BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7675_g1_i1 len=687 path=[1:0-686]

Length=687
                                                                      Score     E

ref|XP_010317039.1|  PREDICTED: wall-associated receptor kinase-l...    241   5e-71   
ref|XP_009773751.1|  PREDICTED: wall-associated receptor kinase-l...    240   1e-70   
ref|XP_009627286.1|  PREDICTED: wall-associated receptor kinase-l...    239   3e-70   
ref|XP_006365061.1|  PREDICTED: wall-associated receptor kinase-l...    238   6e-70   
ref|XP_010663521.1|  PREDICTED: wall-associated receptor kinase-l...    139   4e-34   
ref|XP_010663520.1|  PREDICTED: wall-associated receptor kinase-l...    139   4e-34   
emb|CDP11258.1|  unnamed protein product                                138   1e-33   
emb|CAN64181.1|  hypothetical protein VITISV_007799                     135   8e-33   Vitis vinifera
ref|XP_010663682.1|  PREDICTED: wall-associated receptor kinase-l...    135   9e-33   
emb|CBI15571.3|  unnamed protein product                                135   2e-32   
emb|CDP11262.1|  unnamed protein product                                126   7e-30   
ref|XP_006388664.1|  hypothetical protein POPTR_0126s002301g            122   4e-29   
emb|CAN65982.1|  hypothetical protein VITISV_017971                     124   5e-29   Vitis vinifera
ref|XP_010663523.1|  PREDICTED: wall-associated receptor kinase-l...    124   1e-28   
ref|XP_002513972.1|  kinase, putative                                   123   2e-28   Ricinus communis
emb|CBI15394.3|  unnamed protein product                                124   4e-28   
ref|XP_008353664.1|  PREDICTED: wall-associated receptor kinase-l...    119   4e-28   
ref|XP_010648101.1|  PREDICTED: wall-associated receptor kinase-l...    118   9e-28   
emb|CBI29390.3|  unnamed protein product                                120   1e-27   
ref|XP_010648089.1|  PREDICTED: wall-associated receptor kinase-l...    120   1e-27   
emb|CDP20610.1|  unnamed protein product                                120   1e-27   
ref|XP_008342477.1|  PREDICTED: wall-associated receptor kinase-l...    120   2e-27   
emb|CAN70207.1|  hypothetical protein VITISV_007744                     119   3e-27   Vitis vinifera
ref|XP_007035467.1|  Wall associated kinase-like 6, putative            120   3e-27   
ref|XP_003634276.1|  PREDICTED: wall-associated receptor kinase-l...    119   4e-27   
emb|CAN65979.1|  hypothetical protein VITISV_017968                     115   4e-27   Vitis vinifera
emb|CDP20609.1|  unnamed protein product                                119   5e-27   
ref|XP_007217600.1|  hypothetical protein PRUPE_ppa018374mg             119   7e-27   
ref|XP_008229606.1|  PREDICTED: wall-associated receptor kinase-l...    118   1e-26   
ref|XP_006388660.1|  hypothetical protein POPTR_0126s00200g             117   2e-26   
ref|XP_002274962.1|  PREDICTED: wall-associated receptor kinase-l...    117   2e-26   Vitis vinifera
emb|CAN65983.1|  hypothetical protein VITISV_017972                     117   3e-26   Vitis vinifera
ref|XP_002513974.1|  kinase, putative                                   117   3e-26   Ricinus communis
ref|XP_011017598.1|  PREDICTED: wall-associated receptor kinase-l...    111   6e-26   
ref|XP_007035468.1|  Wall associated kinase-like 6, putative            116   6e-26   
ref|XP_010688363.1|  PREDICTED: wall-associated receptor kinase-l...    114   2e-25   
emb|CDP11260.1|  unnamed protein product                                114   7e-25   
ref|XP_011011593.1|  PREDICTED: wall-associated receptor kinase-l...    112   9e-25   
ref|XP_011011594.1|  PREDICTED: wall-associated receptor kinase-l...    112   1e-24   
ref|XP_011013613.1|  PREDICTED: wall-associated receptor kinase-l...    111   2e-24   
ref|XP_011013615.1|  PREDICTED: wall-associated receptor kinase-l...    111   2e-24   
ref|XP_010688364.1|  PREDICTED: wall-associated receptor kinase-l...    110   3e-24   
ref|XP_006368673.1|  hypothetical protein POPTR_0001s076201g            110   4e-24   
gb|KDP41424.1|  hypothetical protein JCGZ_15831                         110   5e-24   
emb|CAN82289.1|  hypothetical protein VITISV_028339                     107   8e-24   Vitis vinifera
ref|XP_010269758.1|  PREDICTED: wall-associated receptor kinase-l...    109   1e-23   
ref|XP_006387117.1|  hypothetical protein POPTR_1809s00200g             109   1e-23   
ref|XP_007224001.1|  hypothetical protein PRUPE_ppa014914mg             108   2e-23   
ref|XP_011011597.1|  PREDICTED: wall-associated receptor kinase-l...    108   2e-23   
ref|XP_011034598.1|  PREDICTED: wall-associated receptor kinase-l...    108   2e-23   
ref|XP_006383654.1|  hypothetical protein POPTR_0005s22500g             108   2e-23   
gb|KCW47716.1|  hypothetical protein EUGRSUZ_K01467                     107   3e-23   
ref|XP_008222635.1|  PREDICTED: wall-associated receptor kinase-l...    107   7e-23   
ref|XP_006372238.1|  hypothetical protein POPTR_0018s14520g             107   7e-23   
ref|XP_004305856.1|  PREDICTED: wall-associated receptor kinase-l...    107   7e-23   
ref|XP_011078212.1|  PREDICTED: wall-associated receptor kinase-l...    107   8e-23   
ref|XP_006368665.1|  hypothetical protein POPTR_0001s07540g             105   3e-22   
ref|XP_006368667.1|  hypothetical protein POPTR_0001s07560g             102   4e-22   
ref|XP_011078223.1|  PREDICTED: wall-associated receptor kinase-l...    104   5e-22   
emb|CBI29387.3|  unnamed protein product                                102   6e-22   
emb|CDP11259.1|  unnamed protein product                                104   6e-22   
emb|CAN64180.1|  hypothetical protein VITISV_007798                     100   7e-22   Vitis vinifera
ref|XP_007217680.1|  hypothetical protein PRUPE_ppa021669mg             103   9e-22   
ref|XP_002297682.1|  kinase family protein                              103   2e-21   Populus trichocarpa [western balsam poplar]
ref|XP_011013612.1|  PREDICTED: wall-associated receptor kinase-l...    103   2e-21   
ref|XP_004964206.1|  PREDICTED: wall-associated receptor kinase 5...    103   2e-21   
ref|XP_010688575.1|  PREDICTED: wall-associated receptor kinase-l...    103   2e-21   
ref|XP_010648088.1|  PREDICTED: wall-associated receptor kinase-l...    103   2e-21   
ref|XP_007216176.1|  hypothetical protein PRUPE_ppa015763mg             102   3e-21   
ref|XP_007216825.1|  hypothetical protein PRUPE_ppa022857mg             102   3e-21   
ref|XP_009392022.1|  PREDICTED: putative wall-associated receptor...    102   4e-21   
ref|XP_008380329.1|  PREDICTED: wall-associated receptor kinase-l...    101   6e-21   
ref|XP_011034597.1|  PREDICTED: wall-associated receptor kinase-l...    101   7e-21   
ref|XP_008380330.1|  PREDICTED: LOW QUALITY PROTEIN: wall-associa...    101   7e-21   
gb|EMT09542.1|  Wall-associated receptor kinase 5                       101   7e-21   
gb|ABA99844.1|  Protein kinase domain containing protein, expressed     101   8e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007216943.1|  hypothetical protein PRUPE_ppa016387mg           98.6    8e-21   
ref|NP_001177061.1|  Os12g0615000                                       100   1e-20   
ref|XP_004306301.1|  PREDICTED: wall-associated receptor kinase-l...    100   1e-20   
ref|XP_007217163.1|  hypothetical protein PRUPE_ppa002047mg             100   1e-20   
ref|XP_008229716.1|  PREDICTED: wall-associated receptor kinase-l...    100   1e-20   
ref|XP_007226334.1|  hypothetical protein PRUPE_ppa022257mg             100   2e-20   
gb|EAZ21219.1|  hypothetical protein OsJ_36872                          100   2e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002511965.1|  kinase, putative                                   100   2e-20   Ricinus communis
ref|XP_003594613.1|  Wall-associated receptor kinase-like protein       100   2e-20   
ref|XP_006372236.1|  hypothetical protein POPTR_0018s14500g           99.8    3e-20   
ref|XP_002297684.2|  wall-associated kinase family protein            99.8    3e-20   Populus trichocarpa [western balsam poplar]
ref|XP_006368666.1|  hypothetical protein POPTR_0001s07550g           99.4    3e-20   
ref|XP_010237018.1|  PREDICTED: wall-associated receptor kinase 5...  99.8    4e-20   
ref|XP_003594614.1|  Wall-associated receptor kinase-like protein     99.4    4e-20   
ref|XP_008222637.1|  PREDICTED: wall-associated receptor kinase-l...  99.4    4e-20   
ref|XP_008229719.1|  PREDICTED: wall-associated receptor kinase-l...  98.6    6e-20   
ref|XP_009376845.1|  PREDICTED: wall-associated receptor kinase-l...  98.6    7e-20   
ref|XP_009376860.1|  PREDICTED: wall-associated receptor kinase-l...  98.6    8e-20   
ref|XP_008229609.1|  PREDICTED: wall-associated receptor kinase-l...  98.6    8e-20   
ref|XP_008229610.1|  PREDICTED: wall-associated receptor kinase-l...  98.6    8e-20   
ref|XP_009376854.1|  PREDICTED: wall-associated receptor kinase-l...  98.6    8e-20   
ref|XP_003534747.2|  PREDICTED: wall-associated receptor kinase-l...  98.6    9e-20   
ref|XP_007147589.1|  hypothetical protein PHAVU_006G137300g           98.2    9e-20   
ref|XP_010088576.1|  Wall-associated receptor kinase-like 9           98.2    9e-20   
gb|KHN44650.1|  Wall-associated receptor kinase-like 8                98.2    1e-19   
ref|XP_010038777.1|  PREDICTED: wall-associated receptor kinase-l...  98.2    1e-19   
gb|KCW47712.1|  hypothetical protein EUGRSUZ_K01459                   97.8    1e-19   
ref|XP_010036178.1|  PREDICTED: wall-associated receptor kinase-l...  97.8    1e-19   
ref|XP_003534784.1|  PREDICTED: wall-associated receptor kinase-l...  97.8    1e-19   
gb|KCW47701.1|  hypothetical protein EUGRSUZ_K01439                   97.8    1e-19   
ref|XP_006372237.1|  hypothetical protein POPTR_0018s14510g           97.8    1e-19   
ref|XP_011095036.1|  PREDICTED: wall-associated receptor kinase 2...  97.8    1e-19   
ref|XP_011017593.1|  PREDICTED: wall-associated receptor kinase-l...  97.1    2e-19   
ref|XP_008342473.1|  PREDICTED: wall-associated receptor kinase-l...  94.4    3e-19   
ref|XP_009411178.1|  PREDICTED: wall-associated receptor kinase 5...  97.1    3e-19   
ref|XP_007216693.1|  hypothetical protein PRUPE_ppa026738mg           97.1    3e-19   
ref|XP_010229415.1|  PREDICTED: wall-associated receptor kinase 5...  96.7    3e-19   
gb|EMT30697.1|  Wall-associated receptor kinase 3                     96.3    4e-19   
ref|XP_004305857.1|  PREDICTED: wall-associated receptor kinase-l...  96.3    4e-19   
gb|ABA99845.2|  wall-associated kinase 3, putative, expressed         93.2    5e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009356568.1|  PREDICTED: wall-associated receptor kinase-l...  96.3    5e-19   
ref|XP_010920488.1|  PREDICTED: putative wall-associated receptor...  96.3    5e-19   
gb|ABA99409.1|  Protein kinase domain containing protein, expressed   95.9    5e-19   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001067269.2|  Os12g0614800                                     95.9    5e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008358012.1|  PREDICTED: LOW QUALITY PROTEIN: wall-associa...  95.9    5e-19   
ref|XP_006388919.1|  hypothetical protein POPTR_0075s00240g           93.2    6e-19   
gb|EAY84983.1|  hypothetical protein OsI_06348                        95.5    8e-19   Oryza sativa Indica Group [Indian rice]
gb|EEE53613.1|  hypothetical protein OsJ_36873                        95.5    8e-19   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001067272.1|  Os12g0615300                                     95.5    9e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010041300.1|  PREDICTED: wall-associated receptor kinase-l...  95.1    1e-18   
ref|XP_004963217.1|  PREDICTED: wall-associated receptor kinase 4...  95.1    1e-18   
gb|EAY83890.1|  hypothetical protein OsI_39112                        94.7    1e-18   Oryza sativa Indica Group [Indian rice]
ref|XP_010269806.1|  PREDICTED: wall-associated receptor kinase-l...  95.1    1e-18   
ref|XP_010088575.1|  Wall-associated receptor kinase-like 9           94.7    2e-18   
gb|AAX94997.1|  protein kinase                                        94.4    2e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008222638.1|  PREDICTED: wall-associated receptor kinase-l...  94.0    2e-18   
ref|XP_006388916.1|  hypothetical protein POPTR_0075s00210g           94.4    3e-18   
ref|XP_007216118.1|  hypothetical protein PRUPE_ppa018817mg           93.6    4e-18   
ref|XP_007147591.1|  hypothetical protein PHAVU_006G137500g           93.6    4e-18   
ref|XP_006487885.1|  PREDICTED: wall-associated receptor kinase 2...  93.2    4e-18   
ref|XP_006492002.1|  PREDICTED: wall-associated receptor kinase-l...  89.7    4e-18   
ref|XP_008229608.1|  PREDICTED: wall-associated receptor kinase-l...  93.6    4e-18   
ref|XP_008229721.1|  PREDICTED: wall-associated receptor kinase-l...  93.2    5e-18   
ref|XP_010664900.1|  PREDICTED: wall-associated receptor kinase 2...  94.0    5e-18   
ref|XP_006441109.1|  hypothetical protein CICLE_v10023424mg           90.5    5e-18   
gb|EMT14340.1|  Wall-associated receptor kinase 3                     92.8    7e-18   
ref|XP_006385943.1|  hypothetical protein POPTR_0003s18440g           92.4    7e-18   
ref|XP_010539563.1|  PREDICTED: wall-associated receptor kinase-l...  90.9    8e-18   
ref|XP_006385946.1|  hypothetical protein POPTR_0003s18480g           92.0    8e-18   
gb|EMT09544.1|  Wall-associated receptor kinase 5                     92.8    9e-18   
ref|XP_007216280.1|  hypothetical protein PRUPE_ppa019342mg           92.4    1e-17   
gb|KHN44654.1|  Wall-associated receptor kinase-like 8                92.0    1e-17   
gb|KCW47715.1|  hypothetical protein EUGRSUZ_K01465                   91.7    1e-17   
ref|XP_006663676.1|  PREDICTED: wall-associated receptor kinase 5...  92.0    1e-17   
ref|XP_004486489.1|  PREDICTED: wall-associated receptor kinase-l...  92.0    1e-17   
gb|KCW47700.1|  hypothetical protein EUGRSUZ_K01438                   91.7    1e-17   
ref|XP_011082237.1|  PREDICTED: wall-associated receptor kinase-l...  91.7    1e-17   
gb|EMS50137.1|  Wall-associated receptor kinase 3                     91.7    2e-17   
gb|KHN40782.1|  Wall-associated receptor kinase-like 22               91.3    2e-17   
gb|AAY34779.1|  wall-associated kinase-like 1                         91.7    2e-17   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006421679.1|  hypothetical protein CICLE_v10006761mg           88.6    2e-17   
ref|XP_006493342.1|  PREDICTED: putative wall-associated receptor...  91.3    2e-17   
gb|EMT07482.1|  Wall-associated receptor kinase 2                     91.3    2e-17   
ref|XP_003534786.1|  PREDICTED: wall-associated receptor kinase-l...  91.3    2e-17   
ref|XP_011018200.1|  PREDICTED: wall-associated receptor kinase-l...  90.5    3e-17   
ref|XP_006388726.1|  putative wall-associated kinase family protein   88.2    3e-17   
dbj|BAK02349.1|  predicted protein                                    90.9    3e-17   
ref|XP_007217318.1|  hypothetical protein PRUPE_ppa017167mg           90.9    3e-17   
gb|EMT09541.1|  Wall-associated receptor kinase 5                     90.9    3e-17   
ref|XP_010063910.1|  PREDICTED: putative wall-associated receptor...  90.9    3e-17   
gb|EMS55835.1|  Wall-associated receptor kinase 5                     90.5    3e-17   
gb|KHN44652.1|  Wall-associated receptor kinase-like 22               87.8    3e-17   
ref|XP_009356575.1|  PREDICTED: wall-associated receptor kinase-l...  90.5    3e-17   
gb|EEC69674.1|  hypothetical protein OsI_39110                        89.7    4e-17   Oryza sativa Indica Group [Indian rice]
gb|KCW71197.1|  hypothetical protein EUGRSUZ_F04287                   90.5    4e-17   
ref|XP_002274809.1|  PREDICTED: wall-associated receptor kinase-l...  90.5    4e-17   Vitis vinifera
ref|XP_006495028.1|  PREDICTED: wall-associated receptor kinase 2...  87.8    4e-17   
gb|EEC85059.1|  hypothetical protein OsI_32393                        88.2    4e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_009404603.1|  PREDICTED: putative wall-associated receptor...  90.5    5e-17   
ref|XP_006368675.1|  hypothetical protein POPTR_0001s07640g           87.4    5e-17   
ref|XP_006495029.1|  PREDICTED: wall-associated receptor kinase-l...  90.1    5e-17   
ref|XP_011077536.1|  PREDICTED: wall-associated receptor kinase 2...  90.1    5e-17   
ref|XP_006487805.1|  PREDICTED: wall-associated receptor kinase 2...  90.1    5e-17   
ref|XP_010064651.1|  PREDICTED: wall-associated receptor kinase 2...  89.7    6e-17   
gb|EMT09543.1|  Wall-associated receptor kinase 5                     89.7    6e-17   
ref|XP_009392052.1|  PREDICTED: putative wall-associated receptor...  89.7    6e-17   
dbj|BAD46086.1|  putative wall-associated kinase 4                    89.7    6e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008441599.1|  PREDICTED: LOW QUALITY PROTEIN: wall-associa...  89.7    6e-17   
ref|XP_002442545.1|  hypothetical protein SORBIDRAFT_08g021600        89.7    7e-17   Sorghum bicolor [broomcorn]
gb|ABA00518.1|  wall-associated kinase-like 2                         87.4    7e-17   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008380153.1|  PREDICTED: wall-associated receptor kinase-l...  89.7    8e-17   
ref|XP_008229613.1|  PREDICTED: wall-associated receptor kinase-l...  89.7    8e-17   
ref|XP_007147592.1|  hypothetical protein PHAVU_006G137600g           87.4    8e-17   
ref|XP_008383463.1|  PREDICTED: wall-associated receptor kinase 2...  87.4    9e-17   
gb|KDO65455.1|  hypothetical protein CISIN_1g035536mg                 88.2    9e-17   
ref|XP_010911682.1|  PREDICTED: wall-associated receptor kinase 2...  86.7    9e-17   
ref|XP_010673980.1|  PREDICTED: wall-associated receptor kinase 4...  85.9    9e-17   
ref|XP_010673979.1|  PREDICTED: wall-associated receptor kinase 4...  86.3    9e-17   
ref|XP_006388728.1|  hypothetical protein POPTR_0112s00230g           89.4    1e-16   
ref|XP_006490105.1|  PREDICTED: wall-associated receptor kinase-l...  89.4    1e-16   
ref|XP_006441115.1|  hypothetical protein CICLE_v10024305mg           89.0    1e-16   
ref|XP_010110996.1|  Wall-associated receptor kinase 2                85.9    1e-16   
gb|EAZ10086.1|  hypothetical protein OsI_32395                        87.8    2e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_004295865.1|  PREDICTED: wall-associated receptor kinase-l...  88.6    2e-16   
ref|XP_010051379.1|  PREDICTED: wall-associated receptor kinase-l...  89.0    2e-16   
gb|EEC69677.1|  hypothetical protein OsI_39114                        87.8    2e-16   Oryza sativa Indica Group [Indian rice]
gb|EAY77552.1|  hypothetical protein OsI_32591                        88.2    2e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_006421683.1|  hypothetical protein CICLE_v10007060mg           88.2    2e-16   
ref|XP_002442540.1|  hypothetical protein SORBIDRAFT_08g021540        88.2    2e-16   Sorghum bicolor [broomcorn]
ref|XP_002264787.2|  PREDICTED: wall-associated receptor kinase 2...  88.6    2e-16   Vitis vinifera
ref|XP_004980706.1|  PREDICTED: wall-associated receptor kinase 2...  88.2    2e-16   
ref|XP_009385256.1|  PREDICTED: wall-associated receptor kinase 2...  85.1    2e-16   
ref|XP_007209854.1|  hypothetical protein PRUPE_ppa014824mg           88.2    2e-16   
ref|XP_006492000.1|  PREDICTED: wall-associated receptor kinase 3...  85.1    2e-16   
gb|KCW47717.1|  hypothetical protein EUGRSUZ_K01469                   87.8    3e-16   
ref|XP_010041526.1|  PREDICTED: wall-associated receptor kinase 2...  85.9    3e-16   
ref|XP_010655831.1|  PREDICTED: wall-associated receptor kinase 5...  87.8    3e-16   
ref|XP_009392086.1|  PREDICTED: putative wall-associated receptor...  88.2    3e-16   
ref|XP_008798624.1|  PREDICTED: uncharacterized protein LOC103713459  88.6    3e-16   
ref|XP_011069626.1|  PREDICTED: wall-associated receptor kinase 2...  87.8    3e-16   
gb|EAZ09353.1|  hypothetical protein OsI_31625                        87.0    3e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_010051290.1|  PREDICTED: LOW QUALITY PROTEIN: wall-associa...  88.2    3e-16   
ref|XP_002455706.1|  hypothetical protein SORBIDRAFT_03g022080        87.8    4e-16   Sorghum bicolor [broomcorn]
ref|XP_007217301.1|  hypothetical protein PRUPE_ppa018696mg           87.4    4e-16   
ref|XP_006660979.1|  PREDICTED: wall-associated receptor kinase 2...  87.4    4e-16   
ref|XP_011027690.1|  PREDICTED: LOW QUALITY PROTEIN: putative wal...  87.4    4e-16   
gb|EMS58067.1|  Wall-associated receptor kinase 5                     87.4    4e-16   
ref|XP_010051321.1|  PREDICTED: wall-associated receptor kinase-l...  87.8    4e-16   
gb|KCW81763.1|  hypothetical protein EUGRSUZ_C03129                   87.8    4e-16   
emb|CAH66392.1|  OSIGBa0134J07.10                                     85.1    4e-16   Oryza sativa [red rice]
dbj|BAJ95069.1|  predicted protein                                    84.7    4e-16   
ref|XP_006579332.1|  PREDICTED: wall-associated receptor kinase 5...  87.8    4e-16   
ref|XP_006421678.1|  hypothetical protein CICLE_v10007075mg           84.3    5e-16   
gb|EAY93773.1|  hypothetical protein OsI_15554                        84.7    5e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_011034599.1|  PREDICTED: wall-associated receptor kinase-l...  87.0    5e-16   
gb|EAZ25019.1|  hypothetical protein OsJ_08800                        87.0    5e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010064650.1|  PREDICTED: wall-associated receptor kinase 2...  86.7    6e-16   
ref|XP_004306243.1|  PREDICTED: putative wall-associated receptor...  87.0    6e-16   
gb|EEC66495.1|  hypothetical protein OsI_32596                        84.0    6e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_008225630.1|  PREDICTED: wall-associated receptor kinase 2...  87.0    6e-16   
gb|KDO38764.1|  hypothetical protein CISIN_1g004702mg                 86.7    6e-16   
gb|KDP42943.1|  hypothetical protein JCGZ_23885                       86.7    7e-16   
ref|XP_010655829.1|  PREDICTED: wall-associated receptor kinase 2...  86.7    7e-16   
gb|EAY91176.1|  hypothetical protein OsI_12785                        84.0    7e-16   Oryza sativa Indica Group [Indian rice]
emb|CBI31033.3|  unnamed protein product                              86.7    8e-16   
gb|KDO44465.1|  hypothetical protein CISIN_1g041043mg                 86.3    8e-16   
gb|AAU90275.1|  calcium binding EGF domain containing protein         87.0    8e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010673957.1|  PREDICTED: wall-associated receptor kinase-l...  86.7    8e-16   
gb|EMT30820.1|  hypothetical protein F775_02521                       82.4    9e-16   
ref|XP_008225633.1|  PREDICTED: putative wall-associated receptor...  86.3    9e-16   
gb|KGN47514.1|  hypothetical protein Csa_6G352870                     83.6    1e-15   
gb|KCW81882.1|  hypothetical protein EUGRSUZ_C03245                   85.9    1e-15   
ref|XP_006487880.1|  PREDICTED: wall-associated receptor kinase 2...  85.5    1e-15   
ref|XP_004954293.1|  PREDICTED: wall-associated receptor kinase 2...  86.3    1e-15   
ref|XP_002297686.2|  putative wall-associated kinase family protein   85.9    1e-15   Populus trichocarpa [western balsam poplar]
ref|XP_010040829.1|  PREDICTED: wall-associated receptor kinase-l...  83.6    1e-15   
ref|XP_004295598.1|  PREDICTED: uncharacterized protein LOC101293673  86.7    1e-15   
ref|XP_006492574.1|  PREDICTED: wall-associated receptor kinase-l...  85.9    1e-15   
ref|XP_011082236.1|  PREDICTED: wall-associated receptor kinase-l...  85.9    1e-15   
gb|KCW47714.1|  hypothetical protein EUGRSUZ_K01462                   85.9    1e-15   
ref|XP_010038779.1|  PREDICTED: wall-associated receptor kinase-l...  85.5    2e-15   
ref|XP_004974531.1|  PREDICTED: wall-associated receptor kinase 2...  82.8    2e-15   
ref|XP_004174020.1|  PREDICTED: wall-associated receptor kinase 2...  82.8    2e-15   
gb|AHZ44759.1|  WAK-like protein                                      85.9    2e-15   
ref|XP_010545975.1|  PREDICTED: wall-associated receptor kinase-l...  85.5    2e-15   
gb|KDO54372.1|  hypothetical protein CISIN_1g011189mg                 84.7    2e-15   
gb|KDO37202.1|  hypothetical protein CISIN_1g041671mg                 82.8    2e-15   
ref|XP_010051334.1|  PREDICTED: wall-associated receptor kinase-l...  85.9    2e-15   
emb|CBI31034.3|  unnamed protein product                              83.2    2e-15   
ref|NP_001063933.1|  Os09g0561600                                     85.5    2e-15   Oryza sativa Japonica Group [Japonica rice]
emb|CDP22017.1|  unnamed protein product                              83.2    2e-15   
ref|XP_010655830.1|  PREDICTED: wall-associated receptor kinase 2...  82.8    2e-15   
dbj|BAD19239.1|  putative wall-associated serine/threonine kinase     85.5    2e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006487882.1|  PREDICTED: wall-associated receptor kinase 2...  84.7    2e-15   
dbj|BAK03639.1|  predicted protein                                    85.5    2e-15   
gb|EEC66498.1|  hypothetical protein OsI_32601                        85.1    2e-15   Oryza sativa Indica Group [Indian rice]
ref|NP_001048474.1|  Os02g0811200                                     85.5    2e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002303870.2|  hypothetical protein POPTR_0003s18410g           85.1    2e-15   Populus trichocarpa [western balsam poplar]
ref|XP_003570960.1|  PREDICTED: wall-associated receptor kinase 1...  85.1    2e-15   
ref|XP_009418187.1|  PREDICTED: wall-associated receptor kinase 2...  85.1    3e-15   
gb|KCW68272.1|  hypothetical protein EUGRSUZ_F019282                  81.6    3e-15   
ref|XP_008225752.1|  PREDICTED: putative wall-associated receptor...  85.1    3e-15   
ref|XP_006421433.1|  hypothetical protein CICLE_v10004630mg           84.3    3e-15   
dbj|BAC24910.1|  putative wall-associated kinase                      84.0    3e-15   
ref|XP_009382620.1|  PREDICTED: wall-associated receptor kinase 5...  84.7    3e-15   
ref|XP_006490219.1|  PREDICTED: wall-associated receptor kinase-l...  85.1    3e-15   
emb|CAN62684.1|  hypothetical protein VITISV_018338                   84.7    3e-15   
ref|XP_002527556.1|  kinase, putative                                 84.7    3e-15   
ref|XP_007147586.1|  hypothetical protein PHAVU_006G137000g           82.0    3e-15   
gb|KGN47515.1|  hypothetical protein Csa_6G354370                     82.0    3e-15   
gb|EAZ45074.1|  hypothetical protein OsJ_29715                        84.7    4e-15   
ref|XP_006441112.1|  hypothetical protein CICLE_v10024076mg           84.7    4e-15   
ref|XP_010058352.1|  PREDICTED: wall-associated receptor kinase 2...  84.0    4e-15   
gb|KDO65457.1|  hypothetical protein CISIN_1g0053551mg                82.0    4e-15   
ref|XP_010040830.1|  PREDICTED: wall-associated receptor kinase-l...  82.0    4e-15   
ref|XP_004979730.1|  PREDICTED: wall-associated receptor kinase 5...  84.3    4e-15   
gb|KGN47508.1|  hypothetical protein Csa_6G349850                     84.3    4e-15   
ref|XP_009392075.1|  PREDICTED: putative wall-associated receptor...  84.3    4e-15   
ref|XP_010038782.1|  PREDICTED: wall-associated receptor kinase-l...  84.3    4e-15   
ref|XP_010277630.1|  PREDICTED: putative wall-associated receptor...  84.3    4e-15   
gb|EMS55836.1|  Wall-associated receptor kinase 4                     84.3    4e-15   
ref|NP_001048458.1|  Os02g0808300                                     82.4    4e-15   
ref|XP_010256504.1|  PREDICTED: wall-associated receptor kinase 5...  84.3    4e-15   
gb|EEC74205.1|  hypothetical protein OsI_09364                        81.3    4e-15   
ref|XP_010273346.1|  PREDICTED: wall-associated receptor kinase-l...  84.7    4e-15   
ref|XP_006653603.1|  PREDICTED: wall-associated receptor kinase 3...  84.3    5e-15   
ref|XP_004295597.1|  PREDICTED: uncharacterized protein LOC101293382  84.7    5e-15   
ref|XP_007212750.1|  hypothetical protein PRUPE_ppa016617mg           84.0    5e-15   
ref|XP_010273252.1|  PREDICTED: putative wall-associated receptor...  84.3    5e-15   
ref|XP_006421677.1|  hypothetical protein CICLE_v10004476mg           84.0    5e-15   
dbj|BAD22232.1|  putative wall-associated serine/threonine kinase     82.8    5e-15   
ref|XP_006431624.1|  hypothetical protein CICLE_v10003390mg           84.0    5e-15   
ref|NP_001175539.1|  Os08g0365800                                     83.2    5e-15   
ref|XP_006431622.1|  hypothetical protein CICLE_v10000464mg           84.0    6e-15   
gb|AAX94996.1|  Protein kinase domain, putative                       84.0    6e-15   
ref|XP_011095218.1|  PREDICTED: wall-associated receptor kinase 2...  84.0    6e-15   
ref|XP_004165909.1|  PREDICTED: wall-associated receptor kinase 2...  84.0    6e-15   
ref|XP_004974831.1|  PREDICTED: wall-associated receptor kinase 2...  84.0    6e-15   
emb|CAN70918.1|  hypothetical protein VITISV_009580                   84.0    6e-15   
gb|KDO35821.1|  hypothetical protein CISIN_1g046400mg                 80.9    6e-15   
ref|XP_006490107.1|  PREDICTED: wall-associated receptor kinase-l...  84.0    6e-15   
gb|EAZ45077.1|  hypothetical protein OsJ_29717                        83.6    6e-15   
ref|XP_011082235.1|  PREDICTED: wall-associated receptor kinase-l...  84.0    6e-15   
ref|XP_006849835.1|  hypothetical protein AMTR_s00022p00031870        84.0    7e-15   
ref|XP_008380327.1|  PREDICTED: wall-associated receptor kinase-l...  80.1    7e-15   
ref|XP_006441110.1|  hypothetical protein CICLE_v10019768mg           83.2    7e-15   
emb|CDP06459.1|  unnamed protein product                              83.6    7e-15   
gb|EEC74207.1|  hypothetical protein OsI_09367                        83.2    8e-15   
ref|XP_011015193.1|  PREDICTED: wall-associated receptor kinase-l...  83.2    8e-15   
gb|KCW81743.1|  hypothetical protein EUGRSUZ_C03101                   84.0    8e-15   
ref|XP_011015192.1|  PREDICTED: wall-associated receptor kinase-l...  83.6    8e-15   
ref|XP_011020555.1|  PREDICTED: wall-associated receptor kinase-l...  83.2    8e-15   
ref|XP_008798659.1|  PREDICTED: uncharacterized protein LOC103713485  84.0    8e-15   
ref|XP_010051307.1|  PREDICTED: wall-associated receptor kinase-l...  84.0    8e-15   
ref|XP_006490106.1|  PREDICTED: wall-associated receptor kinase-l...  83.6    9e-15   
ref|XP_008365116.1|  PREDICTED: putative wall-associated receptor...  83.6    9e-15   
ref|XP_002264371.1|  PREDICTED: wall-associated receptor kinase 2...  83.6    9e-15   
ref|XP_011020553.1|  PREDICTED: wall-associated receptor kinase-l...  83.2    9e-15   
gb|KDP42933.1|  hypothetical protein JCGZ_23875                       82.4    9e-15   
emb|CAN66582.1|  hypothetical protein VITISV_029054                   83.2    9e-15   
gb|KCW48948.1|  hypothetical protein EUGRSUZ_K02557                   83.2    9e-15   
ref|XP_011077656.1|  PREDICTED: wall-associated receptor kinase 2...  83.2    1e-14   
gb|KHN44286.1|  Wall-associated receptor kinase 2                     83.2    1e-14   
ref|XP_006649150.1|  PREDICTED: wall-associated receptor kinase 2...  83.2    1e-14   
ref|XP_009411179.1|  PREDICTED: wall-associated receptor kinase 5...  83.2    1e-14   
ref|XP_004170705.1|  PREDICTED: wall-associated receptor kinase 5...  83.2    1e-14   
ref|XP_006388724.1|  hypothetical protein POPTR_0112s002002g          81.3    1e-14   
ref|XP_010927440.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  83.6    1e-14   
gb|AAX95007.1|  wall-associated protein kinase                        83.2    1e-14   
ref|XP_004144294.1|  PREDICTED: uncharacterized protein LOC101209380  83.6    1e-14   
ref|XP_006421687.1|  hypothetical protein CICLE_v10004431mg           83.2    1e-14   
ref|XP_010245932.1|  PREDICTED: uncharacterized protein LOC104589347  83.6    1e-14   
gb|KDO37248.1|  hypothetical protein CISIN_1g023486mg                 80.1    1e-14   
dbj|BAG71004.1|  protein kinase family protein                        82.8    1e-14   
ref|XP_008225634.1|  PREDICTED: putative wall-associated receptor...  82.8    1e-14   
ref|XP_004980894.1|  PREDICTED: wall-associated receptor kinase 2...  82.8    1e-14   
gb|EMS62262.1|  Wall-associated receptor kinase 5                     82.8    1e-14   
gb|EEE68103.1|  hypothetical protein OsJ_26164                        83.2    1e-14   
dbj|BAM28960.1|  putative wall-associated protein kinase              82.8    1e-14   
ref|XP_003527958.1|  PREDICTED: wall-associated receptor kinase 2...  82.8    1e-14   
ref|XP_007137493.1|  hypothetical protein PHAVU_009G131600g           80.9    1e-14   
emb|CBI31032.3|  unnamed protein product                              83.2    1e-14   
gb|KCW47711.1|  hypothetical protein EUGRSUZ_K01454                   82.4    1e-14   
gb|EAY81850.1|  hypothetical protein OsI_37016                        82.8    1e-14   
gb|EAZ25016.1|  hypothetical protein OsJ_08797                        82.8    1e-14   
ref|XP_010064639.1|  PREDICTED: wall-associated receptor kinase-l...  82.4    1e-14   
ref|XP_010042183.1|  PREDICTED: wall-associated receptor kinase 2...  80.1    2e-14   
ref|XP_002304843.2|  hypothetical protein POPTR_0003s18400g           79.7    2e-14   
gb|EEE52297.1|  hypothetical protein OsJ_34295                        82.4    2e-14   
gb|KCW68171.1|  hypothetical protein EUGRSUZ_F01840                   82.4    2e-14   
ref|XP_010038775.1|  PREDICTED: wall-associated receptor kinase-l...  82.4    2e-14   
gb|AAX94999.1|  wall-associated protein kinase                        82.4    2e-14   
ref|XP_008222866.1|  PREDICTED: wall-associated receptor kinase 2...  82.4    2e-14   
gb|EAZ06768.1|  hypothetical protein OsI_29010                        79.3    2e-14   
ref|XP_002441899.1|  hypothetical protein SORBIDRAFT_08g004550        82.4    2e-14   
ref|XP_010061249.1|  PREDICTED: wall-associated receptor kinase 3...  82.4    2e-14   
ref|XP_010058350.1|  PREDICTED: putative wall-associated receptor...  82.4    2e-14   
ref|XP_008384231.1|  PREDICTED: wall-associated receptor kinase 2...  79.7    2e-14   
gb|AAX95004.1|  protein kinase                                        82.4    2e-14   
ref|XP_004980702.1|  PREDICTED: wall-associated receptor kinase 2...  82.4    2e-14   
ref|XP_007214754.1|  hypothetical protein PRUPE_ppa024967mg           82.4    2e-14   
ref|XP_010051381.1|  PREDICTED: wall-associated receptor kinase-l...  82.4    2e-14   
ref|XP_004959178.1|  PREDICTED: wall-associated receptor kinase 2...  82.0    2e-14   
ref|XP_003579134.2|  PREDICTED: wall-associated receptor kinase 5...  82.4    2e-14   
ref|XP_010248293.1|  PREDICTED: wall-associated receptor kinase 2...  79.7    2e-14   
ref|XP_002457827.1|  hypothetical protein SORBIDRAFT_03g014450        82.0    2e-14   
ref|XP_007214515.1|  hypothetical protein PRUPE_ppa015696mg           82.0    2e-14   
gb|KCW81746.1|  hypothetical protein EUGRSUZ_C03105                   81.6    2e-14   
ref|XP_006663677.1|  PREDICTED: wall-associated receptor kinase 5...  82.0    2e-14   
ref|XP_004306300.1|  PREDICTED: wall-associated receptor kinase-l...  82.0    2e-14   
gb|KCW47708.1|  hypothetical protein EUGRSUZ_K01448                   79.7    2e-14   
ref|XP_010051380.1|  PREDICTED: LOW QUALITY PROTEIN: wall-associa...  82.4    2e-14   
ref|XP_010680098.1|  PREDICTED: wall-associated receptor kinase 2...  82.0    2e-14   
ref|XP_010051317.1|  PREDICTED: wall-associated receptor kinase-l...  82.4    2e-14   
gb|EMT18055.1|  Wall-associated receptor kinase 5                     82.0    2e-14   
ref|XP_010256487.1|  PREDICTED: wall-associated receptor kinase 2...  82.0    3e-14   
ref|NP_001170728.1|  uncharacterized LOC100384815 precursor           82.0    3e-14   
ref|XP_008229723.1|  PREDICTED: wall-associated receptor kinase-l...  82.0    3e-14   
gb|EEE59576.1|  hypothetical protein OsJ_11873                        82.0    3e-14   
gb|EEC84737.1|  hypothetical protein OsI_31726                        80.9    3e-14   
gb|KCW81758.1|  hypothetical protein EUGRSUZ_C031232                  81.6    3e-14   
ref|XP_004980017.1|  PREDICTED: wall-associated receptor kinase 2...  81.6    3e-14   
ref|XP_002448190.1|  hypothetical protein SORBIDRAFT_06g022700        81.6    3e-14   
ref|XP_006441120.1|  hypothetical protein CICLE_v10019295mg           81.6    3e-14   
gb|AAK52578.1|AC079685_9  Putative wall-associated protein kinase     81.6    3e-14   
ref|NP_001068494.2|  Os11g0691600                                     79.7    3e-14   
ref|XP_009392043.1|  PREDICTED: putative wall-associated receptor...  81.6    3e-14   
ref|XP_010934770.1|  PREDICTED: LOW QUALITY PROTEIN: wall-associa...  81.6    3e-14   
ref|XP_010664149.1|  PREDICTED: putative wall-associated receptor...  81.6    3e-14   
ref|XP_004309591.1|  PREDICTED: wall-associated receptor kinase 2...  81.6    3e-14   
gb|EMS46253.1|  hypothetical protein TRIUR3_08307                     79.3    3e-14   
ref|XP_006495309.1|  PREDICTED: wall-associated receptor kinase-l...  81.6    3e-14   
ref|XP_010928975.1|  PREDICTED: wall-associated receptor kinase 2...  81.6    3e-14   
ref|XP_009624419.1|  PREDICTED: wall-associated receptor kinase 2...  81.3    4e-14   
ref|XP_010036549.1|  PREDICTED: wall-associated receptor kinase-l...  81.3    4e-14   
ref|XP_009404604.1|  PREDICTED: wall-associated receptor kinase 2...  81.3    4e-14   
ref|XP_007034139.1|  Wall associated kinase-like 6, putative          81.6    4e-14   
gb|EAY77563.1|  hypothetical protein OsI_32602                        81.3    4e-14   
ref|XP_004309764.1|  PREDICTED: wall-associated receptor kinase-l...  81.3    4e-14   
ref|XP_010476711.1|  PREDICTED: LOW QUALITY PROTEIN: wall-associa...  80.5    4e-14   
gb|EMS56893.1|  Wall-associated receptor kinase 5                     81.3    4e-14   
gb|EAY93722.1|  hypothetical protein OsI_15511                        79.3    4e-14   
ref|XP_008366070.1|  PREDICTED: wall-associated receptor kinase 2...  79.7    5e-14   
ref|XP_010059281.1|  PREDICTED: wall-associated receptor kinase-l...  80.9    5e-14   
ref|XP_006492600.1|  PREDICTED: wall-associated receptor kinase-l...  80.9    5e-14   
gb|AFW66810.1|  putative wall-associated receptor protein kinase ...  81.3    5e-14   
ref|XP_007225548.1|  hypothetical protein PRUPE_ppa002432m1g          78.2    5e-14   
ref|XP_010051299.1|  PREDICTED: wall-associated receptor kinase-l...  81.3    5e-14   
ref|XP_006372235.1|  hypothetical protein POPTR_0018s14490g           79.0    5e-14   
ref|XP_002523938.1|  hypothetical protein RCOM_1162710                78.2    5e-14   
gb|KCW81883.1|  hypothetical protein EUGRSUZ_C03246                   80.5    5e-14   
ref|XP_004969731.1|  PREDICTED: wall-associated receptor kinase 3...  80.9    5e-14   
emb|CBI31039.3|  unnamed protein product                              80.9    5e-14   
ref|XP_010674019.1|  PREDICTED: wall-associated receptor kinase-l...  80.9    6e-14   
ref|XP_011015417.1|  PREDICTED: wall-associated receptor kinase 2...  80.5    6e-14   
ref|XP_008225748.1|  PREDICTED: uncharacterized protein LOC103325361  81.3    6e-14   
ref|XP_008667030.1|  PREDICTED: uncharacterized LOC100191438 isof...  80.9    6e-14   
ref|XP_002265153.1|  PREDICTED: wall-associated receptor kinase 5...  80.9    6e-14   
ref|XP_004972529.1|  PREDICTED: wall-associated receptor kinase 3...  80.9    6e-14   
ref|XP_010042304.1|  PREDICTED: wall-associated receptor kinase 2...  78.2    6e-14   
ref|NP_001130343.1|  uncharacterized LOC100191438 precursor           80.9    7e-14   
ref|XP_006493924.1|  PREDICTED: wall-associated receptor kinase 2...  80.9    7e-14   
ref|XP_010476713.1|  PREDICTED: wall-associated receptor kinase-l...  80.9    7e-14   
emb|CDX86600.1|  BnaC08g01030D                                        80.9    7e-14   
ref|XP_010674686.1|  PREDICTED: putative wall-associated receptor...  80.5    7e-14   
emb|CAN71409.1|  hypothetical protein VITISV_031032                   80.5    7e-14   
emb|CBI18947.3|  unnamed protein product                              80.9    7e-14   
ref|XP_008669166.1|  PREDICTED: wall-associated receptor kinase 5...  80.5    7e-14   
ref|NP_001068493.2|  Os11g0691500                                     80.5    7e-14   
ref|XP_006657321.1|  PREDICTED: wall-associated receptor kinase 3...  80.5    7e-14   
ref|XP_008669167.1|  PREDICTED: wall-associated receptor kinase 5...  80.5    7e-14   
ref|XP_010023385.1|  PREDICTED: wall-associated receptor kinase-l...  80.5    8e-14   
emb|CBI15599.3|  unnamed protein product                              80.1    8e-14   
ref|XP_004306302.1|  PREDICTED: wall-associated receptor kinase-l...  78.6    8e-14   
ref|XP_010237013.1|  PREDICTED: wall-associated receptor kinase 5...  80.5    8e-14   
ref|XP_010039741.1|  PREDICTED: putative wall-associated receptor...  80.5    8e-14   
ref|XP_006492007.1|  PREDICTED: putative wall-associated receptor...  80.1    8e-14   
gb|EMT07796.1|  Wall-associated receptor kinase 2                     80.5    8e-14   
ref|XP_008383462.1|  PREDICTED: wall-associated receptor kinase 2...  79.0    9e-14   
ref|XP_006386338.1|  putative wall-associated kinase family protein   80.5    9e-14   
ref|XP_010237016.1|  PREDICTED: wall-associated receptor kinase 5...  80.5    9e-14   
ref|XP_010237017.1|  PREDICTED: wall-associated receptor kinase 5...  80.5    9e-14   
emb|CAH66311.1|  OSIGBa0135K14.8                                      80.5    9e-14   
gb|EEE60822.1|  hypothetical protein OsJ_14433                        80.5    9e-14   
ref|XP_010663708.1|  PREDICTED: wall-associated receptor kinase 2...  80.1    9e-14   
gb|KDO58194.1|  hypothetical protein CISIN_1g0431571mg                77.4    9e-14   
emb|CDY15527.1|  BnaA08g28110D                                        80.1    1e-13   
ref|XP_010237014.1|  PREDICTED: wall-associated receptor kinase 5...  80.1    1e-13   
ref|XP_009411180.1|  PREDICTED: wall-associated receptor kinase 5...  80.1    1e-13   
gb|EEE58016.1|  hypothetical protein OsJ_08798                        80.1    1e-13   
gb|EEC70645.1|  hypothetical protein OsI_01925                        79.7    1e-13   
ref|XP_002265582.3|  PREDICTED: wall-associated receptor kinase 5...  80.1    1e-13   
dbj|BAG71006.1|  protein kinase family protein                        80.1    1e-13   
emb|CAN61365.1|  hypothetical protein VITISV_027752                   80.1    1e-13   
gb|KDO36626.1|  hypothetical protein CISIN_1g038707mg                 79.7    1e-13   
ref|XP_010051335.1|  PREDICTED: wall-associated receptor kinase-l...  80.1    1e-13   
ref|XP_010665428.1|  PREDICTED: wall-associated receptor kinase 2...  80.1    1e-13   
gb|EMT14446.1|  Wall-associated receptor kinase 3                     80.1    1e-13   
ref|XP_007211126.1|  hypothetical protein PRUPE_ppa025607mg           79.7    1e-13   
ref|XP_002454747.1|  hypothetical protein SORBIDRAFT_04g036600        79.7    1e-13   
gb|KCW71198.1|  hypothetical protein EUGRSUZ_F04288                   79.7    1e-13   
ref|XP_010049240.1|  PREDICTED: wall-associated receptor kinase-l...  79.7    1e-13   
ref|XP_004301029.1|  PREDICTED: wall-associated receptor kinase-l...  79.7    1e-13   
emb|CDX87362.1|  BnaA07g35110D                                        78.2    1e-13   
ref|XP_010059394.1|  PREDICTED: putative wall-associated receptor...  79.7    2e-13   
ref|XP_006490104.1|  PREDICTED: putative wall-associated receptor...  79.7    2e-13   
ref|XP_004977058.1|  PREDICTED: putative wall-associated receptor...  79.7    2e-13   
ref|XP_011077535.1|  PREDICTED: wall-associated receptor kinase 2...  79.7    2e-13   
ref|XP_006849834.1|  hypothetical protein AMTR_s00022p00031050        79.3    2e-13   
ref|XP_010101391.1|  T-complex protein 1 subunit gamma                79.7    2e-13   
dbj|BAD89450.1|  putative wall-associated kinase 4                    79.3    2e-13   
ref|XP_010256503.1|  PREDICTED: LOW QUALITY PROTEIN: wall-associa...  79.7    2e-13   
gb|KDO38598.1|  hypothetical protein CISIN_1g047613mg                 76.3    2e-13   
gb|KDO37147.1|  hypothetical protein CISIN_1g044892mg                 75.1    2e-13   
ref|XP_008783082.1|  PREDICTED: wall-associated receptor kinase 2...  79.3    2e-13   
ref|XP_008383460.1|  PREDICTED: wall-associated receptor kinase 2...  79.3    2e-13   
gb|KDP42931.1|  hypothetical protein JCGZ_23873                       75.9    2e-13   
gb|KFK42837.1|  hypothetical protein AALP_AA1G045500                  79.0    2e-13   
ref|XP_002453040.1|  hypothetical protein SORBIDRAFT_04g037220        79.3    2e-13   
gb|KHN44655.1|  Wall-associated receptor kinase-like 9                79.3    2e-13   
ref|XP_010277680.1|  PREDICTED: wall-associated receptor kinase 2...  79.3    2e-13   
gb|KCW81783.1|  hypothetical protein EUGRSUZ_C03143                   78.6    2e-13   
ref|XP_010102529.1|  Wall-associated receptor kinase-like 10          79.3    2e-13   
ref|XP_006494618.1|  PREDICTED: wall-associated receptor kinase-l...  79.0    2e-13   



>ref|XP_010317039.1| PREDICTED: wall-associated receptor kinase-like 1 [Solanum lycopersicum]
Length=708

 Score =   241 bits (615),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 108/196 (55%), Positives = 144/196 (73%), Gaps = 7/196 (4%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            CE+RCGN++IP+PFG+   C+LN W+++ CD SS PPK ++NSF+Q+ELQ EV++VS+EN
Sbjct  39   CEERCGNLTIPYPFGLSASCSLNSWYVIKCDRSSDPPKPFMNSFLQVELQSEVISVSIEN  98

Query  413  QTITTLKSVVNFCDDSA-GRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQNSTVV  237
            QTITT  S+VNFC+ S+ G   IT GTDLSGSPFYY+K RNK +  GCGN L TQ   V+
Sbjct  99   QTITTSVSIVNFCNKSSEGSRIITTGTDLSGSPFYYAKDRNKLMLVGCGNGLVTQKQNVL  158

Query  236  AGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKRCNSAF  57
            +GCT+IC    +    GCYGI+CC++  PFDL+SY ANFTNSGIQ +       RC++ F
Sbjct  159  SGCTSICSEGAT--LTGCYGINCCQSLFPFDLSSYKANFTNSGIQQEA----YPRCSAVF  212

Query  56   LIDQRWIPKQSTSLFL  9
            L+DQ W+P +    F+
Sbjct  213  LVDQTWVPDEVAQPFV  228



>ref|XP_009773751.1| PREDICTED: wall-associated receptor kinase-like 1 [Nicotiana 
sylvestris]
Length=699

 Score =   240 bits (612),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/195 (57%), Positives = 142/195 (73%), Gaps = 7/195 (4%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            CE+ CG ++IPFPFG+   C+LN W+L+ CD S  PPK +LNSF+Q+ELQ EV++VSLEN
Sbjct  32   CEESCGKLTIPFPFGLSASCSLNSWYLIKCDRSYNPPKPFLNSFLQVELQSEVISVSLEN  91

Query  413  QTITTLKSVVNFCDDSA-GRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQNSTVV  237
            QTITTL S++NFC+ S+ G   IT GTDLSGSPFYYSK RNK +  GCGN L TQ   V+
Sbjct  92   QTITTLISIINFCNGSSQGSRIITTGTDLSGSPFYYSKDRNKLMLVGCGNGLVTQKQNVL  151

Query  236  AGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKRCNSAF  57
            +GCT+IC    +    GCYGI+CC++ VPFDL+ YTANFTNSGIQ         +C++AF
Sbjct  152  SGCTSICSEGAT--LTGCYGINCCQSLVPFDLSLYTANFTNSGIQEGP----YPKCSAAF  205

Query  56   LIDQRWIPKQSTSLF  12
            L+DQ W+P +    F
Sbjct  206  LVDQTWVPDEVAQPF  220



>ref|XP_009627286.1| PREDICTED: wall-associated receptor kinase-like 1 [Nicotiana 
tomentosiformis]
Length=700

 Score =   239 bits (609),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/195 (56%), Positives = 144/195 (74%), Gaps = 7/195 (4%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            CE+ CGN +IP+PFG+   C+LN W+L+ CD +  PPK +LNSF+Q+ELQ EV++VSL+N
Sbjct  32   CEESCGNFTIPYPFGLSASCSLNSWYLIKCDRNYNPPKLFLNSFLQVELQSEVISVSLKN  91

Query  413  QTITTLKSVVNFCDDSA-GRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQNSTVV  237
            QTITTL S++NFC+DS+ G   IT GT+LSGSPFYYSK RNK +  GCGN L TQN  V+
Sbjct  92   QTITTLVSIINFCNDSSQGSRIITTGTNLSGSPFYYSKDRNKLMLVGCGNGLVTQNLNVL  151

Query  236  AGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKRCNSAF  57
            +GCT+IC    +    GCYGI+CC++ VPFDL+ YTANFTNSGIQ         +C++AF
Sbjct  152  SGCTSICSEGAT--LTGCYGINCCQSLVPFDLSLYTANFTNSGIQQGP----YPKCSAAF  205

Query  56   LIDQRWIPKQSTSLF  12
            L+DQ W+P +    F
Sbjct  206  LVDQTWVPDEVAQPF  220



>ref|XP_006365061.1| PREDICTED: wall-associated receptor kinase-like 1-like [Solanum 
tuberosum]
Length=701

 Score =   238 bits (607),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 145/198 (73%), Gaps = 11/198 (6%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            CE+RCGN++IP+PFG+   C+LN W+L+ CD S  PPK ++NSF+Q+ELQ EV++VS+EN
Sbjct  32   CEERCGNLTIPYPFGLSASCSLNSWYLIKCDKSYNPPKPFMNSFLQVELQSEVISVSIEN  91

Query  413  QTITTLKSVVNFCDDSA-GRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQNSTVV  237
            QTI T  S+VNFC+ S+ G   IT GTDLSGSPFYY+K RNK +  GCGN L TQ   ++
Sbjct  92   QTIITSVSIVNFCNKSSEGSKIITTGTDLSGSPFYYAKDRNKLMLVGCGNGLVTQKQNIL  151

Query  236  AGCTAIC--GANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKRCNS  63
            +GCT+IC  GA ++    GCYGI+CC++ VPFDL+SY ANFTNSGIQ         RC++
Sbjct  152  SGCTSICTEGATLT----GCYGINCCQSLVPFDLSSYKANFTNSGIQQGA----YPRCSA  203

Query  62   AFLIDQRWIPKQSTSLFL  9
             FL+DQ W+P +    F+
Sbjct  204  VFLVDQTWVPDEVAQPFV  221



>ref|XP_010663521.1| PREDICTED: wall-associated receptor kinase-like 1 isoform X2 
[Vitis vinifera]
Length=685

 Score =   139 bits (349),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 77/199 (39%), Positives = 111/199 (56%), Gaps = 18/199 (9%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C+ +CGNV IPFPFGIGE C LN W+ VNC N+S   K +LN     +L  E++ VSLE 
Sbjct  36   CQSQCGNVVIPFPFGIGESCYLNEWYSVNCSNTSGAAKPFLNP---TKLNLELLNVSLEY  92

Query  413  QTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQNSTVVA  234
            QT+T    + ++ D   G + +    +L  SPF +S   N F+  GCG++   ++  + A
Sbjct  93   QTVTVYSPIASY-DQQKGSSELQTSINLDQSPFLFSTLDNIFVVLGCGHAKLMEHEKIWA  151

Query  233  GCTAICGANISSGF--AGCYGIDCCETPVP----FDLTSYTANFTNSGIQSDGSNDNLKR  72
            GCT+I   N S  F   GCYGI+CC+T +P    + L++Y+  FT      D   +N   
Sbjct  152  GCTSI---NCSDSFPDQGCYGINCCQTTIPTIDSYYLSTYSVKFT-----LDDEGNNHST  203

Query  71   CNSAFLIDQRWIPKQSTSL  15
               AFL+D+ W  +  T L
Sbjct  204  STHAFLVDRDWFSRNFTEL  222



>ref|XP_010663520.1| PREDICTED: wall-associated receptor kinase-like 1 isoform X1 
[Vitis vinifera]
 emb|CAN76906.1| hypothetical protein VITISV_006595 [Vitis vinifera]
Length=726

 Score =   139 bits (350),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 77/199 (39%), Positives = 111/199 (56%), Gaps = 18/199 (9%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C+ +CGNV IPFPFGIGE C LN W+ VNC N+S   K +LN     +L  E++ VSLE 
Sbjct  36   CQSQCGNVVIPFPFGIGESCYLNEWYSVNCSNTSGAAKPFLNP---TKLNLELLNVSLEY  92

Query  413  QTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQNSTVVA  234
            QT+T    + ++ D   G + +    +L  SPF +S   N F+  GCG++   ++  + A
Sbjct  93   QTVTVYSPIASY-DQQKGSSELQTSINLDQSPFLFSTLDNIFVVLGCGHAKLMEHEKIWA  151

Query  233  GCTAICGANISSGF--AGCYGIDCCETPVP----FDLTSYTANFTNSGIQSDGSNDNLKR  72
            GCT+I   N S  F   GCYGI+CC+T +P    + L++Y+  FT      D   +N   
Sbjct  152  GCTSI---NCSDSFPDQGCYGINCCQTTIPTIDSYYLSTYSVKFT-----LDDEGNNHST  203

Query  71   CNSAFLIDQRWIPKQSTSL  15
               AFL+D+ W  +  T L
Sbjct  204  STHAFLVDRDWFSRNFTEL  222



>emb|CDP11258.1| unnamed protein product [Coffea canephora]
Length=765

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 118/198 (60%), Gaps = 24/198 (12%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C   CGNV IP+PFG+   CA+N  +++ C+ S    K YL++     L  EV+ +SLEN
Sbjct  87   CSDSCGNVLIPYPFGLSRRCAVNQSYIIICNYS----KPYLSN-----LNLEVLNISLEN  137

Query  413  QTITTLKSVVNFCD-DSAGRNAITN---GTDLSGSPFYYSKSRNKFLFAGCGNSLFTQ-N  249
             T+T   S+ +FC+ D A RN  +     +DL+G+PF+YS+  NK +  GCGN++  Q +
Sbjct  138  HTVTVNSSLASFCNADQAQRNGSSTTWISSDLAGTPFFYSRIDNKMMLFGCGNAVLNQAD  197

Query  248  STVVAGCTAICGANIS----SGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDN  81
            + +++GCT+ C  N S    +  + CYG+ CCET +PF L+ Y  NF  S     G    
Sbjct  198  NKILSGCTSTCEFNTSDLATNSSSRCYGVSCCETIIPFYLSKYNLNFRGSRFNRSG----  253

Query  80   LKRCNSAFLIDQRWIPKQ  27
              +C++ FL+DQ W+P++
Sbjct  254  --QCSTTFLVDQNWLPEK  269



>emb|CAN64181.1| hypothetical protein VITISV_007799 [Vitis vinifera]
Length=705

 Score =   135 bits (340),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 98/160 (61%), Gaps = 5/160 (3%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C++RCG+V+IP+PFGIG+ C LN WF VNC++S  PP  YL+     EL  ++  VSL  
Sbjct  30   CQERCGDVTIPYPFGIGKDCYLNEWFAVNCNDSFNPPTPYLS---HPELNLKLTFVSLAY  86

Query  413  QTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNS-LFTQNSTVV  237
            Q +T +  +  +C D     +   G DLS +PF+YS+  N     GC NS L T+  T++
Sbjct  87   QLVTVISPMAVYCQDHDRNRSTWKGIDLSKTPFFYSEG-NALRVVGCANSVLITRQGTIL  145

Query  236  AGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFT  117
            AGC++IC  + S    GCYGI+CC+T VP +L  Y  N T
Sbjct  146  AGCSSICDNSSSVLSNGCYGINCCKTTVPSNLDFYILNTT  185



>ref|XP_010663682.1| PREDICTED: wall-associated receptor kinase-like 8 [Vitis vinifera]
Length=705

 Score =   135 bits (340),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 98/160 (61%), Gaps = 5/160 (3%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C++RCG+V+IP+PFGIG+ C LN WF VNC++S  PP  YL+     EL  ++  VSL  
Sbjct  30   CQERCGDVTIPYPFGIGKDCYLNEWFAVNCNDSFNPPTPYLS---HPELNLKLTFVSLAY  86

Query  413  QTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNS-LFTQNSTVV  237
            Q +T +  +  +C D     +   G DLS +PF+YS+  N     GC NS L T+  T++
Sbjct  87   QLVTVISPMAVYCQDHDRNRSTWKGIDLSKTPFFYSEG-NALRVVGCANSVLITRQGTIL  145

Query  236  AGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFT  117
            AGC++IC  + S    GCYGI+CC+T VP +L  Y  N T
Sbjct  146  AGCSSICDNSSSVLSNGCYGINCCKTTVPSNLDFYILNTT  185



>emb|CBI15571.3| unnamed protein product [Vitis vinifera]
Length=908

 Score =   135 bits (340),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 98/160 (61%), Gaps = 5/160 (3%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C++RCG+V+IP+PFGIG+ C LN WF VNC++S  PP  YL+     EL  ++  VSL  
Sbjct  212  CQERCGDVTIPYPFGIGKDCYLNEWFAVNCNDSFNPPTPYLS---HPELNLKLTFVSLAY  268

Query  413  QTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNS-LFTQNSTVV  237
            Q +T +  +  +C D     +   G DLS +PF+YS+  N     GC NS L T+  T++
Sbjct  269  QLVTVISPMAVYCQDHDRNRSTWKGIDLSKTPFFYSEG-NALRVVGCANSVLITRQGTIL  327

Query  236  AGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFT  117
            AGC++IC  + S    GCYGI+CC+T VP +L  Y  N T
Sbjct  328  AGCSSICDNSSSVLSNGCYGINCCKTTVPSNLDFYILNTT  367


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSS  492
            C   CG+VSIP+PFG+G+ C LN WF +NC +S+
Sbjct  31   CNDACGSVSIPYPFGVGKDCYLNEWFSINCKHST  64



>emb|CDP11262.1| unnamed protein product [Coffea canephora]
Length=580

 Score =   126 bits (316),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 71/191 (37%), Positives = 102/191 (53%), Gaps = 15/191 (8%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNC-DNSSAPPKAYLNSFVQIELQ--GEVVAVS  423
            C   CG V+IP+PFG+G  CALN  + + C DN ++  K YL+   Q   Q   EV+ +S
Sbjct  6    CNDTCGGVTIPYPFGVGPDCALNDSYTIICVDNYASGSKPYLSFLFQSVSQFFVEVLEIS  65

Query  422  LENQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQNS-  246
            L +QT+T  KS    C D    +       L GSPF+ +   NK +  GCGN+     S 
Sbjct  66   LIDQTVTINKSATRICSDHRQADLAMASYLLDGSPFFVAAEHNKLMLVGCGNAFLMSASD  125

Query  245  --TVVAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKR  72
               +++GCT+IC    +    GCYG++CC+  +P+ L SYT N T S       N   + 
Sbjct  126  SPEILSGCTSIC---TNKKVTGCYGLNCCQASIPYYLGSYTVNITAS------QNFTSRT  176

Query  71   CNSAFLIDQRW  39
            C +A L+DQ+W
Sbjct  177  CPAASLVDQKW  187



>ref|XP_006388664.1| hypothetical protein POPTR_0126s002301g, partial [Populus trichocarpa]
 gb|ERP47578.1| hypothetical protein POPTR_0126s002301g, partial [Populus trichocarpa]
Length=420

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 72/187 (39%), Positives = 102/187 (55%), Gaps = 14/187 (7%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            CE  CG++SIP+PFG+ EGC L+  F + C++SS  PK  +N         EV  +S+++
Sbjct  31   CESYCGDISIPYPFGMKEGCYLDERFKILCNSSSGVPKLTVNG-----TDLEVNNISVDD  85

Query  413  QTITTLKSVV-NFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN-SLFTQNSTV  240
             TI  +  +V   C    G   +    DL GSPF +S S N F+  GCGN +L  QN + 
Sbjct  86   STIAVMFPIVFANCSGKDGNTVV----DLEGSPFVFS-SENYFIARGCGNLALMNQNQSA  140

Query  239  VAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKRCNSA  60
            + GC ++C  N  S  A C GIDCC+T +P  L  +  N T  G++    +     C  A
Sbjct  141  IGGCVSLCDKNRDSMMASCSGIDCCQTRIPSFLKVF--NVTMKGLEDGKGSRGENECRYA  198

Query  59   FLIDQRW  39
            FLID+RW
Sbjct  199  FLIDERW  205



>emb|CAN65982.1| hypothetical protein VITISV_017971 [Vitis vinifera]
Length=671

 Score =   124 bits (312),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 70/189 (37%), Positives = 106/189 (56%), Gaps = 17/189 (9%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C   CG+VSIP+PFGIG GC  N +F +NC++SS PPK +LN     +L  E++ VSLE 
Sbjct  30   CVAHCGDVSIPYPFGIGTGCYFNDYFSINCNDSSTPPKPFLN---HTKLNLELLNVSLEY  86

Query  413  QTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNS--LFTQN-ST  243
            +T+     +   C    G N     TD+ G PF +S+  N F+  GC  +  L T +   
Sbjct  87   KTVMVNSPITPLC----GGNGTWRTTDVGGRPFRFSRVHNIFMVVGCDTNAVLMTDDQEE  142

Query  242  VVAGCTAICGANISSGFAGCYGIDCCETPVPF-DLTSYTANFTNSGIQSDGSNDNLKRCN  66
            ++AGCT+ C + I+S   GCYGI CC+T +P+ + +++   +    I++ G       C+
Sbjct  143  ILAGCTSNCNSGITSTGTGCYGIQCCQTTIPYSNQSTHLGMYQVKYIKTSGD------CS  196

Query  65   SAFLIDQRW  39
             AFL  + W
Sbjct  197  YAFLGVRDW  205



>ref|XP_010663523.1| PREDICTED: wall-associated receptor kinase-like 2 [Vitis vinifera]
Length=708

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 70/189 (37%), Positives = 106/189 (56%), Gaps = 17/189 (9%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C   CG+VSIP+PFGIG GC  N +F +NC++SS PPK +LN     +L  E++ VSLE 
Sbjct  30   CVAHCGDVSIPYPFGIGTGCYFNDYFSINCNDSSTPPKPFLN---HSKLNLELLNVSLEY  86

Query  413  QTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNS--LFTQN-ST  243
            +T+     +   C    G N     TD+ G PF +S+  N F+  GC  +  L T +   
Sbjct  87   KTVMVNSPITPLC----GGNGTWRTTDVGGRPFRFSRVHNIFMVVGCDTNAVLMTDDQEE  142

Query  242  VVAGCTAICGANISSGFAGCYGIDCCETPVPF-DLTSYTANFTNSGIQSDGSNDNLKRCN  66
            ++AGCT+ C + I+S   GCYGI CC+T +P+ + +++   +    I++ G       C+
Sbjct  143  ILAGCTSNCNSGITSTGTGCYGIQCCQTTIPYSNQSTHLGMYQVKYIKTSGD------CS  196

Query  65   SAFLIDQRW  39
             AFL  + W
Sbjct  197  YAFLGVRDW  205



>ref|XP_002513972.1| kinase, putative [Ricinus communis]
 gb|EEF48555.1| kinase, putative [Ricinus communis]
Length=727

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/194 (36%), Positives = 115/194 (59%), Gaps = 13/194 (7%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C++ CG+++ PFPFGIG+GC ++  F + C++S  PPK +L S + +EL  +    S+ +
Sbjct  32   CQESCGDITFPFPFGIGKGCYMSEMFEIVCNDSFTPPKPFLTS-INMELLHD---PSIGS  87

Query  413  QTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN-SLFTQNSTVV  237
            + IT    V++   + + +++ +    L G+ F +S   N+F   GC + ++ TQ+   V
Sbjct  88   ERITVNSPVIS--SNCSNKSSTSTEVSLLGTSFLFSNESNRFTTIGCDSYAMLTQSGNTV  145

Query  236  AGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKRCNSAF  57
             GC +IC  N SS   GCYG++CC+T +P  + S+  N TN    SDG  D   RC SAF
Sbjct  146  GGCLSICRDNSSS---GCYGLNCCQTTIPPYVQSFEVNITNP-FNSDG--DGRDRCKSAF  199

Query  56   LIDQRWIPKQSTSL  15
            ++ Q W+  +ST+L
Sbjct  200  MVSQNWLASKSTNL  213



>emb|CBI15394.3| unnamed protein product [Vitis vinifera]
Length=1912

 Score =   124 bits (310),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 70/189 (37%), Positives = 106/189 (56%), Gaps = 17/189 (9%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C   CG+VSIP+PFGIG GC  N +F +NC++SS PPK +LN     +L  E++ VSLE 
Sbjct  325  CVAHCGDVSIPYPFGIGTGCYFNDYFSINCNDSSTPPKPFLN---HSKLNLELLNVSLEY  381

Query  413  QTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNS--LFTQN-ST  243
            +T+     +   C    G N     TD+ G PF +S+  N F+  GC  +  L T +   
Sbjct  382  KTVMVNSPITPLC----GGNGTWRTTDVGGRPFRFSRVHNIFMVVGCDTNAVLMTDDQEE  437

Query  242  VVAGCTAICGANISSGFAGCYGIDCCETPVPF-DLTSYTANFTNSGIQSDGSNDNLKRCN  66
            ++AGCT+ C + I+S   GCYGI CC+T +P+ + +++   +    I++ G       C+
Sbjct  438  ILAGCTSNCNSGITSTGTGCYGIQCCQTTIPYSNQSTHLGMYQVKYIKTSGD------CS  491

Query  65   SAFLIDQRW  39
             AFL  + W
Sbjct  492  YAFLGVRDW  500


 Score =   117 bits (293),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 67/186 (36%), Positives = 98/186 (53%), Gaps = 13/186 (7%)
 Frame = -2

Query  593   CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
             C   CG+VSIP+PFGIG+ C  N +F +NC++SS+PPK +LN     EL  E+  VSLE 
Sbjct  866   CVAYCGDVSIPYPFGIGKDCYFNDYFSINCNDSSSPPKPFLN---HTELNLELFNVSLEY  922

Query  413   QTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCG-NSLFTQNSTVV  237
             +T+     + + C D    N      D  GSPF +S   N F+  GC  N++      ++
Sbjct  923   KTVMVNSPIPSLCAD----NGTWKSNDFGGSPFRFSSVHNIFMVVGCDTNAVLATGDEIL  978

Query  236   AGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKRCNSAF  57
             AGCT+ C   I+     CYGI CC+T +     SY +  T+ G+ +       + C  AF
Sbjct  979   AGCTSNCDNRIARTRRRCYGIKCCQTTI-----SYNSQSTHLGMYNVSYVKTGEGCAYAF  1033

Query  56    LIDQRW  39
             +  + W
Sbjct  1034  MGGRDW  1039


 Score = 90.5 bits (223),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 66/112 (59%), Gaps = 3/112 (3%)
 Frame = -2

Query  593   CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
             CE RCGN SIP+PFG+G+ C  N WF ++C++SS+ P   L S  +I L  EV  +S+E 
Sbjct  1468  CEDRCGNYSIPYPFGVGKDCYYNEWFAISCNSSSSFPTPLL-SHPRINL--EVQQISVEY  1524

Query  413   QTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLF  258
             QT++    +  +C +    N   +  DL  +PF++S  RN     GCGN++ 
Sbjct  1525  QTVSVQTPMPAYCQNQEETNRTWDSIDLKETPFFFSAERNSLRVIGCGNAVL  1576



>ref|XP_008353664.1| PREDICTED: wall-associated receptor kinase-like 8 [Malus domestica]
Length=327

 Score =   119 bits (298),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 65/191 (34%), Positives = 110/191 (58%), Gaps = 16/191 (8%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C+ +CG+V+IP+PFGIG  C L+ WF ++C+++  P K +LNS      + EV+ VS+E 
Sbjct  20   CQAQCGSVTIPYPFGIGPNCYLDEWFSISCNDTYNPSKPFLNS-----TKLEVLNVSMEL  74

Query  413  QTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN-SLFTQ-NSTV  240
             T+       + C D +    ++    L G PF +S+S+N+F   GC N +L T  N + 
Sbjct  75   GTVRVNYPAKSTCGDMSSAYVMS----LEGGPFVFSQSKNRFTAVGCNNLALMTMVNGST  130

Query  239  VAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKRCNSA  60
            + GC + C + +++  + C GIDCC+T +P DL  +     N+ I+S  + +  + C  A
Sbjct  131  IGGCLSFCRSGLTASSSTCNGIDCCQTTIPSDLQVF-----NTTIESVETGEPTEGCKYA  185

Query  59   FLIDQRWIPKQ  27
            FL+D++W   +
Sbjct  186  FLVDRQWFENE  196



>ref|XP_010648101.1| PREDICTED: wall-associated receptor kinase-like 1 [Vitis vinifera]
Length=325

 Score =   118 bits (295),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 109/206 (53%), Gaps = 21/206 (10%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGE-GCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLE  417
            C++ CG+V IP+PFGIG  GC  + WF V C+NS+ PPK +L       +  EV+ VSL 
Sbjct  29   CQEWCGDVDIPYPFGIGSSGCYFDEWFEVTCNNSTDPPKPFLKG-----VNLEVLNVSLH  83

Query  416  NQTITTLKSVVNFCDDSAGRNAITNGTDL-SGSPFYYSKSRNKFLFAGC-GNSLFTQNST  243
                  + + V    + +G+ +  N T    G PF +S +  +F   GC   + F Q+ T
Sbjct  84   G--TVRVNNPVLLSQNCSGKPS--NDTQWWEGGPFSFSNTYTRFTAVGCSAMAYFMQDDT  139

Query  242  VVAGCTAICGANISSGF--AGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKRC  69
            V+ GC  +C  ++ +    A CYG++CC+T VP  L S+TAN        +GS D  + C
Sbjct  140  VIGGCMTLCKKDVPTAAKNASCYGLECCQTQVPPGLLSFTANLDTF---PEGSADEQEPC  196

Query  68   NSAFLIDQRW----IPKQSTSLFLEY  3
              AF++DQ W    +P   T   +EY
Sbjct  197  KYAFMVDQEWFISNVPDPHTMKDMEY  222



>emb|CBI29390.3| unnamed protein product [Vitis vinifera]
Length=597

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 75/205 (37%), Positives = 112/205 (55%), Gaps = 20/205 (10%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGE-GCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLE  417
            C++RCG+V IP+PFGIG  GC  + WF V C+NS+ PPK +L       +  EV+ VSL+
Sbjct  40   CQERCGDVDIPYPFGIGSAGCYFDEWFEVTCNNSTDPPKPFLKG-----VNLEVLNVSLD  94

Query  416  NQTITTLKSVVNFCDDSAGRNAITNGTDL-SGSPFYYSKSRNKFLFAGCGNSLF-TQNST  243
                  + + V    + +G+ +  N T    G PF +S +  +F   GC   ++  Q+ T
Sbjct  95   G--TIRVNNPVLLSQNCSGKPS--NDTQWWEGGPFSFSNTYTRFTAVGCSALVYIMQDDT  150

Query  242  VVAGCTAICGANISSGFA-GCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKRCN  66
            V+ GC   C  + ++     CYG++CC+T VP  L S+TAN    G  SDGS D  ++C 
Sbjct  151  VIGGCMTFCKKDATAAKKASCYGLECCQTQVPPGLLSFTANL---GTFSDGSADEQEQCK  207

Query  65   SAFLIDQRW----IPKQSTSLFLEY  3
             AF++DQ W    +P   T   +EY
Sbjct  208  FAFMVDQEWFISNVPDPHTVKDMEY  232



>ref|XP_010648089.1| PREDICTED: wall-associated receptor kinase-like 10 [Vitis vinifera]
Length=677

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 77/205 (38%), Positives = 113/205 (55%), Gaps = 20/205 (10%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGE-GCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLE  417
            C++RCG+V IP+PFGIG  GC  + WF V C+NS+ PPK +L       +  EV+ VSL+
Sbjct  29   CQERCGDVDIPYPFGIGSAGCYFDEWFEVTCNNSTDPPKPFLKG-----VNLEVLNVSLD  83

Query  416  NQTITTLKSVVNFCDDSAGRNAITNGTDL-SGSPFYYSKSRNKFLFAGCGNSLF-TQNST  243
              TI     V+    + +G+ +  N T    G PF +S +  +F   GC   ++  Q+ T
Sbjct  84   G-TIRVNNPVL-LSQNCSGKPS--NDTQWWEGGPFSFSNTYTRFTAVGCSALVYIMQDDT  139

Query  242  VVAGCTAICGANISSGFA-GCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKRCN  66
            V+ GC   C  + ++     CYG++CC+T VP  L S+TAN    G  SDGS D  ++C 
Sbjct  140  VIGGCMTFCKKDATAAKKASCYGLECCQTQVPPGLLSFTANL---GTFSDGSADEQEQCK  196

Query  65   SAFLIDQRW----IPKQSTSLFLEY  3
             AF++DQ W    +P   T   +EY
Sbjct  197  FAFMVDQEWFISNVPDPHTVKDMEY  221



>emb|CDP20610.1| unnamed protein product [Coffea canephora]
Length=706

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 80/198 (40%), Positives = 116/198 (59%), Gaps = 22/198 (11%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C   CGNV IP+PFGIG GC+LN  + + C +S    K YL++     L  EV+ VSL N
Sbjct  33   CSDTCGNVRIPYPFGIGPGCSLNESYTIICTSS----KPYLSN-----LNLEVLNVSLRN  83

Query  413  QTITTLKSVVNFC----DDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNS-LFTQN  249
            +T+T   +V  FC      S+  +  +N +DL G+PF+YSK+ N  +  GCGN+ L  QN
Sbjct  84   RTVTVSTTVTPFCSSGSQTSSISSWRSNSSDLGGTPFFYSKTYNNLVIFGCGNAVLINQN  143

Query  248  -STVVAGCTAICGANISS---GFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDN  81
             + +++GCT+ C  N  +     + CYG++CCET +PF L+ Y  NFT S     G+ + 
Sbjct  144  DNKILSGCTSTCEFNSPAQAIDTSSCYGVNCCETTIPFYLSKYHLNFTASRFSLGGTGN-  202

Query  80   LKRCNSAFLIDQRWIPKQ  27
               C+S FL DQ W P++
Sbjct  203  ---CSSVFLADQNWSPEK  217



>ref|XP_008342477.1| PREDICTED: wall-associated receptor kinase-like 22 [Malus domestica]
Length=729

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/187 (35%), Positives = 109/187 (58%), Gaps = 16/187 (9%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C+ +CG+V+IP+PFGIG  C L+ WF ++C+++  P K +LNS      + EV+ VS+E 
Sbjct  20   CQAQCGSVTIPYPFGIGPNCYLDEWFSISCNDTYNPSKPFLNS-----TKLEVLNVSMEL  74

Query  413  QTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN-SLFTQ-NSTV  240
             T+       + C D +    ++    L G PF +S+S+N+F   GC N +L T  N + 
Sbjct  75   GTVRVNYPAKSTCGDMSSAYVMS----LEGGPFVFSQSKNRFTAVGCNNLALMTMVNGST  130

Query  239  VAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKRCNSA  60
            + GC + C + +++  + C GIDCC+T +P DL  +     N+ I+S  + +  + C  A
Sbjct  131  IGGCLSFCRSGLTASSSTCNGIDCCQTTIPSDLQVF-----NTTIESVETGEPTEGCKYA  185

Query  59   FLIDQRW  39
            FL+D++W
Sbjct  186  FLVDRQW  192



>emb|CAN70207.1| hypothetical protein VITISV_007744 [Vitis vinifera]
Length=679

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 110/206 (53%), Gaps = 21/206 (10%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGE-GCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLE  417
            C++ CG+V IP+PFGIG  GC  + WF V C+NS+ PPK +L       +  EV+ VSL 
Sbjct  30   CQEWCGDVDIPYPFGIGSSGCYFDEWFEVTCNNSTDPPKPFLKG-----VNLEVLNVSLH  84

Query  416  NQTITTLKSVVNFCDDSAGRNAITNGTDL-SGSPFYYSKSRNKFLFAGC-GNSLFTQNST  243
                  + + V    + +G+ +  N T    G PF +S +  +F   GC   + F Q+ T
Sbjct  85   G--TVRVNNPVLLSQNCSGKPS--NDTQWWEGGPFSFSNTYTRFTAVGCSAMAYFMQDDT  140

Query  242  VVAGCTAICGANISSGF--AGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKRC  69
            V+ GC  +C  ++++    A CYG++CC+T VP  L S+TAN        +GS D  + C
Sbjct  141  VIGGCMTLCKKDVATAAKNASCYGLECCQTQVPPGLLSFTANLDTF---PEGSADEQEPC  197

Query  68   NSAFLIDQRW----IPKQSTSLFLEY  3
              AF++DQ W    +P   T   +EY
Sbjct  198  KYAFMVDQEWFISNVPDPHTVKDMEY  223



>ref|XP_007035467.1| Wall associated kinase-like 6, putative [Theobroma cacao]
 gb|EOY06393.1| Wall associated kinase-like 6, putative [Theobroma cacao]
Length=758

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 71/189 (38%), Positives = 104/189 (55%), Gaps = 18/189 (10%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C+ RCGNVSIP+PFGIG  C+LNPWF V+C+++S+PP   L S     ++ E++   L  
Sbjct  34   CKDRCGNVSIPYPFGIGAKCSLNPWFEVSCNDTSSPPTISLTS-----IKMELLEFRLGR  88

Query  413  QTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLF-TQNSTVV  237
                 +KS +    + +GR   +   +++GSPF +S+S NKF+ AGC N  F T     +
Sbjct  89   DEYLRVKSPI-ISKNCSGRET-SRRVNITGSPFCFSESMNKFIAAGCNNEAFMTGIEPTI  146

Query  236  AGCTAICGANISSG---FAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKRCN  66
             GC + C  N   G    A C G  CCET +P  L  + A F +   +S+G       C 
Sbjct  147  VGCESACIGNRLFGPNPNATCDGSTCCETVIPSRLHVFNATFQSKESESEG-------CK  199

Query  65   SAFLIDQRW  39
             AFL+++ W
Sbjct  200  LAFLVEEEW  208



>ref|XP_003634276.1| PREDICTED: wall-associated receptor kinase-like 8 [Vitis vinifera]
Length=706

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 71/194 (37%), Positives = 107/194 (55%), Gaps = 9/194 (5%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            CE RCGN SIP+PFG+G+ C  N WF ++C++SS+ P   L S  +I L  EV  +S+E 
Sbjct  30   CEDRCGNYSIPYPFGVGKDCYYNEWFAISCNSSSSFPTPLL-SHPRINL--EVQQISVEY  86

Query  413  QTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNS-LFTQNSTVV  237
            QT++    +  +C +    N   +  DL  +PF++S  RN     GCGN+ L T++   +
Sbjct  87   QTVSVQTPMPAYCQNQEETNRTWDSIDLKETPFFFSAERNSLRVIGCGNAVLVTRSGVTL  146

Query  236  AGCTAICGANISSGFA---GCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKRCN  66
            AGC++ C  N S+ F    GC+GI+CC+  +P +L  +  N T +   S  S        
Sbjct  147  AGCSSFC-QNTSNNFVGNGGCFGINCCQATIPSNLNFFRLNTTATSYLSSESPCTFAALG  205

Query  65   SAFLIDQRWIPKQS  24
            + F  DQ   P+QS
Sbjct  206  NGFSTDQA-SPQQS  218



>emb|CAN65979.1| hypothetical protein VITISV_017968 [Vitis vinifera]
Length=294

 Score =   115 bits (289),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 69/193 (36%), Positives = 98/193 (51%), Gaps = 7/193 (4%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNC--DNSSAPPKAYLNSFVQIELQGEVVAVSL  420
            C  RCGNV+IPFPFGIG+ C LN W+ VNC  + SS   K +LN     +L  E++ VSL
Sbjct  33   CRYRCGNVTIPFPFGIGDSCYLNVWYSVNCSVNMSSGAEKPFLN---HTKLNLELLNVSL  89

Query  419  ENQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQNSTV  240
            E++T+     + ++       N      DL  SPF +S+  N F+  GCG +    +  V
Sbjct  90   EHRTVEVNSPIASYDQRQGESNTSQPSIDLDKSPFLFSRLDNIFVVLGCGQAKLMDHENV  149

Query  239  VAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKRCNSA  60
             A CT+IC  N S    G  G + C+TP+P   + Y  N+     +    N+       A
Sbjct  150  WADCTSIC--NNSYPAQGRNGFNFCQTPIPSTDSYYLNNYLVGFTRGCEGNNYSNSTTHA  207

Query  59   FLIDQRWIPKQST  21
            FL+D+ W    ST
Sbjct  208  FLVDRHWFSHNST  220



>emb|CDP20609.1| unnamed protein product [Coffea canephora]
Length=709

 Score =   119 bits (298),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 79/204 (39%), Positives = 111/204 (54%), Gaps = 31/204 (15%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C   CG+V IP+PFGIG GC+LN  + + C +S    K YL+S     L  EV+ VSL N
Sbjct  40   CSDTCGSVRIPYPFGIGPGCSLNESYTIICASS----KPYLSS-----LNLEVLKVSLRN  90

Query  413  QTITTLKSVV-NFCDDSAGRNAI----TNGTDLSGSPFYYSKSRNKFLFAGCGNSLF--T  255
             T+T    +  + C   A   AI    +N +DL+G+PF+YSK+ NK +  GCG ++    
Sbjct  91   LTVTVNTPITASSCSSGAQTGAISSWRSNSSDLAGTPFFYSKTYNKLVLFGCGTAVLLNQ  150

Query  254  QNSTVVAGCTAICGA-------NISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSD  96
             N+ +++GCT+IC +       NI+S    CY  +CCET +PFDL  Y  NFT S     
Sbjct  151  NNNKILSGCTSICKSDTPPQPININS---TCY--NCCETAIPFDLPKYHLNFTASRFNRG  205

Query  95   GSNDNL---KRCNSAFLIDQRWIP  33
                 +     C+S FL+DQ   P
Sbjct  206  TIRSRINGTSSCSSVFLVDQSLSP  229



>ref|XP_007217600.1| hypothetical protein PRUPE_ppa018374mg, partial [Prunus persica]
 gb|EMJ18799.1| hypothetical protein PRUPE_ppa018374mg, partial [Prunus persica]
Length=689

 Score =   119 bits (297),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 67/188 (36%), Positives = 108/188 (57%), Gaps = 17/188 (9%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C+ +CG+V+IP+PFGIG  C ++ WF ++C+ +  PPK +LNS      + EV+ VS E 
Sbjct  38   CQSQCGDVTIPYPFGIGANCYVDEWFSISCNETFNPPKPFLNS-----TKLEVLEVSTEL  92

Query  413  QTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN-SLFT-QNSTV  240
             T+     V + C D +  N ++    + GSPF +S++ N+F   GC N +L T  N + 
Sbjct  93   GTVRVNFPVNSTCGDRSNANVMS----MEGSPFVFSQADNRFTGVGCNNLALMTLLNGST  148

Query  239  VAGCTAIC-GANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKRCNS  63
            + GC + C   +       C GIDCC+T +P DL ++     N+ I++  + +N + C  
Sbjct  149  IGGCLSFCFSGSTGGSSTTCNGIDCCQTTIPSDLQAF-----NTTIENIEARENSEGCKY  203

Query  62   AFLIDQRW  39
            AFL+DQ+W
Sbjct  204  AFLVDQQW  211



>ref|XP_008229606.1| PREDICTED: wall-associated receptor kinase-like 22 [Prunus mume]
Length=732

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/188 (36%), Positives = 107/188 (57%), Gaps = 17/188 (9%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C+ +CGNV+IP+PFGIG  C ++ WF ++C+ +  PPK +LNS      + EV+ VS E 
Sbjct  30   CQSQCGNVTIPYPFGIGANCYVDEWFSISCNETFNPPKPFLNS-----TKLEVLEVSTEL  84

Query  413  QTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN-SLFT-QNSTV  240
              +     V + C D +  N ++    + GSPF +S++ N+F   GC N +L T  N + 
Sbjct  85   GIVRVNFPVNSTCGDRSSANVMS----MEGSPFVFSQADNRFTGVGCNNLALMTLLNGST  140

Query  239  VAGCTAIC-GANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKRCNS  63
            + GC + C   +       C GIDCC+T +P DL ++     N+ I++  + +N + C  
Sbjct  141  IGGCLSFCFSGSTGGSSTTCNGIDCCQTTIPSDLQAF-----NTTIENIEARENSEGCKY  195

Query  62   AFLIDQRW  39
            AFL+DQ+W
Sbjct  196  AFLVDQQW  203



>ref|XP_006388660.1| hypothetical protein POPTR_0126s00200g [Populus trichocarpa]
 gb|ERP47574.1| hypothetical protein POPTR_0126s00200g [Populus trichocarpa]
Length=667

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/189 (39%), Positives = 100/189 (53%), Gaps = 14/189 (7%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDN--SSAPPKAYLNSFVQIELQGEVVAVSL  420
            CE  CG + IP+PFG  EGC L+  F + C N  S   PK  +N         EV  +S+
Sbjct  6    CESSCGGIDIPYPFGEKEGCYLDERFKILCINYSSGVLPKLTVNG-----TDLEVRYISV  60

Query  419  ENQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN-SLFTQNST  243
            ++ TI  +  +V     +  RN +    DL GSPF +S S N F+  GC N +L TQN +
Sbjct  61   DDSTIQVMFPIVFANCSAKDRNTVV---DLEGSPFVFS-SENYFIARGCDNLALMTQNQS  116

Query  242  VVAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKRCNS  63
             V GC +IC  N  S  A C GIDCC+T +P  L  +  N T +G+     +   K+C  
Sbjct  117  TVGGCVSICDKNSDSMMASCSGIDCCQTRIPSFLKVF--NVTMNGLGDGKGSSGEKQCRY  174

Query  62   AFLIDQRWI  36
            A+LIDQ WI
Sbjct  175  AYLIDQSWI  183



>ref|XP_002274962.1| PREDICTED: wall-associated receptor kinase-like 2 [Vitis vinifera]
Length=717

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 67/186 (36%), Positives = 98/186 (53%), Gaps = 13/186 (7%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C   CG+VSIP+PFGIG+ C  N +F +NC++SS+PPK +LN     EL  E+  VSLE 
Sbjct  31   CVAYCGDVSIPYPFGIGKDCYFNDYFSINCNDSSSPPKPFLN---HTELNLELFNVSLEY  87

Query  413  QTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCG-NSLFTQNSTVV  237
            +T+     + + C D    N      D  GSPF +S   N F+  GC  N++      ++
Sbjct  88   KTVMVNSPIPSLCAD----NGTWKSNDFGGSPFRFSSVHNIFMVVGCDTNAVLATGDEIL  143

Query  236  AGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKRCNSAF  57
            AGCT+ C   I+     CYGI CC+T +     SY +  T+ G+ +       + C  AF
Sbjct  144  AGCTSNCDNRIARTRRRCYGIKCCQTTI-----SYNSQSTHLGMYNVSYVKTGEGCAYAF  198

Query  56   LIDQRW  39
            +  + W
Sbjct  199  MGGRDW  204



>emb|CAN65983.1| hypothetical protein VITISV_017972 [Vitis vinifera]
Length=649

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 67/186 (36%), Positives = 98/186 (53%), Gaps = 13/186 (7%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C   CG+VSIP+PFGIG+ C  N +F +NC++SS+PPK +LN     EL  E+  VSLE 
Sbjct  31   CVAYCGDVSIPYPFGIGKDCYFNDYFSINCNDSSSPPKPFLN---HTELNLELFNVSLEY  87

Query  413  QTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCG-NSLFTQNSTVV  237
            +T+     + + C D    N      D  GSPF +S   N F+  GC  N++      ++
Sbjct  88   KTVMVNSPIPSLCAD----NGTWKSNDFGGSPFRFSSVHNIFMVVGCDTNAVLATGDEIL  143

Query  236  AGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKRCNSAF  57
            AGCT+ C   I+     CYGI CC+T +     SY +  T+ G+ +       + C  AF
Sbjct  144  AGCTSNCDNRIARTRRRCYGIKCCQTTI-----SYNSQSTHLGMYNVSYVKTGEGCAYAF  198

Query  56   LIDQRW  39
            +  + W
Sbjct  199  MGGRDW  204



>ref|XP_002513974.1| kinase, putative [Ricinus communis]
 gb|EEF48557.1| kinase, putative [Ricinus communis]
Length=694

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 71/191 (37%), Positives = 104/191 (54%), Gaps = 18/191 (9%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            CE  CGNV I FPFGIG+GC ++  F V C++SS PPK +L S     +  E++ V   N
Sbjct  32   CESYCGNVPIEFPFGIGKGCYMDESFEVTCNSSSEPPKPFLTS-----INMELLEVLSPN  86

Query  413  QTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN-SLFTQN-STV  240
            Q       + + C   + + +  +   LSG+PF +S + N+F   GC N ++  Q+    
Sbjct  87   QVQVNNPVIYSNC---SHKTSTASRVSLSGTPFTFSNASNRFTAKGCNNYAILMQDIGDT  143

Query  239  VAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKRCNSA  60
            V GC +IC    +S  +GCYGI+C +T +P  + S+ AN TN        +DN   C SA
Sbjct  144  VGGCLSICRDEANS--SGCYGINCWQTTIPPYMKSFEANMTNP------FSDNTNNCKSA  195

Query  59   FLIDQRWIPKQ  27
            F++DQ W   Q
Sbjct  196  FMVDQSWFAFQ  206



>ref|XP_011017598.1| PREDICTED: wall-associated receptor kinase-like 22 [Populus euphratica]
Length=234

 Score =   111 bits (277),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 70/187 (37%), Positives = 96/187 (51%), Gaps = 12/187 (6%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            CE  CG + IP+PFG+ EGC L+  F + C+ SS  PK  +N         +V  +S  +
Sbjct  31   CESYCGRIGIPYPFGMKEGCYLDERFKILCNPSSGVPKLTVNG-----TDLDVNYISAYD  85

Query  413  QTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN-SLFTQNSTVV  237
             TI  +  +V        RN +    DL GSPF +S S N F+  GC N +L TQN + +
Sbjct  86   STIEVMFPIVFANCSGKDRNTVV---DLEGSPFVFS-SGNYFIARGCDNLALMTQNQSTI  141

Query  236  AGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKRCNSAF  57
             GC +IC  N  S  A C GIDCC+T +P  L  +  N    G+     +   K+C  A+
Sbjct  142  GGCVSICDKNRDSMIASCSGIDCCQTRIPSFLKVFNVNM--KGLDDGKGSGGEKQCRYAY  199

Query  56   LIDQRWI  36
            LIDQ  I
Sbjct  200  LIDQTQI  206



>ref|XP_007035468.1| Wall associated kinase-like 6, putative [Theobroma cacao]
 gb|EOY06394.1| Wall associated kinase-like 6, putative [Theobroma cacao]
Length=719

 Score =   116 bits (290),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 71/190 (37%), Positives = 99/190 (52%), Gaps = 20/190 (11%)
 Frame = -2

Query  596  RCEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLE  417
            +C   CGNVSIP+ FGIG  C LNPWF V+C+ +S+PP   L S     +  EV+   L+
Sbjct  29   KCPDLCGNVSIPYSFGIGADCFLNPWFEVSCNETSSPPIISLTS-----INMEVLDFRLD  83

Query  416  NQTITTLKS--VVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLF-TQNS  246
                  +KS  +   C D       + G +++GSPF++S S NKF+ AGC N  F T   
Sbjct  84   RYEYVRVKSPIISKNCSD----RETSRGVNITGSPFFFSGSMNKFIAAGCNNKAFMTGTE  139

Query  245  TVVAGCTAICGANISSGFAG-CYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKRC  69
              + GC + C  N   G    C G  CCET +P  L  + A F +   QS+G       C
Sbjct  140  PTIVGCESACIDNRLFGPNNTCNGETCCETVIPSRLRVFNARFESKESQSEG-------C  192

Query  68   NSAFLIDQRW  39
              AFL++++W
Sbjct  193  KLAFLVEEKW  202



>ref|XP_010688363.1| PREDICTED: wall-associated receptor kinase-like 2 isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=714

 Score =   114 bits (285),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 69/204 (34%), Positives = 102/204 (50%), Gaps = 20/204 (10%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVS--L  420
            C+  CGN+SIP+PFGIG  C  NPWF V CD +S   K        +++ G+ +      
Sbjct  38   CKDHCGNISIPYPFGIGPNCYHNPWFEVECDATSFTLK-------MLQITGKEINWDPLT  90

Query  419  ENQTITTLKSVVNFC--DDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNS--LFTQ  252
            E +T  TL S   +C  D S     I +  ++ GSPF YSK  N  +  GCG    L  +
Sbjct  91   EERTFVTLNSCERYCVRDGSPETVVINDSYNMIGSPFLYSKKHNVLVVNGCGGGIVLRDR  150

Query  251  NSTVVAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNL-K  75
            N+  +AGC A+C  N +     CYG+DCC+T +     S++ ++    + S G+   +  
Sbjct  151  NNQTIAGCAAVCVTNSTRPGLECYGVDCCQTTI-----SHSIDYYEVEVASMGTTRVIGG  205

Query  74   RCNSAFLIDQRWIPKQSTSLFLEY  3
             C  + L    WI K+   L L+Y
Sbjct  206  GCVRSVLAQTNWISKKKKDL-LDY  228



>emb|CDP11260.1| unnamed protein product [Coffea canephora]
Length=1288

 Score =   114 bits (284),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 69/203 (34%), Positives = 104/203 (51%), Gaps = 19/203 (9%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSA-------PPKAYLNSFVQIELQGEV  435
            C+  CG+V IP+PFGIG  CALN  + + C + S         P   L      +   EV
Sbjct  216  CKDTCGSVKIPYPFGIGPDCALNEAYSIRCTDPSGGDSINGLRPYLGLQPGQSAQRIVEV  275

Query  434  VAVSLENQTITTLKSVVNFCD-DSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLF  258
            + VSL +QTIT    +   C  +    +A    + L+ +PF+ S+  NK +F GCGN+L 
Sbjct  276  LEVSLRDQTITINYPLSKICSFNRTTLDASVFESSLAQAPFFVSREHNKLMFLGCGNALL  335

Query  257  TQ---NSTVVAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSN  87
                 +  +++GCT++C  N ++   GCYGI+CC+  +P+ L+ Y+   T S       N
Sbjct  336  HLIDGSQQILSGCTSMC--NSTTTITGCYGINCCQASIPYYLSQYSLQLTAS------EN  387

Query  86   DNLKRCNSAFLIDQRWIPKQSTS  18
                 C  AFL+DQ W  +  TS
Sbjct  388  FTSSTCAYAFLVDQNWELENYTS  410


 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 61/119 (51%), Gaps = 7/119 (6%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQI------ELQGEVV  432
            C   CGNV+IP+PFG+G  CALN  + + C + S      L  ++ +      +   EV+
Sbjct  833  CNDTCGNVTIPYPFGVGPDCALNEAYSILCTDVSGDSIHGLRPYLGLHPGQSSQTIMEVL  892

Query  431  AVSLENQTITTLKSVVNFCD-DSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLF  258
             +SL +QT+T    V   C  + +  +     + L+  PFY S+  NK +  GCGN+L 
Sbjct  893  GISLSDQTVTINYPVYQICSVNGSTVDTAFMDSSLAQVPFYVSREHNKLMLLGCGNALL  951



>ref|XP_011011593.1| PREDICTED: wall-associated receptor kinase-like 2 isoform X1 
[Populus euphratica]
Length=739

 Score =   112 bits (281),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 71/195 (36%), Positives = 110/195 (56%), Gaps = 22/195 (11%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSA--PPKAYLNSFVQIELQGEVVAVSL  420
            C + CGN+SIPFPFGIG GC++N WF V+C+ ++A  P +A+L+      +  EV+ +SL
Sbjct  31   CPETCGNISIPFPFGIGTGCSMNDWFSVDCNKTTADSPSRAFLS-----RINMEVLGISL  85

Query  419  ENQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN-SLFTQNST  243
             N  +     +++     +GR A     D+SGSPF +S S N F+  GC N +L  +   
Sbjct  86   GNSRVRVNSPIIS--SGCSGRGA-NLAFDMSGSPFIFS-SLNIFIAMGCNNRALLNRIEP  141

Query  242  VVAGCTAICGAN--ISSGFAG-----CYGIDCCETPVPFDLTSYTANFTNSGIQSDGSND  84
             + GCT+ CGAN   SS   G     C G +CC+T +P +L  ++A+    G   D ++ 
Sbjct  142  EIVGCTSTCGANNLTSSSTEGKEKRYCSGDNCCQTRIPSNLQVFSASL---GTTEDPNDQ  198

Query  83   NLKRCNSAFLIDQRW  39
               +C  AF++D+ W
Sbjct  199  GRNQCKVAFIVDRGW  213



>ref|XP_011011594.1| PREDICTED: wall-associated receptor kinase-like 2 isoform X2 
[Populus euphratica]
 ref|XP_011011595.1| PREDICTED: wall-associated receptor kinase-like 2 isoform X3 
[Populus euphratica]
Length=739

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 71/195 (36%), Positives = 110/195 (56%), Gaps = 22/195 (11%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSA--PPKAYLNSFVQIELQGEVVAVSL  420
            C + CGN+SIPFPFGIG GC++N WF V+C+ ++A  P +A+L+      +  EV+ +SL
Sbjct  31   CPETCGNISIPFPFGIGTGCSMNDWFSVDCNKTTADSPSRAFLS-----RINMEVLGISL  85

Query  419  ENQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN-SLFTQNST  243
             N  +     +++     +GR A     D+SGSPF +S S N F+  GC N +L  +   
Sbjct  86   GNSRVRVNSPIIS--SGCSGRGA-NLAFDMSGSPFIFS-SLNIFIAMGCNNRALLNRIEP  141

Query  242  VVAGCTAICGAN--ISSGFAG-----CYGIDCCETPVPFDLTSYTANFTNSGIQSDGSND  84
             + GCT+ CGAN   SS   G     C G +CC+T +P +L  ++A+    G   D ++ 
Sbjct  142  EIVGCTSTCGANNLTSSSTEGKEKRYCSGDNCCQTRIPSNLQVFSASL---GTTEDPNDQ  198

Query  83   NLKRCNSAFLIDQRW  39
               +C  AF++D+ W
Sbjct  199  GRNQCKVAFIVDRGW  213



>ref|XP_011013613.1| PREDICTED: wall-associated receptor kinase-like 22 isoform X1 
[Populus euphratica]
 ref|XP_011013614.1| PREDICTED: wall-associated receptor kinase-like 22 isoform X2 
[Populus euphratica]
Length=739

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 70/195 (36%), Positives = 110/195 (56%), Gaps = 22/195 (11%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSA--PPKAYLNSFVQIELQGEVVAVSL  420
            C + CGN+SIPFPFGIG GC++N WF V+C+ ++A  P +A+L+      +  EV+ +SL
Sbjct  31   CPETCGNISIPFPFGIGTGCSMNDWFSVDCNKTTADSPSRAFLS-----RINMEVLGISL  85

Query  419  ENQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN-SLFTQNST  243
             N  +     +++     +GR A     D++GSPF +S S N F+  GC N +L  +   
Sbjct  86   GNSRVRVNSPIIS--SGCSGRGA-NLAFDMTGSPFIFS-SLNIFIAMGCNNRALLNRIEP  141

Query  242  VVAGCTAICGAN--ISSGFAG-----CYGIDCCETPVPFDLTSYTANFTNSGIQSDGSND  84
             + GCT+ CGAN   SS   G     C G +CC+T +P +L  ++A+    G   D ++ 
Sbjct  142  EIVGCTSTCGANNLTSSSTEGKEKRYCSGDNCCQTRIPSNLQVFSASL---GTTEDPNDQ  198

Query  83   NLKRCNSAFLIDQRW  39
               +C  AF++D+ W
Sbjct  199  GRNQCKVAFIVDRGW  213



>ref|XP_011013615.1| PREDICTED: wall-associated receptor kinase-like 22 isoform X3 
[Populus euphratica]
Length=728

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 70/195 (36%), Positives = 110/195 (56%), Gaps = 22/195 (11%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSA--PPKAYLNSFVQIELQGEVVAVSL  420
            C + CGN+SIPFPFGIG GC++N WF V+C+ ++A  P +A+L+      +  EV+ +SL
Sbjct  31   CPETCGNISIPFPFGIGTGCSMNDWFSVDCNKTTADSPSRAFLS-----RINMEVLGISL  85

Query  419  ENQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN-SLFTQNST  243
             N  +     +++     +GR A     D++GSPF +S S N F+  GC N +L  +   
Sbjct  86   GNSRVRVNSPIIS--SGCSGRGA-NLAFDMTGSPFIFS-SLNIFIAMGCNNRALLNRIEP  141

Query  242  VVAGCTAICGAN--ISSGFAG-----CYGIDCCETPVPFDLTSYTANFTNSGIQSDGSND  84
             + GCT+ CGAN   SS   G     C G +CC+T +P +L  ++A+    G   D ++ 
Sbjct  142  EIVGCTSTCGANNLTSSSTEGKEKRYCSGDNCCQTRIPSNLQVFSASL---GTTEDPNDQ  198

Query  83   NLKRCNSAFLIDQRW  39
               +C  AF++D+ W
Sbjct  199  GRNQCKVAFIVDRGW  213



>ref|XP_010688364.1| PREDICTED: wall-associated receptor kinase-like 4 isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=568

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 66/200 (33%), Positives = 93/200 (47%), Gaps = 17/200 (9%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVS--L  420
            C+  CGN+SIP+PFGIG  C  NPWF V CD +S   K        +++ G+ +      
Sbjct  38   CKDHCGNISIPYPFGIGPNCYHNPWFEVECDATSFTLK-------MLQITGKEINWDPLT  90

Query  419  ENQTITTLKSVVNFC--DDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNS--LFTQ  252
            E +T  TL S   +C  D S     I +  ++ GSPF YSK  N  +  GCG    L  +
Sbjct  91   EERTFVTLNSCERYCVRDGSPETVVINDSYNMIGSPFLYSKKHNVLVVNGCGGGIVLRDR  150

Query  251  NSTVVAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKR  72
            N+  +AGC A+C  N +     CYG+DCC+T +   +  Y     + G            
Sbjct  151  NNQTIAGCAAVCVTNSTRPGLECYGVDCCQTTISHSIDYYEVEVASMGTTRVIGGG----  206

Query  71   CNSAFLIDQRWIPKQSTSLF  12
            C  + L    WI K+   L 
Sbjct  207  CVRSVLAQTNWISKKKKDLL  226



>ref|XP_006368673.1| hypothetical protein POPTR_0001s076201g, partial [Populus trichocarpa]
 gb|ERP65242.1| hypothetical protein POPTR_0001s076201g, partial [Populus trichocarpa]
Length=678

 Score =   110 bits (276),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 110/195 (56%), Gaps = 22/195 (11%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSA--PPKAYLNSFVQIELQGEVVAVSL  420
            C + CGN+SIPFPFGIG GC++N WF V+C+ ++A  P +A+L+      +  EV+ +SL
Sbjct  34   CTETCGNISIPFPFGIGTGCSMNDWFSVDCNKTTADSPSRAFLS-----RINMEVLKISL  88

Query  419  ENQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN-SLFTQNST  243
             +  +     +++     +GR A     D++GSPF +S S N F+  GC N +L  +   
Sbjct  89   GSSRVRVNSPIIS--SGCSGRGA-NLSFDMTGSPFVFS-SLNIFIAMGCNNRALLNRIEP  144

Query  242  VVAGCTAICGAN--ISSGFAG-----CYGIDCCETPVPFDLTSYTANFTNSGIQSDGSND  84
             + GCT+ CGAN   SS   G     C G +CC+T +P +L  ++A+    G   D ++ 
Sbjct  145  EIVGCTSTCGANNLTSSSTEGKEKRYCSGNNCCQTRIPSNLQVFSASL---GTTEDSNDQ  201

Query  83   NLKRCNSAFLIDQRW  39
               +C  AF++D+ W
Sbjct  202  GRNQCKVAFIVDRAW  216



>gb|KDP41424.1| hypothetical protein JCGZ_15831 [Jatropha curcas]
Length=731

 Score =   110 bits (275),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 76/192 (40%), Positives = 104/192 (54%), Gaps = 25/192 (13%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLE-  417
            C+  CGNVS  FPFGIG+ C LN  F V C+ S  PPKA+L S     L G   +  ++ 
Sbjct  30   CQYNCGNVSFEFPFGIGKDCYLNESFEVTCNYSFDPPKAFLTSINMELLDGTYKSGQVQV  89

Query  416  NQTITTLKSVVNFCDDSA-GRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN-SLFTQN-S  246
            N  I     + + C D A  R+ ++    +SGSPF +S   N+F   GC N ++  Q+  
Sbjct  90   NNPI-----IYSDCSDKAFNRSRVS----ISGSPFVFSNDSNRFTARGCDNYAMLVQDFG  140

Query  245  TVVAGCTAIC--GANISSGFAGCYGIDCCETPVPFDLTSYTANFTNS-GIQSDGSNDNLK  75
              V GC +IC  GAN S    GCYGI+CC+  +P  + S+    TN  GI+ D S+    
Sbjct  141  NTVGGCLSICPSGANTS----GCYGINCCQATIPPYIQSFEVTMTNPFGIREDKSS----  192

Query  74   RCNSAFLIDQRW  39
             C SAF++DQ W
Sbjct  193  -CKSAFIVDQDW  203



>emb|CAN82289.1| hypothetical protein VITISV_028339 [Vitis vinifera]
Length=352

 Score =   107 bits (267),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 70/192 (36%), Positives = 97/192 (51%), Gaps = 16/192 (8%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEG-CALNPWFLVNCDNSSAP--PKAYLNSFVQIELQGEVVAVS  423
            C++ CG+V IP+PFGIG   C  N WF V C+NS  P  PK +L       L  EV+ VS
Sbjct  82   CKEXCGDVDIPYPFGIGSASCYFNEWFEVTCNNSIHPHIPKPFLK-----RLNLEVLNVS  136

Query  422  LENQTITTLKSVVNFCDDSAGRNAITNG--TDLSGSPFYYSKSRNKFLFAGCGNSLFTQN  249
            L+  TI     V+  C   A    +T        G PF +S++  +F   GC    + + 
Sbjct  137  LDRGTIQVNNPVLFDCSGKASNFTVTPNFTVRWEGGPFSFSETYTRFTAVGCSVLAYIEQ  196

Query  248  STVVA-GCTAICGANISSGFAG-CYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLK  75
            S  +A GC + C  N ++   G CYG++CC+T VP  L S+TA   +        ND   
Sbjct  197  SEAIAGGCMSFCKPNETAVKNGSCYGLECCQTQVPPALRSFTAYLDS----FPSGNDEQL  252

Query  74   RCNSAFLIDQRW  39
             C SAF++DQ W
Sbjct  253  PCKSAFMVDQEW  264



>ref|XP_010269758.1| PREDICTED: wall-associated receptor kinase-like 8 [Nelumbo nucifera]
Length=690

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/188 (34%), Positives = 99/188 (53%), Gaps = 18/188 (10%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C+ RCG+VSIPFPFGIG+ C+    F + CD SS+ P  +L+       + +V+ +S+  
Sbjct  37   CQDRCGDVSIPFPFGIGDRCSKRKQFEITCDRSSSHPTPFLSLSTG---RFQVLNISMNG  93

Query  413  QTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQNS--TV  240
            +    + +       S     +     L GSPF++S+S N F+  GC N  F  N     
Sbjct  94   ELRINVPTF-----SSPNETEVHGRISLEGSPFFFSQSGNVFVAVGCNNRAFVHNHHDNS  148

Query  239  VAGCTAIC-GANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKRCNS  63
              GC + C G ++     GC GI CC+TP+P+ L +     T++GI ++     +  C S
Sbjct  149  TVGCISTCSGRDVKK--KGCCGISCCQTPIPWSLQTVDVTITSAGICNE-----ILGCKS  201

Query  62   AFLIDQRW  39
            AF++DQ+W
Sbjct  202  AFVVDQQW  209



>ref|XP_006387117.1| hypothetical protein POPTR_1809s00200g [Populus trichocarpa]
 gb|ERP46031.1| hypothetical protein POPTR_1809s00200g [Populus trichocarpa]
Length=739

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 107/195 (55%), Gaps = 22/195 (11%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSA--PPKAYLNSFVQIELQGEVVAVSL  420
            C   CGN+SIPFPFGIG GC++N WF V+C+ ++A  P +A+L+      +  EV+ +SL
Sbjct  32   CADTCGNISIPFPFGIGTGCSMNDWFSVDCNKTTADSPSRAFLS-----RINMEVLKISL  86

Query  419  ENQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN-SLFTQNST  243
             N  +     +++      G N   N   ++GSPF +S S N F+  GC N +L  +   
Sbjct  87   GNSRVRVNSPIISSGCSGRGANLAFN---MTGSPFVFS-SLNIFIAMGCNNRALLNRIEP  142

Query  242  VVAGCTAICGAN--ISSGFAG-----CYGIDCCETPVPFDLTSYTANFTNSGIQSDGSND  84
             + GCT+ CGAN   SS   G     C G +CC+T +P +L  ++A+    G   D ++ 
Sbjct  143  EIVGCTSTCGANNLTSSSTTGEEKRYCSGNNCCQTRIPSNLQVFSASL---GTTEDPNDQ  199

Query  83   NLKRCNSAFLIDQRW  39
               +C  AF++D+ W
Sbjct  200  GRNQCKVAFIVDRGW  214



>ref|XP_007224001.1| hypothetical protein PRUPE_ppa014914mg [Prunus persica]
 gb|EMJ25200.1| hypothetical protein PRUPE_ppa014914mg [Prunus persica]
Length=669

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 109/199 (55%), Gaps = 23/199 (12%)
 Frame = -2

Query  593  CEQRCGNVS-IPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQG-EVVAVSL  420
            C  +CG+V+ IP+PFGI  GC L+ WF + CDNS++PPKA+LN      + G EV+ +S+
Sbjct  27   CSSQCGSVTQIPYPFGIEAGCYLDDWFQIICDNSASPPKAFLN------VTGLEVLEISV  80

Query  419  ENQ-TITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN-SLFTQNS  246
            E    + +  +  N  +   GR       +L GSPF +S+ +NKF    CG  +L T + 
Sbjct  81   EGTLKVASPITFSNCSNKPVGRQT----QNLEGSPFLFSR-KNKFTSMSCGGIALMTLHG  135

Query  245  TVVAGCTAICGANISSGF--AGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKR  72
            + + GC +IC    +S      C G++CC+T +P+ L+S+  +F     +S       K 
Sbjct  136  STIGGCLSICDYYSTSVLQTKSCSGMNCCQTTLPYCLSSFNTSFGAVNAESQ------KA  189

Query  71   CNSAFLIDQRWIPKQSTSL  15
            C  AFL+D  W    ST++
Sbjct  190  CKFAFLVDNDWFTSNSTNI  208



>ref|XP_011011597.1| PREDICTED: wall-associated receptor kinase-like 22 [Populus euphratica]
Length=738

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 67/195 (34%), Positives = 105/195 (54%), Gaps = 22/195 (11%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSA--PPKAYLNSFVQIELQGEVVAVSL  420
            C + CGN+SIPFPFGIG GC++N WF V+C+ ++A    +A+L+      +  EV+ + L
Sbjct  31   CAETCGNISIPFPFGIGTGCSMNDWFSVDCNKTTADSSSRAFLS-----RINMEVLKIPL  85

Query  419  ENQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN-SLFTQNST  243
              + +     +++      G N   N   ++GSPF +S S N F   GC N +L TQ   
Sbjct  86   GERWVRVNSPIISSGCSGRGANLAIN---MTGSPFAFSSS-NSFAAMGCNNHALLTQIKP  141

Query  242  VVAGCTAICGAN-----ISSGFAGCY--GIDCCETPVPFDLTSYTANFTNSGIQSDGSND  84
             + GCT+ CGAN      + G   CY  G +CC+T +P DL  + A+   +    D ++ 
Sbjct  142  EIVGCTSTCGANNLTSSSTEGKENCYCSGNNCCQTRIPSDLQVFNASLETT---EDPNDH  198

Query  83   NLKRCNSAFLIDQRW  39
               +C  AF++D+ W
Sbjct  199  GRNQCKVAFIVDREW  213



>ref|XP_011034598.1| PREDICTED: wall-associated receptor kinase-like 22 [Populus euphratica]
Length=739

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 109/195 (56%), Gaps = 22/195 (11%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSA--PPKAYLNSFVQIELQGEVVAVSL  420
            C + CGN+SIPFPFGIG GC++N WF V+C+ ++A  P +A+L+      +  EV+ +SL
Sbjct  31   CTETCGNISIPFPFGIGTGCSMNDWFSVDCNKTTADSPSRAFLS-----RINMEVLGISL  85

Query  419  ENQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN-SLFTQNST  243
             +  +     +++     +GR A     D++GSPF +S S N F+  GC N +L  +   
Sbjct  86   GSSRVRVNSPIIS--SGCSGRGA-NLAFDMTGSPFVFS-SLNIFIAMGCNNHALLNRIEP  141

Query  242  VVAGCTAICGAN-----ISSGFAG--CYGIDCCETPVPFDLTSYTANFTNSGIQSDGSND  84
             V GCT+ CGAN     I+ G     C G +CC+T +P +L  + A+    G   D ++ 
Sbjct  142  EVVGCTSTCGANNLTSSITEGKEKRYCSGNNCCQTRIPSNLQVFNASL---GTTEDPNDQ  198

Query  83   NLKRCNSAFLIDQRW  39
               +C  AF++D+ W
Sbjct  199  GRNQCKVAFIVDRGW  213



>ref|XP_006383654.1| hypothetical protein POPTR_0005s22500g, partial [Populus trichocarpa]
 gb|ERP61451.1| hypothetical protein POPTR_0005s22500g, partial [Populus trichocarpa]
Length=661

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 69/190 (36%), Positives = 101/190 (53%), Gaps = 21/190 (11%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C+  CG +SIPFPFGIG GC  + W  + C+ + +PPK++  S     +  EV+ +S+EN
Sbjct  58   CQAFCGEISIPFPFGIGPGCYSHEWSEIVCNGTFSPPKSFAKS-----MNLEVLNISIEN  112

Query  413  QTITTLKSVVNFCDDSAGRNAITNGT---DLSGSPFYYSKSRNKFLFAGCGN-SLFTQNS  246
              I      VN     +G N  T  +   +L  SPF +S+ RNKF   GC N +L ++ S
Sbjct  113  NGIH-----VNLPITCSGCNGATTSSVRINLESSPFAFSQ-RNKFTATGCDNLALLSEKS  166

Query  245  TVVAGCTAICG-ANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKRC  69
            TV+ GC  +C   N      G  G++ C+  +P DL  Y     N+ I    +N+  K C
Sbjct  167  TVIGGCMPLCHDQNKKLSADGYLGVNRCQATIPSDLREY-----NASIGGMNNNEGSKGC  221

Query  68   NSAFLIDQRW  39
              AFL+DQ+W
Sbjct  222  KYAFLVDQQW  231



>gb|KCW47716.1| hypothetical protein EUGRSUZ_K01467 [Eucalyptus grandis]
Length=547

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 74/202 (37%), Positives = 110/202 (54%), Gaps = 27/202 (13%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C + CGNVSIPFPFGIG GC L+PW+ + C N + P    LN   +I L+  V+ +SL N
Sbjct  15   CVETCGNVSIPFPFGIGAGCFLDPWYEIVCQNRTVP---ILN---KIGLR--VLNISLPN  66

Query  413  --QTITTLKSV---VNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQN  249
              + +  + SV   + + + S G   +    +  GS F +S++RN F   GC N+L T N
Sbjct  67   YREFVDGMISVSLPLMYSNASCGGEGLRVPVNFEGSQFVFSQTRNVFTSVGC-NTLTTVN  125

Query  248  ST--VVAGCTAICGANISS--GFAGCYGID-CCETPVPFDLTSYTANFTNSGIQSDGSND  84
            ST   V GC + C    +   G++ C+G D CC+T +PF+L S++ +F   G +  G   
Sbjct  126  STESAVVGCRSKCAGTSADIGGYSACFGRDECCQTTLPFNLQSFSVDFIEDG-EPQG---  181

Query  83   NLKRCNSAFLIDQRWIPKQSTS  18
                C  AFL D+ W  + S +
Sbjct  182  ----CKYAFLADRSWFLRSSVT  199



>ref|XP_008222635.1| PREDICTED: wall-associated receptor kinase-like 22 [Prunus mume]
Length=713

 Score =   107 bits (267),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 69/199 (35%), Positives = 111/199 (56%), Gaps = 22/199 (11%)
 Frame = -2

Query  593  CEQRCGNVS-IPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQG-EVVAVSL  420
            C  +CG+V+ IP+PFGI  GC L+ WF + CDNS++P KA+LN      + G EV+ +S+
Sbjct  27   CSSQCGSVTQIPYPFGIEAGCYLDDWFQIICDNSASPSKAFLN------ITGLEVLEISV  80

Query  419  ENQ-TITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN-SLFTQNS  246
            E    + +  +  N  +   GR       +L GSPF +S+ +NKF    CG  +L T + 
Sbjct  81   EGTLKVASPITFSNCSNKPVGRQT----PNLEGSPFLFSR-KNKFTSMSCGGIALMTLHG  135

Query  245  TVVAGCTAICGANISSGF--AGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKR  72
            + + GC +IC    +S      C G++CC+T +P+ L+S+  +F      ++ + D+ K 
Sbjct  136  STIGGCLSICDYYSTSVLQTKSCSGMNCCQTTLPYCLSSFNTSFG-----AELNADSQKA  190

Query  71   CNSAFLIDQRWIPKQSTSL  15
            C  AFL+D  W    ST++
Sbjct  191  CKYAFLVDNDWFTSNSTNI  209



>ref|XP_006372238.1| hypothetical protein POPTR_0018s14520g [Populus trichocarpa]
 gb|ERP50035.1| hypothetical protein POPTR_0018s14520g [Populus trichocarpa]
Length=632

 Score =   107 bits (266),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 68/190 (36%), Positives = 100/190 (53%), Gaps = 15/190 (8%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C   CGNVSIP+PFG+ EGC  +    ++C++S+ P    L S    +L   V  +S+ +
Sbjct  38   CPSACGNVSIPYPFGMREGCYCDESLEIHCNSSNIP----LLSINGTDLV--VTDISVGD  91

Query  413  QTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN-SLFTQNSTVV  237
             TIT    +V    D   RN +    DL GSPF +S   N F+ +GC + +L  QN + V
Sbjct  92   STITVNFPIVFANCDGKERNTV---IDLEGSPFVFSSDLNNFIASGCDSLALLIQNQSAV  148

Query  236  AGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGI---QSDGSNDNLKRCN  66
             GC +IC    S+  + C GI+CC+T +P  L  Y  N T  G+   +  G     K+C 
Sbjct  149  GGCMSICDHERSNNLSSCSGINCCQTSIPSYLKVY--NVTLEGVNDGKGPGKKQPAKKCR  206

Query  65   SAFLIDQRWI  36
             A+L+D  W+
Sbjct  207  HAYLVDGNWM  216



>ref|XP_004305856.1| PREDICTED: wall-associated receptor kinase-like 22-like [Fragaria 
vesca subsp. vesca]
Length=756

 Score =   107 bits (267),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 71/199 (36%), Positives = 106/199 (53%), Gaps = 31/199 (16%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALN-PWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLE  417
            C   CG++ IP+PFGIG GC +N  WF V CDNS+  P+ YLN         EV+ +S+ 
Sbjct  38   CPSHCGDIEIPYPFGIGAGCYINDDWFRVFCDNSTGSPRPYLNG-----TNLEVLNISVV  92

Query  416  NQTITTLKSVVNF--CDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCG-NSLFTQNS  246
              T+  +++ + F  C     R A+    +L GSPF +   +N F   GCG  +  T NS
Sbjct  93   EGTL-RVRNPITFSNCSGKPNRQAV----NLEGSPFTFFSQKNMFTAVGCGVMATITSNS  147

Query  245  ---TVVAGCTAICGANISSGFAG-----CYGIDCCETPVPFDLTSYTANFTNSGIQSDGS  90
               T+ AGC + C A++ S  +      C G+DCC+T +P  L ++  +F         +
Sbjct  148  NGVTISAGCRSECYASVDSTNSSTSPNTCNGVDCCQTVIPSSLCAFNTSFQQ-------A  200

Query  89   NDNLKR--CNSAFLIDQRW  39
            NDNL +  C+ AFL+D+ W
Sbjct  201  NDNLTKSSCSYAFLVDRDW  219



>ref|XP_011078212.1| PREDICTED: wall-associated receptor kinase-like 10 [Sesamum indicum]
Length=731

 Score =   107 bits (267),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 66/187 (35%), Positives = 99/187 (53%), Gaps = 15/187 (8%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C++ CGNV+IP+PFGIG  C  N  F V CDNS+ P + YL+S     +Q E++ +SL +
Sbjct  30   CQETCGNVTIPYPFGIGSQCYANSSFAVICDNSTNPARLYLSS-----IQLEILNISLVD  84

Query  413  QTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNS--LFTQNSTV  240
              +  ++ V    + SA     ++G  L GSPF  S   N  +  GC N+  L    +T+
Sbjct  85   GIVRIVQPVSPL-NCSAEMRRQSSGKALLGSPFTISAVHNSVIVLGCRNTVWLLANETTI  143

Query  239  VAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKRCNSA  60
            V GCTAIC  N  S    C G+ CC+  +P  L      +     +S+  ++N   C  A
Sbjct  144  VGGCTAICSEN--STDIRCNGVSCCQITIPRGLQELQFTY-----RSNEFSNNSTFCGYA  196

Query  59   FLIDQRW  39
            F+ +Q+W
Sbjct  197  FVAEQKW  203



>ref|XP_006368665.1| hypothetical protein POPTR_0001s07540g [Populus trichocarpa]
 gb|ERP65234.1| hypothetical protein POPTR_0001s07540g [Populus trichocarpa]
Length=657

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 69/197 (35%), Positives = 109/197 (55%), Gaps = 24/197 (12%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSA--PPKAYLNSFVQIELQGEVVAVSL  420
            C + CGN+SIPFPFGIG GC +N WF V+C+ ++A  P +A+L+S     +  EV+ +SL
Sbjct  6    CAETCGNISIPFPFGIGTGCYMNNWFSVDCNETTAGSPSRAFLSS-----INMEVLEISL  60

Query  419  ENQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN-SLFTQNST  243
            E+ T+     +++     AGR A     +++ SPF +S S N F   GC N +L      
Sbjct  61   EDSTVRVYSPIIS--SGCAGRGA-NLAINMTTSPFAFSSS-NIFTAMGCNNLALLNGIEP  116

Query  242  VVAGCTAICGA-NISSGFAG-------CYGIDCCETPVPFDLTSYTANFTNSGIQSDGSN  87
             + GCT+ CGA N++S  +        C G +CC+T +P  L  + A+    G      N
Sbjct  117  EIVGCTSTCGANNLTSNSSAEGKENSYCSGNNCCQTTIPSSLQVFNASL---GTPEHPIN  173

Query  86   DNLK-RCNSAFLIDQRW  39
            D  + +C +AF++++ W
Sbjct  174  DQGRNQCKAAFIVEEEW  190



>ref|XP_006368667.1| hypothetical protein POPTR_0001s07560g [Populus trichocarpa]
 gb|ERP65236.1| hypothetical protein POPTR_0001s07560g [Populus trichocarpa]
Length=319

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 106/196 (54%), Gaps = 23/196 (12%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSA--PPKAYLNSFVQIELQGEVVAVSL  420
            C   CGN+SIPFPFGIG GC +N WF V+C+ ++A  P +A+L+      +  E + +SL
Sbjct  62   CIDTCGNISIPFPFGIGTGCYMNDWFSVDCNKTTADSPSRAFLS-----RINMEFLGISL  116

Query  419  ENQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN-SLFTQNST  243
            E++ +     +++     AGR A     +++ SPF +S S N+F   GC N +L TQ   
Sbjct  117  EDRVVRVNSPIIS--SGCAGRGA-NLAINMTRSPFAFSSS-NRFAAMGCNNHALLTQIQP  172

Query  242  VVAGC-TAICGANISSGFAG-------CYGIDCCETPVPFDLTSYTANFTNSGIQSDGSN  87
             + GC T+ C AN  + F+        C G +CC+T +P +L  + A+    G   D ++
Sbjct  173  EIVGCTTSTCSANNLTSFSTEGKENCYCSGNNCCQTSIPSNLQVFNASL---GPTEDPND  229

Query  86   DNLKRCNSAFLIDQRW  39
                +C  AF++D  W
Sbjct  230  QGRNQCKLAFIVDGEW  245



>ref|XP_011078223.1| PREDICTED: wall-associated receptor kinase-like 8 [Sesamum indicum]
Length=714

 Score =   104 bits (260),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 93/187 (50%), Gaps = 15/187 (8%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C+  CGNV+IP+PFGIG  C  N  F V CDNS+ P + +L+S     +Q E++ +SL  
Sbjct  15   CQDTCGNVTIPYPFGIGSECYANSSFAVVCDNSTNPARLHLSS-----IQLEILDISLHG  69

Query  413  QTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQ--NSTV  240
                  +     C D     ++  G  L GSPF  S  +N     GC NS++ +   +T+
Sbjct  70   TVRVVQRVFPMTCSDEQKTQSL--GKSLVGSPFTISSIQNSLTVLGCRNSVWLRANKTTI  127

Query  239  VAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKRCNSA  60
              GC A+C  N  S    C GI+CC+  +P  L      + +  I +D +N     C  A
Sbjct  128  TGGCMALCDYN--SRDTSCNGINCCKITIPMGLQELQVTYQS--IANDKNNTPF--CGYA  181

Query  59   FLIDQRW  39
            FL D +W
Sbjct  182  FLADMKW  188



>emb|CBI29387.3| unnamed protein product [Vitis vinifera]
Length=392

 Score =   102 bits (253),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 65/190 (34%), Positives = 93/190 (49%), Gaps = 16/190 (8%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGE-GCALNPWFLVNCDNSSAP--PKAYLNSFVQIELQGEVVAVS  423
            C + CG+V IP+PFGIG  GC  + WF V C+NS  P  PK +L       L  EV+ VS
Sbjct  62   CLETCGDVDIPYPFGIGSAGCYFDEWFEVTCNNSIHPHIPKPFLKI-----LNLEVLNVS  116

Query  422  LENQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN-SLFTQNS  246
            L   TI     V+ + + S       +     G PF +S +  +F   GC   +  TQN 
Sbjct  117  LNRSTIRVNNPVLGYMNCSG--KPSNDAQSWEGGPFSFSDTYTRFTAVGCSTLAYITQND  174

Query  245  TVVAGCTAICGANISSGFAG-CYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKRC  69
            +V+ GC + C    ++   G CYG+ CC+T  P  L  +T    +    SD  ++    C
Sbjct  175  SVIGGCMSYCKQGTTAAKNGSCYGLKCCQTQFPPGLQYFTTMLGDFPSNSDDQDE----C  230

Query  68   NSAFLIDQRW  39
              AF++DQ W
Sbjct  231  KYAFMVDQEW  240



>emb|CDP11259.1| unnamed protein product [Coffea canephora]
Length=640

 Score =   104 bits (259),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 65/200 (33%), Positives = 99/200 (50%), Gaps = 49/200 (25%)
 Frame = -2

Query  593  CEQRC-GN-VSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSL  420
            C + C GN V+IP+PFGIG  CA+N  ++V C++S A                       
Sbjct  342  CNETCAGNAVTIPYPFGIGRDCAMNESYIVTCNHSFA-----------------------  378

Query  419  ENQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQN--S  246
                        N  + ++ +  ++   + + SPF+YSK  NK +  GCGN+L  Q+  +
Sbjct  379  ------------NSSNATSSKPCLSQVANSTWSPFFYSKDDNKLMLFGCGNALLNQDPDN  426

Query  245  TVVAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKRCN  66
             V++GCT++C   I+S   GCYGI+CC T VPF +  Y  N+T +   +         C 
Sbjct  427  QVLSGCTSMC--QINSSITGCYGINCCATSVPFYINKYQLNYTITNFNNS--------CA  476

Query  65   SAFLIDQRWIPKQSTSLFLE  6
            SAFL DQ W P + +  F+ 
Sbjct  477  SAFLADQSWTPGRLSEPFIR  496



>emb|CAN64180.1| hypothetical protein VITISV_007798 [Vitis vinifera]
Length=264

 Score =   100 bits (250),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 60/167 (36%), Positives = 87/167 (52%), Gaps = 15/167 (9%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQG-EVVAVSLE  417
            C    G+VSIP+PFG+G+ C LN WF +NC++S+         F    L G +V ++SLE
Sbjct  31   CNDASGSVSIPYPFGVGKDCYLNEWFSINCNHSTP-------FFTHPNLNGSQVSSISLE  83

Query  416  NQTITTLKSVVNFCD-DSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN-SLFTQNST  243
             QT+    + V+FC    +    + +  DL G+PF +SK  N    +GCGN SL ++   
Sbjct  84   GQTVVVQIATVDFCKLPESQHTQVLDRVDLEGNPFLFSKKGNAVSVSGCGNVSLLSRQDK  143

Query  242  VVAGCTAICGANISSGF-----AGCYGIDCCETPVPFDLTSYTANFT  117
            V+AGC+ IC    ++         C GI+CC T  P  L  Y    T
Sbjct  144  VLAGCSTICDNTSTAAVYPFANGSCTGINCCRTTPPSPLNFYHLKTT  190



>ref|XP_007217680.1| hypothetical protein PRUPE_ppa021669mg, partial [Prunus persica]
 gb|EMJ18879.1| hypothetical protein PRUPE_ppa021669mg, partial [Prunus persica]
Length=612

 Score =   103 bits (257),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 67/201 (33%), Positives = 99/201 (49%), Gaps = 25/201 (12%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIG--EGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSL  420
            CE  CG+V+IP+PFGIG    C L  WF + CD ++ PP+ +L    ++EL    + +S+
Sbjct  10   CETHCGDVTIPYPFGIGPSSNCYLYDWFEIECDYTTIPPRPFLR-LAKLEL----LNISI  64

Query  419  ENQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQ-NST  243
            +  T+     V  F      R    N   L+GSPF YS+  N+     CG  L  + +  
Sbjct  65   DG-TLWVNNPVTFFYGGKGIRKVAPN---LTGSPFVYSERYNRLTAVSCGFFLVVRSDEN  120

Query  242  VVAGCTAICGANISS-GFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDN-----  81
            VV GC + C  N  S G  GC GI+CC+T +P  LT+ T        ++ G ND+     
Sbjct  121  VVGGCMSTCDKNYHSRGNYGCIGINCCQTTLPAYLTAITIELQAENEEATGGNDHMGMGT  180

Query  80   -------LKRCNSAFLIDQRW  39
                   +   N AF++D+ W
Sbjct  181  GTRTGMGMDDYNYAFMVDRDW  201



>ref|XP_002297682.1| kinase family protein [Populus trichocarpa]
 gb|EEE82487.1| kinase family protein [Populus trichocarpa]
Length=741

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 70/200 (35%), Positives = 110/200 (55%), Gaps = 28/200 (14%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSA--PPKAYLNSFVQIELQGEVVAVSL  420
            C + CGN+SI FPFGIG GC++N WF V+C+ ++A  P +A+L+      +  EV+ +SL
Sbjct  31   CTETCGNISISFPFGIGTGCSMNDWFSVDCNKTTADSPSRAFLS-----RINMEVLEISL  85

Query  419  ENQTITTLKS----VVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN-SLFT  255
               TI  ++     + + C  S    AI    +++GSPF +S S N F+  GC N +L +
Sbjct  86   GYSTIPLVRVNSPIISSGCAGSGANLAI----NMTGSPFAFSSS-NIFIAMGCNNRALLS  140

Query  254  QNSTVVAGCTAICGAN--ISSGFAG-----CYGIDCCETPVPFDLTSYTANFTNSGIQSD  96
            +    + GCT+ CGAN   SS   G     C G +CC+T +P  L  + A+    G    
Sbjct  141  RIEPEIVGCTSTCGANNLTSSSAEGKENSYCSGNNCCQTTIPSSLQVFDASL---GTPEH  197

Query  95   GSNDNLK-RCNSAFLIDQRW  39
              ND  + +C +AF++++ W
Sbjct  198  PINDQGRNQCKTAFIVEEEW  217



>ref|XP_011013612.1| PREDICTED: wall-associated receptor kinase-like 22 [Populus euphratica]
Length=738

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 64/195 (33%), Positives = 102/195 (52%), Gaps = 22/195 (11%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSA--PPKAYLNSFVQIELQGEVVAVSL  420
            C + CGN+SIPFPFGIG GC++N WF V+C+ ++A    +A+L       +  EV+ + L
Sbjct  31   CAETCGNISIPFPFGIGTGCSMNDWFSVDCNKTTADSSSRAFLR-----RINMEVLGIPL  85

Query  419  ENQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN-SLFTQNST  243
              + +     +++      G N   N   ++GSPF +S S N F   GC N +L  +   
Sbjct  86   GERWVRVNSPIISSGCSGRGANLAIN---MTGSPFAFSSS-NSFAAMGCNNRALLNRIEP  141

Query  242  VVAGCTAICGAN-----ISSGFAGCY--GIDCCETPVPFDLTSYTANFTNSGIQSDGSND  84
             + GC + CGAN      + G   CY  G +CC+T +P DL  + A+   +    D ++ 
Sbjct  142  EIVGCKSTCGANNLTSSSTEGKENCYCSGNNCCQTRIPSDLQVFNASLETT---EDPNDH  198

Query  83   NLKRCNSAFLIDQRW  39
               +C  AF++D+ W
Sbjct  199  GRNQCKVAFIVDREW  213



>ref|XP_004964206.1| PREDICTED: wall-associated receptor kinase 5-like [Setaria italica]
Length=752

 Score =   103 bits (257),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 63/169 (37%), Positives = 89/169 (53%), Gaps = 17/169 (10%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCA---LNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVS  423
            C  +CG+VSIP+PFGIGE CA   +N +F+V C+++  PP+  +   V      EV  +S
Sbjct  36   CPDKCGDVSIPYPFGIGEQCAARSINSYFIVTCNDTFQPPRPTVGEAVV-----EVTNIS  90

Query  422  LENQTITTLKSVVNFC-DDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFT---  255
            LE   +  L  + + C   S     +  G +L  +PF  S SRN+F   GC N+L     
Sbjct  91   LEYGEMRVLSPISHICFTSSTSFTKLIGGYELQSTPFLPSPSRNRFTAIGC-NTLGLIGG  149

Query  254  ---QNSTVVAGCTAIC-GANISSGFAGCYGIDCCETPVPFDLTSYTANF  120
                 S  VAGC + C G N +S  A C G+ CCE  +P +LTS+   F
Sbjct  150  YQGAASQYVAGCYSYCEGVNSTSDGAPCAGMGCCEAAIPANLTSFGVMF  198



>ref|XP_010688575.1| PREDICTED: wall-associated receptor kinase-like 2 [Beta vulgaris 
subsp. vulgaris]
Length=723

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 68/203 (33%), Positives = 95/203 (47%), Gaps = 12/203 (6%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVV---AVS  423
            CE RCGNVSIP+PFGIG  C  NPWF V C   S        + +   + G  +    V 
Sbjct  41   CEDRCGNVSIPYPFGIGPNCYHNPWFDVECWLESDGFLMKWTTELDFIISGSQINWDPVK  100

Query  422  LENQTITTLKSVVNFC----DDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFT  255
             E +T  T      FC     D           +L+GSPF +S+ RN  L +GCG  +  
Sbjct  101  GE-RTFVTTNPCHGFCISRESDDTSHLMEKPSYNLTGSPFLFSRKRNVLLVSGCGGGVLL  159

Query  254  QNSTV--VAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDN  81
            +N  +  VAGC A+C  N S+    CYG+ CC+T   + +  Y   F N  +    ++ +
Sbjct  160  RNKNMQTVAGCAAVC-INRSAPGKECYGVGCCQTTFSYSIDYYDFEFVNMALARPTNDLS  218

Query  80   LKR-CNSAFLIDQRWIPKQSTSL  15
                C  A L+D  WI  +S  +
Sbjct  219  YSSPCTYAVLVDSTWIINKSKDI  241



>ref|XP_010648088.1| PREDICTED: wall-associated receptor kinase-like 1 [Vitis vinifera]
Length=771

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 65/190 (34%), Positives = 94/190 (49%), Gaps = 16/190 (8%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGE-GCALNPWFLVNCDNSSAP--PKAYLNSFVQIELQGEVVAVS  423
            C + CG+V IP+PFGIG  GC  + WF V C+NS  P  PK +L       L  EV+ VS
Sbjct  62   CLETCGDVDIPYPFGIGSAGCYFDEWFEVTCNNSIHPHIPKPFLKI-----LNLEVLNVS  116

Query  422  LENQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN-SLFTQNS  246
            L   TI     V+ + + S   +   +     G PF +S +  +F   GC   +  TQN 
Sbjct  117  LNRSTIRVNNPVLGYMNCSGKPS--NDAQSWEGGPFSFSDTYTRFTAVGCSTLAYITQND  174

Query  245  TVVAGCTAICGANISSGFAG-CYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKRC  69
            +V+ GC + C    ++   G CYG+ CC+T  P  L  +T    +    SD  ++    C
Sbjct  175  SVIGGCMSYCKQGTTAAKNGSCYGLKCCQTQFPPGLQYFTTMLGDFPSNSDDQDE----C  230

Query  68   NSAFLIDQRW  39
              AF++DQ W
Sbjct  231  KYAFMVDQEW  240



>ref|XP_007216176.1| hypothetical protein PRUPE_ppa015763mg, partial [Prunus persica]
 gb|EMJ17375.1| hypothetical protein PRUPE_ppa015763mg, partial [Prunus persica]
Length=664

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 69/196 (35%), Positives = 96/196 (49%), Gaps = 23/196 (12%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIG--EGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSL  420
            CE  CG+VSIP+PFGIG    C L  WF + CDNS++PPK +L        + EV+ +S+
Sbjct  18   CETHCGDVSIPYPFGIGPSSNCYLYDWFEIECDNSTSPPKPFLRL-----AKLEVLNISI  72

Query  419  ENQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQ-NST  243
               T+     V  F      R  + N   L+GSPF YS   N+     CG  L    + T
Sbjct  73   YG-TLRVNNPVTFFYGGRGIRKVLQN---LTGSPFVYSWRYNRLTAVSCGIFLAVMLDET  128

Query  242  VVAGCTAICG-ANISSGFAGCYGIDCCETPVPFDLTSYTANF-------TNSGIQSDGSN  87
            VV GC + C   +      GC GI+CC+T +P DL+  T          T   +++    
Sbjct  129  VVGGCMSTCDTGHFRRKNYGCIGINCCQTTLPSDLSVITIELQPESEMGTRMQMRTGTRM  188

Query  86   DNLKRCNSAFLIDQRW  39
            D+    N AF++DQ W
Sbjct  189  DDY---NYAFIVDQEW  201



>ref|XP_007216825.1| hypothetical protein PRUPE_ppa022857mg, partial [Prunus persica]
 gb|EMJ18024.1| hypothetical protein PRUPE_ppa022857mg, partial [Prunus persica]
Length=692

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 65/193 (34%), Positives = 99/193 (51%), Gaps = 18/193 (9%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIG--EGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSL  420
            CE  CG+VSIP+PFGIG    C +  WF ++CDNS++P K +L        + EV+ +S+
Sbjct  17   CETHCGDVSIPYPFGIGPSSSCYMYDWFEIHCDNSTSPHKPFLRV-----AKLEVLNISI  71

Query  419  ENQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFT---QN  249
            E   +  +K+ V F      R       +L+GSPF YS+  N+F    CG        ++
Sbjct  72   EGTLL--VKNPVTFF---FYRRKTPLAPNLTGSPFLYSQKYNRFTSVSCGFFALVRSYRD  126

Query  248  STVVAGCTAICGANISSGF-AGCYGIDCCETPVPFDLTSYTANFT--NSGIQSDGSNDNL  78
              VV GC + C  +  +    GC GI+CC+T +P  L+         +    + G++  L
Sbjct  127  ERVVGGCMSTCDKSAETAHNHGCIGINCCQTTLPQYLSVIETQIKSESEESSTSGNDRML  186

Query  77   KRCNSAFLIDQRW  39
             R N AFL++Q W
Sbjct  187  TRYNYAFLVEQDW  199



>ref|XP_009392022.1| PREDICTED: putative wall-associated receptor kinase-like 16 [Musa 
acuminata subsp. malaccensis]
Length=748

 Score =   102 bits (254),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 71/193 (37%), Positives = 100/193 (52%), Gaps = 15/193 (8%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C++ CG VSIP+PFGIG+GC     F V C+  +A P+A+L      E    V ++SL  
Sbjct  39   CKETCGGVSIPYPFGIGDGC-FREGFEVTCEVVNAIPRAFLGGR---ERNITVQSISLPQ  94

Query  413  QTITTLKSVVNFCDDSAGRNAITN--GTDLSGSPFYYSKSRNKFLFAGC---GNSLFTQN  249
               + L  +   C +S G+  + +    +L G PF  S + NKF   GC   G  L  +N
Sbjct  95   GQASMLYDIAWICFNSTGQVVVRHRSSVNLRGLPFRVSNTSNKFTTLGCNVVGILLGLEN  154

Query  248  STVVAGCTAIC--GANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLK  75
            +T  AGC + C   ANI+SG   C+G  CCET +P +L  +T  F      S   ND+  
Sbjct  155  NTYGAGCASFCFDEANIASG--SCHGTGCCETTIPEELEYFTTRFVYFVNVSSHVNDS--  210

Query  74   RCNSAFLIDQRWI  36
            RC  AF+  Q W+
Sbjct  211  RCAYAFVAGQEWL  223



>ref|XP_008380329.1| PREDICTED: wall-associated receptor kinase-like 22 [Malus domestica]
Length=725

 Score =   101 bits (252),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 75/206 (36%), Positives = 110/206 (53%), Gaps = 36/206 (17%)
 Frame = -2

Query  593  CEQRCGNV-SIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLE  417
            C   CG V  IP+PFGIG GC L+ WF + CDNS++PPK +LNS        EV+ +++E
Sbjct  36   CPSYCGQVDQIPYPFGIGTGCYLDDWFQIICDNSTSPPKPFLNS-----TGLEVLEINIE  90

Query  416  NQTITTLK--SVVNFCD---DSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN-SLFT  255
                 TLK  S V F +     +GR       +L GSPF +S+ +N+F    CG   L T
Sbjct  91   G----TLKVASPVTFSNCSHKPSGRQT----ANLEGSPFVFSQ-KNRFTSMSCGGIGLMT  141

Query  254  QNS-TVVAGCTAICGANISSGFA--GCYGIDCCETPVPFDLTSYTANF---TNSGIQSDG  93
              S + + GC +IC  + S+      C G++CC+T +P  L+++  +F   TN+      
Sbjct  142  SLSGSTIGGCLSICD-DTSNALRNNSCSGLNCCQTTIPSSLSTFRTSFGEITNA------  194

Query  92   SNDNLKRCNSAFLIDQRWIPKQSTSL  15
              +  K C  AFL+DQ W    ST++
Sbjct  195  --ERAKLCKYAFLVDQDWFTSDSTNI  218



>ref|XP_011034597.1| PREDICTED: wall-associated receptor kinase-like 22 [Populus euphratica]
Length=738

 Score =   101 bits (252),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 102/195 (52%), Gaps = 22/195 (11%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSA--PPKAYLNSFVQIELQGEVVAVSL  420
            C + CGN+SIPFPFGIG GC++N WF V+C+ ++A    +A+L       +  EV+ + L
Sbjct  31   CAETCGNISIPFPFGIGTGCSMNDWFSVDCNKTTADSSSRAFLR-----RINMEVLGIPL  85

Query  419  ENQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN-SLFTQNST  243
              + +     +++      G N   N   ++GSPF +S S N F   GC N +L  +   
Sbjct  86   GERWVRVNSPIISSGCSGRGANLAIN---MTGSPFAFSSS-NSFAAMGCNNRALLNRIEP  141

Query  242  VVAGCTAICGAN-----ISSGFAGCY--GIDCCETPVPFDLTSYTANFTNSGIQSDGSND  84
             + GC + C AN      + G   CY  G +CC+T +P DL  ++A+   +    D ++ 
Sbjct  142  EIVGCKSTCSANNLTSSSTEGKENCYCSGNNCCQTRIPSDLQVFSASLETT---EDPNDH  198

Query  83   NLKRCNSAFLIDQRW  39
               +C  AF++D+ W
Sbjct  199  GRNQCKVAFIVDREW  213



>ref|XP_008380330.1| PREDICTED: LOW QUALITY PROTEIN: wall-associated receptor kinase-like 
10 [Malus domestica]
Length=701

 Score =   101 bits (252),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 73/201 (36%), Positives = 108/201 (54%), Gaps = 28/201 (14%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C+ RCG+V IP PFGIG GC ++ WF + C NS+ P   +LN   +I+L  EV+ +S++ 
Sbjct  32   CQSRCGDVEIPHPFGIGAGCYIDDWFQITCVNSTKP---FLN---KIDL--EVLEISVKG  83

Query  413  QTITTLKSV--VNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCG-NSLFTQN--  249
                TLK V  + F  + +    I    +L GSPF +S+ +N F   GCG  ++ T N  
Sbjct  84   ----TLKVVNPITFSSNCSANKPIRQAANLEGSPFVFSQ-KNIFTAMGCGVMAMITSNSN  138

Query  248  -STVVAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKR  72
             STV AGC + C  NIS+      G+  C+TP+P+ L+++   F      +  +N     
Sbjct  139  GSTVSAGCKSECD-NISTNVKK-NGVYFCQTPIPWFLSAFNTTFQVYDDYTKSTNS----  192

Query  71   CNSAFLIDQ---RWIPKQSTS  18
            C  AFL+D    +W P  ST 
Sbjct  193  CGYAFLVDHDWFQWFPNNSTK  213



>gb|EMT09542.1| Wall-associated receptor kinase 5 [Aegilops tauschii]
Length=742

 Score =   101 bits (252),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 64/169 (38%), Positives = 88/169 (52%), Gaps = 15/169 (9%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCAL---NPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVS  423
            C  +CGNV IP+PFGIGE CA    N +F ++C+ +  PP+  +     +    EV  +S
Sbjct  18   CPDKCGNVPIPYPFGIGEHCAATSRNSYFNLSCNGTIDPPRPMVGDPGAV---AEVADIS  74

Query  422  LENQTITTLKSVVNFCDDS-AGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFT---  255
            LE+  +  L  V + C  S A     T G +L  +PF  S SRN F   GC N+L     
Sbjct  75   LEHGEMRVLSPVSHICFKSNATFTKFTRGYELDNTPFLPSPSRNHFTVIGC-NTLGLIGG  133

Query  254  ---QNSTVVAGCTAIC-GANISSGFAGCYGIDCCETPVPFDLTSYTANF  120
                 S  VAGC + C G N +S  A C G+ CCET +P +LT++   F
Sbjct  134  YKGTASQYVAGCYSYCDGVNNTSDGAPCAGMGCCETAIPANLTTFEVKF  182



>gb|ABA99844.1| Protein kinase domain containing protein, expressed [Oryza sativa 
Japonica Group]
 gb|EAZ21218.1| hypothetical protein OsJ_36871 [Oryza sativa Japonica Group]
Length=783

 Score =   101 bits (252),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 61/197 (31%), Positives = 99/197 (50%), Gaps = 19/197 (10%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGC---ALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVS  423
            C  +CGNVSIP+PFGIG GC   +L+ +F + C+++  PP+  +   +    + EV+ +S
Sbjct  59   CPGKCGNVSIPYPFGIGAGCSATSLSSYFTITCNDTFQPPRPMVRDLLS---ETEVIDIS  115

Query  422  LENQTITTLKSV--VNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGC------GN  267
            LE   +     V  + F  ++      T G  L G+PF  S +RN+F+  GC      G 
Sbjct  116  LERGEVRVYGPVSYICFSSNTTIPENHTTGFTLEGTPFVPSTTRNRFMAIGCHTLGIIGG  175

Query  266  SLFTQNSTVVAGCTAICGA-NISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGS  90
             + + ++  VAGC + C + N +S  A C G+ CCET +  DL  + A      + +  +
Sbjct  176  YMHSNSNLYVAGCYSYCQSINSTSNGAPCTGMGCCETTIIPDLKDFAAIL----VMNQSA  231

Query  89   NDNLKRCNSAFLIDQRW  39
                  C  A L++  W
Sbjct  232  VWEFNPCFYAMLVEAGW  248



>ref|XP_007216943.1| hypothetical protein PRUPE_ppa016387mg [Prunus persica]
 gb|EMJ18142.1| hypothetical protein PRUPE_ppa016387mg [Prunus persica]
Length=356

 Score = 98.6 bits (244),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 64/193 (33%), Positives = 99/193 (51%), Gaps = 18/193 (9%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIG--EGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSL  420
            CE  CG VSIP+PFGIG    C +  WF ++CDNS++P     N F+++  + EV+ +S+
Sbjct  33   CETHCGVVSIPYPFGIGPSSSCYMYDWFEIHCDNSTSPH----NPFLRVA-KLEVLNISI  87

Query  419  ENQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFT---QN  249
            E   +  +K+ V F      R       +L+GSPF YS+  N+F    CG        ++
Sbjct  88   EGTLL--VKNPVTF---FFYRRKTPLAPNLTGSPFLYSQKYNRFTSVSCGFFALVRSYRD  142

Query  248  STVVAGCTAICGANISSGF-AGCYGIDCCETPVP--FDLTSYTANFTNSGIQSDGSNDNL  78
              VV GC + C  +  +    GC GI+CC+T +P    +        +    + G++  L
Sbjct  143  ERVVGGCMSTCDKSAETAHNHGCIGINCCQTTLPQYLSVIETQIKSESEESSTSGNDRML  202

Query  77   KRCNSAFLIDQRW  39
             R N AFL++Q W
Sbjct  203  TRYNYAFLVEQDW  215



>ref|NP_001177061.1| Os12g0615000 [Oryza sativa Japonica Group]
 dbj|BAH95789.1| Os12g0615000 [Oryza sativa Japonica Group]
Length=748

 Score =   100 bits (250),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 61/197 (31%), Positives = 99/197 (50%), Gaps = 19/197 (10%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGC---ALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVS  423
            C  +CGNVSIP+PFGIG GC   +L+ +F + C+++  PP+  +   +    + EV+ +S
Sbjct  24   CPGKCGNVSIPYPFGIGAGCSATSLSSYFTITCNDTFQPPRPMVRDLLS---ETEVIDIS  80

Query  422  LENQTITTLKSV--VNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGC------GN  267
            LE   +     V  + F  ++      T G  L G+PF  S +RN+F+  GC      G 
Sbjct  81   LERGEVRVYGPVSYICFSSNTTIPENHTTGFTLEGTPFVPSTTRNRFMAIGCHTLGIIGG  140

Query  266  SLFTQNSTVVAGCTAICGA-NISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGS  90
             + + ++  VAGC + C + N +S  A C G+ CCET +  DL  + A      + +  +
Sbjct  141  YMHSNSNLYVAGCYSYCQSINSTSNGAPCTGMGCCETTIIPDLKDFAAIL----VMNQSA  196

Query  89   NDNLKRCNSAFLIDQRW  39
                  C  A L++  W
Sbjct  197  VWEFNPCFYAMLVEAGW  213



>ref|XP_004306301.1| PREDICTED: wall-associated receptor kinase-like 1-like [Fragaria 
vesca subsp. vesca]
Length=771

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 68/193 (35%), Positives = 104/193 (54%), Gaps = 18/193 (9%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIG--EGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSL  420
            C+++CGNVSIPFPFGIG  + C  + WF ++C N S   K +L        Q EV+ +S+
Sbjct  66   CQEKCGNVSIPFPFGIGPDKDCYFDEWFEIDC-NLSTRHKPFLKL-----TQLEVLNISI  119

Query  419  ENQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCG-NSLFTQNST  243
            +   +     V  FC+        +   DL+GSPF YS+ +N+F  A CG  SL + + +
Sbjct  120  KAGALQVNSPVTFFCNVKGS----SQPADLTGSPFVYSQRQNRFTAATCGFVSLVSSDQS  175

Query  242  VVAGCTAICGANISSGFAGC--YGIDCCETPVPFDLTSYTANFTNSGIQS-DGSNDN-LK  75
            VV GC +IC  +    ++     G +CC+T +P  L   TA+    G  +  G ND+ + 
Sbjct  176  VVGGCRSICDKHYIGRYSDSCDIGTNCCQTSIPPYLRVVTASIMVEGPSNMTGRNDSRMP  235

Query  74   RCNS-AFLIDQRW  39
             C+  AFL+D+ W
Sbjct  236  DCSDYAFLVDKDW  248



>ref|XP_007217163.1| hypothetical protein PRUPE_ppa002047mg [Prunus persica]
 gb|EMJ18362.1| hypothetical protein PRUPE_ppa002047mg [Prunus persica]
Length=724

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 71/214 (33%), Positives = 109/214 (51%), Gaps = 30/214 (14%)
 Frame = -2

Query  593  CEQRCGNVS-IPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLE  417
            C  +CGN++ IP+PFGIG GC L+ WF + C+NS++PPKA+LN         EV+ +SL 
Sbjct  34   CLSQCGNITQIPYPFGIGAGCYLDDWFQIICNNSASPPKAFLN-----RTGLEVLEISLG  88

Query  416  NQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN-SLFTQNSTV  240
                 T     + CD+        N   L GSPF +SKS N+F   GC   +L T   + 
Sbjct  89   GTLTVTSAITFSNCDNKKSDRQAPN---LLGSPFVFSKS-NRFTSIGCDVIALMTDQGSP  144

Query  239  VAGCTAICGANISSGFA------GCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNL  78
            + GC +IC  NI+   +       C G+ CC+T +   L+ +  +F  + +  +GS+  +
Sbjct  145  LGGCYSICD-NITHSTSTIFQNNSCSGLRCCQTTILDGLSFFNTSF--AAVLINGSDSEM  201

Query  77   KRCNSAFLIDQRW---------IPKQSTSLFLEY  3
            + C  AF++D  W         +   S  + LEY
Sbjct  202  E-CKYAFMVDHDWFMSTNISTIVDMDSVPVVLEY  234



>ref|XP_008229716.1| PREDICTED: wall-associated receptor kinase-like 22 [Prunus mume]
Length=643

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 69/199 (35%), Positives = 101/199 (51%), Gaps = 20/199 (10%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIG--EGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSL  420
            CE  CG+VSIP+PFGIG    C L  WF + CDNS++PPK +L        + EV+ +S+
Sbjct  34   CESHCGDVSIPYPFGIGPSSNCYLYDWFEIECDNSTSPPKPFLRL-----AKLEVLDISI  88

Query  419  ENQTITTLKSVVNFCDDSAG-RNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSL-FTQNS  246
            +   +  + + V F     G R  + N   L+GSPF YSK  N+     CG  L    + 
Sbjct  89   DG--MLRVNNPVTFLYGGRGIRKVLLN---LTGSPFVYSKY-NRLTAVSCGIFLAVMSDE  142

Query  245  TVVAGCTAICGANISSGF-AGCYGIDCCETPVPFDLTSYTANF---TNSGIQSDGSN-DN  81
            T+V GC + C  + S     GC GI+CC+T +P +L+  T      +  G++        
Sbjct  143  TLVGGCMSTCDKDHSRRENYGCIGINCCQTTLPSNLSVITIELQPESEMGMRMQTRRGTR  202

Query  80   LKRCNSAFLIDQRWIPKQS  24
            +   N AF++DQ W    S
Sbjct  203  MDDYNYAFIVDQEWFENNS  221



>ref|XP_007226334.1| hypothetical protein PRUPE_ppa022257mg, partial [Prunus persica]
 gb|EMJ27533.1| hypothetical protein PRUPE_ppa022257mg, partial [Prunus persica]
Length=663

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 70/200 (35%), Positives = 109/200 (55%), Gaps = 24/200 (12%)
 Frame = -2

Query  593  CEQRCGNVS-IPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQG-EVVAVSL  420
            C  RCG+V+ IP+PFGI  GC L+ WF + CDNS++PPKA+LN      + G EV+ +S+
Sbjct  37   CSSRCGSVTQIPYPFGIEAGCYLDDWFQIICDNSASPPKAFLN------VTGLEVLEISV  90

Query  419  ENQ-TITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN-SLFTQ-N  249
            E    + +  +  N  +   GR       +L GSPF +S  +N+F    CG  +L T  +
Sbjct  91   EGTLKVESPITFSNCSNKPVGRQT----PNLEGSPFVFSM-KNRFTSLSCGEIALMTSLD  145

Query  248  STVVAGCTAICGANISSGF--AGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLK  75
             + +AGC +IC  + +S      C G++CC+T +   L S+  +F   G+     N + K
Sbjct  146  GSTIAGCLSICDDSSTSYLRTKSCIGMNCCQTTITPYLRSFNTSF---GVV---LNADRK  199

Query  74   RCNSAFLIDQRWIPKQSTSL  15
             C  AFL++  W    ST++
Sbjct  200  ACKYAFLVEHDWFTSNSTNV  219



>gb|EAZ21219.1| hypothetical protein OsJ_36872 [Oryza sativa Japonica Group]
 gb|EEC69676.1| hypothetical protein OsI_39113 [Oryza sativa Indica Group]
Length=754

 Score =   100 bits (249),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 62/169 (37%), Positives = 90/169 (53%), Gaps = 14/169 (8%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCA---LNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVS  423
            C  +CGNV+IP+PFGIGE C+   LN +F + C+++  PP+  +    + E   EV  +S
Sbjct  32   CPDKCGNVAIPYPFGIGENCSATNLNSYFNLMCNDTFHPPRPQIR---EPEAHIEVTGIS  88

Query  422  LENQTITTLKSVVNFCDDSAGRNAITNGT--DLSGSPFYYSKSRNKFLFAGCGN-SLFT-  255
            LE   +  L  V + C  S   +  ++G   DLS +PF  S SRN+F   GC    L T 
Sbjct  89   LERGEMRVLSPVNHICFTSNTTSTKSSGVGYDLSRTPFLPSPSRNRFTVIGCNTLGLITG  148

Query  254  ---QNSTVVAGCTAIC-GANISSGFAGCYGIDCCETPVPFDLTSYTANF  120
                +   V GC + C G N +S  A C G+ CCE  +P +LT++   F
Sbjct  149  YRGASGQYVTGCYSYCEGINSTSDGAPCAGMGCCEASIPANLTAFAVTF  197



>ref|XP_002511965.1| kinase, putative [Ricinus communis]
 gb|EEF50634.1| kinase, putative [Ricinus communis]
Length=743

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/188 (34%), Positives = 99/188 (53%), Gaps = 22/188 (12%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C  RCGNV+IP+PFGIGEGC ++  F V C+ +S P + YL S     +  E++ VSLE+
Sbjct  32   CSDRCGNVTIPYPFGIGEGCYMDSGFAVTCNKTSLPYRPYLTS-----INLELLRVSLES  86

Query  413  QTITTLKSVVNF-CDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN-SLFTQNSTV  240
              +     V+N  C D    + ++                N+F   GC N +L  +   V
Sbjct  87   TLVRVNNPVLNSNCQDRPPVSDLSFSGSPFS-----FSDNNRFTALGCNNLALIYRQDMV  141

Query  239  VAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQS-DGSNDNLKRCNS  63
            + GC +IC  N++   + CYGI+CC+T +P  L      F N+ ++S D   D  ++C  
Sbjct  142  IGGCLSIC--NVTVTESSCYGINCCQTSIPPYL-----KFINASLRSIDPVPD--EQCRV  192

Query  62   AFLIDQRW  39
            AF++D+ W
Sbjct  193  AFMVDREW  200



>ref|XP_003594613.1| Wall-associated receptor kinase-like protein [Medicago truncatula]
 gb|AES64864.1| wall associated kinase-like protein [Medicago truncatula]
Length=712

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 71/196 (36%), Positives = 93/196 (47%), Gaps = 23/196 (12%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGE-GCALNPWFLVNC--DNSSAPPKAYLNSFVQIELQGEVVAVS  423
            C   CG +SIPFPFG+ E  C  + WF + C  DNSS  PK YL S     L  EV  V 
Sbjct  37   CNSTCGTMSIPFPFGMKEPRCYADKWFEIECKLDNSSQNPKPYLKS-----LNLEVNNVY  91

Query  422  LENQTITTLKSVVNF-CDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQ-N  249
            L+   +  +  + +  C  +     +T   +L  SPF YS+S NKFL  GC N  F Q N
Sbjct  92   LDLGMVEIMNPIYHSNCQQNINNKTVT--INLGVSPFMYSQSYNKFLAVGCNNLAFLQSN  149

Query  248  STVVAGCTAICGANISSGFAG-----CYGIDCCETPVPFDLTSYTANFTNSGIQSDGSND  84
             T V GC +IC     +         C G  CCET +P  L+ Y A F     QS     
Sbjct  150  GTTVGGCVSICDDGNFNNNFNSSNDRCNGRYCCETSLPTHLSEYNATFQGLSEQS-----  204

Query  83   NLKRCNSAFLIDQRWI  36
             + +C+ A ++   WI
Sbjct  205  -IDQCSYALILSDNWI  219



>ref|XP_006372236.1| hypothetical protein POPTR_0018s14500g [Populus trichocarpa]
 gb|ERP50033.1| hypothetical protein POPTR_0018s14500g [Populus trichocarpa]
Length=708

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 65/183 (36%), Positives = 92/183 (50%), Gaps = 14/183 (8%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDN--SSAPPKAYLNSFVQIELQGEVVAVSL  420
            CE  CG++ IP+P+G+  GC     F + C+N  S   PK  +N         EV  +S+
Sbjct  31   CESYCGDIRIPYPYGMKAGCYQEERFKILCNNYSSGVLPKLTVNG-----TDLEVRYISV  85

Query  419  ENQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN-SLFTQNST  243
             + TI  +  +V        RN +    DL GSPF +S S N F+  GC N +L TQN +
Sbjct  86   YDSTIQVMFPIVFANCSGKDRNTVV---DLEGSPFVFS-SENYFIARGCDNLALMTQNQS  141

Query  242  VVAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKRCNS  63
             + GC +IC  N  S  A C GI CC+T +P  L  +  N T  G+     +   K+C S
Sbjct  142  TIGGCVSICDENSDSMRASCSGIHCCQTRIPSFLKVF--NVTMKGLDDGKGSSGEKQCRS  199

Query  62   AFL  54
            A+L
Sbjct  200  AYL  202



>ref|XP_002297684.2| wall-associated kinase family protein [Populus trichocarpa]
 gb|EEE82489.2| wall-associated kinase family protein [Populus trichocarpa]
Length=711

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 64/190 (34%), Positives = 100/190 (53%), Gaps = 17/190 (9%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSA--PPKAYLNSFVQIELQGEVVAVSL  420
            C + CGN++IPFPFGIG GC +N WF V+C+ ++A  P +A+L+      +  EV  +SL
Sbjct  32   CTETCGNITIPFPFGIGTGCYMNDWFSVHCNETTADSPSRAFLS-----RINMEVFKISL  86

Query  419  ENQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN-SLFTQNST  243
            E+  +     +++      G N   N   ++GSPF +S S N F   GC N +L      
Sbjct  87   ESSVVRVNSPIISSGCSGRGANLAIN---MTGSPFSFSSS-NIFTAMGCNNRALLNGIEP  142

Query  242  VVAGCTAICGANISSGF-AGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLK-RC  69
             + GCT+ CGA+      + C G +CC+T +P  L    A+    G      ND  + +C
Sbjct  143  EIVGCTSTCGASTEGKENSYCSGNNCCQTTIPSSLQVVNASL---GTPEHPINDQGRNQC  199

Query  68   NSAFLIDQRW  39
              AF++ ++W
Sbjct  200  KVAFIVQEKW  209



>ref|XP_006368666.1| hypothetical protein POPTR_0001s07550g [Populus trichocarpa]
 gb|ERP65235.1| hypothetical protein POPTR_0001s07550g [Populus trichocarpa]
Length=701

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 65/198 (33%), Positives = 105/198 (53%), Gaps = 24/198 (12%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSA--PPKAYLNSFVQIELQGEVVAVSL  420
            C + CGN+SIPFPFGIG GC +N WF V+C+ ++A  P +A+L+      +  EV+ +S+
Sbjct  6    CTETCGNISIPFPFGIGAGCYMNDWFSVDCNKTTADSPSRAFLS-----RINMEVLEISI  60

Query  419  ENQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN-SLFTQNST  243
             + +     +        +GR A  +  +++GSPF +S S N F   GC N +L      
Sbjct  61   RDMSNMVRVNSPIISSGCSGRGA-NSAINMTGSPFAFSSS-NIFTAMGCNNRALLNGIEP  118

Query  242  VVAGCTAICGA-NISSGFAG-------CYGIDCCETPVPFDLTSYTANF--TNSGIQSDG  93
             + GCT+ CGA N++S  +        C G +CC+T +P  L  + A+    +  I   G
Sbjct  119  EIVGCTSTCGANNLTSNSSAEGKENSYCSGNNCCQTTIPSSLQVFNASLGTPDHPINDQG  178

Query  92   SNDNLKRCNSAFLIDQRW  39
             N+    C  AF++++ W
Sbjct  179  RNE----CKVAFIVEEEW  192



>ref|XP_010237018.1| PREDICTED: wall-associated receptor kinase 5-like [Brachypodium 
distachyon]
Length=743

 Score = 99.8 bits (247),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 58/172 (34%), Positives = 90/172 (52%), Gaps = 15/172 (9%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCA---LNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVS  423
            C  +CGNVSIP+PFGIG+GCA   ++ +F V C+N+  PP+  +   +   +QGEV+ +S
Sbjct  19   CPDKCGNVSIPYPFGIGDGCAATNISRYFSVTCNNTFEPPRPVVGGPL---MQGEVIDIS  75

Query  422  LENQTITTLKSVVNFCDDSAGRNAITNGTDLS--GSPFYYSKSRNKFLFAGC------GN  267
            L +  +     +   C  S         ++ S  G+PF  S +RN+F   GC      G 
Sbjct  76   LVSGEMRIYGPISYSCFTSNTTTPDNKSSEFSLEGTPFVPSATRNRFTVIGCSTLGLIGG  135

Query  266  SLFTQNSTVVAGCTAIC-GANISSGFAGCYGIDCCETPVPFDLTSYTANFTN  114
            S+    +  V GC + C G N +S  A C G+ CCET +  ++ ++T    N
Sbjct  136  SIHGDANPYVTGCYSYCHGLNSTSDGAPCTGMGCCETTIVPNIINFTTTLLN  187



>ref|XP_003594614.1| Wall-associated receptor kinase-like protein [Medicago truncatula]
 gb|AES64865.1| wall associated kinase-like protein [Medicago truncatula]
Length=726

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 99/199 (50%), Gaps = 28/199 (14%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGE-GCALNPWFLVNC--DNSSAPPKAYLNSFVQIELQGEVVAVS  423
            C   CG +SIPFPFG+ E  C  + WF + C  DN+S  PK YL S     L  EV    
Sbjct  37   CNSTCGTMSIPFPFGMKEPRCYADKWFEIECKLDNNSQNPKPYLKS-----LNLEVNNFY  91

Query  422  LENQTITTLKSVVNFCDDSAGRNAITNGT---DLSGSPFYYSKSRNKFLFAGCGNSLFTQ  252
            L+      L  ++N       R    N T   +L G PF YS+  NKFL  GC N  F Q
Sbjct  92   LD----LGLVEIMNPIHRPNCRKYNNNKTVIINLGGGPFIYSQDYNKFLAVGCNNLAFIQ  147

Query  251  NS-TVVAGCTAICGA-NISSGF-----AGCYGIDCCETPVPFDLTSYTANFTNSGIQSDG  93
            +S  +V GC +IC   NI+S +      GC G  CCET +P  L+ Y A  T  G++   
Sbjct  148  SSGNMVGGCVSICDDNNINSNYFNLSSDGCNGRYCCETSLPMHLSEYNA--TLQGLRG--  203

Query  92   SNDNLKRCNSAFLIDQRWI  36
               N+  C+ A ++ +RW+
Sbjct  204  --PNISECSYALILSRRWV  220



>ref|XP_008222637.1| PREDICTED: wall-associated receptor kinase-like 8 [Prunus mume]
Length=726

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 69/200 (35%), Positives = 108/200 (54%), Gaps = 24/200 (12%)
 Frame = -2

Query  593  CEQRCGNVS-IPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQG-EVVAVSL  420
            C  +CG+V+ IP+PFGI  GC L+ WF + CDNS++PPKA+LN      + G EV+ +S+
Sbjct  28   CSSQCGSVTQIPYPFGIEAGCYLDGWFQIICDNSASPPKAFLN------VTGLEVLEISV  81

Query  419  ENQ-TITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN-SLFTQ-N  249
            E    + +  +  N  +  AGR       +L GSPF +S  +N+F    CG+ +L T  +
Sbjct  82   EGTLKVESPITFSNCSNKPAGRQT----PNLEGSPFVFSM-KNRFTSLSCGDIALMTSLD  136

Query  248  STVVAGCTAICGANISSGF--AGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLK  75
             + +AGC +IC    +S      C G++CC+T +   L S+  +F          N + K
Sbjct  137  GSTIAGCLSICDYTSTSYLRTKSCIGMNCCQTTITPYLRSFNTSFGAV------LNADRK  190

Query  74   RCNSAFLIDQRWIPKQSTSL  15
             C  AFL++  W    ST++
Sbjct  191  ACKYAFLVEHDWFTSNSTNV  210



>ref|XP_008229719.1| PREDICTED: wall-associated receptor kinase-like 1 [Prunus mume]
Length=677

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 64/193 (33%), Positives = 99/193 (51%), Gaps = 18/193 (9%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIG--EGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSL  420
            CE  CG+VSIP+PFGIG    C +  WF ++CDNS++P K +L +      + EV+ +S+
Sbjct  27   CETHCGDVSIPYPFGIGPSSSCYMYDWFEIHCDNSTSPHKPFLRA-----AKLEVLNISI  81

Query  419  ENQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFT---QN  249
            E   +  +K+ V F  +  GR       +L GSPF YS+  N+F    CG         +
Sbjct  82   EGTLL--VKNPVTFFFN--GRKT-PQAPNLMGSPFLYSQKYNRFTAVSCGFFALVRSYHD  136

Query  248  STVVAGCTAICGANISSGF-AGCYGIDCCETPVPFDLT--SYTANFTNSGIQSDGSNDNL  78
              VV GC + C  +  +    GC GI+CC+T +P +L+         +    + G++  L
Sbjct  137  QRVVGGCMSTCDKSAETAHNHGCIGINCCQTTLPQNLSVIETEIKSESEESSTSGNDRML  196

Query  77   KRCNSAFLIDQRW  39
               N AFL++  W
Sbjct  197  APYNYAFLVEHDW  209



>ref|XP_009376845.1| PREDICTED: wall-associated receptor kinase-like 8 isoform X1 
[Pyrus x bretschneideri]
Length=734

 Score = 98.6 bits (244),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 64/197 (32%), Positives = 98/197 (50%), Gaps = 13/197 (7%)
 Frame = -2

Query  593  CEQRCGN--VSIPFPFGIGEGCALNPWFLVNCDNSSAP-PKAYLNSFVQIEL-QGEVVAV  426
            C   CG   + IP+PFGIG GC +N WF + CDNS+   P+  +       L Q EV+ +
Sbjct  35   CPTDCGTDTIPIPYPFGIGAGCFMNEWFEITCDNSTNNFPRRPIPRLNHASLKQLEVLNL  94

Query  425  SLENQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQNS  246
            S++  T++    +  F D   GR       +L+GSPF +SK RN+ +   CG   + +  
Sbjct  95   SMDG-TLSVRNPITFFSDCGTGRPLAEQAPNLTGSPFVFSK-RNRLVSVSCGGITWMELM  152

Query  245  TVVAGCTAICG--ANISSGFAG---CYGIDCCETPVPFDLTSYTANFTNSGIQSD--GSN  87
                GC + CG   ++     G   C GI+CC+TP+P +LT +  +F      S    + 
Sbjct  153  KGSTGCLSTCGDKGDLLEQVYGPDTCNGINCCQTPIPGNLTHFNTSFQEVKDPSKSSDTT  212

Query  86   DNLKRCNSAFLIDQRWI  36
                 C  AFL+D+ W+
Sbjct  213  SGSGSCKYAFLVDEAWV  229



>ref|XP_009376860.1| PREDICTED: wall-associated receptor kinase-like 22 isoform X3 
[Pyrus x bretschneideri]
Length=699

 Score = 98.6 bits (244),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 64/197 (32%), Positives = 98/197 (50%), Gaps = 13/197 (7%)
 Frame = -2

Query  593  CEQRCGN--VSIPFPFGIGEGCALNPWFLVNCDNSSAP-PKAYLNSFVQIEL-QGEVVAV  426
            C   CG   + IP+PFGIG GC +N WF + CDNS+   P+  +       L Q EV+ +
Sbjct  35   CPTDCGTDTIPIPYPFGIGAGCFMNEWFEITCDNSTNNFPRRPIPRLNHASLKQLEVLNL  94

Query  425  SLENQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQNS  246
            S++  T++    +  F D   GR       +L+GSPF +SK RN+ +   CG   + +  
Sbjct  95   SMDG-TLSVRNPITFFSDCGTGRPLAEQAPNLTGSPFVFSK-RNRLVSVSCGGITWMELM  152

Query  245  TVVAGCTAICG--ANISSGFAG---CYGIDCCETPVPFDLTSYTANFTNSGIQSD--GSN  87
                GC + CG   ++     G   C GI+CC+TP+P +LT +  +F      S    + 
Sbjct  153  KGSTGCLSTCGDKGDLLEQVYGPDTCNGINCCQTPIPGNLTHFNTSFQEVKDPSKSSDTT  212

Query  86   DNLKRCNSAFLIDQRWI  36
                 C  AFL+D+ W+
Sbjct  213  SGSGSCKYAFLVDEAWV  229



>ref|XP_008229609.1| PREDICTED: wall-associated receptor kinase-like 1 isoform X1 
[Prunus mume]
Length=745

 Score = 98.6 bits (244),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 68/198 (34%), Positives = 100/198 (51%), Gaps = 19/198 (10%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIG--EGCALNPWFLVNCDNSSAP--PKAYLNSFVQIELQGEVVAV  426
            C++ CG+V IP+PFGIG  + C L+ WF ++C N S+     A     V    Q EV+ +
Sbjct  34   CQEYCGDVLIPYPFGIGSNKHCYLDDWFEMDCSNQSSKTTSSAPHYKLVLKRAQLEVLNI  93

Query  425  SLENQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCG-NSLFTQN  249
            S+   T+     V  FC+     N  +   DL+GSPF YS+ +N+F    CG  +     
Sbjct  94   SIRG-TLRVNSPVTKFCNG----NGSSQMADLTGSPFVYSQDKNRFTAVSCGFLAGMVSA  148

Query  248  STVVAGCTAICGANISSGFAGC-YGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKR  72
              VV GC ++C    S   A C  GI+CC+T +P  LT   A+    G   D S D+   
Sbjct  149  EFVVGGCRSVCDHKKS---ASCDIGINCCQTTIPPYLTMIGASILYQGETRDSSCDDY--  203

Query  71   CNSAFLIDQRWIPKQSTS  18
               AFL+D+ W  + S++
Sbjct  204  ---AFLVDKDWFERSSSA  218



>ref|XP_008229610.1| PREDICTED: wall-associated receptor kinase-like 1 isoform X2 
[Prunus mume]
Length=706

 Score = 98.6 bits (244),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 68/198 (34%), Positives = 100/198 (51%), Gaps = 19/198 (10%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIG--EGCALNPWFLVNCDNSSAP--PKAYLNSFVQIELQGEVVAV  426
            C++ CG+V IP+PFGIG  + C L+ WF ++C N S+     A     V    Q EV+ +
Sbjct  34   CQEYCGDVLIPYPFGIGSNKHCYLDDWFEMDCSNQSSKTTSSAPHYKLVLKRAQLEVLNI  93

Query  425  SLENQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCG-NSLFTQN  249
            S+   T+     V  FC+     N  +   DL+GSPF YS+ +N+F    CG  +     
Sbjct  94   SIRG-TLRVNSPVTKFCNG----NGSSQMADLTGSPFVYSQDKNRFTAVSCGFLAGMVSA  148

Query  248  STVVAGCTAICGANISSGFAGC-YGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKR  72
              VV GC ++C    S   A C  GI+CC+T +P  LT   A+    G   D S D+   
Sbjct  149  EFVVGGCRSVCDHKKS---ASCDIGINCCQTTIPPYLTMIGASILYQGETRDSSCDDY--  203

Query  71   CNSAFLIDQRWIPKQSTS  18
               AFL+D+ W  + S++
Sbjct  204  ---AFLVDKDWFERSSSA  218



>ref|XP_009376854.1| PREDICTED: wall-associated receptor kinase-like 8 isoform X2 
[Pyrus x bretschneideri]
Length=722

 Score = 98.6 bits (244),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 64/197 (32%), Positives = 98/197 (50%), Gaps = 13/197 (7%)
 Frame = -2

Query  593  CEQRCGN--VSIPFPFGIGEGCALNPWFLVNCDNSSAP-PKAYLNSFVQIEL-QGEVVAV  426
            C   CG   + IP+PFGIG GC +N WF + CDNS+   P+  +       L Q EV+ +
Sbjct  35   CPTDCGTDTIPIPYPFGIGAGCFMNEWFEITCDNSTNNFPRRPIPRLNHASLKQLEVLNL  94

Query  425  SLENQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQNS  246
            S++  T++    +  F D   GR       +L+GSPF +SK RN+ +   CG   + +  
Sbjct  95   SMDG-TLSVRNPITFFSDCGTGRPLAEQAPNLTGSPFVFSK-RNRLVSVSCGGITWMELM  152

Query  245  TVVAGCTAICG--ANISSGFAG---CYGIDCCETPVPFDLTSYTANFTNSGIQSD--GSN  87
                GC + CG   ++     G   C GI+CC+TP+P +LT +  +F      S    + 
Sbjct  153  KGSTGCLSTCGDKGDLLEQVYGPDTCNGINCCQTPIPGNLTHFNTSFQEVKDPSKSSDTT  212

Query  86   DNLKRCNSAFLIDQRWI  36
                 C  AFL+D+ W+
Sbjct  213  SGSGSCKYAFLVDEAWV  229



>ref|XP_003534747.2| PREDICTED: wall-associated receptor kinase-like 22-like [Glycine 
max]
Length=772

 Score = 98.6 bits (244),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 65/198 (33%), Positives = 92/198 (46%), Gaps = 24/198 (12%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEG-CALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLE  417
            C+  CG+V IP+PFG+    C    WF + C NS+ P   YL S   I L  EV++  + 
Sbjct  53   CDSGCGDVPIPYPFGMNRSDCYAGKWFEIECRNSTRP---YLKS---IGLGVEVLSFDVN  106

Query  416  NQTITTLKSVV--NFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQ-NS  246
              T+     +   N C     ++   N   L GSPF YS+  NKF+ AGC N  F +   
Sbjct  107  RGTVDINNPIYRSNNCGTKTTKHPAVNNISLEGSPFVYSQRNNKFVAAGCNNIAFLKGKG  166

Query  245  TVVAGCTAICG-----ANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDN  81
            + V+GC +IC       N + G   C G  CCE  +P  L+ YT           G N+N
Sbjct  167  SAVSGCVSICDNDDDVGNTNLGTIECNGESCCENSLPMYLSEYTPEIK-------GLNEN  219

Query  80   LK--RCNSAFLIDQRWIP  33
             K   C+ A ++  +  P
Sbjct  220  KKGNHCSYAMIVQNQPNP  237



>ref|XP_007147589.1| hypothetical protein PHAVU_006G137300g [Phaseolus vulgaris]
 gb|ESW19583.1| hypothetical protein PHAVU_006G137300g [Phaseolus vulgaris]
Length=704

 Score = 98.2 bits (243),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 56/184 (30%), Positives = 93/184 (51%), Gaps = 9/184 (5%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEG-CALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLE  417
            CE +CG+VSIPFPFG+    C    WF + C N+S+        +++  +  EV++  L 
Sbjct  34   CEWQCGDVSIPFPFGMKSSKCYAGKWFEIECRNTSSYNNYSHTPYLK-SIGVEVISFDLR  92

Query  416  NQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQNSTVV  237
               +T    +  +  +   +++      L GSPF YS+  NKF+ AGC    F Q +   
Sbjct  93   RGLVTINHPI--YRSNCGSKDSPRVNQSLEGSPFVYSRKYNKFVAAGCNIMAFLQLNGSG  150

Query  236  AGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKRCNSAF  57
            +GC +IC  +   G A C G  CCE+ +P  LT Y+     + I++   N+    C+ A 
Sbjct  151  SGCVSICDEDYKVGDANCNGKSCCESSLPLYLTQYS-----TVIKALKDNETSHGCSYAM  205

Query  56   LIDQ  45
            ++++
Sbjct  206  VVEK  209



>ref|XP_010088576.1| Wall-associated receptor kinase-like 9 [Morus notabilis]
 gb|EXB36717.1| Wall-associated receptor kinase-like 9 [Morus notabilis]
Length=774

 Score = 98.2 bits (243),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 76/213 (36%), Positives = 108/213 (51%), Gaps = 29/213 (14%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVS---  423
            CEQRCGNV IPFPFGIG  C+L+ WF ++C+NS+ P + +L        Q EV+ +S   
Sbjct  46   CEQRCGNVHIPFPFGIGPNCSLDKWFEISCNNSTIPHRPFLK-----HTQWEVLHISDFY  100

Query  422  LENQTITT------LKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCG---  270
              N  I T      +K+ ++F +    + A     +L+G PFY S S + F+   CG   
Sbjct  101  TVNSEIYTFRHQFQVKNPISFFNCRGKKAA--KALNLTGMPFYLSSS-STFVAVSCGVLA  157

Query  269  --NSLFTQNSTVVAGCTAICGANISSGFAG----CYGIDCCETPVPFD-LTSYTANFTNS  111
              NS  + N+    GCT+IC  N SS  +     C GIDCCET +  D   ++   F N 
Sbjct  158  KVNSS-SGNTNSQTGCTSICSPNDSSTNSTNKTYCDGIDCCETFIRDDSFKAFEITFENR  216

Query  110  GIQSDGSNDNLKR-CNSAFLIDQRWIPKQSTSL  15
               S    D   R C  AFL+D  +    +T++
Sbjct  217  STPSVADQDPYGRDCKFAFLVDDYYWNNNNTNI  249



>gb|KHN44650.1| Wall-associated receptor kinase-like 8 [Glycine soja]
Length=719

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 68/200 (34%), Positives = 101/200 (51%), Gaps = 31/200 (16%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGE-GCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLE  417
            C   CG VSIP+PFG+ +  C  + WF + C ++S   K YL S     L  +V ++S  
Sbjct  45   CNSTCGEVSIPYPFGMKDPECYADGWFEIECKDTSQGQKPYLKS-----LNLQVTSISEF  99

Query  416  NQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQN-STV  240
               +T +  +  +  +   + A+    DL GSPF YS+  NKF+  GC N  F ++    
Sbjct  100  PGLVTIMNPIYRW--NCPSKRAMPAIKDLRGSPFVYSQESNKFVAVGCNNLAFLKSGGDT  157

Query  239  VAGCTAICGAN--------ISSGFAGCYGIDCCETPVPFDLTSYTA-----NFTNSGIQS  99
            V GC +IC  N        ISS   GC+G  CCET +P  L+ Y A     N  NS ++S
Sbjct  158  VGGCVSICDNNEEFKNMDFISSD--GCHGRYCCETSLPNYLSEYNATLQDFNNQNSSVES  215

Query  98   DGSNDNLKRCNSAFLIDQRW  39
                    +C+SAF++++ W
Sbjct  216  -------HQCSSAFIVNKYW  228



>ref|XP_010038777.1| PREDICTED: wall-associated receptor kinase-like 10 [Eucalyptus 
grandis]
Length=710

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 75/203 (37%), Positives = 109/203 (54%), Gaps = 29/203 (14%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C + CGNVSIPFPFGIG GC L+PW+ + C   S P    LN   +I L+  V+++SL N
Sbjct  31   CVETCGNVSIPFPFGIGAGCFLDPWYEIVCPYRSFP---ILN---KIGLR--VLSISLPN  82

Query  413  --QTITTLKSV---VNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQN  249
              Q +  + SV   +   + S G   +    +  GS F +S+  N F   GC N+L T N
Sbjct  83   YYQFVDGMISVSLPLISSNASCGGEGLGGPVNFEGSQFIFSQRWNVFTSVGC-NTLATVN  141

Query  248  ST--VVAGCTAIC---GANISSGFAGCYGID-CCETPVPFDLTSYTANFTNSGIQSDGSN  87
            ST   V GC + C    AN+   ++ C+G D CC+T +PF+L S++ +F   G +S G  
Sbjct  142  STESAVVGCRSKCTGTSANVVR-YSACFGRDQCCQTTLPFNLQSFSVDFKEEG-ESQG--  197

Query  86   DNLKRCNSAFLIDQRWIPKQSTS  18
                 C  AFL D+ W  + + +
Sbjct  198  -----CKYAFLADRSWFLRSNVT  215



>gb|KCW47712.1| hypothetical protein EUGRSUZ_K01459 [Eucalyptus grandis]
Length=699

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 75/203 (37%), Positives = 109/203 (54%), Gaps = 29/203 (14%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C + CGNVSIPFPFGIG GC L+PW+ + C   S P    LN   +I L+  V+++SL N
Sbjct  31   CVETCGNVSIPFPFGIGAGCFLDPWYEIVCPYRSFP---ILN---KIGLR--VLSISLPN  82

Query  413  --QTITTLKSV---VNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQN  249
              Q +  + SV   +   + S G   +    +  GS F +S+  N F   GC N+L T N
Sbjct  83   YYQFVDGMISVSLPLISSNASCGGEGLGGPVNFEGSQFIFSQRWNVFTSVGC-NTLATVN  141

Query  248  ST--VVAGCTAIC---GANISSGFAGCYGID-CCETPVPFDLTSYTANFTNSGIQSDGSN  87
            ST   V GC + C    AN+   ++ C+G D CC+T +PF+L S++ +F   G +S G  
Sbjct  142  STESAVVGCRSKCTGTSANVVR-YSACFGRDQCCQTTLPFNLQSFSVDFKEEG-ESQG--  197

Query  86   DNLKRCNSAFLIDQRWIPKQSTS  18
                 C  AFL D+ W  + + +
Sbjct  198  -----CKYAFLADRSWFLRSNVT  215



>ref|XP_010036178.1| PREDICTED: wall-associated receptor kinase-like 6 [Eucalyptus 
grandis]
Length=755

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/195 (32%), Positives = 96/195 (49%), Gaps = 17/195 (9%)
 Frame = -2

Query  596  RCEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLE  417
             C + CGNV+IPFPFG+G GC L+ W+ ++C  S+  P   LN      L     +V   
Sbjct  57   ECNETCGNVTIPFPFGVGAGCFLDEWYEIDCQQSNTVP--VLNKTGLRVLNISFPSVWGY  114

Query  416  NQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQNST--  243
               + +++  + + + S G + +       G PF +S++RN F   GC ++L T  +T  
Sbjct  115  TNGMISVRLPLIYSNASCGADGLGEPVSFEGGPFVFSQTRNVFTSVGC-DTLATVGTTES  173

Query  242  VVAGCTAICG---ANISSGFAGCYGID-CCETPVPFDLTSYTANFTNSGIQSDGSNDNLK  75
             V GC + C     NIS  ++ C G D CC++ +PFDL  ++ +F   G           
Sbjct  174  AVVGCRSKCAEISTNISWHYSTCSGRDECCQSTLPFDLQVFSVDFKEEGGHHG-------  226

Query  74   RCNSAFLIDQRWIPK  30
             C  AFL D+ W  K
Sbjct  227  -CKHAFLADRSWFLK  240



>ref|XP_003534784.1| PREDICTED: wall-associated receptor kinase-like 8-like [Glycine 
max]
Length=705

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 65/195 (33%), Positives = 99/195 (51%), Gaps = 21/195 (11%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGE-GCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLE  417
            C   CG VSIP+PFG+ +  C  + WF + C ++S   K YL S     L  +V ++S  
Sbjct  31   CNSTCGEVSIPYPFGMKDPECYADGWFEIECKDTSQGQKPYLKS-----LNLQVTSISDF  85

Query  416  NQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQN-STV  240
               +T +  +  +  +   + A+    DL GSPF YS+  NKF+  GC N  F ++    
Sbjct  86   LGLVTIMNPIYRW--NCPSKRAMPAIKDLRGSPFVYSQESNKFVAVGCNNLAFLKSGGDT  143

Query  239  VAGCTAICGAN--------ISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSND  84
            V GC +IC  N        ISS   GC+G  CCET +P  L+ Y A   +   Q+     
Sbjct  144  VGGCVSICDNNEEFKNMDFISSD--GCHGRYCCETSLPNYLSEYNATLQDFNNQNSSVES  201

Query  83   NLKRCNSAFLIDQRW  39
            +  +C+SAF++++ W
Sbjct  202  H--QCSSAFIVNKYW  214



>gb|KCW47701.1| hypothetical protein EUGRSUZ_K01439 [Eucalyptus grandis]
Length=776

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/195 (32%), Positives = 96/195 (49%), Gaps = 17/195 (9%)
 Frame = -2

Query  596  RCEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLE  417
             C + CGNV+IPFPFG+G GC L+ W+ ++C  S+  P   LN      L     +V   
Sbjct  30   ECNETCGNVTIPFPFGVGAGCFLDEWYEIDCQQSNTVP--VLNKTGLRVLNISFPSVWGY  87

Query  416  NQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQNST--  243
               + +++  + + + S G + +       G PF +S++RN F   GC ++L T  +T  
Sbjct  88   TNGMISVRLPLIYSNASCGADGLGEPVSFEGGPFVFSQTRNVFTSVGC-DTLATVGTTES  146

Query  242  VVAGCTAICG---ANISSGFAGCYGID-CCETPVPFDLTSYTANFTNSGIQSDGSNDNLK  75
             V GC + C     NIS  ++ C G D CC++ +PFDL  ++ +F   G           
Sbjct  147  AVVGCRSKCAEISTNISWHYSTCSGRDECCQSTLPFDLQVFSVDFKEEGGHHG-------  199

Query  74   RCNSAFLIDQRWIPK  30
             C  AFL D+ W  K
Sbjct  200  -CKHAFLADRSWFLK  213



>ref|XP_006372237.1| hypothetical protein POPTR_0018s14510g [Populus trichocarpa]
 gb|ERP50034.1| hypothetical protein POPTR_0018s14510g [Populus trichocarpa]
Length=738

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 65/196 (33%), Positives = 106/196 (54%), Gaps = 30/196 (15%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQG---EVVAVS  423
            C++RCGN++IP+PFG+  GC L   F ++C++SS P          ++L G   EV  +S
Sbjct  31   CKERCGNITIPYPFGMETGCYLEERFRIDCNSSSIPT---------LDLNGTSLEVTDIS  81

Query  422  LENQTITTLKSVVNF---CDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN-SLFT  255
            ++      +   + F      ++ R+++    +L  +PF +S + N+F+ AGC N +L +
Sbjct  82   VDKANNIQINFPIIFQNCSSKTSSRDSLV--VNLEDTPFSFS-TENRFVAAGCNNLALLS  138

Query  254  QNSTVVAGCTAICGANISSGFAG---CYGIDCCETPVPFDLTSYTANFTNSGIQSDGSND  84
            +N   V GC +IC  + S   A    C GI+CCET +P  L     +F N+ +Q  G  D
Sbjct  139  RNEATVGGCMSICNVSSSDASADGTICNGINCCETTIPSGL-----DFFNATLQVVG--D  191

Query  83   NLKR-CNSAFLIDQRW  39
             +K  C  A+L+DQ W
Sbjct  192  KVKDGCKYAYLVDQNW  207



>ref|XP_011095036.1| PREDICTED: wall-associated receptor kinase 2-like [Sesamum indicum]
Length=787

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 65/203 (32%), Positives = 108/203 (53%), Gaps = 24/203 (12%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEG--CALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSL  420
            C  +CGN+++P+PFGIG G  C ++PWF +NC N+  PP+AYL         G +    +
Sbjct  47   CPSKCGNLTVPYPFGIGRGSGCGIDPWFELNCSNAFDPPRAYL---------GNIQIYDI  97

Query  419  ENQTITTLKSVVNFCDDSAGRNAITN--GTDLSGSPFYYSKSRNKFLFAGCGN-SLFT--  255
             +  +     +   C D AG  + TN   +D++G+P+ YS S NKF   GC + +L T  
Sbjct  98   SDNQMRISNVMARRCYDRAGDVSQTNYASSDITGTPYSYS-SLNKFTVLGCDDFALVTGG  156

Query  254  QNSTVVAGCTAIC--GANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDN  81
                  +GC ++C    ++ SG+  C GI CC+T +P  L  Y  +   S +++     +
Sbjct  157  GGRNFTSGCVSLCSRAEDVISGY--CSGIGCCQTSLPKGLKFYLTDL--SSLRNHTGVSS  212

Query  80   LKRCNSAFL-IDQRWIPKQSTSL  15
               C+ AFL  +QR++ + ++ L
Sbjct  213  FNPCSYAFLGEEQRFVFRGASDL  235



>ref|XP_011017593.1| PREDICTED: wall-associated receptor kinase-like 10 [Populus euphratica]
Length=737

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/191 (34%), Positives = 103/191 (54%), Gaps = 20/191 (10%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C++RCGN++IP+PFG+  GC L   F ++C NSS+ P   +N      L+ + ++V   N
Sbjct  31   CKERCGNITIPYPFGMETGCYLEERFRIDC-NSSSIPTLDING---TSLEVKDISVDTAN  86

Query  413  QTITTLKSVVNFC-DDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN-SLFTQNSTV  240
                    +   C   ++ R+++    +L  +PF +S + N+F+  GC N +L ++N   
Sbjct  87   NIQVNFPIIFQNCSSKTSSRDSLV--VNLEDTPFSFS-TENRFIAVGCNNLALLSRNEAT  143

Query  239  VAGCTAICGANISSGFAG---CYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKR-  72
            V GC +IC  + S   A    C GI+CCET +P  L     +F N+ +Q  G  D +K  
Sbjct  144  VGGCMSICNVSSSDASANGTICNGINCCETTIPSGL-----DFFNATLQVVG--DKVKDG  196

Query  71   CNSAFLIDQRW  39
            C  A+L+DQ W
Sbjct  197  CKYAYLVDQNW  207



>ref|XP_008342473.1| PREDICTED: wall-associated receptor kinase-like 8 [Malus domestica]
Length=335

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 66/196 (34%), Positives = 98/196 (50%), Gaps = 15/196 (8%)
 Frame = -2

Query  593  CEQRCGN--VSIPFPFGIGEGCALNPWFLVNCDNSSA-PPKAYLNSFVQIEL-QGEVVAV  426
            C   CGN  +SIP+PFGIG  C +N WF + CDNS+   P+  +       L Q EV+ +
Sbjct  35   CPAHCGNDTISIPYPFGIGADCFMNAWFEITCDNSTYNSPRRPIPRLNHPSLKQLEVLEL  94

Query  425  SLENQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQ--  252
            S+ N T++    +  F D    R       +L+GSPF +SK RN+    GCG     +  
Sbjct  95   SM-NGTLSVRNPITFFGDCGTNRTLAEQAPNLTGSPFVFSK-RNRLFSVGCGGIALMKLM  152

Query  251  NSTVVAGCTAICG--ANISSGF---AGCYGIDCCETPVPFDLTSYTANF--TNSGIQSDG  93
            N + V GC +ICG   +I         C GI+CC+T +P +LT++  +F      + +  
Sbjct  153  NGSSVGGCLSICGDKGDILEQLNEPDNCNGINCCQTTIPGNLTNFNTSFQEVKGLLNASD  212

Query  92   SNDNLKRCNSAFLIDQ  45
            +      C  AFL D+
Sbjct  213  TTSGSGSCKYAFLADE  228



>ref|XP_009411178.1| PREDICTED: wall-associated receptor kinase 5-like [Musa acuminata 
subsp. malaccensis]
Length=732

 Score = 97.1 bits (240),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 62/204 (30%), Positives = 109/204 (53%), Gaps = 20/204 (10%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C  +CG V IP+PFGIG GC++   F + C++++ PPK ++ +   I    E++ VSL +
Sbjct  25   CPSKCGEVDIPYPFGIGRGCSME-GFDITCNDTTDPPKPFI-AVGNI----EILNVSLVD  78

Query  413  QTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLF-----TQN  249
              ++    +V  C + +G  + T+       PF +S + NKF   GC    +      + 
Sbjct  79   HELSVHIYMVGQCYEQSGNYSTTS----LALPFLFSAASNKFTVVGCSTLAYVVGQNVKG  134

Query  248  STVVAGCTAIC--GANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLK  75
            +T  +GC + C     +S G  GC G+ CC+T +P  L+++TA F++S   S+ +  +  
Sbjct  135  NTYASGCVSYCDDAGGVSEG-PGCDGMGCCQTSIPKSLSNFTAYFSDSLNNSEVA--SFS  191

Query  74   RCNSAFLIDQRWIPKQSTSLFLEY  3
             C+ AF+ DQ W     ++LF ++
Sbjct  192  PCSYAFVADQDWFRFNKSTLFPDF  215



>ref|XP_007216693.1| hypothetical protein PRUPE_ppa026738mg, partial [Prunus persica]
 gb|EMJ17892.1| hypothetical protein PRUPE_ppa026738mg, partial [Prunus persica]
Length=767

 Score = 97.1 bits (240),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 64/193 (33%), Positives = 99/193 (51%), Gaps = 15/193 (8%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIG-EGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLE  417
            C+++CG V IP+PFGIG + C L+ WF + C N S+   +  +  V    Q EV+++S+E
Sbjct  15   CKEKCGGVLIPYPFGIGHKDCYLDDWFEIECSNQSSKTTSSAHKPVLKRAQLEVLSISIE  74

Query  416  NQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQNST-V  240
              T+     V  FC+     N  +   +L GSPF YS+ +N+F    CG     +++  V
Sbjct  75   G-TLRVNSPVTFFCNG----NGSSEMANLMGSPFVYSQDKNRFTAVSCGFLAMMESAEFV  129

Query  239  VAGCTAICGANISSGFAGC-YGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKRCNS  63
            V GC ++C  +  S  A C  GI+CC+T +P  L    A+    G       D+      
Sbjct  130  VGGCRSVC--DYGSYNASCDIGINCCQTTIPPYLIMIGASILYKGETRKADCDDY-----  182

Query  62   AFLIDQRWIPKQS  24
            AFL+D+ W  + S
Sbjct  183  AFLVDKDWFQRSS  195



>ref|XP_010229415.1| PREDICTED: wall-associated receptor kinase 5-like [Brachypodium 
distachyon]
Length=754

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 66/204 (32%), Positives = 98/204 (48%), Gaps = 17/204 (8%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCA---LNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVS  423
            C  +CG+V IP+PFGIGE CA   L+ +F + C+++  PP+  +      + + E+  +S
Sbjct  32   CPNKCGDVLIPYPFGIGEHCAATSLSSYFNLICNSTINPPRPMVGDN---DTEVEIADIS  88

Query  422  LENQTITTLKSVVNFCDDSAGR-NAITNGTDLSGSPFYYSKSRNKFLFAGCGN-----SL  261
            LE+  +  L  V + C  S         G +L  +PF  S SRN+F   GC         
Sbjct  89   LEHGEMRVLSPVNHICFTSNTTFTKFVGGYELEPTPFLPSPSRNRFTVIGCNTLGLIGGF  148

Query  260  FTQNSTVVAGCTAIC-GANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSND  84
               +S  VAGC + C G N +S  A C G+ CCE  +P +LTSY   F  +  +  G N 
Sbjct  149  KGASSQYVAGCYSFCDGVNNTSDGAPCAGMGCCEAAIPANLTSYGVMFEMNQSKVWGFNP  208

Query  83   NLKRCNSAFLIDQRWIPKQSTSLF  12
                C  A + +  W   +   LF
Sbjct  209  ----CFYAMVAEVGWYNFRQQDLF  228



>gb|EMT30697.1| Wall-associated receptor kinase 3 [Aegilops tauschii]
Length=757

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 61/168 (36%), Positives = 89/168 (53%), Gaps = 15/168 (9%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCA---LNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVS  423
            C  +CGNVSIP+PFGIG GCA   LN +F V C+++  PP+  +     +    E++ +S
Sbjct  32   CPDKCGNVSIPYPFGIGNGCAAASLNSYFTVTCNSTFQPPRPMIGDPSGLS---EIIDIS  88

Query  422  LENQTITTLKSVVN--FCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGC------GN  267
            LE   +     V    F  ++   +  T+G +L G+PF  S +RN+F+  GC      G 
Sbjct  89   LERAEMRVYGPVSYNCFTSNTTVMDNYTSGFNLVGTPFIPSTTRNRFMVIGCNTMGIIGG  148

Query  266  SLFTQNSTVVAGCTAIC-GANISSGFAGCYGIDCCETPVPFDLTSYTA  126
             L +     VAGC + C G N +S  A C G  CCET +  +LT + A
Sbjct  149  YLHSNPDLYVAGCYSYCQGINSTSNGAPCTGKGCCETTITPNLTDFAA  196



>ref|XP_004305857.1| PREDICTED: wall-associated receptor kinase-like 8-like [Fragaria 
vesca subsp. vesca]
Length=710

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 64/194 (33%), Positives = 102/194 (53%), Gaps = 16/194 (8%)
 Frame = -2

Query  596  RCEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLE  417
            +C   CG V IP+PFGI EGC ++ WF + C N +  P   L  + + ++  EV+ +S+E
Sbjct  31   KCTPNCGVVQIPYPFGIEEGCYID-WFRIQCYNFTGIPTPTL-WYPEKQMSLEVLNISVE  88

Query  416  NQTITTLKSVVNFCDDSAGRNAITNG--TDLSGSPFYYSKSRNKFLFAGCGNSLFT--QN  249
                 T++S + F D   G     +G   +LSGSPF +S+ +N+    GCG + +    N
Sbjct  89   G--TLTVRSPITFLDPICGCPWPNSGQPANLSGSPFVFSQ-KNRLAVMGCGGTTWMTLDN  145

Query  248  STVVAGCTAIC--GANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLK  75
             + VA C ++C  G  +      C GI+CC+   P +LT++   F  S   + G+    +
Sbjct  146  GSRVASCPSVCGDGGKLPDTLDRCNGINCCQINTPPELTAFNYTFEASNKTTPGT----E  201

Query  74   RCNSAFLIDQR-WI  36
             C  AFL+DQ  W+
Sbjct  202  SCKYAFLVDQESWV  215



>gb|ABA99845.2| wall-associated kinase 3, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAG89117.1| unnamed protein product [Oryza sativa Japonica Group]
Length=318

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 62/169 (37%), Positives = 90/169 (53%), Gaps = 14/169 (8%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCA---LNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVS  423
            C  +CGNV+IP+PFGIGE C+   LN +F + C+++  PP+  +    + E   EV  +S
Sbjct  32   CPDKCGNVAIPYPFGIGENCSATNLNSYFNLMCNDTFHPPRPQIR---EPEAHIEVTGIS  88

Query  422  LENQTITTLKSVVNFCDDSAGRNAITNGT--DLSGSPFYYSKSRNKFLFAGCGN-SLFT-  255
            LE   +  L  V + C  S   +  ++G   DLS +PF  S SRN+F   GC    L T 
Sbjct  89   LERGEMRVLSPVNHICFTSNTTSTKSSGVGYDLSRTPFLPSPSRNRFTVIGCNTLGLITG  148

Query  254  ---QNSTVVAGCTAIC-GANISSGFAGCYGIDCCETPVPFDLTSYTANF  120
                +   V GC + C G N +S  A C G+ CCE  +P +LT++   F
Sbjct  149  YRGASGQYVTGCYSYCEGINSTSDGAPCAGMGCCEASIPANLTAFAVTF  197



>ref|XP_009356568.1| PREDICTED: wall-associated receptor kinase-like 1 [Pyrus x bretschneideri]
Length=744

 Score = 96.3 bits (238),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 65/191 (34%), Positives = 102/191 (53%), Gaps = 23/191 (12%)
 Frame = -2

Query  596  RCEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLE  417
            +C  RCGNV+IP+PFGIG  C  +  F ++C+ ++       N  V  +   EV+ +S+ 
Sbjct  34   KCLSRCGNVNIPYPFGIGPDCYFDEGFEISCNKTTG------NVPVLRQTSLEVLNISIA  87

Query  416  NQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN-SLFTQNSTV  240
              TI     V  FC    G N+     +L G+PF YS+  N+F    CG   L   +  V
Sbjct  88   EGTIQVKNPVTFFC----GGNSSRQPANLKGTPFVYSERHNRFTAVSCGYLVLVGSDKYV  143

Query  239  VAGCTAIC-GANISSGFAGC-YGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKRCN  66
            V GC ++C G  I+ G   C  GI+CC+T +P  L++ + +  ++GI++ G +     CN
Sbjct  144  VGGCRSVCEGTGINYG--NCEVGINCCQTTIPPHLSAISMHI-DTGIRARGDD-----CN  195

Query  65   S--AFLIDQRW  39
            +  AFL+D+ W
Sbjct  196  NAYAFLVDKNW  206



>ref|XP_010920488.1| PREDICTED: putative wall-associated receptor kinase-like 16 [Elaeis 
guineensis]
Length=718

 Score = 96.3 bits (238),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 67/204 (33%), Positives = 96/204 (47%), Gaps = 43/204 (21%)
 Frame = -2

Query  596  RCEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNS----FVQIEL---QGE  438
            RC   CGN+SIP+PFGIG  C++   F + C++S  PPK  + +    FV I L   Q  
Sbjct  11   RCPATCGNLSIPYPFGIGSACSMEG-FEITCNDSHTPPKPLMGTGNIEFVDISLTLGQAR  69

Query  437  V---VAVSLENQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN  267
            V   +     N+T  TL++                  DL GSPF +S +RNKF   GC  
Sbjct  70   VYKHIGFKCYNETSITLEA--------------EPYMDLRGSPFTFSDTRNKFTAVGCHT  115

Query  266  ----SLFTQNSTVVAGCTAICG--ANISSGFAGCYGIDCCETPVPFDLTSYTA----NFT  117
                S+ +   T   GC A C   +++++G   C GI CC+ P+P  L  Y      NF 
Sbjct  116  LAYMSMSSPEKTYETGCLATCHDPSDVTNG--SCSGIGCCQIPIPKGLNYYEPIFDRNFN  173

Query  116  NSGIQSDGSNDNLKRCNSAFLIDQ  45
            +S +           C+ AFL+D+
Sbjct  174  HSQVY------QFNPCSYAFLVDE  191



>gb|ABA99409.1| Protein kinase domain containing protein, expressed [Oryza sativa 
Japonica Group]
 gb|EAZ21217.1| hypothetical protein OsJ_36870 [Oryza sativa Japonica Group]
Length=741

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 61/169 (36%), Positives = 86/169 (51%), Gaps = 15/169 (9%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCA---LNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVS  423
            C  +CGNVSIP+PFG+G  CA   ++ +F + C N+  PP+  +      E   EV  +S
Sbjct  37   CPDKCGNVSIPYPFGVGPSCAATSISSYFNLTCSNTFNPPRPMVGD---SEALVEVTDIS  93

Query  422  LENQTITTLKSVVNFC-DDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQN-  249
            LE+  +  L  V   C   +      T G +L  +PF  S SRN+F   GC N+L     
Sbjct  94   LEHGEMRVLSPVYYICFTANTTFTKFTEGYELKHTPFLPSPSRNRFTVIGC-NTLGLIGG  152

Query  248  -----STVVAGCTAICGA-NISSGFAGCYGIDCCETPVPFDLTSYTANF  120
                 S  V GC + C + N +S  A C G+ CCE  +P DLT++ A F
Sbjct  153  YKGTVSHYVTGCYSYCESINSTSDGAPCAGMGCCEAAIPTDLTAWGAMF  201



>ref|NP_001067269.2| Os12g0614800 [Oryza sativa Japonica Group]
 dbj|BAF30288.2| Os12g0614800 [Oryza sativa Japonica Group]
Length=752

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 61/169 (36%), Positives = 86/169 (51%), Gaps = 15/169 (9%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCA---LNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVS  423
            C  +CGNVSIP+PFG+G  CA   ++ +F + C N+  PP+  +      E   EV  +S
Sbjct  48   CPDKCGNVSIPYPFGVGPSCAATSISSYFNLTCSNTFNPPRPMVGD---SEALVEVTDIS  104

Query  422  LENQTITTLKSVVNFC-DDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQN-  249
            LE+  +  L  V   C   +      T G +L  +PF  S SRN+F   GC N+L     
Sbjct  105  LEHGEMRVLSPVYYICFTANTTFTKFTEGYELKHTPFLPSPSRNRFTVIGC-NTLGLIGG  163

Query  248  -----STVVAGCTAICGA-NISSGFAGCYGIDCCETPVPFDLTSYTANF  120
                 S  V GC + C + N +S  A C G+ CCE  +P DLT++ A F
Sbjct  164  YKGTVSHYVTGCYSYCESINSTSDGAPCAGMGCCEAAIPTDLTAWGAMF  212



>ref|XP_008358012.1| PREDICTED: LOW QUALITY PROTEIN: wall-associated receptor kinase-like 
1 [Malus domestica]
 ref|XP_008365609.1| PREDICTED: LOW QUALITY PROTEIN: wall-associated receptor kinase-like 
1 [Malus domestica]
Length=742

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 64/195 (33%), Positives = 99/195 (51%), Gaps = 25/195 (13%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCAL-NPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLE  417
            C+  CG++ IP+PFGIG GC + + WF + CDNS+  P  +LN         EV+ +S E
Sbjct  34   CQSHCGDIEIPYPFGIGAGCYIDDDWFQIICDNSTGNPTPFLN-----RTNLEVLEISAE  88

Query  416  NQTITTLKSVV-NFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCG-NSLFTQNS-  246
              T+     +  + C +        N   L GSPF YS ++N F   GCG  +  T NS 
Sbjct  89   GGTLKVTNPITFSNCSNKPINRQTAN---LEGSPFAYS-TKNVFTAVGCGFMATITSNSN  144

Query  245  --TVVAGCTAICGANISSG----FAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSND  84
              ++ +GC + C  +I+         C G+DCC+T +P  L+++  +F     ++  S  
Sbjct  145  GYSISSGCKSECDISINKSNGTRHNVCNGVDCCQTAIPSFLSAFNTSFQRDDDKTRSS--  202

Query  83   NLKRCNSAFLIDQRW  39
                CN AFL+D+ W
Sbjct  203  ----CNYAFLVDRXW  213



>ref|XP_006388919.1| hypothetical protein POPTR_0075s00240g, partial [Populus trichocarpa]
 gb|ERP47833.1| hypothetical protein POPTR_0075s00240g, partial [Populus trichocarpa]
Length=318

 Score = 93.2 bits (230),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 55/191 (29%), Positives = 95/191 (50%), Gaps = 19/191 (10%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C  RCG+++IP+PFG G+ C  + WF V C+ ++ PP+A+++      ++ EV+ +S++ 
Sbjct  33   CPDRCGDITIPYPFGTGKDCYKDEWFAVECNKTTNPPRAFIS-----RIKMEVLNISVKT  87

Query  413  QTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNS-LFTQNSTVV  237
             T T    V++F  +  GR       DL+GSPF +S   N+F+  GC    L +     V
Sbjct  88   ATATVKSPVISF--NCTGRKD-GGSLDLTGSPFVFSDFWNEFIAVGCDTPVLMSGIEPQV  144

Query  236  AGCTAICGANISSGFA-----GCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKR  72
             GC   CG   S+         C G +CC+  +P  L  +     ++ +     +   + 
Sbjct  145  LGCVPTCGNQQSTNVWLQENNMCSGRNCCQASIPSLLQVFKPTLVSTNV-----DQGREA  199

Query  71   CNSAFLIDQRW  39
            C  A L+++ W
Sbjct  200  CKLAVLVNRTW  210



>gb|EAY84983.1| hypothetical protein OsI_06348 [Oryza sativa Indica Group]
Length=711

 Score = 95.5 bits (236),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 65/197 (33%), Positives = 95/197 (48%), Gaps = 27/197 (14%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C  +CG V IPFPFG+G  CAL P   V+C++S APP+ Y+          E + VSLE 
Sbjct  39   CPSKCGEVDIPFPFGVGVDCAL-PGLNVSCNHSFAPPRPYIAD------DNEFIDVSLET  91

Query  413  QTITTLKSVVNFCDD----SAGRNAITNGTDLSGSPFYYSKSRNKFLFAGC---GNSLFT  255
                    V+  C D    S+  +AI  G DL+G+PF  S  RN+F   GC   G     
Sbjct  92   GETRVYTPVLQNCFDLSNTSSSSDAIWQGLDLTGTPFLVSPERNEFTATGCDTLGMMYGR  151

Query  254  QNSTVVAGCTAICGANISSGFAG--CYGIDCCE-TPVPFDLT----SYTANFTNSGIQSD  96
            ++ + + GC   C +  ++   G  C G+ CC+   +P +LT      +AN T+  I + 
Sbjct  152  EDGSYLTGCVTTCASLDAAANDGDHCAGLGCCQIQSIPTNLTLLRIVLSANITDRKIAA-  210

Query  95   GSNDNLKRCNSAFLIDQ  45
                    C  AF+ D+
Sbjct  211  -----WNPCRYAFITDR  222



>gb|EEE53613.1| hypothetical protein OsJ_36873 [Oryza sativa Japonica Group]
Length=762

 Score = 95.5 bits (236),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 61/169 (36%), Positives = 87/169 (51%), Gaps = 15/169 (9%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCA---LNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVS  423
            C  +CGN+SIP+PFGIG  CA   ++ +F + C+N+  PP+  +      E   EV  +S
Sbjct  37   CPDKCGNISIPYPFGIGPSCAATSISSYFNLTCNNTFNPPRPMVGD---SEALVEVTDIS  93

Query  422  LENQTITTLKSVVNFC-DDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQN-  249
            LE+  +  L  V   C   +      T G +L  +PF  S SRN+F   GC N+L     
Sbjct  94   LEHGEMRVLSPVYYICFTANTTFTRFTEGYELKHTPFLPSPSRNRFTVIGC-NTLGLIGG  152

Query  248  -----STVVAGCTAICGA-NISSGFAGCYGIDCCETPVPFDLTSYTANF  120
                 S  V GC + C + N +S  A C G+ CCE  +P DLT++ A F
Sbjct  153  YKGTVSHYVTGCYSYCESINSTSDGAPCAGMGCCEAAIPTDLTAWGAMF  201



>ref|NP_001067272.1| Os12g0615300 [Oryza sativa Japonica Group]
 gb|ABA99846.1| Protein kinase domain containing protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF30291.1| Os12g0615300 [Oryza sativa Japonica Group]
Length=731

 Score = 95.5 bits (236),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 61/169 (36%), Positives = 87/169 (51%), Gaps = 15/169 (9%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCA---LNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVS  423
            C  +CGN+SIP+PFGIG  CA   ++ +F + C+N+  PP+  +      E   EV  +S
Sbjct  6    CPDKCGNISIPYPFGIGPSCAATSISSYFNLTCNNTFNPPRPMVGD---SEALVEVTDIS  62

Query  422  LENQTITTLKSVVNFC-DDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQN-  249
            LE+  +  L  V   C   +      T G +L  +PF  S SRN+F   GC N+L     
Sbjct  63   LEHGEMRVLSPVYYICFTANTTFTRFTEGYELKHTPFLPSPSRNRFTVIGC-NTLGLIGG  121

Query  248  -----STVVAGCTAICGA-NISSGFAGCYGIDCCETPVPFDLTSYTANF  120
                 S  V GC + C + N +S  A C G+ CCE  +P DLT++ A F
Sbjct  122  YKGTVSHYVTGCYSYCESINSTSDGAPCAGMGCCEAAIPTDLTAWGAMF  170



>ref|XP_010041300.1| PREDICTED: wall-associated receptor kinase-like 10 [Eucalyptus 
grandis]
Length=677

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 70/197 (36%), Positives = 100/197 (51%), Gaps = 29/197 (15%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C + CGNVSIPFPFGIG GC L+PW+ + C + S P        +  ++   V+ +SL N
Sbjct  31   CVETCGNVSIPFPFGIGAGCFLDPWYEIVCQDRSVP--------ILYKIGLRVLNISLPN  82

Query  413  --QTITTLKSV---VNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQN  249
              Q +  + SV   +   + S G   +    +  GS F +S+  N F   GC N+L T N
Sbjct  83   YYQFVDGMISVSLPLISSNASCGGEGLGGPVNFEGSQFIFSQRWNVFTSVGC-NTLATVN  141

Query  248  ST--VVAGCTAICG---ANISSGFAGCYGID-CCETPVPFDLTSYTANFTNSGIQSDGSN  87
            ST  VV GC + C    ANIS  +  C G D CC+T +P +L  ++ +F   G       
Sbjct  142  STESVVVGCRSKCAGTSANISQ-YNACSGRDGCCQTTLPDNLRGFSVDFKEEG-------  193

Query  86   DNLKRCNSAFLIDQRWI  36
               + C  AFL D+ W+
Sbjct  194  -GPQGCKYAFLADRSWL  209



>ref|XP_004963217.1| PREDICTED: wall-associated receptor kinase 4-like [Setaria italica]
Length=755

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 89/172 (52%), Gaps = 15/172 (9%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCA---LNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVS  423
            C  +CGNVSIP+PFGIG+GCA   L+P F + C+NS  PP+     F       EV+ +S
Sbjct  31   CPDKCGNVSIPYPFGIGDGCAATSLSPSFTLICNNSFQPPRPM---FSNSSRPVEVIDIS  87

Query  422  LENQTITTLKSVVNFC--DDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGC------GN  267
            LE+  +    +V  +C   ++   +  T G  L   PF  S +RN+F   GC      G 
Sbjct  88   LEHGEVRVYGNVSYYCFTSNTTISDNNTAGVSLENMPFIPSITRNRFTVIGCNTLGLIGG  147

Query  266  SLFTQNSTVVAGCTAIC-GANISSGFAGCYGIDCCETPVPFDLTSYTANFTN  114
               + +   +AGC + C G N ++  A C GI CCET +  +LT + A   N
Sbjct  148  YTHSNSDLYLAGCYSYCRGINSTTDGAPCIGIGCCETTISPNLTDFAALLIN  199



>gb|EAY83890.1| hypothetical protein OsI_39112 [Oryza sativa Indica Group]
Length=592

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/197 (31%), Positives = 98/197 (50%), Gaps = 19/197 (10%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGC---ALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVS  423
            C  +CGNVSIP+PFGIG GC   +L+ +F + C+++  PP+  +   +    + EV+ +S
Sbjct  59   CPGKCGNVSIPYPFGIGAGCSATSLSSYFTITCNDTFQPPQPMVRDLLS---ETEVIDIS  115

Query  422  LENQTITTLKSVVNFC--DDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGC------GN  267
            LE   +     V   C   ++      T G  L G+PF  S +RN+F+  GC      G 
Sbjct  116  LERGEVRVYGPVSYICFSSNTTIPENHTTGFTLEGTPFVPSTTRNRFMAIGCHTLGIIGG  175

Query  266  SLFTQNSTVVAGCTAICGA-NISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGS  90
             + + ++  VAGC + C + N +S  A C G+ CCET +  DL  + A      + +  +
Sbjct  176  YMHSNSNLYVAGCYSYCQSINSTSNGAPCTGMGCCETTIIPDLKDFAAIL----VMNQSA  231

Query  89   NDNLKRCNSAFLIDQRW  39
                  C  A L++  W
Sbjct  232  VWEFNPCFYAMLVEAGW  248



>ref|XP_010269806.1| PREDICTED: wall-associated receptor kinase-like 8 [Nelumbo nucifera]
Length=1028

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 67/207 (32%), Positives = 98/207 (47%), Gaps = 36/207 (17%)
 Frame = -2

Query  596  RCEQRCGNVSIPFPFGIGEGCALNPWFLVNC-DNSSAPPKAYL---NSFVQIELQGEVVA  429
            RC+++CGNVSIP+PFGIG  C+ N WF V C D SS PP+         V I  +G+VV 
Sbjct  41   RCQEKCGNVSIPYPFGIGANCSKNSWFNVFCNDTSSNPPEMSFGGGRDLVDILAEGKVV-  99

Query  428  VSLENQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQN  249
                     T    +  CD S     I  G + + SP++ S+  NKF+  GC N  +   
Sbjct  100  ---------TRGWSITXCDTSGEGFRIFYGHNFTSSPYFLSQESNKFITLGCDNLGYFIG  150

Query  248  ST---VVAGCTAICGAN----------ISSGFAGCYGIDCCETPVP----FDLTSYTANF  120
            S+    + GC + C             +++  + C G  CC TPVP    F +T  T + 
Sbjct  151  SSSYQTIGGCMSFCNTTEFKINGTKLAVTTNPSECNGFGCCSTPVPPLQEFYIT--TRHI  208

Query  119  TNSGIQSDGSNDNLKRCNSAFLIDQRW  39
             + G   D  +    RC +A + D++W
Sbjct  209  NDLGFLRDEPS---TRCATALIADRKW  232



>ref|XP_010088575.1| Wall-associated receptor kinase-like 9 [Morus notabilis]
 gb|EXB36716.1| Wall-associated receptor kinase-like 9 [Morus notabilis]
Length=729

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/192 (27%), Positives = 92/192 (48%), Gaps = 19/192 (10%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C+ RCG+V IP+PFGI  GC L+ WF + C  S+          ++ + + EV+ +++E 
Sbjct  23   CKSRCGDVEIPYPFGIRAGCYLDKWFEILCLKSTP--------LLRHDPELEVLQINVEM  74

Query  413  QTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQNST---  243
            ++   ++  + F         +    +L+GSPF +S+ +N+F    C      +++    
Sbjct  75   ESTIKVRHPITF--SKCREKKLYEAANLTGSPFVFSQKKNRFTAVSCDQLALMKSTNDYY  132

Query  242  --VVAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTN--SGIQSDGSNDNLK  75
               V  C +IC    +     C G++CC+T +P +L S+   F +  S    + S     
Sbjct  133  ADTVGACMSICDKTTTE--KSCNGMNCCQTTIPLNLRSFHTEFGDQISIYWRNNSRRQRG  190

Query  74   RCNSAFLIDQRW  39
             C  AFL+D  W
Sbjct  191  ECVYAFLVDLEW  202



>gb|AAX94997.1| protein kinase [Oryza sativa Japonica Group]
 gb|ABA95431.1| Protein kinase domain containing protein [Oryza sativa Japonica 
Group]
 gb|EAZ18767.1| hypothetical protein OsJ_34294 [Oryza sativa Japonica Group]
Length=710

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 62/179 (35%), Positives = 90/179 (50%), Gaps = 21/179 (12%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C  +CG V IPFPFG+G  CAL P   V+C++S APP+ Y+          E + VSLE 
Sbjct  39   CPSKCGEVDIPFPFGVGVDCAL-PGLNVSCNHSFAPPRPYIAD------DNEFIDVSLET  91

Query  413  QTITTLKSVVNFCDD----SAGRNAITNGTDLSGSPFYYSKSRNKFLFAGC---GNSLFT  255
                    V+  C D    S+  +AI  G DL+G+PF  S  RN+F   GC   G     
Sbjct  92   GETRVYTPVLQNCFDLSNTSSSSDAIWQGLDLTGTPFLVSPERNEFTATGCDALGLIYGR  151

Query  254  QNSTVVAGCTAICGANISSGFAG--CYGIDCCE-TPVPFDLT----SYTANFTNSGIQS  99
            ++ +   GC   C +  ++   G  C G+ CC+   +P +LT    + TAN T++ I +
Sbjct  152  EDVSFFTGCVTTCTSLGTAANDGDNCTGLGCCQLQSIPGNLTLLGMTLTANITDTKISA  210



>ref|XP_008222638.1| PREDICTED: wall-associated receptor kinase-like 1 [Prunus mume]
Length=672

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 66/202 (33%), Positives = 107/202 (53%), Gaps = 27/202 (13%)
 Frame = -2

Query  593  CEQRCGNVS-IPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQG-EVVAVSL  420
            C  +CG V+ IP+PFGI +GC L  WF + CDNS+ P +A++N      + G EV+ +S+
Sbjct  16   CSSQCGLVTQIPYPFGIEDGCYLGDWFQIMCDNSTNPSRAFMN------VTGLEVLEISV  69

Query  419  ENQTITTLKSVVNF---CDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN-SLFTQ  252
            E      +KS + F    +   GR       +L GSPF +S+ +N+F    CG  +L T 
Sbjct  70   EG--TLKVKSPITFSNCSNKPVGRQT----PNLEGSPFVFSQ-KNRFTSLSCGGVALMTS  122

Query  251  -NSTVVAGCTAICGANISSGF--AGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDN  81
             + + +AGC +IC    +S      C G++CC+T +   L S++ +F    + +D     
Sbjct  123  LDGSTIAGCLSICDYTSTSYLRTKSCIGMNCCQTTITPYLRSFSTSFGALLLNADR----  178

Query  80   LKRCNSAFLIDQRWIPKQSTSL  15
             + C  AFL++  W    ST++
Sbjct  179  -QTCKYAFLVEHDWFTSNSTNV  199



>ref|XP_006388916.1| hypothetical protein POPTR_0075s00210g [Populus trichocarpa]
 gb|ERP47830.1| hypothetical protein POPTR_0075s00210g [Populus trichocarpa]
Length=912

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 94/191 (49%), Gaps = 19/191 (10%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C  RCG+++IP+PFG G+ C  + WF V C+ ++ PP+A+++      ++ EV+ +S++ 
Sbjct  33   CPDRCGDITIPYPFGTGKDCYKDEWFAVECNKTTNPPRAFIS-----RIKMEVLNISVKT  87

Query  413  QTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNS-LFTQNSTVV  237
             T T    V++F  +  GR       DL+GSPF +S  RN F+  GC    L +     V
Sbjct  88   ATATVKSPVISF--NCTGRKD-GGSLDLTGSPFVFSYFRNVFIAVGCDTQVLMSGIEPQV  144

Query  236  AGCTAICGANISSGFA-----GCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKR  72
             GC   CG   S+         C G +CC+  +P  L  +     ++ +     +   + 
Sbjct  145  LGCVPTCGNQQSTNVWLQENNMCSGQNCCQASIPSLLQVFKPTLVSTNV-----DQGREA  199

Query  71   CNSAFLIDQRW  39
            C  A L++  W
Sbjct  200  CKLAVLVNTTW  210


 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 68/196 (35%), Positives = 96/196 (49%), Gaps = 27/196 (14%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C   CGN+SIP+PFGIG+ C +   F V CD +S PP+A+L S     ++ E+V ++LE 
Sbjct  643  CSDHCGNISIPYPFGIGKDCYMAESFDVECDETSKPPRAFLRS-----IKMELVNITLEG  697

Query  413  QTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN--SLFTQN-ST  243
              +     V++    S+GR       +L G+PF +S + N F+  GC    SL+T+N ST
Sbjct  698  GAVVN-GPVISV--HSSGRQEGV-PVNLEGTPFLFSYT-NYFIAVGCNTRASLWTKNGST  752

Query  242  VVAGCTAICG-----ANISSGFAGCYGIDCCE---TPVPFDLTSYTANFTNSGIQSDGSN  87
               GC +IC      +NI      C G DCC+    P    + + T         SDG  
Sbjct  753  EHVGCDSICSNGSSISNIQLENGACSGKDCCQGMYWPPSLQVFNSTFELIEGKQGSDG--  810

Query  86   DNLKRCNSAFLIDQRW  39
                R   AFL D  W
Sbjct  811  ----RKVLAFLADMNW  822



>ref|XP_007216118.1| hypothetical protein PRUPE_ppa018817mg, partial [Prunus persica]
 gb|EMJ17317.1| hypothetical protein PRUPE_ppa018817mg, partial [Prunus persica]
Length=712

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 71/195 (36%), Positives = 102/195 (52%), Gaps = 20/195 (10%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGI-GEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLE  417
            C+++CG V IP+PFGI G  C L+ WF + C N S+ P  +L    Q+E+    +  +LE
Sbjct  42   CKEKCGGVLIPYPFGIGGTDCYLDDWFEIECSNQSSKP--FLKR-AQLEVLNISIGGTLE  98

Query  416  NQ--TITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQNST  243
                T+     V  FC+ + G + + N TD   SPF YS+ +N+F    CG  L T  S 
Sbjct  99   AMLGTLEVNSPVTFFCNGN-GSSKMANLTD---SPFVYSQDKNRFTAVSCG-FLATMESA  153

Query  242  --VVAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKRC  69
              VV GC ++C  N SS +    GI+CC+T +P  LT  + +     I   G N N    
Sbjct  154  DFVVGGCRSVC-YNQSSAYCDI-GINCCQTTIPPYLTMMSLS-----ILYKGENRNADCD  206

Query  68   NSAFLIDQRWIPKQS  24
            N AFL+D+ W  + S
Sbjct  207  NYAFLVDKDWFDRSS  221



>ref|XP_007147591.1| hypothetical protein PHAVU_006G137500g [Phaseolus vulgaris]
 gb|ESW19585.1| hypothetical protein PHAVU_006G137500g [Phaseolus vulgaris]
Length=714

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 56/193 (29%), Positives = 92/193 (48%), Gaps = 18/193 (9%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEG-CALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLE  417
            C+ RCG+V IPFPFG+    C    WF + C N+S         +++  +  EV ++ +E
Sbjct  30   CDSRCGDVPIPFPFGMKSSECYAEKWFEIECRNASTYTHYSHTPYLK-SIGLEVTSIYVE  88

Query  416  NQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN-SLFTQNSTV  240
              T+T    +  +  +   +++      L GSPF YS+ RNKF+ AGC + ++   N + 
Sbjct  89   AGTVTIKHPI--YRSNCGSKDSPPVNQSLEGSPFVYSQERNKFVAAGCNSIAILKLNGSE  146

Query  239  VAGCTAICGANISSGFAG--------CYGIDCCETPVPFDLTSYTANFTNSGIQSDGSND  84
            V+GC + C  N   G  G        C G  CCE+ +P  L  Y+       I+     +
Sbjct  147  VSGCVSTCNENYKVGDIGNIELRESDCNGTSCCESSLPSYLKEYSIE-----IKGLKEKE  201

Query  83   NLKRCNSAFLIDQ  45
            +   C+ A ++ Q
Sbjct  202  SSHECSYAMVVQQ  214



>ref|XP_006487885.1| PREDICTED: wall-associated receptor kinase 2-like [Citrus sinensis]
Length=596

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 61/191 (32%), Positives = 93/191 (49%), Gaps = 16/191 (8%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEG-CALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLE  417
            C+++CG+V++P+PFGI    CA+N  F +NC    +PPK  +          EV  +S+E
Sbjct  36   CQEKCGHVTVPYPFGIDNSMCAMNKNFFLNCSRGDSPPKLMIGDL-------EVFNLSIE  88

Query  416  NQTITTLKSVVNFCDDSAG-RNAITNG--TDLSGSPFYYSKSRNKFLFAGCGNSLFT--Q  252
            N ++    S  + C D  G RN+  N     L   P  +S +RNK    GC  S +    
Sbjct  89   NGSMIASISTAHRCYDGLGNRNSDYNDPYVKLGNRPLRFSDTRNKLTAIGCDTSAYMGDP  148

Query  251  NSTVVAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKR  72
            N +   GC ++C  N S   + C GI CC+ P+P  L S   N T   I +  +      
Sbjct  149  NGSFWTGCISMC-TNESLNESSCSGIGCCQIPLPQSLKSL--NLTLRSIHNHTNLGKFMP  205

Query  71   CNSAFLIDQRW  39
            C+ A L+D+ +
Sbjct  206  CDYALLVDETF  216



>ref|XP_006492002.1| PREDICTED: wall-associated receptor kinase-like 8-like [Citrus 
sinensis]
Length=223

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 64/188 (34%), Positives = 96/188 (51%), Gaps = 14/188 (7%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C   CGNVSI +PFGIGEGC  +  + V CD+SS  PKA+L    ++EL   V  +S ++
Sbjct  28   CPTECGNVSISYPFGIGEGCYFDKGYEVICDHSSGTPKAFLPGVNRLEL---VDILSNDS  84

Query  413  QTITTLKSVVNFCDDSAGRNA-ITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQN-STV  240
            +    +     F + S+ R + I  G +LSG+PF +S + NKF   GC       N S+V
Sbjct  85   RAAVRVNGPAIFLNSSSKRTSNIAKGVNLSGTPFSFS-TDNKFAAIGCKMRYHQGNGSSV  143

Query  239  VAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKRCNSA  60
              GC +IC  +  + +  CY   C   P      ++  N   S + S       ++C S 
Sbjct  144  FDGCLSICTCD-PTVYPACYDFLCPFRPN----ITHLFNLNKSYLFSQSIP---QKCQSV  195

Query  59   FLIDQRWI  36
            FL+D+ W+
Sbjct  196  FLVDEDWV  203



>ref|XP_008229608.1| PREDICTED: wall-associated receptor kinase-like 3 [Prunus mume]
Length=750

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 68/193 (35%), Positives = 93/193 (48%), Gaps = 27/193 (14%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIG--EGCALNPWFLVNCDNSS--APPKAYLNSFVQIELQGEVVAV  426
            C   CG++SIP+PFGIG  + C  + WF + C+ SS  +P K YL        Q EV+ V
Sbjct  41   CATHCGDISIPYPFGIGPHKDCYFDEWFEMVCNQSSSNSPHKLYLR-----RAQLEVLNV  95

Query  425  SLENQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN-SLFTQN  249
               N T+     +  FC +  G+       +LSGSPF YS   NKF    CG  +L +  
Sbjct  96   -YANGTLRVKNPIAFFCGEYKGQQP----ANLSGSPFVYSGKHNKFTAVSCGYLALVSSE  150

Query  248  STVVAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKR-  72
              +V GC +IC     S      G++CC+T +P  L         S I +D  +D   R 
Sbjct  151  KYLVGGCRSICEGTSISPEDCEIGVNCCQTSIPPHL---------SVINTDIEDDRRARA  201

Query  71   CNS--AFLIDQRW  39
            C    AFL+DQ W
Sbjct  202  CKDVYAFLVDQDW  214



>ref|XP_008229721.1| PREDICTED: wall-associated receptor kinase-like 6 [Prunus mume]
Length=794

 Score = 93.2 bits (230),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 65/199 (33%), Positives = 95/199 (48%), Gaps = 24/199 (12%)
 Frame = -2

Query  593  CEQRCG-NVSIPFPFGIG--EGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVS  423
            C   CG NVSIP+PFG+G  + C  N WF ++C N S   K +L       +Q EV+ +S
Sbjct  45   CTTHCGINVSIPYPFGVGPNKDCYFNEWFQIDC-NESTGHKPFLR-----RVQMEVLNIS  98

Query  422  LENQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN-SLFTQNS  246
            ++      +KS V F     G+       +L+GSPF Y   +N F    CG  +    + 
Sbjct  99   IDG--TLQVKSPVTFFGGCKGKET-HQAPNLTGSPFVYLDRKNMFTAVSCGRLATMRSDE  155

Query  245  TVVAGCTAICGANISSGFA---GCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLK  75
             VV GC + C    +   A   G  G +CC+T +P +++ +TA             D + 
Sbjct  156  NVVQGCNSTCDDQSTDSAAYRCGTSGTNCCQTTIPPNISVFTAEIQ--------PRDQID  207

Query  74   RCNSAFLIDQRWIPKQSTS  18
             CN AFL+DQ W  K  +S
Sbjct  208  GCNYAFLVDQDWFLKNLSS  226



>ref|XP_010664900.1| PREDICTED: wall-associated receptor kinase 2-like [Vitis vinifera]
Length=1385

 Score = 94.0 bits (232),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 62/188 (33%), Positives = 95/188 (51%), Gaps = 14/188 (7%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C+  CG V+IP+PFG  EGC LN  +L+ C+N+ +PPK +L +        EV+ +SL +
Sbjct  36   CQATCGGVTIPYPFGTTEGCYLNRNYLITCNNTFSPPKPFLRTG-----NIEVLNISLVD  90

Query  413  QTITTLKSVVNFC-DDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQN----  249
              +  L  V + C ++  GR  +T  T LS  PF  S +RNKF   GC       N    
Sbjct  91   HYLRVLTPVGSDCYNEKGGRRQVTARTTLSRFPF--SNTRNKFTAIGCDTFAVIMNGMNG  148

Query  248  STVVAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKRC  69
             ++  GC ++C +  S     C GI CC+T +P  L ++  N T S   +     +   C
Sbjct  149  QSISTGCLSMCDSIQSVTNGSCSGIGCCQTSIPKGLLNF--NVTVSSFSNHSDILSFNPC  206

Query  68   NSAFLIDQ  45
            +  FL ++
Sbjct  207  SYTFLTEE  214


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/164 (34%), Positives = 78/164 (48%), Gaps = 11/164 (7%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYL-NSFVQIELQGEVVAVSLE  417
            CE  CG+VSIP+PFG  EGC LN  FL+ C++S +PPK  L NS   +    +V+ +S+E
Sbjct  665  CEATCGDVSIPYPFGTREGCYLNDDFLIACNHSLSPPKPLLWNSSFNL----QVLNISIE  720

Query  416  NQTITTLKSVVNFCDDSAGRNAITNGTDLSGSP-FYYSKSRNKFLFAGCGNSL----FTQ  252
            +  +     V   C D  G+         +  P F +S   N+F   GC           
Sbjct  721  DHRLRIYTFVGRDCYDKMGKQYDQPTLAYANLPRFPFSDKGNRFTAIGCDTIAVFNGLNG  780

Query  251  NSTVVAGCTAICGANISSGFAGCYGIDCCETP-VPFDLTSYTAN  123
                  GC ++C +  S     C GI CC+T  +P  L SY A+
Sbjct  781  ADDFTTGCLSLCNSIRSVTNGSCSGIGCCQTSNIPKGLFSYYAS  824



>ref|XP_006441109.1| hypothetical protein CICLE_v10023424mg, partial [Citrus clementina]
 gb|ESR54349.1| hypothetical protein CICLE_v10023424mg, partial [Citrus clementina]
Length=327

 Score = 90.5 bits (223),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 63/188 (34%), Positives = 96/188 (51%), Gaps = 14/188 (7%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C   CGNVSI +PFGIGEGC  +  + V CD+SS  PKA+L    ++EL   +  +S ++
Sbjct  35   CPTECGNVSISYPFGIGEGCYFDKGYEVICDHSSGSPKAFLPGVNRLEL---LDTLSYDS  91

Query  413  QTITTLKSVVNFCDDSAGRNA-ITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQN-STV  240
            +    +       + S+ R + I  G +LSG+PF +S S NKF   GC       N S+V
Sbjct  92   RPAVRVNVPTISLNSSSKRTSNILKGVNLSGTPFAFS-SDNKFAAIGCNMRYHQGNGSSV  150

Query  239  VAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKRCNSA  60
               C +IC  +  + +  CY   C   P+P ++T    +  N       S    ++C S 
Sbjct  151  FDACLSICTCD-PTLYPACYDFLC---PLPRNIT----HLLNVNTSYLFSQSIPQKCQSV  202

Query  59   FLIDQRWI  36
            FL+D+ W+
Sbjct  203  FLVDEHWV  210



>gb|EMT14340.1| Wall-associated receptor kinase 3 [Aegilops tauschii]
Length=813

 Score = 92.8 bits (229),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 65/181 (36%), Positives = 87/181 (48%), Gaps = 35/181 (19%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C   CG+VS+P+PFGIG+GC   P F + CD +    +  +          EVV +SL N
Sbjct  88   CPPSCGSVSVPYPFGIGQGCYW-PGFNLTCDRAPGRERLLIGGRSGTL---EVVDISLAN  143

Query  413  QTITTLKSVVNFCDDSAGRNAIT-------NGT--DLSGS---PFYYSKSRNKFLFAGCG  270
             T+  +        D+AG   IT       NGT   L+G+   PF  S++RN+FL  GC 
Sbjct  144  STVRVM--------DTAGAVNITYYGIPEGNGTWGGLAGARAGPFVVSETRNQFLVTGCN  195

Query  269  --NSLFTQNSTVVAGCTAICGAN--ISSG-------FAGCYGIDCCETPVPFDLTSYTAN  123
               +L  +   V+ GC+A C  N   SS         A C GI CCETP+P    SY   
Sbjct  196  VQATLLGETGNVIVGCSAFCAVNDRWSSAATSSLEEVAKCAGIGCCETPIPIGRPSYGVE  255

Query  122  F  120
            F
Sbjct  256  F  256



>ref|XP_006385943.1| hypothetical protein POPTR_0003s18440g, partial [Populus trichocarpa]
 gb|ERP63740.1| hypothetical protein POPTR_0003s18440g, partial [Populus trichocarpa]
Length=645

 Score = 92.4 bits (228),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 57/190 (30%), Positives = 94/190 (49%), Gaps = 18/190 (9%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C  RCG+++IP+PFG G+ C  + WF V C+ ++ PP+A+++      ++ EV+ +S+E 
Sbjct  22   CPDRCGDITIPYPFGTGKDCYKDEWFAVECNKTTNPPRAFIS-----RIKMEVLNISVEK  76

Query  413  QTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQN-STVV  237
               T    V++F  +  GR       DL+GSPF +S S N F+  GC    F       V
Sbjct  77   GLATVKSPVISF--NCTGRED-GGSLDLTGSPFVFSDSWNVFIAGGCDTRAFMSGIEPQV  133

Query  236  AGCTAICG---ANIS-SGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKRC  69
             GC   CG   +N+S      C G +CC+  +P  L  +     ++ +     +   + C
Sbjct  134  LGCVPTCGNQRSNVSLQENNMCSGRNCCQASIPSLLQVFKPTLVSTNV-----DQGREAC  188

Query  68   NSAFLIDQRW  39
              A L++  W
Sbjct  189  KLAVLVNGTW  198



>ref|XP_010539563.1| PREDICTED: wall-associated receptor kinase-like 22 [Tarenaya 
hassleriana]
Length=410

 Score = 90.9 bits (224),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 64/209 (31%), Positives = 99/209 (47%), Gaps = 27/209 (13%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C+  CG  +IP+PFGIG+GC L+ W+ + C+N+S  P  +L+      +  EVV +SL  
Sbjct  35   CQSHCGETAIPYPFGIGKGCYLSEWYEIICNNTSGNPVLFLS-----RMNREVVNISLRG  89

Query  413  QTITTLKSV-------VNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN-SLF  258
                   SV        + C D    ++  N   ++GSPF+ +  RN  +  GC N ++ 
Sbjct  90   DFSYEFGSVRIKTPITSSGCSDGEESSSTLN---VTGSPFFLT-GRNSLVAVGCNNRAVM  145

Query  257  TQNSTVVAGCTAICGANISSGF--AGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSND  84
            T     + GC +IC   + S     GC G  CC+  +P      TA     G++ +  + 
Sbjct  146  TNVEPQIGGCESICHEGLDSKGQNTGCNGYRCCQAKIP------TARLQLIGVRIERVDG  199

Query  83   NL--KRCNSAFLIDQRWIPKQSTSLFLEY  3
            N+  K C  AFL D+ + P   T   L Y
Sbjct  200  NITGKTCRVAFLTDETYSPSNITQPELLY  228



>ref|XP_006385946.1| hypothetical protein POPTR_0003s18480g, partial [Populus trichocarpa]
 gb|ERP63743.1| hypothetical protein POPTR_0003s18480g, partial [Populus trichocarpa]
Length=572

 Score = 92.0 bits (227),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 52/164 (32%), Positives = 83/164 (51%), Gaps = 14/164 (9%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C  RCG+++IP+PFG G+ C  + WF + C+ ++ PP+A+++      ++ EV+ +S++ 
Sbjct  33   CPDRCGDITIPYPFGTGKDCYKDEWFAIECNKTTNPPRAFIS-----RIKMEVLNISVKT  87

Query  413  QTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQN-STVV  237
             T T    V++F  +  GR       DL+GSPF +S  RN F+  GC    F       V
Sbjct  88   ATATVKSPVISF--NCTGRKD-GGSLDLTGSPFVFSDFRNVFIAVGCDTRAFMSGIEPQV  144

Query  236  AGCTAICGANISSGFA-----GCYGIDCCETPVPFDLTSYTANF  120
             GC   CG    S  +      C G +CC+  +P  L  +   F
Sbjct  145  LGCVPTCGNQRISNVSMQENNMCSGRNCCQALIPSLLQVFKPRF  188



>gb|EMT09544.1| Wall-associated receptor kinase 5 [Aegilops tauschii]
Length=904

 Score = 92.8 bits (229),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 60/168 (36%), Positives = 83/168 (49%), Gaps = 13/168 (8%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCA---LNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVS  423
            C  +CG+VSIP+PFGIG  CA   LN +F ++CD++  PP+  +       +  E+  +S
Sbjct  182  CPDKCGDVSIPYPFGIGAHCAAISLNSYFNLDCDSTVDPPRPTVGD---PNVAAEIADIS  238

Query  422  LENQTITTLKSVVNFCDDSAGR-NAITNGTDLSGSPFYYSKSRNKFLFAGCGN-SLFT--  255
            L+N  +     V + C  S       T G DL  +PF  S  RN+F   GC    L T  
Sbjct  239  LKNGEMHLYSPVNHICFTSNTTFTKFTTGYDLKRTPFLPSPPRNRFTVIGCNTLGLITGY  298

Query  254  --QNSTVVAGCTAIC-GANISSGFAGCYGIDCCETPVPFDLTSYTANF  120
                   V GC + C G N +S  A C G+ CCE  +P +LTS    F
Sbjct  299  KETAGQYVTGCYSNCEGINNTSEGAPCNGMGCCEVAIPTNLTSLEIKF  346



>ref|XP_007216280.1| hypothetical protein PRUPE_ppa019342mg [Prunus persica]
 gb|EMJ17479.1| hypothetical protein PRUPE_ppa019342mg [Prunus persica]
Length=1064

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 67/192 (35%), Positives = 97/192 (51%), Gaps = 24/192 (13%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIG--EGCALNPWFLVNCDNSS--APPKAYLNSFVQIELQGEVVAV  426
            C   CG++SIP+PFGIG  + C  + WF + C+ SS  +P K YL        Q EV+ V
Sbjct  346  CATHCGDISIPYPFGIGPNKDCYFDEWFEMVCNQSSSTSPHKLYLR-----RAQLEVLNV  400

Query  425  SLENQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN-SLFTQN  249
               N T+     +  FC +  G+       +LSGSPF YS   NKF    CG  +  +  
Sbjct  401  -YANGTLRVNNPIAFFCQEYRGQQP----ANLSGSPFVYSGRHNKFTAVSCGYLASVSSE  455

Query  248  STVVAGCTAIC-GANISSGFAGC-YGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLK  75
              +V GC +IC G +IS     C  G++CC+T +P  L+  + +     I+ D      K
Sbjct  456  KYLVGGCRSICEGTSISP--ENCEIGVNCCQTNIPPHLSVISTD-----IKDDRRGRVCK  508

Query  74   RCNSAFLIDQRW  39
            +   AFL+DQ+W
Sbjct  509  KNIYAFLVDQKW  520



>gb|KHN44654.1| Wall-associated receptor kinase-like 8 [Glycine soja]
Length=690

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 62/170 (36%), Positives = 86/170 (51%), Gaps = 22/170 (13%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIG-EGCALNPWFLVNCDN------SSAPPKAYLNSFVQIELQGEV  435
            C+++CGNV IPFPFG+G E C  + WF ++C N      SS   K YL     I+L  EV
Sbjct  29   CDRKCGNVFIPFPFGMGRENCYASSWFEIDCRNNNTTTNSSGEQKPYLK---YIDL--EV  83

Query  434  VAVSLENQTITTLKSVVNFCDDSAGRN---AITNGTDLSG-SPFYYSKSRNKFLFAGCGN  267
              + L N+ +  +  +       +G+N     T G +L G SPF YS   N FL  GCGN
Sbjct  84   KFIDLWNEALIIMNPIYQ-----SGKNCERDKTGGINLKGGSPFVYSARYNTFLAVGCGN  138

Query  266  SL-FTQNSTVVAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANF  120
            +  F  N   V  C ++C  +     A C G  CC+T +P  L+ Y  +F
Sbjct  139  TASFWSNGEEVRACASMCNGDDLIKVANCRGRKCCQTSLPRHLSEYNVSF  188



>gb|KCW47715.1| hypothetical protein EUGRSUZ_K01465 [Eucalyptus grandis]
Length=625

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 65/201 (32%), Positives = 102/201 (51%), Gaps = 25/201 (12%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C + CGNVSIPFPFGIG GC L+PW+ + C N S P    LN   +I L+  V+ +SL N
Sbjct  31   CVETCGNVSIPFPFGIGAGCFLDPWYEIVCQNRSVP---ILN---KIGLR--VLNISLPN  82

Query  413  --QTITTLKSV---VNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGC-GNSLFTQ  252
              + +  + SV   + +   S G   +    + +GS F +S++ N F   GC   ++   
Sbjct  83   YREFVDGMISVSLPLIYSSASCGGEGLGARVNFNGSQFVFSQTENVFTSVGCNAQTIVNS  142

Query  251  NSTVVAGCTAIC-GANISSG-FAGCYGID-CCETPVPFDLTSYTANFTNSGIQSDGSNDN  81
              + V GC + C G+N   G ++ C+G D CC+T + F+L  +  +F             
Sbjct  143  TESAVVGCRSKCAGSNADIGPYSACFGRDQCCQTTLSFNLQGFDVDFQ--------EERE  194

Query  80   LKRCNSAFLIDQRWIPKQSTS  18
             + C  AFL D+ W  + + +
Sbjct  195  PQGCKYAFLADRSWFLRSNVT  215



>ref|XP_006663676.1| PREDICTED: wall-associated receptor kinase 5-like [Oryza brachyantha]
Length=722

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 59/196 (30%), Positives = 98/196 (50%), Gaps = 19/196 (10%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPW--FLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSL  420
            C  +CG V IP+PFGIGEGCA      F V+CD+S +PP+ Y ++        E++ +SL
Sbjct  44   CPSKCGEVEIPYPFGIGEGCARPGLDNFTVDCDHSFSPPRPYFSNI-------EIIDISL  96

Query  419  ENQTITTLKSVVNFCDDSAGRNAITNGTD---LSGSPFYYSKSRNKFLFAGCGNSLF---  258
            E   +     VV  C +S+     + G D   ++G PF  +++RN+F   GCG +     
Sbjct  97   EAGEMRIYTLVVYDCYNSSNTTDNSQGFDSLNVTGLPFLLAQTRNEFTAVGCGAAALLWG  156

Query  257  TQNSTVVAGCTAICGANISSGFAG--CYGIDCCETP-VPFDLTSYTANFTNSGIQSDGSN  87
              + + + GC + C +   +   G  C G+ CC+ P +P +L++    +  +G   D   
Sbjct  157  RDDGSYLTGCISTCMSLDEAANDGDPCTGLGCCQVPSIPPNLSTIAMTWA-TGNLGDNYA  215

Query  86   DNLKRCNSAFLIDQRW  39
                 C  AF+ ++ W
Sbjct  216  WREAPCRYAFVAEKGW  231



>ref|XP_004486489.1| PREDICTED: wall-associated receptor kinase-like 8-like [Cicer 
arietinum]
Length=725

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 66/194 (34%), Positives = 90/194 (46%), Gaps = 18/194 (9%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGE-GCALNPWFLVNC--DNSSAPPKAYLNSFVQIELQGEVVAVS  423
            C   CG +SIPFPFG+ E  C  + WF V C  DN+S   K YL S     L  EV    
Sbjct  38   CASTCGTISIPFPFGMNEPHCYAHKWFEVECKLDNTSHIEKPYLKS-----LNLEVTLFD  92

Query  422  LENQTITTLKSVVN--FCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQ-  252
            + +  +  +  + +     ++   N  T   +L  SPF YS+  N FL  GC N  F Q 
Sbjct  93   VNSALVEIMNPIYHSNCKKNNNNNNNKTVVINLKDSPFIYSQQYNTFLAVGCNNLAFLQS  152

Query  251  NSTVVAGCTAIC---GANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDN  81
            N T V GC +IC     N +     C G  CCET +P  L  Y A  T  G++ + S+ +
Sbjct  153  NGTTVGGCVSICEDNNNNFNLESRSCNGRYCCETSLPMHLAEYNA--TLQGLRKESSDHD  210

Query  80   LKRCNSAFLIDQRW  39
               C+ A +    W
Sbjct  211  --ECSYALIASDFW  222



>gb|KCW47700.1| hypothetical protein EUGRSUZ_K01438 [Eucalyptus grandis]
Length=725

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 71/198 (36%), Positives = 100/198 (51%), Gaps = 22/198 (11%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSL--  420
            C Q+CG V+IPFPFGIG GC L+ W+ + C  SS      LN     ++   V+ +SL  
Sbjct  43   CTQKCGEVTIPFPFGIGTGCFLDEWYEIVCQESSNGSVPVLN-----KVNLRVLNISLPD  97

Query  419  ----ENQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCG-NSLFT  255
                 N  I     ++   + S G N       L GS F +S+SRN F   GCG   L  
Sbjct  98   YDGNTNGIINVSLPILYSSNVSCGVNKSFAPVSLKGSQFVFSESRNVFAAVGCGIRFLMD  157

Query  254  QNSTVVAGCTAICGA-NISSGFAGCYGID-CCETPVPFDLTSYTANFT-NSGIQSDGSND  84
               + + GCT+ CGA N   G   C G D CC+T +  DL ++  NF  N+G  + G+N+
Sbjct  158  DTKSAIIGCTSSCGADNDVVGNVTCSGSDGCCQTTITSDLQAFRVNFQPNNG--TVGNNE  215

Query  83   NLKRCNSAFLIDQ-RWIP  33
                C  AFL D+ +++P
Sbjct  216  ----CKYAFLGDRSQFVP  229



>ref|XP_011082237.1| PREDICTED: wall-associated receptor kinase-like 2 [Sesamum indicum]
Length=728

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 65/189 (34%), Positives = 101/189 (53%), Gaps = 20/189 (11%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIG--EGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSL  420
            C  +CG++++P+PFGIG    C++NP F +NC++S  PPKA+L +        EVV +S 
Sbjct  46   CPSKCGDLNVPYPFGIGIKANCSINPSFDINCNSSFDPPKAFLGNL-------EVVGIS-  97

Query  419  ENQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN-SLFTQNST  243
            E Q I     + + C++S   +   +  DLSG+PF  S ++NK    GC + SL ++ S 
Sbjct  98   ETQ-IRIKNHLASICNNSIDNSM--SVLDLSGTPFSLS-NQNKLTVVGCNHVSLMSKESK  153

Query  242  V---VAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKR  72
            +   ++ C A+C          C GI CC+  +P  L  Y A  T   + +  SNDN   
Sbjct  154  LDNYISSCIAVCSKPQELSDGSCSGIGCCQASIPKGL-QYIAT-TMLLLNAQSSNDNFNP  211

Query  71   CNSAFLIDQ  45
            C  +FL +Q
Sbjct  212  CGYSFLAEQ  220



>gb|EMS50137.1| Wall-associated receptor kinase 3 [Triticum urartu]
Length=752

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 72/218 (33%), Positives = 98/218 (45%), Gaps = 42/218 (19%)
 Frame = -2

Query  596  RCEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSA-PPKAYLNSFVQIELQGEVVAVSL  420
            RC   CG V +P+PFGIG GC   P F + CD +    P+  + S +Q      VV +SL
Sbjct  32   RCPTSCGGVKVPYPFGIGNGCH-RPGFNLTCDRTRGREPRLLVGSDLQ------VVEISL  84

Query  419  ENQTITTLKSVVNFCDDSAGRNAIT--NGTD--------LSGSPFYYSKSRNKFLFAGCG  270
             N T+  L        DSAG+  +T   G D         +G P+  S+ RN F+  GC 
Sbjct  85   ANSTVKIL--------DSAGQVKLTFSGGLDGTGTWGGLGAGGPYVLSEMRNHFVVTGCN  136

Query  269  -NSLFTQNSTVVAGCTAICGAN--------ISSGFAG--CYGIDCCETPVPFDLTSYTAN  123
              +    +  VV  C++ C  N         S+G+ G  C GI CCETP+P    SY   
Sbjct  137  VQATLVGDGGVVGCCSSFCSINDKWTGVVTSSAGYGGAACSGIGCCETPIPIGRPSYDVE  196

Query  122  FTNSGIQSDGSNDNLKRCNSAFLIDQR-WIPKQSTSLF  12
              +     D SN+   R   A  I +R W    ST+L 
Sbjct  197  MRS----LDASNEYADRLPIAVRIAERGWFEGASTTLL  230



>gb|KHN40782.1| Wall-associated receptor kinase-like 22 [Glycine soja]
Length=684

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 64/189 (34%), Positives = 88/189 (47%), Gaps = 22/189 (12%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEG-CALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLE  417
            C+  CG+V IP+PFG+    C    WF + C NS+ P   YL S   I L  EV+++ + 
Sbjct  21   CDSGCGDVPIPYPFGMNRSECYAGKWFEIECRNSTRP---YLKS---IGLGVEVLSIDVN  74

Query  416  NQTITTLKSVV--NFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQ-NS  246
              T+     +   N C     ++   N   L GSPF YS+  NKF+ AGC N  F +   
Sbjct  75   EGTVDINNPIYRSNNCGTRTTKHPAVNNISLEGSPFVYSQRNNKFVAAGCNNIAFLKGKG  134

Query  245  TVVAGCTAICG-----ANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDN  81
            + V+GC +IC       N + G   C G  CCE  +P  L+ YT           G N+N
Sbjct  135  SAVSGCVSICDNDDDVGNTNLGRIECNGESCCENSLPMYLSEYTPEIK-------GLNEN  187

Query  80   LKRCNSAFL  54
             K    A L
Sbjct  188  KKDFVPAVL  196



>gb|AAY34779.1| wall-associated kinase-like 1 [Triticum aestivum]
Length=753

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 72/218 (33%), Positives = 98/218 (45%), Gaps = 42/218 (19%)
 Frame = -2

Query  596  RCEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNS-SAPPKAYLNSFVQIELQGEVVAVSL  420
            RC   CG V +P+PFGIG GC   P F + CD +    P+  + S +Q      VV +SL
Sbjct  33   RCPTSCGGVKVPYPFGIGNGCH-RPGFNLTCDRTRGGEPRLLVGSDLQ------VVEISL  85

Query  419  ENQTITTLKSVVNFCDDSAGRNAIT--NGTD--------LSGSPFYYSKSRNKFLFAGCG  270
             N T+  L        DSAG+  +T   G D         +G P+  S+ RN F+  GC 
Sbjct  86   TNSTVRIL--------DSAGQVKLTFSGGLDGTGTWGGLGAGGPYMLSEMRNHFVVTGCN  137

Query  269  -NSLFTQNSTVVAGCTAICGAN--------ISSGFAG--CYGIDCCETPVPFDLTSYTAN  123
              +    +  VV  C++ C  N         S+G+ G  C GI CCETP+P    SY   
Sbjct  138  VQATLVGDGGVVGCCSSFCSINDRWMGVVTSSAGYGGAACSGIGCCETPIPIGRPSYDVE  197

Query  122  FTNSGIQSDGSNDNLKRCNSAFLIDQR-WIPKQSTSLF  12
              +     D SN+   R   A  I +R W    ST+L 
Sbjct  198  MRS----LDASNEYADRLPIAVRIAERGWFEGASTTLL  231



>ref|XP_006421679.1| hypothetical protein CICLE_v10006761mg [Citrus clementina]
 gb|ESR34919.1| hypothetical protein CICLE_v10006761mg [Citrus clementina]
Length=291

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 64/188 (34%), Positives = 90/188 (48%), Gaps = 17/188 (9%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C   CGNVSI +PFGIG+GC  +  + V CDNSS  PKA+L S ++ EL       S  +
Sbjct  41   CPTECGNVSIIYPFGIGKGCYFDKGYEVICDNSSGSPKAFLPS-IKTELLD-----SYSD  94

Query  413  QTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFT--QNSTV  240
             TI     V+   +  A RN +    +LSGS F +    NKF   GC N       +STV
Sbjct  95   TTIRVNIPVIFLHNRIATRNHMAREVNLSGSAFTFPWRLNKFTAIGCDNYAIDLGNDSTV  154

Query  239  VAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKRCNSA  60
              GC ++C  + +   +GCY   C   P+   L +  + F +  I        L+ C S 
Sbjct  155  SGGCLSVCTCDPTQK-SGCYDFLCSIPPISKVLNANLSYFYSQSI--------LQNCRSV  205

Query  59   FLIDQRWI  36
             L+   W+
Sbjct  206  SLVQGDWL  213



>ref|XP_006493342.1| PREDICTED: putative wall-associated receptor kinase-like 13-like 
[Citrus sinensis]
Length=691

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 65/189 (34%), Positives = 99/189 (52%), Gaps = 16/189 (8%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C   CGNVSI +PFGIGEGC  +  + V CD+SS  PKA+L    ++EL   +  +S ++
Sbjct  28   CPTECGNVSISYPFGIGEGCYFDKGYEVICDHSSGSPKAFLPGVNRLEL---LDTLSYDS  84

Query  413  QTITTLKSVVNFCDDSAGRNA-ITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQ--NST  243
                 +       + S+ R + I  G +LSG+PF +S S NKF   GC N  + Q  +S+
Sbjct  85   SPAVRVNVPTISLNSSSKRTSNILKGVNLSGTPFAFS-SDNKFAAIGC-NMRYHQGNDSS  142

Query  242  VVAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKRCNS  63
            V  GC +IC  +  + +  CY   C   P+P ++T    +  N       S    ++C S
Sbjct  143  VFDGCLSICTCD-PTLYPACYDFLC---PLPRNIT----HLLNVNTSYLFSQSIPQKCQS  194

Query  62   AFLIDQRWI  36
             FL+D+ W+
Sbjct  195  VFLVDEHWV  203



>gb|EMT07482.1| Wall-associated receptor kinase 2 [Aegilops tauschii]
Length=659

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 66/177 (37%), Positives = 93/177 (53%), Gaps = 22/177 (12%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLV-NCDNSSAPPKAYLNSFVQIELQGEVVAVSLE  417
            C   CG+++IP+PFGIG GC L+ + L  N D S  PPK +L          EV+ +SLE
Sbjct  6    CPSSCGDIAIPYPFGIGPGCYLDGFNLTCNDDGSHRPPKLFLGDGTV-----EVLEISLE  60

Query  416  NQTITTLKSVVNFCDDSAGRNAITNGTDLSGS-PFYYSKSRNKFLFAGCGNS---LFTQN  249
            N T+  + SVV+  +D+      T G+ L+G+ PFY +  RN+ +  GC      L  +N
Sbjct  61   NTTV-RVSSVVD-TNDTVVPGVGTWGSGLAGAGPFYLTGQRNQLVVRGCNMQAVLLDARN  118

Query  248  ST-VVAGCTAICG---------ANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSG  108
            S+ VVA CT+IC          A  S     C G+ CC+T +   LTSYT   +  G
Sbjct  119  SSYVVAACTSICAYVNSNPGLPALASQPMDHCSGVSCCQTSIYVGLTSYTVQLSPVG  175



>ref|XP_003534786.1| PREDICTED: wall-associated receptor kinase-like 22-like [Glycine 
max]
Length=712

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 62/167 (37%), Positives = 85/167 (51%), Gaps = 16/167 (10%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIG-EGCALNPWFLVNCD------NSSAPPKAYLNSFVQIELQGEV  435
            C+++CGNV IPFPFG+G E C  + WF ++C       NSS   K YL     I+L  EV
Sbjct  45   CDRKCGNVFIPFPFGMGRENCYASSWFEIDCRNNNTTTNSSGEQKPYLK---YIDL--EV  99

Query  434  VAVSLENQTITTLKSVVNFCDDSAGRNAITNGTDLS-GSPFYYSKSRNKFLFAGCGNSL-  261
              + L N+ +  +  +      +  RN  T G +L  GSPF YS   N FL  GCGN+  
Sbjct  100  KFIDLWNEALIIMNPIYQ-SGKNCERNK-TGGINLKGGSPFVYSARYNTFLAVGCGNTAS  157

Query  260  FTQNSTVVAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANF  120
            F  N   V+GC ++C  +       C G  CCE  +P  L+ Y  +F
Sbjct  158  FWSNGEEVSGCASMCNGDDLIKVDNCRGRKCCEASLPRYLSEYNVSF  204



>ref|XP_011018200.1| PREDICTED: wall-associated receptor kinase-like 22 [Populus euphratica]
Length=583

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 83/161 (52%), Gaps = 12/161 (7%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C   CGNVSIP+PFG+ EGC  +    + C NSS  P   +N    +     V  +S+ +
Sbjct  38   CPGVCGNVSIPYPFGMREGCYHDESLKILC-NSSEIPLLSINGTDLV-----VTDISVGD  91

Query  413  QTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN-SLFTQNSTVV  237
             TIT    +V    D   RN +    DL GSPF +S   N F+ +GC N +L  QN + V
Sbjct  92   STITVNFPIVFANCDGKERNTV---FDLEGSPFVFSSDLNNFIASGCDNLALLIQNQSAV  148

Query  236  AGCTAICGANISSGF--AGCYGIDCCETPVPFDLTSYTANF  120
             GC +IC    S+ +  + C GI+CC+T +P  L  Y   F
Sbjct  149  GGCMSICDHERSNNYLLSSCSGINCCQTSIPSYLKVYNVTF  189



>ref|XP_006388726.1| putative wall-associated kinase family protein [Populus trichocarpa]
 gb|ERP47640.1| putative wall-associated kinase family protein [Populus trichocarpa]
Length=303

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 64/193 (33%), Positives = 98/193 (51%), Gaps = 22/193 (11%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C  RCGN+SIP+PFGIG+ C +   F V C+ +S PP+A+L S     ++ E+V ++LE 
Sbjct  35   CSDRCGNISIPYPFGIGKDCYMEESFDVECNETSKPPRAFLRS-----IKMELVNITLEG  89

Query  413  QTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN--SLFTQNST-  243
              +  +   V   D S  +  +T   +L G+PF +S + N F+  GC    +L+T+  T 
Sbjct  90   GAV--VNGPVISVDSSGRQEGVT--VNLEGTPFLFSYT-NYFIAVGCNTRAALWTKKGTD  144

Query  242  VVAGCTAICG-----ANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNL  78
               GC +IC      +NI  G + C G DCC+      L      F ++ +  +G   + 
Sbjct  145  EHVGCDSICSNASSISNIRFGNSSCSGKDCCQD---MYLPPSLQVFNSTVVSKEGKQGSD  201

Query  77   KRCNSAFLIDQRW  39
             R   AFL D  W
Sbjct  202  GR-KLAFLADTNW  213



>dbj|BAK02349.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=752

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 57/168 (34%), Positives = 83/168 (49%), Gaps = 13/168 (8%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCA---LNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVS  423
            C  +CG+V IP+PFGIG  CA   L+ +F + C+ +  PP+  + +    E   E+  +S
Sbjct  30   CPDKCGDVPIPYPFGIGTHCAATSLSSYFNLTCNGTMDPPRPMVGN---DEAVVEITDIS  86

Query  422  LENQTITTLKSVVNFCDDSAGR-NAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQN-  249
            LE+  +  L  V + C  S         G +L  +PF  S SRN+F   GC         
Sbjct  87   LEHGEMRVLSPVNHICFTSETTFTKFLGGYELQLTPFLPSPSRNRFTVIGCNTLGLISGY  146

Query  248  ----STVVAGCTAIC-GANISSGFAGCYGIDCCETPVPFDLTSYTANF  120
                S  VAGC + C G N ++  A C G+ CCE  +P +LTS+   F
Sbjct  147  KGTASQYVAGCYSYCEGVNNTTEGAPCAGMGCCEAAIPANLTSFGVKF  194



>ref|XP_007217318.1| hypothetical protein PRUPE_ppa017167mg, partial [Prunus persica]
 gb|EMJ18517.1| hypothetical protein PRUPE_ppa017167mg, partial [Prunus persica]
Length=715

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 63/199 (32%), Positives = 95/199 (48%), Gaps = 24/199 (12%)
 Frame = -2

Query  593  CEQRCG-NVSIPFPFGIG--EGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVS  423
            C   CG NVSIP+PFG+G  + C  N WF ++C N S   K +L        Q EV+ +S
Sbjct  22   CPTHCGINVSIPYPFGVGPNKDCYFNEWFQIDC-NESTGHKPFLR-----RSQMEVLNIS  75

Query  422  LENQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN-SLFTQNS  246
            ++      +KS V F     G+       +L+GSPF Y   +N F    CG  +    + 
Sbjct  76   IDG--TLQVKSPVTFSGGCKGKET-RQAPNLTGSPFVYLDRKNMFTAVSCGRLATMRSDE  132

Query  245  TVVAGCTAIC---GANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLK  75
             VV GC++ C     + ++   G  G +CC+T +P +++ +T              D + 
Sbjct  133  NVVHGCSSTCDDQSTDSATHRCGTIGTNCCQTTIPPNISVFTTEIQ--------PRDQID  184

Query  74   RCNSAFLIDQRWIPKQSTS  18
             CN AFL+DQ W  K  +S
Sbjct  185  GCNYAFLVDQDWFLKNLSS  203



>gb|EMT09541.1| Wall-associated receptor kinase 5 [Aegilops tauschii]
Length=752

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 57/168 (34%), Positives = 84/168 (50%), Gaps = 13/168 (8%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCA---LNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVS  423
            C  +CG+V IP+PFGIG  CA   L+ +F + C+++  PP+  + +    E   E+  +S
Sbjct  30   CPDKCGDVPIPYPFGIGTHCAATSLSSYFNLTCNSTIHPPRPMVGN---DEAVVEITNIS  86

Query  422  LENQTITTLKSVVNFCDDS-AGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQN-  249
            LE+  +  L  V + C  S         G +L  +PF  S SRN+F   GC         
Sbjct  87   LEHGEMRVLSPVNHICFTSDTTFTKFLGGYELQLTPFLPSPSRNRFTVIGCNTLGLISGY  146

Query  248  ----STVVAGCTAIC-GANISSGFAGCYGIDCCETPVPFDLTSYTANF  120
                S  VAGC + C G N ++  A C G+ CCE  +P +LTS+   F
Sbjct  147  KGTASQYVAGCYSYCEGVNNTTEGAPCAGMGCCEAAIPANLTSFGVKF  194



>ref|XP_010063910.1| PREDICTED: putative wall-associated receptor kinase-like 16 [Eucalyptus 
grandis]
Length=753

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 60/190 (32%), Positives = 96/190 (51%), Gaps = 13/190 (7%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNC---DNSSAPPKAYLNSFVQIELQGEVVAVS  423
            C++ CGNVS+P+PFGIGEGC+LN +F++ C   DN+++ PK YL      +   EV+ +S
Sbjct  37   CQETCGNVSVPYPFGIGEGCSLNNYFVIGCRVPDNTTSTPKPYL-----WDSNTEVLDIS  91

Query  422  LENQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQNST  243
            L+ +         +   DS  R           S F +S ++NKF   GC        S 
Sbjct  92   LDGELRINTYIGKDCYKDSGVRQQPRTFAYSVLSAFPFSNTKNKFTAIGCDTVAVIAGSN  151

Query  242  ---VVAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKR  72
                 +GC ++C          C GI CC+TP+P  L +Y A+ ++    S+  + N   
Sbjct  152  GQGFSSGCLSVCAGIDDVTDGACDGIGCCQTPIPKMLLNYNASVSSMNNHSNVWSFN--P  209

Query  71   CNSAFLIDQR  42
            C+ AF+++ +
Sbjct  210  CSYAFIVEDK  219



>gb|EMS55835.1| Wall-associated receptor kinase 5 [Triticum urartu]
Length=742

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 66/195 (34%), Positives = 93/195 (48%), Gaps = 17/195 (9%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCAL---NPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVS  423
            C  +CG+V IP+PFGIGE CA    N +F + C+++  PP+  +      E   EV  +S
Sbjct  18   CPDKCGDVPIPYPFGIGEDCAAASRNNYFNLICNSTIDPPRPMVG---YPEAVAEVADIS  74

Query  422  LENQTITTLKSVVNFCDDSAGR-NAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFT---  255
            LE+  +  L  V + C +S       T G  L  +PF  S SRN F   GC         
Sbjct  75   LEHGEMRVLSPVSHICFNSNTTFTKFTGGYQLQDTPFLPSPSRNHFTVIGCNTMGLIGGQ  134

Query  254  --QNSTVVAGCTAIC-GANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSND  84
                S  VAGC + C G N +S  A C G+ CCE+ +P +LT++   F  +  Q  G N 
Sbjct  135  KGAASQYVAGCYSYCDGVNNTSDGAPCAGMGCCESAIPANLTTFEVIFATNQSQVWGFNP  194

Query  83   NLKRCNSAFLIDQRW  39
                C  A + +  W
Sbjct  195  ----CFYAMIAEVGW  205



>gb|KHN44652.1| Wall-associated receptor kinase-like 22 [Glycine soja]
Length=289

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 61/167 (37%), Positives = 84/167 (50%), Gaps = 16/167 (10%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIG-EGCALNPWFLVNC------DNSSAPPKAYLNSFVQIELQGEV  435
            C+++CGNV IPFPFG+G E C  + WF ++C       NSS   K YL     I+L  EV
Sbjct  45   CDRKCGNVFIPFPFGMGRENCYASSWFEIDCRNNNTTTNSSGEQKPYLK---YIDL--EV  99

Query  434  VAVSLENQTITTLKSVVNFCDDSAGRNAITNGTDLS-GSPFYYSKSRNKFLFAGCGNSL-  261
              + L  + +  +  +      +  RN  T G +L  GSPF YS   N FL  GCGN+  
Sbjct  100  KFIDLWKEALIIMNPIYQ-SGKNCERNK-TGGINLKGGSPFVYSARYNTFLAVGCGNTAS  157

Query  260  FTQNSTVVAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANF  120
            F  N   V+GC ++C  +       C G  CCE  +P  L+ Y  +F
Sbjct  158  FWSNGEEVSGCASMCNGDDLIKVDNCRGRKCCEASLPRYLSEYNVSF  204



>ref|XP_009356575.1| PREDICTED: wall-associated receptor kinase-like 1 [Pyrus x bretschneideri]
Length=742

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 65/195 (33%), Positives = 97/195 (50%), Gaps = 26/195 (13%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C+  CG++ IP+PFGI  GC ++ WF + CDNS+  P  +LN         EV+ +S E 
Sbjct  34   CQSHCGDIEIPYPFGIAAGCFIDDWFQIICDNSTGNPTPFLN-----RTNLEVLEISAEG  88

Query  413  QTITTLKSVV--NFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCG-NSLFTQNS-  246
             T+     +   N  +    R       +L GSPF YS   N F   GCG  +  T NS 
Sbjct  89   GTLRVTNPITFSNCSNKPIDRQT----ANLEGSPFAYS-IMNVFTAVGCGFMATITSNSN  143

Query  245  --TVVAGCTAIC--GANISSGFAG--CYGIDCCETPVPFDLTSYTANFTNSGIQSDGSND  84
              ++ +GC + C    N S+G      YG++ C+T +P  L++++ +F     Q D  N 
Sbjct  144  GYSISSGCKSECDISKNKSTGTRHNVWYGVNWCQTAIPSFLSAFSTSF-----QPDDDN-  197

Query  83   NLKRCNSAFLIDQRW  39
                CN AFL+D+ W
Sbjct  198  TPSSCNYAFLVDREW  212



>gb|EEC69674.1| hypothetical protein OsI_39110 [Oryza sativa Indica Group]
Length=519

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 61/169 (36%), Positives = 87/169 (51%), Gaps = 15/169 (9%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCA---LNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVS  423
            C  +CGN+SIP+PFGIG  CA   ++ +F + C+N+  PP+  +      E   EV  +S
Sbjct  37   CPDKCGNISIPYPFGIGPSCAATSISSYFNLTCNNTFNPPRPMVGDS---EALVEVTDIS  93

Query  422  LENQTITTLKSVVNFC-DDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQN-  249
            LE+  +  L  V   C   +      T G +L  +PF  S SRN+F   GC N+L     
Sbjct  94   LEHGEMRVLSPVYYICFTANTTFTKFTEGYELKRTPFLPSPSRNRFTVIGC-NTLGLIGG  152

Query  248  -----STVVAGCTAICGA-NISSGFAGCYGIDCCETPVPFDLTSYTANF  120
                 S  V GC + C + N +S  A C G+ CCE  +P DLT++ A F
Sbjct  153  YKGTVSHYVTGCYSYCESINSTSDGAPCAGMGCCEAAIPTDLTAWGAMF  201



>gb|KCW71197.1| hypothetical protein EUGRSUZ_F04287 [Eucalyptus grandis]
Length=694

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 60/190 (32%), Positives = 96/190 (51%), Gaps = 13/190 (7%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNC---DNSSAPPKAYLNSFVQIELQGEVVAVS  423
            C++ CGNVS+P+PFGIGEGC+LN +F++ C   DN+++ PK YL      +   EV+ +S
Sbjct  37   CQETCGNVSVPYPFGIGEGCSLNNYFVIGCRVPDNTTSTPKPYL-----WDSNTEVLDIS  91

Query  422  LENQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQNST  243
            L+ +         +   DS  R           S F +S ++NKF   GC        S 
Sbjct  92   LDGELRINTYIGKDCYKDSGVRQQPRTFAYSVLSAFPFSNTKNKFTAIGCDTVAVIAGSN  151

Query  242  ---VVAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKR  72
                 +GC ++C          C GI CC+TP+P  L +Y A+ ++    S+  + N   
Sbjct  152  GQGFSSGCLSVCAGIDDVTDGACDGIGCCQTPIPKMLLNYNASVSSMNNHSNVWSFN--P  209

Query  71   CNSAFLIDQR  42
            C+ AF+++ +
Sbjct  210  CSYAFIVEDK  219



>ref|XP_002274809.1| PREDICTED: wall-associated receptor kinase-like 8 [Vitis vinifera]
Length=718

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 63/187 (34%), Positives = 98/187 (52%), Gaps = 20/187 (11%)
 Frame = -2

Query  593  CEQ-RCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLE  417
            CEQ  CG++ IP+PFG+G+ C  + WF ++C +S  PPK  L+     +L  EV+++ ++
Sbjct  33   CEQDHCGDILIPYPFGMGKSCYKDEWFSISCSHSFDPPKPILS-----KLNLEVLSIEMD  87

Query  416  NQTITTLKSVVNFCDDSAGRNAIT----NGTDLSGSPFYYSKSRNKFLFAGCGNSLFT-Q  252
                + + +   + +   G   +T       DL GSPF YS   N  +  GC N L   +
Sbjct  88   RFQKSVMVNSPIYSNCENGEVEVTSSPWQSRDLWGSPFLYS-LHNDLVGVGCHNVLLRDR  146

Query  251  NSTVVAGCTAICGANISSGFAGC-YGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLK  75
            N  ++AGC + C  +I++   GC YGI+CC T +  DL  Y+ + T S  +  G  D   
Sbjct  147  NEEIMAGCASTCDKSITT--KGCLYGINCCLTRLQEDLDFYSLSTTASSSER-GDPD---  200

Query  74   RCNSAFL  54
             C  AFL
Sbjct  201  -CTYAFL  206



>ref|XP_006495028.1| PREDICTED: wall-associated receptor kinase 2-like [Citrus sinensis]
Length=341

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 61/193 (32%), Positives = 92/193 (48%), Gaps = 18/193 (9%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEG-CALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLE  417
            C+++CG+V++P+PFGI    CA+N  F +NC    +PPK  +          EV  +S+E
Sbjct  36   CQEKCGHVTVPYPFGIDNSMCAMNKNFFLNCSRGDSPPKLMIGDL-------EVFNLSIE  88

Query  416  NQTITTLKSVVNFCDDSAG-RNAITNG--TDLSGSPFYYSKSRNKFLFAGCGNSLFT--Q  252
            N ++    S  + C D  G RN+  N     L   P  +S +RNK    GC  S +    
Sbjct  89   NGSMIASISTAHRCYDGLGNRNSDYNDPYVKLGNRPLRFSDTRNKLTAIGCDTSAYMGDP  148

Query  251  NSTVVAGCTAICGANISSGF--AGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNL  78
            N +   GC ++C  N S+    + C GI CC+TP+P  L S   N T   +         
Sbjct  149  NGSFWTGCISMC-TNESAKLNESSCSGIGCCQTPLPKSLKSL--NLTLRSVYDHEDMGKF  205

Query  77   KRCNSAFLIDQRW  39
              C+ A L D+ +
Sbjct  206  MPCDYAILADETF  218



>gb|EEC85059.1| hypothetical protein OsI_32393 [Oryza sativa Indica Group]
Length=366

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 58/214 (27%), Positives = 106/214 (50%), Gaps = 33/214 (15%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C   CGN+SIP+PFGIG GCA +  F + C+++S+PP   +++      + +++++SL +
Sbjct  27   CPSTCGNISIPYPFGIGAGCARDEGFQLECNHTSSPPLLIVSNSTGGRHRQQLLSLSLAD  86

Query  413  QTITTLKSVVNFCDDSAGRNAIT----NGTD--LSGSPFYYSKSRNKFLFAGCGN--SLF  258
                T  +    C +S+  + ++    N T+  LSG+P+ +S+SRN+ +  GC N   L 
Sbjct  87   GEARTFLTAKRRCYNSSTGDMVSENDQNATEMSLSGTPYRFSRSRNRLVALGCPNLAYLV  146

Query  257  TQNSTVVAGCTAIC------GANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSD  96
                + ++ CT+IC       A  + GF    G  CC++ +P+ +  Y  +    G +  
Sbjct  147  DGRGSYISSCTSICRTPESVAAGSTVGFT---GEGCCQSSIPYSVDVYKPDII--GFKQG  201

Query  95   GSNDNL--------------KRCNSAFLIDQRWI  36
             + D++                C   +L + RWI
Sbjct  202  QAGDSVLLNSTAASSILQSSTVCRYMYLAEDRWI  235



>ref|XP_009404603.1| PREDICTED: putative wall-associated receptor kinase-like 16 [Musa 
acuminata subsp. malaccensis]
Length=737

 Score = 90.5 bits (223),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 60/185 (32%), Positives = 90/185 (49%), Gaps = 9/185 (5%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C  +CGNVSIP+PFG   GC L+  F V+C+ +  PPK +L++        EV  +S + 
Sbjct  30   CSGKCGNVSIPYPFGTSSGCYLSHGFYVSCNTTYNPPKLFLST-----TDIEVAEISQDG  84

Query  413  QTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQNS--TV  240
             TI T  +   F     G N  +  TD++G P+ +S SRN F   GC        S  + 
Sbjct  85   VTIYTPIARDCFSGLGLGTNINSISTDVTGLPYTFSYSRNMFTALGCDTVALNYQSSFSF  144

Query  239  VAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKRCNSA  60
             +GC + C    S     C GI CC+T +P  L S      +  +++  +      C+ A
Sbjct  145  SSGCLSYCSDKSSIVNGSCAGIGCCQTSIPKGLKSIYTILRS--VKNHSTTWTFSPCSYA  202

Query  59   FLIDQ  45
            FL+D+
Sbjct  203  FLVDR  207



>ref|XP_006368675.1| hypothetical protein POPTR_0001s07640g, partial [Populus trichocarpa]
 gb|ERP65244.1| hypothetical protein POPTR_0001s07640g, partial [Populus trichocarpa]
Length=314

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 57/197 (29%), Positives = 95/197 (48%), Gaps = 26/197 (13%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C  RCG++SIP+PFGI + C +N WF + C+ S  P +A+++      +  EV+ +S E 
Sbjct  28   CPDRCGDISIPYPFGIRKDCYMNEWFAIECNASVNPARAFIS-----RINMEVLNISAER  82

Query  413  QTITTLKSVVNFCDDSAGRNAITNGT--DLSGSPFYYSKSRNKFLFAGCG-NSLFTQNST  243
             T T    +++   +  GR    +G   +L+G+PF +S+  N F+  GC   +L T  + 
Sbjct  83   ATATVKSPIIS--SNCTGRE---DGVPLNLTGTPFVFSRYDNVFIAVGCNTQALMTGITP  137

Query  242  VVAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKRCNS  63
             + GC + C    S  F        CE  +P  L  +     N  I++   N + + C  
Sbjct  138  NLIGCVSTCSDVKSKNF--------CEALLPSSLQVF-----NPRIEATDDNQDREGCKL  184

Query  62   AFLIDQRWIPKQSTSLF  12
            AFL++  W     +  F
Sbjct  185  AFLVNHTWFESNVSDPF  201



>ref|XP_006495029.1| PREDICTED: wall-associated receptor kinase-like 2-like [Citrus 
sinensis]
Length=738

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 61/191 (32%), Positives = 91/191 (48%), Gaps = 18/191 (9%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEG-CALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLE  417
            C+++CG+V++P+PFGI    CA+N  F +NC    +PPK  +          EV  +S+E
Sbjct  36   CQEKCGHVTVPYPFGIDNSMCAMNKNFFLNCSRGDSPPKLMIGDL-------EVFNLSIE  88

Query  416  NQTITTLKSVVNFCDDSAG-RNAITNG--TDLSGSPFYYSKSRNKFLFAGCGNSLFT--Q  252
            N ++    S  + C D  G RN+  N     L   P  +S +RNK    GC  S +    
Sbjct  89   NGSMIASISTAHRCYDGLGNRNSDYNDPYVKLGNRPLRFSDTRNKLTAIGCDTSAYMGDP  148

Query  251  NSTVVAGCTAICGANISSGF--AGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNL  78
            N +   GC ++C  N S+    + C GI CC+TP+P  L S   N T   +         
Sbjct  149  NGSFWTGCISMC-TNESAKLNESSCSGIGCCQTPLPKSLKSL--NLTLRSVYDHEDMGKF  205

Query  77   KRCNSAFLIDQ  45
              C+ A L D+
Sbjct  206  MPCDYAILADE  216



>ref|XP_011077536.1| PREDICTED: wall-associated receptor kinase 2-like [Sesamum indicum]
Length=765

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 58/202 (29%), Positives = 101/202 (50%), Gaps = 21/202 (10%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIG--EGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSL  420
            C+ +CGN+++P+PFGIG   GC++ PWF V CDNSS+PPK ++ +       G +  V +
Sbjct  53   CQTKCGNLTVPYPFGIGLNSGCSIGPWFDVKCDNSSSPPKPFIAT-------GNLEIVDI  105

Query  419  ENQTITTLKSVVNFCDDSAGRNAITN--GTDLSGSPFYYSKSRNKFLFAGCGNSLFTQNS  246
             +  +     V   C    G     N    + + +P+ +S S N+F   GC +      S
Sbjct  106  SDDQVRIKNWVAARCYTETGNITRQNIIAINFTSTPYSFSDS-NRFTVVGCDDLAVIVGS  164

Query  245  T---VVAGCTAIC--GANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDN  81
            +     +GC ++C   ++I  GF  C GI CC+ P+P  L ++++    + + +     +
Sbjct  165  SGRNFTSGCLSLCSQSSDIIDGF--CTGIGCCQVPMPKGLKTFSSAL--ASLNNHTMIHS  220

Query  80   LKRCNSAFLIDQRWIPKQSTSL  15
               C  AF+ DQ     +++ L
Sbjct  221  FDPCGYAFIGDQERFQFRTSDL  242



>ref|XP_006487805.1| PREDICTED: wall-associated receptor kinase 2-like [Citrus sinensis]
Length=723

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 60/190 (32%), Positives = 93/190 (49%), Gaps = 17/190 (9%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGE-GCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLE  417
            CE++CG+V +P+PFGI +  CA++ +F +NC  S +PPK +           EV  +S+E
Sbjct  33   CEEKCGDVIVPYPFGIDDPKCAMDEYFFLNCSRSVSPPKLWFRK------NSEVFNISIE  86

Query  416  NQTITTLKSVVNFCDDSAGRNAITN-GTDLSGSPFYYSKSRNKFLFAGCGNSLFTQN--S  246
            + T+         C D  G    T+  T+L   PF +S +RNK    GC    +  +   
Sbjct  87   DGTMIGSIWTAERCYDGLGDYNYTDVRTNLGDGPFRFSDTRNKLTAFGCDTYAYMGDLVG  146

Query  245  TVVAGCTAIC---GANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLK  75
            +  +GC +IC    A I+     C GI CC TP+P   ++ + N T     +     N  
Sbjct  147  SFWSGCISICNNESAKITEN--SCSGIGCCHTPLP--KSTKSLNITLRSAYNHSRLRNFM  202

Query  74   RCNSAFLIDQ  45
             C+ AFL D+
Sbjct  203  PCDYAFLADE  212



>ref|XP_010064651.1| PREDICTED: wall-associated receptor kinase 2-like [Eucalyptus 
grandis]
Length=723

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 61/194 (31%), Positives = 98/194 (51%), Gaps = 20/194 (10%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C++ CGN+S+PFPFG+ E CA N   ++NC ++ A PK +L + +       V+ +S+EN
Sbjct  12   CDRTCGNMSVPFPFGLNENCAWNSGLVLNCIHTLASPKLFLGNSI------PVLNISVEN  65

Query  413  QTITTLKSVVNFCDDSAGRNAITNGTDLSGS-------PFYYSKSRNKFLFAGCGNSLFT  255
             T+T  + +   C D + R    NG+D   S       P+ +S +RNK    GC      
Sbjct  66   GTMTIGEYIAFDCYDQSRRR--LNGSDHQPSITVGQDGPYTFSDTRNKLTVFGCDTLALI  123

Query  254  QNS--TVVAGCTAICGANIS-SGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSND  84
             ++  T   GC + C  +I     + C G+ CC+  +P  L S   + T+  + +  S  
Sbjct  124  SDAAGTFGTGCFSSCLKDIDFKAESTCSGLGCCQLSIPKSLRSLNISLTS--VTNYSSVW  181

Query  83   NLKRCNSAFLIDQR  42
            N   C SAF++DQ 
Sbjct  182  NFSSCGSAFVVDQE  195



>gb|EMT09543.1| Wall-associated receptor kinase 5 [Aegilops tauschii]
Length=662

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 69/196 (35%), Positives = 93/196 (47%), Gaps = 19/196 (10%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCAL---NPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVS  423
            C  +CG+V IP+PFGIGE CA    N +F + C+++  PP+         E   EV  +S
Sbjct  18   CPDKCGDVLIPYPFGIGEDCAAASRNSYFNLICNSTIDPPRPMAGP---PEAVAEVADIS  74

Query  422  LENQTITTLKSVVNFCDDSAGR-NAITNGTDLSGSPFYYSKSRNKFLFAGC------GNS  264
            LE+  +  L  V + C  S       T G  L  SPF  S SRN F   GC      G  
Sbjct  75   LEHGEMRVLSPVSHICFKSNTTFTKFTGGYRLQDSPFLPSPSRNHFTVIGCNTMGLIGGQ  134

Query  263  LFTQNSTVVAGCTAIC-GANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSN  87
              T N   VAGC + C G N +S  A C G+ CCE+ +P +LT++   F  +  Q  G N
Sbjct  135  KGTANQ-YVAGCYSYCDGVNNTSDGAPCAGMGCCESAIPANLTTFEIIFATNQSQVWGFN  193

Query  86   DNLKRCNSAFLIDQRW  39
                 C  A + +  W
Sbjct  194  P----CFYAMIAEVGW  205



>ref|XP_009392052.1| PREDICTED: putative wall-associated receptor kinase-like 16 [Musa 
acuminata subsp. malaccensis]
Length=748

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 63/191 (33%), Positives = 89/191 (47%), Gaps = 11/191 (6%)
 Frame = -2

Query  596  RCEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLE  417
             C + CG +SIP+PFGIG+GC     F V C+  +A P+A+L      E    V  +SL 
Sbjct  40   HCNETCGGISIPYPFGIGDGC-FRDGFEVTCEVVNAIPRAFLGGS---ERNITVQNISLL  95

Query  416  NQTITTLKSVVNFCDDSAGRNAITNGT--DLSGSPFYYSKSRNKFLFAGC---GNSLFTQ  252
                + L  +   C +S G      G+  +LSG PF  S +RN+    GC   G  +   
Sbjct  96   QGQASVLNDIAWLCFNSTGDVVDDQGSSINLSGLPFSVSGTRNELTTMGCDVIGILIGGD  155

Query  251  NSTVVAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKR  72
            N T+ AGC + C    S     C+G  CCET +P  L ++T  F         S  +   
Sbjct  156  NYTLGAGCVSGCFEEASIAIGSCHGAGCCETTIPEKLDNFTVTFAT--FFDISSYTDYSP  213

Query  71   CNSAFLIDQRW  39
            C+ AF+ D  W
Sbjct  214  CSYAFIADTDW  224



>dbj|BAD46086.1| putative wall-associated kinase 4 [Oryza sativa Japonica Group]
Length=770

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 57/211 (27%), Positives = 108/211 (51%), Gaps = 27/211 (13%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C   CGN+SIP+PFGIG GCA +  F + C+++S+PP   +++      + +++++SL +
Sbjct  27   CPSTCGNISIPYPFGIGAGCARDEGFQLECNHTSSPPLLIVSNSTGGRHRQQLLSLSLAD  86

Query  413  QTITTLKSVVNFCDDSAGRNAIT----NGTD--LSGSPFYYSKSRNKFLFAGCGN--SLF  258
                T  +    C +S+  + ++    N T+  LSG+P+ +S+SRN+ +  GC N   L 
Sbjct  87   GEARTFLTAKRRCYNSSTGDMVSENDQNATEMSLSGTPYRFSRSRNRLVALGCPNLAYLV  146

Query  257  TQNSTVVAGCTAICGA--NISSG-FAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSN  87
                + ++ CT+IC    ++++G   G  G  CC++ +P+ +  Y  +    G +   + 
Sbjct  147  DGRGSYISSCTSICRTPESVAAGSTVGFTGEGCCQSSIPYSVDVYKPDII--GFKQGQAG  204

Query  86   DNL--------------KRCNSAFLIDQRWI  36
            D++                C   +L + RWI
Sbjct  205  DSVLLNSTAASSILQSSTVCRYMYLAEDRWI  235



>ref|XP_008441599.1| PREDICTED: LOW QUALITY PROTEIN: wall-associated receptor kinase 
2-like [Cucumis melo]
Length=748

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 61/192 (32%), Positives = 94/192 (49%), Gaps = 14/192 (7%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C++ CG++ IP+P+G+ EGC LN  FL+ CD + +PPKA+L     ++    V  +SL N
Sbjct  31   CDEWCGDLRIPYPYGVKEGCYLNQTFLITCDKAFSPPKAFL-----MDTNISVTNISL-N  84

Query  413  QTITTLKSVVNFCDDSA---GRNAITNGTDLSGSP-FYYSKSRNKFLFAGCGN-SLFT--  255
              +  L+ +V  C +     G + I N T+L+  P    +  +NKF+  GC    LFT  
Sbjct  85   GELHMLQPIVRDCHEGVQLGGGSFIPNITNLTAPPTLSIADGKNKFIAIGCNTFGLFTGM  144

Query  254  -QNSTVVAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNL  78
             + S  + GC A+C  N S     C G  CCE  +P  L S            +G+    
Sbjct  145  LKGSEFLTGCVAVCTNNSSIVDGSCSGTGCCELNIPNGLRSLGLAVGQLLDDRNGTFVKY  204

Query  77   KRCNSAFLIDQR  42
              C  AF++ + 
Sbjct  205  NPCGYAFVVGEE  216



>ref|XP_002442545.1| hypothetical protein SORBIDRAFT_08g021600 [Sorghum bicolor]
 gb|EES16383.1| hypothetical protein SORBIDRAFT_08g021600 [Sorghum bicolor]
Length=697

 Score = 89.7 bits (221),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 59/165 (36%), Positives = 85/165 (52%), Gaps = 21/165 (13%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCA---LNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVS  423
            C  +CGNVSIP+PFGIG+GCA   LN +F V C +S  PP+  +          EV+ +S
Sbjct  31   CPDKCGNVSIPYPFGIGDGCAAGNLNRYFAVTCKDSFQPPRPMIGDPSSAV---EVIDIS  87

Query  422  LENQTITTLKSVVNFC--DDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQN  249
            LE+  +     V  +C   ++   +  T G  L  +PF  S +RN+F+  GC N+L    
Sbjct  88   LEHGEVRVYGDVSYYCFTSNTTISDNNTAGFSLENTPFIPS-TRNRFMAIGC-NTL----  141

Query  248  STVVAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTN  114
                     I G N +S  A C G+ CCET +  +LT++ A   N
Sbjct  142  -------GLIGGINSTSDGAPCTGMGCCETTISPNLTNFAALLYN  179



>gb|ABA00518.1| wall-associated kinase-like 2 [Triticum aestivum]
Length=365

 Score = 87.4 bits (215),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 71/218 (33%), Positives = 95/218 (44%), Gaps = 42/218 (19%)
 Frame = -2

Query  596  RCEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSA-PPKAYLNSFVQIELQGEVVAVSL  420
            RC   CG V +P+PFGIG GC   P F + CD +    P+  + S +Q      VV +SL
Sbjct  33   RCPTSCGGVKVPYPFGIGNGCH-RPGFNLTCDRTRGREPRLLVGSDLQ------VVEISL  85

Query  419  ENQTITTLKSVVNFCDDSAGRNAITNGTDLSGS----------PFYYSKSRNKFLFAGCG  270
             N T+  L        D AG+  +T    L G+          P+  S+ RN F+  GC 
Sbjct  86   ANSTVRIL--------DRAGQVKLTFSEGLDGNGTWGGLGAGGPYVLSEMRNHFVVTGCN  137

Query  269  -NSLFTQNSTVVAGCTAICGAN--------ISSGFAG--CYGIDCCETPVPFDLTSYTAN  123
              +    N  VV  C++ C  N         S+G+ G  C GI CCETP+P    SY   
Sbjct  138  VQATLVGNGGVVGCCSSFCSINDKWTGVVTSSAGYGGAACSGIGCCETPIPIGRPSYDVE  197

Query  122  FTNSGIQSDGSNDNLKRCNSAFLIDQR-WIPKQSTSLF  12
              +     D SN    R   A  I +R W    ST+L 
Sbjct  198  MRS----LDASNVYADRLPIAVRIAERGWFEGASTTLL  231



>ref|XP_008380153.1| PREDICTED: wall-associated receptor kinase-like 1 [Malus domestica]
Length=764

 Score = 89.7 bits (221),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 65/194 (34%), Positives = 96/194 (49%), Gaps = 29/194 (15%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIG--EGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSL  420
            C + CG VSIP+PFGIG    C  +  F ++C+ ++     Y     Q  L  EV+ +S+
Sbjct  54   CSRDCGGVSIPYPFGIGPNRDCYFDEGFEISCNKTT----GYAPVLRQTSL--EVLNISI  107

Query  419  ENQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN-SLFTQNST  243
             + TI     V  FC   +GR       +L+G+PF YS+  N+F    CG  ++   +  
Sbjct  108  ADGTIQVKNPVAFFCGGKSGRQP----ANLTGTPFVYSERHNRFTAVSCGYLAMVGSDEY  163

Query  242  VVAGCTAICGANISSGFAGC-YGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKR--  72
            +V GC +IC    S  +  C  GI+CC+T +P  L         S I +D   DN  R  
Sbjct  164  LVGGCRSICEGT-SINYGNCEVGINCCQTTIPPHL---------SAISTDIIKDNRGRGD  213

Query  71   -CNS--AFLIDQRW  39
             CN+  AFL+D+ W
Sbjct  214  DCNNAYAFLVDKNW  227



>ref|XP_008229613.1| PREDICTED: wall-associated receptor kinase-like 1 isoform X1 
[Prunus mume]
Length=782

 Score = 89.7 bits (221),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 65/212 (31%), Positives = 98/212 (46%), Gaps = 28/212 (13%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEG--CALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSL  420
            C   CG VSIP+PFGIG    C LN WF ++C N S   K +L        Q EV+ +S+
Sbjct  39   CTTLCGGVSIPYPFGIGPSTNCFLNGWFQIDC-NKSTGHKPFLR-----RAQLEVLDISI  92

Query  419  ENQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCG----------  270
             N T+     +   C+   G ++     +L+GS F +S+  N F    CG          
Sbjct  93   -NGTLRVNSPITFLCNTKKGNSSHQLLANLTGSFFVFSQRHNIFTAVSCGFLAVVTSSND  151

Query  269  NSLFTQNSTVVAGCTAICGA--NISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSD  96
            + +      ++ GC +IC +     S + GC GI+CC+T +P +LTS T +   +   + 
Sbjct  152  DDMVAVADKIIGGCRSICDSFQKGRSNYDGCDGINCCQTTIPPNLTSVTTHILYANASAI  211

Query  95   GSND-------NLKRCNSAFLIDQRWIPKQST  21
               D         K  N AFL+D+ W    S+
Sbjct  212  DCTDYPPTDYIYEKNINYAFLVDREWFDNTSS  243



>ref|XP_007147592.1| hypothetical protein PHAVU_006G137600g [Phaseolus vulgaris]
 gb|ESW19586.1| hypothetical protein PHAVU_006G137600g [Phaseolus vulgaris]
Length=359

 Score = 87.4 bits (215),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 57/194 (29%), Positives = 95/194 (49%), Gaps = 19/194 (10%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGE-GCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLE  417
            C+ RCGNV IPFPFG+    C    WF + C NS+     Y ++     +  EV++++L+
Sbjct  30   CDWRCGNVPIPFPFGMKSFECYAGKWFEIECRNSTY--TNYTHTPYLKSIGVEVISINLQ  87

Query  416  NQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCG-NSLFTQNSTV  240
              T+     +  +  +   +++      L GSPF YS+  NKF+ AGC   ++   N + 
Sbjct  88   LGTVNIKNPI--YRSNCGSKDSPPVNKSLEGSPFVYSQKYNKFMAAGCNIIAILQLNRSE  145

Query  239  VAGCTAICGANISSGFAG--------CYGIDCCETPVPFDLTSYTANFTNSGIQSDGSND  84
            V+GC +IC  N   G  G        C G  CC++ +P  L  Y+      G++ + ++D
Sbjct  146  VSGCVSICDENYKVGDIGKMDFRKSDCNGKSCCDSSLPLYLKEYSTEI--KGLKDNETSD  203

Query  83   NLKRCNSAFLIDQR  42
                C+ A ++ Q 
Sbjct  204  ---ECSYAMVVQQH  214



>ref|XP_008383463.1| PREDICTED: wall-associated receptor kinase 2-like [Malus domestica]
Length=377

 Score = 87.4 bits (215),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 68/206 (33%), Positives = 96/206 (47%), Gaps = 25/206 (12%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQG---EVVAVS  423
            C   CGN++IP+PFGIG  C L+  F + CD S+ PP A L       L G   E+  +S
Sbjct  30   CPNHCGNLTIPYPFGIGSACYLDHRFEITCDISTQPPTARL-------LTGNVKEITNIS  82

Query  422  LENQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFY-YSKSRNKFLFAGCGN-SLFT--  255
            L +  +  L+     C D+ G     N ++L  SP Y  SK++N F+  GC   +LF   
Sbjct  83   LYDGELQILQFAARDCYDAQGNRTEYNRSELWVSPPYTISKTKNMFVAVGCDTYALFKGY  142

Query  254  -QNSTVVAGCTAICG--ANISSGFAGCYGIDCCETPVPFDL---TSYTANFTNSGIQSDG  93
                     C +IC    N +     C G+ CC+T +P  L   T Y  +F N     D 
Sbjct  143  QGEEMHRTRCMSICDNLTNATDQLDTCSGVGCCQTKIPGGLKNGTVYLGSFDNYYFVGDS  202

Query  92   SNDNLKRCNSAFLIDQRWIPKQSTSL  15
            +     RC+ AFL+ +      STSL
Sbjct  203  N-----RCSYAFLVQEDEFNFTSTSL  223



>gb|KDO65455.1| hypothetical protein CISIN_1g035536mg, partial [Citrus sinensis]
Length=445

 Score = 88.2 bits (217),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 63/188 (34%), Positives = 90/188 (48%), Gaps = 17/188 (9%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C   CGNVSI +PFGIG+GC  +  + V CDNSS  PKA+L S ++ EL       S  +
Sbjct  41   CPTECGNVSIIYPFGIGKGCYFDKGYEVICDNSSGSPKAFLPS-IKTELLD-----SYSD  94

Query  413  QTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFT--QNSTV  240
             TI     V+   +  A RN +    +LSGS F +    NKF   GC N       +ST+
Sbjct  95   TTIRVNIPVIFLHNRIATRNHMAREVNLSGSAFTFPWRLNKFTAIGCDNYAIDLGNDSTI  154

Query  239  VAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKRCNSA  60
              GC ++C  + +   +GCY   C   P+   L +  + F +  I        L+ C S 
Sbjct  155  SGGCLSVCTCDPTQK-SGCYDFLCSIPPISKVLNANLSYFYSQSI--------LQNCRSV  205

Query  59   FLIDQRWI  36
             L+   W+
Sbjct  206  SLVQGDWL  213



>ref|XP_010911682.1| PREDICTED: wall-associated receptor kinase 2-like [Elaeis guineensis]
Length=314

 Score = 86.7 bits (213),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 71/196 (36%), Positives = 98/196 (50%), Gaps = 24/196 (12%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSS-APPKAYLNSFVQIELQGEVVAVSLE  417
            C+ +CGNVSIP+PFGIGEGC L   F + CDN S  PPK +L+    I+++        E
Sbjct  28   CQPKCGNVSIPYPFGIGEGCFLEG-FEITCDNKSFNPPKPFLDR-GNIDVR--------E  77

Query  416  NQTITTLKSVVNFC-------DDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN--S  264
             Q I  L  V NF        + S G +  T+   LS S F +S +RNKF+  GC     
Sbjct  78   IQLIEGLVVVTNFIARDCFFKNGSQGNHTYTS-VKLSKS-FKFSTTRNKFVAIGCDTMGH  135

Query  263  LFTQNSTVVAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSND  84
            L  + S    GC ++C ++       C GI CCET +P +L S+   +  S     G  D
Sbjct  136  LVDEESRFNTGCLSVCNSSSYITNGTCNGIGCCETVIPNELRSFRV-YVTSFRNHTGCWD  194

Query  83   NLKRCNSAFLIDQRWI  36
                C+  FL D+R +
Sbjct  195  -FNNCSYGFLADERML  209



>ref|XP_010673980.1| PREDICTED: wall-associated receptor kinase 4-like isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=233

 Score = 85.9 bits (211),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 60/213 (28%), Positives = 95/213 (45%), Gaps = 27/213 (13%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C + CGNV+IP+PFGIG GC+L   +++ CD          N+F    L G  V    + 
Sbjct  13   CPRECGNVTIPYPFGIGRGCSLGYNYVIVCD--------IQNNFSVPRLPGRQVLDISDT  64

Query  413  QTITTLKSVVNFCDDS---AGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQNST  243
            Q I T +     C+ +   +G +   N   L+G P+  S + NKF+  GC +    +  T
Sbjct  65   QLIITARPAAASCESALTESGDHNTWNNVSLAGLPYAVSSTSNKFVVTGCHHYGLIEAQT  124

Query  242  V----VAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLK  75
            +    V  C A+C          C GI CCE P+P  L  +  +       +  S+ N  
Sbjct  125  ISGREVTSCVALCTREEDLLNEMCSGIGCCEAPIPKGLRVWNTSLEKIYYNTSMSSGN--  182

Query  74   RCNSAFLIDQRWI---------PKQSTSLFLEY  3
             C  AF++++  +         P +S  L L++
Sbjct  183  -CTYAFILEKSTLKYRGFQDAGPLKSVPLVLDW  214



>ref|XP_010673979.1| PREDICTED: wall-associated receptor kinase 4-like isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=264

 Score = 86.3 bits (212),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 60/213 (28%), Positives = 95/213 (45%), Gaps = 27/213 (13%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C + CGNV+IP+PFGIG GC+L   +++ CD          N+F    L G  V    + 
Sbjct  44   CPRECGNVTIPYPFGIGRGCSLGYNYVIVCD--------IQNNFSVPRLPGRQVLDISDT  95

Query  413  QTITTLKSVVNFCDDS---AGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQNST  243
            Q I T +     C+ +   +G +   N   L+G P+  S + NKF+  GC +    +  T
Sbjct  96   QLIITARPAAASCESALTESGDHNTWNNVSLAGLPYAVSSTSNKFVVTGCHHYGLIEAQT  155

Query  242  V----VAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLK  75
            +    V  C A+C          C GI CCE P+P  L  +  +       +  S+ N  
Sbjct  156  ISGREVTSCVALCTREEDLLNEMCSGIGCCEAPIPKGLRVWNTSLEKIYYNTSMSSGN--  213

Query  74   RCNSAFLIDQRWI---------PKQSTSLFLEY  3
             C  AF++++  +         P +S  L L++
Sbjct  214  -CTYAFILEKSTLKYRGFQDAGPLKSVPLVLDW  245



>ref|XP_006388728.1| hypothetical protein POPTR_0112s00230g [Populus trichocarpa]
 gb|ERP47642.1| hypothetical protein POPTR_0112s00230g [Populus trichocarpa]
Length=693

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 56/190 (29%), Positives = 93/190 (49%), Gaps = 18/190 (9%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C  RCG+++IP+PFG G+ C  + WF V C+ ++ PP+A+++     ++  EV+ +S+E 
Sbjct  33   CPDRCGDITIPYPFGTGKDCYKDEWFAVECNKTTNPPRAFIS-----QINVEVLNISVET  87

Query  413  QTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQN-STVV  237
               T    V++F  +  GR       +L+GSPF +S   N F+  GC    F       V
Sbjct  88   GLATVKSPVISF--NCTGRKD-GGSLNLTGSPFVFSDFWNVFIAVGCDTRAFMSGIEPQV  144

Query  236  AGCTAICG---ANIS-SGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKRC  69
             GC   CG    N+S      C G +CCE  +P  L  +     ++ +     +   + C
Sbjct  145  LGCVPTCGNQRNNVSLQENNMCSGRNCCEASIPSLLQVFKPTLVSTNV-----DQGREAC  199

Query  68   NSAFLIDQRW  39
              A L+++ W
Sbjct  200  KLAVLVNETW  209



>ref|XP_006490105.1| PREDICTED: wall-associated receptor kinase-like 10-like [Citrus 
sinensis]
Length=715

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 63/188 (34%), Positives = 90/188 (48%), Gaps = 17/188 (9%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C   CGNVSI +PFGIG+GC  +  + V CDNSS  PKA+L S ++ EL       S  +
Sbjct  29   CPSECGNVSIIYPFGIGKGCYFDKGYEVICDNSSGSPKAFLPS-IKTELLD-----SYSD  82

Query  413  QTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFT--QNSTV  240
             TI     V+   +  A RN +    +LSGS F +    NKF   GC N       +ST+
Sbjct  83   TTIRVNIPVIFLHNRIATRNHMAREVNLSGSAFTFPWRLNKFTAIGCDNYAIDLGNDSTI  142

Query  239  VAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKRCNSA  60
              GC ++C  + +   +GCY   C   P+   L +  + F +  I        L+ C S 
Sbjct  143  SGGCLSVCTCDPTQK-SGCYDFLCSIPPISKVLNANLSYFYSQSI--------LQNCRSV  193

Query  59   FLIDQRWI  36
             L+   W+
Sbjct  194  SLVQGDWL  201



>ref|XP_006441115.1| hypothetical protein CICLE_v10024305mg, partial [Citrus clementina]
 gb|ESR54355.1| hypothetical protein CICLE_v10024305mg, partial [Citrus clementina]
Length=618

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 64/188 (34%), Positives = 98/188 (52%), Gaps = 14/188 (7%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C   CGNVSI +PFGIGEGC  +  + V CD+ S  PKA+L    ++EL   V  +S ++
Sbjct  28   CPTECGNVSISYPFGIGEGCYFDKGYEVICDHPSGIPKAFLPGVNRLEL---VDILSNDS  84

Query  413  QTITTLKSVVNFCDDSAGRNA-ITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQN-STV  240
            +    +     F + S+ R + I  G +LSG+PF +S + NKF   GC       N S+V
Sbjct  85   RAAVRVNVPAIFLNSSSKRTSNIAKGVNLSGTPFSFS-TDNKFAAIGCKMRYHQGNGSSV  143

Query  239  VAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKRCNSA  60
              GC +IC  +  + +  CY   C   P+  ++T +  N   S + S       ++C S 
Sbjct  144  FDGCLSICTCD-PTVYPACYDFLC---PLRPNIT-HLFNLNKSYLFSQSIP---QKCQSV  195

Query  59   FLIDQRWI  36
            FL+D+ W+
Sbjct  196  FLVDEDWV  203



>ref|XP_010110996.1| Wall-associated receptor kinase 2 [Morus notabilis]
 gb|EXC29382.1| Wall-associated receptor kinase 2 [Morus notabilis]
Length=259

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 62/191 (32%), Positives = 93/191 (49%), Gaps = 14/191 (7%)
 Frame = -2

Query  596  RCEQRCGNVSIPFPFGIGE-GCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSL  420
            RC   CG + +P+PFGI +  CA +  FL+ C+ S +PPK  L   +      EV+ +S+
Sbjct  45   RCNGTCGKLKVPYPFGIDDKDCAKDKEFLLTCNRSFSPPKLILGENI------EVLDISV  98

Query  419  ENQTITTLKSVVNFCDDSAGRNAI--TNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQNS  246
            EN T++        C + +   A    N T  + +P+ +S S NK +  GC    F  ++
Sbjct  99   ENGTMSVSIDSAYKCYNESSLTASFDQNITLGNKNPYTFSSSENKLIGLGCDTLAFMNDA  158

Query  245  --TVVAGCTAICGANISSGFAG-CYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLK  75
                 +GC ++C   +     G C GI CC+T +P +L S       S  QSD    N  
Sbjct  159  DGKFGSGCISLCSDKVDLAAEGSCSGIGCCQTSLPKNLKSLEITLITSPNQSDVLTFN--  216

Query  74   RCNSAFLIDQR  42
             C  AFL+DQR
Sbjct  217  PCGFAFLVDQR  227



>gb|EAZ10086.1| hypothetical protein OsI_32395 [Oryza sativa Indica Group]
Length=482

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/165 (35%), Positives = 85/165 (52%), Gaps = 20/165 (12%)
 Frame = -2

Query  584  RCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLENQTI  405
            RCGNVS+P+PF I  GC+L P F + CD +  PP+  + +        +VV +SL N T+
Sbjct  36   RCGNVSVPYPFAISHGCSL-PGFELTCDTTRNPPRLMIGNGTL-----QVVDISLANSTV  89

Query  404  TT--LKSVVNFCDD--SAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN--SLFTQNST  243
                L   VN   D  +AG    +      G P+  S+ RN+ +  GC    +L   +  
Sbjct  90   RAMDLAGAVNITPDGFNAGNGTWSGLGAGGGIPYVVSERRNQLIVTGCNRQVTLSGDSDN  149

Query  242  VVAGCTAICGAN------ISS--GFAGCYGIDCCETPVPFDLTSY  132
            V+ GC++ C  N      ++S  G +GC GI CC+TP+P   +SY
Sbjct  150  VIIGCSSFCSINDIWTDFVASMPGNSGCSGIACCKTPIPIGRSSY  194



>ref|XP_004295865.1| PREDICTED: wall-associated receptor kinase-like 22-like [Fragaria 
vesca subsp. vesca]
Length=700

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 65/209 (31%), Positives = 105/209 (50%), Gaps = 33/209 (16%)
 Frame = -2

Query  596  RCEQRCGNVSIPFPFGIG--EGCALNPWFLVNCDNSSAPPKAYL---NSFVQIELQGEVV  432
             C+  CG + IP+PFG+G  + C L+  F + CDNS+ PPK +L   NS      + EV+
Sbjct  37   HCQPECGGIEIPYPFGMGTSDDCYLSDSFQIYCDNSTDPPKPFLYLSNS------KREVL  90

Query  431  AVSLENQTITTLKSV--VNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLF  258
             +SL      TLK +  ++F + S           L G+ + YS+ RN+F    CG   +
Sbjct  91   EISLAG----TLKVMNPISFFNCSDKEFTTLQPASLVGTSYVYSQ-RNRFTSMSCGAIAY  145

Query  257  T---QNSTVVAGCTAICGANISSGFA-----GCYGIDCCETPVPFDLTSYTANFTNSGIQ  102
                ++ ++++GC +IC  + S+G        C GI CC+T +P  +  +  +F   G++
Sbjct  146  MMSWESESIISGCLSIC--DPSAGRRSLLNNSCTGIHCCQTTIPAAVQDFYTDF--RGVE  201

Query  101  SDGSNDNLKRCNSAFLIDQRWIPKQSTSL  15
                 D    C  AFL+DQ W    ST++
Sbjct  202  LAAEKD---MCKFAFLVDQDWFTSDSTNI  227



>ref|XP_010051379.1| PREDICTED: wall-associated receptor kinase-like 1 [Eucalyptus 
grandis]
Length=982

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 66/191 (35%), Positives = 96/191 (50%), Gaps = 30/191 (16%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C + CG+V+IPFPFGI  GC L+ W+ + C+ +   P        +I LQ  V+ +SL +
Sbjct  289  CAETCGSVTIPFPFGIRAGCFLDDWYQIVCEQNHTVP-----ILKKIRLQ--VLNISLPD  341

Query  413  QTITTLKSV------VNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQ  252
            + +  + +V       N C    GR A  +   L GS F +SK RN F   GC N+L T 
Sbjct  342  KDVDGMINVSLPVIYSNACRRGDGRGATVS---LKGSQFVFSKKRNIFTVVGC-NTLVTA  397

Query  251  NSTV--VAGCTAIC-GANIS-SGFAGCYGID-CCETPVPFDLTSYTANFTNSGIQSDGSN  87
            NST   V GC + C G N + S ++ C G D CC++ +P +L  +  +F           
Sbjct  398  NSTKSDVFGCQSKCAGTNFTISKYSACSGEDGCCQSSLPLNLQGFGVDFK--------EE  449

Query  86   DNLKRCNSAFL  54
            D  + C  AFL
Sbjct  450  DGHEGCKYAFL  460


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 59/188 (31%), Positives = 87/188 (46%), Gaps = 25/188 (13%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C + CGNV+IPFPFGIG GC    W+ + C  ++  P       +  ++   V+ +SL +
Sbjct  31   CPETCGNVTIPFPFGIGAGCFFEEWYQIVCKQNNMVP-------ILKKIGLRVLNISLPD  83

Query  413  QTITTL--KSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQNST-  243
              +  +   S+        G +    G  L GS F +S+ RN F   GC N+L   ++T 
Sbjct  84   VDVDGIINISLPIIYSKGCGGDGHAAGVSLKGSQFVFSQKRNVFTLVGC-NTLAIVDTTK  142

Query  242  -VVAGCTAICGA-NISSGFAG--CYGIDCCETPVPFDLTSYTANFT-NSGIQSDGSNDNL  78
               AGC + C A N S  + G      DCC+T +P +L  +  +F   SG Q        
Sbjct  143  SAFAGCRSRCAAPNTSISWNGNCSRRDDCCQTRLPLNLQGFRVDFKEESGHQG-------  195

Query  77   KRCNSAFL  54
              C  AFL
Sbjct  196  --CKYAFL  201



>gb|EEC69677.1| hypothetical protein OsI_39114 [Oryza sativa Indica Group]
Length=521

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 60/169 (36%), Positives = 86/169 (51%), Gaps = 15/169 (9%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCA---LNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVS  423
            C  +CGN+SIP+PFGI   CA   ++ +F + C+N+  PP+  +      E   EV  +S
Sbjct  37   CPDKCGNISIPYPFGISPSCAATSISSYFNLTCNNTFNPPRPMVGDS---EALVEVTDIS  93

Query  422  LENQTITTLKSVVNFC-DDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQN-  249
            LE+  +  L  V   C   +      T G +L  +PF  S SRN+F   GC N+L     
Sbjct  94   LEHGEMRVLSPVYYICFTANTTFTRFTEGYELKHTPFLPSPSRNRFTVIGC-NTLGLIGG  152

Query  248  -----STVVAGCTAICGA-NISSGFAGCYGIDCCETPVPFDLTSYTANF  120
                 S  V GC + C + N +S  A C G+ CCE  +P DLT++ A F
Sbjct  153  YKGTVSHYVTGCYSYCESINSTSDGAPCAGMGCCEAAIPTDLTAWGAMF  201



>gb|EAY77552.1| hypothetical protein OsI_32591 [Oryza sativa Indica Group]
Length=667

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 62/179 (35%), Positives = 90/179 (50%), Gaps = 21/179 (12%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C  +CG V IPFPFG+G  CAL P   V+C++S APP+ Y+          E + VSLE 
Sbjct  39   CPSKCGEVDIPFPFGVGVDCAL-PGLNVSCNHSFAPPRPYIAD------DNEFIDVSLET  91

Query  413  QTITTLKSVVNFCDD----SAGRNAITNGTDLSGSPFYYSKSRNKFLFAGC---GNSLFT  255
                    V+  C D    S+  +AI  G DL+G+PF  S  RN+F   GC   G     
Sbjct  92   GETRVYTPVLQNCFDLSNTSSSSDAIWQGLDLTGTPFLVSPERNEFTATGCDALGLIYGR  151

Query  254  QNSTVVAGCTAICGANISSGFAG--CYGIDCCE-TPVPFDLT----SYTANFTNSGIQS  99
            ++ +   GC   C +  ++   G  C G+ CC+   +P +LT    + TAN T++ I +
Sbjct  152  EDVSFFTGCVTTCTSLGTAANDGDNCTGLGCCQLQSIPGNLTLLGMTLTANITDTKISA  210



>ref|XP_006421683.1| hypothetical protein CICLE_v10007060mg [Citrus clementina]
 gb|ESR34923.1| hypothetical protein CICLE_v10007060mg [Citrus clementina]
Length=695

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 63/188 (34%), Positives = 89/188 (47%), Gaps = 17/188 (9%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C   CGNVSI +PFGIG+GC  +  + V CDNSS  PKA+L S ++ EL       S  +
Sbjct  41   CSTECGNVSIIYPFGIGKGCYFDKGYEVICDNSSGSPKAFLPS-IKTELLD-----SFSD  94

Query  413  QTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFT--QNSTV  240
             TI     V+   +     N I    ++SGSPF +    NKF   GC N       +STV
Sbjct  95   TTIRVNIPVIFLHNSIVTSNNIARRVNVSGSPFTFPWRLNKFTAIGCDNYAIDLGNDSTV  154

Query  239  VAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKRCNSA  60
              GC ++C  + +   +GCY   C   P+   L +  + F +  I        L+ C S 
Sbjct  155  SGGCLSVCTCDPTQK-SGCYDFLCSIPPISKVLNANLSYFYSQSI--------LQNCRSV  205

Query  59   FLIDQRWI  36
             L+   W+
Sbjct  206  SLVQGDWL  213



>ref|XP_002442540.1| hypothetical protein SORBIDRAFT_08g021540 [Sorghum bicolor]
 gb|EES16378.1| hypothetical protein SORBIDRAFT_08g021540 [Sorghum bicolor]
Length=725

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/171 (36%), Positives = 88/171 (51%), Gaps = 12/171 (7%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCAL---NPWFLVNCDNSSAPPKAYLNSFVQ-IELQGEVVAV  426
            C  +CG+V+IP+PFGIG+GCA    NP F V C+N+  PP+  + +         EV+ +
Sbjct  36   CPDKCGDVTIPYPFGIGDGCAATSRNPSFAVTCNNTFQPPRPMIYAPASNTSTPMEVIDI  95

Query  425  SLENQTITTLKSVVNFCDDSAGRNAITNGT---DLSGSPFYYSKSRNKFLFAGC---GNS  264
            SLE   ++    V   C +    N + N T    L G+P   S +RN+F+  GC   G  
Sbjct  96   SLERGEVSIYAPVGYSCFE-PNTNTLDNYTGEFSLEGTPLILSSTRNRFMAIGCSALGLI  154

Query  263  LFTQNSTVVAGCTAIC-GANISSGFAGCYGIDCCETPVPFDLTSYTANFTN  114
              +     VAGC + C G N +S  A C G  CCET +  +LT++ A   N
Sbjct  155  GASDPEPSVAGCFSYCEGINQTSDGAPCSGKGCCETAISPNLTAFQAAVAN  205



>ref|XP_002264787.2| PREDICTED: wall-associated receptor kinase 2-like [Vitis vinifera]
Length=761

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/193 (30%), Positives = 91/193 (47%), Gaps = 14/193 (7%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C + CGNVSI +PFGIG+GC L+  F + C NSS P   +    +  E + EV+ +SLE 
Sbjct  36   CPETCGNVSIVYPFGIGKGCYLDKRFEITCSNSSLPHPIFQ---LDEENEAEVLLISLEY  92

Query  413  QTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGC--------GNSLF  258
              I    S + + + ++   +    +     PF YS + NKF+  GC         N+  
Sbjct  93   MRIRDWTSPICYVNYTSEGQSYAEFSYAPMEPFSYSHTENKFIGIGCDIFAYIGYSNTTN  152

Query  257  TQNSTVVAGCTAICGANISSGF---AGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSN  87
            + NS+ ++GC ++C     S       C GI CC+T  P DL+       N     DG +
Sbjct  153  SINSSYISGCVSVCNGQGWSWLDTNYSCSGIGCCQTTFPEDLSIVDIRIGNMSTWPDGRD  212

Query  86   DNLKRCNSAFLID  48
                +C+   + +
Sbjct  213  WPSNQCSLVLIAE  225



>ref|XP_004980706.1| PREDICTED: wall-associated receptor kinase 2-like [Setaria italica]
Length=702

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 95/200 (48%), Gaps = 29/200 (15%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C   CG++ IPFPFGIG+GC+ +  F + CDNS  P +A+         + EV  ++LE 
Sbjct  49   CPSMCGDIHIPFPFGIGDGCSRSKGFAIFCDNSYNPARAFFGR------RFEVKDITLET  102

Query  413  QTITTLKSVVNFCDDSAGRNAITNGTDLS----GSPFYYSKSRNKFLFAGC-------GN  267
              +     V + C +S+  N I++   L     GSPF  S SRN+F   GC       GN
Sbjct  103  GEMRVFTEVAHICYNSS--NTISSRRPLKYNFNGSPFLISSSRNEFTGVGCNTVALLSGN  160

Query  266  SLFTQNSTVVAGCTAICGA-NISSGFAGCYGIDCCETPVPFDLTSYTA---NFTNSGIQS  99
             L   +   ++GC   C +   ++    C G  CC+T  P  L +        TN+  ++
Sbjct  161  DLDEDDGRYLSGCITTCASLGDAADDVNCTGKGCCQTATPEGLDTVNVRCNKLTNNTARN  220

Query  98   DGSNDNLKRCNSAFLIDQRW  39
              S      C++AFL ++ W
Sbjct  221  HNS------CSTAFLGEKGW  234



>ref|XP_009385256.1| PREDICTED: wall-associated receptor kinase 2-like [Musa acuminata 
subsp. malaccensis]
Length=272

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/196 (31%), Positives = 98/196 (50%), Gaps = 16/196 (8%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C +RCG++ +P+PFGI  GC  +  F ++CD + +  K Y  +        +V+ V + N
Sbjct  7    CTRRCGSIDVPYPFGIEPGCYRDG-FDLSCDVTES--KLYAGNI-------QVIGVDVPN  56

Query  413  QTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN-SLFT--QNST  243
                  K +   CDDS     ++   DL+GS + +S +RNKF   GC   +LF    + +
Sbjct  57   GQARVYKRISWDCDDSVFPAKVSIPMDLTGSHYTFSDTRNKFTAIGCDTIALFVGATDQS  116

Query  242  VVAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKRCNS  63
               GC +IC  N +     C G  CC+T +   L  +   F+++G   + S DN   C+ 
Sbjct  117  YSTGCVSICNDNTTFSNGSCSGAGCCQTSILRGLQFFNITFSSTG-HEEISWDN--PCSF  173

Query  62   AFLIDQRWIPKQSTSL  15
            AFL+D  W   ++T L
Sbjct  174  AFLVDGSWYSFRTTDL  189



>ref|XP_007209854.1| hypothetical protein PRUPE_ppa014824mg [Prunus persica]
 gb|EMJ11053.1| hypothetical protein PRUPE_ppa014824mg [Prunus persica]
Length=728

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 66/206 (32%), Positives = 104/206 (50%), Gaps = 35/206 (17%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIG--EGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSL  420
            C   CG+V+IP+PFGIG  + C L+ WF ++C ++++   A  +  V       + +V+L
Sbjct  37   CTTHCGDVAIPYPFGIGPSKDCYLDKWFQIDCRHTNSTTSANYSRQVPF-----LKSVNL  91

Query  419  ENQTITTLKSVVNFCDDSAG-----RNAIT----------NGTDLSGSPFYYSKSRNKFL  285
            E      L S+  F D S       +N IT             +L+GSPF YS++ N F+
Sbjct  92   E------LLSISPFEDGSGTQSVQVKNPITFFSCKGKETRQPQNLTGSPFIYSQTYNTFI  145

Query  284  FAGCGN-SLFTQNSTVVAGCTAICGANISSGFAGCY-GIDCCETPVP-FDLTSYTANFTN  114
               C   +L   +   +AGC +IC  N    F+ CY GIDCCE  +P ++LT+++    +
Sbjct  146  AVSCDLFALMRSDHGTLAGCWSICRNNTGGDFSTCYKGIDCCEGFLPSYELTNFSIEIPS  205

Query  113  SGIQSDGSNDNLKRCNSAFLIDQRWI  36
            +   SD   D    C  AFL+D  ++
Sbjct  206  NSSTSDPMGD----CKYAFLVDSSFM  227



>ref|XP_006492000.1| PREDICTED: wall-associated receptor kinase 3-like isoform X1 
[Citrus sinensis]
Length=280

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 65/200 (33%), Positives = 94/200 (47%), Gaps = 25/200 (13%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIE-LQGEVVAV---  426
            C+  CGNV+I +PFGIG+GC  +  F V CD SS  PKA+L +   ++ L G V  V   
Sbjct  27   CQYDCGNVTISYPFGIGDGCYFDKSFEVICDYSSGSPKAFLANINNLQVLDGHVYTVYDS  86

Query  425  --SLENQTITTLKSVVNFCD-DSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFT  255
              S     I  ++  +      S+   +   G  LSGSPF +S+SRN+F   GC N    
Sbjct  87   YTSFYVYMIRPIRVYIPVISLKSSNLTSNDKGVSLSGSPFTFSRSRNRFTAIGCNNY---  143

Query  254  QNSTVVAGCTAICGANISSGFAGCYGIDCCE---TPVPFD----LTSYTANFTNSGIQSD  96
                     T I   N SS F GC  I  C+    P  +D    L       +N+ I + 
Sbjct  144  --------STIIKRHNDSSVFGGCLSISTCDPALNPGCYDFLCTLPQNITQVSNAQISNF  195

Query  95   GSNDNLKRCNSAFLIDQRWI  36
             S    ++C+S  ++++ WI
Sbjct  196  YSKRIPQKCHSVSMVEEDWI  215



>gb|KCW47717.1| hypothetical protein EUGRSUZ_K01469 [Eucalyptus grandis]
Length=615

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 65/193 (34%), Positives = 97/193 (50%), Gaps = 27/193 (14%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C + CGNVSIPFPFGIG GC L+PW+ + C N   P        +  ++   V+ +SL N
Sbjct  31   CVETCGNVSIPFPFGIGAGCFLDPWYEIVCQNRLVP--------ILYKIGLRVLNISLPN  82

Query  413  --QTITTLKSV---VNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQN  249
              Q++  + SV   + + + S     +    +  GS F +S+  N F   GC N+L T N
Sbjct  83   YYQSVDGMISVSLPLIYSNASCRGEGLGGPVNFEGSQFIFSQRWNVFTSVGC-NTLTTVN  141

Query  248  STV--VAGCTAIC-GANISSG-FAGCYGID-CCETPVPFDLTSYTANFTNSGIQSDGSND  84
            ST   V GC + C G +   G ++ C G D CC+T +P +L  ++ +F   G        
Sbjct  142  STESDVVGCRSKCAGTSTDFGRYSACLGRDQCCQTTLPVNLQGFSVDFKEEG--------  193

Query  83   NLKRCNSAFLIDQ  45
              + C  AFL D+
Sbjct  194  GPQGCKYAFLADR  206



>ref|XP_010041526.1| PREDICTED: wall-associated receptor kinase 2-like [Eucalyptus 
grandis]
 gb|KCW44291.1| hypothetical protein EUGRSUZ_L02269 [Eucalyptus grandis]
Length=363

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 62/189 (33%), Positives = 102/189 (54%), Gaps = 13/189 (7%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAP-PKAYLNSFVQIELQGEVVAVSLE  417
            C + CG+V++P+PFGIGEGC +N +F + CD ++AP PK YL      +   EV+ +SLE
Sbjct  37   CNKTCGDVAVPYPFGIGEGCYMNKYFSIRCDVTAAPTPKPYL-----WDSNIEVLNISLE  91

Query  416  NQ-TITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGC---GNSLFTQN  249
             +  I T  S+  + ++S  R    N T+ + S F +S+++N F   GC   G    + +
Sbjct  92   GELRIYTHISMACY-NESGIRQQPHNFTNGTLSAFPFSRTKNTFTAIGCDTMGMIAGSND  150

Query  248  STVVAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKRC  69
                +GC + CG         C GI CC+T +P    +YTA+  +    S+  + N   C
Sbjct  151  QGFSSGCLSSCGRIDDVTDGECNGIGCCKTSIPEKTLNYTASVGSFNNHSNVWSFN--PC  208

Query  68   NSAFLIDQR  42
            + AF+++ +
Sbjct  209  SYAFIVEDK  217



>ref|XP_010655831.1| PREDICTED: wall-associated receptor kinase 5-like [Vitis vinifera]
Length=665

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 58/193 (30%), Positives = 91/193 (47%), Gaps = 14/193 (7%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C + CGNVSI +PFGIG+GC L+  F + C+NSS P   +    V  E + EV+ +SLE 
Sbjct  36   CPETCGNVSIVYPFGIGKGCYLDKRFEITCNNSSLPHPLF---HVDEENEAEVLYMSLEY  92

Query  413  QTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGC--------GNSLF  258
              I    S V + + ++   +    +     PF YS + NKF+  GC         N+  
Sbjct  93   MRIKDWTSPVCYANYTSEGQSYALFSIAPMEPFSYSHTENKFIGIGCDIFAYIGYSNTTN  152

Query  257  TQNSTVVAGCTAICGANISSGF---AGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSN  87
              N + ++GC +IC     S       C GI CC+T  P DL+ +         ++D  +
Sbjct  153  FINKSYISGCVSICSGQGWSWLDTNYSCSGIGCCQTTFPVDLSIFEIQSGKMSARADSWD  212

Query  86   DNLKRCNSAFLID  48
             +  +C    + +
Sbjct  213  RSSNQCRLVLIAE  225



>ref|XP_009392086.1| PREDICTED: putative wall-associated receptor kinase-like 16 [Musa 
acuminata subsp. malaccensis]
Length=749

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 69/197 (35%), Positives = 94/197 (48%), Gaps = 23/197 (12%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCD--NSSAPPKAYLNSFVQIELQGEVVAVSL  420
            C + CG VSIP+PFGIG+GC     F V C+  N SA P+A+L      E    V  + L
Sbjct  38   CNETCGGVSIPYPFGIGDGC-FREGFEVTCEVGNGSATPRAFLGGR---EGNITVEEIFL  93

Query  419  ENQTITTLKSVVNFCDDSAGRNAITN--GTDLSGSPFYYSKSRNKFLFAGC---GNSLFT  255
                 + L  +   C +S G   + +    DL   PF+ S ++N+F   GC   G  L  
Sbjct  94   PQGQASILNGIAWDCFNSTGDRVVRHRPSLDLGDKPFWASSTKNRFTTVGCNVVGYILGG  153

Query  254  QNSTVVAGCTAIC--GANISSGFAGCYGIDCCETPVPFDLTSYT---ANFTNSGIQSDGS  90
             N+T   GC + C  GANI+SG   C G  CC+T +   L ++T   A F N     D S
Sbjct  154  DNTTYGTGCASFCFEGANITSG--SCSGTGCCQTTISDKLDNFTTRLAYFVNVSSYKDYS  211

Query  89   NDNLKRCNSAFLIDQRW  39
                  C  AF+ D+ W
Sbjct  212  P-----CTYAFIADKEW  223



>ref|XP_008798624.1| PREDICTED: uncharacterized protein LOC103713459 [Phoenix dactylifera]
Length=1427

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 61/194 (31%), Positives = 94/194 (48%), Gaps = 24/194 (12%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C+ +CGNV+IP+PFGIGEGC +   F + C+NS           V+I+L   ++ V   N
Sbjct  29   CQAKCGNVTIPYPFGIGEGCFMEG-FDITCNNSVPYLSDGNIDVVEIQLSEGLLVV---N  84

Query  413  QTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNS--LFTQNSTV  240
            Q     K+   + +D    +      +++G P+ +S SRNKF+  GC     L+  +S +
Sbjct  85   Q----FKAFDCYSEDGKDNSYNKPSINITGLPYKFSDSRNKFMAVGCDTVAYLWDDDSGL  140

Query  239  VAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSY------TANFTNSGIQSDGSNDNL  78
              GC  +C    +     C GI CC+TP+P  LT++      T N TN            
Sbjct  141  QTGCFTLCNNTRNIPLGTCSGIGCCQTPIPKGLTNFEVVIDSTMNHTNCW--------GF  192

Query  77   KRCNSAFLIDQRWI  36
              C+  FL D+ W+
Sbjct  193  NPCSYGFLADEGWL  206


 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 59/192 (31%), Positives = 97/192 (51%), Gaps = 20/192 (10%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C+ +CGNV++P+PFGIG+GC +   F + C+ S     AYL+     +   +VV ++L  
Sbjct  730  CQAKCGNVTVPYPFGIGKGCFMEG-FDITCNESV----AYLS-----DTNIDVVKINLTE  779

Query  413  QTITTLKSVVNFCDDSAGRNAITN--GTDLSGSPFYYSKSRNKFLFAGCGNSLFTQNST-  243
              +   + +   C    G++   N    +++G P+ +S SRNKF+  GC      ++   
Sbjct  780  GLLVVNQYMAQDCYSKDGKDNDYNIPSINITGMPYKFSDSRNKFMAVGCDTLAVLRDDEL  839

Query  242  -VVAGCTAICGA--NISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKR  72
             +  GC   C +  NI SG   C GI CCETP+P  LT++       G  +  +  +   
Sbjct  840  GLKTGCITSCNSTRNIPSG--TCAGIGCCETPIPKGLTAF--EVIVDGPMNHTNCWDFNP  895

Query  71   CNSAFLIDQRWI  36
            C+  FL D+ W+
Sbjct  896  CSYGFLADEGWL  907



>ref|XP_011069626.1| PREDICTED: wall-associated receptor kinase 2-like [Sesamum indicum]
Length=701

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 56/197 (28%), Positives = 97/197 (49%), Gaps = 12/197 (6%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C   CGN++IP+PFG    C+ +  FL+NC++S  PPK +LNS        EV+ +SL+ 
Sbjct  18   CPTSCGNLTIPYPFGTSHHCSHDNSFLINCNHSYNPPKLFLNSS-----SIEVLDISLDG  72

Query  413  QTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQNS----  246
             ++     + + C D +G       ++L+ S F  S +RNKF+  GC      + S    
Sbjct  73   -SLKVASFIASDCYDKSGAQISGTVSELTLSKFLISSTRNKFIAIGCDTYALVEGSDEWK  131

Query  245  TVVAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKRCN  66
             + AGC + C +  S     C+GI CC+T +P  +  +  +  +   ++     +   C 
Sbjct  132  QMSAGCVSWCDSIESVVNGTCFGIGCCQTSIPNGVKDFLVDIRS--FRNHTRVKSFNPCG  189

Query  65   SAFLIDQRWIPKQSTSL  15
             AF+++ +     S+ L
Sbjct  190  YAFVVEAKAFEFSSSDL  206



>gb|EAZ09353.1| hypothetical protein OsI_31625 [Oryza sativa Indica Group]
Length=465

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 86/188 (46%), Gaps = 36/188 (19%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C  RCG+VS+P+PFGI +GC L P F + CD + APP+  L +        +VV +SL N
Sbjct  30   CPDRCGDVSVPYPFGIRDGCHL-PGFRLTCDATRAPPRLMLGNGTL-----QVVDISLAN  83

Query  413  QTITT--LKSVVNFCDD------SAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCG--NS  264
             T+    L   VNF  D      S      + GT     P+  S+ RN+ +  GC    +
Sbjct  84   STVRALDLAGAVNFTYDVSKVAPSGSGTWASLGTVAGAGPYVVSEQRNRLVVTGCNVQAT  143

Query  263  LFTQNSTVVAGCTAIC-----------------GA---NISSGFAGCYGIDCCETPVPFD  144
            L  +N+ ++ GC++ C                 GA   N + G   C G  CCETP+   
Sbjct  144  LAGENTNIIGGCSSFCPVSEMFTSVAATTPVVPGAGADNATDGGFTCSGTSCCETPIAIG  203

Query  143  LTSYTANF  120
              SY   F
Sbjct  204  RPSYLVQF  211



>ref|XP_010051290.1| PREDICTED: LOW QUALITY PROTEIN: wall-associated receptor kinase-like 
6 [Eucalyptus grandis]
Length=940

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 60/170 (35%), Positives = 91/170 (54%), Gaps = 16/170 (9%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C ++CG+V+IPFPFGI  GC L+ W+ + C  ++  P        +I LQ  V+ +SL +
Sbjct  291  CAEKCGSVTIPFPFGIEAGCFLDDWYQIVCQQNNTVP-----ILKKIRLQ--VLNISLPD  343

Query  413  QTITTLKSV---VNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQNST  243
              +  + +V   V + + S G +       L GS F +S+ RN F   GC N+L T NST
Sbjct  344  IDVDGMINVSLPVIYSNASYGGDGRGAMVSLKGSQFVFSQKRNIFTVVGC-NTLVTVNST  402

Query  242  --VVAGCTAIC-GANIS-SGFAGCYGID-CCETPVPFDLTSYTANFTNSG  108
               V GC + C G N + S ++ C G D CC++ +P +L  +  NF   G
Sbjct  403  ESAVFGCRSKCAGTNFTISKYSACSGRDGCCQSSLPLNLQGFDVNFKEEG  452


 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 60/189 (32%), Positives = 95/189 (50%), Gaps = 26/189 (14%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C   CG++ IPFPFG G GC L+ W+ ++C  ++  P       +  ++   V+ +SL +
Sbjct  31   CPDTCGDIPIPFPFGTGAGCFLDEWYQIDCQQNNTVP-------ILKKIGLRVLNISLPD  83

Query  413  QTITTLKSV---VNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQNST  243
            + +  + ++   V + + S G +    G  L GS F +S+ RN F   GC N+L T ++T
Sbjct  84   EYVDGMINISLPVIYSNASCGGDGRGAGVSLKGSQFVFSQKRNVFTLVGC-NTLATVDTT  142

Query  242  --VVAGCTAIC-GANISSGFAG-CYGID-CCETPVPFDLTSYTANFT-NSGIQSDGSNDN  81
               V GC + C G N S  + G C   D CC+T +P +L  ++ +F   SG Q       
Sbjct  143  KSAVVGCRSRCAGTNTSISWNGDCSRRDGCCQTELPINLQGFSVDFKEESGHQG------  196

Query  80   LKRCNSAFL  54
               C  AFL
Sbjct  197  ---CKYAFL  202



>ref|XP_002455706.1| hypothetical protein SORBIDRAFT_03g022080 [Sorghum bicolor]
 gb|EES00826.1| hypothetical protein SORBIDRAFT_03g022080 [Sorghum bicolor]
Length=786

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 58/187 (31%), Positives = 91/187 (49%), Gaps = 26/187 (14%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C   CGN+S+P+PFGIG  C+L P F + CD +  PP+  +          ++V +SL N
Sbjct  51   CPSSCGNLSVPYPFGIGASCSL-PGFNLTCDRTRHPPRLLVGDGAL-----QIVEISLAN  104

Query  413  QTITTLKS--VVNFCDDSAGRNAITNGT------DLSGSPFYYSKSRNKFLFAGCG--NS  264
             T+  L +   VN    ++  +   +GT        S SP+  S+ RN+ +  GC    +
Sbjct  105  STVRALYTAGAVNINFSTSATSVDGSGTWSGGLGAASDSPYVVSEWRNQLVVTGCNVQGT  164

Query  263  LFTQNSTVVAGCTAIC-------GANISS---GFAGCYGIDCCETPVPFDLTSYTANFTN  114
            L   +  V+ GC++ C       GA +++   G   C GI CCETP+P    SY   F  
Sbjct  165  LLGGSGNVITGCSSFCSIDDKWTGAVVTTPDEGATACSGIRCCETPIPIGRPSYNVQFKY  224

Query  113  SGIQSDG  93
              +++ G
Sbjct  225  LDVENTG  231



>ref|XP_007217301.1| hypothetical protein PRUPE_ppa018696mg, partial [Prunus persica]
 gb|EMJ18500.1| hypothetical protein PRUPE_ppa018696mg, partial [Prunus persica]
Length=725

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 93/199 (47%), Gaps = 24/199 (12%)
 Frame = -2

Query  593  CEQRCG-NVSIPFPFGIG--EGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVS  423
            C   CG NVSIP+PFGIG  + C  N WF ++C N S   K +L        Q EV+ +S
Sbjct  22   CMTHCGINVSIPYPFGIGPNKDCYFNEWFQIDC-NESTGHKPFLR-----RAQMEVLNIS  75

Query  422  LENQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN-SLFTQNS  246
            ++      +KS V F     G+       +L+GSPF Y   +N F    CG  +    + 
Sbjct  76   IDG--TLQVKSPVTFFSGCKGKET-RQAPNLTGSPFVYLDRKNMFTAVSCGRLATMRSDE  132

Query  245  TVVAGCTAIC---GANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLK  75
             V  GC + C     + ++   G  G +CC+T +P ++  +T              D L+
Sbjct  133  NVFHGCNSTCDDQSTDSATYRCGTIGNNCCQTTIPPNIGVFTTEIQ--------PRDQLE  184

Query  74   RCNSAFLIDQRWIPKQSTS  18
             CN AFL+DQ W  K  +S
Sbjct  185  GCNYAFLVDQDWFLKNLSS  203



>ref|XP_006660979.1| PREDICTED: wall-associated receptor kinase 2-like [Oryza brachyantha]
Length=756

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 66/197 (34%), Positives = 93/197 (47%), Gaps = 38/197 (19%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYL-NSFVQIELQGEVVAVSLE  417
            C  RCGNVS+PFPFGI +GC L   F + CD + +PP+  L N  +Q      VV +SL 
Sbjct  31   CPDRCGNVSVPFPFGIRDGCHLE-GFRLTCDATRSPPRLMLGNGTLQ------VVEISLA  83

Query  416  NQTITTLKSVVNFCDDSAGRNAITNGT-DLSGS----------PFYYSKSRNKFLFAGCG  270
            N T+  +        D AG   +T GT D +G+          P+  S++RN+ L  GC 
Sbjct  84   NSTVRAV--------DVAGAANMTFGTIDGNGTWAGVGYDSDGPYVVSETRNQLLVTGCN  135

Query  269  NSLFTQNSTV--VAGCTAIC-------GANISSGFAGCYGIDCCETPVPFDLTSYTANFT  117
              +  Q S+   + GC++ C       G  +S     C G+ CC+TP+P    SY     
Sbjct  136  VLVTLQGSSSNDIVGCSSFCSNNDRWTGTVLSIPGDKCSGLGCCKTPIPIGRPSYHVQLK  195

Query  116  NSGI--QSDGSNDNLKR  72
            N     + DG   N  R
Sbjct  196  NLDFSREQDGKVPNAVR  212



>ref|XP_011027690.1| PREDICTED: LOW QUALITY PROTEIN: putative wall-associated receptor 
kinase-like 16, partial [Populus euphratica]
Length=749

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 61/194 (31%), Positives = 99/194 (51%), Gaps = 20/194 (10%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C+ RCGNVSIP+PFG    C  +  FL+ C+++  PPKA+LN+         V+ ++LE 
Sbjct  33   CQDRCGNVSIPYPFGTENDCYYDHRFLITCNHTLNPPKAFLNTS-----NINVMEIALEG  87

Query  413  QTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCG-----NSLF---  258
            + +  LK +   C D++GR  +      + + F  S + N F+  GC      N  F   
Sbjct  88   K-LHILKYIAKECYDASGR-TLRIIPSFTLAYFIISDADNMFVSIGCDSVASLNGNFKAA  145

Query  257  --TQNSTVVAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSND  84
              T+N  VV GCT++C +        C GI CC+T +   +  +  N T S  ++     
Sbjct  146  GSTENEYVV-GCTSLCNSLKYVRNDTCSGIGCCQTSLAKGVNKF--NLTVSSRKNHTGIL  202

Query  83   NLKRCNSAFLIDQR  42
            N + C+ AF+I+++
Sbjct  203  NFRSCSYAFVIEEK  216



>gb|EMS58067.1| Wall-associated receptor kinase 5 [Triticum urartu]
Length=742

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 55/172 (32%), Positives = 82/172 (48%), Gaps = 16/172 (9%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCA---LNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVS  423
            C  RCG+V IP+PFGIG  CA   L+ +F ++C+N+S P +  +     + +   V  +S
Sbjct  44   CPDRCGDVPIPYPFGIGAQCAAVSLSSFFNLDCENTSHPLRPTVGGPADVAVN--VADIS  101

Query  422  LENQTITTLKSVVNFCDDSAGRNAITN----GTDLSGSPFYYSKSRNKFLFAGCGN----  267
            LE   +  L  V   C  S+   + +N    G  L  +PF  S  RN+F+  GC      
Sbjct  102  LERGEMRVLIPVSYICFTSSATVSASNNNTVGFGLEDTPFLPSPGRNRFMVIGCNTLGLV  161

Query  266  -SLFTQNSTVVAGCTAIC--GANISSGFAGCYGIDCCETPVPFDLTSYTANF  120
                   S  +AGC + C   +  S   A C G  CCE  +P +LT++   F
Sbjct  162  GGFRGGTSQYLAGCYSYCDGASGASDDGAPCTGTGCCEASIPTNLTAFNVAF  213



>ref|XP_010051321.1| PREDICTED: wall-associated receptor kinase-like 5 [Eucalyptus 
grandis]
Length=984

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 58/170 (34%), Positives = 90/170 (53%), Gaps = 16/170 (9%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C + CGNV+IPFPFGIG GC    W+ + C  ++  P       +  ++   V+ +SL +
Sbjct  31   CLETCGNVTIPFPFGIGAGCFFEEWYRIVCKQNNTVP-------ILKKIGLRVLNISLPD  83

Query  413  QTITTLKSV---VNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQNST  243
              +  + +V   V + + S G +    G  L GS F +S++RN F   GC N+L T N+T
Sbjct  84   GYVDGMINVSLPVIYSNASCGGDGRAAGVSLEGSQFVFSRTRNVFTLVGC-NTLATVNTT  142

Query  242  VVA--GCTAIC-GANISSGF-AGCYGID-CCETPVPFDLTSYTANFTNSG  108
              A  GC + C G N S  + + C G D CC+T +P +L  ++ +F   G
Sbjct  143  QSAFVGCKSRCAGTNTSFSWNSACSGRDGCCQTMLPLNLQGFSVDFKEKG  192


 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 53/166 (32%), Positives = 89/166 (54%), Gaps = 16/166 (10%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C + CG+V+IPFPFGI   C L+ W+ + C+ ++  P       +  ++   V+ +SL +
Sbjct  290  CAETCGSVTIPFPFGIRAKCFLDDWYQIVCEQNNTVP-------ILKKIGLRVLNISLPD  342

Query  413  QTITTLKSV---VNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQN--  249
            + +  + +V   V + + S G +       L GSPF +S+ RN F   GC N+L T N  
Sbjct  343  EDVDGMINVSLPVIYSNASCGGDGRGALVSLKGSPFVFSQKRNIFTVVGC-NTLLTANGK  401

Query  248  STVVAGCTAIC-GANIS-SGFAGCYGID-CCETPVPFDLTSYTANF  120
             + V GC + C G N + S ++ C G D CC++ +P +L  +  +F
Sbjct  402  ESAVFGCQSKCAGTNFTISKYSACSGEDECCQSSLPLNLQGFGVDF  447



>gb|KCW81763.1| hypothetical protein EUGRSUZ_C03129 [Eucalyptus grandis]
Length=958

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 58/170 (34%), Positives = 90/170 (53%), Gaps = 16/170 (9%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C + CGNV+IPFPFGIG GC    W+ + C  ++  P       +  ++   V+ +SL +
Sbjct  31   CLETCGNVTIPFPFGIGAGCFFEEWYRIVCKQNNTVP-------ILKKIGLRVLNISLPD  83

Query  413  QTITTLKSV---VNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQNST  243
              +  + +V   V + + S G +    G  L GS F +S++RN F   GC N+L T N+T
Sbjct  84   GYVDGMINVSLPVIYSNASCGGDGRAAGVSLEGSQFVFSRTRNVFTLVGC-NTLATVNTT  142

Query  242  VVA--GCTAIC-GANISSGF-AGCYGID-CCETPVPFDLTSYTANFTNSG  108
              A  GC + C G N S  + + C G D CC+T +P +L  ++ +F   G
Sbjct  143  QSAFVGCKSRCAGTNTSFSWNSACSGRDGCCQTMLPLNLQGFSVDFKEKG  192


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 42/147 (29%), Positives = 75/147 (51%), Gaps = 16/147 (11%)
 Frame = -2

Query  536  CALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLENQTITTLKSV---VNFCDDS  366
            C L+ W+ + C+ ++  P       +  ++   V+ +SL ++ +  + +V   V + + S
Sbjct  283  CFLDDWYQIVCEQNNTVP-------ILKKIGLRVLNISLPDEDVDGMINVSLPVIYSNAS  335

Query  365  AGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQN--STVVAGCTAIC-GANIS-S  198
             G +       L GSPF +S+ RN F   GC N+L T N   + V GC + C G N + S
Sbjct  336  CGGDGRGALVSLKGSPFVFSQKRNIFTVVGC-NTLLTANGKESAVFGCQSKCAGTNFTIS  394

Query  197  GFAGCYGID-CCETPVPFDLTSYTANF  120
             ++ C G D CC++ +P +L  +  +F
Sbjct  395  KYSACSGEDECCQSSLPLNLQGFGVDF  421



>emb|CAH66392.1| OSIGBa0134J07.10 [Oryza sativa Indica Group]
Length=338

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 56/188 (30%), Positives = 98/188 (52%), Gaps = 19/188 (10%)
 Frame = -2

Query  590  EQRCGNVSIPFPFGI--GEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLE  417
            + +CG+V IP+PFGI   + CA  P F ++C+NS    + +L  F       EV+ +SL+
Sbjct  35   DTKCGSVDIPYPFGIVGQDSCATMPHFKLHCNNS----RPFLGDF-------EVLNISLQ  83

Query  416  NQTITTLKSVVNFCDDSAGRNAITNGTDLS-GSPFYYSKSRNKFLFAGCGNSLFT--QNS  246
               +  L  + +FC ++  +    +  + +  +PF +S + NKF   GC    +   +++
Sbjct  84   LGQLRVLNRIFSFCYNTTSQEMEQHKWNKTLSAPFRFSDTGNKFTVIGCRTLAYITDRDA  143

Query  245  TVVAGCTAICGANISSGF--AGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKR  72
              ++GC + C  +  +G     C GI CC+T +P DL  Y  +F + G+ +  S  N  R
Sbjct  144  RYLSGCVSACQRDGVTGATNGSCSGIGCCQTTIPKDLHHYQVSF-DKGLNTSDSMYNATR  202

Query  71   CNSAFLID  48
            C+ A L+D
Sbjct  203  CSYAVLMD  210



>dbj|BAJ95069.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=320

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 57/168 (34%), Positives = 83/168 (49%), Gaps = 13/168 (8%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCA---LNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVS  423
            C  +CG+V IP+PFGIG  CA   L+ +F + C+ +  PP+  + +    E   E+  +S
Sbjct  30   CPDKCGDVPIPYPFGIGTHCAATSLSSYFNLTCNGTMDPPRPMVGN---DEAVVEITDIS  86

Query  422  LENQTITTLKSVVNFCDDSAGR-NAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQN-  249
            LE+  +  L  V + C  S         G +L  +PF  S SRN+F   GC         
Sbjct  87   LEHGEMRVLSPVNHICFTSETTFTKFLGGYELQLTPFLPSPSRNRFTVIGCNTLGLISGY  146

Query  248  ----STVVAGCTAIC-GANISSGFAGCYGIDCCETPVPFDLTSYTANF  120
                S  VAGC + C G N ++  A C G+ CCE  +P +LTS+   F
Sbjct  147  KGTASQYVAGCYSYCEGVNNTTEGAPCAGMGCCEAAIPANLTSFGVKF  194



>ref|XP_006579332.1| PREDICTED: wall-associated receptor kinase 5-like [Glycine max]
Length=1279

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 90/174 (52%), Gaps = 10/174 (6%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C+ +CG+V+IP+PFG  E C LN  F V C+ S  PPK +L +  +     E++ VSL N
Sbjct  9    CQNKCGSVNIPYPFGTTENCCLNRNFYVACNTSHNPPKPFLWNVTK---NIEILEVSL-N  64

Query  413  QTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQNSTV--  240
              +     V   C D  G    +  + ++   F++S S+NKF+  GC ++L T N+T+  
Sbjct  65   GHLRIKSPVAYVCYDEKGVLVDSGNSFMTLQAFHFSYSQNKFIGIGC-DTLSTINATIGK  123

Query  239  ---VAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSN  87
                 GC ++C +  SS     +GI  C+T +P ++ +Y A    S +     N
Sbjct  124  NYSAGGCFSLCSSVESSANGSWFGIGFCQTSIPKNILAYQARVLRSNLMHSDMN  177


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 81/164 (49%), Gaps = 18/164 (11%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYL-NSFVQIELQGEVVAVSLE  417
            C+Q+CGNV IPFPFG+ E C+LN  FL+ C  + +PP  +L N + QI     V+ +SLE
Sbjct  769  CQQKCGNVIIPFPFGMTEACSLNTSFLITCHRNLSPPTPFLQNDYHQI----SVLDISLE  824

Query  416  NQTITTLKSVVNFC--DDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQNST  243
               ++    V   C  ++  G + I     ++  PF+ S ++NK +  G   +    N  
Sbjct  825  YGQLSISLPVARNCLINNLTGESFIA----MNLGPFHLSSNQNKLIVFGADAAGMVYNLE  880

Query  242  VVAG-------CTAICGANISSGFAGCYGIDCCETPVPFDLTSY  132
              +G       C ++     S+    C G  CCETP+   L+ +
Sbjct  881  NASGILYPTIACMSVYAPAASAPDKSCSGTLCCETPIQQRLSEF  924



>ref|XP_006421678.1| hypothetical protein CICLE_v10007075mg, partial [Citrus clementina]
 gb|ESR34918.1| hypothetical protein CICLE_v10007075mg, partial [Citrus clementina]
Length=259

 Score = 84.3 bits (207),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 62/199 (31%), Positives = 93/199 (47%), Gaps = 33/199 (17%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIEL------QGEVV  432
            C+  CGNV+I +PFGIG+GC  +  + V CDNSS  PKA+L     +EL       G ++
Sbjct  16   CQYSCGNVTINYPFGIGDGCYFDKRYEVVCDNSSGSPKAFLAGVNNLELLNSDRYDGNLM  75

Query  431  AVSLENQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGN----S  264
             V   N  + +LK+               NG +LSG P  +S+  N+F   GC N     
Sbjct  76   RV---NIPVISLKTT-----------GHQNGVNLSGIPLTFSRWHNRFAAIGCRNYNTIV  121

Query  263  LFTQNSTVVAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSND  84
                +STV  GC  I    +SS   GCY   C   P      + T +F N+ +    S  
Sbjct  122  KRANDSTVFGGCLTISTCALSS--RGCYDFVCALPP------NLTQDF-NASMLYHFSQS  172

Query  83   NLKRCNSAFLIDQRWIPKQ  27
              ++C S  ++++ W+  +
Sbjct  173  IPQKCQSVLMVEENWLQSE  191



>gb|EAY93773.1| hypothetical protein OsI_15554 [Oryza sativa Indica Group]
Length=338

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 56/188 (30%), Positives = 98/188 (52%), Gaps = 19/188 (10%)
 Frame = -2

Query  590  EQRCGNVSIPFPFGI--GEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLE  417
            + +CG+V IP+PFGI   + CA  P F ++C+NS    + +L  F       EV+ +SL+
Sbjct  35   DTKCGSVDIPYPFGIVGQDSCATMPHFKLHCNNS----RPFLGDF-------EVLNISLQ  83

Query  416  NQTITTLKSVVNFCDDSAGRNAITNGTDLS-GSPFYYSKSRNKFLFAGCGNSLFT--QNS  246
               +  L  + +FC ++  +    +  + +  +PF +S + NKF   GC    +   +++
Sbjct  84   LGQLRVLNRISSFCYNTTSQEMEQHKWNKTLSAPFRFSDTGNKFTVIGCRTLAYITDRDA  143

Query  245  TVVAGCTAICGANISSGF--AGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKR  72
              ++GC + C  +  +G     C GI CC+T +P DL  Y  +F + G+ +  S  N  R
Sbjct  144  RYLSGCVSACQRDGVTGATNGSCSGIGCCQTTIPKDLHHYQVSF-DKGLNTSDSMYNATR  202

Query  71   CNSAFLID  48
            C+ A L+D
Sbjct  203  CSYAVLMD  210



>ref|XP_011034599.1| PREDICTED: wall-associated receptor kinase-like 22 [Populus euphratica]
Length=697

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 95/186 (51%), Gaps = 22/186 (12%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C  RCG++SIP+PFGIG+ C +N WF + C+ +  P +A+++      +  EV+ +S E 
Sbjct  31   CPDRCGDISIPYPFGIGKDCYMNEWFAIECNATVNPARAFISG-----INMEVLNISAER  85

Query  413  QTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCG-NSLFTQNSTVV  237
             T+ T+KS +   + + G + +    + +G+PF +S + N F+  GC   +L T  +  +
Sbjct  86   ATV-TVKSPIISSNCTGGEDGVP--LNFTGTPFVFSGNDNVFIAVGCNTQALMTGITPSL  142

Query  236  AGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKRCNSAF  57
             GC + C    S  F        C+   P  L  +     N  +++   N + + C  AF
Sbjct  143  IGCVSTCSDVKSKNF--------CQASPPSFLQVF-----NPKLEATDDNQDREGCKLAF  189

Query  56   LIDQRW  39
            L++Q W
Sbjct  190  LVNQTW  195



>gb|EAZ25019.1| hypothetical protein OsJ_08800 [Oryza sativa Japonica Group]
Length=761

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 60/205 (29%), Positives = 101/205 (49%), Gaps = 27/205 (13%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C  +CG++SIP+PFGIG  CA + +F + C+ + +PP+  +++  Q      +V +SL +
Sbjct  37   CPDKCGDISIPYPFGIGARCARDQYFELECNRAYSPPRLIVSTHRQ-----HLVNLSLAD  91

Query  413  QTITTLKSVVNFCDDSA------GRNAITNGTDLSGSPFY-YSKSRNKFLFAGCGNSLFT  255
               T L +    C +S         N +     L GS  Y +S +RN+F+  GC N  + 
Sbjct  92   GEATALINARRQCYNSTEGLIGDANNYVNKDITLVGSNAYRFSAARNRFVALGCPNMGYF  151

Query  254  QNS--TVVAGCTAICGANISSGFA-----GCYGIDCCETPVPFDLTSYTANFTNSGIQSD  96
             ++    V+GCT+IC  +  +G +     GC G  CC++ +P + T Y   +  +     
Sbjct  152  VDTYGYYVSGCTSICRPSQGNGASGASTGGCTGEGCCQSRIPTN-TDYYELYVQTF--KP  208

Query  95   GSNDNLKR-----CNSAFLIDQRWI  36
            G  D + R     C   FL + +WI
Sbjct  209  GEGDPILRGGTTACRYVFLAEDKWI  233



>ref|XP_010064650.1| PREDICTED: wall-associated receptor kinase 2-like [Eucalyptus 
grandis]
Length=658

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 62/194 (32%), Positives = 96/194 (49%), Gaps = 24/194 (12%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C++ CGN+S+PFPFG+ E CA N + +++C+++S          + +E    V+ +SLEN
Sbjct  14   CDRTCGNMSVPFPFGLDESCARNSYLVLSCNHTSGD--------LSLEDDIPVLDISLEN  65

Query  413  QTITTLKSVV--------NFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLF  258
             T+T  +           +  DDS    +IT G D     + +S +RNK    GC    F
Sbjct  66   GTMTIGQYRAFDCYDESGHLLDDSVPDTSITLGED---GQYTFSDTRNKLTVFGCDTLAF  122

Query  257  T--QNSTVVAGCTAICGANIS-SGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSN  87
                N T  +GC + C  +I+ +  + C G  CC+T +P  L S   N +     +  S 
Sbjct  123  ILGANGTAGSGCFSYCHEDINFTAESYCSGYGCCQTSIPKSLRSL--NISMISATNYTSV  180

Query  86   DNLKRCNSAFLIDQ  45
             N   C SAFL+DQ
Sbjct  181  YNFSSCGSAFLVDQ  194



>ref|XP_004306243.1| PREDICTED: putative wall-associated receptor kinase-like 13-like 
[Fragaria vesca subsp. vesca]
Length=787

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 66/203 (33%), Positives = 90/203 (44%), Gaps = 32/203 (16%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIG--EGCALNPWFLVNCD--------NSSAPPKAYLNSFVQIELQ  444
            C   CG V IP+PFGIG    C  + WF + C         NSS P   +L       LQ
Sbjct  34   CTSLCGGVQIPYPFGIGPNNHCYFDGWFEIECRNSIDFQFFNSSVPETPFLR-----RLQ  88

Query  443  GEVVAVSLENQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPF-YYSKSRNKFLFAGCGN  267
             EV+++S+ N T+  L  V  F   S  R       +L+ SPF Y +   N F    CG 
Sbjct  89   LEVLSISIVNATLQVLSPVTFF---SCKRKKSPPAPNLTASPFSYATDDHNTFFAVSCG-  144

Query  266  SLFTQNST------VVAGCTAICGANISSGFAGC-YGIDCCETPVPFDLTSYTANFTNSG  108
             LF    T       VAGC + C +        C YGI+CC T     L+ Y  +F+   
Sbjct  145  -LFASMRTAGPPNHTVAGCASTCSSTTPLTNESCGYGINCCRT----TLSQYVTSFSVMQ  199

Query  107  IQSDGSNDNLKRCNSAFLIDQRW  39
             Q +   + +   + AFL+DQ+W
Sbjct  200  EQDETRRNAMDCKDYAFLVDQKW  222



>gb|EEC66495.1| hypothetical protein OsI_32596 [Oryza sativa Indica Group]
Length=285

 Score = 84.0 bits (206),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 60/194 (31%), Positives = 100/194 (52%), Gaps = 19/194 (10%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C ++CG+V IP+PFGIG  CA  P F V C++S  PP+ Y  +        E++ +SLE 
Sbjct  31   CGRKCGDVRIPYPFGIGVDCAW-PGFDVTCNHSFTPPRPYTGNV-------EIMDISLEA  82

Query  413  QTITTLKSVVNFC---DDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQ---  252
              +     VV+ C   D+++     ++  DL G+ F Y++SRN+F   GCG   F +   
Sbjct  83   GEMRVYTDVVSNCYTSDNTSEYVTTSSQLDL-GTTFLYARSRNEFTAIGCGVIAFLRGRD  141

Query  251  NSTVVAGCTAICGANISSGFAG--CYGIDCCETP-VPFDLTSYTANFTNSGIQSDGSNDN  81
            +++   GC   C +   +   G  C G+ CC+ P +P +L     +F    I ++ +  +
Sbjct  142  DASYSTGCITTCASLDEAAHDGDDCTGLGCCQVPSIPPNLDILNISFDPRSIINNLAWKD  201

Query  80   LKRCNSAFLIDQRW  39
               C+ AF+ +Q W
Sbjct  202  -SPCSYAFVAEQGW  214



>ref|XP_008225630.1| PREDICTED: wall-associated receptor kinase 2-like [Prunus mume]
Length=749

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 62/190 (33%), Positives = 93/190 (49%), Gaps = 15/190 (8%)
 Frame = -2

Query  596  RC-EQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSL  420
            RC  Q+CGNVS+P+PFGI  GC     F +NC  S+ PP AYL      E    V  +SL
Sbjct  25   RCLNQKCGNVSVPYPFGIDSGCYREEKFFINCSQSTNPPIAYLG-----EGNLPVTNISL  79

Query  419  ENQTITTLKSVVNFCDDSAGR--NAITNGTDLSGSPFYYSKSRNKFLFAGCG-NSLF---  258
            E   +     +   C D  G   N     + +  + F  S ++N+F+  GC  N++F   
Sbjct  80   EKGELQIQMLITKDCYDQQGEQTNDSQAFSSIKMAEFTISATKNRFMAVGCDTNAIFGGY  139

Query  257  TQNSTVVAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNL  78
             +    ++GCT+ C  +I S    C GI CC+T +P  LT+   N T     +   + N 
Sbjct  140  RETEQYMSGCTSFC-QSIPSVNDSCSGIGCCQTYIPSGLTN--QNITLESFYNHKYSWNF  196

Query  77   KRCNSAFLID  48
              C+ AF+++
Sbjct  197  NPCSFAFVVE  206



>gb|KDO38764.1| hypothetical protein CISIN_1g004702mg [Citrus sinensis]
Length=735

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 56/188 (30%), Positives = 90/188 (48%), Gaps = 12/188 (6%)
 Frame = -2

Query  596  RCEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLE  417
            RC  RCG+V IP+PFG   GC LN  FL+ C+++  PPK +L      +   EVV +S++
Sbjct  23   RCPNRCGDVEIPYPFGTKRGCFLNKDFLITCNDTLNPPKPFLR-----KSSIEVVNISID  77

Query  416  NQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSL----FTQN  249
               +  ++     C D+ G +  +N   ++ S F +S++ NKF+  GC +      F   
Sbjct  78   GH-LNVMQYTAKVCYDAKGYSVDSNLPYITLSKFTFSRTGNKFVVIGCDSYAYVLGFLGE  136

Query  248  STVVAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDNLKRC  69
                +GCT+ C +        C G  CC+  +P  L        +    +  S+ N   C
Sbjct  137  DRYKSGCTSTCDSLDYVTNGSCVGTGCCQIEIPGGLKELEVEAFSFKNHTKVSSFN--PC  194

Query  68   NSAFLIDQ  45
              AF++DQ
Sbjct  195  TYAFVVDQ  202



>gb|KDP42943.1| hypothetical protein JCGZ_23885 [Jatropha curcas]
Length=705

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 61/196 (31%), Positives = 90/196 (46%), Gaps = 21/196 (11%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIG--------EGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGE  438
            C +RCG+V +P+PFGI           CALN  F++ C+ S  PP  +    + I     
Sbjct  26   CPERCGDVLVPYPFGINFTSGISNPYNCALNKHFILTCNVSDDPPTLFFGENMPIH----  81

Query  437  VVAVSLENQTITTLKSVVNFCDDSAG--RNAITNGTDLSGSPFYYSKSRNKFLFAGCGNS  264
               +S+E  TI+      N C +  G   N         G P  +S +RNKF   GC   
Sbjct  82   --NISIEEGTISVRIESANNCYNETGITYNFSQYIRMKGGRPVRFSDTRNKFTVVGCDTL  139

Query  263  LFTQN--STVVAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGS  90
               ++   T  +GC ++C +N++     C G  CC+TP+P +LT  T N   S + +   
Sbjct  140  ALMEDDEETFGSGCISMCDSNVTLE-GSCSGRGCCQTPLPRNLT--TINIHLSSLYNHSR  196

Query  89   NDNLKRCNSAFLIDQR  42
                K C  AFL D+R
Sbjct  197  VWQFKPCEFAFLADER  212



>ref|XP_010655829.1| PREDICTED: wall-associated receptor kinase 2-like [Vitis vinifera]
Length=764

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 57/193 (30%), Positives = 90/193 (47%), Gaps = 14/193 (7%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C + CGNVSI +PFGIG+GC L+  F + C+NSS P   +    V  E + EV+ +SLE 
Sbjct  6    CPETCGNVSIVYPFGIGKGCYLDKRFEITCNNSSLPHPLF---HVDEENEAEVLYMSLEY  62

Query  413  QTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGC--------GNSLF  258
              I    S   + + ++   +          PF YS + NKF+  GC         N+  
Sbjct  63   MRIRDWASPDCYANYTSEGQSYAQFPVAPMEPFSYSHTENKFIGIGCDIFAYIGYSNTTN  122

Query  257  TQNSTVVAGCTAICGANISSGF---AGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSN  87
            + N + ++GC ++C     S       C GI CC+   P DL+ +     N    +DG +
Sbjct  123  STNKSYISGCVSVCNGQGWSWLDTNYSCSGIGCCQNTFPEDLSIFEIRIGNMSTWADGGD  182

Query  86   DNLKRCNSAFLID  48
                +C+   + +
Sbjct  183  WPSNQCSLVLIAE  195



>gb|EAY91176.1| hypothetical protein OsI_12785 [Oryza sativa Indica Group]
Length=308

 Score = 84.0 bits (206),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 61/190 (32%), Positives = 90/190 (47%), Gaps = 33/190 (17%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCA---LNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVS  423
            C  +CG+VSIP+PFG+G+ CA   LNP+F + CD+++ PP   L       +Q EV+ ++
Sbjct  6    CPDKCGDVSIPYPFGVGDRCAAVGLNPYFNITCDDAARPPVPKLG---DPGMQAEVIDIT  62

Query  422  LENQTITT--LKSVVNFCDDSAGRNA----ITNGTDLSGSPFYYSKSRNKFLFAGC----  273
            LE   +      S V +  +++  NA    +  GT L  SP     SRN+    GC    
Sbjct  63   LERGEVRMNGFISYVCYTSNTSSTNATGQFVVGGTQLRVSP-----SRNQLTVIGCSTLG  117

Query  272  ----------GNSLFTQNSTVVAGCTAICGANISSGFAG--CYGIDCCETPVPFDLTSYT  129
                      G S    +     GC   CG+  S+G  G  C G  CC+ P+  DL S  
Sbjct  118  LTGGAYSGPGGRSEPDDDVYYATGCYTYCGSLNSTGADGAPCAGTGCCQVPITADLASVG  177

Query  128  ANFTNSGIQS  99
            A F ++ + S
Sbjct  178  ARFPSNWVSS  187



>emb|CBI31033.3| unnamed protein product [Vitis vinifera]
Length=702

 Score = 86.7 bits (213),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 57/193 (30%), Positives = 90/193 (47%), Gaps = 14/193 (7%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C + CGNVSI +PFGIG+GC L+  F + C+NSS P   +    V  E + EV+ +SLE 
Sbjct  55   CPETCGNVSIVYPFGIGKGCYLDKRFEITCNNSSLPHPLF---HVDEENEAEVLYMSLEY  111

Query  413  QTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGC--------GNSLF  258
              I    S   + + ++   +          PF YS + NKF+  GC         N+  
Sbjct  112  MRIRDWASPDCYANYTSEGQSYAQFPVAPMEPFSYSHTENKFIGIGCDIFAYIGYSNTTN  171

Query  257  TQNSTVVAGCTAICGANISSGF---AGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSN  87
            + N + ++GC ++C     S       C GI CC+   P DL+ +     N    +DG +
Sbjct  172  STNKSYISGCVSVCNGQGWSWLDTNYSCSGIGCCQNTFPEDLSIFEIRIGNMSTWADGGD  231

Query  86   DNLKRCNSAFLID  48
                +C+   + +
Sbjct  232  WPSNQCSLVLIAE  244



>gb|KDO44465.1| hypothetical protein CISIN_1g041043mg [Citrus sinensis]
Length=678

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 95/192 (49%), Gaps = 20/192 (10%)
 Frame = -2

Query  593  CEQRCGN-VSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLE  417
            C   CGN V+IPFPFGIGE C  +  + ++C +S    K  L S     +  EV+   LE
Sbjct  36   CPYSCGNNVTIPFPFGIGENCYFDKLYAIDCKSS----KPILRS-----INLEVLEFLLE  86

Query  416  NQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQNST--  243
              T+   +SV++ C D     +  N   L   PFY+S   N F   GC N+L + +S   
Sbjct  87   KSTMRVNQSVISSCQDKTTEASFVN---LEKLPFYFSYYDNIFSGIGC-NNLASMSSADH  142

Query  242  --VVAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANF--TNSGIQSDGSNDNLK  75
              ++ GC +IC     +    C GI+CC+  VP+ L S+  +    N+   S  S+    
Sbjct  143  DFILGGCFSICDPRNKTEDDSCNGIECCKAGVPWALKSFNISIISINNATSSSSSSQEEG  202

Query  74   RCNSAFLIDQRW  39
            +C  AF++++ W
Sbjct  203  KCKYAFMVEKEW  214



>gb|AAU90275.1| calcium binding EGF domain containing protein [Oryza sativa Japonica 
Group]
 gb|ABF97847.1| Calcium binding EGF domain containing protein, expressed [Oryza 
sativa Japonica Group]
Length=1096

 Score = 87.0 bits (214),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 57/185 (31%), Positives = 87/185 (47%), Gaps = 28/185 (15%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCA---LNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVS  423
            C  +CG+VSIP+PFG+G+ CA   LNP+F + CD++  PP   L       ++ EV+ ++
Sbjct  339  CPDKCGDVSIPYPFGVGDRCAAVGLNPYFNITCDDAVRPPVPKLGD---PGMEAEVLDIT  395

Query  422  LENQTI--TTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGC--------  273
            LE   I  T   S V +   ++   ++  G  + G+    S SRN+    GC        
Sbjct  396  LERGEIRLTGFLSYVCYTSSNSSYASLPGGIFVGGTQLRVSPSRNQLTVIGCRALGLLVG  455

Query  272  ----GNSLFTQNSTVVAGCTAICGANISSGFAG--CYGIDCCETPVPFDLT----SYTAN  123
                G S          GC   C +  S+   G  C G  CC+ P+  DL     ++ +N
Sbjct  456  GAHAGGS--GDGDEYATGCYTYCASLNSTDADGAPCAGTGCCQAPISSDLAYVGGTFPSN  513

Query  122  FTNSG  108
            +TNSG
Sbjct  514  WTNSG  518



>ref|XP_010673957.1| PREDICTED: wall-associated receptor kinase-like 8 isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=783

 Score = 86.7 bits (213),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 78/157 (50%), Gaps = 12/157 (8%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAY-LNSFVQIELQGEVVAVSLE  417
            C+++CGN++IP+PFGIG GC     F + C+ S  PPKA+ L  F   E+  E++ ++ E
Sbjct  40   CQRKCGNLTIPYPFGIGNGCYFRDVFAIRCNTSYNPPKAFALTGFDPDEIYPEILEMT-E  98

Query  416  NQTITTLKSVVNFCDDSAGRNA--ITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQNST  243
            NQ I    +V + C DS G     I     + GSP+  S + NK    GC        ST
Sbjct  99   NQVIIRNTAVTSRCYDSRGIETSYIEGSLGMQGSPYSVSNT-NKLTVIGCDEYALISGST  157

Query  242  VV-----AGCTAICGANISSGF--AGCYGIDCCETPV  153
             +     AGC A+C   +        C G  CC+T V
Sbjct  158  EITNDEKAGCIALCNLEVDQVVTQGSCLGSGCCQTSV  194



>gb|EMT30820.1| hypothetical protein F775_02521 [Aegilops tauschii]
Length=191

 Score = 82.4 bits (202),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 79/156 (51%), Gaps = 14/156 (9%)
 Frame = -2

Query  584  RCGNVSIPFPFGIGEGCA---LNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            RC +VSIP PFGIG GCA   L+ +F++ C+N+  PP+  ++  V      EV+ +SLE 
Sbjct  28   RCADVSIPCPFGIGTGCAAASLSSYFIITCNNTFQPPRPMISGGV--PKTKEVIDISLER  85

Query  413  QTITTLKSVVNFC--DDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGC------GNSLF  258
              +     V   C   +S      T+   L G+PF  S +RN+F+  GC      G S+ 
Sbjct  86   GEMCMYGPVSYSCFTPNSTMSGNTTSEFSLEGTPFILSTTRNRFVAIGCNTVRLIGGSMH  145

Query  257  TQNSTVVAGCTAIC-GANISSGFAGCYGIDCCETPV  153
                  V GC + C G N +S  A C G+ CCE  +
Sbjct  146  GDTDPYVTGCYSYCHGLNSTSDGAPCIGMGCCEITI  181



>ref|XP_008225633.1| PREDICTED: putative wall-associated receptor kinase-like 16 [Prunus 
mume]
Length=762

 Score = 86.3 bits (212),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 55/165 (33%), Positives = 78/165 (47%), Gaps = 12/165 (7%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C+  CGN+SIP+PFGIG GC L P F + C+ SS  PK  L +   I     +   S+E 
Sbjct  34   CQDHCGNLSIPYPFGIGPGCYLQPQFNITCNQSSQHPKVQLLTSNII-----ITNFSIEE  88

Query  413  QTITTLKSVVNFCDDSAGRNAITNGTDL-SGSPFYYSKSRNKFLFAGCGN----SLFTQN  249
              +  L+ V   C D+ G     N   L    P+  S ++NKF   GC      S + ++
Sbjct  89   GELQILQYVAEDCYDAQGNPTGRNVPRLWVPPPYTISHTKNKFYALGCDTYSFFSGYRED  148

Query  248  STVVAGCTAICGA--NISSGFAGCYGIDCCETPVPFDLTSYTANF  120
                 GC +IC +  N   G   C G+ CC+T +P  L + T   
Sbjct  149  QKFTTGCMSICDSLDNAVDGQNTCSGVGCCQTSIPSGLKNQTVTL  193



>gb|KGN47514.1| hypothetical protein Csa_6G352870 [Cucumis sativus]
Length=302

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 57/197 (29%), Positives = 91/197 (46%), Gaps = 23/197 (12%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLN----SFVQIELQGEVVAV  426
            C++ CG++ IP+PFG+ +GC  N  FL+ CD +  PPKA+L     S   I L GE    
Sbjct  31   CDEWCGDLRIPYPFGVKQGCYFNQAFLITCDKAFNPPKAFLKDTNISVTNISLNGE----  86

Query  425  SLENQTITTLKSVVNFCDDSAG---RNAITNGTDLSGSP-FYYSKSRNKFLFAGCGN-SL  261
                  +  L+ +V FC++      R+ I N T+L  +  F  +  +NKF+  GC     
Sbjct  87   ------LHILQPIVRFCNEDVSLVNRSFIPNTTNLPATATFPIADGKNKFIAIGCNTFGF  140

Query  260  FTQN----STVVAGCTAICGANISSGFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDG  93
            FT         + GC A+C  N  +    C G  CC+  +P   +        + + +D 
Sbjct  141  FTGKLKGGDQFLTGCIAVCPNNNKNNTWSCSGNGCCKLDIPDGSSDLNLTVAPALLDTDR  200

Query  92   SNDNLKRCNSAFLIDQR  42
            +    K C  AF++ + 
Sbjct  201  NLVQNKPCGYAFVVGEE  217



>gb|KCW81882.1| hypothetical protein EUGRSUZ_C03245 [Eucalyptus grandis]
Length=550

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 61/169 (36%), Positives = 90/169 (53%), Gaps = 22/169 (13%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C + CG+V+IPFPFGI  GC L+ W+ + C+ +   P        +I LQ  V+ +SL +
Sbjct  289  CAETCGSVTIPFPFGIRAGCFLDDWYQIVCEQNHTVP-----ILKKIRLQ--VLNISLPD  341

Query  413  QTITTLKSV------VNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQ  252
            + +  + +V       N C    GR A  +   L GS F +SK RN F   GC N+L T 
Sbjct  342  KDVDGMINVSLPVIYSNACRRGDGRGATVS---LKGSQFVFSKKRNIFTVVGC-NTLVTA  397

Query  251  NSTV--VAGCTAIC-GANIS-SGFAGCYGID-CCETPVPFDLTSYTANF  120
            NST   V GC + C G N + S ++ C G D CC++ +P +L  +  +F
Sbjct  398  NSTKSDVFGCQSKCAGTNFTISKYSACSGEDGCCQSSLPLNLQGFGVDF  446


 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/165 (32%), Positives = 80/165 (48%), Gaps = 15/165 (9%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLEN  414
            C + CGNV+IPFPFGIG GC    W+ + C  ++  P       +  ++   V+ +SL +
Sbjct  31   CPETCGNVTIPFPFGIGAGCFFEEWYQIVCKQNNMVP-------ILKKIGLRVLNISLPD  83

Query  413  QTITTL--KSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQNST-  243
              +  +   S+        G +    G  L GS F +S+ RN F   GC N+L   ++T 
Sbjct  84   VDVDGIINISLPIIYSKGCGGDGHAAGVSLKGSQFVFSQKRNVFTLVGC-NTLAIVDTTK  142

Query  242  -VVAGCTAICGA-NISSGFAG--CYGIDCCETPVPFDLTSYTANF  120
               AGC + C A N S  + G      DCC+T +P +L  +  +F
Sbjct  143  SAFAGCRSRCAAPNTSISWNGNCSRRDDCCQTRLPLNLQGFRVDF  187



>ref|XP_006487880.1| PREDICTED: wall-associated receptor kinase 2-like [Citrus sinensis]
Length=502

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 62/194 (32%), Positives = 94/194 (48%), Gaps = 20/194 (10%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEG-CALNPWFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVSLE  417
            C+++CG+V++P+PFGI    CA+N  F +NC    +PPK  +     ++L  EV  +S+E
Sbjct  36   CQEKCGHVTVPYPFGIDNSMCAMNKNFFLNCSRRDSPPKLMI-----VDL--EVFNLSIE  88

Query  416  NQTITTLKSVVNFCDDSAGRNAITNGTD----LSGSPFYYSKSRNKFLFAGCGNSLFT--  255
            N +IT      + C D  G N  ++  D    L   P  +S +RNK    GC  S +   
Sbjct  89   NGSITASFFTAHRCYDGLG-NRTSDYNDPYVRLGNRPLRFSDTRNKLTAIGCDTSAYMGD  147

Query  254  QNSTVVAGCTAICGANISSGF--AGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSNDN  81
             N +   GC +IC  N S+    + C GI CC+ P+P  L S   N T   +        
Sbjct  148  PNGSFWTGCISIC-TNESAKLNESSCSGIGCCQIPLPKSLKSL--NLTLRSLYDHEDMGK  204

Query  80   LKRCNSAFLIDQRW  39
               C+ A L D+ +
Sbjct  205  FMPCDYAILADETF  218



>ref|XP_004954293.1| PREDICTED: wall-associated receptor kinase 2-like [Setaria italica]
Length=765

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/206 (26%), Positives = 96/206 (47%), Gaps = 14/206 (7%)
 Frame = -2

Query  593  CEQRCGNVSIPFPFGIGEGCALNP---WFLVNCDNSSAPPKAYLNSFVQIELQGEVVAVS  423
            C  RCGN++IP+PFGIG GC  +     F + CD++ +PP+  ++ +   +L    +A  
Sbjct  43   CRDRCGNITIPYPFGIGAGCYRDDGVGGFQLLCDDTHSPPRLTISDYSSTQLADLSLAAG  102

Query  422  LENQTITTLKSVVNFCDDSAGRNAITNGTDLSGSPFYYSKSRNKFLFAGCGNSLFTQNST  243
                 +   +   N       RN   +   L  SP+ +S  +N+ +  GC +  +  ++ 
Sbjct  103  EARAYLNATRKCYNDTGGFVDRNTNPSYMSLGTSPYLFSPVKNRLVATGCPSLGYFVDAA  162

Query  242  --VVAGCTAICGANISS--GFAGCYGIDCCETPVPFDLTSYTANFTNSGIQSDGSND---  84
               ++GCT++C  +  +  G   C G+ CC++ +P  +  Y  N  N  +Q  G  D   
Sbjct  163  EYFISGCTSVCRPSQYTIPGQGSCTGVGCCQSDIPPGVNYYQPNTLN--LQLPGQLDPTF  220

Query  83   --NLKRCNSAFLIDQRWIPKQSTSLF  12
              N+  C+  FL++  W      + F
Sbjct  221  SRNVTTCHYVFLVETAWFSYSDAAFF  246



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1079781307330