BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c76927_g1_i1 len=126 path=[1:0-125]

Length=126
                                                                      Score     E

gb|ADQ85945.1|  L1                                                    76.6    6e-15   
gb|AEQ98804.1|  major capsid protein                                  69.7    2e-12   
gb|AFV27133.1|  L1                                                    69.7    2e-12   
gb|ADH29825.1|  major capsid protein L1                               68.2    7e-12   
gb|AEM24627.1|  major capsid protein                                  65.5    5e-11   
ref|YP_004169297.1|  L1                                               62.0    1e-09   
ref|YP_002756544.1|  L1 protein                                       59.7    6e-09   
gb|AEM24620.1|  major capsid protein                                  59.7    7e-09   
gb|ADH29797.1|  major capsid protein L1                               56.2    1e-07   
gb|ADQ85952.1|  L1                                                    55.5    2e-07   
gb|AGC93445.1|  L1 protein                                            52.4    3e-07   
emb|CAF05708.1|  L1 protein                                           53.9    6e-07   Human papillomavirus 95
gb|AFV27109.1|  L1                                                    53.9    7e-07   
ref|YP_003668031.1|  major capsid protein L1                          53.1    1e-06   
ref|YP_009058918.1|  L1                                               52.8    2e-06   
sp|Q07874.1|VL1_HPV65  RecName: Full=Major capsid protein L1          52.4    2e-06   Human papillomavirus 65
ref|YP_873945.1|  L1                                                  52.0    3e-06   Micromys minutus papillomavirus 1
ref|YP_803393.1|  major capsid L1 protein                             51.6    4e-06   Mastomys coucha papillomavirus 2
gb|AIM47234.1|  L1                                                    51.6    5e-06   
gb|AEM24648.1|  major capsid protein                                  51.2    5e-06   
ref|NP_040895.1|  hypothetical protein HpV4gp7                        51.2    6e-06   Human papillomavirus 4
ref|YP_001595472.1|  major structural protein                         50.8    7e-06   Bandicoot papillomatosis carcinomatosis virus type 1
gb|AFK85000.1|  L1                                                    50.8    9e-06   
gb|AEX31149.1|  L1 protein                                            50.4    1e-05   
ref|YP_001955936.1|  major capsid protein                             50.1    1e-05   Bandicoot papillomatosis carcinomatosis virus type 2
gb|AFV27115.1|  L1                                                    50.1    2e-05   
gb|ADQ85973.1|  L1                                                    49.7    2e-05   
gb|ACU32897.1|  L1                                                    49.7    2e-05   Rattus norvegicus papillomavirus 1
ref|YP_002427696.1|  major capsid protein                             49.7    2e-05   Erinaceus europaeus papillomavirus 1
gb|AHC00356.1|  L1                                                    49.7    2e-05   
gb|AEM24683.1|  major capsid protein                                  49.7    2e-05   
emb|CAB54542.1|  L1                                                   47.0    2e-05   Human papillomavirus
gb|AHA37347.1|  L1                                                    49.3    3e-05   
gb|AGC93441.1|  L1                                                    49.3    3e-05   
ref|YP_008720077.1|  L1 protein                                       48.9    4e-05   
ref|YP_009058911.1|  L1                                               48.9    5e-05   
ref|YP_003778198.1|  L1                                               48.9    5e-05   
gb|ACK56331.1|  L1 capsid protein                                     46.2    5e-05   Human papillomavirus
gb|AEM05821.1|  L1                                                    48.1    7e-05   
emb|CAH41942.1|  major capsid protein                                 45.8    7e-05   Human papillomavirus type 68
gb|AEW46324.1|  major capsid protein L1                               45.8    8e-05   
emb|CAB42969.1|  major capsid protein                                 45.8    8e-05   Human papillomavirus
emb|CDN67544.1|  L1 protein                                           47.8    8e-05   
emb|CDX10179.1|  L1 protein                                           47.8    8e-05   
gb|AAQ72428.1|  L1 protein                                            45.4    8e-05   Human papillomavirus
gb|AEM24655.1|  major capsid protein                                  47.8    1e-04   
gb|ADM89076.1|  major capsid protein                                  47.4    1e-04   
ref|YP_004169269.1|  L1                                               47.4    1e-04   
emb|CCW28273.1|  major capsid protein                                 45.1    1e-04   
emb|CDG15350.1|  major capsid protein                                 44.7    2e-04   
ref|YP_009022063.2|  L1 protein                                       47.0    2e-04   
gb|AGC93434.2|  L1                                                    47.0    2e-04   
dbj|BAE87028.1|  major capsid protein                                 45.4    2e-04   Bovine papillomavirus
dbj|BAE87030.1|  major capsid protein                                 45.1    2e-04   Bovine papillomavirus
sp|P50790.1|VL1_HPV24  RecName: Full=Major capsid protein L1          47.0    2e-04   Human papillomavirus type 24
gb|ACK56825.1|  L1 capsid protein                                     44.3    2e-04   Human papillomavirus
gb|ACK56613.1|  L1 capsid protein                                     44.3    2e-04   Human papillomavirus
gb|ACK56446.1|  L1 capsid protein                                     44.3    2e-04   Human papillomavirus
gb|ACK56826.1|  L1 capsid protein                                     44.3    2e-04   Human papillomavirus
gb|ACK56617.1|  L1 capsid protein                                     44.3    2e-04   Human papillomavirus
ref|YP_002756551.1|  L1 protein                                       47.0    2e-04   
emb|CAB54539.1|  L1                                                   44.3    2e-04   Human papillomavirus
gb|AAA47016.1|  coat protein                                          45.4    2e-04   Human papillomavirus type 13
ref|YP_003084352.1|  L1 protein                                       46.6    2e-04   
gb|AHM27271.1|  L1 protein                                            46.6    2e-04   
emb|CAA03932.1|  L1                                                   43.9    3e-04   Human papillomavirus
gb|ACK56322.1|  L1 capsid protein                                     43.9    3e-04   Human papillomavirus
gb|ACK56316.1|  L1 capsid protein                                     43.9    3e-04   Human papillomavirus
sp|P06417.1|VL1_HPV08  RecName: Full=Major capsid protein L1          46.2    3e-04   Human papillomavirus type 8
ref|YP_656498.1|  L1 protein                                          46.2    3e-04   Human papillomavirus type 103
gb|ACK56407.1|  truncated L1 capsid protein                           43.9    3e-04   Human papillomavirus
gb|ACK56317.1|  L1 capsid protein                                     43.9    3e-04   Human papillomavirus
gb|AAR20823.1|  L1 capsid protein                                     43.9    3e-04   Florida manatee papillomavirus
gb|AAF19369.1|AF193303_1  major capsid protein L1                     43.5    3e-04   Human papillomavirus
gb|ACK56313.1|  L1 capsid protein                                     43.9    3e-04   Human papillomavirus
emb|CAA03934.1|  L1                                                   43.9    4e-04   Human papillomavirus
ref|YP_009021240.1|  putative L1 protein                              46.2    4e-04   
gb|AAA67237.1|  L1 protein, My09/My11 region                          43.9    4e-04   Human papillomavirus type 44
gb|AFM74344.1|  L1 protein                                            43.9    4e-04   
ref|YP_008828150.1|  L1                                               46.2    4e-04   
gb|ACK56411.1|  L1 capsid protein                                     43.5    4e-04   Human papillomavirus
gb|AGU90815.1|  L1                                                    45.8    4e-04   
gb|AAO15462.1|AF436130_8  putative major capsid protein L1            45.8    4e-04   Human papillomavirus type 74
gb|AGU90801.1|  L1                                                    45.8    4e-04   
gb|AGU90794.1|  L1                                                    45.8    4e-04   
gb|AHB82182.1|  L1 protein                                            43.9    4e-04   
gb|ABC79063.1|  L1                                                    45.8    5e-04   Human papillomavirus type 13
sp|Q02273.1|VL1_HPV13  RecName: Full=Major capsid protein L1          45.8    5e-04   Human papillomavirus type 13
ref|NP_043443.1|  major capsid protein L1                             45.8    5e-04   Human papillomavirus type 60
gb|AHA13320.1|  L1 protein                                            44.3    5e-04   
sp|P50787.1|VL1_HPV21  RecName: Full=Major capsid protein L1          45.8    5e-04   Human papillomavirus type 21
emb|CCW28274.1|  major capsid protein                                 43.1    5e-04   
gb|AGU90787.1|  L1                                                    45.4    5e-04   
gb|AEX31177.1|  L1 protein                                            45.4    5e-04   
gb|ABL86457.1|  major capsid protein L1                               42.7    5e-04   Human papillomavirus type 18
ref|YP_004169276.1|  L1                                               45.4    5e-04   
gb|AAY86492.1|  L1                                                    45.4    5e-04   Human papillomavirus 5
ref|NP_041372.1|  major capsid protein                                45.4    6e-04   Human papillomavirus 5
gb|AAB19140.1|  major capsid protein L1                               43.5    6e-04   Human papillomavirus type 39
emb|CAP58402.1|  major capsid protein L1                              45.4    6e-04   Human papillomavirus 5
gb|AAK95802.1|  major capsid protein L1                               45.4    6e-04   Human papillomavirus
emb|CCX35146.1|  major envelope protein                               43.1    6e-04   
gb|AEA35084.1|  early protein L1                                      45.4    6e-04   
gb|AAB19139.1|  major capsid protein L1                               43.5    6e-04   Human papillomavirus type 39
emb|CAG26713.1|  major capsid protein                                 43.1    6e-04   Human papillomavirus
gb|ACK56762.1|  L1 capsid protein                                     43.1    6e-04   Human papillomavirus
gb|ACK56522.1|  L1 capsid protein                                     43.1    7e-04   Human papillomavirus
emb|CAA04508.1|  late major capsid protein L1                         43.1    7e-04   Human papillomavirus
emb|CAH41943.1|  major capsid protein                                 43.1    7e-04   Human papillomavirus type 68
gb|ACK56764.1|  L1 capsid protein                                     43.1    7e-04   Human papillomavirus
gb|AAB19169.1|  major capsid protein L1                               43.1    7e-04   Human papillomavirus type 68
gb|AFM74355.1|  L1 protein                                            43.1    7e-04   
ref|YP_001672014.1|  L1 protein                                       45.4    7e-04   Human papillomavirus type 88
gb|AGT95859.1|  L1 protein                                            45.4    8e-04   
gb|ACA61505.1|  L1 protein                                            45.1    8e-04   Bovine papillomavirus BAA5-Japan
gb|ACK56538.1|  truncated L1 capsid protein                           42.7    8e-04   Human papillomavirus
gb|AAG14947.1|AF181682_1  major capsid protein L1                     42.7    8e-04   Trichosurus vulpecula papillomavirus
gb|AAQ72427.1|  L1 protein                                            42.7    8e-04   Human papillomavirus
dbj|BAF95820.1|  L1 protein                                           45.1    8e-04   Bovine papillomavirus type 10
emb|CAW42222.1|  L1 protein                                           45.1    8e-04   Human papillomavirus 98
gb|AFL02858.1|  L1                                                    45.1    8e-04   
gb|ACK56519.1|  truncated L1 capsid protein                           42.4    0.001   Human papillomavirus
sp|P50812.1|VL1_HPV36  RecName: Full=Major capsid protein L1          44.7    0.001   Human papillomavirus type 36
gb|AAA67241.1|  L1 protein, My09/My11 region                          42.7    0.001   Human papillomavirus type 69



>gb|ADQ85945.1| L1 [Human papillomavirus type 149]
Length=516

 Score = 76.6 bits (187),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +TIVDN HNTNFTISQYNGQS  PDTYKA D++QYLRHVEE
Sbjct  343  VTIVDNAHNTNFTISQYNGQSPLPDTYKATDFNQYLRHVEE  383



>gb|AEQ98804.1| major capsid protein [Human papillomavirus type 155]
Length=514

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 1/42 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSS-APDTYKANDYSQYLRHVEE  3
            +TIVDNTHNTNFTISQY G +S  PDTYK++DY+Q+LRHVEE
Sbjct  339  VTIVDNTHNTNFTISQYKGDASEPPDTYKSDDYNQFLRHVEE  380



>gb|AFV27133.1| L1 [Human papillomavirus type 170]
Length=518

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 37/42 (88%), Gaps = 1/42 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSS-APDTYKANDYSQYLRHVEE  3
            +T+VDNTHNTNFTIS+YNG +S  PDTYK+ DY QYLRH+EE
Sbjct  342  VTVVDNTHNTNFTISRYNGAASEPPDTYKSTDYKQYLRHIEE  383



>gb|ADH29825.1| major capsid protein L1 [Human papillomavirus type 123]
Length=520

 Score = 68.2 bits (165),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQ-SSAPDTYKANDYSQYLRHVEE  3
            +T+VDNTHNTNFTISQY G  SS PDTYK +DY QYLRH EE
Sbjct  341  VTLVDNTHNTNFTISQYTGSASSPPDTYKQDDYKQYLRHAEE  382



>gb|AEM24627.1| major capsid protein [Human papillomavirus type 139]
Length=518

 Score = 65.5 bits (158),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T+VDNTHNTNFTISQY G    P TYK+ +Y +YLRHVEE
Sbjct  340  VTVVDNTHNTNFTISQYTGAGDTPTTYKSQEYKEYLRHVEE  380



>ref|YP_004169297.1| L1 [Human papillomavirus type 134]
 gb|ADQ85980.1| L1 [Human papillomavirus type 134]
Length=516

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T+VDNTHNTNFTIS+Y+G S+ P+TY ++++  YLRH EE
Sbjct  340  VTVVDNTHNTNFTISRYSGSSTKPETYNSSEFKNYLRHCEE  380



>ref|YP_002756544.1| L1 protein [Human papillomavirus type 109]
 gb|ACD67925.1| L1 protein [Human papillomavirus type 109]
Length=517

 Score = 59.7 bits (143),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNG-QSSAPDTYKANDYSQYLRHVEE  3
            +T+VDNTHNTNFTISQY+G Q   P  Y ++DY  YLRHVEE
Sbjct  340  VTVVDNTHNTNFTISQYSGAQEQPPQEYDSSDYKVYLRHVEE  381



>gb|AEM24620.1| major capsid protein [Human papillomavirus type 138]
Length=514

 Score = 59.7 bits (143),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 1/41 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T+VDNTHNTNFTISQY G S+   TYK+ D+ +YLRHVEE
Sbjct  340  VTVVDNTHNTNFTISQYTG-SNPLSTYKSTDFKEYLRHVEE  379



>gb|ADH29797.1| major capsid protein L1 [Human papillomavirus type 119]
Length=527

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 35/45 (78%), Gaps = 4/45 (9%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPD----TYKANDYSQYLRHVEE  3
            +T+VDNT NTNFTIS YN  +S P+     YKA++++QYLRHVEE
Sbjct  344  LTVVDNTRNTNFTISVYNKGASVPNPTQYVYKASEFNQYLRHVEE  388



>gb|ADQ85952.1| L1 [Human papillomavirus type 130]
Length=520

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 32/43 (74%), Gaps = 2/43 (5%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDT--YKANDYSQYLRHVEE  3
            ITI+DNTHNTNFT++ Y   +  PD+  YKA D+  YLRHVEE
Sbjct  342  ITILDNTHNTNFTLNFYKEAAKVPDSYKYKAEDFKHYLRHVEE  384



>gb|AGC93445.1| L1 protein, partial [Human papillomavirus]
Length=127

 Score = 52.4 bits (124),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 28/39 (72%), Gaps = 2/39 (5%)
 Frame = -2

Query  113  DNTHNTNFTISQYNGQSSAPD--TYKANDYSQYLRHVEE  3
            DNT NTNFTIS Y+ Q   P   TYKA D+ QYLRH+EE
Sbjct  1    DNTRNTNFTISVYSPQKEIPSGYTYKAGDFKQYLRHIEE  39



>emb|CAF05708.1| L1 protein [Human papillomavirus type 95]
Length=515

 Score = 53.9 bits (128),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T+VDNTHNTNFTIS  +       TYKAND+ QYLRH+EE
Sbjct  340  VTLVDNTHNTNFTISVKHEGEDNNYTYKANDFKQYLRHIEE  380



>gb|AFV27109.1| L1 [Human papillomavirus type 164]
Length=525

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 32/45 (71%), Gaps = 4/45 (9%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPD----TYKANDYSQYLRHVEE  3
            +T+VDNT NTNFTIS +   +  PD     YKA+D+ QYLRHVEE
Sbjct  343  LTVVDNTRNTNFTISVFQQAAKIPDPTQYNYKASDFKQYLRHVEE  387



>ref|YP_003668031.1| major capsid protein L1 [Human papillomavirus type 121]
 gb|ADH29811.1| major capsid protein L1 [Human papillomavirus type 121]
Length=519

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 31/43 (72%), Gaps = 2/43 (5%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPD--TYKANDYSQYLRHVEE  3
            IT+ DNTHNTNFT++ Y   +  P+  TYKA D+  YLRHVEE
Sbjct  340  ITLFDNTHNTNFTLNFYKNGTDVPEQYTYKAEDFKHYLRHVEE  382



>ref|YP_009058918.1| L1 [Apodemus sylvaticus papillomavirus 1]
 gb|AEI00711.1| L1 [Apodemus sylvaticus papillomavirus 1]
Length=515

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 1/41 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            IT+VDNT NTNFTISQ   Q+  PDTY + ++  YLRHVE+
Sbjct  335  ITLVDNTRNTNFTISQ-KTQTPNPDTYDSKNFKNYLRHVEQ  374



>sp|Q07874.1|VL1_HPV65 RecName: Full=Major capsid protein L1 [Human papillomavirus type 
65]
 emb|CAA50177.1| unnamed protein product [Human papillomavirus type 65]
Length=516

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T+VDNTHNTNFTIS     +     YKA D+ QYLRH+EE
Sbjct  340  VTLVDNTHNTNFTISVKTEAADESYKYKAGDFKQYLRHIEE  380



>ref|YP_873945.1| L1 [Micromys minutus papillomavirus 1]
 gb|ABB85358.1| L1 [Micromys minutus papillomavirus 1]
Length=512

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 1/41 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T+VDNT N NFTISQ   Q+  PDTY + ++ QYLRHVE+
Sbjct  341  VTLVDNTRNVNFTISQKT-QTPDPDTYDSQNFKQYLRHVEQ  380



>ref|YP_803393.1| major capsid L1 protein [Mastomys coucha papillomavirus 2]
 gb|ABG56162.1| L1 [Mastomys coucha papillomavirus 2]
Length=541

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 1/41 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T+VDNT NTNFTISQ    + +PD Y + ++ QYLRHVE+
Sbjct  360  VTMVDNTRNTNFTISQ-KTTTPSPDVYDSQNFKQYLRHVEQ  399



>gb|AIM47234.1| L1 [Human papillomavirus type 197]
Length=515

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 32/46 (70%), Gaps = 5/46 (11%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQ---SSAPD--TYKANDYSQYLRHVEE  3
            +T VDNT NTNF IS Y G    +S P   TYKA+D+ QYLRHVEE
Sbjct  343  LTYVDNTRNTNFNISVYTGDNAGASVPQNYTYKASDFKQYLRHVEE  388



>gb|AEM24648.1| major capsid protein [Human papillomavirus type 142]
Length=520

 Score = 51.2 bits (121),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 31/43 (72%), Gaps = 2/43 (5%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPD--TYKANDYSQYLRHVEE  3
            +T +DNTHNTNFT++ Y   S+ P+   YKA D+  YLRHVEE
Sbjct  340  VTFMDNTHNTNFTLNFYKEGSAIPEQYKYKATDFKHYLRHVEE  382



>ref|NP_040895.1| hypothetical protein HpV4gp7 [Human papillomavirus type 4]
 sp|Q07860.1|VL1_HPV04 RecName: Full=Major capsid protein L1 [Human papillomavirus type 
4]
 emb|CAA50163.1| unnamed protein product [Human papillomavirus type 4]
Length=516

 Score = 51.2 bits (121),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T+VDNTHNTNFTIS  +  ++    YKA+D+ QYLRH+EE
Sbjct  340  VTLVDNTHNTNFTISVKSDGANDNYQYKASDFKQYLRHIEE  380



>ref|YP_001595472.1| major structural protein [Bandicoot papillomatosis carcinomatosis 
virus type 1]
 gb|ABW76697.1| major structural protein [Bandicoot papillomatosis carcinomatosis 
virus type 1]
Length=505

 Score = 50.8 bits (120),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYN-GQSSAPDTYKANDYSQYLRHVEE  3
            ITIVDNT N NFTIS +N    S   TYK+++YS YLRHVEE
Sbjct  331  ITIVDNTRNCNFTISVFNKADESQGQTYKSSNYSVYLRHVEE  372



>gb|AFK85000.1| L1 [Miniopterus schreibersii papillomavirus 1]
Length=565

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 33/42 (79%), Gaps = 3/42 (7%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQ-YNGQSSAPDTYKANDYSQYLRHVEE  3
            IT++DNT +TNFTISQ   G ++A  +Y +NDY QYLRHVEE
Sbjct  395  ITVLDNTRSTNFTISQDVTGTAAA--SYTSNDYKQYLRHVEE  434



>gb|AEX31149.1| L1 protein [Human papillomavirus]
Length=511

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 34/46 (74%), Gaps = 5/46 (11%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYN-GQSSA-PD---TYKANDYSQYLRHVEE  3
            +T VDNT NTNFTIS Y+ GQ+   PD    YKA+D+ QY+RHVEE
Sbjct  339  LTYVDNTRNTNFTISVYSEGQAGEQPDQNYMYKASDFKQYMRHVEE  384



>ref|YP_001955936.1| major capsid protein [Bandicoot papillomatosis carcinomatosis 
virus type 2]
 gb|ABZ89642.1| major capsid protein [Bandicoot papillomatosis carcinomatosis 
virus type 2]
Length=502

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 32/42 (76%), Gaps = 1/42 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYN-GQSSAPDTYKANDYSQYLRHVEE  3
            IT+VDNT N NFTIS +N   SS   TYK+++Y+ +LRHVEE
Sbjct  331  ITVVDNTRNCNFTISVFNKADSSQGQTYKSSNYNMFLRHVEE  372



>gb|AFV27115.1| L1 [Human papillomavirus type 163]
Length=507

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T+VDNTHNTNFT+S       +   YKA+D++Q+LRHVEE
Sbjct  338  VTVVDNTHNTNFTLSVKKEGVDSNYKYKASDFNQFLRHVEE  378



>gb|ADQ85973.1| L1 [Human papillomavirus type 133]
Length=518

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 29/43 (67%), Gaps = 2/43 (5%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPD--TYKANDYSQYLRHVEE  3
            +TI DNTHNTNF ++ Y   S  P    YKA+D+  YLRHVEE
Sbjct  340  VTIFDNTHNTNFNLNFYKEDSKLPSEYKYKADDFKHYLRHVEE  382



>gb|ACU32897.1| L1 [Rattus norvegicus papillomavirus 1 EES-2009]
Length=511

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 1/41 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T+VDNT NTNFTISQ    +  PD Y + ++ QYLRHVE+
Sbjct  335  VTLVDNTRNTNFTISQ-KTTTPNPDVYDSQNFKQYLRHVEQ  374



>ref|YP_002427696.1| major capsid protein [Erinaceus europaeus papillomavirus]
 gb|ABQ66263.2| major capsid protein [Erinaceus europaeus papillomavirus 1]
Length=515

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 29/41 (71%), Gaps = 1/41 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +TIVDNT NTNFTIS    + + P  Y+A  + QYLRHVEE
Sbjct  337  LTIVDNTRNTNFTISM-TTEGTIPQEYEAKKFKQYLRHVEE  376



>gb|AHC00356.1| L1 [Human papillomavirus type 173]
Length=513

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTIS-QYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T+VDNTHN NF IS +  G +S   TYKA+D+  YLRHVEE
Sbjct  340  VTVVDNTHNVNFNISVKATGDNSDTYTYKASDFKHYLRHVEE  381



>gb|AEM24683.1| major capsid protein [Human papillomavirus type 147]
Length=521

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 30/45 (67%), Gaps = 4/45 (9%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPD----TYKANDYSQYLRHVEE  3
            +T+VDNT N NF IS Y   ++ P     TYKA+D+ QY RHVEE
Sbjct  342  LTVVDNTRNVNFNISVYKSAATVPTPNQYTYKASDFKQYSRHVEE  386



>emb|CAB54542.1| L1 [Human papillomavirus]
Length=129

 Score = 47.0 bits (110),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 30/43 (70%), Gaps = 2/43 (5%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDT--YKANDYSQYLRHVEE  3
            IT+VDNT NTNF+IS Y+   +  D   YKA  + +YLRHVEE
Sbjct  5    ITVVDNTRNTNFSISIYSEGGNIKDIQNYKATQFREYLRHVEE  47



>gb|AHA37347.1| L1 [Human papillomavirus type 168]
Length=523

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 30/46 (65%), Gaps = 5/46 (11%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPD-----TYKANDYSQYLRHVEE  3
            +T+VDN+ N NFTIS Y   ++ P       YKA D+ QYLRHVEE
Sbjct  343  LTVVDNSRNVNFTISVYKNGNNVPTPVNQYIYKATDFKQYLRHVEE  388



>gb|AGC93441.1| L1 [Human papillomavirus type 180]
Length=519

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 29/43 (67%), Gaps = 2/43 (5%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPD--TYKANDYSQYLRHVEE  3
            +TI DNTHNTNFT++ Y   +  P+   Y A D+  YLRHVEE
Sbjct  340  VTIFDNTHNTNFTLNFYKNDAKIPENYMYNAEDFKHYLRHVEE  382



>ref|YP_008720077.1| L1 protein [Mesocricetus auratus papillomavirus 1]
 emb|CDI44931.1| L1 protein [Mesocricetus auratus papillomavirus 1]
Length=502

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 3/41 (7%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            IT+VDNT N NFTI+Q N  +   D Y A ++SQYLRHVE+
Sbjct  333  ITLVDNTRNVNFTINQKNAHT---DDYAATNFSQYLRHVEQ  370



>ref|YP_009058911.1| L1 [Mus musculus papillomavirus 1]
 gb|AEI00704.1| L1 [Mus musculus papillomavirus 1]
Length=536

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 1/41 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T+VDNT NTNFTISQ    +  PDTY + ++  YLRHVE+
Sbjct  361  VTVVDNTRNTNFTISQQT-NTPNPDTYDSTNFKNYLRHVEQ  400



>ref|YP_003778198.1| L1 [Mus musculus papillomavirus type 1]
 gb|ADG63125.1| L1 [Mus musculus papillomavirus type 1]
Length=536

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 1/41 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T+VDNT NTNFTISQ    +  PDTY + ++  YLRHVE+
Sbjct  361  VTVVDNTRNTNFTISQQT-NTPNPDTYDSTNFKNYLRHVEQ  400



>gb|ACK56331.1| L1 capsid protein [Human papillomavirus]
Length=138

 Score = 46.2 bits (108),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 1/41 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T+VD T +TNFT+S    +S+ PD Y  N + +Y+RHVEE
Sbjct  9    LTVVDTTRSTNFTLST-TTESAVPDVYDPNKFKEYIRHVEE  48



>gb|AEM05821.1| L1 [Peromyscus papillomavirus type 1]
Length=507

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 29/41 (71%), Gaps = 3/41 (7%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T+VDNT  TNFTI   N Q +  DTYKA ++ QY RHVEE
Sbjct  338  VTVVDNTRGTNFTI---NVQQTKEDTYKAGNFKQYSRHVEE  375



>emb|CAH41942.1| major capsid protein [Human papillomavirus type 68]
Length=152

 Score = 45.8 bits (107),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 1/41 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T+VD T +TNFT+S    +S+ PD Y  N + +Y+RHVEE
Sbjct  16   LTVVDTTRSTNFTLST-TTESAVPDVYDPNKFKEYIRHVEE  55



>gb|AEW46324.1| major capsid protein L1 [Human papillomavirus type 13]
Length=151

 Score = 45.8 bits (107),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 28/41 (68%), Gaps = 1/41 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T+VD T +TN T+      SS  DTYKA +Y QY+RHVEE
Sbjct  16   VTVVDTTRSTNMTVCAAT-TSSLSDTYKATEYKQYMRHVEE  55



>emb|CAB42969.1| major capsid protein [Human papillomavirus]
Length=152

 Score = 45.8 bits (107),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 1/41 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T+VD T +TNFT+S    +S+ PD Y  N + +Y+RHVEE
Sbjct  16   LTVVDTTRSTNFTLST-TTESAVPDVYDPNKFKEYIRHVEE  55



>emb|CDN67544.1| L1 protein [Phodopus sungorus papillomavirus type 1]
Length=502

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 3/41 (7%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            IT+VDNT N NFTI+Q N  +   D Y A +++QYLRHVE+
Sbjct  333  ITLVDNTRNVNFTINQKNAHT---DDYAAQNFTQYLRHVEQ  370



>emb|CDX10179.1| L1 protein [Phodopus sungorus papillomavirus type 1]
 gb|AJA71482.1| L1 protein [Phodopus sungorus papillomavirus type 1]
Length=502

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 3/41 (7%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            IT+VDNT N NFTI+Q N  +   D Y A +++QYLRHVE+
Sbjct  333  ITLVDNTRNVNFTINQKNAHT---DDYAAQNFTQYLRHVEQ  370



>gb|AAQ72428.1| L1 protein [Human papillomavirus]
Length=110

 Score = 45.4 bits (106),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 1/41 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T+ DNT NTNFTIS  N ++   + Y AN+  +YLRHVEE
Sbjct  33   VTVADNTRNTNFTISVSN-EAQPAEEYNANNIREYLRHVEE  72



>gb|AEM24655.1| major capsid protein [Human papillomavirus type 143]
Length=516

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 30/43 (70%), Gaps = 2/43 (5%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDT--YKANDYSQYLRHVEE  3
            IT+VDNT NTNF+IS YN Q +  D   Y A+ + +Y RHVEE
Sbjct  343  ITVVDNTRNTNFSISVYNDQGAIKDIQDYNADKFREYQRHVEE  385



>gb|ADM89076.1| major capsid protein [Bovine papillomavirus]
Length=532

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/43 (56%), Positives = 30/43 (70%), Gaps = 2/43 (5%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQY--NGQSSAPDTYKANDYSQYLRHVEE  3
            +T VD+T  TNF+IS +  N ++   DTYKA DY  YLRHVEE
Sbjct  357  VTAVDSTRGTNFSISVHKDNPEAGPQDTYKAADYKHYLRHVEE  399



>ref|YP_004169269.1| L1 [Human papillomavirus type 128]
 gb|ADR77927.1| L1 [Human papillomavirus type 128]
Length=504

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 32/44 (73%), Gaps = 3/44 (7%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNG-QSSAPDTYK--ANDYSQYLRHVEE  3
            +T+VDNT  TN+T+S YN  Q   PD+YK  A+D++QY RH EE
Sbjct  331  VTVVDNTRATNYTLSVYNKNQGKLPDSYKYTASDFNQYTRHTEE  374



>emb|CCW28273.1| major capsid protein, partial [Human papillomavirus]
Length=127

 Score = 45.1 bits (105),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 28/43 (65%), Gaps = 2/43 (5%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYN--GQSSAPDTYKANDYSQYLRHVEE  3
            +T+VDNT NTNF+IS Y   G+      Y A  + +YLRHVEE
Sbjct  8    VTVVDNTRNTNFSISMYTEAGEIKNIANYDAKKFREYLRHVEE  50



>emb|CDG15350.1| major capsid protein, partial [Human papillomavirus]
Length=127

 Score = 44.7 bits (104),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 27/43 (63%), Gaps = 2/43 (5%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDT--YKANDYSQYLRHVEE  3
            IT+VDNT NTNF+IS Y       D   Y AN + +Y RHVEE
Sbjct  8    ITVVDNTRNTNFSISVYTDPGKVRDIKDYDANKFREYQRHVEE  50



>ref|YP_009022063.2| L1 protein [Human papillomavirus type 178]
 gb|AHN16192.2| L1 protein [Human papillomavirus type 178]
Length=511

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 31/46 (67%), Gaps = 5/46 (11%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQY-NGQSSAPDT----YKANDYSQYLRHVEE  3
            ++ VDNT NTNF +S Y +G   AP      YKA+D+ QYLRHVEE
Sbjct  338  VSYVDNTRNTNFNLSVYKSGAPGAPVPSDYRYKASDFKQYLRHVEE  383



>gb|AGC93434.2| L1 [Human papillomavirus type 175]
Length=504

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 27/43 (63%), Gaps = 2/43 (5%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPD--TYKANDYSQYLRHVEE  3
            +T+VDNT NTNF IS Y      P+   YKA D+  Y+RH EE
Sbjct  334  VTVVDNTRNTNFNISVYKENGGIPNEYQYKAKDFKNYVRHTEE  376



>dbj|BAE87028.1| major capsid protein [Bovine papillomavirus]
 dbj|BAE87032.1| major capsid protein [Bovine papillomavirus]
Length=183

 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 27/43 (63%), Gaps = 2/43 (5%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSA--PDTYKANDYSQYLRHVEE  3
            IT VD T  TNFTIS +  +      DTY A+DY  YLRHVEE
Sbjct  18   ITAVDTTRGTNFTISVHKSEEGPREQDTYTASDYKHYLRHVEE  60



>dbj|BAE87030.1| major capsid protein [Bovine papillomavirus]
Length=183

 Score = 45.1 bits (105),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 27/43 (63%), Gaps = 2/43 (5%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSA--PDTYKANDYSQYLRHVEE  3
            IT VD T  TNFTIS +  +      DTY A+DY  YLRHVEE
Sbjct  18   ITAVDTTRGTNFTISVHKSEEGPREQDTYTASDYKHYLRHVEE  60



>sp|P50790.1|VL1_HPV24 RecName: Full=Major capsid protein L1 [Human papillomavirus type 
24]
 gb|AAA79421.1| major capsid protein L1 [Human papillomavirus type 24]
Length=512

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 31/43 (72%), Gaps = 2/43 (5%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQY--NGQSSAPDTYKANDYSQYLRHVEE  3
            IT+VDNT NTNF+IS Y  NG+ +  + Y AN + +Y RHVEE
Sbjct  345  ITVVDNTRNTNFSISVYTENGKVTDINEYDANKFREYQRHVEE  387



>gb|ACK56825.1| L1 capsid protein [Human papillomavirus]
Length=138

 Score = 44.3 bits (103),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 26/41 (63%), Gaps = 1/41 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T+VD T +TN TI     QS  P TY +  Y QY+RHVEE
Sbjct  9    VTVVDTTRSTNMTICAATTQS-PPSTYTSEQYKQYMRHVEE  48



>gb|ACK56613.1| L1 capsid protein [Human papillomavirus]
 gb|ACK56616.1| L1 capsid protein [Human papillomavirus]
 gb|ACK56823.1| L1 capsid protein [Human papillomavirus]
Length=138

 Score = 44.3 bits (103),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 26/41 (63%), Gaps = 1/41 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T+VD T +TN TI     QS  P TY +  Y QY+RHVEE
Sbjct  9    VTVVDTTRSTNMTICAATTQS-PPSTYTSEQYKQYMRHVEE  48



>gb|ACK56446.1| L1 capsid protein [Human papillomavirus]
 gb|ACK56447.1| L1 capsid protein [Human papillomavirus]
 gb|ACK56448.1| L1 capsid protein [Human papillomavirus]
Length=138

 Score = 44.3 bits (103),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 26/41 (63%), Gaps = 1/41 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T+VD T +TN TI     QS  P TY +  Y QY+RHVEE
Sbjct  9    VTVVDTTRSTNMTICAATTQS-PPSTYTSEQYKQYMRHVEE  48



>gb|ACK56826.1| L1 capsid protein [Human papillomavirus]
Length=138

 Score = 44.3 bits (103),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 26/41 (63%), Gaps = 1/41 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T+VD T +TN TI     QS  P TY +  Y QY+RHVEE
Sbjct  9    VTVVDTTRSTNMTICAATTQS-PPSTYTSEQYKQYMRHVEE  48



>gb|ACK56617.1| L1 capsid protein [Human papillomavirus]
Length=138

 Score = 44.3 bits (103),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 26/41 (63%), Gaps = 1/41 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T+VD T +TN TI     QS  P TY +  Y QY+RHVEE
Sbjct  9    VTVVDTTRSTNMTICAATTQS-PPSTYTSEQYKQYMRHVEE  48



>ref|YP_002756551.1| L1 protein [Human papillomavirus type 112]
 gb|ACD67932.1| L1 protein [Human papillomavirus type 112]
Length=526

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 29/43 (67%), Gaps = 2/43 (5%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPD--TYKANDYSQYLRHVEE  3
            +T+VDNT NTNFTIS        P    YKA+++ QYLRHVEE
Sbjct  345  LTVVDNTRNTNFTISVSKTAIENPSQYNYKADNFKQYLRHVEE  387



>emb|CAB54539.1| L1 [Human papillomavirus]
Length=127

 Score = 44.3 bits (103),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 30/41 (73%), Gaps = 1/41 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            IT+ DNT NTNFTIS  + +++  + Y AN+  +YLRHVEE
Sbjct  5    ITVADNTRNTNFTIS-VSTEAAQTEEYNANNIREYLRHVEE  44



>gb|AAA47016.1| coat protein, partial [Human papillomavirus type 13]
Length=199

 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 28/41 (68%), Gaps = 1/41 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T+VD T +TN T+      SS  DTYKA +Y QY+RHVEE
Sbjct  89   VTVVDTTRSTNMTVCAAT-TSSLSDTYKATEYKQYMRHVEE  128



>ref|YP_003084352.1| L1 protein [Human papillomavirus 116]
 gb|ACT76418.1| L1 protein [Human papillomavirus 116]
Length=518

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 29/43 (67%), Gaps = 2/43 (5%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPD--TYKANDYSQYLRHVEE  3
            IT++DNTHNTNF +S Y G     +  TYK  D+ ++LRH EE
Sbjct  339  ITLLDNTHNTNFILSVYTGARPMEEGYTYKKADFKKFLRHTEE  381



>gb|AHM27271.1| L1 protein [Vulpes vulpes papillomavirus 1]
Length=512

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 26/40 (65%), Gaps = 1/40 (3%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVE  6
            IT+VDNTHNTNF I+  N     P TYK  D+  +LRH E
Sbjct  335  ITLVDNTHNTNFHIT-VNSNGETPQTYKPADFRTFLRHTE  373



>emb|CAA03932.1| L1 [Human papillomavirus]
Length=130

 Score = 43.9 bits (102),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 28/43 (65%), Gaps = 2/43 (5%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQY--NGQSSAPDTYKANDYSQYLRHVEE  3
            IT+VDNT NTNF+IS Y   GQ      Y +  + +YLRHVEE
Sbjct  5    ITVVDNTRNTNFSISVYTEGGQIKDIRDYTSTQFREYLRHVEE  47



>gb|ACK56322.1| L1 capsid protein [Human papillomavirus]
Length=138

 Score = 43.9 bits (102),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 30/41 (73%), Gaps = 1/41 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T+VD T +TNFT+S  + +SS P TY  + + +Y+RHVEE
Sbjct  9    LTVVDTTRSTNFTLST-SIESSIPSTYDPSKFKEYIRHVEE  48



>gb|ACK56316.1| L1 capsid protein [Human papillomavirus]
 gb|ACK56318.1| L1 capsid protein [Human papillomavirus]
 gb|ACK56321.1| L1 capsid protein [Human papillomavirus]
Length=138

 Score = 43.9 bits (102),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 30/41 (73%), Gaps = 1/41 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T+VD T +TNFT+S  + +SS P TY  + + +Y+RHVEE
Sbjct  9    LTVVDTTRSTNFTLST-SIESSIPSTYDPSKFKEYIRHVEE  48



>sp|P06417.1|VL1_HPV08 RecName: Full=Major capsid protein L1 [Human papillomavirus type 
8]
Length=514

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 30/43 (70%), Gaps = 2/43 (5%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQY--NGQSSAPDTYKANDYSQYLRHVEE  3
            +T+VDNT NTNF+IS Y  NG+      YK+  + +YLRHVEE
Sbjct  342  VTVVDNTRNTNFSISVYTENGELKNITDYKSTQFREYLRHVEE  384



>ref|YP_656498.1| L1 protein [Human papillomavirus type 103]
 gb|AAZ39490.1| L1 protein [Human papillomavirus type 103]
Length=515

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 25/41 (61%), Gaps = 1/41 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            IT+VDNTHN NFTI+     +     Y A  Y  YLRHVEE
Sbjct  341  ITLVDNTHNVNFTIN-VKSDAGVAQQYAATSYKHYLRHVEE  380



>gb|ACK56407.1| truncated L1 capsid protein [Human papillomavirus]
Length=115

 Score = 43.9 bits (102),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 29/41 (71%), Gaps = 1/41 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T+VD T +TNFT+S    +S+ P+ Y  N + +Y+RHVEE
Sbjct  9    LTVVDTTRSTNFTLST-TTESAVPNIYDPNKFKEYIRHVEE  48



>gb|ACK56317.1| L1 capsid protein [Human papillomavirus]
Length=138

 Score = 43.9 bits (102),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 30/41 (73%), Gaps = 1/41 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T+VD T +TNFT+S  + +SS P TY  + + +Y+RHVEE
Sbjct  9    LTVVDTTRSTNFTLST-SIKSSIPSTYDPSKFKEYIRHVEE  48



>gb|AAR20823.1| L1 capsid protein [Florida manatee papillomavirus]
 gb|AAR20824.2| L1 capsid protein [Florida manatee papillomavirus]
 gb|AAS00466.1| L1 capsid protein [Florida manatee papillomavirus]
 gb|AAS00467.1| L1 capsid protein [Florida manatee papillomavirus]
 gb|AAS00468.1| L1 capsid protein [Florida manatee papillomavirus]
 gb|AAS00469.1| L1 capsid protein [Florida manatee papillomavirus]
 gb|AAS00470.1| L1 capsid protein [Florida manatee papillomavirus]
 gb|AAS00472.1| L1 capsid protein [Florida manatee papillomavirus]
 gb|AAS00473.1| L1 capsid protein [Florida manatee papillomavirus]
Length=153

 Score = 43.9 bits (102),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +TI+DNT  TN T+S     +   D Y  NDY+QYLRH EE
Sbjct  16   VTILDNTRGTNMTVSVSTQNALVVDHYDDNDYAQYLRHAEE  56



>gb|AAF19369.1|AF193303_1 major capsid protein L1 [Human papillomavirus]
Length=79

 Score = 43.5 bits (101),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 27/41 (66%), Gaps = 1/41 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T+ DNT NTNFTIS    Q+S    Y AN   ++LRHVEE
Sbjct  8    VTVADNTRNTNFTIS-VTSQNSPLTEYDANSIREFLRHVEE  47



>gb|ACK56313.1| L1 capsid protein [Human papillomavirus]
Length=138

 Score = 43.9 bits (102),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 30/41 (73%), Gaps = 1/41 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T+ DNT NTNFTIS  + +++  + Y AN+  +YLRHVEE
Sbjct  9    VTVADNTRNTNFTIS-VSTEAAQTEEYNANNIREYLRHVEE  48



>emb|CAA03934.1| L1 [Human papillomavirus]
Length=145

 Score = 43.9 bits (102),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 28/43 (65%), Gaps = 2/43 (5%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDT--YKANDYSQYLRHVEE  3
            IT+VDNT NTNF+IS Y+      D   Y AN + +Y +HVEE
Sbjct  5    ITVVDNTRNTNFSISVYSEAGKVKDISDYDANKFREYQKHVEE  47



>ref|YP_009021240.1| putative L1 protein [Canis familiaris papillomavirus 13]
 gb|AFQ52499.1| putative L1 protein [Canis familiaris papillomavirus 13]
Length=504

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 30/41 (73%), Gaps = 2/41 (5%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T++DNT NTNF+IS  N Q   PDT+++  ++ + RHVEE
Sbjct  332  VTVMDNTRNTNFSISVLNKQK--PDTFESTAFNHFTRHVEE  370



>gb|AAA67237.1| L1 protein, My09/My11 region, partial [Human papillomavirus type 
44]
Length=151

 Score = 43.9 bits (102),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 26/41 (63%), Gaps = 1/41 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T+VD T +TN TI     QS  P TY +  Y QY+RHVEE
Sbjct  16   VTVVDTTRSTNMTICAATTQS-PPSTYTSEQYKQYMRHVEE  55



>gb|AFM74344.1| L1 protein, partial [Human papillomavirus type 44]
Length=150

 Score = 43.9 bits (102),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 26/41 (63%), Gaps = 1/41 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T+VD T +TN TI     QS  P TY +  Y QY+RHVEE
Sbjct  15   VTVVDTTRSTNMTICAATTQS-PPSTYTSEQYKQYMRHVEE  54



>ref|YP_008828150.1| L1 [Human papillomavirus type 167]
 gb|AHA37353.1| L1 [Human papillomavirus type 167]
Length=516

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 30/44 (68%), Gaps = 4/44 (9%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDT---YKANDYSQYLRHVEE  3
            +TI+DNT NTNF IS +  Q S  DT   YKA D+  YLRH+EE
Sbjct  341  LTILDNTRNTNFIISVFK-QDSTLDTTYSYKAADFKNYLRHIEE  383



>gb|ACK56411.1| L1 capsid protein [Human papillomavirus]
Length=138

 Score = 43.5 bits (101),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 29/41 (71%), Gaps = 1/41 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T+VD T +TNFT+S    +S+ P+ Y  N + +Y+RHVEE
Sbjct  9    LTVVDTTRSTNFTLST-TTESAVPNIYDPNKFKEYIRHVEE  48



>gb|AGU90815.1| L1 [Human papillomavirus type 68]
Length=505

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 1/41 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T+VD T +TNFT+S    +S+ PD Y  N + +Y+RHVEE
Sbjct  331  LTVVDTTRSTNFTLST-TTESAVPDVYDPNKFKEYIRHVEE  370



>gb|AAO15462.1|AF436130_8 putative major capsid protein L1 [Human papillomavirus type 74]
Length=528

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T+VD T +TN T+     QS    TY + DY QY+RHVEE
Sbjct  353  VTVVDTTRSTNMTVCAPTTQSPPAATYTSTDYKQYMRHVEE  393



>gb|AGU90801.1| L1 [Human papillomavirus type 68]
Length=505

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 1/41 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T+VD T +TNFT+S    +S+ PD Y  N + +Y+RHVEE
Sbjct  331  LTVVDTTRSTNFTLST-TTESAVPDVYDPNKFKEYIRHVEE  370



>gb|AGU90794.1| L1 [Human papillomavirus type 68]
 gb|AGU90808.1| L1 [Human papillomavirus type 68]
Length=505

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 1/41 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T+VD T +TNFT+S    +S+ PD Y  N + +Y+RHVEE
Sbjct  331  LTVVDTTRSTNFTLST-TTESAVPDVYDPNKFKEYIRHVEE  370



>gb|AHB82182.1| L1 protein, partial [Bovine papillomavirus]
Length=154

 Score = 43.9 bits (102),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 28/43 (65%), Gaps = 2/43 (5%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPD--TYKANDYSQYLRHVEE  3
            +T VD+T  TNFTIS +  + S  D  TY A D+  YLRHVEE
Sbjct  16   VTAVDSTRGTNFTISVHRNKPSLEDQDTYTAADFKHYLRHVEE  58



>gb|ABC79063.1| L1 [Human papillomavirus type 13]
Length=499

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 28/41 (68%), Gaps = 1/41 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T+VD T +TN T+      SS  DTYKA +Y QY+RHVEE
Sbjct  325  VTVVDTTRSTNMTVCAAT-TSSLSDTYKATEYKQYMRHVEE  364



>sp|Q02273.1|VL1_HPV13 RecName: Full=Major capsid protein L1 [Human papillomavirus type 
13]
 emb|CAA44654.1| L1 [Human papillomavirus type 13]
Length=499

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 28/41 (68%), Gaps = 1/41 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T+VD T +TN T+      SS  DTYKA +Y QY+RHVEE
Sbjct  325  VTVVDTTRSTNMTVCAAT-TSSLSDTYKATEYKQYMRHVEE  364



>ref|NP_043443.1| major capsid protein L1 [Human papillomavirus type 60]
 sp|P50821.2|VL1_HPV60 RecName: Full=Major capsid protein L1 [Human papillomavirus type 
60]
 gb|AAA79491.1| major capsid protein L1 [Human papillomavirus type 60]
Length=508

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 29/44 (66%), Gaps = 4/44 (9%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPD---TYKANDYSQYLRHVEE  3
            ITIVDNT NTN +IS Y  Q +A D    YK  D+ QYLRH EE
Sbjct  336  ITIVDNTRNTNLSISVYK-QDAAIDNRYKYKQEDFRQYLRHTEE  378



>gb|AHA13320.1| L1 protein, partial [Xipapillomavirus 1]
Length=200

 Score = 44.3 bits (103),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 28/43 (65%), Gaps = 2/43 (5%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPD--TYKANDYSQYLRHVEE  3
            +T VD+T  TNFTIS +  + S  D  TY A D+  YLRHVEE
Sbjct  25   VTAVDSTRGTNFTISVHRNKPSLEDQDTYTAADFKHYLRHVEE  67



>sp|P50787.1|VL1_HPV21 RecName: Full=Major capsid protein L1 [Human papillomavirus type 
21]
 gb|AAA79400.1| major capsid protein L1 [Human papillomavirus type 21]
Length=518

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 29/43 (67%), Gaps = 2/43 (5%)
 Frame = -2

Query  125  ITIVDNTHNTNFTIS--QYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T+VDNT NTNF+IS    N   S  + YKA  + +YLRHVEE
Sbjct  345  VTVVDNTRNTNFSISVNPENADVSKIENYKAESFQEYLRHVEE  387



>emb|CCW28274.1| major capsid protein, partial [Human papillomavirus]
Length=124

 Score = 43.1 bits (100),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 27/41 (66%), Gaps = 1/41 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            IT+ DNT NTNFTIS  N   +  D Y A +  +YLRHVEE
Sbjct  8    ITVADNTRNTNFTISVTNDAGAIED-YTAQNIREYLRHVEE  47



>gb|AGU90787.1| L1 [Human papillomavirus type 68]
Length=505

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 1/41 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T+VD T +TNFT+S    +S+ PD Y  N + +Y+RHVEE
Sbjct  331  LTVVDTTRSTNFTLST-TTESAVPDIYDPNKFKEYIRHVEE  370



>gb|AEX31177.1| L1 protein [Human papillomavirus]
Length=508

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 28/44 (64%), Gaps = 3/44 (7%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYN---GQSSAPDTYKANDYSQYLRHVEE  3
            ITI DN+  TNFT+S YN   G+  A  +YK  D+  YLRH EE
Sbjct  336  ITIYDNSRGTNFTLSVYNQNDGKVPASYSYKNTDFKNYLRHAEE  379



>gb|ABL86457.1| major capsid protein L1, partial [Human papillomavirus type 18]
Length=48

 Score = 42.7 bits (99),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 26/41 (63%), Gaps = 1/41 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T+VDNT +TN TI   + QS  P  Y A  + QY RHVEE
Sbjct  2    VTVVDNTRSTNLTICA-STQSPVPGQYDATKFKQYSRHVEE  41



>ref|YP_004169276.1| L1 [Human papillomavirus type 129]
 gb|ADR77934.1| L1 [Human papillomavirus type 129]
Length=517

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 30/43 (70%), Gaps = 2/43 (5%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKAN--DYSQYLRHVEE  3
            IT++DNTHNTNFT+S Y  Q      Y+ N  ++ +YLRHVEE
Sbjct  340  ITLLDNTHNTNFTLSVYTEQPPMNANYQYNKSNFRKYLRHVEE  382



>gb|AAY86492.1| L1 [Human papillomavirus type 5]
Length=516

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 29/43 (67%), Gaps = 2/43 (5%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDT--YKANDYSQYLRHVEE  3
            IT+VDNT NTNF+IS YN   +  D   Y A+ + +Y RHVEE
Sbjct  343  ITVVDNTRNTNFSISVYNQAGALKDVADYNADQFREYQRHVEE  385



>ref|NP_041372.1| major capsid protein [Human papillomavirus type 5]
 sp|P06917.2|VL1_HPV05 RecName: Full=Major capsid protein L1 [Human papillomavirus type 
5]
 gb|AAA46990.1| major capsid protein [Human papillomavirus type 5]
Length=516

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 29/43 (67%), Gaps = 2/43 (5%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDT--YKANDYSQYLRHVEE  3
            IT+VDNT NTNF+IS YN   +  D   Y A+ + +Y RHVEE
Sbjct  343  ITVVDNTRNTNFSISVYNQAGALKDVADYNADQFREYQRHVEE  385



>gb|AAB19140.1| major capsid protein L1, partial [Human papillomavirus type 39]
Length=152

 Score = 43.5 bits (101),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 30/41 (73%), Gaps = 1/41 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T+VD T +TNFT+S  + +SS P TY  + + +Y+RHVEE
Sbjct  16   LTVVDTTRSTNFTLST-SIESSIPSTYDPSKFKEYIRHVEE  55



>emb|CAP58402.1| major capsid protein L1 [Human papillomavirus type 5]
Length=516

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 29/43 (67%), Gaps = 2/43 (5%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDT--YKANDYSQYLRHVEE  3
            IT+VDNT NTNF+IS YN   +  D   Y A+ + +Y RHVEE
Sbjct  343  ITVVDNTRNTNFSISVYNQAGALKDVADYNADQFREYQRHVEE  385



>gb|AAK95802.1| major capsid protein L1 [Human papillomavirus]
Length=516

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 29/43 (67%), Gaps = 2/43 (5%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDT--YKANDYSQYLRHVEE  3
            IT+VDNT NTNF+IS YN + +  D   Y A  + +Y RHVEE
Sbjct  343  ITVVDNTRNTNFSISVYNERGAIKDISDYNAEQFREYQRHVEE  385



>emb|CCX35146.1| major envelope protein, partial [Human papillomavirus]
Length=124

 Score = 43.1 bits (100),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 27/41 (66%), Gaps = 1/41 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            IT+ DNT NTNFTIS  N   +  D Y A +  +YLRHVEE
Sbjct  8    ITVADNTRNTNFTISVTNDAGAIED-YTAQNIREYLRHVEE  47



>gb|AEA35084.1| early protein L1 [Human papillomavirus type 36]
Length=516

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 29/43 (67%), Gaps = 2/43 (5%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDT--YKANDYSQYLRHVEE  3
            IT+VDNT NTNF+IS YN + +  D   Y A  + +Y RHVEE
Sbjct  343  ITVVDNTRNTNFSISVYNERGAIKDISDYNAEQFREYQRHVEE  385



>gb|AAB19139.1| major capsid protein L1, partial [Human papillomavirus type 39]
Length=152

 Score = 43.5 bits (101),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 30/41 (73%), Gaps = 1/41 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T+VD T +TNFT+S  + +SS P TY  + + +Y+RHVEE
Sbjct  16   LTVVDTTRSTNFTLST-SIESSIPSTYDPSKFKEYIRHVEE  55



>emb|CAG26713.1| major capsid protein [Human papillomavirus]
Length=123

 Score = 43.1 bits (100),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 27/41 (66%), Gaps = 1/41 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            IT+ DNT NTNF+IS  + + + P  Y A    +YLRHVEE
Sbjct  8    ITVADNTRNTNFSIS-VSTEDTPPQEYDATKIREYLRHVEE  47



>gb|ACK56762.1| L1 capsid protein [Human papillomavirus]
Length=138

 Score = 43.1 bits (100),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 1/41 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T+VD T +TNFT+S  + +SS P TY  + + +Y RHVEE
Sbjct  9    LTVVDTTRSTNFTLST-STESSIPSTYDPSKFKEYTRHVEE  48



>gb|ACK56522.1| L1 capsid protein [Human papillomavirus]
Length=138

 Score = 43.1 bits (100),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 1/41 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T+VD T +TNFT+S   G SS P TY  + + +Y RHVEE
Sbjct  9    LTVVDTTRSTNFTLSTSIG-SSIPSTYDPSKFKEYTRHVEE  48



>emb|CAA04508.1| late major capsid protein L1 [Human papillomavirus]
Length=145

 Score = 43.1 bits (100),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 30/43 (70%), Gaps = 2/43 (5%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQY--NGQSSAPDTYKANDYSQYLRHVEE  3
            IT+VDNT +TNF+IS +  N   S  D++ A  + +YLRHVEE
Sbjct  5    ITVVDNTRSTNFSISVHTENQDISKIDSFDATQFREYLRHVEE  47



>emb|CAH41943.1| major capsid protein [Human papillomavirus type 68]
Length=152

 Score = 43.1 bits (100),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 29/41 (71%), Gaps = 1/41 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T+VD T +TNFT+S    +S+ P+ Y  N + +Y+RHVEE
Sbjct  16   LTVVDTTRSTNFTLST-TTESAVPNIYDPNKFKEYIRHVEE  55



>gb|ACK56764.1| L1 capsid protein [Human papillomavirus]
Length=138

 Score = 43.1 bits (100),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 1/41 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T+VD T +TNFT+S  + +SS P TY  + + +Y RHVEE
Sbjct  9    LTVVDTTRSTNFTLST-STESSIPSTYDPSKFKEYTRHVEE  48



>gb|AAB19169.1| major capsid protein L1, partial [Human papillomavirus type 68]
Length=152

 Score = 43.1 bits (100),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 29/41 (71%), Gaps = 1/41 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T+VD T +TNFT+S    +S+ P+ Y  N + +Y+RHVEE
Sbjct  16   LTVVDTTRSTNFTLST-TTESAVPNIYDPNKFKEYIRHVEE  55



>gb|AFM74355.1| L1 protein, partial [Human papillomavirus type 68]
Length=153

 Score = 43.1 bits (100),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 29/41 (71%), Gaps = 1/41 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T+VD T +TNFT+S    +S+ P+ Y  N + +Y+RHVEE
Sbjct  17   LTVVDTTRSTNFTLST-TTESAVPNIYDPNKFKEYIRHVEE  56



>ref|YP_001672014.1| L1 protein [Human papillomavirus type 88]
 gb|ABR20508.1| L1 protein [Human papillomavirus type 88]
Length=510

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 2/43 (5%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPD--TYKANDYSQYLRHVEE  3
            +T++DN+ NTNFT+S YN   +  +  TYK+ D++QY RH EE
Sbjct  336  VTVLDNSRNTNFTLSIYNQGGAIGNQYTYKSQDFTQYTRHAEE  378



>gb|AGT95859.1| L1 protein [Bovine papillomavirus type 10]
Length=580

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 27/43 (63%), Gaps = 2/43 (5%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSA--PDTYKANDYSQYLRHVEE  3
            IT VD T  TNFTIS +  +      DTY A+DY  YLRHVEE
Sbjct  406  ITAVDTTRGTNFTISVHKSEEGPREQDTYTASDYKHYLRHVEE  448



>gb|ACA61505.1| L1 protein [Bovine papillomavirus BAA5-Japan]
Length=580

 Score = 45.1 bits (105),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 27/43 (63%), Gaps = 2/43 (5%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSA--PDTYKANDYSQYLRHVEE  3
            IT VD T  TNFTIS +  +      DTY A+DY  YLRHVEE
Sbjct  406  ITAVDTTRGTNFTISVHKSEEGPREQDTYTASDYKHYLRHVEE  448



>gb|ACK56538.1| truncated L1 capsid protein [Human papillomavirus]
Length=107

 Score = 42.7 bits (99),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 1/41 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T+VD T +TNFT+S  + +SS P TY  + + +Y RHVEE
Sbjct  9    LTVVDTTRSTNFTLST-SIESSIPSTYDPSKFKEYTRHVEE  48



>gb|AAG14947.1|AF181682_1 major capsid protein L1, partial [Trichosurus vulpecula papillomavirus]
Length=130

 Score = 42.7 bits (99),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 1/41 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T+VDNT N NF+IS  +     P T+  ++Y QYLRHVEE
Sbjct  5    LTMVDNTRNYNFSISVLDVDP-PPQTFNNDNYKQYLRHVEE  44



>gb|AAQ72427.1| L1 protein [Human papillomavirus]
Length=113

 Score = 42.7 bits (99),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 30/44 (68%), Gaps = 4/44 (9%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKAN---DYSQYLRHVEE  3
            +T+VDNT NTNFTIS  +    AP  Y A+   ++ +YLRHVEE
Sbjct  33   VTVVDNTRNTNFTIS-VSSTDQAPTEYNASNTPNFREYLRHVEE  75



>dbj|BAF95820.1| L1 protein [Bovine papillomavirus-10]
Length=580

 Score = 45.1 bits (105),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 27/43 (63%), Gaps = 2/43 (5%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSA--PDTYKANDYSQYLRHVEE  3
            IT VD T  TNFTIS +  +      DTY A+DY  YLRHVEE
Sbjct  406  ITAVDTTRGTNFTISVHKSEEGPREQDTYTASDYKHYLRHVEE  448



>emb|CAW42222.1| L1 protein [Human papillomavirus type 98]
Length=512

 Score = 45.1 bits (105),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 28/43 (65%), Gaps = 2/43 (5%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDT--YKANDYSQYLRHVEE  3
            IT+VDNT NTNF+IS Y+      D   Y AN + +Y RHVEE
Sbjct  345  ITVVDNTRNTNFSISVYSEAGKVKDISDYDANKFREYQRHVEE  387



>gb|AFL02858.1| L1 [Human papillomavirus type 5]
Length=516

 Score = 45.1 bits (105),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 28/43 (65%), Gaps = 2/43 (5%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDT--YKANDYSQYLRHVEE  3
            IT+VDNT NTNF+IS YN   +  D   Y A  + +Y RHVEE
Sbjct  343  ITVVDNTRNTNFSISVYNQAGALKDVADYNAEQFREYQRHVEE  385



>gb|ACK56519.1| truncated L1 capsid protein [Human papillomavirus]
Length=114

 Score = 42.4 bits (98),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 1/41 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T+VD T +TNFT+S  + +SS P TY  + + +Y RHVEE
Sbjct  9    LTVVDTTRSTNFTLST-SIESSIPSTYDPSKFKEYTRHVEE  48



>sp|P50812.1|VL1_HPV36 RecName: Full=Major capsid protein L1 [Human papillomavirus type 
36]
 gb|AAA79442.1| major capsid protein L1 [Human papillomavirus type 36]
Length=516

 Score = 44.7 bits (104),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 28/43 (65%), Gaps = 2/43 (5%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDT--YKANDYSQYLRHVEE  3
            IT+VDNT NTNF+IS YN   +  D   Y A  + +Y RHVEE
Sbjct  343  ITVVDNTRNTNFSISIYNNNGALKDINDYTAEQFREYQRHVEE  385



>gb|AAA67241.1| L1 protein, My09/My11 region, partial [Human papillomavirus type 
69]
Length=152

 Score = 42.7 bits (99),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 1/41 (2%)
 Frame = -2

Query  125  ITIVDNTHNTNFTISQYNGQSSAPDTYKANDYSQYLRHVEE  3
            +T VD T +TN TIS  + QS A  T+K +DY Q++RH EE
Sbjct  16   VTCVDTTRSTNLTISTVSAQS-ASATFKPSDYKQFIRHGEE  55



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 515174157784