RK 
Sbjct  70    EAAVDDPEEVASAVHMSISNS------TARRSLGYLSCGTGNPIDDCWRCDPDWHLNRKT  123

Query  1432  LAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVIT  1253
             LA C  GFG    GG  G FYVVTDS D D  NP+PGTLR+AV+Q++PLWI F++ MVIT
Sbjct  124   LADCGIGFGRNAIGGRDGEFYVVTDSGDDDPVNPRPGTLRYAVVQDDPLWITFERDMVIT  183

Query  1252  LKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNH  1073
             L QELI+N  KTIDGRG +VHIA GA +TIQ+V NVIIHG+ IH   P    M+R S +H
Sbjct  184   LDQELIMNSFKTIDGRGANVHIANGACITIQYVTNVIIHGLHIHDCKPTGNAMVRSSPSH  243

Query  1072  IGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLL  893
              G RTM+DGDG+SIFGS+HVW+DH ++S C+DGL+DA+M STAIT+SN  F HHN V+LL
Sbjct  244   YGWRTMADGDGVSIFGSSHVWVDHCSLSNCADGLVDAVMGSTAITVSNNYFTHHNEVMLL  303

Query  892   GASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTI  713
             G SD +  D  MQVT+AFN FG+GLIQRMPRCR G+FH+VNNDYT WEMYAIGGS+ PTI
Sbjct  304   GHSDSYERDKSMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTI  363

Query  712   VSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRSEGDLFLNGAYFVESGEELHHYnnt  533
              SQGNR+ A +NPF K+VTKR     ++WKNW WRSEGDL LNGAYF  SG       +T
Sbjct  364   NSQGNRYLAPTNPFAKEVTKRVDTDASLWKNWNWRSEGDLLLNGAYFTPSGAG----AST  419

Query  532   rfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
              +   + +  +P+S VG LT  +GAL C+ G  C
Sbjct  420   SYARASSLGAKPSSMVGTLTSDAGALSCRAGTQC  453



>emb|CDX74293.1| BnaA03g27540D [Brassica napus]
Length=471

 Score =   448 bits (1153),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 239/452 (53%), Positives = 302/452 (67%), Gaps = 38/452 (8%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMN-------------  1541
             +A++AE D Y  K A+EA + +L AY+ +P ++ D+F+E   D   +             
Sbjct  23    RANVAETDDYWVKMANEARKRTLMAYHPDPYQIVDHFHERHYDNSTDVEETEEHASEEED  82

Query  1540  -------WTNTTRRHLRGSH--------------CKATNSIDRCWRCDQDWAKHRKRLAF  1424
                     TN+TRR LRG                C A+N ID+CWRC  DWA+ RK+L  
Sbjct  83    DIEMSSSLTNSTRRSLRGRGKGKGRGKWSKLKGPCTASNPIDKCWRCQPDWARRRKKLVK  142

Query  1423  CArgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQ  1244
             C RGFG  TTGG +GR YVVT + D D  NP+PGTLRHAVIQ EPLWIIFK  M I L Q
Sbjct  143   CVRGFGYRTTGGKRGRIYVVTSNRDDDTVNPRPGTLRHAVIQNEPLWIIFKHDMSIRLSQ  202

Query  1243  ELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGL  1064
             EL+IN  KTID RG +VHIAYGAG+T+Q+VRN+IIHG+ +HHI+P  GGMIR+S +H G 
Sbjct  203   ELMINSHKTIDARGTNVHIAYGAGITMQYVRNIIIHGLHVHHIVPGSGGMIRNSNDHFGF  262

Query  1063  RTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGAS  884
             R  +DGDGISIFG+ ++WLDH++MS+C DGLIDAIM ST ITISN  F HHN V+LLGA 
Sbjct  263   RGQADGDGISIFGATNIWLDHISMSKCQDGLIDAIMGSTGITISNSHFTHHNDVMLLGAQ  322

Query  883   DLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQ  704
             +    D  MQVTVAFN FGKGL+QRMPR RWGF H+VNNDYT WE+YAIGGS  PTI+S 
Sbjct  323   NDNHADKKMQVTVAFNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQSPTILSH  382

Query  703   GNRFKASSN-PFTKQVTKREIVSKNVWKNWQWRSEGDLFLNGAYFVESGEELHHYnntrf  527
             GNRF A  +    ++VTKR+   ++ WKNW WRS+ D+F+N AYF +SG           
Sbjct  383   GNRFIAPPHIQHYREVTKRDYAPESEWKNWNWRSDKDIFMNNAYFRQSGNP---KFMCSH  439

Query  526   nntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             +    I+ +  S V +LT+ +GAL C+VG+ C
Sbjct  440   SRQQMIKPKHGSAVSKLTKYAGALDCRVGKPC  471



>emb|CDY53564.1| BnaC04g55760D [Brassica napus]
Length=455

 Score =   447 bits (1151),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 225/403 (56%), Positives = 286/403 (71%), Gaps = 6/403 (1%)
 Frame = -1

Query  1633  EALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTN--TTRRHLRGSHCKATNSIDRCWRCD  1460
             E ++ + Q    +P++V D  +  V   I    +  T RR L    C   N ID CWRCD
Sbjct  57    EGVELNKQHAVDDPDKVADEVSTLVKVLIFRSEHNITARRKLGFFSCGTGNPIDDCWRCD  116

Query  1459  QDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHAVIQEEPLWI  1280
             ++W K+RKRLA C  GFG    GG  GRFYVVTD +D+D+ NPKPGTLRHAVIQ+EPLWI
Sbjct  117   RNWHKNRKRLADCGIGFGRNAVGGRDGRFYVVTDPTDEDVINPKPGTLRHAVIQDEPLWI  176

Query  1279  IFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIKIHHILPKMG  1100
             +FK+ MVI LKQELI+N  KTIDGRG +VHIA GA +TIQF+ NVIIHG+ IH   P   
Sbjct  177   VFKRDMVIELKQELIMNSFKTIDGRGANVHIANGACITIQFITNVIIHGLHIHDCKPTGN  236

Query  1099  GMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMASTAITISNCKF  920
              M+R S +H G RTM+DGD +SIF S+H+W+DH ++S C+DGL+DA+M STAIT+SN  F
Sbjct  237   AMVRSSPSHFGWRTMADGDAVSIFQSSHIWIDHNSLSHCADGLVDAVMGSTAITVSNNHF  296

Query  919   NHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNNDYTKWEMYA  740
              HHN V+LLG SD +++D +MQVT+A+N FG+GL+QRMPRCR G+FH+VNNDYT WEMYA
Sbjct  297   THHNEVMLLGHSDSYTKDKLMQVTIAYNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYA  356

Query  739   IGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRSEGDLFLNGAYFVESG  560
             IGGS+ PTI SQGNR+ A  NPF K+VTKR     + W+ W WRSEGDL LNGA+F  SG
Sbjct  357   IGGSADPTINSQGNRYAAPKNPFAKEVTKRVETDASEWQKWNWRSEGDLLLNGAFFKASG  416

Query  559   EELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
              E     +  +   + +  +P+S V  +T T+GAL C+ GR C
Sbjct  417   AE----ASASYGRASSLAAKPSSMVHTITSTAGALGCRRGRPC  455



>ref|XP_007145412.1| hypothetical protein PHAVU_007G236800g [Phaseolus vulgaris]
 gb|ESW17406.1| hypothetical protein PHAVU_007G236800g [Phaseolus vulgaris]
Length=451

 Score =   447 bits (1151),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 226/410 (55%), Positives = 285/410 (70%), Gaps = 10/410 (2%)
 Frame = -1

Query  1660  DAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSHCKATNSI  1481
             ++ + ++A EA + + +A   NPEEV       + ++      T RR+L    C   N I
Sbjct  52    NSSMVERAKEAEKLNEEAAVANPEEVVSMVEMSIHNS------TQRRNLGFFSCGTGNPI  105

Query  1480  DRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHAVI  1301
             D CWRCD +W ++RKRLA C  GFG    GG  G++YVVTD  D D  NPKPGTLRHAVI
Sbjct  106   DDCWRCDPNWQRNRKRLADCGIGFGRNAIGGRDGKYYVVTDPRDDDPVNPKPGTLRHAVI  165

Query  1300  QEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIKIH  1121
             Q+ PLWI+FK+ MVI LKQELI+N  KTIDGRG +VHIA GA +TIQF+ NVIIHG+ IH
Sbjct  166   QDRPLWIVFKRDMVIQLKQELIMNSFKTIDGRGANVHIANGACITIQFITNVIIHGLHIH  225

Query  1120  HILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMASTAI  941
               +P    M+R S  H G RTM+DGD ISIF S+H+W+DH ++S C+DGL+DA++ STAI
Sbjct  226   DCVPTGNAMVRSSPTHFGWRTMADGDAISIFSSSHIWVDHNSLSHCADGLVDAVLGSTAI  285

Query  940   TISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNNDY  761
             TISN  F HHN V+LLG SD ++ D +MQVT+A+N FG+GLIQRMPRCR G+FH+VNNDY
Sbjct  286   TISNNHFTHHNEVILLGHSDSYTRDKLMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDY  345

Query  760   TKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRSEGDLFLNG  581
             T WEMYAIGGS+ PTI SQGNR+ A  NPF K+VTKR   ++  WK W WRSEGDL LNG
Sbjct  346   THWEMYAIGGSANPTINSQGNRYNAPVNPFAKEVTKRVETAQTQWKGWNWRSEGDLLLNG  405

Query  580   AYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             AYF  SG       +  +   + +  + +S VG +T  +GAL CK GR C
Sbjct  406   AYFTPSGAGA----SASYARASSLGAKSSSMVGSMTSNAGALGCKRGRQC  451



>emb|CDX70590.1| BnaC03g06740D [Brassica napus]
Length=475

 Score =   448 bits (1153),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 249/456 (55%), Positives = 316/456 (69%), Gaps = 42/456 (9%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNE---------------------  1565
             QAD++E D Y  ++ADEA + +LQAY+ +P E+ D+F+E                     
Sbjct  23    QADMSELDEYWSQRADEAREFTLQAYHSDPYEIIDHFHERHYDNSTDITPTEEASNAKPE  82

Query  1564  EVGDTIM-------NWTNTTRRHLRG----------SHCKATNSIDRCWRCDQDWAKHRK  1436
             EV + ++       N TN+TRR LRG            C A+N ID+CWRC ++WAK RK
Sbjct  83    EVENEVIEMVGSGDNSTNSTRRSLRGKGKGKWSKLKGPCTASNPIDKCWRCRKNWAKRRK  142

Query  1435  RLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVI  1256
             +L  C RGFG  T GG  GR YVVT + D+D+ NP+PGTLRHAVIQEEPLWIIFK  M I
Sbjct  143   KLVKCVRGFGHMTVGGKHGRIYVVTSNLDEDVVNPEPGTLRHAVIQEEPLWIIFKNDMSI  202

Query  1255  TLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVN  1076
              L QEL+IN  KTID RG +VHIA+GAG+T+QFVR+VIIHG+ IHHI    GGMIRDS +
Sbjct  203   RLNQELMINSFKTIDARGANVHIAHGAGVTMQFVRHVIIHGLHIHHISESSGGMIRDSAD  262

Query  1075  HIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLL  896
             H G+RT +DGDG+SI+GS+++WLDH++MS+C DGLIDAI+ STAITISN  F HHN V+L
Sbjct  263   HFGMRTRADGDGLSIYGSSNIWLDHVSMSQCQDGLIDAIVGSTAITISNSHFTHHNDVML  322

Query  895   LGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPT  716
             LGA + +  D  MQVTVA+N FGKGL+QRMPR RWGF H+VNNDYT WE+YAIGGS  PT
Sbjct  323   LGAQNTYDLDKKMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQSPT  382

Query  715   IVSQGNRFKASSN-PFTKQVTKREIVSKNVWKNWQWRSEGDLFLNGAYFVESGEELHHYn  539
             I+SQGNRF A  + P  ++VTKR+   +  WK+W WRSE D+F+NGAYF +SG   +   
Sbjct  383   ILSQGNRFIAPPHLPHYREVTKRDYAPEEEWKHWNWRSEKDIFMNGAYFRQSGNPNYE--  440

Query  538   ntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
              T     N I+ +    V +LT+ +GAL C+VGR C
Sbjct  441   -TDHTRRNMIKPKNGYAVSKLTKYAGALDCRVGRRC  475



>ref|XP_002297822.1| pectate lyase family protein [Populus trichocarpa]
 gb|ABK96205.1| unknown [Populus trichocarpa]
 gb|EEE82627.1| pectate lyase family protein [Populus trichocarpa]
Length=450

 Score =   447 bits (1150),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 231/401 (58%), Positives = 281/401 (70%), Gaps = 5/401 (1%)
 Frame = -1

Query  1630  ALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTT-RRHLRGSHCKATNSIDRCWRCDQD  1454
             A +S  +A   N + V DN  E V    M+  N+T RR L    C   N ID CWRCD +
Sbjct  54    AARSQEEADALNEKAVADNPEEVVSMVEMSIRNSTERRRLGYFSCGTGNPIDDCWRCDPN  113

Query  1453  WAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHAVIQEEPLWIIF  1274
             W K+RKRLA C  GFG    GG  GRFYVVTD SD D  NP+PGTLRHAVIQ+ PLWI+F
Sbjct  114   WQKNRKRLADCGIGFGRNAIGGRDGRFYVVTDPSDNDPVNPRPGTLRHAVIQDAPLWIVF  173

Query  1273  KKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIKIHHILPKMGGM  1094
             K+ MVI LKQELI+N  KTIDGRGV+VHIA G  +TIQFV NVIIHG+ IH   P    M
Sbjct  174   KRDMVIQLKQELIMNSFKTIDGRGVNVHIANGGCITIQFVTNVIIHGLHIHDCKPTGNAM  233

Query  1093  IRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMASTAITISNCKFNH  914
             +R S +H G RTM+DGD +SIFGS+H+W+DH ++S C+DGL+DA+M STAIT+SN  F H
Sbjct  234   VRSSPSHYGWRTMADGDAVSIFGSSHIWVDHNSLSNCADGLVDAVMGSTAITVSNNHFTH  293

Query  913   HNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNNDYTKWEMYAIG  734
             HN V+LLG SD ++ D  MQVT+A+N FG+GLIQRMPRCR G+FH+VNNDYT WEMYAIG
Sbjct  294   HNEVMLLGHSDSYTRDKQMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIG  353

Query  733   GSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRSEGDLFLNGAYFVESGEE  554
             GS+ PTI SQGNR+ A  NPF K+VTKR   +   WKNW WRSEGDL LNGAYF  SG  
Sbjct  354   GSAEPTINSQGNRYNAPVNPFAKEVTKRVDTAAGYWKNWNWRSEGDLLLNGAYFTPSGAG  413

Query  553   LHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
                  ++ +   + +  + +S VG +T  +GAL C+  R C
Sbjct  414   A----SSSYARASSLGAKSSSMVGAMTANAGALGCRRARQC  450



>gb|KGN47799.1| hypothetical protein Csa_6G404140 [Cucumis sativus]
Length=415

 Score =   446 bits (1147),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 236/415 (57%), Positives = 285/415 (69%), Gaps = 25/415 (6%)
 Frame = -1

Query  1666  EYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH---CK  1496
             + D Y + +A EA + +  A+  NPE VTD  N  V  T++   N+TRR LR  +   C 
Sbjct  23    DEDEYWQTRATEAKKVAQGAFNANPEIVTDTLNAAVSRTMLG-HNSTRRSLRKKYRGPCL  81

Query  1495  ATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGTL  1316
             ATN IDRCWRCD++WAK+R++LA C  GFG  T GG +G  YVVTD+SD D+ NPKPGTL
Sbjct  82    ATNPIDRCWRCDRNWAKNRRKLAECPLGFGHQTIGGKRGPIYVVTDASDDDLVNPKPGTL  141

Query  1315  RHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIH  1136
             RH VIQ+ PLWIIF +SMVI L QEL+I+  KTID RG +VHIA+GAGLTIQFV NVIIH
Sbjct  142   RHGVIQKGPLWIIFGRSMVIRLSQELMISSHKTIDARGANVHIAFGAGLTIQFVNNVIIH  201

Query  1135  GIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIM  956
              + IH I+ K GGMIRDSV+H G RT SDGDGISIFGS+HVW+DH++MS C DGLIDAIM
Sbjct  202   NLHIHDIVSKSGGMIRDSVDHYGFRTQSDGDGISIFGSSHVWIDHVSMSNCQDGLIDAIM  261

Query  955   ASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHI  776
              STAITISNC F HHN            E AI           K  + +MPRCRWGFFH+
Sbjct  262   GSTAITISNCHFTHHN------------ERAIAT--------QKTKLCKMPRCRWGFFHV  301

Query  775   VNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRSEGD  596
             VNNDYT W MYAIGGS  PTIVSQGNRF A  NP  KQ+TKRE   ++ WK+W WRSEGD
Sbjct  302   VNNDYTHWLMYAIGGSQHPTIVSQGNRFIAPPNPNAKQITKREYAMEDEWKHWSWRSEGD  361

Query  595   LFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
               +NGA F+ SG++         +  + I  +P +YV RL R SG ++C  G+ C
Sbjct  362   ELMNGAVFIASGDQTKG-KKKGLSRYDMISFKPGTYVRRLVRLSGTIECTPGKPC  415



>ref|XP_008460727.1| PREDICTED: probable pectate lyase 1 isoform X2 [Cucumis melo]
Length=431

 Score =   446 bits (1148),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 228/390 (58%), Positives = 279/390 (72%), Gaps = 5/390 (1%)
 Frame = -1

Query  1597  NPEEVTDNFNEEVGDTIMNWTNTT-RRHLRGSHCKATNSIDRCWRCDQDWAKHRKRLAFC  1421
             N E   DN +E      M+  N+T RR L    C   N ID CWRCD +W ++RKRLA C
Sbjct  46    NNEHAVDNPDEIAASVEMSIRNSTERRKLGFFSCGTGNPIDDCWRCDSNWHRNRKRLAEC  105

Query  1420  ArgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQE  1241
               GFG    GG  GRFYVVTDSSD D  NPKPGTLRHAVIQE+PLWI+FK+ MVI LKQE
Sbjct  106   GIGFGRNAIGGRDGRFYVVTDSSDNDPVNPKPGTLRHAVIQEKPLWIVFKRDMVIRLKQE  165

Query  1240  LIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLR  1061
             LI+N  KTID RGV+VHIA GA +TIQFV N+IIHG+ IH   P    M+R S +H G R
Sbjct  166   LIMNSFKTIDARGVNVHIANGACITIQFVTNIIIHGLHIHDCKPTGNAMVRSSPSHFGWR  225

Query  1060  TMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASD  881
             TM+DGD ISIFGS+H+W+DH ++S C+DGL+DA+M STAITISN  F HHN V+LLG SD
Sbjct  226   TMADGDAISIFGSSHIWIDHNSLSNCADGLVDAVMGSTAITISNNHFTHHNEVMLLGHSD  285

Query  880   LFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQG  701
              +++D  MQVT+A+N FG+GLIQRMPRCR G+FH+VNNDYT WEMYAIGGS+ PTI SQG
Sbjct  286   SYTKDKQMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQG  345

Query  700   NRFKASSNPFTKQVTKREIVSKNVWKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnn  521
             NR+ A +NPF K+VTKR    ++ WK W WRSEGD+ LNGAYF  SG       +  +  
Sbjct  346   NRYAAPTNPFAKEVTKRVETPESEWKGWNWRSEGDMLLNGAYFTPSGAGA----SASYAR  401

Query  520   tnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
              + +  + AS VG +T ++G+L C+ G  C
Sbjct  402   ASSLGAKSASMVGSITSSAGSLPCRRGHPC  431



>ref|XP_002871648.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47907.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=472

 Score =   448 bits (1152),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 247/453 (55%), Positives = 312/453 (69%), Gaps = 39/453 (9%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNE-------------EVGDT---  1550
             + +I+E D Y  ++ADEA + +LQAY+ +P E+ D+F+E             E GD    
Sbjct  23    RGNISELDEYWSQRADEAREFTLQAYHSDPYEIVDHFHERHYDNSTDVTTTEEEGDAKPE  82

Query  1549  ---------IMNWTNTTRRHLRG----------SHCKATNSIDRCWRCDQDWAKHRKRLA  1427
                      + + TN+TRR LRG            C A+N ID+CWRC  DWAK RKRL 
Sbjct  83    EEEKEFIEMLGSSTNSTRRSLRGKGKGKWSKLKGPCTASNPIDKCWRCRSDWAKRRKRLT  142

Query  1426  FCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLK  1247
              C RGFG  TTGG +GR YVVT + D DM NPKPGTLRHAVIQ+EPLWIIFK  M I L 
Sbjct  143   RCVRGFGHRTTGGKRGRIYVVTSNLDDDMVNPKPGTLRHAVIQKEPLWIIFKNDMSIRLN  202

Query  1246  QELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIG  1067
             QEL+IN  KTID RG +VH+A+GAG+T+QFV+NVIIHG+ IHHI    GGMIRDSV+H G
Sbjct  203   QELLINSHKTIDARGANVHVAHGAGITMQFVKNVIIHGLHIHHISESSGGMIRDSVDHFG  262

Query  1066  LRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGA  887
             +RT +DGDG+SI+GS+++WLDH++MS+C DGLIDAI+ ST ITISN  F HHN V+LLGA
Sbjct  263   MRTRADGDGLSIYGSSNIWLDHISMSKCQDGLIDAIVGSTGITISNSHFTHHNDVMLLGA  322

Query  886   SDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVS  707
              +    D  MQVTVA+N FGKGL+QRMPR RWGF H+VNNDYT WE+YAIGGS  PTI+S
Sbjct  323   QNTNEADKHMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILS  382

Query  706   QGNRFKASSN-PFTKQVTKREIVSKNVWKNWQWRSEGDLFLNGAYFVESGEELHHYnntr  530
              GNRF A  + P  ++VTKR+  S++ WK+W WRSE D+F+NGAYF +SG   +      
Sbjct  383   HGNRFIAPPHKPHYREVTKRDYASEDEWKHWNWRSEKDVFMNGAYFRQSGNPQY---KCA  439

Query  529   fnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
                   I+ +    V +LT+ +GAL C+VG+ C
Sbjct  440   HTRQQMIKPKHGLAVSKLTKYAGALDCRVGKRC  472



>ref|XP_004134015.1| PREDICTED: probable pectate lyase 15-like [Cucumis sativus]
 ref|XP_004157662.1| PREDICTED: probable pectate lyase 15-like [Cucumis sativus]
 gb|KGN56767.1| hypothetical protein Csa_3G133180 [Cucumis sativus]
Length=447

 Score =   447 bits (1149),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 227/410 (55%), Positives = 283/410 (69%), Gaps = 10/410 (2%)
 Frame = -1

Query  1660  DAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSHCKATNSI  1481
             ++ +  + DEA     +    NPEE+    +  + +       T RR L    C   N I
Sbjct  48    NSTMAVRLDEAKDLGNEHAVDNPEEIAAMVDMSIRNA------TARRELGFFSCGTGNPI  101

Query  1480  DRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHAVI  1301
             D CWRCD +W ++RKRLA C  GFG    GG  GRFYVVTDS D +  NPKPGTLRHAVI
Sbjct  102   DDCWRCDPNWQQNRKRLADCGIGFGRNAIGGRDGRFYVVTDSGDDNPVNPKPGTLRHAVI  161

Query  1300  QEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIKIH  1121
             Q+EPLWI+FK+ MVI LKQELI+N  KTID RG +VHIA GA LTIQFV NVI+HG+ IH
Sbjct  162   QDEPLWIVFKRDMVIQLKQELIMNSFKTIDARGTNVHIANGACLTIQFVTNVIVHGLNIH  221

Query  1120  HILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMASTAI  941
                P    M+R S NH+G RT++DGD ISIFGS+H+W+DH ++S C+DGL+DA+M STAI
Sbjct  222   DCKPTGNAMVRSSPNHVGWRTIADGDAISIFGSSHIWIDHNSLSNCADGLVDAVMGSTAI  281

Query  940   TISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNNDY  761
             TISN  F HHN V+LLG SD +  D +MQVT+A+N FG+GLIQRMPRCR G+FH+VNNDY
Sbjct  282   TISNNYFTHHNEVMLLGHSDSYVRDKLMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDY  341

Query  760   TKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRSEGDLFLNG  581
             T WEMYAIGGS+ PTI SQGNR+ A +NPF K+VTKR   S++ WK W WRSEGDL LNG
Sbjct  342   THWEMYAIGGSANPTINSQGNRYAAPTNPFAKEVTKRVETSESEWKGWNWRSEGDLLLNG  401

Query  580   AYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             A+F+ SG          +   + +  + +S VG +T  +GAL C+ G  C
Sbjct  402   AFFIPSGAGASSS----YARASSLGAKSSSMVGTITSNAGALSCRRGHAC  447



>ref|XP_006292606.1| hypothetical protein CARUB_v10018855mg [Capsella rubella]
 gb|EOA25504.1| hypothetical protein CARUB_v10018855mg [Capsella rubella]
Length=455

 Score =   447 bits (1150),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 238/432 (55%), Positives = 294/432 (68%), Gaps = 15/432 (3%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIM--NWTNTTRRHLR-  1511
             QA IA +D Y  ++  EALQ +L+AY   P  VTD+FN +    ++     N TRR LR 
Sbjct  24    QAHIAVHDEYWTQRQTEALQQTLEAYDPEPLNVTDHFNHQAALAMVPTGIVNETRRELRQ  83

Query  1510  ----------GSHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVT  1361
                       G   ++ N+ID+CWR D++W K+RK+LA C  GFG  TTGG  G FYVVT
Sbjct  84    VGRGNKKPRRGRRYESLNAIDKCWRGDKNWDKNRKKLADCVLGFGRKTTGGKNGPFYVVT  143

Query  1360  DSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAY  1181
             D SD D+ NPKPGTLR+AV ++ PLWIIF +SM+I L+QELII +DKTIDGRG +VHI  
Sbjct  144   DPSDTDLMNPKPGTLRYAVTRDRPLWIIFARSMIIKLQQELIITNDKTIDGRGANVHITG  203

Query  1180  GAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDH  1001
             GAGLT+QFVRNVIIH I I  I    GG+IRDS +H GLRT+SDGDGI+IFG+ +VW+DH
Sbjct  204   GAGLTLQFVRNVIIHNIYIKQIKKGAGGLIRDSEHHFGLRTVSDGDGINIFGATNVWIDH  263

Query  1000  LTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKG  821
             ++M+ CSDG+IDAIM STAITISN  F  H+ V+L G ++    D  MQ+TVAFN FGK 
Sbjct  264   VSMTDCSDGMIDAIMGSTAITISNSHFTDHDEVMLFGGTNKDVIDKKMQITVAFNHFGKR  323

Query  820   LIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIV  641
             L QRMPR R+G  H+VNNDYT WEMYAIGG+  PTI+SQGNRF A     +KQVTKRE  
Sbjct  324   LKQRMPRVRYGLVHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPIEDSKQVTKREYT  383

Query  640   SKNVWKNWQWRSEGDLFLNGAYFVESGE--ELHHYnntrfnntnRIRHRPASYVGRLTRT  467
                 WK W W+SE D FLNGAYFV+SG+                 IR +P + V RLT+ 
Sbjct  384   PYPEWKTWNWQSEKDYFLNGAYFVQSGKANAWSTAPKNPIPRKFAIRPQPGTKVRRLTKD  443

Query  466   SGALKCKVGRFC  431
             +G L CK G+ C
Sbjct  444   AGTLGCKPGKSC  455



>emb|CDX91953.1| BnaC03g32550D [Brassica napus]
Length=471

 Score =   447 bits (1151),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 239/452 (53%), Positives = 302/452 (67%), Gaps = 38/452 (8%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNW------------  1538
             +A++AE D Y  K A+EA + +L AY+ +P ++ D+F+E   D   +             
Sbjct  23    RANVAETDDYWVKMANEARKRTLMAYHPDPYQIVDHFHERHYDNSTDVEETEEHASEEED  82

Query  1537  --------TNTTRRHLRGSH--------------CKATNSIDRCWRCDQDWAKHRKRLAF  1424
                     TN+TRR LRG                C A+N ID+CWRC  DWA+ RK+L  
Sbjct  83    DIEMSSSPTNSTRRSLRGRGKGKGRGKWSKLKGPCTASNPIDKCWRCQPDWARRRKKLVK  142

Query  1423  CArgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQ  1244
             C RGFG  TTGG +GR YVVT + D D  NP+PGTLRHAVIQ EPLWIIFK  M I L Q
Sbjct  143   CVRGFGYRTTGGKRGRIYVVTSNRDDDTVNPRPGTLRHAVIQNEPLWIIFKHDMSIRLSQ  202

Query  1243  ELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGL  1064
             EL+IN  KTID RG +VHIAYGAG+T+Q+VRN+IIHG+ +HHI+P  GGMIR+S +H G 
Sbjct  203   ELMINSHKTIDARGTNVHIAYGAGITMQYVRNIIIHGLHVHHIVPGSGGMIRNSNDHFGF  262

Query  1063  RTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGAS  884
             R  +DGDGISIFG+ ++WLDH++MS+C DGLIDAIM ST ITISN  F HHN V+LLGA 
Sbjct  263   RGQADGDGISIFGATNIWLDHISMSKCQDGLIDAIMGSTGITISNSHFTHHNDVMLLGAQ  322

Query  883   DLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQ  704
             +    D  MQVTVAFN FGKGL+QRMPR RWGF H+VNNDYT WE+YAIGGS  PTI+S 
Sbjct  323   NDNHADKKMQVTVAFNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQSPTILSH  382

Query  703   GNRFKASSN-PFTKQVTKREIVSKNVWKNWQWRSEGDLFLNGAYFVESGEELHHYnntrf  527
             GNRF A  +    ++VTKR+   ++ WKNW WRS+ D+F+N AYF +SG           
Sbjct  383   GNRFIAPPHIQHYREVTKRDYAPESEWKNWNWRSDKDIFMNNAYFRQSGNP---KFMCSH  439

Query  526   nntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             +    I+ +  S V +LT+ +GAL C+VG+ C
Sbjct  440   SRQQMIKPKHGSAVSKLTKYAGALDCRVGKPC  471



>ref|XP_002884619.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60878.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=416

 Score =   446 bits (1146),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 227/389 (58%), Positives = 281/389 (72%), Gaps = 10/389 (3%)
 Frame = -1

Query  1597  NPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSHCKATNSIDRCWRCDQDWAKHRKRLAFCA  1418
             NP+EV    +  + ++      T RR L    C   N ID CWRCD+ W   RKRLA C+
Sbjct  38    NPDEVAAMVDMSIRNS------TERRRLGYFSCATGNPIDDCWRCDRKWQLRRKRLADCS  91

Query  1417  rgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQEL  1238
              GFG    GG  GRFYVVTD  D +  NP PGTLRHAVIQ+EPLWIIFK+ MVITLKQEL
Sbjct  92    IGFGRNAIGGRDGRFYVVTDPGDDNPVNPIPGTLRHAVIQDEPLWIIFKRDMVITLKQEL  151

Query  1237  IINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRT  1058
             I+N  KTIDGRGV+VHIA GA LTIQ+V N+I+HGI IH  +P    M+R S +H G R+
Sbjct  152   IMNSFKTIDGRGVNVHIANGACLTIQYVTNIIVHGIHIHDCVPTGNAMVRSSPSHYGFRS  211

Query  1057  MSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDL  878
             M+DGD ISIFGS+H+W+DH ++S C+DGL+DA+M+STAIT+SN  F HHN V+LLG SD 
Sbjct  212   MADGDAISIFGSSHIWIDHNSLSNCADGLVDAVMSSTAITVSNNFFTHHNEVMLLGHSDS  271

Query  877   FSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGN  698
             ++ D +MQVT+A+N FG+GLIQRMPRCR G+FH+VNNDYT WEMYAIGGS+ PTI SQGN
Sbjct  272   YTRDKVMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTINSQGN  331

Query  697   RFKASSNPFTKQVTKREIVSKNVWKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnnt  518
             RF A +NPF K+VTKRE   ++ WK+W WRSEGDLFLNGA+F  SG        + +   
Sbjct  332   RFLAPTNPFAKEVTKREYTGESKWKHWNWRSEGDLFLNGAFFTRSGAG----AGSNYARA  387

Query  517   nRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             + +  + +S VG +T  SGAL C+ GR C
Sbjct  388   SSLSAKSSSLVGTMTSYSGALNCRAGRRC  416



>gb|KHG07401.1| putative pectate lyase P59 [Gossypium arboreum]
Length=442

 Score =   446 bits (1148),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 243/421 (58%), Positives = 303/421 (72%), Gaps = 8/421 (2%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNW-TNTTRRHLR--  1511
             +A IAEYD Y +++  +A ++  +AY  NPEEVT +FN+ V   +M + TN+TRR L+  
Sbjct  26    EAHIAEYDDYWRERELQAKENLEKAYNPNPEEVTQHFNDHVARILMGFRTNSTRRMLKKR  85

Query  1510  -GSHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMEN  1334
              G  C+ATN ID+CWRCD++W K+RK+LA CA GFG GTTGG  G  YVVTD +D D+ N
Sbjct  86    KGGPCEATNPIDQCWRCDRNWEKNRKKLADCALGFGRGTTGGKDGPIYVVTDPTD-DVLN  144

Query  1333  PKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFV  1154
             P  GTLRHAVIQ  PLWI F + M+I LK+EL++  +KTIDGRG +VHIAYGAG+TIQF 
Sbjct  145   PSRGTLRHAVIQNRPLWITFARGMIIRLKEELLMTSNKTIDGRGANVHIAYGAGITIQFA  204

Query  1153  RNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDG  974
             +NVIIH I IH+I P  GG I+D  NH+GLRT SDGDGIS+FG+ +VWLDHL++ +CSDG
Sbjct  205   KNVIIHNIHIHNIFPSKGGKIKDGENHLGLRTRSDGDGISLFGATNVWLDHLSVYKCSDG  264

Query  973   LIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCR  794
             +IDAI  STAITISNC F  HN V+L GASD +S D  MQ+TVAF  FGK L+QRMPR R
Sbjct  265   IIDAIQGSTAITISNCHFTDHNDVMLFGASDSYSADEKMQITVAFTHFGKNLVQRMPRVR  324

Query  793   WGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQ  614
             +GF H+VNNDY  W M AIGGSS PTI+S GNRF+A  N   K+V KRE  ++  WKNW 
Sbjct  325   FGFVHVVNNDYRHWIMSAIGGSSHPTIISHGNRFRAPRNIAAKEVCKREYATEQEWKNWD  384

Query  613   WRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRF  434
             WRSEGDL LNGA F +SG+        +F     I ++PA  V  L R SG L+C+  + 
Sbjct  385   WRSEGDLMLNGAIFTQSGDP---RAAKKFGGDKMIAYKPAHMVPLLVRWSGTLECRPNKP  441

Query  433   C  431
             C
Sbjct  442   C  442



>gb|KFK43687.1| hypothetical protein AALP_AA1G160000 [Arabis alpina]
Length=460

 Score =   447 bits (1150),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 235/434 (54%), Positives = 297/434 (68%), Gaps = 18/434 (4%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWT---NTTRR---  1520
             +A +A +D Y  ++  +AL+ ++ +Y  NP  VTD+FN  V    M+ T   N TRR   
Sbjct  28    RAHVAVFDNYWTQRQTDALRQTMNSYDPNPLNVTDHFNHHV-SLAMDATESNNGTRRELT  86

Query  1519  ---------HLRGSHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYV  1367
                      H     C A N+ID+CWRCD++WAK+RK+L  C  GFG  TTGG  G  YV
Sbjct  87    QVRKSGRKIHKSSGKCLAYNAIDKCWRCDRNWAKNRKKLTDCVLGFGRKTTGGKDGPIYV  146

Query  1366  VTDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHI  1187
             V D+SD D+ NPKPGTLR+AV ++ PLWIIF +SM+I L+QEL+I  DKTIDGRG  ++I
Sbjct  147   VNDASDNDLVNPKPGTLRYAVTRDGPLWIIFARSMIIKLQQELMITSDKTIDGRGARIYI  206

Query  1186  AYGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWL  1007
               GAGLT+Q+V NVIIH I + HI+P  GG+IRDS +H+GLRT SDGDGIS+FG+ +VW+
Sbjct  207   MEGAGLTLQYVNNVIIHNIYVKHIVPGNGGLIRDSEHHLGLRTKSDGDGISLFGATNVWI  266

Query  1006  DHLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFG  827
             DH++M+RC+DG+IDAI  STA+TISN  F  H  V+L GA D    D  MQ+TVAFN FG
Sbjct  267   DHVSMTRCADGMIDAIQGSTAVTISNSHFTDHQEVMLFGARDEDVIDKKMQITVAFNHFG  326

Query  826   KGLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKRE  647
             K L QRMPRCR+G  H+VNNDYT WEMYAIGG+  PTI+SQGNRF A  N   KQ+TKRE
Sbjct  327   KRLEQRMPRCRFGLIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNEQAKQITKRE  386

Query  646   IVSKNVWKNWQWRSEGDLFLNGAYFVESGE--ELHHYnntrfnntnRIRHRPASYVGRLT  473
                   WK+W W+SEGD FLNGAYFV+SG+             N  RIR +P + V +LT
Sbjct  387   YTPFIEWKSWNWQSEGDYFLNGAYFVQSGKANAWSPKPVNPLPNKFRIRPKPGTMVRKLT  446

Query  472   RTSGALKCKVGRFC  431
               +GAL CK G+ C
Sbjct  447   MDAGALGCKHGKAC  460



>ref|XP_006282594.1| hypothetical protein CARUB_v10004736mg [Capsella rubella]
 gb|EOA15492.1| hypothetical protein CARUB_v10004736mg [Capsella rubella]
Length=469

 Score =   447 bits (1150),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 225/403 (56%), Positives = 284/403 (70%), Gaps = 9/403 (2%)
 Frame = -1

Query  1639  ADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSHCKATNSIDRCWRCD  1460
              DE  Q ++ A   +P+EV     + +  +  N   T RR+L    C   N +D CWRCD
Sbjct  76    GDEPHQHAVAA---DPDEVAAEVAKLIQMSEQN--RTARRNLGFFSCGTGNPVDDCWRCD  130

Query  1459  QDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHAVIQEEPLWI  1280
             ++W K+RKRLA C  GFG    GG  GRFYVVTD +D+D+ NPKPGTLRHAVIQEEPLWI
Sbjct  131   RNWHKNRKRLADCGIGFGRNAIGGRDGRFYVVTDPTDEDVVNPKPGTLRHAVIQEEPLWI  190

Query  1279  IFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIKIHHILPKMG  1100
             +FK+ MVI LKQELI+N  KTIDGRG +VHIA GA +TIQF+ NVIIHG+ IH   P   
Sbjct  191   VFKRDMVIELKQELIMNSFKTIDGRGANVHIANGACITIQFITNVIIHGLHIHDCKPTGN  250

Query  1099  GMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMASTAITISNCKF  920
              M+R +  H G RTM+DGD +SIFGS+H+W+DH ++S C+DGL+DA+M STAIT+SN  F
Sbjct  251   AMVRSTPTHFGWRTMADGDAVSIFGSSHIWVDHNSLSHCADGLVDAVMGSTAITVSNNHF  310

Query  919   NHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNNDYTKWEMYA  740
              HHN V+LLG SD +++D +MQVT+A+N FG+GL+QRMPRCR G+FH+VNNDYT WEMYA
Sbjct  311   THHNEVMLLGHSDTYTKDKLMQVTIAYNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYA  370

Query  739   IGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRSEGDLFLNGAYFVESG  560
             IGGS+ PTI SQGNR+ A  + F K+VTKR     N WK W WRSEGDL LNGA+F  SG
Sbjct  371   IGGSAEPTINSQGNRYAAPMDRFAKEVTKRVETDANEWKKWNWRSEGDLLLNGAFFRSSG  430

Query  559   EELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
                    +  +     +  +P+S V  +T T+GAL C+ GR C
Sbjct  431   AG----ASASYGRAASLAAKPSSMVDTITSTAGALGCRKGRPC  469



>sp|Q9LFP5.1|PLY19_ARATH RecName: Full=Probable pectate lyase 19; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAC01830.1| pectate lyase-like protein [Arabidopsis thaliana]
Length=472

 Score =   447 bits (1150),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 246/453 (54%), Positives = 313/453 (69%), Gaps = 39/453 (9%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNE-------------EVGDT---  1550
             + +I+E D Y  ++ADEA + +LQAY+ +P E+ D+F+E             E GD    
Sbjct  23    RGNISELDEYWSQRADEAREFTLQAYHSDPYEIVDHFHERHYDNSTDVTTPEEDGDAKPE  82

Query  1549  ---------IMNWTNTTRRHLRG----------SHCKATNSIDRCWRCDQDWAKHRKRLA  1427
                      + + TN+TRR LRG            C A+N ID+CWRC  DWAK RK+L 
Sbjct  83    EEEKEFIEMLGSSTNSTRRSLRGKGKGKWSKLKGPCTASNPIDKCWRCRSDWAKRRKKLT  142

Query  1426  FCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLK  1247
              C RGFG  TTGG +GR YVVT + D+DM NPKPGTLRHAVIQ+EPLWIIFK  M I L 
Sbjct  143   RCVRGFGHRTTGGKRGRIYVVTSNLDEDMVNPKPGTLRHAVIQKEPLWIIFKNDMSIRLN  202

Query  1246  QELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIG  1067
             QEL+IN  KTID RG +VH+A+GAG+T+QFV+NVIIHG+ IHHI    GGMIRDSV+H G
Sbjct  203   QELLINSHKTIDARGANVHVAHGAGITMQFVKNVIIHGLHIHHISESSGGMIRDSVDHFG  262

Query  1066  LRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGA  887
             +RT +DGDG+SI+GS+++WLDH++MS+C DGLIDAI+ ST ITISN  F HHN V+LLGA
Sbjct  263   MRTRADGDGLSIYGSSNIWLDHISMSKCQDGLIDAIVGSTGITISNSHFTHHNDVMLLGA  322

Query  886   SDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVS  707
              +    D  MQVTVA+N FGKGL+QRMPR RWGF H+VNNDYT WE+YAIGGS  PTI+S
Sbjct  323   QNTNEADKHMQVTVAYNHFGKGLVQRMPRIRWGFVHVVNNDYTHWELYAIGGSQGPTILS  382

Query  706   QGNRFKASSN-PFTKQVTKREIVSKNVWKNWQWRSEGDLFLNGAYFVESGEELHHYnntr  530
              GNRF A  + P  ++VTKR+  S++ WK+W WRS+ D+F+NGAYF +SG   +      
Sbjct  383   HGNRFIAPPHKPHYREVTKRDYASEDEWKHWNWRSDKDVFMNGAYFRQSGNPQY---KCA  439

Query  529   fnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
                   I+ +    V +LT+ +GAL C+VGR C
Sbjct  440   HTRQQMIKPKNGLAVSKLTKYAGALDCRVGRRC  472



>ref|NP_172894.1| putative pectate lyase 3 [Arabidopsis thaliana]
 sp|Q9M9S2.1|PLY3_ARATH RecName: Full=Probable pectate lyase 3; AltName: Full=Pectate 
lyase A2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF43942.1|AC012188_19 Strong similarity to Pectate Lyase Precursor from Lilium longiflorum 
gi|730290 and contains a Pectate lyase PF|00544 domain. 
EST gb|AW004514 comes from this gene [Arabidopsis thaliana]
 gb|AAQ62871.1| At1g14420 [Arabidopsis thaliana]
 dbj|BAD43564.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43610.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43654.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43743.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43876.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43899.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29161.1| putative pectate lyase 3 [Arabidopsis thaliana]
Length=459

 Score =   446 bits (1148),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 234/432 (54%), Positives = 295/432 (68%), Gaps = 15/432 (3%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTI--MNWTNTTRRHL--  1514
             + ++A +D+Y  ++  +AL+ ++ +Y  +P  VT++FN  V   +      N TRR L  
Sbjct  28    RGNVAVFDSYWTQRQSDALKQTIGSYDPHPLNVTNHFNYHVNIAVDASESRNDTRRELTQ  87

Query  1513  ----RGSH-----CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVT  1361
                 R +H     C A N ID CWRCD++WA +RK+LA C  GFG  TTGG  G  YVV 
Sbjct  88    VRSGRKTHKSSGKCLAYNPIDNCWRCDRNWANNRKKLADCVLGFGRRTTGGKDGPIYVVK  147

Query  1360  DSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAY  1181
             D+SD D+ NPKPGTLRHAV ++ PLWIIF +SM+I L+QEL+I  DKTIDGRG  V+I  
Sbjct  148   DASDNDLINPKPGTLRHAVTRDGPLWIIFARSMIIKLQQELMITSDKTIDGRGARVYIME  207

Query  1180  GAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDH  1001
             GAGLT+QFV NVIIH I + HI+P  GG+IRDS  HIGLRT SDGDGIS+FG+ ++W+DH
Sbjct  208   GAGLTLQFVNNVIIHNIYVKHIVPGNGGLIRDSEAHIGLRTKSDGDGISLFGATNIWIDH  267

Query  1000  LTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKG  821
             ++M+RC+DG+IDAI  STA+TISN  F  H  V+L GA D    D  MQ+TVAFN FGK 
Sbjct  268   VSMTRCADGMIDAIDGSTAVTISNSHFTDHQEVMLFGARDEHVIDKKMQITVAFNHFGKR  327

Query  820   LIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIV  641
             L QRMPRCR+G  H+VNNDYT WEMYAIGG+  PTI+SQGNRF A  N   KQ+TKRE  
Sbjct  328   LEQRMPRCRYGTIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNEEAKQITKREYT  387

Query  640   SKNVWKNWQWRSEGDLFLNGAYFVESGE--ELHHYnntrfnntnRIRHRPASYVGRLTRT  467
                 WK+W W+SEGD FLNGAYFV+SG+         T   N   IR +P + V +LT  
Sbjct  388   PYGEWKSWNWQSEGDYFLNGAYFVQSGKANAWSSKPKTPLPNKFTIRPKPGTMVRKLTMD  447

Query  466   SGALKCKVGRFC  431
             +G L CK+G  C
Sbjct  448   AGVLGCKLGEAC  459



>gb|AAF19196.1|AF206320_1 pectate lyase 2 [Musa acuminata AAA Group]
Length=454

 Score =   446 bits (1147),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 229/417 (55%), Positives = 288/417 (69%), Gaps = 13/417 (3%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH  1502
              A+    DA L+++A   +  + +A   +PEEV       V  TI+N  +T RR L    
Sbjct  51    SANATSADASLEERA---VTRAAEAAVDDPEEVA----STVLTTIIN--STARRSLGYLS  101

Query  1501  CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPG  1322
             C + N ID CWRCD DW  +RK+LA C  GFG    GG  G  YVVTDS D D  NP+PG
Sbjct  102   CGSGNPIDDCWRCDPDWHVNRKKLADCGIGFGRNAIGGRDGELYVVTDSGDDDPVNPRPG  161

Query  1321  TLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVI  1142
             TLR+AVIQ+ PLWI FK  M ITLK+ELI+N  KTIDGRGV+VHIA GA +TIQ++ NVI
Sbjct  162   TLRYAVIQDVPLWITFKHDMEITLKEELIMNSFKTIDGRGVNVHIANGACITIQYITNVI  221

Query  1141  IHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDA  962
             IHG+ IH   P    M+R S +H G RTM+DGD +SIFGS+H+W+DH ++S C+DGL+DA
Sbjct  222   IHGLHIHDCKPTGNAMVRSSPSHYGWRTMADGDAVSIFGSSHIWVDHCSLSNCADGLVDA  281

Query  961   IMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFF  782
             +M STAIT+SN  F HHN V+LLG +D ++ D+IMQVT+AFN FG+GLIQRMPRCR G+F
Sbjct  282   VMGSTAITVSNNYFTHHNEVMLLGHTDSYARDSIMQVTIAFNHFGEGLIQRMPRCRHGYF  341

Query  781   HIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRSE  602
             H+VNNDYT WEMYAIGGS+ PTI SQGNR+ A +NPF K+VTKR    ++ WKNW WRSE
Sbjct  342   HVVNNDYTHWEMYAIGGSANPTINSQGNRYLAPTNPFAKEVTKRVDTDQSTWKNWNWRSE  401

Query  601   GDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             GDL LNGA+F  SG       +  +   +    +P+S V  LT  +G L C+VG  C
Sbjct  402   GDLLLNGAFFTPSGAGA----SASYARASSFGAKPSSLVDTLTSDAGVLSCQVGTRC  454



>ref|XP_010447044.1| PREDICTED: probable pectate lyase 8 [Camelina sativa]
Length=417

 Score =   444 bits (1143),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 227/389 (58%), Positives = 280/389 (72%), Gaps = 10/389 (3%)
 Frame = -1

Query  1597  NPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSHCKATNSIDRCWRCDQDWAKHRKRLAFCA  1418
             NPEEV    +  + ++      T RR L    C   N ID CWRCD+ W   RKRLA C+
Sbjct  39    NPEEVAAMVDMSIRNS------TERRRLGYFSCSTGNPIDDCWRCDRKWQLRRKRLADCS  92

Query  1417  rgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQEL  1238
              GFG    GG  GR+YVVT+ +D +  NP PGTLRHAVIQEEPLWIIFK+ MVITLKQEL
Sbjct  93    IGFGRNAIGGRDGRYYVVTNPNDDNPVNPIPGTLRHAVIQEEPLWIIFKRDMVITLKQEL  152

Query  1237  IINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRT  1058
             I+N  KTIDGRGV+VHIA GA LTIQ+V N+I+HGI IH   P    M+R S +H G R+
Sbjct  153   IMNSFKTIDGRGVNVHIANGACLTIQYVTNIIVHGIHIHDCKPTGNAMVRSSPSHYGWRS  212

Query  1057  MSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDL  878
             M+DGD ISIFGS+H+W+DH ++S C+DGL+DA+M+STAIT+SN  F HHN V+LLG SD 
Sbjct  213   MADGDAISIFGSSHIWIDHNSLSNCADGLVDAVMSSTAITVSNNFFTHHNEVMLLGHSDS  272

Query  877   FSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGN  698
             ++ D +MQVT+A+N FG+GLIQRMPRCR G+FH+VNNDYT WEMYAIGGS+ PTI SQGN
Sbjct  273   YTRDKVMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTINSQGN  332

Query  697   RFKASSNPFTKQVTKREIVSKNVWKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnnt  518
             RF A +NPF K+VTKRE   ++ WK+W WRSEGDLFLNGA+F  SG          +   
Sbjct  333   RFLAPTNPFAKEVTKREYTGQSKWKHWNWRSEGDLFLNGAFFTRSGAG----AGANYARA  388

Query  517   nRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             + +  + +S VG +T  SGAL C+ GR C
Sbjct  389   SSLSAKSSSLVGTMTSYSGALNCRAGRRC  417



>ref|XP_010496063.1| PREDICTED: probable pectate lyase 3 [Camelina sativa]
Length=455

 Score =   446 bits (1147),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 237/435 (54%), Positives = 297/435 (68%), Gaps = 23/435 (5%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFN----------EEVGDTIMNWTNT  1529
             A +A +D+Y  ++  +AL+ +  +Y  NP  VT++FN          E + DT    T  
Sbjct  25    AHVAVFDSYWMQRKSDALKQTFGSYDPNPLNVTNHFNYHVNLAVDATESINDTRRELTQV  84

Query  1528  -TRRHLR--GSHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTD  1358
              +RR L+  G  C A N ID+CWRCD++WA +RK+LA CA GFG  TTGG  G  YVVTD
Sbjct  85    RSRRKLQKHGGKCVAYNPIDKCWRCDRNWANNRKKLADCALGFGRKTTGGKDGPIYVVTD  144

Query  1357  SSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYG  1178
             +SD D+ NPKPGTLR+AV ++ PLWIIF +SM+I L+QEL+I  DKTIDGRG  V+I  G
Sbjct  145   ASDNDLINPKPGTLRYAVTRDGPLWIIFARSMIIKLQQELMITSDKTIDGRGARVYIMEG  204

Query  1177  AGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHL  998
             AGLT+QFV NVIIH I + HI+   GG+IRDS  HIGLRT SDGDGIS+FG+ ++W+DH+
Sbjct  205   AGLTLQFVNNVIIHNIYVKHIVTGNGGLIRDSEQHIGLRTKSDGDGISLFGATNIWIDHV  264

Query  997   TMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGL  818
             +M+RC DG+IDAI  STA+TISN  F  H  V+L GA D    D  MQ+TVAFN FGK L
Sbjct  265   SMTRCEDGMIDAIDGSTAVTISNSHFTDHQEVMLFGARDEHVIDKKMQITVAFNHFGKRL  324

Query  817   IQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVS  638
              QRMPRCR+G  H+VNNDYT WEMYAIGG+  PTI+SQGNRF A  N   KQ+TKRE   
Sbjct  325   EQRMPRCRFGTIHVVNNDYTHWEMYAIGGNMDPTIISQGNRFIAPPNEQAKQITKREYTP  384

Query  637   KNVWKNWQWRSEGDLFLNGAYFVESGE------ELHHYnntrfnntnRIRHRPASYVGRL  476
                WK+W W+SEGD FLNGAYFV+SG+      +LH+       N   IR +P   V +L
Sbjct  385   FVEWKSWNWQSEGDYFLNGAYFVQSGKANAWSAKLHN----PIPNKFAIRPKPGMMVRKL  440

Query  475   TRTSGALKCKVGRFC  431
             T  +G L CK G+ C
Sbjct  441   TMEAGVLGCKHGKAC  455



>ref|XP_009385867.1| PREDICTED: probable pectate lyase 8 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=454

 Score =   446 bits (1147),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 229/417 (55%), Positives = 286/417 (69%), Gaps = 13/417 (3%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH  1502
              A+    DA L+++A   +  + +A   +PEEV       V  TI+N  +T RR L    
Sbjct  51    SANATSADASLEERA---VTRAAEAAVDDPEEVA----STVLTTIIN--STARRSLGYLS  101

Query  1501  CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPG  1322
             C + N ID CWRCD DW  +RK+LA C  GFG    GG  G  YVVTDS D D  NP+PG
Sbjct  102   CGSGNPIDDCWRCDPDWHVNRKKLADCGIGFGRNAIGGRDGELYVVTDSGDDDPVNPRPG  161

Query  1321  TLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVI  1142
             TLR+AVIQ+ PLWI FK  M ITLK+ELI+N  KTIDGRGV+VHIA GA +TIQ++ NVI
Sbjct  162   TLRYAVIQDVPLWITFKHDMEITLKEELIMNSFKTIDGRGVNVHIANGACITIQYITNVI  221

Query  1141  IHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDA  962
             IHG+ IH   P    M+R S +H G RTM+DGD +SIFGS+H+W+DH ++S C+DGL+DA
Sbjct  222   IHGLHIHDCKPTGNAMVRSSPSHYGWRTMADGDAVSIFGSSHIWVDHCSLSNCADGLVDA  281

Query  961   IMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFF  782
             +M STAIT+SN  F HHN V+LLG +D ++ D+IMQVT+AFN FG+GLIQRMPRCR G+F
Sbjct  282   VMGSTAITVSNNYFTHHNEVMLLGHTDSYARDSIMQVTIAFNHFGEGLIQRMPRCRHGYF  341

Query  781   HIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRSE  602
             H+VNNDYT WEMYAIGGS+ PTI SQGNR+ A +NPF K+VTKR    ++ WKNW WRSE
Sbjct  342   HVVNNDYTHWEMYAIGGSANPTINSQGNRYLAPTNPFAKEVTKRVDTDQSTWKNWNWRSE  401

Query  601   GDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             GDL LNGA+F  SG           +       +P+S V  LT  +G L C+VG  C
Sbjct  402   GDLLLNGAFFTPSGAGASASYARASSFGA----KPSSLVDTLTSDAGVLSCQVGTRC  454



>ref|NP_001057945.1| Os06g0583900 [Oryza sativa Japonica Group]
 dbj|BAD68734.1| putative pectate lyase [Oryza sativa Japonica Group]
 dbj|BAF19859.1| Os06g0583900 [Oryza sativa Japonica Group]
 dbj|BAG93046.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC80871.1| hypothetical protein OsI_23497 [Oryza sativa Indica Group]
Length=448

 Score =   446 bits (1146),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 243/424 (57%), Positives = 296/424 (70%), Gaps = 14/424 (3%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFN-------EEVGDTIMNWTNTTR  1523
             +A+I EYD Y +K+   A  ++   Y  +P EVT++FN       EE G   +     T+
Sbjct  32    EANIGEYDEYWQKRKLMADAAAEATYKRDPFEVTNSFNRAVHRSEEESGRRELA---MTK  88

Query  1522  RHLRGSHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKD  1343
             R      CKATN IDRCWRC  DW   RKRLA CA+GFG  TTGGL G+FY+VTD +D D
Sbjct  89    RKKFAGPCKATNPIDRCWRCRADWVTDRKRLARCAQGFGRNTTGGLAGKFYLVTDGTDDD  148

Query  1342  MENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTI  1163
             +ENP+PGTLR  VIQ+EPLWIIF K M+I LK+E++IN DKTIDGRG  V I  GA +T+
Sbjct  149   VENPRPGTLRWGVIQDEPLWIIFAKDMIINLKEEMMINSDKTIDGRGAQVRITNGAQVTV  208

Query  1162  QFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRC  983
             Q   NVIIH I IH IL   GGMIRDS  H G RT SDGDGISIFGS +VWLDHL++S C
Sbjct  209   QNSNNVIIHNIHIHDILQGKGGMIRDSPEHFGFRTQSDGDGISIFGSTNVWLDHLSLSNC  268

Query  982   SDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMP  803
              DGLID I  ST +TISNC   +HN V+L G+SD FSED IMQ+TVAFN FG+GL+QRMP
Sbjct  269   QDGLIDVIAKSTGVTISNCHLTNHNDVMLFGSSDSFSEDQIMQITVAFNHFGRGLVQRMP  328

Query  802   RCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWK  623
             RCRWGFFH+VNNDYT W MYAIGGS  PTI+SQGNR+ A  N   K++TK+   ++  WK
Sbjct  329   RCRWGFFHVVNNDYTHWLMYAIGGSKNPTIISQGNRYIAPPNLAAKRITKQLGATEEEWK  388

Query  622   NWQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKV  443
             NW W SE DLF+ GAYF  SG  +      +F+N + I+ +P SYV RLTR +G++ C  
Sbjct  389   NWVWHSEEDLFMEGAYFTTSGGPIQK----QFSNKDLIKPKPGSYVTRLTRFAGSIPCVA  444

Query  442   GRFC  431
             G+ C
Sbjct  445   GKPC  448



>ref|XP_010243989.1| PREDICTED: probable pectate lyase 8 [Nelumbo nucifera]
Length=444

 Score =   445 bits (1145),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 235/415 (57%), Positives = 289/415 (70%), Gaps = 13/415 (3%)
 Frame = -1

Query  1648  KKKADEALQSSLQAYYHNPEEVTDNFNE-------EVGDTI-MNWTNTT-RRHLRGSHCK  1496
             + +  E LQSS  +      E T+ +NE       EV   + M+  N+T RR+L    C 
Sbjct  34    RTEGTEQLQSSKNSTMEGRLEETEPWNEHAVDNPEEVASMVDMSIRNSTERRNLGYLSCG  93

Query  1495  ATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGTL  1316
               N ID CWRCD  W  HRKRLA C  GFG    GG  GRFYVVTD SD D  NP+PGTL
Sbjct  94    TGNPIDDCWRCDPQWHLHRKRLADCGIGFGRNAIGGRDGRFYVVTDPSDDDPVNPRPGTL  153

Query  1315  RHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIH  1136
             R+AVIQ++PLWI+FK+ MVITLKQELI+N  KTIDGRGV+VHIA GA +TIQF+ NVIIH
Sbjct  154   RYAVIQDKPLWIVFKRDMVITLKQELIMNSFKTIDGRGVNVHIANGACITIQFITNVIIH  213

Query  1135  GIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIM  956
             G+ IH   P    M+R S +H G RTM+DGD +SIFGS+H+W+DH ++S C+DGL+DA+M
Sbjct  214   GLHIHDCKPTGNAMVRSSPSHYGWRTMADGDAVSIFGSSHIWVDHNSLSNCADGLVDAVM  273

Query  955   ASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHI  776
              STAITISN  F HHN V+LLG SD ++ D  MQVT+A+N FG+GLIQRMPRCR G+FH+
Sbjct  274   GSTAITISNNYFTHHNEVMLLGHSDSYTRDKQMQVTIAYNHFGEGLIQRMPRCRHGYFHV  333

Query  775   VNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRSEGD  596
             VNNDYT WEMYAIGGS+ PTI SQGNR+ A +NPF K+VTKR   S  VWKNW WRSEGD
Sbjct  334   VNNDYTHWEMYAIGGSADPTINSQGNRYLAPTNPFAKEVTKRVDTSSGVWKNWNWRSEGD  393

Query  595   LFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             L LNGAYF  SG       +  ++  + +  + +S V  +T  +GAL C+ G  C
Sbjct  394   LLLNGAYFTPSGAGA----SASYSRASSLGAKSSSMVASITSGAGALSCRRGSQC  444



>ref|XP_010486231.1| PREDICTED: probable pectate lyase 8 [Camelina sativa]
Length=419

 Score =   444 bits (1143),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 227/389 (58%), Positives = 280/389 (72%), Gaps = 10/389 (3%)
 Frame = -1

Query  1597  NPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSHCKATNSIDRCWRCDQDWAKHRKRLAFCA  1418
             NPEEV    +  + ++      T RR L    C   N ID CWRCD+ W   RKRLA C+
Sbjct  41    NPEEVAAMVDMSIRNS------TERRRLGYFSCSTGNPIDDCWRCDRKWQLRRKRLADCS  94

Query  1417  rgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQEL  1238
              GFG    GG  GR+YVVT+ +D +  NP PGTLRHAVIQEEPLWIIFK+ MVITLKQEL
Sbjct  95    IGFGRNAIGGRDGRYYVVTNPNDDNPVNPIPGTLRHAVIQEEPLWIIFKRDMVITLKQEL  154

Query  1237  IINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRT  1058
             I+N  KTIDGRGV+VHIA GA LTIQ+V N+I+HGI IH   P    M+R S +H G R+
Sbjct  155   IMNSFKTIDGRGVNVHIANGACLTIQYVTNIIVHGIHIHDCKPTGNAMVRSSPSHYGWRS  214

Query  1057  MSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDL  878
             M+DGD ISIFGS+H+W+DH ++S C+DGL+DA+M+STAIT+SN  F HHN V+LLG SD 
Sbjct  215   MADGDAISIFGSSHIWIDHNSLSNCADGLVDAVMSSTAITVSNNFFTHHNEVMLLGHSDS  274

Query  877   FSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGN  698
             ++ D +MQVT+A+N FG+GLIQRMPRCR G+FH+VNNDYT WEMYAIGGS+ PTI SQGN
Sbjct  275   YTRDKVMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTINSQGN  334

Query  697   RFKASSNPFTKQVTKREIVSKNVWKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnnt  518
             RF A +NPF K+VTKRE   ++ WK+W WRSEGDLFLNGA+F  SG          +   
Sbjct  335   RFLAPTNPFAKEVTKREYTGQSKWKHWNWRSEGDLFLNGAFFTRSGAG----AGANYARA  390

Query  517   nRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             + +  + +S VG +T  SGAL C+ GR C
Sbjct  391   SSLSAKSSSLVGTMTSYSGALNCRAGRRC  419



>gb|ACF87417.1| unknown [Zea mays]
Length=444

 Score =   445 bits (1145),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 225/420 (54%), Positives = 292/420 (70%), Gaps = 12/420 (3%)
 Frame = -1

Query  1675  DIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMN-----WTNTTRRHLR  1511
             ++ ++D +L+K+ + A  S+ +AY  +P  VT++FN  V   + +     W    R+H +
Sbjct  32    NVGQFDDHLQKRKELAEASAREAYRPDPYNVTNSFNAAVHRAVSSSRREMWERP-RKHKK  90

Query  1510  GSHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENP  1331
                C+ATN ID+CWRC +DWA  R+RLA CARGFG  TTGGL G+ YVVTD +D D+ NP
Sbjct  91    RGPCRATNPIDKCWRCRRDWATDRQRLARCARGFGHATTGGLGGKIYVVTDPTDLDVVNP  150

Query  1330  KPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVR  1151
             +PGTLR  VIQ  PLWIIF +SM+I L QEL+++ DKTIDGRG  VHIA GAG+T+Q  +
Sbjct  151   RPGTLRWGVIQPGPLWIIFARSMIIQLSQELLMSSDKTIDGRGAQVHIANGAGITVQLAQ  210

Query  1150  NVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGL  971
             NVIIH + +H +   MGG++RDS  HIG RT +DGDGIS+F + +VW+DH++MS C DGL
Sbjct  211   NVIIHNLHVHDVKHTMGGLMRDSPTHIGSRTRADGDGISLFSATNVWIDHISMSNCEDGL  270

Query  970   IDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRW  791
             ID + +ST ITISNC F +HN V+L GASD + +D IMQ+TVAFN FG+GL+QRMPRCRW
Sbjct  271   IDVVQSSTGITISNCHFTNHNDVMLFGASDSWPQDQIMQITVAFNHFGRGLVQRMPRCRW  330

Query  790   GFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQW  611
             GFFH+VNNDYT W MYAIGG   PTI+SQGNR+ A  N   K +TK     + VWKNW W
Sbjct  331   GFFHVVNNDYTHWLMYAIGGGDAPTIISQGNRYIAPPNIAAKVITK-HYAEEGVWKNWVW  389

Query  610   RSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
              +E DLF+NGA F  SG           +    ++ +P +YV RLTR SG L C  G+ C
Sbjct  390   HTEDDLFMNGAIFNPSGGAPKQV-----DTNEWVKPKPGTYVTRLTRFSGTLSCCTGKPC  444



>ref|XP_007157384.1| hypothetical protein PHAVU_002G065800g [Phaseolus vulgaris]
 gb|ESW29378.1| hypothetical protein PHAVU_002G065800g [Phaseolus vulgaris]
Length=448

 Score =   445 bits (1145),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 235/415 (57%), Positives = 284/415 (68%), Gaps = 8/415 (2%)
 Frame = -1

Query  1663  YDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH----CK  1496
             +D Y K +   A + + +AY  +P   T N    + D I       RR+L G      C 
Sbjct  38    FDGYWKGRKQVAEKQNQEAYITDPYSFTINMTNNISDLITG-EEKGRRNLAGKQSQDSCL  96

Query  1495  ATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGTL  1316
             ATN IDRCWRCD  W+++RK+LA C +GFG  T GG KG FYVVT + D DM NP PGTL
Sbjct  97    ATNPIDRCWRCDPKWSENRKKLADCVQGFGRDTIGGKKGPFYVVTSNLDNDMVNPVPGTL  156

Query  1315  RHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIH  1136
             RHAV +  PLWIIF  SM I L QELI+  DKTIDGRG  ++I  GAG TIQFV+NVIIH
Sbjct  157   RHAVTRNGPLWIIFAHSMNIRLSQELIVAGDKTIDGRGADIYIVNGAGFTIQFVKNVIIH  216

Query  1135  GIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIM  956
             GIKI  I    GG+IRDS +H GLRT SDGDGISIFGS+++W+DH++M    DGLIDAI 
Sbjct  217   GIKIFDINAGQGGLIRDSESHYGLRTQSDGDGISIFGSSYIWIDHVSMRNARDGLIDAIQ  276

Query  955   ASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHI  776
              STAITISN  F  HN V+L GASD   ED IMQ+T+ FN FGK L+QRMPRCR+GF H+
Sbjct  277   GSTAITISNSHFTDHNEVMLFGASDSHEEDKIMQITLVFNHFGKRLVQRMPRCRFGFIHV  336

Query  775   VNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRSEGD  596
             VNNDYT WEMYAIGGS  PTI+S+GNRF A  +   KQ+TKRE   +  WK WQWRS  D
Sbjct  337   VNNDYTHWEMYAIGGSKHPTIISEGNRFVAPDSKDAKQITKREYSLEPEWKKWQWRSIKD  396

Query  595   LFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
               +NGA+F+ESG +L +     F   + I  RP +YVGRLTR +G+L+C VG+ C
Sbjct  397   EVINGAFFIESGPDLTN---RPFTRKDMISSRPGTYVGRLTRHAGSLRCIVGKPC  448



>ref|XP_004966014.1| PREDICTED: pectate lyase-like [Setaria italica]
Length=486

 Score =   447 bits (1149),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 244/426 (57%), Positives = 301/426 (71%), Gaps = 13/426 (3%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH  1502
             +A+I E+D Y +++   A  ++   Y H+P EV +  N  V  +I     +TRR + G  
Sbjct  65    EANIGEFDDYWRQRKLMADAAAEATYQHDPIEVPNQLNRAVHRSIKKEDISTRREMLGQK  124

Query  1501  -------CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKD  1343
                    CKATN IDRCWRC +DWA  RKRLA CA+GFG  TTGGL G+FYVVTD +D D
Sbjct  125   KGKMNGPCKATNPIDRCWRCRKDWATDRKRLARCAQGFGRNTTGGLAGKFYVVTDGTDDD  184

Query  1342  MENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTI  1163
             + NP+PGTLR AVIQ EPLWI F K+M+ITLK+ELII  DKTIDGRGV V IA GA LT+
Sbjct  185   VVNPRPGTLRWAVIQIEPLWITFAKTMIITLKEELIIRGDKTIDGRGVQVRIANGAQLTV  244

Query  1162  QFVRNVIIHGIKIHHILP--KMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMS  989
             QF  NVIIH I I+ I+   K GG IRDS +H G RT+SDGDGI++FGS +VWLDHL++S
Sbjct  245   QFANNVIIHNIHINDIISSNKNGGNIRDSPDHFGWRTVSDGDGITVFGSTNVWLDHLSLS  304

Query  988   RCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQR  809
              C DGLID I  ST +TISNC   +HN V+L  +SD   ED IMQ+TVAFN FG+GL+QR
Sbjct  305   NCQDGLIDVIAKSTGVTISNCHMTNHNDVMLFSSSDKHPEDQIMQITVAFNHFGRGLVQR  364

Query  808   MPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNV  629
             MPRCRWGFFH+VNNDYT W MYAIGGS  PTI+SQGNR+ A  N   KQVTK+    ++ 
Sbjct  365   MPRCRWGFFHVVNNDYTHWLMYAIGGSKAPTIISQGNRYIAPPNLAAKQVTKQHDAPESE  424

Query  628   WKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKC  449
             WKNW W SE DLF+ GAYF  +G +++     +FN  + I+ +P SYV RLTR +G+L C
Sbjct  425   WKNWVWHSEDDLFMEGAYFTVTGGQINR----QFNKKDLIKPKPGSYVTRLTRFAGSLDC  480

Query  448   KVGRFC  431
             K G+ C
Sbjct  481   KPGKPC  486



>ref|XP_002437204.1| hypothetical protein SORBIDRAFT_10g022830 [Sorghum bicolor]
 gb|EER88571.1| hypothetical protein SORBIDRAFT_10g022830 [Sorghum bicolor]
Length=454

 Score =   446 bits (1146),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 238/428 (56%), Positives = 295/428 (69%), Gaps = 14/428 (3%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRH-----  1517
             +A+I ++D Y +++   A  ++   Y H+P EVT+  N  V  ++     +TRR      
Sbjct  30    EANIGDFDDYWRQRKLMADAAAEATYKHDPLEVTNQLNRAVHRSVEKEDMSTRRRAMMGH  89

Query  1516  ----LRGSHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSD  1349
                 L    C+ATN IDRCWRC QDWA  RKRLA CA+GFG  TTGGL G+FYVVTD +D
Sbjct  90    KKGKLNNGPCEATNPIDRCWRCRQDWATDRKRLARCAQGFGRNTTGGLAGKFYVVTDGTD  149

Query  1348  KDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGL  1169
              D+ NP+PGTLR AVIQ EPLWI F ++M+ITLK+ELII  DKTIDGRG  V IA GA L
Sbjct  150   DDVVNPRPGTLRWAVIQIEPLWITFARTMIITLKEELIIQGDKTIDGRGAQVRIANGAQL  209

Query  1168  TIQFVRNVIIHGIKIHHILP--KMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLT  995
             T+QF  NVIIH + I+ I+   K GG IRDS +H G RT+SDGDGI++FGS +VWLDHL+
Sbjct  210   TVQFANNVIIHNVHINDIMSSNKNGGNIRDSPDHFGWRTVSDGDGITLFGSTNVWLDHLS  269

Query  994   MSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLI  815
             +S C DGLID I+ ST +TISNC   +HN V+L  +SD   ED IMQ+TVAFN FG+GL+
Sbjct  270   LSNCQDGLIDVIVKSTGVTISNCHMTNHNDVMLFSSSDKHPEDQIMQITVAFNHFGRGLV  329

Query  814   QRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSK  635
             QRMPRCRWGFFH+VNNDYT W MYAIGGS  PTI+SQGNR+ A  N   K VTK     +
Sbjct  330   QRMPRCRWGFFHVVNNDYTHWLMYAIGGSKAPTIISQGNRYIAPPNLAAKLVTKHHDAPE  389

Query  634   NVWKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGAL  455
             + WKNW W SE DLF+ GA F  SG +     N  F+  + I+ +  SYV RLTR +GAL
Sbjct  390   SEWKNWVWHSENDLFMEGANFTVSGGQ---KINRNFHKKDLIKPKNGSYVTRLTRYAGAL  446

Query  454   KCKVGRFC  431
              C+ G+ C
Sbjct  447   ACRPGKPC  454



>ref|XP_008679844.1| PREDICTED: pectate lyase [Zea mays]
 gb|AFW66064.1| pectate lyase-like protein [Zea mays]
Length=444

 Score =   445 bits (1145),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 224/419 (53%), Positives = 291/419 (69%), Gaps = 10/419 (2%)
 Frame = -1

Query  1675  DIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMN----WTNTTRRHLRG  1508
             ++ ++D +L+K+ + A  S+ +AY  +P  VT++FN  V   + +         R+H + 
Sbjct  32    NVGQFDDHLQKRKELAEASAREAYRPDPYNVTNSFNAAVHRAVSSSRREMRERPRKHKKR  91

Query  1507  SHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPK  1328
               C+ATN ID+CWRC +DWA  R+RLA CARGFG  TTGGL G+ YVVTD +D D+ NP+
Sbjct  92    GPCRATNPIDKCWRCRRDWATDRQRLARCARGFGHATTGGLGGKIYVVTDPTDLDVVNPR  151

Query  1327  PGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRN  1148
             PGTLR  VIQ  PLWIIF +SM+I L QEL+++ DKTIDGRG  VHIA GAG+T+Q  +N
Sbjct  152   PGTLRWGVIQPGPLWIIFARSMIIQLSQELLMSSDKTIDGRGAQVHIANGAGITVQLAQN  211

Query  1147  VIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLI  968
             VIIH + +H +   MGG++RDS  HIG RT +DGDGIS+F + +VW+DH++MS C DGLI
Sbjct  212   VIIHNLHVHDVKHTMGGLMRDSPTHIGSRTRADGDGISLFSATNVWIDHISMSNCEDGLI  271

Query  967   DAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWG  788
             D + +ST ITISNC F +HN V+L GASD + +D IMQ+TVAFN FG+GL+QRMPRCRWG
Sbjct  272   DVVQSSTGITISNCHFTNHNDVMLFGASDSWPQDQIMQITVAFNHFGRGLVQRMPRCRWG  331

Query  787   FFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWR  608
             FFH+VNNDYT W MYAIGG   PTI+SQGNR+ A  N   K +TK     + VWKNW W 
Sbjct  332   FFHVVNNDYTHWLMYAIGGGDAPTIISQGNRYIAPPNIAAKVITK-HYAEEGVWKNWVWH  390

Query  607   SEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             +E DLF+NGA F  SG           +    ++ +P +YV RLTR SG L C  G+ C
Sbjct  391   TEDDLFMNGAIFNPSGGAPKQV-----DTNEWVKPKPGTYVTRLTRFSGTLSCCTGKPC  444



>ref|XP_002265100.1| PREDICTED: probable pectate lyase 8 [Vitis vinifera]
 emb|CBI37263.3| unnamed protein product [Vitis vinifera]
Length=445

 Score =   445 bits (1145),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 229/389 (59%), Positives = 277/389 (71%), Gaps = 10/389 (3%)
 Frame = -1

Query  1597  NPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSHCKATNSIDRCWRCDQDWAKHRKRLAFCA  1418
             NPEEV    +  + ++      T RR+L    C   N ID CWRCD  W  HRKRLA C 
Sbjct  67    NPEEVASMVDMSIRNS------TERRNLGYFSCGTGNPIDDCWRCDPHWQLHRKRLADCG  120

Query  1417  rgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQEL  1238
              GFG    GG  GR+YVVTD  D D  NP+PGTLRHAVIQ++PLWI+FK+ MVI LKQEL
Sbjct  121   IGFGRNAIGGRDGRYYVVTDPGDYDAVNPRPGTLRHAVIQDKPLWIVFKRDMVIKLKQEL  180

Query  1237  IINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRT  1058
             I+N  KTID RGV+VHIA GA +TIQF+ NVIIHG+ IH   P    M+R S +H G RT
Sbjct  181   IMNSFKTIDARGVNVHIANGACITIQFITNVIIHGLNIHDCKPTGNAMVRSSPSHYGWRT  240

Query  1057  MSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDL  878
             M+DGDGISIFGS+H+W+DH ++S C+DGLIDA+M STAITISN  F HHN V+LLG SD 
Sbjct  241   MADGDGISIFGSSHIWIDHNSLSNCADGLIDAVMGSTAITISNNYFTHHNEVMLLGHSDS  300

Query  877   FSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGN  698
             ++ D  MQVT+A+N FG+GLIQRMPRCR G+FH+VNNDYT WEMYAIGGS+ PTI SQGN
Sbjct  301   YTRDKQMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQGN  360

Query  697   RFKASSNPFTKQVTKREIVSKNVWKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnnt  518
             R+ A +NPF K+VTKR I S +VWK+W WRSEGDL LNGAYF  SG          +   
Sbjct  361   RYLAPANPFAKEVTKRVITSNSVWKHWNWRSEGDLLLNGAYFTPSGAGA----AASYARA  416

Query  517   nRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             + +  + +S VG +T  +GAL C+ GR C
Sbjct  417   SSLGAKSSSMVGTITSGAGALSCRRGRQC  445



>ref|XP_010264036.1| PREDICTED: probable pectate lyase 8 [Nelumbo nucifera]
Length=440

 Score =   445 bits (1144),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 232/406 (57%), Positives = 281/406 (69%), Gaps = 12/406 (3%)
 Frame = -1

Query  1648  KKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSHCKATNSIDRCW  1469
               KAD   Q+  +    NPEEV    +  + ++      T RR+L    C   N ID CW
Sbjct  47    SSKADRLEQA--EHAVDNPEEVAAMVDMSIRNS------TARRNLGFLSCGTGNPIDDCW  98

Query  1468  RCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHAVIQEEP  1289
             RCD  W   RKRLA C  GFG    GG  GRFYVVTD  D D  NP+PGTLRHAVIQ+EP
Sbjct  99    RCDPMWHLRRKRLADCGIGFGRNAIGGRDGRFYVVTDPGDDDPVNPRPGTLRHAVIQDEP  158

Query  1288  LWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIKIHHILP  1109
             LWI+FK+ MVITLKQELI+N  KTIDGRGV+VHIA GA +TIQF+ NVIIHGI IH   P
Sbjct  159   LWIVFKRDMVITLKQELIMNSFKTIDGRGVNVHIANGACITIQFITNVIIHGIHIHDCKP  218

Query  1108  KMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMASTAITISN  929
                 M+R S +H G RTM+DGD +SIFGS+H+W+DH ++S C+DGL+DAIM STAITISN
Sbjct  219   TGNAMVRSSPSHYGWRTMADGDAVSIFGSSHIWVDHNSLSNCADGLVDAIMGSTAITISN  278

Query  928   CKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNNDYTKWE  749
               F HHN V+LLG SD ++ D +MQVT+A+N FG+GLIQRMPRCR G+FH+VNNDYT WE
Sbjct  279   NYFTHHNEVMLLGHSDSYTRDKMMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWE  338

Query  748   MYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRSEGDLFLNGAYFV  569
             MYAIGGS+ PTI SQGNR+ A +NPF K+VTKR      VWKNW WRSEGDL LNGAYF 
Sbjct  339   MYAIGGSANPTINSQGNRYLAPTNPFAKEVTKRVSTDSGVWKNWNWRSEGDLLLNGAYFT  398

Query  568   ESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
              SG       +  ++  + +  + +S V  +T  +GAL C+ G  C
Sbjct  399   PSGAGA----SASYSRASSLGAKSSSMVASITSGAGALSCRKGSRC  440



>emb|CAN75298.1| hypothetical protein VITISV_008675 [Vitis vinifera]
Length=445

 Score =   445 bits (1144),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 229/389 (59%), Positives = 277/389 (71%), Gaps = 10/389 (3%)
 Frame = -1

Query  1597  NPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSHCKATNSIDRCWRCDQDWAKHRKRLAFCA  1418
             NPEEV    +  + ++      T RR+L    C   N ID CWRCD  W  HRKRLA C 
Sbjct  67    NPEEVASMVDMSIRNS------TERRNLGYFSCGTGNPIDDCWRCDPHWQLHRKRLADCG  120

Query  1417  rgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQEL  1238
              GFG    GG  GR+YVVTD  D D  NP+PGTLRHAVIQ++PLWI+FK+ MVI LKQEL
Sbjct  121   IGFGRNAIGGRDGRYYVVTDPGDYDAVNPRPGTLRHAVIQDKPLWIVFKRDMVIKLKQEL  180

Query  1237  IINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRT  1058
             I+N  KTID RGV+VHIA GA +TIQF+ NVIIHG+ IH   P    M+R S +H G RT
Sbjct  181   IMNSFKTIDARGVNVHIANGACITIQFITNVIIHGLNIHDCKPTGNAMVRSSPSHYGWRT  240

Query  1057  MSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDL  878
             M+DGDGISIFGS+H+W+DH ++S C+DGLIDA+M STAITISN  F HHN V+LLG SD 
Sbjct  241   MADGDGISIFGSSHIWIDHNSLSNCADGLIDAVMGSTAITISNNYFTHHNEVMLLGHSDS  300

Query  877   FSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGN  698
             ++ D  MQVT+A+N FG+GLIQRMPRCR G+FH+VNNDYT WEMYAIGGS+ PTI SQGN
Sbjct  301   YTRDKQMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQGN  360

Query  697   RFKASSNPFTKQVTKREIVSKNVWKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnnt  518
             R+ A +NPF K+VTKR I S +VWK+W WRSEGDL LNGAYF  SG          +   
Sbjct  361   RYLAPANPFAKEVTKRVITSNSVWKHWNWRSEGDLLLNGAYFTPSGAGA----AASYARA  416

Query  517   nRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             + +  + +S VG +T  +GAL C+ GR C
Sbjct  417   SSLGAKSSSMVGTMTSGAGALSCRRGRQC  445



>emb|CBI15265.3| unnamed protein product [Vitis vinifera]
Length=398

 Score =   443 bits (1140),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 233/418 (56%), Positives = 287/418 (69%), Gaps = 44/418 (11%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR--GS  1505
             A+I ++D   + +A+EA +++LQAY  +PE+VTDNFN++V  +  + TN TRR+L     
Sbjct  23    ANIGDFDEVWQTRAEEARKAALQAYNPHPEKVTDNFNKKVHKSF-DSTNHTRRNLSKFSG  81

Query  1504  HCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKP  1325
              C ATN IDRCWRC  DWA +R +LA C  GFG  TTGG  G+ YVVTD SD DM NPKP
Sbjct  82    LCMATNPIDRCWRCRSDWASNRMKLADCVLGFGQKTTGGKGGKIYVVTDPSDNDMVNPKP  141

Query  1324  GTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNV  1145
             GTLRHA IQEEPLWIIF  SM I L +ELI+  +KTID RG +VHIA GAGLT+      
Sbjct  142   GTLRHAAIQEEPLWIIFAHSMAIRLNEELIMTSNKTIDARGANVHIANGAGLTLH-----  196

Query  1144  IIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLID  965
                                            DGDGISIFG+ ++W+DH++MS C+DGLID
Sbjct  197   -------------------------------DGDGISIFGATNIWIDHISMSNCADGLID  225

Query  964   AIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGF  785
             AIMASTAITISNC F HHN V+L GASD +S DAIMQ+T+ FN FG+GL QRMPRCRWGF
Sbjct  226   AIMASTAITISNCHFTHHNEVMLFGASDGYSGDAIMQITITFNHFGQGLTQRMPRCRWGF  285

Query  784   FHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRS  605
             FH+VNNDYT W MYAIGGS  PTI+SQGNRF A  +   K+VTKR+   ++VWK+W WRS
Sbjct  286   FHVVNNDYTHWLMYAIGGSHHPTILSQGNRFIAPPDINCKEVTKRDYSPESVWKSWTWRS  345

Query  604   EGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             +GDL +NGA+FVESG+    +     +N   IR +P ++V RLTR SGAL C+ G  C
Sbjct  346   QGDLMMNGAFFVESGDPNFDF-----SNKYVIRAKPGAFVTRLTRFSGALSCREGMPC  398



>ref|XP_009139602.1| PREDICTED: probable pectate lyase 15 [Brassica rapa]
Length=451

 Score =   445 bits (1145),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 224/401 (56%), Positives = 285/401 (71%), Gaps = 6/401 (1%)
 Frame = -1

Query  1633  EALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSHCKATNSIDRCWRCDQD  1454
             E ++ + Q    +P++V D  +  V  +  N T   RR L    C   N ID CWRCD++
Sbjct  57    EGVELNEQHAVDDPDKVADEVSTLVQMSEHNIT--ARRKLGFFSCGTGNPIDDCWRCDRN  114

Query  1453  WAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHAVIQEEPLWIIF  1274
             W K+RKRLA C  GFG    GG  GRFYVVTD +D+D+ NPKPGTLRHAVIQ+EPLWI+F
Sbjct  115   WHKNRKRLADCGIGFGRNAVGGRDGRFYVVTDPTDEDVINPKPGTLRHAVIQDEPLWIVF  174

Query  1273  KKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIKIHHILPKMGGM  1094
             K+ MVI LKQELI+N  KTIDGRG +VHIA GA +T+QF+ NVIIHG+ IH   P    M
Sbjct  175   KRDMVIELKQELIMNSFKTIDGRGANVHIANGACITLQFITNVIIHGVHIHDCKPTGNAM  234

Query  1093  IRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMASTAITISNCKFNH  914
             +R S +H G RTM+DGD +SIF S+H+W+DH ++S C+DGL+DA+M STAIT+SN  F H
Sbjct  235   VRSSPSHFGWRTMADGDAVSIFQSSHIWIDHNSLSHCADGLVDAVMGSTAITVSNNHFTH  294

Query  913   HNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNNDYTKWEMYAIG  734
             HN V+LLG SD ++ D +MQVT+A+N FG+GL+QRMPRCR G+FH+VNNDYT WEMYAIG
Sbjct  295   HNEVMLLGHSDSYTIDKLMQVTIAYNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIG  354

Query  733   GSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRSEGDLFLNGAYFVESGEE  554
             GS+ PTI SQGNR+ A  NPF K+VTKR     + W+ W WRSEGDL LNGA+F  SG E
Sbjct  355   GSADPTINSQGNRYAAPKNPFAKEVTKRVETDASEWQKWNWRSEGDLLLNGAFFKASGAE  414

Query  553   LHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
                  +  +   + +  +P+S V  +T T+GAL C+ GR C
Sbjct  415   ----ASASYGRASSLAAKPSSMVHTITSTAGALGCRRGRPC  451



>ref|XP_008667903.1| PREDICTED: pectate lyase 8 isoform X1 [Zea mays]
 tpg|DAA38670.1| TPA: pectate lyase 8 [Zea mays]
Length=479

 Score =   446 bits (1147),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 225/396 (57%), Positives = 281/396 (71%), Gaps = 10/396 (3%)
 Frame = -1

Query  1618  SLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSHCKATNSIDRCWRCDQDWAKHR  1439
             ++     +PE V ++ +  + ++      T RR+L    C   N ID CWRCD DW  +R
Sbjct  94    AVTGAVEDPEAVANDVHVSIRNS------TARRNLGYLSCGTGNPIDDCWRCDSDWHSNR  147

Query  1438  KRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMV  1259
             +RLA C  GFG    GG  G+ YVVTD SD D  NP+ GTLRHAVIQEEPLWIIFK+ MV
Sbjct  148   QRLADCGIGFGRNAIGGRDGKVYVVTDPSDDDPVNPREGTLRHAVIQEEPLWIIFKRDMV  207

Query  1258  ITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSV  1079
             ITL++ELI+N  KTIDGRG +VHIA GA +TIQ+V NVIIHG+ IH   P    M+R S 
Sbjct  208   ITLREELIMNSFKTIDGRGANVHIANGACVTIQYVTNVIIHGLHIHDCRPTGNAMVRSSP  267

Query  1078  NHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVL  899
             +H G RTM+DGDG+SIFGS+HVW+DH ++S C+DGLIDAIM STAIT+SN  F HHN V+
Sbjct  268   SHYGWRTMADGDGVSIFGSSHVWVDHCSLSNCADGLIDAIMGSTAITLSNNYFTHHNEVM  327

Query  898   LLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRP  719
             LLG SD + +D  MQVT+AFN FG+GLIQRMPRCR G+FH+VNNDYT WEMYAIGGS+ P
Sbjct  328   LLGHSDSYVKDKAMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEP  387

Query  718   TIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRSEGDLFLNGAYFVESGEELHHYn  539
             TI SQGNR+ A +NPF K+VTKR   ++ VWK+W WRSEGDL LNGAYF  SG       
Sbjct  388   TINSQGNRYLAPTNPFAKEVTKRVETAQTVWKSWNWRSEGDLLLNGAYFTPSGAGA----  443

Query  538   ntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             +  ++  + +  + +S VG +T  +GAL C+ G  C
Sbjct  444   SASYSRASSLGAKSSSMVGTITSDAGALSCRKGAAC  479



>ref|NP_187357.1| putative pectate lyase 8 [Arabidopsis thaliana]
 sp|Q9M8Z8.1|PLY8_ARATH RecName: Full=Probable pectate lyase 8; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF27005.1|AC016827_16 putative pectate lyase [Arabidopsis thaliana]
 dbj|BAH20216.1| AT3G07010 [Arabidopsis thaliana]
 gb|AEE74488.1| putative pectate lyase 8 [Arabidopsis thaliana]
Length=416

 Score =   444 bits (1141),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 227/389 (58%), Positives = 278/389 (71%), Gaps = 10/389 (3%)
 Frame = -1

Query  1597  NPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSHCKATNSIDRCWRCDQDWAKHRKRLAFCA  1418
             NP+EV    +  + ++      T RR L    C   N ID CWRCD+ W   RKRLA C+
Sbjct  38    NPDEVAAMVDMSIRNS------TERRRLGYFSCATGNPIDDCWRCDRKWQLRRKRLADCS  91

Query  1417  rgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQEL  1238
              GFG    GG  GRFYVVTD  D D  NP PGTLRHAVIQ+EPLWIIFK+ MVITLKQEL
Sbjct  92    IGFGRNAIGGRDGRFYVVTDPGDDDPVNPIPGTLRHAVIQDEPLWIIFKRDMVITLKQEL  151

Query  1237  IINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRT  1058
             I+N  KTIDGRGV+VHIA GA LTIQ+V N+I+HGI +H   P    M+R S +H G R+
Sbjct  152   IMNSFKTIDGRGVNVHIANGACLTIQYVTNIIVHGIHVHDCKPTGNAMVRSSPSHYGFRS  211

Query  1057  MSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDL  878
             M+DGD ISIFGS+H+W+DH ++S C+DGL+DA+M+STAIT+SN  F HHN V+LLG SD 
Sbjct  212   MADGDAISIFGSSHIWIDHNSLSNCADGLVDAVMSSTAITVSNNFFTHHNEVMLLGHSDS  271

Query  877   FSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGN  698
             ++ D +MQVT+A+N FG+GLIQRMPRCR G+FH+VNNDYT WEMYAIGGS+ PTI SQGN
Sbjct  272   YTRDKVMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAGPTINSQGN  331

Query  697   RFKASSNPFTKQVTKREIVSKNVWKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnnt  518
             RF A  NPF K+VTKRE   ++ WK+W WRSEGDLFLNGA+F  SG          +   
Sbjct  332   RFLAPVNPFAKEVTKREYTGESKWKHWNWRSEGDLFLNGAFFTRSGAG----AGANYARA  387

Query  517   nRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             + +  + +S VG +T  SGAL C+ GR C
Sbjct  388   SSLSAKSSSLVGTMTSYSGALNCRAGRRC  416



>sp|P40973.1|PLY_LILLO RecName: Full=Pectate lyase; Flags: Precursor [Lilium longiflorum]
 emb|CAA78976.1| pectate lyase [Lilium longiflorum]
 gb|AAA33398.1| pectate lyase [Lilium longiflorum]
Length=434

 Score =   444 bits (1143),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 242/419 (58%), Positives = 306/419 (73%), Gaps = 9/419 (2%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGS--  1505
             A+IAE+D Y +KK+  A   + +AY  +PEEVT++FN+ V  +     N+TRR+LR +  
Sbjct  22    ANIAEFDEYWQKKSKVAQAKAKKAYTPHPEEVTNHFNKAVHSSFEG--NSTRRNLRTNKL  79

Query  1504  -HCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPK  1328
               C ATN IDRCWRC ++W+ +RK L  C +GFG  TTGG  G  YVVTD SD  + +PK
Sbjct  80    GQCLATNPIDRCWRCKKNWSANRKDLVKCVKGFGRKTTGGAAGEIYVVTDPSDDSLTDPK  139

Query  1327  PGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRN  1148
              GTLR  VIQ+ PLWIIF KSMVI LKQELIIN+DKTIDGRG +V IA GA LT+QFV N
Sbjct  140   FGTLRWGVIQDRPLWIIFGKSMVIRLKQELIINNDKTIDGRGANVQIAGGAQLTVQFVHN  199

Query  1147  VIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLI  968
             VIIHGI IH I P  GG+IRDS  H G+RT SDGDGISI GS+++W+DH++++RCSDGLI
Sbjct  200   VIIHGIHIHDIKPGEGGLIRDSEKHSGIRTRSDGDGISIIGSSNIWIDHVSLARCSDGLI  259

Query  967   DAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWG  788
             D I+ STAITISNC    H+ V+LLGASD +++D IMQVTVAFN FG+GL+QRMPRCR+G
Sbjct  260   DVILGSTAITISNCHLTEHDDVMLLGASDTYTQDEIMQVTVAFNHFGRGLVQRMPRCRYG  319

Query  787   FFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWR  608
             F H+VNNDYT W MYA+GGS  PTI+SQGNR+ A      K+VTKR+      W  W W+
Sbjct  320   FVHVVNNDYTHWIMYAVGGSQHPTIISQGNRYIAPHIEAAKEVTKRDYAEPAEWSKWTWK  379

Query  607   SEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             S+GDLF++GA+FVESG    +    +++  + I+ +P ++V RLTR SGAL CK    C
Sbjct  380   SQGDLFVSGAFFVESGGPFEN----KYSKKDLIKAKPGTFVQRLTRFSGALNCKENMEC  434



>gb|KDP33375.1| hypothetical protein JCGZ_12924 [Jatropha curcas]
Length=449

 Score =   445 bits (1144),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 229/388 (59%), Positives = 276/388 (71%), Gaps = 5/388 (1%)
 Frame = -1

Query  1591  EEVTDNFNEEVGDTIMNWTNTT-RRHLRGSHCKATNSIDRCWRCDQDWAKHRKRLAFCAr  1415
             E   D+  E V    M+  N+T RR L    C   N ID CWRCD +W K+RKRLA C  
Sbjct  66    EHAVDDPEEVVAMVEMSIRNSTERRQLGYFSCGTGNPIDDCWRCDPNWQKNRKRLAECGI  125

Query  1414  gfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELI  1235
             GFG    GG  GRFYVVTD+ D D  NPKPGTLRHAVIQ+EPLWI+FK+ MVI LKQELI
Sbjct  126   GFGRNAIGGRDGRFYVVTDAGDDDPVNPKPGTLRHAVIQDEPLWIVFKRDMVIQLKQELI  185

Query  1234  INHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTM  1055
             +N  KTIDGRGV+VHIA GA +TIQFV NVIIHG+ IH   P    M+R S +H G RTM
Sbjct  186   MNSFKTIDGRGVNVHIANGACITIQFVTNVIIHGLHIHDCKPTGNAMVRSSPSHFGWRTM  245

Query  1054  SDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLF  875
             +DGD ISIFGS+H+W+DH ++S C+DGL+DA+M STAITISN  F HHN V+LLG SD +
Sbjct  246   ADGDAISIFGSSHIWVDHNSLSHCADGLVDAVMGSTAITISNNHFTHHNEVMLLGHSDSY  305

Query  874   SEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNR  695
             + D  MQVT+A+N FG+GLIQRMPRCR G+FH+VNNDYT WEMYAIGGS+ PTI SQGNR
Sbjct  306   TRDKQMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNR  365

Query  694   FKASSNPFTKQVTKREIVSKNVWKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnntn  515
             + A  NPF K+VTKR   + + WK W WRSEGDL LNGAYF  SG       +  +   +
Sbjct  366   YNAPFNPFAKEVTKRVDTATSQWKGWNWRSEGDLLLNGAYFTPSGAGA----SASYARAS  421

Query  514   RIRHRPASYVGRLTRTSGALKCKVGRFC  431
              +  + ++ VG +T  +GAL C+ GR C
Sbjct  422   SLGAKSSAMVGTMTANAGALPCRRGREC  449



>ref|XP_010464311.1| PREDICTED: probable pectate lyase 8 [Camelina sativa]
Length=417

 Score =   444 bits (1141),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 227/389 (58%), Positives = 280/389 (72%), Gaps = 10/389 (3%)
 Frame = -1

Query  1597  NPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSHCKATNSIDRCWRCDQDWAKHRKRLAFCA  1418
             NPEEV    +  + ++      T RR L    C   N ID CWRCD+ W   RKRLA C+
Sbjct  39    NPEEVAAMVDMSIRNS------TERRRLGYFSCSTGNPIDDCWRCDRKWQLRRKRLADCS  92

Query  1417  rgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQEL  1238
              GFG    GG  GRFYVVT+ +D +  NP PGTLRHAVIQEEPLWIIFK+ MVITLKQEL
Sbjct  93    IGFGRNAIGGRDGRFYVVTNPNDDNPVNPIPGTLRHAVIQEEPLWIIFKRDMVITLKQEL  152

Query  1237  IINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRT  1058
             I+N  KTIDGRGV+VHIA GA LTIQ+V N+I+HGI IH   P    M+R S +H G R+
Sbjct  153   IMNSFKTIDGRGVNVHIANGACLTIQYVTNIIVHGIHIHDCKPTGNAMVRSSPSHYGWRS  212

Query  1057  MSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDL  878
             M+DGD +SIFGS+H+W+DH ++S C+DGL+DA+M+STAIT+SN  F HHN V+LLG SD 
Sbjct  213   MADGDALSIFGSSHIWIDHNSLSNCADGLVDAVMSSTAITVSNNFFTHHNEVMLLGHSDS  272

Query  877   FSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGN  698
             ++ D +MQVT+A+N FG+GLIQRMPRCR G+FH+VNNDYT WEMYAIGGS+ PTI SQGN
Sbjct  273   YTRDKVMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTINSQGN  332

Query  697   RFKASSNPFTKQVTKREIVSKNVWKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnnt  518
             RF A +NPF K+VTKRE   ++ WK+W WRSEGDLFLNGA+F  SG          +   
Sbjct  333   RFLAPTNPFAKEVTKREYTGQSKWKHWNWRSEGDLFLNGAFFTRSGAG----AGANYARA  388

Query  517   nRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             + +  + +S VG +T  SGAL C+ GR C
Sbjct  389   SSLSAKSSSLVGTMTSYSGALNCRAGRRC  417



>emb|CDX81636.1| BnaC08g39650D [Brassica napus]
Length=484

 Score =   446 bits (1147),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 233/423 (55%), Positives = 287/423 (68%), Gaps = 11/423 (3%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTI--MNWTNTTRRHLRG  1508
             QA++A +D Y K++  +AL+ ++ +Y  NP  VTD+ N  V   +     TN TRR L G
Sbjct  25    QANVAIFDNYWKQRQGDALKQTIASYDPNPLNVTDHLNYHVALAVDATESTNNTRRELIG  84

Query  1507  -------SHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSD  1349
                      C A N ID+CWRCD +W K+RK+L  C  GFG  TTGG  G  YVV DSSD
Sbjct  85    RETQEGSGKCIAYNPIDKCWRCDPNWEKNRKKLVECVLGFGRKTTGGKDGPIYVVNDSSD  144

Query  1348  KDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGL  1169
             +D+ NPKPGTLRHAV ++ PLWIIF  SMVI L+QEL+I  +KTIDGRG  V+I  GAGL
Sbjct  145   EDLVNPKPGTLRHAVTRDGPLWIIFANSMVIKLQQELMITSNKTIDGRGARVYIMEGAGL  204

Query  1168  TIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMS  989
             T QFV NVII+ I + HI+P  GG+IRDS  H+GLRT SDGDGIS+FG+ +VW+DH++M+
Sbjct  205   TQQFVNNVIINNIYVKHIIPGNGGLIRDSEEHVGLRTKSDGDGISLFGATNVWIDHVSMT  264

Query  988   RCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQR  809
             RC+DG+IDAI  STA+TISN  F  H  V+L GA D    D  MQ+TVAFN FGK L QR
Sbjct  265   RCTDGMIDAIEGSTAVTISNSHFTDHQEVMLFGAKDEHVIDKNMQITVAFNHFGKRLEQR  324

Query  808   MPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNV  629
             MPRCR+G  H+VNNDYT WEMYAIGG+  PTI+SQGNRF A  N   K+VTKRE  S   
Sbjct  325   MPRCRFGTIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNEQAKEVTKREYTSYTD  384

Query  628   WKNWQWRSEGDLFLNGAYFVESGEE--LHHYnntrfnntnRIRHRPASYVGRLTRTSGAL  455
             WK+W W+SEGD FLNGAYFV+SG              +   IR +P + V  LT  +G L
Sbjct  385   WKSWNWQSEGDYFLNGAYFVQSGRPNAWSPKPKNPVPSKFAIRPKPGTMVRELTMDAGVL  444

Query  454   KCK  446
              C+
Sbjct  445   GCE  447



>ref|XP_003555714.2| PREDICTED: probable pectate lyase 1-like [Glycine max]
Length=489

 Score =   446 bits (1147),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 229/410 (56%), Positives = 285/410 (70%), Gaps = 10/410 (2%)
 Frame = -1

Query  1660  DAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSHCKATNSI  1481
             ++ + ++A EA + + QA   NPEEV       + ++      T RR L    C   N I
Sbjct  90    NSSMAERAKEAEKLNEQAAVANPEEVVSMVEMSIQNS------TERRKLGFFSCGTGNPI  143

Query  1480  DRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHAVI  1301
             D CWRCD +W ++RKRLA C  GFG    GG  G+FYVVTD  D D  NPKPGTLRHAVI
Sbjct  144   DDCWRCDPNWQRNRKRLADCGIGFGRNAIGGRDGKFYVVTDPRDDDPVNPKPGTLRHAVI  203

Query  1300  QEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIKIH  1121
             Q++PLWI+FK+ MVI LKQELI+N  KTIDGRGV+VHIA GA +TIQFV NVIIHG+ IH
Sbjct  204   QDKPLWIVFKRDMVIQLKQELIMNSFKTIDGRGVNVHIANGACITIQFVTNVIIHGLHIH  263

Query  1120  HILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMASTAI  941
                P    M+R S  H G RTM+DGD ISIFGS+H+W+DH ++S C+DGL+DA++ STAI
Sbjct  264   DCKPTGNAMVRSSPTHFGWRTMADGDAISIFGSSHIWVDHNSLSHCADGLVDAVLGSTAI  323

Query  940   TISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNNDY  761
             TISN  F HHN V+LLG SD ++ D  MQVT+A+N FG+GLIQRMPRCR G+FH+VNNDY
Sbjct  324   TISNNHFTHHNEVILLGHSDSYTRDKQMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDY  383

Query  760   TKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRSEGDLFLNG  581
             T WEMYAIGGS+ PTI SQGNR+ A +N F K+VTKR   +++ WK W WRSEGDL LNG
Sbjct  384   THWEMYAIGGSANPTINSQGNRYNAPTNRFAKEVTKRVETAESQWKGWNWRSEGDLLLNG  443

Query  580   AYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             AYF  SG       +  +   + +  + +S VG +T  +GAL CK G  C
Sbjct  444   AYFTPSGA----GASASYARASSLGAKSSSMVGSMTSNAGALGCKRGSQC  489



>emb|CDY53552.1| BnaA09g57110D [Brassica napus]
Length=495

 Score =   446 bits (1148),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 233/424 (55%), Positives = 287/424 (68%), Gaps = 11/424 (3%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTI--MNWTNTTRRHLRG  1508
             QA++A +D Y  ++  +AL+ ++ +Y  NP  VTD+ N  V   +     TN TRR L G
Sbjct  25    QANVAVFDNYWTQRQGDALKQTIASYDPNPLNVTDHLNYHVALAVDATESTNNTRRELIG  84

Query  1507  -------SHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSD  1349
                      C A N ID+CWRCD +W K+RK+LA C  GFG  TTGG  G  YVV DSSD
Sbjct  85    RKTQEGSGKCIAHNPIDKCWRCDPNWEKNRKKLAECVLGFGRKTTGGKDGPIYVVNDSSD  144

Query  1348  KDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGL  1169
              D+ NPKPGTLRHAV ++ PLWIIF  SMVI L+QEL+I  +KTIDGRG  V+I  G GL
Sbjct  145   DDLVNPKPGTLRHAVTRDGPLWIIFANSMVIKLQQELMITSNKTIDGRGAKVYIMEGVGL  204

Query  1168  TIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMS  989
             T+QFV NVII+ I + HI+P  GG+IRDS  H+GLRT SDGDGIS+FG+ +VW+DH++M+
Sbjct  205   TLQFVNNVIINNIYVKHIIPGNGGLIRDSEEHVGLRTKSDGDGISLFGATNVWIDHVSMT  264

Query  988   RCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQR  809
             RC+DG+IDAI  STA+TISN  F  H  V+L GA D    D  MQ+TVAFN FGK L QR
Sbjct  265   RCTDGMIDAIEGSTAVTISNSHFTDHQEVMLFGAKDEHVIDKNMQITVAFNHFGKRLEQR  324

Query  808   MPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNV  629
             MPRCR+G  H+VNNDYT WEMYAIGG+  PTI+SQGNRF A  N   K+VTKRE  S   
Sbjct  325   MPRCRFGTIHVVNNDYTHWEMYAIGGNMNPTIISQGNRFIAPPNEQAKEVTKREYTSYTD  384

Query  628   WKNWQWRSEGDLFLNGAYFVESGEE--LHHYnntrfnntnRIRHRPASYVGRLTRTSGAL  455
             WK+W W+SEGD FLNGAYFV+SG              +   IR +P + V  LT  +GAL
Sbjct  385   WKSWNWQSEGDYFLNGAYFVQSGRPNAWSPKPKNPVPSKFAIRPKPGTMVRELTMDAGAL  444

Query  454   KCKV  443
              C+ 
Sbjct  445   GCEA  448



>emb|CDY01151.1| BnaA04g06680D [Brassica napus]
Length=452

 Score =   445 bits (1144),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 224/401 (56%), Positives = 285/401 (71%), Gaps = 6/401 (1%)
 Frame = -1

Query  1633  EALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSHCKATNSIDRCWRCDQD  1454
             E ++ + Q    +P++V D  +  V  +  N T   RR L    C   N ID CWRCD++
Sbjct  58    EGVELNEQHAVDDPDKVADEVSTLVQMSEHNIT--ARRKLGFFSCGTGNPIDDCWRCDRN  115

Query  1453  WAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHAVIQEEPLWIIF  1274
             W K+RKRLA C  GFG    GG  GRFYVVTD +D+D+ NPKPGTLRHAVIQ+EPLWI+F
Sbjct  116   WHKNRKRLADCGIGFGRNAVGGRDGRFYVVTDPTDEDVINPKPGTLRHAVIQDEPLWIVF  175

Query  1273  KKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIKIHHILPKMGGM  1094
             K+ MVI LKQELI+N  KTIDGRG +VHIA GA +T+QF+ NVIIHG+ IH   P    M
Sbjct  176   KRDMVIELKQELIMNSFKTIDGRGANVHIANGACITLQFITNVIIHGLHIHDCKPTGNAM  235

Query  1093  IRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMASTAITISNCKFNH  914
             +R S +H G RTM+DGD +SIF S+H+W+DH ++S C+DGL+DA+M STAIT+SN  F H
Sbjct  236   VRSSPSHFGWRTMADGDAVSIFQSSHIWIDHNSLSHCADGLVDAVMGSTAITVSNNHFTH  295

Query  913   HNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNNDYTKWEMYAIG  734
             HN V+LLG SD ++ D +MQVT+A+N FG+GL+QRMPRCR G+FH+VNNDYT WEMYAIG
Sbjct  296   HNEVMLLGHSDSYTIDKLMQVTIAYNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIG  355

Query  733   GSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRSEGDLFLNGAYFVESGEE  554
             GS+ PTI SQGNR+ A  NPF K+VTKR     + W+ W WRSEGDL LNGA+F  SG E
Sbjct  356   GSADPTINSQGNRYAAPKNPFAKEVTKRVETDASEWQKWNWRSEGDLLLNGAFFKASGAE  415

Query  553   LHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
                  +  +   + +  +P+S V  +T T+GAL C+ GR C
Sbjct  416   ----ASASYGRASSLAAKPSSMVHTITSTAGALGCRRGRPC  452



>ref|XP_007034463.1| Pectin lyase-like superfamily protein [Theobroma cacao]
 gb|EOY05389.1| Pectin lyase-like superfamily protein [Theobroma cacao]
Length=447

 Score =   444 bits (1143),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 236/414 (57%), Positives = 284/414 (69%), Gaps = 17/414 (4%)
 Frame = -1

Query  1633  EALQSSLQAYYHNPEEVTDNFNE-----------EVGDTI-MNWTNTT-RRHLRGSHCKA  1493
             E LQSS  +      E  +  NE           EV   I MN  N T RR L    C  
Sbjct  38    EKLQSSNNSTMAARSEEAEPLNEHAVPDPGAVAAEVETMIDMNIRNVTERRKLGFFSCGT  97

Query  1492  TNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLR  1313
              N ID CWRCD +W K+RKRLA C  GFG    GG  GRFYVVTD  D D  NP+PGTLR
Sbjct  98    GNPIDDCWRCDPNWQKNRKRLADCGIGFGRNAIGGRDGRFYVVTDPGDDDPVNPRPGTLR  157

Query  1312  HAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHG  1133
             HAVIQ++PLWI+FK+ MVI LKQELI+N  KTIDGRGV+VHIA GA +TIQFV NVIIHG
Sbjct  158   HAVIQDQPLWIVFKRDMVIQLKQELIMNSFKTIDGRGVNVHIANGACITIQFVTNVIIHG  217

Query  1132  IKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMA  953
             + IH   P    M+R S +H G RTM+DGDGISIFGS+H+W+DH ++S C+DGL+DA+M 
Sbjct  218   LHIHDCKPTGNAMVRSSPSHFGWRTMADGDGISIFGSSHIWVDHNSLSNCADGLVDAVMG  277

Query  952   STAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIV  773
             STAITISN    HHN V+LLG SD ++ D  MQVT+A+N FG+GLIQRMPRCR G+FH+V
Sbjct  278   STAITISNNHLTHHNEVMLLGHSDSYTRDKQMQVTIAYNHFGEGLIQRMPRCRHGYFHVV  337

Query  772   NNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRSEGDL  593
             NNDYT WEMYAIGGS+ PTI SQGNR+ A +NPF K+VTKR    ++ WK+W WRSEGDL
Sbjct  338   NNDYTHWEMYAIGGSANPTINSQGNRYAAPTNPFAKEVTKRVDTGESQWKSWNWRSEGDL  397

Query  592   FLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
              LNGAYF  SG       +  +   + +  + +S VG +T  +GAL C+ GR C
Sbjct  398   LLNGAYFTPSGAGA----SASYARASSLGAKSSSMVGAMTSNAGALPCRRGRQC  447



>gb|KHG06252.1| hypothetical protein F383_10745 [Gossypium arboreum]
Length=429

 Score =   444 bits (1141),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 227/389 (58%), Positives = 275/389 (71%), Gaps = 6/389 (2%)
 Frame = -1

Query  1597  NPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSHCKATNSIDRCWRCDQDWAKHRKRLAFCA  1418
             +PE V       +   I N   T RR L    C   N ID CWRCD +W K+RKRLA C 
Sbjct  47    DPEAVAAEVETIIDMNIRN--ATERRKLGFFSCGTGNPIDDCWRCDPNWQKNRKRLADCG  104

Query  1417  rgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQEL  1238
              GFG    GG  GRFYVVTDS+D D  NPKPGTLRHAVIQE+PLWI+FK+ MVI LKQEL
Sbjct  105   IGFGRNAIGGRDGRFYVVTDSNDDDPVNPKPGTLRHAVIQEQPLWIVFKRDMVIKLKQEL  164

Query  1237  IINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRT  1058
             ++N  KTIDGRGV+VHIA GA +TIQ+V NVI+HG+ IH   P    M+R S  H G RT
Sbjct  165   LVNSFKTIDGRGVNVHIANGACITIQYVTNVIVHGLHIHDCKPTGNAMVRSSPTHFGWRT  224

Query  1057  MSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDL  878
             M+DGD ISIFGS+HVW+DH ++S C+DGL+DA+M STAITISN    HHN V+LLG SD 
Sbjct  225   MADGDAISIFGSSHVWVDHNSLSNCADGLVDAVMGSTAITISNNHLTHHNEVMLLGHSDS  284

Query  877   FSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGN  698
             ++ D  MQVT+A+N FG+GLIQRMPRCR G+FH+VNNDYT WEMYAIGGS+ PTI SQGN
Sbjct  285   YTRDKQMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGN  344

Query  697   RFKASSNPFTKQVTKREIVSKNVWKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnnt  518
             R+ A  NPF K+VTKR   +++ WK+W WRSEGDL LNGAYF  SG       +  +   
Sbjct  345   RYAAPRNPFAKEVTKRVDTAESHWKSWNWRSEGDLLLNGAYFTPSGAGA----SASYARA  400

Query  517   nRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             + +  + +S VG +T  +GAL C+ GR C
Sbjct  401   SSLGAKSSSMVGSMTSNAGALPCRRGRQC  429



>ref|XP_002453531.1| hypothetical protein SORBIDRAFT_04g007450 [Sorghum bicolor]
 gb|EES06507.1| hypothetical protein SORBIDRAFT_04g007450 [Sorghum bicolor]
Length=445

 Score =   444 bits (1143),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 227/419 (54%), Positives = 291/419 (69%), Gaps = 8/419 (2%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEV-GDTIMNWT--NTTRRHLRG  1508
             A+IA++D + +K+ + A  S  + Y  +P  VT++FN  V   T +  T     R+H + 
Sbjct  32    ANIADFDEHWQKRKELAEASVRETYRPDPYNVTNSFNVAVHRATSLRRTMREMPRKHKKK  91

Query  1507  SHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPK  1328
               C+ATN ID+CWRC  DWA  R RLA CARGFG  TTGGL G  Y+VTD SD D+ NP+
Sbjct  92    GPCRATNPIDKCWRCKNDWATDRFRLARCARGFGQATTGGLGGPIYIVTDPSDGDVVNPR  151

Query  1327  PGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRN  1148
             PGTLR  VIQ  PLWIIF KSM+I L QEL+++ DKTIDGRG  VHIA GAG+T+Q  RN
Sbjct  152   PGTLRWGVIQPGPLWIIFAKSMIIQLSQELLVSSDKTIDGRGAQVHIANGAGITVQLARN  211

Query  1147  VIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLI  968
             VIIH + +H +L  MGG++RDS  H+G RT +DGDGIS+F + +VW+DH++MS C DGLI
Sbjct  212   VIIHNLHVHDVLHSMGGLMRDSPTHVGSRTKADGDGISLFQATNVWIDHISMSNCEDGLI  271

Query  967   DAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWG  788
             D + +ST ITISNC F +HN V+L GASD + +D +MQ+TVAFN FG+GL+QRMPRCRWG
Sbjct  272   DVVQSSTGITISNCHFTNHNDVMLFGASDSYPQDQMMQITVAFNHFGRGLVQRMPRCRWG  331

Query  787   FFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWR  608
             FFH+VNNDYT W MYAIGG   PTI+SQGNR+ A  N   K +TK     +  WKNW W 
Sbjct  332   FFHVVNNDYTHWLMYAIGGGKAPTIISQGNRYIAPPNIAAKVITK-HYAEEGEWKNWVWH  390

Query  607   SEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             +E DLF+NGA F  SG  +      + N+   ++ +P +YV RLTR SG L C + + C
Sbjct  391   TEDDLFMNGAIFEPSGGAVQR----QINSNEWVKPKPGTYVTRLTRFSGTLSCCMSKPC  445



>ref|XP_010476496.1| PREDICTED: probable pectate lyase 3 [Camelina sativa]
Length=455

 Score =   444 bits (1143),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 235/435 (54%), Positives = 297/435 (68%), Gaps = 23/435 (5%)
 Frame = -1

Query  1678  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFN----------EEVGDTIMNWTNT  1529
             A +A +D+Y  ++  +AL+ +  +Y  NP  VT++FN          E + DT    T  
Sbjct  25    AHVAVFDSYWMQRKTDALKQTFGSYDPNPLNVTNHFNYHVNLAVDATESINDTRRELTQV  84

Query  1528  -TRRHLR--GSHCKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTD  1358
              +RR L+  G  C A N ID+CWRCD++WA +RK+LA CA GFG  TTGG  G  YVVTD
Sbjct  85    RSRRKLQKHGGKCVAYNPIDKCWRCDRNWANNRKKLAECALGFGRKTTGGKDGPIYVVTD  144

Query  1357  SSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYG  1178
             +SD D+ NPKPGTLR+AV ++ PLWIIF +SM+I L+QEL+I  DKTIDGRG  V+I  G
Sbjct  145   ASDNDLINPKPGTLRYAVTRDGPLWIIFARSMIIKLQQELMITSDKTIDGRGARVYIMEG  204

Query  1177  AGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHL  998
             AGLT+QFV NVIIH I +  I+   GG+IRDS  HIGLRT SDGDGIS+FG+ ++W+DH+
Sbjct  205   AGLTLQFVNNVIIHNIYVKQIVTGNGGLIRDSEQHIGLRTKSDGDGISLFGATNIWIDHV  264

Query  997   TMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGL  818
             +M+RC DG+IDAI  STA+TISN  F  H  V+L GA D    D  MQ+TVAFN FGK L
Sbjct  265   SMTRCEDGMIDAIDGSTAVTISNSHFTDHQEVMLFGARDEHVIDKKMQITVAFNHFGKRL  324

Query  817   IQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVS  638
              QRMPRCR+G  H+VNNDYT WEMYAIGG+  PTI+SQGNRF A  N   KQ+TKRE   
Sbjct  325   EQRMPRCRFGTIHVVNNDYTHWEMYAIGGNMDPTIISQGNRFIAPPNEQAKQITKREYTP  384

Query  637   KNVWKNWQWRSEGDLFLNGAYFVESGE------ELHHYnntrfnntnRIRHRPASYVGRL  476
                WK+W W+SEGD FLNGAYFV+SG+      +LH+       +   IR +P + V +L
Sbjct  385   FVEWKSWNWQSEGDYFLNGAYFVQSGKANAWSAKLHN----PIPSKFAIRPKPGTMVRKL  440

Query  475   TRTSGALKCKVGRFC  431
             T  +G L CK G+ C
Sbjct  441   TMEAGVLGCKHGKEC  455



>ref|XP_006297767.1| hypothetical protein CARUB_v10013802mg [Capsella rubella]
 gb|EOA30665.1| hypothetical protein CARUB_v10013802mg [Capsella rubella]
Length=418

 Score =   443 bits (1140),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 226/388 (58%), Positives = 277/388 (71%), Gaps = 10/388 (3%)
 Frame = -1

Query  1594  PEEVTDNFNEEVGDTIMNWTNTTRRHLRGSHCKATNSIDRCWRCDQDWAKHRKRLAFCAr  1415
             PEEV    +  + ++      T RR L    C   N ID CWRCD+ W   RKRLA C+ 
Sbjct  41    PEEVAAMVDMSIRNS------TERRRLGYFSCATGNPIDDCWRCDRKWQLRRKRLADCSI  94

Query  1414  gfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELI  1235
             GFG    GG  GR+YVVTD  D +  NP PGTLRHAVIQEEPLWIIFK+ MVITLKQELI
Sbjct  95    GFGRNAIGGRDGRYYVVTDPGDDNPVNPVPGTLRHAVIQEEPLWIIFKRDMVITLKQELI  154

Query  1234  INHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTM  1055
             +N  KTIDGRGV+VHIA GA LTIQ+V N+I+HGI IH   P    M+R S  H G R+M
Sbjct  155   MNSFKTIDGRGVNVHIANGACLTIQYVTNIIVHGIHIHDCKPTGNAMVRSSPTHYGWRSM  214

Query  1054  SDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDLF  875
             +DGD ISIFG++H+W+DH ++S C+DGL+DA+M+STAIT+SN  F HHN V+LLG SD +
Sbjct  215   ADGDAISIFGASHIWIDHNSLSNCADGLVDAVMSSTAITVSNNFFTHHNEVMLLGHSDSY  274

Query  874   SEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNR  695
             + D +MQVT+A+N FG+GLIQRMPRCR G+FH+VNNDYT WEMYAIGGS+ PTI SQGNR
Sbjct  275   TRDKVMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTINSQGNR  334

Query  694   FKASSNPFTKQVTKREIVSKNVWKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnntn  515
             F A +NPF K+VTKRE   ++ WK+W WRSEGDLFLNGA+F  SG          +   +
Sbjct  335   FLAPTNPFAKEVTKREYTGQSTWKHWNWRSEGDLFLNGAFFTRSGAG----AGANYARAS  390

Query  514   RIRHRPASYVGRLTRTSGALKCKVGRFC  431
              +  + +S VG +T  SGAL C+ GR C
Sbjct  391   SLSAKSSSLVGTMTSYSGALNCRAGRRC  418



>gb|AAM61584.1| putative pectate lyase [Arabidopsis thaliana]
Length=416

 Score =   443 bits (1140),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 226/389 (58%), Positives = 278/389 (71%), Gaps = 10/389 (3%)
 Frame = -1

Query  1597  NPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSHCKATNSIDRCWRCDQDWAKHRKRLAFCA  1418
             NP+EV    +  + ++      T RR L    C   N ID CWRCD+ W   RKRLA C+
Sbjct  38    NPDEVAAMVDMSIRNS------TERRRLGYFSCATGNPIDDCWRCDRKWQLRRKRLADCS  91

Query  1417  rgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQEL  1238
              GF     GG  GRFYVVTD  D D  NP PGTLRHAVIQ+EPLWIIFK+ MVITLKQEL
Sbjct  92    IGFCRNAIGGRDGRFYVVTDPGDDDPVNPIPGTLRHAVIQDEPLWIIFKRDMVITLKQEL  151

Query  1237  IINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRT  1058
             I+N  KTIDGRGV+VHIA GA LTIQ+V N+I+HGI +H   P    M+R S +H G R+
Sbjct  152   IMNSFKTIDGRGVNVHIANGACLTIQYVTNIIVHGIHVHDCKPTGNAMVRSSPSHYGFRS  211

Query  1057  MSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMASTAITISNCKFNHHNHVLLLGASDL  878
             M+DGD ISIFGS+H+W+DH ++S C+DGL+DA+M+STAIT+SN  F HHN V+LLG SD 
Sbjct  212   MADGDAISIFGSSHIWIDHNSLSNCADGLVDAVMSSTAITVSNNFFTHHNEVMLLGHSDS  271

Query  877   FSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGN  698
             ++ D +MQVT+A+N FG+GLIQRMPRCR G+FH+VNNDYT WEMYAIGGS+ PTI SQGN
Sbjct  272   YTRDKVMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAGPTINSQGN  331

Query  697   RFKASSNPFTKQVTKREIVSKNVWKNWQWRSEGDLFLNGAYFVESGEELHHYnntrfnnt  518
             RF A  NPF K+VTKRE   ++ WK+W WRSEGDLFLNGA+F  SG        + +   
Sbjct  332   RFLAPVNPFAKEVTKREYTGESKWKHWNWRSEGDLFLNGAFFTRSGAG----AGSNYARA  387

Query  517   nRIRHRPASYVGRLTRTSGALKCKVGRFC  431
             + +  + +S VG +T  SGAL C+ GR C
Sbjct  388   SSLSAKSSSLVGTMTSYSGALNCRAGRRC  416



>ref|XP_011020694.1| PREDICTED: probable pectate lyase 8 [Populus euphratica]
Length=452

 Score =   444 bits (1143),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 231/401 (58%), Positives = 280/401 (70%), Gaps = 5/401 (1%)
 Frame = -1

Query  1630  ALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTT-RRHLRGSHCKATNSIDRCWRCDQD  1454
             A +S  +A   N + V  + +E V    MN  N+T RR L    C   N ID CWRCD +
Sbjct  56    AARSQEEADAFNEKAVAADPDEVVSMVEMNIRNSTERRRLGYFSCGTGNPIDDCWRCDPN  115

Query  1453  WAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDMENPKPGTLRHAVIQEEPLWIIF  1274
             W K+RKRLA C  GFG    GG  GRFYVVTDSSD D  NP+PGTLRHAVIQ+ PLWI+F
Sbjct  116   WHKNRKRLADCGIGFGRNAIGGRDGRFYVVTDSSDHDPVNPRPGTLRHAVIQDAPLWIVF  175

Query  1273  KKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQFVRNVIIHGIKIHHILPKMGGM  1094
             K+ MVI LKQELI+N  KTIDGRGV+VHIA G  +TIQFV NVIIHG+ IH   P    M
Sbjct  176   KRDMVIQLKQELIMNSFKTIDGRGVNVHIANGGCITIQFVTNVIIHGLHIHDCKPTGNAM  235

Query  1093  IRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCSDGLIDAIMASTAITISNCKFNH  914
             +R S +H G RTM+DGD ISIFGS+H+W+DH ++S C+DGL+DA+M STAIT+SN  F H
Sbjct  236   VRSSPSHYGWRTMADGDAISIFGSSHIWVDHNSLSNCADGLVDAVMGSTAITVSNNHFTH  295

Query  913   HNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPRCRWGFFHIVNNDYTKWEMYAIG  734
             HN V+LLG SD ++ D  MQVT+A+N FG+GLIQRMPRCR G+FH+VNNDYT WEMYAIG
Sbjct  296   HNEVMLLGHSDSYTRDKQMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIG  355

Query  733   GSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKNWQWRSEGDLFLNGAYFVESGEE  554
             GS+ PTI SQGNR+ A +NPF K+VTKR   +   WKNW WRSEGDL  NGAYF  SG  
Sbjct  356   GSAEPTINSQGNRYNAPANPFAKEVTKRVDTAPGKWKNWNWRSEGDLLANGAYFTPSGAG  415

Query  553   LHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVGRFC  431
                  +  +   + +  + +S VG +T  SG L C+ G  C
Sbjct  416   A----SASYARASSLGAKSSSMVGAMTANSGVLGCRRGHQC  452



>ref|XP_003563707.1| PREDICTED: pectate lyase-like [Brachypodium distachyon]
Length=448

 Score =   444 bits (1142),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 226/423 (53%), Positives = 293/423 (69%), Gaps = 10/423 (2%)
 Frame = -1

Query  1681  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH  1502
             QA+I ++D + +++   A  ++   Y  +P EV ++ N  V          TRR + G H
Sbjct  30    QANIGDFDEHWQQRKAAARAAAEAIYQSDPLEVANSLNRAVHRATKEDDAGTRRSMLGKH  89

Query  1501  ------CKATNSIDRCWRCDQDWAKHRKRLAFCArgfgsgttgglkgrFYVVTDSSDKDM  1340
                   C+ATN IDRCWRC +DWA  RKRLA CA+GFG   TGGL G+FY+VTD SD D+
Sbjct  90    KKFAGPCRATNPIDRCWRCRKDWATDRKRLARCAQGFGRNATGGLAGKFYIVTDGSDDDV  149

Query  1339  ENPKPGTLRHAVIQEEPLWIIFKKSMVITLKQELIINHDKTIDGRGVSVHIAYGAGLTIQ  1160
               P+PGTLR AVIQ EPLWIIF +SM+I LK+EL+I  DKTIDGRG  V IA GA +T+Q
Sbjct  150   LAPRPGTLRWAVIQAEPLWIIFARSMLIKLKEELLIGSDKTIDGRGAQVRIADGAQVTVQ  209

Query  1159  FVRNVIIHGIKIHHILPKMGGMIRDSVNHIGLRTMSDGDGISIFGSNHVWLDHLTMSRCS  980
             +  NVIIH I I+ ++   GGMIRDS  H G RT SDGDG+++FGS  VWLDHL+++ C 
Sbjct  210   YAHNVIIHNIHINDLIVGKGGMIRDSPAHFGFRTQSDGDGVNVFGSTSVWLDHLSLATCQ  269

Query  979   DGLIDAIMASTAITISNCKFNHHNHVLLLGASDLFSEDAIMQVTVAFNRFGKGLIQRMPR  800
             DGLID I  ST +TISNC   +HN V+L G+SD   +D IMQ+TVAFN FG+GL+QRMPR
Sbjct  270   DGLIDVIAESTGVTISNCHLTNHNDVMLFGSSDSNPKDVIMQITVAFNHFGRGLVQRMPR  329

Query  799   CRWGFFHIVNNDYTKWEMYAIGGSSRPTIVSQGNRFKASSNPFTKQVTKREIVSKNVWKN  620
             CRWGFFH+VNNDYT W MYAIGGS  PTI+SQGNR+ A  N   KQ+TK+   ++  WKN
Sbjct  330   CRWGFFHVVNNDYTHWLMYAIGGSKDPTILSQGNRYIAPPNLAAKQITKQIGAAEPEWKN  389

Query  619   WQWRSEGDLFLNGAYFVESGEELHHYnntrfnntnRIRHRPASYVGRLTRTSGALKCKVG  440
             W W S+ DL +NGA+F E+G ++      +F+  + I+ +P +YV RLTR +G + C+ G
Sbjct  390   WVWHSQEDLLMNGAFFTETGGDIKR----KFDKDDLIKPKPGTYVTRLTRYAGCIPCRPG  445

Query  439   RFC  431
             + C
Sbjct  446   KPC  448



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5439169767108