BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7664_g1_i2 len=1029 path=[1:0-417 419:418-568 570:569-824
826:825-926 826:927-1028]

Length=1029
                                                                      Score     E

ref|XP_009614358.1|  PREDICTED: uncharacterized protein LOC104107297    208   1e-60   
ref|XP_009627277.1|  PREDICTED: uncharacterized protein LOC104117...    203   8e-56   
ref|XP_009627274.1|  PREDICTED: uncharacterized protein LOC104117...    203   1e-55   
ref|XP_009627275.1|  PREDICTED: uncharacterized protein LOC104117...    203   1e-55   
ref|XP_009613415.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    196   2e-54   
ref|XP_009778602.1|  PREDICTED: uncharacterized protein LOC104227921    197   2e-53   
ref|XP_006365051.1|  PREDICTED: ankyrin repeat-containing protein...    196   4e-53   
ref|XP_004233910.2|  PREDICTED: uncharacterized protein LOC101247887    194   1e-52   
ref|XP_006365062.1|  PREDICTED: ankyrin repeat-containing protein...    181   4e-48   
ref|XP_004161981.1|  PREDICTED: ankyrin repeat-containing protein...    173   3e-45   
ref|XP_010656436.1|  PREDICTED: ankyrin repeat-containing protein...    172   1e-44   
ref|XP_002862767.1|  hypothetical protein ARALYDRAFT_333222             163   4e-43   
ref|XP_009349120.1|  PREDICTED: ankyrin repeat-containing protein...    167   8e-43   
ref|XP_010244728.1|  PREDICTED: uncharacterized protein LOC104588485    166   1e-42   
ref|XP_008440794.1|  PREDICTED: ankyrin repeat-containing protein...    166   1e-42   
ref|XP_006448678.1|  hypothetical protein CICLE_v10014877mg             165   1e-42   
ref|XP_008440732.1|  PREDICTED: ankyrin repeat-containing protein...    166   2e-42   
gb|KDO41013.1|  hypothetical protein CISIN_1g021201mg                   159   2e-42   
ref|XP_008384216.1|  PREDICTED: ankyrin repeat-containing protein...    157   3e-42   
gb|EYU28334.1|  hypothetical protein MIMGU_mgv1a023484mg                160   3e-42   
gb|EYU25856.1|  hypothetical protein MIMGU_mgv1a004842mg                164   3e-42   
gb|KDO41012.1|  hypothetical protein CISIN_1g021201mg                   160   4e-42   
ref|XP_010244047.1|  PREDICTED: uncharacterized protein LOC104587959    164   6e-42   
ref|XP_009377835.1|  PREDICTED: ankyrin repeat-containing protein...    164   6e-42   
ref|XP_009344351.1|  PREDICTED: ankyrin repeat-containing protein...    163   7e-42   
ref|XP_006284892.1|  hypothetical protein CARUB_v10006184mg             163   8e-42   
ref|XP_004296497.1|  PREDICTED: ankyrin repeat-containing protein...    164   1e-41   
ref|XP_009344349.1|  PREDICTED: ankyrin repeat-containing protein...    163   1e-41   
ref|XP_008440786.1|  PREDICTED: ankyrin repeat-containing protein...    163   1e-41   
ref|XP_008356256.1|  PREDICTED: ankyrin repeat-containing protein...    163   1e-41   
ref|XP_006464318.1|  PREDICTED: ankyrin repeat-containing protein...    163   2e-41   
ref|XP_006428079.1|  hypothetical protein CICLE_v10027269mg             162   2e-41   
gb|KDO40245.1|  hypothetical protein CISIN_1g037778mg                   162   2e-41   
gb|KDO77352.1|  hypothetical protein CISIN_1g003814mg                   162   2e-41   
ref|XP_004171684.1|  PREDICTED: uncharacterized protein LOC101226258    157   3e-41   
ref|XP_006490206.1|  PREDICTED: ankyrin repeat-containing protein...    162   3e-41   
ref|XP_006490203.1|  PREDICTED: ankyrin repeat-containing protein...    162   3e-41   
ref|XP_006490205.1|  PREDICTED: ankyrin repeat-containing protein...    162   3e-41   
gb|KDO77348.1|  hypothetical protein CISIN_1g003814mg                   163   3e-41   
ref|XP_006490204.1|  PREDICTED: ankyrin repeat-containing protein...    162   3e-41   
gb|AFK34707.1|  unknown                                                 156   3e-41   
ref|XP_006468495.1|  PREDICTED: ankyrin repeat-containing protein...    162   3e-41   
ref|XP_010655716.1|  PREDICTED: ankyrin-2-like isoform X4               162   3e-41   
ref|XP_002523649.1|  hypothetical protein RCOM_0892190                  155   3e-41   Ricinus communis
ref|XP_008440886.1|  PREDICTED: ankyrin repeat-containing protein...    162   4e-41   
ref|XP_009790151.1|  PREDICTED: uncharacterized protein LOC104237...    162   4e-41   
ref|XP_006365060.1|  PREDICTED: ankyrin repeat-containing protein...    162   4e-41   
gb|KCW75495.1|  hypothetical protein EUGRSUZ_E04253                     157   5e-41   
gb|KDO77347.1|  hypothetical protein CISIN_1g003814mg                   163   5e-41   
gb|KDP30536.1|  hypothetical protein JCGZ_15245                         162   5e-41   
emb|CBI30987.3|  unnamed protein product                                162   6e-41   
ref|XP_010655715.1|  PREDICTED: ankyrin repeat-containing protein...    162   6e-41   
ref|XP_006468494.1|  PREDICTED: ankyrin repeat-containing protein...    162   6e-41   
ref|XP_004170708.1|  PREDICTED: ankyrin repeat-containing protein...    155   7e-41   
ref|XP_010648914.1|  PREDICTED: uncharacterized protein LOC100260982    162   1e-40   
ref|XP_006448683.1|  hypothetical protein CICLE_v10014428mg             161   1e-40   
ref|XP_010655713.1|  PREDICTED: uncharacterized protein LOC100256...    162   1e-40   
ref|XP_004145182.1|  PREDICTED: ankyrin repeat-containing protein...    156   1e-40   
ref|XP_004153952.1|  PREDICTED: uncharacterized protein LOC101208435    158   1e-40   
ref|XP_010655714.1|  PREDICTED: ankyrin repeat-containing protein...    161   1e-40   
ref|XP_004153946.1|  PREDICTED: ankyrin repeat-containing protein...    160   1e-40   
ref|XP_004153885.1|  PREDICTED: ankyrin repeat-containing protein...    160   1e-40   
ref|XP_004164876.1|  PREDICTED: ankyrin repeat-containing protein...    160   1e-40   
ref|XP_008348005.1|  PREDICTED: ankyrin repeat-containing protein...    160   1e-40   
gb|KGN64472.1|  hypothetical protein Csa_1G058070                       160   2e-40   
ref|XP_008360874.1|  PREDICTED: ankyrin repeat-containing protein...    159   2e-40   
ref|XP_010317038.1|  PREDICTED: ankyrin repeat-containing protein...    160   2e-40   
ref|XP_010260577.1|  PREDICTED: ankyrin repeat-containing protein...    157   2e-40   
ref|XP_004145192.1|  PREDICTED: uncharacterized protein LOC101213772    160   2e-40   
ref|XP_010251695.1|  PREDICTED: ankyrin repeat-containing protein...    159   2e-40   
ref|XP_008219093.1|  PREDICTED: ankyrin repeat-containing protein...    159   3e-40   
ref|XP_008440605.1|  PREDICTED: LOW QUALITY PROTEIN: ankyrin repe...    160   3e-40   
ref|XP_004145199.1|  PREDICTED: uncharacterized protein LOC101215460    159   3e-40   
ref|XP_008440631.1|  PREDICTED: uncharacterized protein LOC103484...    159   4e-40   
ref|XP_009610229.1|  PREDICTED: ankyrin repeat-containing protein...    159   4e-40   
ref|XP_009610228.1|  PREDICTED: ankyrin repeat-containing protein...    159   4e-40   
ref|XP_007024884.1|  Ankyrin repeat-containing protein, putative ...    159   4e-40   
emb|CBI27188.3|  unnamed protein product                                162   4e-40   
ref|XP_004291593.1|  PREDICTED: ankyrin repeat-containing protein...    159   5e-40   
ref|XP_007024885.1|  Ankyrin repeat-containing protein, putative ...    159   5e-40   
ref|XP_010260576.1|  PREDICTED: ankyrin repeat-containing protein...    157   5e-40   
ref|XP_010090151.1|  Ankyrin repeat-containing protein                  160   6e-40   
emb|CAN68568.1|  hypothetical protein VITISV_029434                     162   7e-40   Vitis vinifera
ref|XP_008440640.1|  PREDICTED: uncharacterized protein LOC103484...    158   9e-40   
ref|XP_004145202.1|  PREDICTED: uncharacterized protein LOC101216177    161   9e-40   
ref|XP_004153711.1|  PREDICTED: ankyrin repeat-containing protein...    153   1e-39   
ref|XP_004145193.1|  PREDICTED: ankyrin repeat-containing protein...    158   1e-39   
ref|XP_008440580.1|  PREDICTED: ankyrin repeat-containing protein...    158   2e-39   
ref|XP_004145197.1|  PREDICTED: ankyrin repeat-containing protein...    157   2e-39   
ref|XP_010260578.1|  PREDICTED: ankyrin repeat-containing protein...    157   2e-39   
ref|XP_008440674.1|  PREDICTED: ankyrin repeat-containing protein...    157   2e-39   
ref|XP_008440666.1|  PREDICTED: ankyrin repeat-containing protein...    157   2e-39   
ref|XP_008440571.1|  PREDICTED: ankyrin repeat-containing protein...    158   2e-39   
ref|XP_009113887.1|  PREDICTED: ankyrin repeat-containing protein...    154   3e-39   
ref|XP_004153560.1|  PREDICTED: ankyrin repeat-containing protein...    157   3e-39   
ref|XP_010090147.1|  Ankyrin repeat-containing protein                  156   3e-39   
ref|XP_004172299.1|  PREDICTED: LOW QUALITY PROTEIN: ankyrin repe...    156   4e-39   
ref|XP_004145185.1|  PREDICTED: ankyrin repeat-containing protein...    153   4e-39   
gb|KHN47695.1|  Ankyrin repeat and death domain-containing protei...    155   5e-39   
ref|XP_004163109.1|  PREDICTED: ankyrin repeat-containing protein...    156   5e-39   
ref|XP_010059716.1|  PREDICTED: uncharacterized protein LOC104447703    157   8e-39   
ref|XP_010256492.1|  PREDICTED: ankyrin repeat-containing protein...    150   8e-39   
ref|XP_008440848.1|  PREDICTED: ankyrin repeat-containing protein...    155   9e-39   
ref|XP_003534875.1|  PREDICTED: uncharacterized protein LOC100808...    155   9e-39   
ref|XP_007224368.1|  hypothetical protein PRUPE_ppa020961mg             155   1e-38   
ref|XP_004164877.1|  PREDICTED: uncharacterized LOC101218503            155   1e-38   
ref|XP_006381090.1|  hypothetical protein POPTR_0006s06170g             151   1e-38   
ref|XP_008229278.1|  PREDICTED: ankyrin repeat-containing protein...    153   1e-38   
ref|XP_006586973.1|  PREDICTED: uncharacterized protein LOC100808...    154   1e-38   
ref|XP_002322392.1|  ankyrin repeat family protein                      155   2e-38   Populus trichocarpa [western balsam poplar]
ref|XP_004289303.1|  PREDICTED: ankyrin repeat-containing protein...    155   2e-38   
ref|XP_004143703.1|  PREDICTED: uncharacterized protein LOC101207503    157   2e-38   
emb|CDY13083.1|  BnaA09g17340D                                          154   2e-38   
ref|XP_011000169.1|  PREDICTED: ankyrin repeat-containing protein...    155   2e-38   
ref|XP_004287295.1|  PREDICTED: uncharacterized protein LOC101314594    157   2e-38   
ref|XP_004291592.1|  PREDICTED: ankyrin repeat-containing protein...    154   2e-38   
ref|XP_008355241.1|  PREDICTED: ankyrin repeat-containing protein...    153   4e-38   
ref|XP_006448682.1|  hypothetical protein CICLE_v10018102mg             153   4e-38   
ref|XP_008355240.1|  PREDICTED: ankyrin repeat-containing protein...    153   5e-38   
ref|XP_007138825.1|  hypothetical protein PHAVU_009G240400g             153   7e-38   
ref|XP_007207550.1|  hypothetical protein PRUPE_ppa017666mg             152   8e-38   
emb|CDP11284.1|  unnamed protein product                                149   8e-38   
emb|CDY61717.1|  BnaC09g51990D                                          152   8e-38   
ref|XP_010248105.1|  PREDICTED: ankyrin repeat-containing protein...    146   9e-38   
ref|XP_010248129.1|  PREDICTED: ankyrin repeat-containing protein...    146   1e-37   
ref|XP_007022427.1|  Ankyrin repeat family protein, putative            152   1e-37   
gb|KEH37408.1|  ankyrin repeat plant-like protein                       152   1e-37   
ref|XP_010248103.1|  PREDICTED: ankyrin repeat-containing protein...    146   1e-37   
gb|KCW75498.1|  hypothetical protein EUGRSUZ_E04257                     149   1e-37   
ref|XP_004171826.1|  PREDICTED: ankyrin repeat-containing protein...    151   2e-37   
ref|XP_004145188.1|  PREDICTED: ankyrin repeat-containing protein...    151   2e-37   
ref|XP_007012652.1|  Ankyrin repeat-containing-like protein             151   2e-37   
gb|KDO52574.1|  hypothetical protein CISIN_1g0076771mg                  145   2e-37   
ref|XP_008391125.1|  PREDICTED: ankyrin repeat-containing protein...    151   2e-37   
gb|KDP37317.1|  hypothetical protein JCGZ_06771                         151   2e-37   
gb|KHN24819.1|  Ankyrin-1                                               151   2e-37   
ref|XP_008229257.1|  PREDICTED: ankyrin repeat-containing protein...    151   2e-37   
ref|XP_011020234.1|  PREDICTED: ankyrin repeat-containing protein...    150   2e-37   
ref|XP_008467210.1|  PREDICTED: ankyrin repeat-containing protein...    151   2e-37   
ref|XP_004145201.1|  PREDICTED: ankyrin repeat-containing protein...    145   2e-37   
gb|EYU28337.1|  hypothetical protein MIMGU_mgv11b016979mg               147   2e-37   
ref|XP_011020233.1|  PREDICTED: ankyrin repeat-containing protein...    150   3e-37   
ref|XP_010644722.1|  PREDICTED: uncharacterized protein LOC100258...    148   4e-37   
gb|KHN47696.1|  Serine/threonine-protein phosphatase 6 regulatory...    151   4e-37   
ref|XP_010276715.1|  PREDICTED: uncharacterized protein LOC104611...    150   4e-37   
ref|XP_003547425.2|  PREDICTED: ankyrin repeat-containing protein...    151   6e-37   
ref|XP_010644721.1|  PREDICTED: uncharacterized protein LOC100258...    147   6e-37   
ref|XP_010276714.1|  PREDICTED: uncharacterized protein LOC104611...    149   6e-37   
ref|XP_009344348.1|  PREDICTED: ankyrin repeat-containing protein...    149   6e-37   
ref|XP_008229300.1|  PREDICTED: uncharacterized protein LOC103328...    144   7e-37   
ref|XP_006597772.1|  PREDICTED: ankyrin repeat-containing protein...    151   7e-37   
ref|XP_010276713.1|  PREDICTED: uncharacterized protein LOC104611...    149   7e-37   
gb|KGN50436.1|  hypothetical protein Csa_5G174620                       149   7e-37   
ref|XP_006597771.1|  PREDICTED: ankyrin repeat-containing protein...    151   8e-37   
ref|XP_009344347.1|  PREDICTED: ankyrin repeat-containing protein...    149   9e-37   
ref|XP_008229250.1|  PREDICTED: ankyrin repeat-containing protein...    149   1e-36   
ref|XP_010665704.1|  PREDICTED: ankyrin repeat-containing protein...    150   1e-36   
ref|XP_009344346.1|  PREDICTED: ankyrin repeat-containing protein...    149   1e-36   
ref|XP_010256489.1|  PREDICTED: uncharacterized protein LOC104596860    150   1e-36   
ref|XP_004487934.1|  PREDICTED: uncharacterized protein LOC101490749    141   1e-36   
ref|XP_008229295.1|  PREDICTED: ankyrin repeat-containing protein...    145   1e-36   
ref|XP_008440652.1|  PREDICTED: ankyrin repeat-containing protein...    149   2e-36   
ref|XP_009346492.1|  PREDICTED: ankyrin repeat-containing protein...    148   2e-36   
emb|CAN70012.1|  hypothetical protein VITISV_017115                     148   2e-36   Vitis vinifera
emb|CDP11257.1|  unnamed protein product                                149   2e-36   
ref|XP_010058027.1|  PREDICTED: ankyrin repeat-containing protein...    149   3e-36   
ref|XP_010665509.1|  PREDICTED: ankyrin repeat-containing protein...    147   4e-36   
emb|CAN81449.1|  hypothetical protein VITISV_011174                     149   6e-36   Vitis vinifera
ref|XP_011078078.1|  PREDICTED: uncharacterized protein LOC105161921    148   7e-36   
ref|XP_008364280.1|  PREDICTED: ankyrin repeat-containing protein...    141   7e-36   
ref|XP_008229901.1|  PREDICTED: ankyrin repeat-containing protein...    146   8e-36   
ref|XP_004153918.1|  PREDICTED: uncharacterized protein LOC101219138    146   1e-35   
ref|XP_006427804.1|  hypothetical protein CICLE_v10025204mg             145   1e-35   
ref|XP_007030435.1|  Ankyrin repeat family protein, putative            145   1e-35   
gb|KDO77346.1|  hypothetical protein CISIN_1g044420mg                   145   2e-35   
ref|XP_009790150.1|  PREDICTED: ankyrin repeat-containing protein...    147   2e-35   
ref|XP_007207536.1|  hypothetical protein PRUPE_ppa015617mg             144   2e-35   
ref|XP_010665694.1|  PREDICTED: ankyrin repeat-containing protein...    146   2e-35   
ref|XP_007216370.1|  hypothetical protein PRUPE_ppa019187mg             146   2e-35   
ref|XP_010644720.1|  PREDICTED: uncharacterized protein LOC100248044    145   2e-35   
ref|XP_010244048.1|  PREDICTED: uncharacterized protein LOC104587960    147   2e-35   
ref|XP_004301924.1|  PREDICTED: uncharacterized protein LOC101300157    140   2e-35   
ref|XP_006464617.1|  PREDICTED: uncharacterized protein LOC102609031    145   2e-35   
ref|XP_009361709.1|  PREDICTED: ankyrin repeat-containing protein...    140   2e-35   
ref|XP_007041075.1|  Ankyrin repeat family protein, putative            145   3e-35   
ref|XP_007213190.1|  hypothetical protein PRUPE_ppa026120mg             145   4e-35   
ref|XP_009366066.1|  PREDICTED: ankyrin repeat-containing protein...    139   6e-35   
ref|XP_007154755.1|  hypothetical protein PHAVU_003G144900g             144   6e-35   
ref|XP_008363461.1|  PREDICTED: ankyrin repeat-containing protein...    141   8e-35   
ref|XP_010694923.1|  PREDICTED: ankyrin repeat-containing protein...    143   8e-35   
ref|XP_010644712.1|  PREDICTED: uncharacterized protein LOC100265216    144   9e-35   
ref|XP_010694915.1|  PREDICTED: ankyrin repeat-containing protein...    143   9e-35   
ref|XP_010694908.1|  PREDICTED: uncharacterized protein LOC104907...    143   1e-34   
ref|XP_010694898.1|  PREDICTED: uncharacterized protein LOC104907...    143   1e-34   
ref|XP_011096818.1|  PREDICTED: ankyrin repeat-containing protein...    143   2e-34   
ref|XP_004153308.1|  PREDICTED: uncharacterized protein LOC101218503    142   2e-34   
ref|XP_006432670.1|  hypothetical protein CICLE_v10003360mg             141   3e-34   
ref|XP_007145674.1|  hypothetical protein PHAVU_007G2588001g            142   3e-34   
ref|XP_008391127.1|  PREDICTED: ankyrin repeat-containing protein...    142   3e-34   
ref|XP_008388249.1|  PREDICTED: ankyrin repeat-containing protein...    137   3e-34   
gb|KDO39998.1|  hypothetical protein CISIN_1g037666mg                   139   3e-34   
ref|XP_008391126.1|  PREDICTED: ankyrin repeat-containing protein...    141   3e-34   
gb|KEH33946.1|  ankyrin repeat protein                                  139   4e-34   
ref|XP_009346494.1|  PREDICTED: ankyrin repeat-containing protein...    141   4e-34   
ref|XP_010644786.1|  PREDICTED: uncharacterized protein LOC100250...    138   5e-34   
ref|XP_007204827.1|  hypothetical protein PRUPE_ppa004153mg             140   5e-34   
ref|XP_009346493.1|  PREDICTED: ankyrin repeat-containing protein...    141   5e-34   
ref|XP_010694148.1|  PREDICTED: ankyrin repeat-containing protein...    141   5e-34   
gb|KDO57160.1|  hypothetical protein CISIN_1g040056mg                   140   5e-34   
ref|XP_006586964.1|  PREDICTED: uncharacterized protein LOC100808...    142   6e-34   
gb|EYU43670.1|  hypothetical protein MIMGU_mgv1a022389mg                140   7e-34   
emb|CAN68331.1|  hypothetical protein VITISV_030161                     140   8e-34   Vitis vinifera
ref|XP_010644785.1|  PREDICTED: uncharacterized protein LOC100250...    138   8e-34   
gb|KEH33948.1|  ankyrin repeat protein                                  139   8e-34   
ref|XP_011022999.1|  PREDICTED: ankyrin repeat-containing protein...    141   8e-34   
ref|XP_004288982.1|  PREDICTED: ankyrin repeat-containing protein...    137   9e-34   
ref|XP_010092701.1|  Splicing factor 3B subunit 4                       142   9e-34   
emb|CDP03067.1|  unnamed protein product                                137   1e-33   
ref|XP_008230430.1|  PREDICTED: ankyrin repeat-containing protein...    140   1e-33   
ref|XP_011022998.1|  PREDICTED: ankyrin repeat-containing protein...    140   1e-33   
ref|XP_007221373.1|  hypothetical protein PRUPE_ppa017363mg             137   1e-33   
gb|KHN24825.1|  hypothetical protein glysoja_044103                     141   2e-33   
ref|XP_009628824.1|  PREDICTED: uncharacterized protein LOC104119112    139   2e-33   
gb|AES70441.2|  ankyrin repeat protein                                  139   2e-33   
ref|XP_009783301.1|  PREDICTED: uncharacterized protein LOC104231...    142   2e-33   
ref|XP_009783300.1|  PREDICTED: uncharacterized protein LOC104231...    142   2e-33   
ref|XP_008440858.1|  PREDICTED: ankyrin repeat-containing protein...    139   2e-33   
ref|XP_003547429.2|  PREDICTED: uncharacterized protein LOC100814943    138   2e-33   
ref|NP_190975.1|  ankyrin repeat-containing protein                     139   2e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008348268.1|  PREDICTED: uncharacterized protein LOC103411410    137   2e-33   
gb|KEH33947.1|  ankyrin repeat protein                                  139   2e-33   
ref|XP_003600190.1|  hypothetical protein MTR_3g055310                  139   2e-33   
ref|XP_008337866.1|  PREDICTED: ankyrin repeat-containing protein...    139   2e-33   
ref|XP_011096899.1|  PREDICTED: ankyrin repeat-containing protein...    140   2e-33   
ref|XP_002513462.1|  ankyrin repeat-containing protein, putative        139   3e-33   Ricinus communis
ref|XP_011093854.1|  PREDICTED: alpha-latrocrustotoxin-Lt1a-like ...    139   3e-33   
ref|XP_007203639.1|  hypothetical protein PRUPE_ppa004188mg             139   3e-33   
ref|XP_008379536.1|  PREDICTED: uncharacterized protein LOC103442515    140   3e-33   
ref|XP_002869960.1|  hypothetical protein ARALYDRAFT_354764             139   3e-33   
gb|KEH33949.1|  ankyrin repeat protein                                  138   3e-33   
ref|XP_011093852.1|  PREDICTED: uncharacterized protein LOC105173...    139   3e-33   
ref|XP_010665693.1|  PREDICTED: ankyrin repeat-containing protein...    140   4e-33   
ref|XP_007207788.1|  hypothetical protein PRUPE_ppa025725mg             135   4e-33   
ref|XP_008242231.1|  PREDICTED: ankyrin repeat-containing protein...    139   4e-33   
ref|XP_011093848.1|  PREDICTED: uncharacterized protein LOC105173...    139   4e-33   
ref|XP_011093853.1|  PREDICTED: alpha-latrocrustotoxin-Lt1a-like ...    139   4e-33   
ref|XP_008242230.1|  PREDICTED: ankyrin repeat-containing protein...    139   5e-33   
ref|XP_008244948.1|  PREDICTED: ankyrin repeat-containing protein...    135   5e-33   
emb|CDP00887.1|  unnamed protein product                                136   5e-33   
ref|XP_007154757.1|  hypothetical protein PHAVU_003G145000g             139   6e-33   
ref|XP_004153279.1|  PREDICTED: ankyrin repeat-containing protein...    135   6e-33   
ref|XP_010665689.1|  PREDICTED: ankyrin repeat-containing protein...    138   6e-33   
ref|XP_010277704.1|  PREDICTED: uncharacterized protein LOC104612086    139   6e-33   
gb|KDP43902.1|  hypothetical protein JCGZ_20912                         138   6e-33   
ref|XP_009359765.1|  PREDICTED: ankyrin repeat-containing protein...    138   7e-33   
ref|XP_009628820.1|  PREDICTED: ankyrin repeat-containing protein...    138   8e-33   
ref|XP_004154041.1|  PREDICTED: ankyrin repeat-containing protein...    137   9e-33   
ref|XP_010665688.1|  PREDICTED: ankyrin repeat-containing protein...    138   9e-33   
ref|XP_008230435.1|  PREDICTED: ankyrin repeat-containing protein...    137   1e-32   
ref|NP_198430.1|  Ankyrin repeat family protein                         135   1e-32   Arabidopsis thaliana [mouse-ear cress]
gb|KDP43899.1|  hypothetical protein JCGZ_20909                         137   1e-32   
ref|XP_004301352.1|  PREDICTED: uncharacterized protein LOC101304778    139   1e-32   
ref|XP_009628819.1|  PREDICTED: uncharacterized protein LOC104119...    138   1e-32   
gb|KDP43903.1|  hypothetical protein JCGZ_20913                         137   1e-32   
ref|XP_009628816.1|  PREDICTED: uncharacterized protein LOC104119...    138   1e-32   
ref|XP_008231968.1|  PREDICTED: uncharacterized protein LOC103331138    134   1e-32   
ref|XP_002311025.2|  hypothetical protein POPTR_0008s02380g             135   1e-32   Populus trichocarpa [western balsam poplar]
gb|KDP43897.1|  hypothetical protein JCGZ_20907                         134   1e-32   
ref|XP_009783944.1|  PREDICTED: uncharacterized protein LOC104232...    138   1e-32   
ref|XP_009619909.1|  PREDICTED: uncharacterized protein LOC104111...    138   1e-32   
ref|XP_009783941.1|  PREDICTED: uncharacterized protein LOC104232...    138   2e-32   
ref|XP_009783942.1|  PREDICTED: uncharacterized protein LOC104232...    138   2e-32   
ref|XP_009783297.1|  PREDICTED: ankyrin repeat-containing protein...    137   2e-32   
ref|XP_004301332.1|  PREDICTED: ankyrin repeat-containing protein...    130   2e-32   
ref|XP_009783943.1|  PREDICTED: uncharacterized protein LOC104232...    138   2e-32   
ref|XP_009619907.1|  PREDICTED: uncharacterized protein LOC104111...    138   2e-32   
ref|XP_009619906.1|  PREDICTED: uncharacterized protein LOC104111...    138   2e-32   
ref|XP_009619904.1|  PREDICTED: uncharacterized protein LOC104111...    138   2e-32   
ref|XP_009619908.1|  PREDICTED: uncharacterized protein LOC104111...    138   2e-32   
ref|XP_007221374.1|  hypothetical protein PRUPE_ppa017822mg             137   2e-32   
ref|XP_007146563.1|  hypothetical protein PHAVU_006G051200g             137   2e-32   
ref|XP_004293065.1|  PREDICTED: ankyrin repeat-containing protein...    137   3e-32   
gb|KDO57164.1|  hypothetical protein CISIN_1g045240mg                   134   3e-32   
ref|XP_010543609.1|  PREDICTED: ankyrin repeat-containing protein...    136   3e-32   
ref|XP_006427500.1|  hypothetical protein CICLE_v10026492mg             130   3e-32   
ref|XP_009783291.1|  PREDICTED: ankyrin repeat-containing protein...    137   3e-32   
gb|KHN14067.1|  Ankyrin repeat-containing protein                       135   4e-32   
ref|XP_002311027.2|  hypothetical protein POPTR_0008s02390g             134   4e-32   
ref|XP_009783296.1|  PREDICTED: ankyrin repeat-containing protein...    136   4e-32   
emb|CAN70302.1|  hypothetical protein VITISV_032663                     133   4e-32   
ref|XP_011032352.1|  PREDICTED: uncharacterized protein LOC105131...    136   4e-32   
ref|XP_008354421.1|  PREDICTED: ankyrin repeat-containing protein...    133   4e-32   
ref|XP_007216914.1|  hypothetical protein PRUPE_ppa019047mg             136   4e-32   
ref|XP_010242785.1|  PREDICTED: uncharacterized protein LOC104587044    137   5e-32   
ref|XP_008230428.1|  PREDICTED: uncharacterized protein LOC103329709    137   5e-32   
ref|XP_004173283.1|  PREDICTED: ankyrin repeat-containing protein...    134   5e-32   
gb|KDO65032.1|  hypothetical protein CISIN_1g0061731mg                  134   6e-32   
ref|XP_008368491.1|  PREDICTED: uncharacterized protein LOC103432100    137   6e-32   
ref|XP_011096897.1|  PREDICTED: ankyrin repeat-containing protein...    135   6e-32   
ref|XP_006586979.1|  PREDICTED: receptor-interacting serine/threo...    136   7e-32   
ref|XP_006431557.1|  hypothetical protein CICLE_v10003926mg             132   7e-32   
emb|CDP21227.1|  unnamed protein product                                136   7e-32   
emb|CDP00886.1|  unnamed protein product                                136   7e-32   
gb|KEH37406.1|  ankyrin repeat plant-like protein                       136   7e-32   
ref|XP_002509751.1|  protein binding protein, putative                  132   7e-32   
gb|KHN44023.1|  Ankyrin repeat-containing protein                       136   8e-32   
ref|XP_011032351.1|  PREDICTED: uncharacterized protein LOC105131...    135   8e-32   
gb|KHN24822.1|  hypothetical protein glysoja_044100                     134   9e-32   
ref|XP_009357118.1|  PREDICTED: uncharacterized protein LOC103947878    136   1e-31   
ref|XP_007154758.1|  hypothetical protein PHAVU_003G145100g             135   1e-31   
gb|AFK48305.1|  unknown                                                 129   1e-31   
ref|XP_006431545.1|  hypothetical protein CICLE_v10003295mg             134   1e-31   
ref|XP_006379474.1|  hypothetical protein POPTR_0008s02390g             133   1e-31   
ref|XP_006426655.1|  hypothetical protein CICLE_v10025100mg             135   1e-31   
emb|CAN62183.1|  hypothetical protein VITISV_044401                     135   2e-31   
ref|XP_006602166.1|  PREDICTED: uncharacterized protein LOC102660751    134   2e-31   
gb|KHN28408.1|  Ankyrin repeat-containing protein                       134   2e-31   
gb|KEH37407.1|  ankyrin repeat plant-like protein                       135   2e-31   
emb|CBI37569.3|  unnamed protein product                                135   2e-31   
ref|XP_008357275.1|  PREDICTED: ankyrin repeat-containing protein...    131   2e-31   
ref|XP_007048310.1|  Ankyrin repeat family protein, putative            135   2e-31   
ref|XP_007221371.1|  hypothetical protein PRUPE_ppa015563mg             131   2e-31   
ref|XP_010244231.1|  PREDICTED: uncharacterized protein LOC104588110    135   2e-31   
ref|XP_006382837.1|  hypothetical protein POPTR_0005s05920g             133   2e-31   
emb|CDP04741.1|  unnamed protein product                                132   2e-31   
ref|XP_007207966.1|  hypothetical protein PRUPE_ppa016505mg             133   2e-31   
ref|XP_008230427.1|  PREDICTED: uncharacterized protein LOC103329708    135   3e-31   
ref|XP_009349331.1|  PREDICTED: ankyrin repeat-containing protein...    132   3e-31   
ref|XP_010649391.1|  PREDICTED: uncharacterized protein LOC100250...    135   3e-31   
emb|CDP00880.1|  unnamed protein product                                132   3e-31   
ref|XP_010649394.1|  PREDICTED: uncharacterized protein LOC100250...    134   3e-31   
ref|XP_006575984.1|  PREDICTED: uncharacterized protein LOC102663323    129   3e-31   
ref|XP_010256236.1|  PREDICTED: uncharacterized protein LOC104596682    132   3e-31   
ref|XP_004288337.1|  PREDICTED: uncharacterized protein LOC101314411    135   3e-31   
ref|XP_006432672.1|  hypothetical protein CICLE_v10000862mg             132   3e-31   
ref|XP_007221403.1|  hypothetical protein PRUPE_ppa022028mg             130   4e-31   
emb|CDP00875.1|  unnamed protein product                                134   4e-31   
gb|KDO48313.1|  hypothetical protein CISIN_1g0069422mg                  130   4e-31   
ref|XP_006465922.1|  PREDICTED: uncharacterized protein LOC102626928    133   6e-31   
ref|XP_008235975.1|  PREDICTED: uncharacterized protein LOC103334783    133   7e-31   
ref|XP_008341407.1|  PREDICTED: uncharacterized protein LOC103404...    132   8e-31   
gb|KDO48316.1|  hypothetical protein CISIN_1g004089mg                   134   8e-31   
ref|XP_008362322.1|  PREDICTED: ankyrin repeat-containing protein...    130   8e-31   
gb|KDO58358.1|  hypothetical protein CISIN_1g0113382mg                  126   8e-31   
ref|XP_006487636.1|  PREDICTED: uncharacterized protein LOC102628...    134   8e-31   
gb|KHN24821.1|  Ankyrin repeat-containing protein                       133   8e-31   
gb|KDO48317.1|  hypothetical protein CISIN_1g004089mg                   133   8e-31   
ref|XP_006487635.1|  PREDICTED: uncharacterized protein LOC102628...    133   9e-31   
ref|XP_008341406.1|  PREDICTED: uncharacterized protein LOC103404...    132   9e-31   
ref|XP_006432216.1|  hypothetical protein CICLE_v10003987mg             131   1e-30   
ref|XP_004308737.1|  PREDICTED: uncharacterized protein LOC101304047    133   1e-30   
ref|XP_007207987.1|  hypothetical protein PRUPE_ppa015117mg             131   1e-30   
ref|XP_010665512.1|  PREDICTED: ankyrin repeat-containing protein...    132   1e-30   
ref|XP_008231973.1|  PREDICTED: ankyrin repeat-containing protein...    129   1e-30   
ref|XP_006431560.1|  hypothetical protein CICLE_v10003198mg             132   1e-30   
ref|XP_007216069.1|  hypothetical protein PRUPE_ppa017939mg             129   1e-30   
ref|XP_006383846.1|  hypothetical protein POPTR_0004s00510g             129   2e-30   
ref|XP_008245505.1|  PREDICTED: ankyrin repeat-containing protein...    127   2e-30   
ref|XP_006494240.1|  PREDICTED: ankyrin repeat-containing protein...    129   2e-30   
ref|XP_007011009.1|  Ankyrin repeat family protein                      130   2e-30   
ref|XP_011047004.1|  PREDICTED: uncharacterized protein LOC105141473    132   2e-30   
ref|XP_008359726.1|  PREDICTED: uncharacterized protein LOC103423425    127   2e-30   
ref|XP_007048311.1|  Ankyrin repeat family protein                      131   2e-30   
ref|XP_007221398.1|  hypothetical protein PRUPE_ppa020222mg             131   2e-30   
ref|XP_010658761.1|  PREDICTED: ankyrin repeat-containing protein...    132   2e-30   
ref|XP_007030438.1|  Ankyrin repeat family protein, putative            131   2e-30   
ref|XP_006431547.1|  hypothetical protein CICLE_v10003659mg             130   2e-30   
ref|XP_006431563.1|  hypothetical protein CICLE_v10003303mg             130   2e-30   
gb|KHN24823.1|  Ankyrin repeat and sterile alpha motif domain-con...    132   2e-30   
ref|XP_003544297.1|  PREDICTED: ankyrin repeat-containing protein...    130   2e-30   
ref|XP_009113888.1|  PREDICTED: ankyrin repeat-containing protein...    129   2e-30   
ref|XP_007221263.1|  hypothetical protein PRUPE_ppa008654mg             128   3e-30   
ref|XP_006465113.1|  PREDICTED: ankyrin repeat-containing protein...    131   3e-30   
ref|XP_008245179.1|  PREDICTED: uncharacterized protein LOC103343293    132   3e-30   
ref|XP_009377222.1|  PREDICTED: uncharacterized protein LOC103965855    130   3e-30   
ref|XP_003517655.1|  PREDICTED: uncharacterized protein LOC100808539    132   3e-30   
ref|XP_006587876.1|  PREDICTED: uncharacterized protein LOC102666856    132   4e-30   
ref|XP_008242227.1|  PREDICTED: ankyrin repeat-containing protein...    130   4e-30   
emb|CDP04745.1|  unnamed protein product                                131   4e-30   
ref|XP_007036277.1|  Ankyrin repeat family protein, putative isof...    131   4e-30   
ref|XP_008242226.1|  PREDICTED: ankyrin repeat-containing protein...    130   5e-30   
ref|XP_008368496.1|  PREDICTED: uncharacterized protein LOC103432108    127   5e-30   
ref|XP_010099146.1|  Ankyrin repeat-containing protein                  130   5e-30   
gb|KHN29416.1|  Ankyrin repeat-containing protein                       131   5e-30   
ref|XP_010049418.1|  PREDICTED: ankyrin repeat-containing protein...    129   5e-30   
ref|XP_007216945.1|  hypothetical protein PRUPE_ppa016309mg             129   5e-30   
ref|XP_007048305.1|  Ankyrin repeat family protein, putative            129   6e-30   
ref|XP_003612716.1|  hypothetical protein MTR_5g028100                  128   6e-30   
ref|XP_007036274.1|  Ankyrin repeat family protein, putative isof...    130   6e-30   
ref|XP_007217839.1|  hypothetical protein PRUPE_ppa025911mg             129   6e-30   
ref|XP_007099534.1|  Ankyrin repeat family protein, putative isof...    129   6e-30   
gb|KDP25714.1|  hypothetical protein JCGZ_23935                         124   6e-30   
ref|XP_006431561.1|  hypothetical protein CICLE_v10003229mg             129   7e-30   
gb|KCW82110.1|  hypothetical protein EUGRSUZ_C03485                     125   7e-30   
ref|XP_008230404.1|  PREDICTED: uncharacterized protein LOC103329682    130   7e-30   
ref|XP_004153099.1|  PREDICTED: uncharacterized protein LOC101211131    122   7e-30   
ref|XP_008391129.1|  PREDICTED: ankyrin repeat-containing protein...    129   8e-30   
gb|KHN40083.1|  Serine/threonine-protein phosphatase 6 regulatory...    130   8e-30   
ref|XP_006487634.1|  PREDICTED: uncharacterized protein LOC102628573    130   8e-30   
ref|XP_004506664.1|  PREDICTED: uncharacterized protein LOC101497...    129   8e-30   
ref|XP_004506665.1|  PREDICTED: uncharacterized protein LOC101497...    129   9e-30   
ref|XP_004153067.1|  PREDICTED: ankyrin repeat-containing protein...    130   9e-30   
ref|XP_008391128.1|  PREDICTED: ankyrin repeat-containing protein...    129   9e-30   
ref|XP_002311023.2|  hypothetical protein POPTR_0008s02350g             130   1e-29   
ref|XP_007099533.1|  Ankyrin repeat family protein, putative isof...    130   1e-29   
ref|XP_003612733.1|  Ankyrin repeat-containing protein                  126   1e-29   
ref|XP_010049415.1|  PREDICTED: ankyrin repeat-containing protein...    130   1e-29   
ref|XP_010049414.1|  PREDICTED: ankyrin repeat-containing protein...    130   1e-29   
ref|XP_007036273.1|  Ankyrin repeat family protein, putative isof...    130   1e-29   
ref|XP_006494238.1|  PREDICTED: uncharacterized protein LOC102615306    129   1e-29   
ref|XP_010051393.1|  PREDICTED: uncharacterized protein LOC104440109    128   1e-29   
ref|XP_010049416.1|  PREDICTED: ankyrin repeat-containing protein...    129   1e-29   
ref|XP_011014995.1|  PREDICTED: ankyrin repeat-containing protein...    128   1e-29   
ref|XP_009346496.1|  PREDICTED: ankyrin repeat-containing protein...    128   1e-29   
gb|KDP37872.1|  hypothetical protein JCGZ_06379                         124   2e-29   
ref|XP_011014996.1|  PREDICTED: ankyrin repeat-containing protein...    127   2e-29   
ref|XP_006431552.1|  hypothetical protein CICLE_v10003296mg             128   2e-29   
ref|XP_010051555.1|  PREDICTED: uncharacterized protein LOC104440309    125   2e-29   
ref|XP_009346495.1|  PREDICTED: ankyrin repeat-containing protein...    127   2e-29   
ref|XP_011032833.1|  PREDICTED: uncharacterized protein LOC105131524    130   2e-29   
ref|XP_006398925.1|  hypothetical protein EUTSA_v10012899mg             129   2e-29   
ref|XP_009357066.1|  PREDICTED: uncharacterized protein LOC103947...    129   2e-29   
ref|XP_003612724.1|  Ankyrin repeat-containing protein                  125   2e-29   
ref|XP_007221378.1|  hypothetical protein PRUPE_ppa024832mg             124   2e-29   
gb|KDO50307.1|  hypothetical protein CISIN_1g046389mg                   127   2e-29   
ref|XP_009360647.1|  PREDICTED: ankyrin repeat-containing protein...    123   2e-29   
ref|XP_010242786.1|  PREDICTED: uncharacterized protein LOC104587045    129   2e-29   
ref|XP_009357068.1|  PREDICTED: uncharacterized protein LOC103947...    129   2e-29   
ref|XP_004301925.1|  PREDICTED: uncharacterized protein LOC101300455    128   2e-29   
ref|XP_009347689.1|  PREDICTED: ankyrin repeat-containing protein...    125   3e-29   
ref|XP_010109847.1|  Ankyrin repeat-containing protein                  127   3e-29   
gb|EYU45770.1|  hypothetical protein MIMGU_mgv1a026656mg                125   3e-29   
ref|XP_003612765.1|  hypothetical protein MTR_5g028700                  129   3e-29   
ref|XP_007221399.1|  hypothetical protein PRUPE_ppa021053mg             125   3e-29   
ref|XP_007011012.1|  Ankyrin repeat family protein                      128   3e-29   
gb|KEH37402.1|  ankyrin repeat plant-like protein                       128   3e-29   
ref|XP_003617408.1|  Ankyrin repeat-containing protein                  127   3e-29   
ref|XP_010051420.1|  PREDICTED: ankyrin repeat-containing protein...    129   3e-29   
gb|KEH37401.1|  ankyrin repeat plant-like protein                       128   3e-29   
emb|CDP04744.1|  unnamed protein product                                129   4e-29   
ref|XP_008231516.1|  PREDICTED: ankyrin repeat-containing protein...    127   4e-29   
ref|XP_008341891.1|  PREDICTED: uncharacterized protein LOC103404...    127   4e-29   
ref|XP_006838957.1|  hypothetical protein AMTR_s00002p00270930          129   4e-29   
ref|XP_011023002.1|  PREDICTED: ankyrin repeat-containing protein...    127   4e-29   
ref|XP_006432671.1|  hypothetical protein CICLE_v10003287mg             127   5e-29   
gb|AES95682.2|  ankyrin repeat protein                                  126   5e-29   
ref|XP_007041074.1|  Ankyrin repeat family protein, putative            127   5e-29   
ref|XP_008341890.1|  PREDICTED: uncharacterized protein LOC103404...    127   5e-29   
ref|XP_010090150.1|  Transient receptor potential cation channel ...    127   6e-29   
gb|KCW82215.1|  hypothetical protein EUGRSUZ_C03627                     124   6e-29   
gb|KEH37391.1|  ankyrin repeat plant-like protein                       127   6e-29   
emb|CAN70871.1|  hypothetical protein VITISV_000567                     126   6e-29   
ref|XP_007158230.1|  hypothetical protein PHAVU_002G135000g             128   6e-29   
ref|XP_008368494.1|  PREDICTED: ankyrin repeat-containing protein...    122   8e-29   
ref|XP_006431550.1|  hypothetical protein CICLE_v10003521mg             125   8e-29   
emb|CAN72916.1|  hypothetical protein VITISV_014583                     127   9e-29   
ref|XP_009629768.1|  PREDICTED: uncharacterized protein LOC104119870    126   1e-28   
ref|XP_007200818.1|  hypothetical protein PRUPE_ppa025785mg             122   1e-28   
ref|XP_011008861.1|  PREDICTED: ankyrin repeat-containing protein...    122   1e-28   
ref|XP_006586975.1|  PREDICTED: uncharacterized protein LOC100810...    128   1e-28   
ref|XP_008341404.1|  PREDICTED: ankyrin repeat-containing protein...    123   1e-28   
gb|KEH37389.1|  ankyrin repeat plant-like protein                       125   1e-28   
ref|XP_009360626.1|  PREDICTED: uncharacterized protein LOC103951067    125   1e-28   
ref|XP_002309894.2|  hypothetical protein POPTR_0007s03780g             125   1e-28   
gb|KDP25715.1|  hypothetical protein JCGZ_23936                         124   2e-28   
ref|XP_010049429.1|  PREDICTED: uncharacterized protein LOC104438050    123   2e-28   
ref|XP_002526410.1|  ankyrin repeat-containing protein, putative        122   2e-28   
emb|CDP21828.1|  unnamed protein product                                124   2e-28   
ref|XP_007036288.1|  Ankyrin repeat family protein                      125   2e-28   
gb|KDP35850.1|  hypothetical protein JCGZ_10331                         125   2e-28   
emb|CDP21621.1|  unnamed protein product                                120   2e-28   
gb|KDO57161.1|  hypothetical protein CISIN_1g007858mg                   125   2e-28   
ref|XP_002311032.2|  hypothetical protein POPTR_0008s02420g             124   2e-28   
gb|KDO39991.1|  hypothetical protein CISIN_1g0055561mg                  125   2e-28   
ref|XP_010321572.1|  PREDICTED: uncharacterized protein LOC101249...    126   2e-28   
ref|XP_007215442.1|  hypothetical protein PRUPE_ppa006277mg             123   3e-28   
ref|XP_011001718.1|  PREDICTED: ankyrin repeat-containing protein...    126   3e-28   
ref|XP_008346704.1|  PREDICTED: uncharacterized protein LOC103409673    124   3e-28   
ref|XP_006290064.1|  hypothetical protein CARUB_v10003702mg             125   3e-28   
ref|XP_010321571.1|  PREDICTED: uncharacterized protein LOC101249...    125   3e-28   
ref|XP_008341744.1|  PREDICTED: uncharacterized protein LOC103404595    121   3e-28   
ref|XP_010321570.1|  PREDICTED: uncharacterized protein LOC101249...    125   3e-28   
ref|XP_002317173.2|  hypothetical protein POPTR_0011s01190g             123   3e-28   
gb|AES95705.2|  ankyrin repeat protein                                  122   3e-28   
ref|XP_011001717.1|  PREDICTED: ankyrin repeat-containing protein...    125   3e-28   
gb|KDP45109.1|  hypothetical protein JCGZ_18551                         124   3e-28   
gb|KDO52334.1|  hypothetical protein CISIN_1g035949mg                   119   3e-28   
ref|XP_010051526.1|  PREDICTED: uncharacterized protein LOC104440269    124   3e-28   
ref|XP_006494237.1|  PREDICTED: ankyrin repeat-containing protein...    125   3e-28   
ref|XP_010550279.1|  PREDICTED: ankyrin repeat-containing protein...    125   3e-28   
ref|XP_009343381.1|  PREDICTED: ankyrin repeat-containing protein...    125   4e-28   
gb|KCW82515.1|  hypothetical protein EUGRSUZ_C03912                     122   4e-28   
gb|KCW64231.1|  hypothetical protein EUGRSUZ_G01882                     122   4e-28   
ref|XP_011032835.1|  PREDICTED: uncharacterized protein LOC105131...    125   4e-28   
ref|XP_007048306.1|  Ankyrin repeat family protein isoform 1            125   4e-28   
gb|KHN40430.1|  Ankyrin repeat-containing protein                       124   5e-28   
ref|XP_009343383.1|  PREDICTED: uncharacterized protein LOC103935349    123   5e-28   
ref|XP_007048308.1|  Ankyrin repeat family protein isoform 3            124   5e-28   
ref|XP_008380086.1|  PREDICTED: uncharacterized protein LOC103443078    124   6e-28   
ref|XP_011008858.1|  PREDICTED: uncharacterized protein LOC105114...    124   6e-28   



>ref|XP_009614358.1| PREDICTED: uncharacterized protein LOC104107297 [Nicotiana tomentosiformis]
Length=314

 Score =   208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 136/275 (49%), Positives = 174/275 (63%), Gaps = 14/275 (5%)
 Frame = -1

Query  1020  EVVPANKKNDDQVEE-----EEDIMQESSA-LRLSTATQKEV--VPANKKNDDQV--EEE  871
             E  PAN + ++ +++     ++ I Q +   + +  A +K +  + A KK  + V  +EE
Sbjct  25    EQTPANIEYEEALQQLITEIDQKIAQPNPCNIIMGKALRKLIREIEAIKKLTETVCYKEE  84

Query  870   EDIMQESSALRLSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLK  691
             E IM   S L++S AAL  +REI WF  VEKIVP SF  M+N D KTP+QLF +EH  L 
Sbjct  85    EKIM-PPSFLQVSGAALRLQREILWFKEVEKIVPPSFLRMKNNDEKTPRQLFSEEHKLLL  143

Query  690   INAEKSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAV  511
                E+ +R TA+ CMIVATLIATV F+AAFT PGGN+D  G PI +K   FTVF ISDAV
Sbjct  144   KEGERWMRDTANYCMIVATLIATVMFAAAFTVPGGNNDNEGTPIMLKLKGFTVFVISDAV  203

Query  510   AMIFSMVSILTFLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAYG  334
             AM  S+VSI+ FLSIL  R  +DDF ++L K+L  G  AL  SI GML AF A FFL Y 
Sbjct  204   AMFCSIVSIIMFLSILTSRCNEDDFLVSLPKKLLFGLTALFASIVGMLVAFAATFFLVYN  263

Query  333   R--AWQPILIAAFVALPIASFLYLNARLWIDVVGS  235
                AWQP LIAA   +P+A F  L+ +LW D V S
Sbjct  264   NHMAWQPKLIAAISGVPVALFGCLHYKLWWDTVKS  298



>ref|XP_009627277.1| PREDICTED: uncharacterized protein LOC104117858 isoform X3 [Nicotiana 
tomentosiformis]
Length=640

 Score =   203 bits (516),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 119/219 (54%), Positives = 145/219 (66%), Gaps = 4/219 (2%)
 Frame = -1

Query  882  VEEEEDIMQESSALRLSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEH  703
            V+EEE IM   S LR+S AAL  +REI WF  VEKIVP SF  M+N DGKTP+QLF +EH
Sbjct  407  VKEEEKIM-PPSFLRVSGAALQMQREILWFKEVEKIVPLSFLRMKNNDGKTPRQLFTEEH  465

Query  702  MKLKINAEKSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTI  523
              L    E+ ++ TA+SCMI ATLIAT+ F+A FT PGGN+   G P+ +    F+VF I
Sbjct  466  QLLLKEGERWMKDTANSCMIAATLIATMVFAAGFTLPGGNNSDLGTPVMLTLKGFSVFVI  525

Query  522  SDAVAMIFSMVSILTFLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfaftaaff  346
            SDAVA+  S+VSI+ FLSIL  R T+DDF ++L  +L  G   L VSI  ML AF A FF
Sbjct  526  SDAVALFSSIVSIIMFLSILTSRYTEDDFLVSLPAKLLFGLTTLFVSIVSMLLAFAATFF  585

Query  345  lAYGR--AWQPILIAAFVALPIASFLYLNARLWIDVVGS  235
            L Y    AWQP LIAAF  +P+A F  L  +LW DV  S
Sbjct  586  LVYNNHMAWQPKLIAAFAGVPVALFGCLQYKLWFDVAKS  624



>ref|XP_009627274.1| PREDICTED: uncharacterized protein LOC104117858 isoform X1 [Nicotiana 
tomentosiformis]
Length=692

 Score =   203 bits (517),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 119/219 (54%), Positives = 145/219 (66%), Gaps = 4/219 (2%)
 Frame = -1

Query  882  VEEEEDIMQESSALRLSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEH  703
            V+EEE IM   S LR+S AAL  +REI WF  VEKIVP SF  M+N DGKTP+QLF +EH
Sbjct  459  VKEEEKIM-PPSFLRVSGAALQMQREILWFKEVEKIVPLSFLRMKNNDGKTPRQLFTEEH  517

Query  702  MKLKINAEKSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTI  523
              L    E+ ++ TA+SCMI ATLIAT+ F+A FT PGGN+   G P+ +    F+VF I
Sbjct  518  QLLLKEGERWMKDTANSCMIAATLIATMVFAAGFTLPGGNNSDLGTPVMLTLKGFSVFVI  577

Query  522  SDAVAMIFSMVSILTFLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfaftaaff  346
            SDAVA+  S+VSI+ FLSIL  R T+DDF ++L  +L  G   L VSI  ML AF A FF
Sbjct  578  SDAVALFSSIVSIIMFLSILTSRYTEDDFLVSLPAKLLFGLTTLFVSIVSMLLAFAATFF  637

Query  345  lAYGR--AWQPILIAAFVALPIASFLYLNARLWIDVVGS  235
            L Y    AWQP LIAAF  +P+A F  L  +LW DV  S
Sbjct  638  LVYNNHMAWQPKLIAAFAGVPVALFGCLQYKLWFDVAKS  676



>ref|XP_009627275.1| PREDICTED: uncharacterized protein LOC104117858 isoform X2 [Nicotiana 
tomentosiformis]
Length=659

 Score =   203 bits (516),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 119/219 (54%), Positives = 145/219 (66%), Gaps = 4/219 (2%)
 Frame = -1

Query  882  VEEEEDIMQESSALRLSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEH  703
            V+EEE IM   S LR+S AAL  +REI WF  VEKIVP SF  M+N DGKTP+QLF +EH
Sbjct  426  VKEEEKIM-PPSFLRVSGAALQMQREILWFKEVEKIVPLSFLRMKNNDGKTPRQLFTEEH  484

Query  702  MKLKINAEKSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTI  523
              L    E+ ++ TA+SCMI ATLIAT+ F+A FT PGGN+   G P+ +    F+VF I
Sbjct  485  QLLLKEGERWMKDTANSCMIAATLIATMVFAAGFTLPGGNNSDLGTPVMLTLKGFSVFVI  544

Query  522  SDAVAMIFSMVSILTFLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfaftaaff  346
            SDAVA+  S+VSI+ FLSIL  R T+DDF ++L  +L  G   L VSI  ML AF A FF
Sbjct  545  SDAVALFSSIVSIIMFLSILTSRYTEDDFLVSLPAKLLFGLTTLFVSIVSMLLAFAATFF  604

Query  345  lAYGR--AWQPILIAAFVALPIASFLYLNARLWIDVVGS  235
            L Y    AWQP LIAAF  +P+A F  L  +LW DV  S
Sbjct  605  LVYNNHMAWQPKLIAAFAGVPVALFGCLQYKLWFDVAKS  643



>ref|XP_009613415.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104106550 
[Nicotiana tomentosiformis]
Length=477

 Score =   196 bits (499),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 112/210 (53%), Positives = 140/210 (67%), Gaps = 3/210 (1%)
 Frame = -1

Query  849  SALRLSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSI  670
            S LR+S AAL  +RE+ WF  VEKIVP S H MRN DGKTP+Q F +EH  L    E+ +
Sbjct  254  SFLRVSGAALPLQRELLWFKEVEKIVPPSLHRMRNNDGKTPRQFFTEEHQLLLKEGERLM  313

Query  669  RGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMV  490
            + T +SCMIVATLIAT+ F+A FT PGGN+D  G PI ++   FTVF ISDAVA+  S+V
Sbjct  314  KDTVNSCMIVATLIATMVFAAGFTVPGGNNDDEGTPIMLQLKGFTVFVISDAVALFSSIV  373

Query  489  SILTFLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfaftaafflAYG--RAWQP  319
            SI+ FLSIL+ R  +DDF ++L  +L  G + L  SI  ML AF A FFL Y   RAW P
Sbjct  374  SIIMFLSILMSRYAEDDFLVSLPAKLLFGLSTLFASIVSMLVAFAATFFLIYNNHRAWGP  433

Query  318  ILIAAFVALPIASFLYLNARLWIDVVGSML  229
             LIAA   +P+A F  L  +LW DV  S++
Sbjct  434  KLIAACSGVPVALFGCLQYKLWFDVAKSII  463



>ref|XP_009778602.1| PREDICTED: uncharacterized protein LOC104227921 [Nicotiana sylvestris]
Length=757

 Score =   197 bits (502),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 134/275 (49%), Positives = 170/275 (62%), Gaps = 14/275 (5%)
 Frame = -1

Query  1020  EVVPANKKNDDQVEE-----EEDIMQESSA-LRLSTATQKEV--VPANKKNDDQV--EEE  871
             E  PAN + ++ +++     ++ I Q S   + +  A QK +  + A KK  + V  +EE
Sbjct  468   EQTPANIEYEEALQQLITEIDQKIGQPSPCNIIMRKALQKLIREIEAIKKLAETVCFKEE  527

Query  870   EDIMQESSALRLSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLK  691
             E IM   S LR+S AAL  +REI WF  VEKIVP SF  M+N D KTP+QLF +EH  L 
Sbjct  528   EKIM-PPSFLRVSGAALRLQREILWFKEVEKIVPPSFLRMKNNDEKTPRQLFSEEHKLLL  586

Query  690   INAEKSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAV  511
                E+ +R TA+ CMIVATLIATV F+AAFT PGGN+D  G PI +K   FTVF ISDAV
Sbjct  587   KEGERWMRDTANYCMIVATLIATVMFAAAFTVPGGNNDNEGTPIMLKLKGFTVFVISDAV  646

Query  510   AMIFSMVSILTFLSILIWRNTDDDFHLALKRLFVGFAALG-VSICGMlfaftaafflAYG  334
             AM  S+VSI+ FLSIL  R  +DDF ++L +  +        SI GML AF A FFL Y 
Sbjct  647   AMFCSIVSIIMFLSILTSRYNEDDFLVSLPKKLLLGLTTLFASIVGMLVAFAATFFLVYN  706

Query  333   R--AWQPILIAAFVALPIASFLYLNARLWIDVVGS  235
                AWQP LIAA   +P+A F  L+ +LW D V S
Sbjct  707   NHMAWQPKLIAAISGVPVALFGCLHYKLWWDTVKS  741



>ref|XP_006365051.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006365052.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X2 [Solanum tuberosum]
Length=679

 Score =   196 bits (499),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 122/253 (48%), Positives = 155/253 (61%), Gaps = 16/253 (6%)
 Frame = -1

Query  984  VEEEEDIMQESSALRLSTATQKEVVPANKKNDDQVEEEEDIMQESSALRLSTAALHYERE  805
            VE  + + QE   +R  T TQ             V+ EE IM   S LR+S AAL  +RE
Sbjct  414  VESLQQLFQEIEIIRHITETQ------------SVKAEEKIM-PPSFLRVSGAALQMQRE  460

Query  804  ISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTADSCMIVATLIA  625
            I WF  VEK++P S    RNKDGKTP++LF +EH  L  + EK ++ TA+SCMI ATLIA
Sbjct  461  ILWFKEVEKLIPPSGRKRRNKDGKTPRELFTEEHKILLKDGEKWMKDTANSCMIAATLIA  520

Query  624  TVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILTFLSILIWRNTD  445
            T+ F+A FT PGGN D  G PI+++   F +F ISDAVA+  S+VSI+ FLSIL  R  +
Sbjct  521  TMVFAAGFTVPGGNMDDNGFPIWLELNGFRIFVISDAVALFSSIVSIIMFLSILTSRYAE  580

Query  444  DDFHLALK-RLFVGFAALGVSICGMlfaftaafflAYGR--AWQPILIAAFVALPIASFL  274
            DDF ++L  +LF G  AL VSI  ML AFTA F L Y +   W+P LI A   +P+A F 
Sbjct  581  DDFLVSLPAKLFFGLTALFVSIVSMLVAFTATFVLIYRKHTGWEPKLIVACAGVPVALFG  640

Query  273  YLNARLWIDVVGS  235
             L  +LW DV  S
Sbjct  641  CLQYKLWFDVAKS  653



>ref|XP_004233910.2| PREDICTED: uncharacterized protein LOC101247887 [Solanum lycopersicum]
Length=616

 Score =   194 bits (493),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 114/228 (50%), Positives = 143/228 (63%), Gaps = 4/228 (2%)
 Frame = -1

Query  909  PANKKNDDQVEEEEDIMQESSALRLSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKT  730
            P      + V+EEE IM   S LR+S AAL  +REI WF  VEK+VP S+   +NKDGKT
Sbjct  374  PQKNVQSNAVKEEEKIMP-PSFLRISGAALQMQREILWFKEVEKLVPPSYQKRKNKDGKT  432

Query  729  PKQLFLKEHMKLKINAEKSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIK  550
            P++LF +EH  L    E+ ++ T +SCMIV+TLIAT+ F+A FT PGG +   GIPI + 
Sbjct  433  PRELFTEEHKILLKEGERWMKDTGNSCMIVSTLIATMVFAAGFTVPGGYNSDNGIPILLN  492

Query  549  RASFTVFTISDAVAMIFSMVSILTFLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGM  373
               F VF ISDAVA+  S+VSI+ FLSIL  R  +DDF ++L  +LF G   L VSI  M
Sbjct  493  LIGFKVFVISDAVALFTSIVSIIMFLSILTSRYAEDDFRVSLPAKLFFGLTMLFVSIVIM  552

Query  372  lfaftaafflAYGR--AWQPILIAAFVALPIASFLYLNARLWIDVVGS  235
            L AFTA F L Y     W+P LIAA   +P+A F  L   LW DV  S
Sbjct  553  LVAFTATFVLIYSSHIGWEPKLIAACAGVPVALFGCLQYNLWFDVAKS  600



>ref|XP_006365062.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Solanum 
tuberosum]
Length=561

 Score =   181 bits (459),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 108/216 (50%), Positives = 142/216 (66%), Gaps = 4/216 (2%)
 Frame = -1

Query  873  EEDIMQESSALRLSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKL  694
            +E IM   S LR+S AAL  ++EI WF  VEK++P S H+++NK  KTP+++F +EH  L
Sbjct  331  KEKIML-PSFLRVSGAALQMQKEILWFKEVEKLLPPSLHNIKNKAEKTPREVFTEEHNLL  389

Query  693  KINAEKSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDA  514
                E+ ++ TA+SCMIVATLIAT+ F+A FT PGGN+  TGIPI ++   F VF ISDA
Sbjct  390  LKEGERWMKDTANSCMIVATLIATMVFAAGFTVPGGNNSDTGIPILLEFNGFRVFVISDA  449

Query  513  VAMIFSMVSILTFLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfaftaafflAY  337
            VA+  S++SI+ FLSIL  R  +DDF ++L  +L  G   L VSI  ML AFT AFFL Y
Sbjct  450  VALFSSILSIIMFLSILTSRYAEDDFLVSLPAKLLFGLTTLFVSIVSMLLAFTTAFFLVY  509

Query  336  GRA--WQPILIAAFVALPIASFLYLNARLWIDVVGS  235
                 W+P LIAA   +P+A F     +LW DV  S
Sbjct  510  SNHTDWEPKLIAACAGIPVALFGCFQYKLWFDVAKS  545



>ref|XP_004161981.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like, 
partial [Cucumis sativus]
Length=571

 Score =   173 bits (439),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 103/205 (50%), Positives = 134/205 (65%), Gaps = 3/205 (1%)
 Frame = -1

Query  840  RLSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGT  661
            R+S AAL  +RE+ WF  V+KIV    H M+  DG TP++LF K+H KL+ + E+ ++ T
Sbjct  352  RVSGAALQMQRELLWFKEVKKIVTPMHHEMKCADGLTPRELFTKQHRKLQKDGEEWMKNT  411

Query  660  ADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSIL  481
            A SCM+VATLIAT+ F+AAFT PGGNDDK GIPIF    +FTVF ISD  A++ S+ SIL
Sbjct  412  ASSCMLVATLIATIVFAAAFTVPGGNDDKDGIPIFQHNQAFTVFVISDVAALVMSITSIL  471

Query  480  TFLSILIWRNTDDDFHLALKRLFV-GFAALGVSICGMlfaftaafflAYGRAWQ--PILI  310
            T LSIL  R  ++DF L L    + G   L VSI  M  AF+A FFL Y +     P +I
Sbjct  472  TSLSILTSRYAEEDFLLRLPLKLLFGLVTLFVSIACMAVAFSATFFLVYHKTETKLPWVI  531

Query  309  AAFVALPIASFLYLNARLWIDVVGS  235
            A   +LPI  F  L+ +L +D+VGS
Sbjct  532  AVVTSLPICCFCVLHFKLVVDIVGS  556



>ref|XP_010656436.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Vitis 
vinifera]
Length=621

 Score =   172 bits (436),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 99/204 (49%), Positives = 129/204 (63%), Gaps = 3/204 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  VEKI+  ++   +NKDGKTP+ LF KEH  L  + EK +RGTA
Sbjct  402  VSGAALQMQRELLWFKEVEKIMLPTYRERKNKDGKTPRDLFTKEHKNLMKDGEKWMRGTA  461

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
               M+VATLIATV F+AAFT PGG++  TGIPI +++ SF +F +SDA+A+  S  SIL 
Sbjct  462  AQSMLVATLIATVVFAAAFTVPGGSNQDTGIPILLRKKSFMIFAVSDAIALFSSSTSILV  521

Query  477  FLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAYGR--AWQPILIA  307
            FLSIL  R  +DDF  +L  RL  G   L VSI  M+  FT  FFL +G   AW P+LIA
Sbjct  522  FLSILTSRYAEDDFLESLPSRLMFGLITLFVSIISMMVTFTITFFLVFGHGFAWAPMLIA  581

Query  306  AFVALPIASFLYLNARLWIDVVGS  235
                +P+  +  L   L  D+  S
Sbjct  582  VSACVPVTLYFSLQYPLLADIFRS  605



>ref|XP_002862767.1| hypothetical protein ARALYDRAFT_333222 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_002870314.1| hypothetical protein ARALYDRAFT_915425 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39025.1| hypothetical protein ARALYDRAFT_333222 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46573.1| hypothetical protein ARALYDRAFT_915425 [Arabidopsis lyrata subsp. 
lyrata]
Length=341

 Score =   163 bits (412),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 95/204 (47%), Positives = 131/204 (64%), Gaps = 3/204 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +REI WF  V+KIVP S+   +NK+G+  + +F   H +L+   EK ++ TA
Sbjct  122  VSGAALQMQREILWFKAVKKIVPRSYIKSKNKEGELAQDIFTNGHKELRKEGEKWMKDTA  181

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
             SCM+VATLIATV F+AAFT PGGN++++G+PI  K+  F +F +SDAVA+  S  SI+ 
Sbjct  182  TSCMLVATLIATVVFAAAFTVPGGNNEESGLPILQKKKWFNIFILSDAVALCSSSTSIVI  241

Query  477  FLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAYGR--AWQPILIA  307
            FLSIL  R  +DDF ++L  RL +G  AL VSI  M+ AF A  FL Y R  AW    I 
Sbjct  242  FLSILTSRYAEDDFLVSLPSRLMLGLLALFVSIIAMVIAFCATLFLIYDRRLAWNLAFII  301

Query  306  AFVALPIASFLYLNARLWIDVVGS  235
            +  ++   SF  L+ +LW D + S
Sbjct  302  SLASITAFSFALLHVQLWFDTLRS  325



>ref|XP_009349120.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Pyrus 
x bretschneideri]
Length=722

 Score =   167 bits (423),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 100/223 (45%), Positives = 135/223 (61%), Gaps = 10/223 (4%)
 Frame = -1

Query  840  RLST---AALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSI  670
            RL+T   AAL + RE+ WF  VEKIV   +  MRN DGKTP+ LF +EH  L    EK +
Sbjct  500  RLNTDTGAALQFRRELQWFKEVEKIVQPLYKEMRNSDGKTPQVLFTEEHKDLLREGEKWM  559

Query  669  RGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMV  490
            +GTA SCM+VATLIATV F+   T PGGN++ TGIPIF+   +F VFTISDA++++ S  
Sbjct  560  KGTASSCMVVATLIATVMFAVFSTVPGGNNNDTGIPIFLNSRAFMVFTISDALSLVSSAT  619

Query  489  SILTFLSILIWRNTDDDF-HLALKRLFVGFAALGVSICGMlfaftaafflAYGRAWQ---  322
            SIL+FLSIL  R  + DF H    RL VG A L +SI  M+  F A+ ++  G  +Q   
Sbjct  620  SILSFLSILTSRYAEGDFLHSLPNRLIVGLATLFISIVTMMITFVASLYIVLGHGYQGIK  679

Query  321  -PILIAAFVALPIASFLYLNARLWIDVVGSMLLKLLPFTKQTT  196
             PI +AA   +P++ +  L   L  D++    +  + F    T
Sbjct  680  VPIALAA--GVPVSFYALLQFPLLGDMISHAYISRVSFRPMGT  720



>ref|XP_010244728.1| PREDICTED: uncharacterized protein LOC104588485 [Nelumbo nucifera]
Length=669

 Score =   166 bits (421),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 128/203 (63%), Gaps = 3/203 (1%)
 Frame = -1

Query  834  STAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTAD  655
            S AAL  +RE+ WF GVEKIV  SF +++N +GKTP+ LF + H +L +  EK ++ TA 
Sbjct  452  SGAALQMQRELQWFKGVEKIVDPSFQNLKNSEGKTPRALFTEHHKELAVKGEKWMKETAT  511

Query  654  SCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILTF  475
             CMIVAT+IA+V F AAFT PGG +  +GIPIF++   F  F +SDA+A+ FS  SI+ F
Sbjct  512  PCMIVATIIASVVFGAAFTVPGGINGDSGIPIFLQSNYFMAFVVSDAMALFFSTTSIVMF  571

Query  474  LSILIWRNTDDDFHLALKR-LFVGFAALGVSICGMlfaftaafflAYGR--AWQPILIAA  304
            LSIL     ++DF +AL R L +G  AL +S+  M+ AF+A  ++  G    W    I  
Sbjct  572  LSILTSSYNEEDFLIALPRTLIIGLGALFISVAAMVTAFSAGLYIVLGHRVKWVIFPITL  631

Query  303  FVALPIASFLYLNARLWIDVVGS  235
               LP++SF  L   L++ ++ S
Sbjct  632  LACLPLSSFALLQFPLFVKIIHS  654



>ref|XP_008440794.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X2 [Cucumis melo]
Length=614

 Score =   166 bits (421),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 104/232 (45%), Positives = 143/232 (62%), Gaps = 9/232 (4%)
 Frame = -1

Query  903  NKKNDDQVEEEEDIMQESSALR--LSTAALHYEREISWFMGVEKIVPSSFHHMRNK----  742
            N+KND  +      +     L   +S  AL  + E+ WF  VEKIV  S + M+ K    
Sbjct  367  NEKNDCNILHLAGKLASPYHLNKVVSGKALQMQYELRWFKEVEKIVIPSHYEMKMKNEHG  426

Query  741  DGKTPKQLFLKEHMKLKINAEKSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIP  562
            D  TP++LF KEH  L+   E+ ++ TA+SCM+VA LIATV F+AAFT PGGN+DK GIP
Sbjct  427  DRLTPRELFTKEHKHLRREGEEWMKNTANSCMLVAALIATVVFAAAFTVPGGNEDKDGIP  486

Query  561  IFIKRASFTVFTISDAVAMIFSMVSILTFLSILIWRNTDDDFHLAL-KRLFVGFAALGVS  385
            IF K   FTVF ISD  A++ S  SILTFLSIL  R  ++DF ++L  +L +G   L VS
Sbjct  487  IFQKNQVFTVFVISDVAALVMSTTSILTFLSILTARYAEEDFLISLPSKLLIGLITLFVS  546

Query  384  ICGMlfaftaafflAYGRAWQ--PILIAAFVALPIASFLYLNARLWIDVVGS  235
            I  M+ AF+A FF+AY +     P+++AA + LPI  F   + +L++D + S
Sbjct  547  IACMMVAFSATFFIAYHKTTVKIPLIVAAVLILPIVCFCMFHFKLFLDTMRS  598



>ref|XP_006448678.1| hypothetical protein CICLE_v10014877mg [Citrus clementina]
 gb|ESR61918.1| hypothetical protein CICLE_v10014877mg [Citrus clementina]
Length=530

 Score =   165 bits (418),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 91/204 (45%), Positives = 130/204 (64%), Gaps = 3/204 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  V+ ++ SSF    N+  +TP+ LF KEH KL+   EK ++ TA
Sbjct  281  VSGAALQMQRELLWFREVKNVIQSSFVEKENRHHETPRALFTKEHKKLREEGEKWMKDTA  340

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
             SCMIVATLIATV F+AAFT PGG   +TG+P F K+ SF +F ISDA++++ S  SI+ 
Sbjct  341  TSCMIVATLIATVVFAAAFTVPGGTKGETGLPFFDKKVSFQIFAISDAISLVSSSASIVN  400

Query  477  FLSILIWRNTDDDF-HLALKRLFVGFAALGVSICGMlfaftaafflAYG--RAWQPILIA  307
            FLSIL  R  ++DF  L   +L  G   L +SI  M+  F+  FF+ +   R W  +L+ 
Sbjct  401  FLSILTSRYAEEDFLELLPGKLLFGLLTLFISILTMMVVFSTTFFIFFNHERLWIAVLVT  460

Query  306  AFVALPIASFLYLNARLWIDVVGS  235
             F + P+  F+Y + +L+IDV+ S
Sbjct  461  VFSSFPVILFIYQHIQLFIDVLRS  484



>ref|XP_008440732.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Cucumis 
melo]
Length=728

 Score =   166 bits (420),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 102/241 (42%), Positives = 144/241 (60%), Gaps = 18/241 (7%)
 Frame = -1

Query  903  NKKNDDQVEEEEDIMQESSALRLSTAALHYEREISWFMGVEKIVPSSFHHMRNK------  742
            +KKN + +     +       R+S AAL  +RE+ WF  VEK V SS+  M+ K      
Sbjct  472  HKKNSNMLHLAGKLAAPYHLSRVSGAALQMQRELLWFTEVEKFVVSSYLQMKTKIPLPPQ  531

Query  741  ---------DGKTPKQLFLKEHMKLKINAEKSIRGTADSCMIVATLIATVAFSAAFTAPG  589
                     +  TP++LF KEH  L  + E+ ++ TA+SCM+VATLIATV F+AAFT PG
Sbjct  532  APGIDENRFEELTPRELFTKEHKSLLKDGEEWMKNTANSCMLVATLIATVVFAAAFTVPG  591

Query  588  GNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILTFLSILIWRNTDDDFHLALK-RLF  412
            GNDDK+G P F +  +FTVF I+D  A++FS  SILTFLSIL  R  +DDF ++L  +L 
Sbjct  592  GNDDKSGTPNFRQNQAFTVFVITDVAALVFSTTSILTFLSILTSRYAEDDFLMSLPIKLL  651

Query  411  VGFAALGVSICGMlfaftaafflAYGRAWQ--PILIAAFVALPIASFLYLNARLWIDVVG  238
             G   L +SI  M+ AF+A FF+AY +  Q  P+ IA    +P+  F   +++L +D+  
Sbjct  652  FGLVTLFLSISCMVVAFSATFFIAYDKTKQNIPLAIAIVSIVPVVCFCLFHSKLVVDIFR  711

Query  237  S  235
            S
Sbjct  712  S  712



>gb|KDO41013.1| hypothetical protein CISIN_1g021201mg [Citrus sinensis]
Length=285

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/220 (40%), Positives = 136/220 (62%), Gaps = 5/220 (2%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S +AL  +RE+ WF  V+K+VP      +NK G TP+ LF ++H  LK   EK ++ TA
Sbjct  35   VSGSALQMQRELLWFQAVKKVVPRKLAEAKNKKGLTPRALFSEQHRDLKEKGEKWMKDTA  94

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
             SCMIVATLIATV F+AA T PGGN + TG+P F+   SF +F +S+ ++++ S +SI+ 
Sbjct  95   SSCMIVATLIATVVFAAALTVPGGNKEDTGLPFFLHNVSFKIFAVSNVISLVASTLSIVV  154

Query  477  FLSILIWRNTDDDF-HLALKRLFVGFAALGVSICGMlfaftaafflAY--GRAWQPILIA  307
            FLS++  R  + DF  L  ++L+VG   L ++I  M+  F+A  F+ +  G  W  IL+ 
Sbjct  155  FLSLVTPRYAEKDFLSLLPRKLYVGLGTLFIAIAAMMVVFSATSFIVFTDGSTWIAILVI  214

Query  306  AFVALPIASFLYLNARLWIDVVGSMLLK--LLPFTKQTTY  193
               ++P   F YL+ RL+ D++ S+ +   L+P  K + +
Sbjct  215  VVPSVPAILFFYLHFRLFDDILRSVFVSDYLIPKCKTSLF  254



>ref|XP_008384216.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Malus 
domestica]
Length=212

 Score =   157 bits (396),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 123/196 (63%), Gaps = 3/196 (2%)
 Frame = -1

Query  813  EREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTADSCMIVAT  634
            +RE+ WF  VEKIV + F  M+N+ GKTP++LF  EH  L    E  ++ TA+SCM+V+T
Sbjct  2    QRELVWFEEVEKIVQTHFIDMKNRQGKTPRELFTSEHEDLLRKGESWMKDTANSCMLVST  61

Query  633  LIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILTFLSILIWR  454
            LIATV FSAAF+ PGG DD  G P FIK A+F +F I D VA+  S  +IL FL IL  R
Sbjct  62   LIATVVFSAAFSIPGGIDDNKGTPNFIKEAAFLIFAIFDGVALFSSSTAILMFLYILTSR  121

Query  453  NTDDDFHLALK-RLFVGFAALGVSICGMlfaftaafflA--YGRAWQPILIAAFVALPIA  283
              ++DF  +L  +L VG A+L VSI  M+  F+  F+L+  YG  W P LI  F  +P+A
Sbjct  122  YAENDFLKSLPLKLMVGLASLFVSITSMMVTFSTXFYLSCHYGLRWVPDLIFIFAFVPVA  181

Query  282  SFLYLNARLWIDVVGS  235
             F +L   L  D+  S
Sbjct  182  LFAFLQXPLLFDMFFS  197



>gb|EYU28334.1| hypothetical protein MIMGU_mgv1a023484mg [Erythranthe guttata]
Length=312

 Score =   160 bits (404),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 91/204 (45%), Positives = 125/204 (61%), Gaps = 3/204 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ W+  VEK +  S     NK GK+P  +F +EH KLK   EK I+ T+
Sbjct  93   ISGAALQMQREMQWYKQVEKTMNPSSRKRENKQGKSPNMVFTEEHKKLKEEGEKWIKDTS  152

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
            +SC I A LI T+ F+AA T PGGN+  TG P+F +   F VF ISDA+++  S  S+L 
Sbjct  153  ESCTIAAALIVTIMFAAAITVPGGNESDTGFPVFAREKVFLVFAISDAISLFASTTSLLM  212

Query  477  FLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAYGR--AWQPILIA  307
            FLSIL  R  ++DF   L KRL +G   L +SI  M+ AF+A  +L +GR  AW  I +A
Sbjct  213  FLSILTSRYAEEDFLSNLPKRLIIGLGTLFLSITFMMVAFSATLYLVFGRKNAWVLIPVA  272

Query  306  AFVALPIASFLYLNARLWIDVVGS  235
            A   LP+ SF++L   L  D++ S
Sbjct  273  ALACLPVTSFVFLQFPLLADLISS  296



>gb|EYU25856.1| hypothetical protein MIMGU_mgv1a004842mg [Erythranthe guttata]
Length=507

 Score =   164 bits (414),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 97/204 (48%), Positives = 126/204 (62%), Gaps = 3/204 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  VEK V        N  GKTPK +F +EH  LKI  EK ++ TA
Sbjct  288  VSGAALQMQRELQWFKEVEKFVHPYTKERPNYAGKTPKMVFTEEHKDLKIEGEKWMKDTA  347

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
            +SC I A LIATV F+AA T PGGN+  TG PIF+K  +F +F +SDAV++  S  S+L 
Sbjct  348  NSCTIAAALIATVVFAAAITVPGGNESTTGYPIFLKSGAFVLFAVSDAVSLFTSTTSLLM  407

Query  477  FLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAYG--RAWQPILIA  307
            FLSIL  R  ++DF  AL KRL +G   L VSI  M  AF+A  +L +G    W  + +A
Sbjct  408  FLSILTSRYAEEDFLYALPKRLCIGLFTLFVSILFMTIAFSATLYLVFGLNNRWVVMPVA  467

Query  306  AFVALPIASFLYLNARLWIDVVGS  235
            A   LPI+SF+ L   L +DV+ S
Sbjct  468  ALACLPISSFVLLQFPLLVDVISS  491



>gb|KDO41012.1| hypothetical protein CISIN_1g021201mg [Citrus sinensis]
Length=316

 Score =   160 bits (404),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 87/220 (40%), Positives = 136/220 (62%), Gaps = 5/220 (2%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S +AL  +RE+ WF  V+K+VP      +NK G TP+ LF ++H  LK   EK ++ TA
Sbjct  66   VSGSALQMQRELLWFQAVKKVVPRKLAEAKNKKGLTPRALFSEQHRDLKEKGEKWMKDTA  125

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
             SCMIVATLIATV F+AA T PGGN + TG+P F+   SF +F +S+ ++++ S +SI+ 
Sbjct  126  SSCMIVATLIATVVFAAALTVPGGNKEDTGLPFFLHNVSFKIFAVSNVISLVASTLSIVV  185

Query  477  FLSILIWRNTDDDF-HLALKRLFVGFAALGVSICGMlfaftaafflAY--GRAWQPILIA  307
            FLS++  R  + DF  L  ++L+VG   L ++I  M+  F+A  F+ +  G  W  IL+ 
Sbjct  186  FLSLVTPRYAEKDFLSLLPRKLYVGLGTLFIAIAAMMVVFSATSFIVFTDGSTWIAILVI  245

Query  306  AFVALPIASFLYLNARLWIDVVGSMLLK--LLPFTKQTTY  193
               ++P   F YL+ RL+ D++ S+ +   L+P  K + +
Sbjct  246  VVPSVPAILFFYLHFRLFDDILRSVFVSDYLIPKCKTSLF  285



>ref|XP_010244047.1| PREDICTED: uncharacterized protein LOC104587959 [Nelumbo nucifera]
Length=588

 Score =   164 bits (415),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 92/233 (39%), Positives = 139/233 (60%), Gaps = 3/233 (1%)
 Frame = -1

Query  924  QKEVVPANKKNDDQVEEEEDIMQESSALRLSTAALHYEREISWFMGVEKIVPSSFHHMRN  745
            +  ++P +K+ +  +     +   S   R+S AAL  +RE+ WF  VEK VP  +   +N
Sbjct  345  ESYIMPFDKQQNTMLHLAAMLSPYSQLSRVSGAALQMQRELQWFKEVEKFVPPKYKEFQN  404

Query  744  KDGKTPKQLFLKEHMKLKINAEKSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGI  565
             +G+TP+ LF + H  L  + EK ++ TA SCM+VATLIAT+ F+AAFT PGGN+  TGI
Sbjct  405  SNGQTPQTLFTEAHRNLVKDGEKWMKDTATSCMVVATLIATIMFTAAFTMPGGNNSDTGI  464

Query  564  PIFIKRASFTVFTISDAVAMIFSMVSILTFLSILIWRNTDDDFHLAL-KRLFVGFAALGV  388
            PIF+   +F +F ISDA ++  S  S+L FL IL  R  ++DF ++L KRL +G A L  
Sbjct  465  PIFLHTKAFMIFIISDAFSLFSSTTSVLMFLGILTSRYAEEDFLVSLPKRLIIGLATLFF  524

Query  387  SICGMlfa-ftaafflAYGRA-WQPILIAAFVALPIASFLYLNARLWIDVVGS  235
            S+  M+ A     F + + RA W  I +    ++P+A F+ L   L +D++ S
Sbjct  525  SVATMMIAFGATLFIVLHHRAKWTAIPVTLLGSVPVALFVLLQFPLLVDMIVS  577



>ref|XP_009377835.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Pyrus 
x bretschneideri]
Length=614

 Score =   164 bits (415),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 98/212 (46%), Positives = 126/212 (59%), Gaps = 3/212 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  VEKIV   F  M+NK GKTP++LF  EH  L    E  ++ T 
Sbjct  396  VSGAALQMQRELVWFEEVEKIVQPPFIDMKNKQGKTPRELFTSEHEDLLRKGESWMKDTT  455

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
            +SCM+V+TLIATV FSAAF+ PGG DD  G P FIK A+F +F ISD VA+  S  +IL 
Sbjct  456  NSCMLVSTLIATVVFSAAFSIPGGIDDNKGTPNFIKEAAFLIFAISDGVALFSSSTAILM  515

Query  477  FLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfaftaa--fflAYGRAWQPILIA  307
            FL IL  R  ++DF  +L  +L VG ++L VSI  M+  F+ A      YG  W P LI 
Sbjct  516  FLYILTSRYAENDFLKSLPLKLMVGLSSLFVSITSMMVTFSTAFYLSCHYGLRWVPDLIF  575

Query  306  AFVALPIASFLYLNARLWIDVVGSMLLKLLPF  211
             F  +P+A F +L   L  D+  S     L F
Sbjct  576  IFAFVPVALFAFLQYPLLFDMFFSTYCSSLLF  607



>ref|XP_009344351.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X2 [Pyrus x bretschneideri]
Length=553

 Score =   163 bits (413),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 98/212 (46%), Positives = 125/212 (59%), Gaps = 3/212 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  VEKIV   F  M+NK GKTP++LF  EH  L    E  ++ T 
Sbjct  335  VSGAALQMQRELVWFEEVEKIVQPPFIDMKNKQGKTPRELFTSEHEDLLRKGESWMKDTT  394

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
            +SCM+V+TLIATV FSAAF+ PGG DD  G P FIK A+F +F ISD VA+  S  +IL 
Sbjct  395  NSCMLVSTLIATVVFSAAFSIPGGIDDNKGTPNFIKEAAFLIFAISDGVALFSSSTAILM  454

Query  477  FLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfaftaa--fflAYGRAWQPILIA  307
            FL IL  R  ++DF  +L  +L VG  +L VSI  M+  F+ A      YG  W P LI 
Sbjct  455  FLYILTSRYAENDFLKSLPLKLMVGLTSLFVSITSMMVTFSTAFYLSCHYGLRWVPDLIF  514

Query  306  AFVALPIASFLYLNARLWIDVVGSMLLKLLPF  211
             F  +P+A F +L   L  D+  S     L F
Sbjct  515  IFAFVPVALFAFLQYPLLFDMFFSTYCSSLLF  546



>ref|XP_006284892.1| hypothetical protein CARUB_v10006184mg [Capsella rubella]
 gb|EOA17790.1| hypothetical protein CARUB_v10006184mg [Capsella rubella]
Length=558

 Score =   163 bits (413),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 96/204 (47%), Positives = 128/204 (63%), Gaps = 3/204 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +REI WF  V+KIVP S+   +N +GK  + LF   H  L+   EK ++ TA
Sbjct  339  VSGAALQMQREILWFKAVKKIVPRSYIKSKNSEGKVAQDLFTNGHNDLRKEGEKWMKDTA  398

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
             SCM+VATLIATV F+AAFT PGGN+++ G+PI   R  F +F +SDAVA+  S  SI+ 
Sbjct  399  TSCMLVATLIATVVFAAAFTVPGGNNEEIGLPILQNRKWFNIFILSDAVALCSSSTSIVI  458

Query  477  FLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAYGR--AWQPILIA  307
            FLSIL  R  +DDF ++L  RL +G  +L VSI  M+ AF A  FL Y R  AW   LI 
Sbjct  459  FLSILTSRYAEDDFLVSLPSRLMLGLLSLFVSIIAMVIAFCATLFLIYDRRFAWNLALII  518

Query  306  AFVALPIASFLYLNARLWIDVVGS  235
            +  ++   SF  L+ +LW D + S
Sbjct  519  SLASITAFSFALLHVQLWFDTLRS  542



>ref|XP_004296497.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Fragaria 
vesca subsp. vesca]
Length=701

 Score =   164 bits (415),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 101/223 (45%), Positives = 133/223 (60%), Gaps = 10/223 (4%)
 Frame = -1

Query  855  ESSALRLST---AALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKIN  685
             +SA RLST   AAL   RE+ WF  VEKIV   +  MRN DG+ P+ LF KEH +L   
Sbjct  473  RASASRLSTDTGAALQLRRELIWFKEVEKIVQPLYKEMRNSDGEIPQLLFTKEHKELLRE  532

Query  684  AEKSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAM  505
             E  ++GTA SCM+VATLIATV F+   T PGGN++ TGIPIF+K  +FTVF ISDA+++
Sbjct  533  GEVWMKGTASSCMVVATLIATVMFAVISTVPGGNNNNTGIPIFLKSRAFTVFVISDAISL  592

Query  504  IFSMVSILTFLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAYGRA  328
            I S  SIL+FLSIL  R  + DF  +L  RL VG A L +SI  M+  F A   +  G  
Sbjct  593  ITSTTSILSFLSILTSRYHEGDFLNSLPNRLIVGLATLFISIATMMITFVATLLMVLGPG  652

Query  327  WQ----PILIAAFVALPIASFLYLNARLWIDVVGSMLLKLLPF  211
            +     PI + A  A+P+  +  L   L  D++    +  + F
Sbjct  653  FHEIKVPITLVA--AVPVGFYALLQFPLLADMISHAYISRVSF  693



>ref|XP_009344349.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009344350.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X1 [Pyrus x bretschneideri]
Length=614

 Score =   163 bits (413),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 98/212 (46%), Positives = 125/212 (59%), Gaps = 3/212 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  VEKIV   F  M+NK GKTP++LF  EH  L    E  ++ T 
Sbjct  396  VSGAALQMQRELVWFEEVEKIVQPPFIDMKNKQGKTPRELFTSEHEDLLRKGESWMKDTT  455

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
            +SCM+V+TLIATV FSAAF+ PGG DD  G P FIK A+F +F ISD VA+  S  +IL 
Sbjct  456  NSCMLVSTLIATVVFSAAFSIPGGIDDNKGTPNFIKEAAFLIFAISDGVALFSSSTAILM  515

Query  477  FLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfaftaa--fflAYGRAWQPILIA  307
            FL IL  R  ++DF  +L  +L VG  +L VSI  M+  F+ A      YG  W P LI 
Sbjct  516  FLYILTSRYAENDFLKSLPLKLMVGLTSLFVSITSMMVTFSTAFYLSCHYGLRWVPDLIF  575

Query  306  AFVALPIASFLYLNARLWIDVVGSMLLKLLPF  211
             F  +P+A F +L   L  D+  S     L F
Sbjct  576  IFAFVPVALFAFLQYPLLFDMFFSTYCSSLLF  607



>ref|XP_008440786.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X1 [Cucumis melo]
Length=625

 Score =   163 bits (413),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 101/232 (44%), Positives = 137/232 (59%), Gaps = 19/232 (8%)
 Frame = -1

Query  840  RLSTAALHYEREISWFMGVEKIVPSSFHHMRNK----------------DGKTPKQLFLK  709
            R+S AAL  +RE+ WF  VEKIV S    +  K                D  TP+QLF +
Sbjct  389  RVSGAALQMQRELLWFKEVEKIVYSYHTRVHCKGLPNLTGGETKLFDPADTLTPRQLFSR  448

Query  708  EHMKLKINAEKSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVF  529
            +H +L+ + E+ ++ TA+SCM+VATLI TV F+AAFT PGGN+DK G PIF +  +FTVF
Sbjct  449  QHEQLRKDGEEWMKSTANSCMVVATLITTVVFAAAFTFPGGNNDKDGTPIFRQNQAFTVF  508

Query  528  TISDAVAMIFSMVSILTFLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfaftaa  352
             ISD  A++ S  SILTFLSIL  R  ++DF ++L  +L  G   L VSI  M  AF+  
Sbjct  509  IISDVAALVLSTTSILTFLSILTSRYAEEDFLMSLPGKLLFGLLTLFVSIACMAVAFSMT  568

Query  351  fflAYGR--AWQPILIAAFVALPIASFLYLNARLWIDVVGSMLLKLLPFTKQ  202
            FF+AY +  A  P+ IAA   +PI  F   + RL +D++ S       F K+
Sbjct  569  FFIAYDKTNAKLPLAIAAVTVIPIGCFCVFHLRLIVDILRSAYWSYFSFRKR  620



>ref|XP_008356256.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Malus 
domestica]
Length=654

 Score =   163 bits (413),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 94/211 (45%), Positives = 130/211 (62%), Gaps = 7/211 (3%)
 Frame = -1

Query  828  AALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTADSC  649
            AAL + RE+ WF  V+KIV   +  MRN DGKTP+ LF +EH  L    EK ++GTA SC
Sbjct  439  AALQFRRELQWFKEVKKIVQPLYKEMRNSDGKTPQVLFTEEHKDLLREGEKWMKGTASSC  498

Query  648  MIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILTFLS  469
            M+VATLIATV F+   T PGGN++ TGIPIF+   +F VF ISDA++++ S  SIL+FLS
Sbjct  499  MLVATLIATVMFAVFSTVPGGNNNDTGIPIFLNSRAFMVFAISDALSLVSSATSILSFLS  558

Query  468  ILIWRNTDDDF-HLALKRLFVGFAALGVSICGMlfaftaafflAYGRAWQ----PILIAA  304
            IL  R  ++DF H    RL VG A L +SI  M+  F A+ ++  G  +Q    PI +AA
Sbjct  559  ILTSRYAEEDFLHSLPNRLIVGLATLFISIVTMMITFVASLYIVLGHGYQGIKFPITLAA  618

Query  303  FVALPIASFLYLNARLWIDVVGSMLLKLLPF  211
               +P++ +  L   L  D++    +  + F
Sbjct  619  --GVPVSFYALLQFPLLGDMISHAYISRVSF  647



>ref|XP_006464318.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Citrus 
sinensis]
Length=665

 Score =   163 bits (413),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 92/204 (45%), Positives = 130/204 (64%), Gaps = 3/204 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  VEK V       +N+DG +P+ LF ++H  L+   EK ++ TA
Sbjct  411  VSGAALQMQRELLWFEEVEKAVQRRSAEAKNEDGLSPRALFTRKHENLREQGEKWMKDTA  470

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
             SCM+VATLIATV F+AAFT PGGN   TG P F+++ SF +F IS+A++++ S  SI+ 
Sbjct  471  TSCMLVATLIATVVFAAAFTVPGGNKGDTGFPFFLEKVSFKIFAISEAISLVSSSASIVN  530

Query  477  FLSILIWRNTDDDF-HLALKRLFVGFAALGVSICGMlfaftaafflAY--GRAWQPILIA  307
            FLSIL  R T+ DF  L  K+L +G A L VSI  M+  F+AAFF+ +   R W  IL+ 
Sbjct  531  FLSILTSRYTEKDFLRLLPKKLLIGLATLFVSIAAMMVVFSAAFFIVFKDSRLWVAILVT  590

Query  306  AFVALPIASFLYLNARLWIDVVGS  235
               ++P+  F+  + +L  DVV S
Sbjct  591  VIASIPVIMFIVQHCQLLCDVVRS  614



>ref|XP_006428079.1| hypothetical protein CICLE_v10027269mg, partial [Citrus clementina]
 gb|ESR41319.1| hypothetical protein CICLE_v10027269mg, partial [Citrus clementina]
Length=583

 Score =   162 bits (411),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 92/204 (45%), Positives = 130/204 (64%), Gaps = 3/204 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  VEK V       +N+DG +P+ LF ++H  L+   EK ++ TA
Sbjct  329  VSGAALQMQRELLWFEEVEKAVQRRSAEAKNEDGLSPRALFTRKHENLREQGEKWMKDTA  388

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
             SCM+VATLIATV F+AAFT PGGN   TG P F+++ SF +F IS+A++++ S  SI+ 
Sbjct  389  TSCMLVATLIATVVFAAAFTVPGGNKGDTGFPFFLEKVSFKIFAISEAISLVSSSASIVN  448

Query  477  FLSILIWRNTDDDF-HLALKRLFVGFAALGVSICGMlfaftaafflAY--GRAWQPILIA  307
            FLSIL  R T+ DF  L  K+L +G A L VSI  M+  F+AAFF+ +   R W  IL+ 
Sbjct  449  FLSILTSRYTEKDFLRLLPKKLLIGLATLFVSIAAMMVVFSAAFFIVFKDSRLWVAILVT  508

Query  306  AFVALPIASFLYLNARLWIDVVGS  235
               ++P+  F+  + +L  DVV S
Sbjct  509  VIASIPVIMFIVQHCQLLCDVVRS  532



>gb|KDO40245.1| hypothetical protein CISIN_1g037778mg, partial [Citrus sinensis]
Length=575

 Score =   162 bits (410),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 92/204 (45%), Positives = 130/204 (64%), Gaps = 3/204 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  VEK V       +N+DG +P+ LF ++H  L+   EK ++ TA
Sbjct  329  VSGAALQMQRELLWFEEVEKAVQRRSAEAKNEDGLSPRALFTRKHENLREQGEKWMKDTA  388

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
             SCM+VATLIATV F+AAFT PGGN   TG P F+++ SF +F IS+A++++ S  SI+ 
Sbjct  389  TSCMLVATLIATVVFAAAFTVPGGNKGDTGFPFFLEKVSFKIFAISEAISLVSSSASIVN  448

Query  477  FLSILIWRNTDDDF-HLALKRLFVGFAALGVSICGMlfaftaafflAY--GRAWQPILIA  307
            FLSIL  R T+ DF  L  K+L +G A L VSI  M+  F+AAFF+ +   R W  IL+ 
Sbjct  449  FLSILTSRYTEKDFLRLLPKKLLIGLATLFVSIAAMMVVFSAAFFIVFKDSRLWVAILVT  508

Query  306  AFVALPIASFLYLNARLWIDVVGS  235
               ++P+  F+  + +L  DVV S
Sbjct  509  VIASIPVIMFIVQHCQLLCDVVRS  532



>gb|KDO77352.1| hypothetical protein CISIN_1g003814mg [Citrus sinensis]
Length=570

 Score =   162 bits (410),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 99/218 (45%), Positives = 133/218 (61%), Gaps = 4/218 (2%)
 Frame = -1

Query  834  STAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTAD  655
            S AAL   RE+ WF  +EK+V  S+   +N +G+TP  LF +EH +L    EK ++ TA 
Sbjct  352  SGAALQLRRELHWFKEIEKVVQPSYREAKNSEGRTPHILFSEEHRRLVREGEKWMKDTAS  411

Query  654  SCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILTF  475
            SCM+VATLIATV F+AAFT PGGNDD TG PIF+   SF VF +SDA+A+  S  SIL F
Sbjct  412  SCMVVATLIATVMFAAAFTVPGGNDDSTGRPIFLHYKSFMVFAVSDALALFCSATSILMF  471

Query  474  LSILIWRNTDDDF-HLALKRLFVGFAALGVSICGMlfaftaafflAYGR--AWQPILIAA  304
            LSI+  R  ++DF H    RL +G A L +SI  M+ AF A  F+  G    W  I IA 
Sbjct  472  LSIITSRYAEEDFVHSLPNRLIIGLATLFISIATMMAAFAATLFIVLGDDFVWIAIPIAT  531

Query  303  FVALPIASFLYLNARLWIDVVGSMLLKLLPFTKQTTYV  190
               +P++ F  L   L  D++ S L K   FT+++ ++
Sbjct  532  GACVPVSLFALLQFPLLSDMI-SHLYKYSIFTRRSNHL  568



>ref|XP_004171684.1| PREDICTED: uncharacterized protein LOC101226258 [Cucumis sativus]
Length=297

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 95/208 (46%), Positives = 129/208 (62%), Gaps = 9/208 (4%)
 Frame = -1

Query  840  RLSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGK------TPKQLFLKEHMKLKINAE  679
            R+S AAL  +RE+ WF  VEKIV  S   +++ D        TP+QLF ++H +L+   E
Sbjct  70   RVSGAALQMQREMLWFKEVEKIVLPSQLEVKSNDPDPSIPKLTPRQLFTEKHKRLRKEGE  129

Query  678  KSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIF  499
            + ++ TA+SCM+VATLI+TV F+AAFT PGGNDD TG PIF  +  F +F +SDA+A+  
Sbjct  130  EWMKNTANSCMLVATLISTVVFAAAFTVPGGNDDNTGTPIFQNKFWFAMFVVSDAIALFS  189

Query  498  SMVSILTFLSILIWRNTDDDF-HLALKRLFVGFAALGVSICGMlfaftaafflAYGRA--  328
            S  SIL FLSIL  R  ++DF H    +L  G A+L +SI  M  AF++ FFL Y  A  
Sbjct  190  SSTSILMFLSILTSRYAEEDFLHSLPSKLLFGLASLFISIVFMAVAFSSTFFLIYHNANI  249

Query  327  WQPILIAAFVALPIASFLYLNARLWIDV  244
              P ++ A   +PI  F  L   LWID+
Sbjct  250  SIPTMVTAMAIIPITCFCLLQFTLWIDI  277



>ref|XP_006490206.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X4 [Citrus sinensis]
Length=647

 Score =   162 bits (411),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 87/220 (40%), Positives = 136/220 (62%), Gaps = 5/220 (2%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S +AL  +RE+ WF  V+K+VP      +NK G TP+ LF ++H  LK   EK ++ TA
Sbjct  397  VSGSALQMQRELLWFQAVKKVVPRKLAEAKNKKGLTPRALFSEQHRDLKEKGEKWMKDTA  456

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
             SCMIVATLIATV F+AA T PGGN + TG+P F+   SF +F +S+ ++++ S +SI+ 
Sbjct  457  SSCMIVATLIATVVFAAALTVPGGNKEDTGLPFFLHNVSFKIFAVSNVISLVASTLSIVV  516

Query  477  FLSILIWRNTDDDF-HLALKRLFVGFAALGVSICGMlfaftaafflAY--GRAWQPILIA  307
            FLS++  R  + DF  L  ++L+VG   L ++I  M+  F+A  F+ +  G  W  IL+ 
Sbjct  517  FLSLVTPRYAEKDFLSLLPRKLYVGLGTLFIAIAAMMVVFSATSFIVFTDGSTWIAILVI  576

Query  306  AFVALPIASFLYLNARLWIDVVGSMLLK--LLPFTKQTTY  193
               ++P   F YL+ RL+ D++ S+ +   L+P  K + +
Sbjct  577  VVPSVPAILFFYLHFRLFDDILRSVFVSDYLIPKCKTSLF  616



>ref|XP_006490203.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X1 [Citrus sinensis]
Length=653

 Score =   162 bits (411),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 87/220 (40%), Positives = 136/220 (62%), Gaps = 5/220 (2%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S +AL  +RE+ WF  V+K+VP      +NK G TP+ LF ++H  LK   EK ++ TA
Sbjct  403  VSGSALQMQRELLWFQAVKKVVPRKLAEAKNKKGLTPRALFSEQHRDLKEKGEKWMKDTA  462

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
             SCMIVATLIATV F+AA T PGGN + TG+P F+   SF +F +S+ ++++ S +SI+ 
Sbjct  463  SSCMIVATLIATVVFAAALTVPGGNKEDTGLPFFLHNVSFKIFAVSNVISLVASTLSIVV  522

Query  477  FLSILIWRNTDDDF-HLALKRLFVGFAALGVSICGMlfaftaafflAY--GRAWQPILIA  307
            FLS++  R  + DF  L  ++L+VG   L ++I  M+  F+A  F+ +  G  W  IL+ 
Sbjct  523  FLSLVTPRYAEKDFLSLLPRKLYVGLGTLFIAIAAMMVVFSATSFIVFTDGSTWIAILVI  582

Query  306  AFVALPIASFLYLNARLWIDVVGSMLLK--LLPFTKQTTY  193
               ++P   F YL+ RL+ D++ S+ +   L+P  K + +
Sbjct  583  VVPSVPAILFFYLHFRLFDDILRSVFVSDYLIPKCKTSLF  622



>ref|XP_006490205.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X3 [Citrus sinensis]
Length=648

 Score =   162 bits (411),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 87/220 (40%), Positives = 136/220 (62%), Gaps = 5/220 (2%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S +AL  +RE+ WF  V+K+VP      +NK G TP+ LF ++H  LK   EK ++ TA
Sbjct  398  VSGSALQMQRELLWFQAVKKVVPRKLAEAKNKKGLTPRALFSEQHRDLKEKGEKWMKDTA  457

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
             SCMIVATLIATV F+AA T PGGN + TG+P F+   SF +F +S+ ++++ S +SI+ 
Sbjct  458  SSCMIVATLIATVVFAAALTVPGGNKEDTGLPFFLHNVSFKIFAVSNVISLVASTLSIVV  517

Query  477  FLSILIWRNTDDDF-HLALKRLFVGFAALGVSICGMlfaftaafflAY--GRAWQPILIA  307
            FLS++  R  + DF  L  ++L+VG   L ++I  M+  F+A  F+ +  G  W  IL+ 
Sbjct  518  FLSLVTPRYAEKDFLSLLPRKLYVGLGTLFIAIAAMMVVFSATSFIVFTDGSTWIAILVI  577

Query  306  AFVALPIASFLYLNARLWIDVVGSMLLK--LLPFTKQTTY  193
               ++P   F YL+ RL+ D++ S+ +   L+P  K + +
Sbjct  578  VVPSVPAILFFYLHFRLFDDILRSVFVSDYLIPKCKTSLF  617



>gb|KDO77348.1| hypothetical protein CISIN_1g003814mg [Citrus sinensis]
 gb|KDO77349.1| hypothetical protein CISIN_1g003814mg [Citrus sinensis]
 gb|KDO77350.1| hypothetical protein CISIN_1g003814mg [Citrus sinensis]
 gb|KDO77351.1| hypothetical protein CISIN_1g003814mg [Citrus sinensis]
Length=715

 Score =   163 bits (412),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 99/218 (45%), Positives = 133/218 (61%), Gaps = 4/218 (2%)
 Frame = -1

Query  834  STAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTAD  655
            S AAL   RE+ WF  +EK+V  S+   +N +G+TP  LF +EH +L    EK ++ TA 
Sbjct  497  SGAALQLRRELHWFKEIEKVVQPSYREAKNSEGRTPHILFSEEHRRLVREGEKWMKDTAS  556

Query  654  SCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILTF  475
            SCM+VATLIATV F+AAFT PGGNDD TG PIF+   SF VF +SDA+A+  S  SIL F
Sbjct  557  SCMVVATLIATVMFAAAFTVPGGNDDSTGRPIFLHYKSFMVFAVSDALALFCSATSILMF  616

Query  474  LSILIWRNTDDDF-HLALKRLFVGFAALGVSICGMlfaftaafflAYGR--AWQPILIAA  304
            LSI+  R  ++DF H    RL +G A L +SI  M+ AF A  F+  G    W  I IA 
Sbjct  617  LSIITSRYAEEDFVHSLPNRLIIGLATLFISIATMMAAFAATLFIVLGDDFVWIAIPIAT  676

Query  303  FVALPIASFLYLNARLWIDVVGSMLLKLLPFTKQTTYV  190
               +P++ F  L   L  D++ S L K   FT+++ ++
Sbjct  677  GACVPVSLFALLQFPLLSDMI-SHLYKYSIFTRRSNHL  713



>ref|XP_006490204.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X2 [Citrus sinensis]
Length=652

 Score =   162 bits (411),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 87/220 (40%), Positives = 136/220 (62%), Gaps = 5/220 (2%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S +AL  +RE+ WF  V+K+VP      +NK G TP+ LF ++H  LK   EK ++ TA
Sbjct  402  VSGSALQMQRELLWFQAVKKVVPRKLAEAKNKKGLTPRALFSEQHRDLKEKGEKWMKDTA  461

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
             SCMIVATLIATV F+AA T PGGN + TG+P F+   SF +F +S+ ++++ S +SI+ 
Sbjct  462  SSCMIVATLIATVVFAAALTVPGGNKEDTGLPFFLHNVSFKIFAVSNVISLVASTLSIVV  521

Query  477  FLSILIWRNTDDDF-HLALKRLFVGFAALGVSICGMlfaftaafflAY--GRAWQPILIA  307
            FLS++  R  + DF  L  ++L+VG   L ++I  M+  F+A  F+ +  G  W  IL+ 
Sbjct  522  FLSLVTPRYAEKDFLSLLPRKLYVGLGTLFIAIAAMMVVFSATSFIVFTDGSTWIAILVI  581

Query  306  AFVALPIASFLYLNARLWIDVVGSMLLK--LLPFTKQTTY  193
               ++P   F YL+ RL+ D++ S+ +   L+P  K + +
Sbjct  582  VVPSVPAILFFYLHFRLFDDILRSVFVSDYLIPKCKTSLF  621



>gb|AFK34707.1| unknown [Lotus japonicus]
Length=282

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 97/204 (48%), Positives = 129/204 (63%), Gaps = 3/204 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL    E+SWF  V+K++  S   M+N +  TP +LF +EH  L   AE     TA
Sbjct  63   VSGAALQMMLELSWFEEVKKMMLPSSLEMKNSEDLTPGELFTREHADLLKRAEAWKERTA  122

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
            +SCM+V+TLIAT  FSAAF+ PGGN+D TG P ++++ SF +F +SDA A+I S  SIL 
Sbjct  123  NSCMVVSTLIATGVFSAAFSLPGGNNDNTGSPNYLEKPSFLLFALSDATALISSSTSILI  182

Query  477  FLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfaftaafflAY--GRAWQPILIA  307
            FLSILI R  +DDF  +L  +L  G  AL +SI  M+ AF++AFF+ Y  G  W P LI+
Sbjct  183  FLSILISRYAEDDFLKSLPLKLISGLIALFISIISMMVAFSSAFFITYYHGLKWVPYLIS  242

Query  306  AFVALPIASFLYLNARLWIDVVGS  235
                LPI  F+YL   LW D+  S
Sbjct  243  GLAFLPIPLFIYLQFSLWSDIAYS  266



>ref|XP_006468495.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X2 [Citrus sinensis]
 ref|XP_006468496.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X3 [Citrus sinensis]
 ref|XP_006468497.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X4 [Citrus sinensis]
Length=715

 Score =   162 bits (411),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 99/218 (45%), Positives = 133/218 (61%), Gaps = 4/218 (2%)
 Frame = -1

Query  834  STAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTAD  655
            S AAL   RE+ WF  +EK+V  S+   +N +G+TP  LF +EH +L    EK ++ TA 
Sbjct  497  SGAALQLRRELHWFKEIEKVVQPSYREAKNSEGRTPHILFSEEHRRLVREGEKWMKDTAS  556

Query  654  SCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILTF  475
            SCM+VATLIATV F+AAFT PGGNDD TG PIF+   SF VF +SDA+A+  S  SIL F
Sbjct  557  SCMVVATLIATVMFAAAFTVPGGNDDSTGRPIFLHYKSFMVFAVSDALALFCSATSILMF  616

Query  474  LSILIWRNTDDDF-HLALKRLFVGFAALGVSICGMlfaftaafflAYGR--AWQPILIAA  304
            LSI+  R  ++DF H    RL +G A L +SI  M+ AF A  F+  G    W  I IA 
Sbjct  617  LSIITSRYAEEDFVHSLPNRLIIGLATLFISIATMMAAFAATLFIVLGDDFVWIAIPIAT  676

Query  303  FVALPIASFLYLNARLWIDVVGSMLLKLLPFTKQTTYV  190
               +P++ F  L   L  D++ S L K   FT+++ ++
Sbjct  677  GACVPVSLFALLQFPLLSDMI-SHLYKYSIFTRRSNHL  713



>ref|XP_010655716.1| PREDICTED: ankyrin-2-like isoform X4 [Vitis vinifera]
 ref|XP_010655717.1| PREDICTED: ankyrin-2-like isoform X4 [Vitis vinifera]
 ref|XP_010655718.1| PREDICTED: ankyrin-2-like isoform X4 [Vitis vinifera]
Length=678

 Score =   162 bits (411),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 125/201 (62%), Gaps = 3/201 (1%)
 Frame = -1

Query  834  STAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTAD  655
            S AAL   RE+ WF  VEKIV   +  +RN +GKTP+ LF++EH  L    EK ++ TA 
Sbjct  460  SGAALQLRRELHWFKEVEKIVQPLYREIRNSEGKTPQTLFMEEHKVLVREGEKWMKDTAA  519

Query  654  SCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILTF  475
            SCM+VATLIATV F+A FT PGG++  TGIPIF+KR SFTVF +SDA++ + S  SIL F
Sbjct  520  SCMLVATLIATVMFAAFFTVPGGDNGNTGIPIFLKRRSFTVFAVSDALSFVSSAASILMF  579

Query  474  LSILIWRNTDDDF-HLALKRLFVGFAALGVSICGMlfaftaafflAYGRAWQ--PILIAA  304
            LSIL  R  ++DF H    RL +G   L +S+  M+ AF A  FL  G       I IA 
Sbjct  580  LSILTSRYAEEDFLHSLPNRLTIGLGTLFISVATMMIAFCATLFLVLGHGLHQAKIPIAL  639

Query  303  FVALPIASFLYLNARLWIDVV  241
               +P++ F  L   L+ D+V
Sbjct  640  VACIPVSLFALLQFPLFADMV  660



>ref|XP_002523649.1| hypothetical protein RCOM_0892190 [Ricinus communis]
 gb|EEF38735.1| hypothetical protein RCOM_0892190 [Ricinus communis]
Length=233

 Score =   155 bits (391),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 123/202 (61%), Gaps = 3/202 (1%)
 Frame = -1

Query  834  STAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTAD  655
            S AAL   RE+ WF  VEKIV   +  M+N DG+TP+ LF  EH KLK   EK ++ TA 
Sbjct  18   SGAALQLRRELLWFKEVEKIVQPLYTEMKNFDGQTPECLFSIEHKKLKREGEKWMKETAS  77

Query  654  SCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILTF  475
            SCM+VATLIATV F+AAFT PGG ++ +G PIF+   SF  F ISDA+A+  S  SIL F
Sbjct  78   SCMLVATLIATVMFAAAFTVPGGTNENSGRPIFLHTRSFMAFVISDALALFSSATSILIF  137

Query  474  LSILIWRNTDDDF-HLALKRLFVGFAALGVSICGMlfaftaa--fflAYGRAWQPILIAA  304
            LSIL  R  ++DF H    +L +G A L +SI  M+ AFTA     L +G  W  + I  
Sbjct  138  LSILTSRYAEEDFLHSLPNKLIMGLATLFISITTMMVAFTATLFLVLRHGLEWTTLPIII  197

Query  303  FVALPIASFLYLNARLWIDVVG  238
               +P++ F  L   L +D+V 
Sbjct  198  VACIPVSLFASLQFPLVVDIVS  219



>ref|XP_008440886.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Cucumis 
melo]
Length=647

 Score =   162 bits (410),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 95/208 (46%), Positives = 131/208 (63%), Gaps = 8/208 (4%)
 Frame = -1

Query  840  RLSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGK-TPKQLFLKEHMKLKINAEKSIRG  664
            R+S A     RE+ WF  VE I   +   MR K GK TP++LF +EH +L   AE+ ++ 
Sbjct  426  RVSGAVFQMHRELLWFKEVEDIGERT---MRIKKGKQTPQELFTQEHRQLVKEAEQWVKS  482

Query  663  TADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSI  484
            TA+SCM+VATLIATV F+AAFT PGGN+D  G+P+F+    FTVF ISD++A+I S  +I
Sbjct  483  TANSCMLVATLIATVVFTAAFTVPGGNNDNNGVPLFLHHKWFTVFVISDSIALISSSTAI  542

Query  483  LTFLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfaftaafflAYGR---AWQPI  316
            L FLSIL  R  + DF   L   L  G   L +S+ GM+ AF+A  FL YG+   +W P+
Sbjct  543  LLFLSILTSRCVETDFLFWLPLELVFGLGFLFLSVLGMVLAFSACLFLHYGKDYFSWIPL  602

Query  315  LIAAFVALPIASFLYLNARLWIDVVGSM  232
            LI+    +PI+ F  L  +LW D + ++
Sbjct  603  LISGMAIVPISWFCMLQWKLWADGLAAL  630



>ref|XP_009790151.1| PREDICTED: uncharacterized protein LOC104237664 isoform X2 [Nicotiana 
sylvestris]
Length=695

 Score =   162 bits (410),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 95/204 (47%), Positives = 132/204 (65%), Gaps = 3/204 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  V+ IV +S+  MR+  G+TP  LF +EH +L    EK ++ TA
Sbjct  476  VSGAALQMQRELLWFKEVKTIVQASYKEMRDSKGRTPGMLFAEEHKELVKEGEKWMKETA  535

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
             SCM+VA LI TV F+A FT PGGN+D TG PIF+K  +F +F+I+DA+A+  S+ SIL 
Sbjct  536  SSCMLVAALITTVMFAAIFTVPGGNNDDTGTPIFLKEKTFILFSITDALALFSSVTSILM  595

Query  477  FLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAYGR--AWQPILIA  307
            FLSIL  R  ++DF   L KRL +GF  L V+I  ML AF+++FF+  G   AW  I +A
Sbjct  596  FLSILTSRYAEEDFLSTLPKRLILGFITLFVAIAAMLVAFSSSFFIVLGHQMAWIIIPVA  655

Query  306  AFVALPIASFLYLNARLWIDVVGS  235
               ++PI  F +L   L  D++ S
Sbjct  656  VLASIPITLFAFLQFPLLADMIRS  679



>ref|XP_006365060.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Solanum 
tuberosum]
Length=695

 Score =   162 bits (410),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 100/242 (41%), Positives = 149/242 (62%), Gaps = 15/242 (6%)
 Frame = -1

Query  930  ATQKEVVPANKKNDDQVEEEEDIMQESSAL----RL---STAALHYEREISWFMGVEKIV  772
             + K+++ + K  ++     E+I+  ++ L    RL   S AAL  +RE+ WF  VE IV
Sbjct  443  GSHKDIITSYKSTNN-----ENILHLAAKLAPTNRLGIVSGAALQMQRELLWFKEVETIV  497

Query  771  PSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTADSCMIVATLIATVAFSAAFTAP  592
             +S+  MR+  G+TP  LF +EH +L    EK ++ TA SCM+VA LI TV F+A FT P
Sbjct  498  QASYKEMRDSRGRTPGMLFTEEHKELVKEGEKWMKETASSCMLVAALITTVMFAAIFTVP  557

Query  591  GGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILTFLSILIWRNTDDDFHLAL-KRL  415
            GGN++ TG   F+K  +F +F++ DA+A+  S++SIL FLSIL  R  ++DF   L KRL
Sbjct  558  GGNNNDTGTAFFLKEKAFIIFSMMDALALFSSVISILMFLSILTSRYAEEDFLCTLPKRL  617

Query  414  FVGFAALGVSICGMlfaftaafflAYGR--AWQPILIAAFVALPIASFLYLNARLWIDVV  241
             +GF +L V+I  ML AF ++FF+  GR  AW  I +AA  ++P+  F +L   L  D++
Sbjct  618  IIGFISLFVAIAAMLVAFCSSFFIVLGRQMAWIIIPVAALASIPVTLFAFLQFPLLADMI  677

Query  240  GS  235
             S
Sbjct  678  TS  679



>gb|KCW75495.1| hypothetical protein EUGRSUZ_E04253 [Eucalyptus grandis]
Length=326

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 100/238 (42%), Positives = 142/238 (60%), Gaps = 5/238 (2%)
 Frame = -1

Query  930  ATQKEVVPANK-KNDDQVEEEEDIMQESSALRL-STAALHYEREISWFMGVEKIVPSSFH  757
              +K+++ A K +ND+ +      +     L++ S AAL  + E+ WF  VE IV  S+ 
Sbjct  74   GARKDMIAAYKDENDNNILHLAGKLAPRIQLKIDSGAALQMQEELLWFKEVEVIVQPSYR  133

Query  756  HMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTADSCMIVATLIATVAFSAAFTAPGGNDD  577
             M+N +GKTP  LF +EH +L+  AEK ++ TA SCM+VATLI T+AFSA FT PGGND+
Sbjct  134  EMKNSEGKTPYLLFTEEHKELRQEAEKWMKHTASSCMVVATLICTMAFSATFTIPGGNDN  193

Query  576  KTGIPIFIKRASFTVFTISDAVAMIFSMVSILTFLSILIWRNTDDDFHLAL-KRLFVGFA  400
             TG PIF+    F +FT+S A+A+  S  S+L FLSIL  R  ++DF  +L  RL +G  
Sbjct  194  NTGKPIFLHNRLFMIFTVSTALAVFSSATSVLMFLSILTSRYAEEDFLYSLPSRLVLGIG  253

Query  399  ALGVSICGMlfaftaafflAYGRAWQ--PILIAAFVALPIASFLYLNARLWIDVVGSM  232
            +L VSI  M+ AF A  F+  G  +    I IAAF +  +  F  L   L  D++G +
Sbjct  254  SLFVSIASMMVAFGATHFIFLGHDYARIAIPIAAFASGTVTLFALLQFPLLSDLIGHI  311



>gb|KDO77347.1| hypothetical protein CISIN_1g003814mg [Citrus sinensis]
Length=793

 Score =   163 bits (412),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 99/218 (45%), Positives = 133/218 (61%), Gaps = 4/218 (2%)
 Frame = -1

Query  834  STAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTAD  655
            S AAL   RE+ WF  +EK+V  S+   +N +G+TP  LF +EH +L    EK ++ TA 
Sbjct  575  SGAALQLRRELHWFKEIEKVVQPSYREAKNSEGRTPHILFSEEHRRLVREGEKWMKDTAS  634

Query  654  SCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILTF  475
            SCM+VATLIATV F+AAFT PGGNDD TG PIF+   SF VF +SDA+A+  S  SIL F
Sbjct  635  SCMVVATLIATVMFAAAFTVPGGNDDSTGRPIFLHYKSFMVFAVSDALALFCSATSILMF  694

Query  474  LSILIWRNTDDDF-HLALKRLFVGFAALGVSICGMlfaftaafflAYGR--AWQPILIAA  304
            LSI+  R  ++DF H    RL +G A L +SI  M+ AF A  F+  G    W  I IA 
Sbjct  695  LSIITSRYAEEDFVHSLPNRLIIGLATLFISIATMMAAFAATLFIVLGDDFVWIAIPIAT  754

Query  303  FVALPIASFLYLNARLWIDVVGSMLLKLLPFTKQTTYV  190
               +P++ F  L   L  D++ S L K   FT+++ ++
Sbjct  755  GACVPVSLFALLQFPLLSDMI-SHLYKYSIFTRRSNHL  791



>gb|KDP30536.1| hypothetical protein JCGZ_15245 [Jatropha curcas]
Length=722

 Score =   162 bits (410),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 98/201 (49%), Positives = 125/201 (62%), Gaps = 3/201 (1%)
 Frame = -1

Query  834  STAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTAD  655
            S AAL   RE+ WF  VEKIV   +  M+N +G+TP  LF  EH  LK   EK ++ T+ 
Sbjct  505  SGAALQLRRELLWFQEVEKIVQPLYSEMKNSEGQTPDCLFTMEHKTLKREGEKWMKDTSS  564

Query  654  SCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILTF  475
            SCM+VATLIATV F+A FT PGGND+KTG PIF++   F VF ISDAVA+  S  SIL F
Sbjct  565  SCMVVATLIATVMFAAVFTVPGGNDEKTGRPIFLQTRLFLVFVISDAVALFSSASSILIF  624

Query  474  LSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaa--fflAYGRAWQPILIAA  304
            LSIL  R  ++DF  +L  +L +G A L VSI  M+ AFTA     L++G AW  I +  
Sbjct  625  LSILTSRYAEEDFLQSLPNKLIMGLATLFVSITSMMIAFTATIFIILSHGLAWTTIPVVI  684

Query  303  FVALPIASFLYLNARLWIDVV  241
               +P+  F+ L   L  D+V
Sbjct  685  VACIPVYLFVSLQFPLVADIV  705



>emb|CBI30987.3| unnamed protein product [Vitis vinifera]
Length=702

 Score =   162 bits (409),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 125/201 (62%), Gaps = 3/201 (1%)
 Frame = -1

Query  834  STAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTAD  655
            S AAL   RE+ WF  VEKIV   +  +RN +GKTP+ LF++EH  L    EK ++ TA 
Sbjct  461  SGAALQLRRELHWFKEVEKIVQPLYREIRNSEGKTPQTLFMEEHKVLVREGEKWMKDTAA  520

Query  654  SCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILTF  475
            SCM+VATLIATV F+A FT PGG++  TGIPIF+KR SFTVF +SDA++ + S  SIL F
Sbjct  521  SCMLVATLIATVMFAAFFTVPGGDNGNTGIPIFLKRRSFTVFAVSDALSFVSSAASILMF  580

Query  474  LSILIWRNTDDDF-HLALKRLFVGFAALGVSICGMlfaftaafflAYGRAWQ--PILIAA  304
            LSIL  R  ++DF H    RL +G   L +S+  M+ AF A  FL  G       I IA 
Sbjct  581  LSILTSRYAEEDFLHSLPNRLTIGLGTLFISVATMMIAFCATLFLVLGHGLHQAKIPIAL  640

Query  303  FVALPIASFLYLNARLWIDVV  241
               +P++ F  L   L+ D+V
Sbjct  641  VACIPVSLFALLQFPLFADMV  661



>ref|XP_010655715.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X3 [Vitis vinifera]
Length=734

 Score =   162 bits (410),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 125/201 (62%), Gaps = 3/201 (1%)
 Frame = -1

Query  834  STAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTAD  655
            S AAL   RE+ WF  VEKIV   +  +RN +GKTP+ LF++EH  L    EK ++ TA 
Sbjct  516  SGAALQLRRELHWFKEVEKIVQPLYREIRNSEGKTPQTLFMEEHKVLVREGEKWMKDTAA  575

Query  654  SCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILTF  475
            SCM+VATLIATV F+A FT PGG++  TGIPIF+KR SFTVF +SDA++ + S  SIL F
Sbjct  576  SCMLVATLIATVMFAAFFTVPGGDNGNTGIPIFLKRRSFTVFAVSDALSFVSSAASILMF  635

Query  474  LSILIWRNTDDDF-HLALKRLFVGFAALGVSICGMlfaftaafflAYGRAWQ--PILIAA  304
            LSIL  R  ++DF H    RL +G   L +S+  M+ AF A  FL  G       I IA 
Sbjct  636  LSILTSRYAEEDFLHSLPNRLTIGLGTLFISVATMMIAFCATLFLVLGHGLHQAKIPIAL  695

Query  303  FVALPIASFLYLNARLWIDVV  241
               +P++ F  L   L+ D+V
Sbjct  696  VACIPVSLFALLQFPLFADMV  716



>ref|XP_006468494.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X1 [Citrus sinensis]
Length=793

 Score =   162 bits (411),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 99/218 (45%), Positives = 133/218 (61%), Gaps = 4/218 (2%)
 Frame = -1

Query  834  STAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTAD  655
            S AAL   RE+ WF  +EK+V  S+   +N +G+TP  LF +EH +L    EK ++ TA 
Sbjct  575  SGAALQLRRELHWFKEIEKVVQPSYREAKNSEGRTPHILFSEEHRRLVREGEKWMKDTAS  634

Query  654  SCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILTF  475
            SCM+VATLIATV F+AAFT PGGNDD TG PIF+   SF VF +SDA+A+  S  SIL F
Sbjct  635  SCMVVATLIATVMFAAAFTVPGGNDDSTGRPIFLHYKSFMVFAVSDALALFCSATSILMF  694

Query  474  LSILIWRNTDDDF-HLALKRLFVGFAALGVSICGMlfaftaafflAYGR--AWQPILIAA  304
            LSI+  R  ++DF H    RL +G A L +SI  M+ AF A  F+  G    W  I IA 
Sbjct  695  LSIITSRYAEEDFVHSLPNRLIIGLATLFISIATMMAAFAATLFIVLGDDFVWIAIPIAT  754

Query  303  FVALPIASFLYLNARLWIDVVGSMLLKLLPFTKQTTYV  190
               +P++ F  L   L  D++ S L K   FT+++ ++
Sbjct  755  GACVPVSLFALLQFPLLSDMI-SHLYKYSIFTRRSNHL  791



>ref|XP_004170708.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Cucumis 
sativus]
Length=258

 Score =   155 bits (391),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 95/205 (46%), Positives = 126/205 (61%), Gaps = 7/205 (3%)
 Frame = -1

Query  840  RLSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGK---TPKQLFLKEHMKLKINAEKSI  670
            R+S  AL  +RE+ W+  VEKIV       +  DG    TP++LF KEH +L+ + E+ +
Sbjct  16   RVSGPALQMQRELLWYKEVEKIVLPCQREAKCNDGSIQLTPRELFTKEHTELRKHGEEWM  75

Query  669  RGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMV  490
            + TA+SCM+VATLI TV F+AAFT PGGNDD+TG P    +  F VF ISDAVA++ S  
Sbjct  76   KNTANSCMLVATLITTVVFAAAFTVPGGNDDETGDPTLQTKNWFVVFVISDAVALLSSST  135

Query  489  SILTFLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAY---GRAWQ  322
            SIL FLSIL  R  +DDF  +L  +L  G   L +SI  M+  F+A FFL Y      W 
Sbjct  136  SILMFLSILTSRYREDDFLRSLPSKLLSGLVLLFISIVCMVVTFSATFFLLYRHPSNIWL  195

Query  321  PILIAAFVALPIASFLYLNARLWID  247
            P+ IAA   +P++ F  L  +L ID
Sbjct  196  PMTIAAMAIIPVSCFWGLQFKLSID  220



>ref|XP_010648914.1| PREDICTED: uncharacterized protein LOC100260982 [Vitis vinifera]
 ref|XP_010648918.1| PREDICTED: uncharacterized protein LOC100260982 [Vitis vinifera]
 ref|XP_010648922.1| PREDICTED: uncharacterized protein LOC100260982 [Vitis vinifera]
 ref|XP_010648925.1| PREDICTED: uncharacterized protein LOC100260982 [Vitis vinifera]
 ref|XP_010648930.1| PREDICTED: uncharacterized protein LOC100260982 [Vitis vinifera]
Length=768

 Score =   162 bits (409),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 126/201 (63%), Gaps = 3/201 (1%)
 Frame = -1

Query  834  STAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTAD  655
            S AA   +RE+ WF  VEKI+  S+  M+N+ G+TP+ LF +EH  L    EK ++ TA 
Sbjct  551  SGAAFQLQRELHWFKEVEKIIQPSYTEMKNEQGRTPQILFTEEHKDLVREGEKWMKDTAS  610

Query  654  SCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILTF  475
            SCM+VATLIATV F+AAF+ PGGNDD TG PIF+ + SF VF ISDA+A+  S  SIL F
Sbjct  611  SCMVVATLIATVMFAAAFSVPGGNDDDTGRPIFLTKKSFLVFAISDALALFSSATSILIF  670

Query  474  LSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAYGR--AWQPILIAA  304
            LSIL  R  ++DF  +L  RL +G A L +S+  M+ AF A  F+  G    W    +A 
Sbjct  671  LSILTSRYAEEDFLESLPNRLIIGLATLFISVATMMIAFCATLFIVLGPELVWVANPMAL  730

Query  303  FVALPIASFLYLNARLWIDVV  241
               +P+  F  L   L+ID++
Sbjct  731  VACVPVTLFPLLKFPLFIDMI  751



>ref|XP_006448683.1| hypothetical protein CICLE_v10014428mg [Citrus clementina]
 gb|ESR61923.1| hypothetical protein CICLE_v10014428mg [Citrus clementina]
Length=715

 Score =   161 bits (407),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 99/218 (45%), Positives = 132/218 (61%), Gaps = 4/218 (2%)
 Frame = -1

Query  834  STAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTAD  655
            S AAL   RE+ WF  +EK+V  S+   +N +G+TP  LF +EH +L    EK ++ TA 
Sbjct  497  SGAALQLRRELHWFKEIEKVVQPSYREAKNSEGRTPHILFSEEHRRLVREGEKWMKDTAS  556

Query  654  SCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILTF  475
            SCM+VATLIATV F+AAFT PGGNDD TG PIF    SF VF +SDA+A+  S  SIL F
Sbjct  557  SCMVVATLIATVMFAAAFTVPGGNDDSTGRPIFRHYKSFMVFAVSDALALFCSATSILMF  616

Query  474  LSILIWRNTDDDF-HLALKRLFVGFAALGVSICGMlfaftaafflAYGR--AWQPILIAA  304
            LSI+  R  ++DF H    RL +G A L +SI  M+ AF A  F+  G    W  I IA 
Sbjct  617  LSIITSRYAEEDFVHSLPNRLIIGLATLFISIATMMAAFAATLFIVLGDDFVWIAIPIAT  676

Query  303  FVALPIASFLYLNARLWIDVVGSMLLKLLPFTKQTTYV  190
               +P++ F  L   L  D++ S L K   FT+++ ++
Sbjct  677  GACVPVSLFALLQFPLLSDMI-SHLYKYSIFTRRSNHL  713



>ref|XP_010655713.1| PREDICTED: uncharacterized protein LOC100256559 isoform X1 [Vitis 
vinifera]
Length=775

 Score =   162 bits (409),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 125/201 (62%), Gaps = 3/201 (1%)
 Frame = -1

Query  834  STAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTAD  655
            S AAL   RE+ WF  VEKIV   +  +RN +GKTP+ LF++EH  L    EK ++ TA 
Sbjct  557  SGAALQLRRELHWFKEVEKIVQPLYREIRNSEGKTPQTLFMEEHKVLVREGEKWMKDTAA  616

Query  654  SCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILTF  475
            SCM+VATLIATV F+A FT PGG++  TGIPIF+KR SFTVF +SDA++ + S  SIL F
Sbjct  617  SCMLVATLIATVMFAAFFTVPGGDNGNTGIPIFLKRRSFTVFAVSDALSFVSSAASILMF  676

Query  474  LSILIWRNTDDDF-HLALKRLFVGFAALGVSICGMlfaftaafflAYGRAWQ--PILIAA  304
            LSIL  R  ++DF H    RL +G   L +S+  M+ AF A  FL  G       I IA 
Sbjct  677  LSILTSRYAEEDFLHSLPNRLTIGLGTLFISVATMMIAFCATLFLVLGHGLHQAKIPIAL  736

Query  303  FVALPIASFLYLNARLWIDVV  241
               +P++ F  L   L+ D+V
Sbjct  737  VACIPVSLFALLQFPLFADMV  757



>ref|XP_004145182.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Cucumis 
sativus]
Length=332

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 94/208 (45%), Positives = 127/208 (61%), Gaps = 8/208 (4%)
 Frame = -1

Query  840  RLSTAALHYEREISWFMGVEKIVPSSFHHMRNKD-GKTPKQLFLKEHMKLKINAEKSIRG  664
            R+S A     RE+ WF  VE I   +   MR K   KTP++LF +EH +L   AEK ++ 
Sbjct  111  RVSGAVFQMHRELLWFKEVEDIAERT---MRIKQRKKTPQELFTQEHRQLVKEAEKWVKS  167

Query  663  TADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSI  484
            TA+SCM+VATLIATV F+AAFT PGGN+D  G P+F+    F VF ISD++A+I S  +I
Sbjct  168  TANSCMLVATLIATVVFTAAFTVPGGNNDNNGFPLFLHHKWFIVFVISDSIALISSSTAI  227

Query  483  LTFLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfaftaafflAYGR---AWQPI  316
            L FLSIL  R  + DF   L   L  G   L +S+ GM+ AF+A  FL YG+   +W P+
Sbjct  228  LLFLSILTSRCVETDFLFWLPLELVFGLGFLFLSVLGMVLAFSACLFLHYGKDHFSWIPL  287

Query  315  LIAAFVALPIASFLYLNARLWIDVVGSM  232
            LI+    +PI  F  L  +LW D + ++
Sbjct  288  LISGMTIVPIFWFCMLQWKLWADGLAAL  315



>ref|XP_004153952.1| PREDICTED: uncharacterized protein LOC101208435, partial [Cucumis 
sativus]
Length=420

 Score =   158 bits (399),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 95/208 (46%), Positives = 129/208 (62%), Gaps = 9/208 (4%)
 Frame = -1

Query  840  RLSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGK------TPKQLFLKEHMKLKINAE  679
            R+S AAL  +RE+ WF  VEKIV  S   +++ D        TP+QLF ++H +L+   E
Sbjct  193  RVSGAALQMQREMLWFKEVEKIVLPSQLEVKSNDPDPSIPKLTPRQLFTEKHKRLRKEGE  252

Query  678  KSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIF  499
            + ++ TA+SCM+VATLI+TV F+AAFT PGGNDD TG PIF  +  F +F +SDA+A+  
Sbjct  253  EWMKNTANSCMLVATLISTVVFAAAFTVPGGNDDNTGTPIFQNKFWFAMFVVSDAIALFS  312

Query  498  SMVSILTFLSILIWRNTDDDF-HLALKRLFVGFAALGVSICGMlfaftaafflAYGRA--  328
            S  SIL FLSIL  R  ++DF H    +L  G A+L +SI  M  AF++ FFL Y  A  
Sbjct  313  SSTSILMFLSILTSRYAEEDFLHSLPSKLLFGLASLFISIVFMAVAFSSTFFLIYHNANI  372

Query  327  WQPILIAAFVALPIASFLYLNARLWIDV  244
              P ++ A   +PI  F  L   LWID+
Sbjct  373  SIPTMVTAMAIIPITCFCLLQFTLWIDI  400



>ref|XP_010655714.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X2 [Vitis vinifera]
Length=745

 Score =   161 bits (408),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 125/201 (62%), Gaps = 3/201 (1%)
 Frame = -1

Query  834  STAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTAD  655
            S AAL   RE+ WF  VEKIV   +  +RN +GKTP+ LF++EH  L    EK ++ TA 
Sbjct  527  SGAALQLRRELHWFKEVEKIVQPLYREIRNSEGKTPQTLFMEEHKVLVREGEKWMKDTAA  586

Query  654  SCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILTF  475
            SCM+VATLIATV F+A FT PGG++  TGIPIF+KR SFTVF +SDA++ + S  SIL F
Sbjct  587  SCMLVATLIATVMFAAFFTVPGGDNGNTGIPIFLKRRSFTVFAVSDALSFVSSAASILMF  646

Query  474  LSILIWRNTDDDF-HLALKRLFVGFAALGVSICGMlfaftaafflAYGRAWQ--PILIAA  304
            LSIL  R  ++DF H    RL +G   L +S+  M+ AF A  FL  G       I IA 
Sbjct  647  LSILTSRYAEEDFLHSLPNRLTIGLGTLFISVATMMIAFCATLFLVLGHGLHQAKIPIAL  706

Query  303  FVALPIASFLYLNARLWIDVV  241
               +P++ F  L   L+ D+V
Sbjct  707  VACIPVSLFALLQFPLFADMV  727



>ref|XP_004153946.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like, 
partial [Cucumis sativus]
Length=685

 Score =   160 bits (406),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 99/219 (45%), Positives = 126/219 (58%), Gaps = 9/219 (4%)
 Frame = -1

Query  840  RLSTAALHYEREISWFMGVEKIV-PSSFHHMRNKDGK-----TPKQLFLKEHMKLKINAE  679
            R++ AA   +RE+ WF  VEKIV PS      N         TP++LF + H  L+   E
Sbjct  458  RVTGAAFQMQRELLWFKEVEKIVLPSQLMGKSNDPNPQLSKLTPRELFTENHKDLRKAGE  517

Query  678  KSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIF  499
            + ++ TA+SCMIVA LI TV F+AAFT PGG DD TG PIF  +  FTVF ISDA A++ 
Sbjct  518  EWMKNTANSCMIVAALITTVVFAAAFTVPGGCDDNTGNPIFQHKPWFTVFVISDAAALVS  577

Query  498  SMVSILTFLSILIWRNTDDDF-HLALKRLFVGFAALGVSICGMlfaftaafflAYGRA--  328
            S  SIL F+SIL  R  +DDF H    RL +G  +L VSI  M+  FTA FFL Y  A  
Sbjct  578  SSTSILMFMSILTSRYAEDDFLHSLPSRLLIGLTSLFVSIVCMVVTFTATFFLLYQNAKL  637

Query  327  WQPILIAAFVALPIASFLYLNARLWIDVVGSMLLKLLPF  211
            W P+ +A    LP+  F  L  +LW+D   +  L    F
Sbjct  638  WVPLTVAVMTILPVCCFCRLQFKLWVDTFHNTYLSRFLF  676



>ref|XP_004153885.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Cucumis 
sativus]
 ref|XP_004169715.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Cucumis 
sativus]
 gb|KGN64474.1| hypothetical protein Csa_1G058090 [Cucumis sativus]
Length=702

 Score =   160 bits (406),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 101/217 (47%), Positives = 131/217 (60%), Gaps = 7/217 (3%)
 Frame = -1

Query  840  RLSTAALHYEREISWFMGVEKIV-PSSFHHMRNKDGK---TPKQLFLKEHMKLKINAEKS  673
            R+S AAL  +RE+ WF  VEKIV PS        D     TP +LF KEH  L+ + E+ 
Sbjct  449  RVSGAALQMQRELLWFKEVEKIVLPSQRGAKCEVDSLIKLTPCELFTKEHKDLRKDGEEW  508

Query  672  IRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSM  493
            ++ TA+SCM+V+TLIATV F+AAFT PGGND  +G PIF     FT+F ISDA  ++ S 
Sbjct  509  MKNTANSCMLVSTLIATVVFAAAFTVPGGNDGNSGTPIFQHEFWFTIFVISDAFGLVSSS  568

Query  492  VSILTFLSILIWRNTDDDF-HLALKRLFVGFAALGVSICGMlfaftaafflAYGRA--WQ  322
             SIL FLSIL  R  +DDF H    +L VG A+L +SI  M+ AF+A FF+ Y +   W 
Sbjct  569  TSILMFLSILTSRYAEDDFLHSLPSKLLVGIASLFISIVCMVIAFSATFFMLYNKKNMWI  628

Query  321  PILIAAFVALPIASFLYLNARLWIDVVGSMLLKLLPF  211
            P  + A   +PI+ F  L+  LWID   +  L  L F
Sbjct  629  PATVTAIAIVPISCFFALHFGLWIDTFHNTYLSRLLF  665



>ref|XP_004164876.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Cucumis 
sativus]
Length=689

 Score =   160 bits (406),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 99/219 (45%), Positives = 126/219 (58%), Gaps = 9/219 (4%)
 Frame = -1

Query  840  RLSTAALHYEREISWFMGVEKIV-PSSFHHMRNKDGK-----TPKQLFLKEHMKLKINAE  679
            R++ AA   +RE+ WF  VEKIV PS      N         TP++LF + H  L+   E
Sbjct  462  RVTGAAFQMQRELLWFKEVEKIVLPSQLMGKSNDPNPQLSKLTPRELFTENHKDLRKAGE  521

Query  678  KSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIF  499
            + ++ TA+SCMIVA LI TV F+AAFT PGG DD TG PIF  +  FTVF ISDA A++ 
Sbjct  522  EWMKNTANSCMIVAALITTVVFAAAFTVPGGCDDNTGNPIFQHKPWFTVFVISDAAALVS  581

Query  498  SMVSILTFLSILIWRNTDDDF-HLALKRLFVGFAALGVSICGMlfaftaafflAYGRA--  328
            S  SIL F+SIL  R  +DDF H    RL +G  +L VSI  M+  FTA FFL Y  A  
Sbjct  582  SSTSILMFMSILTSRYAEDDFLHSLPSRLLIGLTSLFVSIVCMVVTFTATFFLLYQNAKL  641

Query  327  WQPILIAAFVALPIASFLYLNARLWIDVVGSMLLKLLPF  211
            W P+ +A    LP+  F  L  +LW+D   +  L    F
Sbjct  642  WVPLTVAVMTILPVCCFCRLQFKLWVDTFHNTYLSRFLF  680



>ref|XP_008348005.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Malus 
domestica]
Length=553

 Score =   160 bits (404),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 96/212 (45%), Positives = 123/212 (58%), Gaps = 3/212 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  VEKIV   F  M+N  GKTP++LF  EH  L    E  ++ T 
Sbjct  335  VSGAALQMQRELVWFEEVEKIVQPPFIDMKNTQGKTPRELFTSEHEDLLRKGESWMKDTT  394

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
            +SCM+V+TLIATV FSAAF+ PGG DD  G P FIK  +F +F ISD VA+  S  +IL 
Sbjct  395  NSCMLVSTLIATVVFSAAFSIPGGIDDNKGTPNFIKEEAFLIFAISDGVALFSSSTAILM  454

Query  477  FLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfaftaa--fflAYGRAWQPILIA  307
            FL IL  R  ++DF  +L  +L VG  +L VSI  M+  F+ A      YG  W P LI 
Sbjct  455  FLYILTSRYAENDFLKSLPLKLMVGLTSLFVSITSMMVTFSTAFYLSCHYGLRWVPDLIF  514

Query  306  AFVALPIASFLYLNARLWIDVVGSMLLKLLPF  211
             F  +P+A F +L   L  D+  S     L F
Sbjct  515  IFAFVPVALFAFLQXPLLFDMFFSTYCSSLLF  546



>gb|KGN64472.1| hypothetical protein Csa_1G058070 [Cucumis sativus]
Length=715

 Score =   160 bits (406),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 99/219 (45%), Positives = 126/219 (58%), Gaps = 9/219 (4%)
 Frame = -1

Query  840  RLSTAALHYEREISWFMGVEKIV-PSSFHHMRNKDGK-----TPKQLFLKEHMKLKINAE  679
            R++ AA   +RE+ WF  VEKIV PS      N         TP++LF + H  L+   E
Sbjct  488  RVTGAAFQMQRELLWFKEVEKIVLPSQLMGKSNDPNPQLSKLTPRELFTENHKDLRKAGE  547

Query  678  KSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIF  499
            + ++ TA+SCMIVA LI TV F+AAFT PGG DD TG PIF  +  FTVF ISDA A++ 
Sbjct  548  EWMKNTANSCMIVAALITTVVFAAAFTVPGGCDDNTGNPIFQHKPWFTVFVISDAAALVS  607

Query  498  SMVSILTFLSILIWRNTDDDF-HLALKRLFVGFAALGVSICGMlfaftaafflAYGRA--  328
            S  SIL F+SIL  R  +DDF H    RL +G  +L VSI  M+  FTA FFL Y  A  
Sbjct  608  SSTSILMFMSILTSRYAEDDFLHSLPSRLLIGLTSLFVSIVCMVVTFTATFFLLYQNAKL  667

Query  327  WQPILIAAFVALPIASFLYLNARLWIDVVGSMLLKLLPF  211
            W P+ +A    LP+  F  L  +LW+D   +  L    F
Sbjct  668  WVPLTVAVMTILPVCCFCRLQFKLWVDTFHNTYLSRFLF  706



>ref|XP_008360874.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Malus 
domestica]
Length=553

 Score =   159 bits (403),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 96/212 (45%), Positives = 123/212 (58%), Gaps = 3/212 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  VEKIV   F  M+N  GKTP++LF  EH  L    E  ++ T 
Sbjct  335  VSGAALQMQRELVWFEEVEKIVQPPFIDMKNTQGKTPRELFTSEHEDLLRKGESWMKDTT  394

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
            +SCM+V+TLIATV FSAAF+ PGG DD  G P FIK  +F +F ISD VA+  S  +IL 
Sbjct  395  NSCMLVSTLIATVVFSAAFSIPGGIDDNKGTPNFIKEEAFLIFAISDGVALFSSSTAILM  454

Query  477  FLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfaftaa--fflAYGRAWQPILIA  307
            FL IL  R  ++DF  +L  +L VG  +L VSI  M+  F+ A      YG  W P LI 
Sbjct  455  FLYILTSRYAENDFLKSLPLKLMVGLTSLFVSITSMMVTFSTAFYLSCHYGLRWVPDLIF  514

Query  306  AFVALPIASFLYLNARLWIDVVGSMLLKLLPF  211
             F  +P+A F +L   L  D+  S     L F
Sbjct  515  IFAFVPVALFAFLQYPLLFDMFFSTYCSSLLF  546



>ref|XP_010317038.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Solanum 
lycopersicum]
Length=701

 Score =   160 bits (405),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 100/242 (41%), Positives = 147/242 (61%), Gaps = 15/242 (6%)
 Frame = -1

Query  930  ATQKEVVPANKKNDDQVEEEEDIMQESSAL----RL---STAALHYEREISWFMGVEKIV  772
             + K+++ + K  ++     E+I+  ++ L    RL   S AAL  +RE+ WF  VE IV
Sbjct  449  GSHKDIITSYKSTNN-----ENILHLAAKLAPINRLGIVSGAALQMQRELLWFKEVETIV  503

Query  771  PSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTADSCMIVATLIATVAFSAAFTAP  592
             +S+  MR+  G+TP  LF +EH +L    EK ++ TA SCM+VA LI TV F+A FT P
Sbjct  504  QASYKEMRDSKGRTPGMLFTEEHKELIKEGEKWMKETASSCMLVAALITTVMFAAIFTVP  563

Query  591  GGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILTFLSILIWRNTDDDFHLAL-KRL  415
            GGN++ TG  IF+K  +F +F++ DA+A+  S++SIL FLSIL  R  ++DF   L KRL
Sbjct  564  GGNNNDTGTAIFLKEKAFIIFSMMDALALFSSVISILMFLSILTSRYAEEDFLCTLPKRL  623

Query  414  FVGFAALGVSICGMlfaftaafflAYGR--AWQPILIAAFVALPIASFLYLNARLWIDVV  241
             +GF  L V+I  ML AF ++FF+  G    W  I +AA  ++PI  F +L   L  D++
Sbjct  624  IIGFITLFVAIAAMLVAFCSSFFIVLGHQMTWIVIPVAALASIPITLFAFLQFPLLADMI  683

Query  240  GS  235
             S
Sbjct  684  TS  685



>ref|XP_010260577.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X2 [Nelumbo nucifera]
Length=412

 Score =   157 bits (398),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 95/226 (42%), Positives = 134/226 (59%), Gaps = 3/226 (1%)
 Frame = -1

Query  903  NKKNDDQVEEEEDIMQESSALRLSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPK  724
            +  N++ +    ++   S    +S AAL  +RE  WF  VEK++   +  M+N +GKTP+
Sbjct  171  DGNNNNMLHLAGNLAPSSRLNTISGAALQMQREHQWFKEVEKVMQPLYMEMKNSEGKTPR  230

Query  723  QLFLKEHMKLKINAEKSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRA  544
             LF ++H  L    EK ++ TA SCMIVATLIATV F+AAFT PGGN D  GIP+F++  
Sbjct  231  TLFTEKHANLVKEGEKWMKDTASSCMIVATLIATVVFAAAFTVPGGNYDDKGIPVFLEVR  290

Query  543  SFTVFTISDAVAMIFSMVSILTFLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlf  367
            SF VF ISDA+A+  S+ S+L FLSIL  R   +DF   L +R+ +G   L VSI  M+ 
Sbjct  291  SFIVFAISDALALFSSITSVLMFLSILTSRYAAEDFLETLPRRMVLGLTTLFVSIATMVI  350

Query  366  aftaafflAYGRA--WQPILIAAFVALPIASFLYLNARLWIDVVGS  235
            AF+A  F+       W  I IA    +P+  F  L   L++D++ S
Sbjct  351  AFSATLFIVLRSRLDWIAIPIAILACVPVTMFALLQFPLFMDIIHS  396



>ref|XP_004145192.1| PREDICTED: uncharacterized protein LOC101213772 [Cucumis sativus]
Length=730

 Score =   160 bits (405),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 100/219 (46%), Positives = 135/219 (62%), Gaps = 17/219 (8%)
 Frame = -1

Query  840  RLSTAALHYEREISWFMGVEKIVPSSFHHMR-------------NK-DGKTPKQLFLKEH  703
            R+S AAL  +RE+ WF  VEKIV SS+  MR             N+ D  TP++LF KEH
Sbjct  496  RVSGAALQMQRELLWFTEVEKIVVSSYLQMRATIPLPPQAGTEENRFDELTPRELFTKEH  555

Query  702  MKLKINAEKSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTI  523
              L    E+ ++ TA+SCM+VATLIATV F+AAFT PGGNDDK+G P F +  +FTVF I
Sbjct  556  KNLLKAGEEWMKNTANSCMLVATLIATVVFAAAFTVPGGNDDKSGTPNFRQNPAFTVFVI  615

Query  522  SDAVAMIFSMVSILTFLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfaftaaff  346
            SD  A++ S  SILTFLSIL  R  ++DF ++L  +L  G   L +SI  M+ AF+A FF
Sbjct  616  SDVAALVLSTTSILTFLSILTSRYAEEDFLMSLPLKLLFGLVTLFLSISCMVVAFSATFF  675

Query  345  lAYGRAWQ--PILIAAFVALPIASFLYLNARLWIDVVGS  235
            +AY +     P+ IA    +P+  F   + +L +D+  S
Sbjct  676  IAYDKTKHKIPLGIAIVSIVPVGCFCLFHTKLVVDIFRS  714



>ref|XP_010251695.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X1 [Nelumbo nucifera]
 ref|XP_010251696.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X1 [Nelumbo nucifera]
Length=625

 Score =   159 bits (403),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 96/206 (47%), Positives = 129/206 (63%), Gaps = 7/206 (3%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  +EK V        N +GKTP+  F +EHM L    EK ++ TA
Sbjct  404  VSGAALQMQRELQWFKEIEKFVSPHCKEETNNEGKTPRAAFGEEHMDLVEKGEKWMKDTA  463

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
             SCMIVATLIATV F+AAFT PGGN D  G PIF++  SF +F ISD +A+  S+ S+L 
Sbjct  464  TSCMIVATLIATVVFAAAFTVPGGNIDGKGTPIFLEETSFMIFLISDTIALFSSITSVLM  523

Query  477  FLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAYG----RAWQPIL  313
            FL+IL  R   DDF  +L K+L +G A L +SI GM+ AF++A F+  G    R   PI+
Sbjct  524  FLAILTARYAVDDFLESLPKKLIIGLATLFISIAGMVIAFSSALFIILGDQKKRLITPII  583

Query  312  IAAFVALPIASFLYLNARLWIDVVGS  235
            +  F  LP+ SF  L   L+I+++ S
Sbjct  584  L--FACLPVTSFGLLEFPLFIEIIFS  607



>ref|XP_008219093.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Prunus 
mume]
 ref|XP_008219094.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Prunus 
mume]
Length=635

 Score =   159 bits (403),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 104/243 (43%), Positives = 141/243 (58%), Gaps = 7/243 (3%)
 Frame = -1

Query  921  KEVVPANKKNDDQVEEEEDIMQESSALRL---STAALHYEREISWFMGVEKIVPSSFHHM  751
            KE++ ++K ND+         + + A+RL   + AAL   RE+ WF  VEKIV   +  M
Sbjct  386  KELIASDKDNDNN-NMLHLAAKLAPAIRLNDDTGAALKLRRELLWFKEVEKIVQPLYKEM  444

Query  750  RNKDGKTPKQLFLKEHMKLKINAEKSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKT  571
            RN  GKTP+ LF +EH +L    E  ++GTA SCM+VATLIATV F+A  T PGGN++ T
Sbjct  445  RNSIGKTPQILFTEEHKELLREGEVWMKGTASSCMVVATLIATVMFAAFSTVPGGNNNDT  504

Query  570  GIPIFIKRASFTVFTISDAVAMIFSMVSILTFLSILIWRNTDDDF-HLALKRLFVGFAAL  394
            GIPIF++  +F VF ISDAV++I S  SIL+FLSIL  R  + DF H    RL VG A L
Sbjct  505  GIPIFLQSRAFIVFAISDAVSLISSAASILSFLSILTSRYAEGDFLHSLPNRLIVGLATL  564

Query  393  GVSICGMlfaftaafflAYGRAWQPI--LIAAFVALPIASFLYLNARLWIDVVGSMLLKL  220
             +SI  M+  F A  F+  G  +  I   IA    +P+  +  L   L  D+V    +  
Sbjct  565  FISITAMMITFVATVFIVLGSEFHGIKVPIALVAGVPVGFYALLQFPLLADMVSHAYISR  624

Query  219  LPF  211
            + F
Sbjct  625  VSF  627



>ref|XP_008440605.1| PREDICTED: LOW QUALITY PROTEIN: ankyrin repeat-containing protein 
At3g12360-like [Cucumis melo]
Length=716

 Score =   160 bits (404),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 99/219 (45%), Positives = 126/219 (58%), Gaps = 9/219 (4%)
 Frame = -1

Query  840  RLSTAALHYEREISWFMGVEKIV-PSSFHHMRNKDGK-----TPKQLFLKEHMKLKINAE  679
            R++ AA   +RE+ WF  VEKIV PS      N         TP++LF + H  L+   E
Sbjct  489  RVTGAAFQMQRELLWFKEVEKIVLPSQLMAKSNDPNPQLSKLTPRELFTENHKDLRKAGE  548

Query  678  KSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIF  499
            + ++ TA+SCMIVA LI TV F+AAFT PGG DD TG PIF  +  FTVF ISDA A++ 
Sbjct  549  EWMKXTANSCMIVAALITTVVFAAAFTVPGGCDDNTGNPIFQHKPWFTVFVISDAAALVS  608

Query  498  SMVSILTFLSILIWRNTDDDF-HLALKRLFVGFAALGVSICGMlfaftaafflAYGRA--  328
            S  SIL F+SIL  R  +DDF H    RL +G  +L VSI  M+  FTA FFL Y  A  
Sbjct  609  SSTSILMFMSILTSRYAEDDFLHSLPSRLLIGLTSLFVSIVCMVVTFTATFFLLYQNAKL  668

Query  327  WQPILIAAFVALPIASFLYLNARLWIDVVGSMLLKLLPF  211
            W P+ +A    LP+  F  L  +LW+D   +  L    F
Sbjct  669  WVPLTVAVMTILPVCCFCRLQFKLWVDTFHNTYLSRFLF  707



>ref|XP_004145199.1| PREDICTED: uncharacterized protein LOC101215460 [Cucumis sativus]
Length=652

 Score =   159 bits (403),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 95/208 (46%), Positives = 129/208 (62%), Gaps = 9/208 (4%)
 Frame = -1

Query  840  RLSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGK------TPKQLFLKEHMKLKINAE  679
            R+S AAL  +RE+ WF  VEKIV  S   +++ D        TP+QLF ++H +L+   E
Sbjct  425  RVSGAALQMQREMLWFKEVEKIVLPSQLEVKSNDPDPSIPKLTPRQLFTEKHKRLRKEGE  484

Query  678  KSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIF  499
            + ++ TA+SCM+VATLI+TV F+AAFT PGGNDD TG PIF  +  F +F +SDA+A+  
Sbjct  485  EWMKNTANSCMLVATLISTVVFAAAFTVPGGNDDNTGTPIFQNKFWFAMFVVSDAIALFS  544

Query  498  SMVSILTFLSILIWRNTDDDF-HLALKRLFVGFAALGVSICGMlfaftaafflAYGRA--  328
            S  SIL FLSIL  R  ++DF H    +L  G A+L +SI  M  AF++ FFL Y  A  
Sbjct  545  SSTSILMFLSILTSRYAEEDFLHSLPSKLLFGLASLFISIVFMAVAFSSTFFLIYHNANI  604

Query  327  WQPILIAAFVALPIASFLYLNARLWIDV  244
              P ++ A   +PI  F  L   LWID+
Sbjct  605  SIPTMVTAMAIIPITCFCLLQFTLWIDI  632



>ref|XP_008440631.1| PREDICTED: uncharacterized protein LOC103484989 isoform X1 [Cucumis 
melo]
Length=654

 Score =   159 bits (402),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 95/208 (46%), Positives = 129/208 (62%), Gaps = 9/208 (4%)
 Frame = -1

Query  840  RLSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGK------TPKQLFLKEHMKLKINAE  679
            R+S AAL  +RE+ WF  VEKIV  S   +++ D        TP+QLF ++H +L+   E
Sbjct  427  RVSGAALQMQREMLWFKEVEKIVLPSQLEVKSNDPDPSIPKLTPRQLFTEKHKRLRKEGE  486

Query  678  KSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIF  499
            + ++ TA+SCM+VATLI+TV F+AAFT PGGNDD TG PIF  +  F +F +SDA+A+  
Sbjct  487  EWMKNTANSCMLVATLISTVVFAAAFTVPGGNDDNTGTPIFQNKFWFAMFVVSDAIALFS  546

Query  498  SMVSILTFLSILIWRNTDDDF-HLALKRLFVGFAALGVSICGMlfaftaafflAYGRA--  328
            S  SIL FLSIL  R  ++DF H    +L  G A+L +SI  M  AF++ FFL Y  A  
Sbjct  547  SSTSILMFLSILTSRYAEEDFLHSLPSKLLFGLASLFISIVFMAIAFSSTFFLIYHNANI  606

Query  327  WQPILIAAFVALPIASFLYLNARLWIDV  244
              P ++ A   +PI  F  L   LWID+
Sbjct  607  SIPTMVTAMAIIPITCFCLLQFTLWIDI  634



>ref|XP_009610229.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X2 [Nicotiana tomentosiformis]
Length=690

 Score =   159 bits (403),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 94/204 (46%), Positives = 131/204 (64%), Gaps = 3/204 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  V+ IV +S+  MR+  G+TP  LF +EH +L    EK ++ TA
Sbjct  471  VSGAALQMQRELLWFKEVKTIVQASYKEMRDLKGRTPGMLFAEEHKELVKEGEKWMKETA  530

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
             SCM+VA LI TV F+A FT PGGN+D TG PIF+K  +F +F+I+DA+A+  S+ SIL 
Sbjct  531  SSCMLVAALITTVMFAAIFTVPGGNNDDTGTPIFLKEKTFILFSITDALALFSSVTSILM  590

Query  477  FLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAYGR--AWQPILIA  307
            FLSIL  R  ++DF   L KRL +GF  L V+I  ML AF+++FF+  G   AW    +A
Sbjct  591  FLSILTSRYAEEDFLSTLPKRLILGFITLFVAIAAMLVAFSSSFFIVLGHQMAWIITPVA  650

Query  306  AFVALPIASFLYLNARLWIDVVGS  235
               ++PI  F +L   L  D++ S
Sbjct  651  VLASIPITLFAFLQFPLLADMIRS  674



>ref|XP_009610228.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X1 [Nicotiana tomentosiformis]
Length=692

 Score =   159 bits (403),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 101/240 (42%), Positives = 147/240 (61%), Gaps = 15/240 (6%)
 Frame = -1

Query  924  QKEVVPANKKNDDQVEEEEDIMQESSAL----RL---STAALHYEREISWFMGVEKIVPS  766
             K+++ + K  ++     E+I+  ++ L    RL   S AAL  +RE+ WF  V+ IV +
Sbjct  442  HKDIITSYKSRNN-----ENILHLAAKLAPTNRLGIVSGAALQMQRELLWFKEVKTIVQA  496

Query  765  SFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTADSCMIVATLIATVAFSAAFTAPGG  586
            S+  MR+  G+TP  LF +EH +L    EK ++ TA SCM+VA LI TV F+A FT PGG
Sbjct  497  SYKEMRDLKGRTPGMLFAEEHKELVKEGEKWMKETASSCMLVAALITTVMFAAIFTVPGG  556

Query  585  NDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILTFLSILIWRNTDDDFHLAL-KRLFV  409
            N+D TG PIF+K  +F +F+I+DA+A+  S+ SIL FLSIL  R  ++DF   L KRL +
Sbjct  557  NNDDTGTPIFLKEKTFILFSITDALALFSSVTSILMFLSILTSRYAEEDFLSTLPKRLIL  616

Query  408  GFAALGVSICGMlfaftaafflAYGR--AWQPILIAAFVALPIASFLYLNARLWIDVVGS  235
            GF  L V+I  ML AF+++FF+  G   AW    +A   ++PI  F +L   L  D++ S
Sbjct  617  GFITLFVAIAAMLVAFSSSFFIVLGHQMAWIITPVAVLASIPITLFAFLQFPLLADMIRS  676



>ref|XP_007024884.1| Ankyrin repeat-containing protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY27506.1| Ankyrin repeat-containing protein, putative isoform 1 [Theobroma 
cacao]
Length=709

 Score =   159 bits (403),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 93/204 (46%), Positives = 128/204 (63%), Gaps = 3/204 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  VEK V   +  MR+ +G+TP+ LF +EH KL    EK ++ TA
Sbjct  498  VSGAALQMQRELLWFKEVEKNVQPLYKEMRDINGRTPRMLFTEEHAKLVKEGEKWMKSTA  557

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
             SCM+VATLI TV F+A FT PGGND++ G P+F++  SF +F ISDA+A+  S+ SIL 
Sbjct  558  SSCMLVATLITTVMFAAIFTVPGGNDNEKGTPLFLEAKSFIIFAISDALALFSSVTSILM  617

Query  477  FLSILIWRNTDDDF-HLALKRLFVGFAALGVSICGMlfaftaafflAYGR--AWQPILIA  307
            FLSIL  R  ++DF  L  +RL VG A L +SI  ML AF A F +   +  AW  +  A
Sbjct  618  FLSILTSRYAEEDFLRLLPQRLIVGLATLFLSIAAMLVAFGATFCIVLSQRLAWIAVPAA  677

Query  306  AFVALPIASFLYLNARLWIDVVGS  235
                +P+  F +L   L +D++ S
Sbjct  678  LIACIPVTLFAFLQFPLLVDMIQS  701



>emb|CBI27188.3| unnamed protein product [Vitis vinifera]
Length=1855

 Score =   162 bits (411),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 126/201 (63%), Gaps = 3/201 (1%)
 Frame = -1

Query  834  STAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTAD  655
            S AA   +RE+ WF  VEKI+  S+  M+N+ G+TP+ LF +EH  L    EK ++ TA 
Sbjct  483  SGAAFQLQRELHWFKEVEKIIQPSYTEMKNEQGRTPQILFTEEHKDLVREGEKWMKDTAS  542

Query  654  SCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILTF  475
            SCM+VATLIATV F+AAF+ PGGNDD TG PIF+ + SF VF ISDA+A+  S  SIL F
Sbjct  543  SCMVVATLIATVMFAAAFSVPGGNDDDTGRPIFLTKKSFLVFAISDALALFSSATSILIF  602

Query  474  LSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAYGR--AWQPILIAA  304
            LSIL  R  ++DF  +L  RL +G A L +S+  M+ AF A  F+  G    W    +A 
Sbjct  603  LSILTSRYAEEDFLESLPNRLIIGLATLFISVATMMIAFCATLFIVLGPELVWVANPMAL  662

Query  303  FVALPIASFLYLNARLWIDVV  241
               +P+  F  L   L+ID++
Sbjct  663  VACVPVTLFPLLKFPLFIDMI  683



>ref|XP_004291593.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Fragaria 
vesca subsp. vesca]
Length=615

 Score =   159 bits (401),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 96/238 (40%), Positives = 136/238 (57%), Gaps = 3/238 (1%)
 Frame = -1

Query  915  VVPANKKNDDQVEEEEDIMQESSALRLSTAALHYEREISWFMGVEKIVPSSFHHMRNKDG  736
            V   +K+ ++ V     +  ++    +S  AL  +RE+ WF  V+KIV   +  M NK G
Sbjct  370  VTYEDKEGNNIVHMAAKVAPQNQLNLVSGVALQMQRELVWFEEVKKIVQPQYIEMENKKG  429

Query  735  KTPKQLFLKEHMKLKINAEKSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIF  556
            KTP++LF KEH  L    EK ++ TA SC++VAT+IATV FSAAF+ PGG DDKTG P F
Sbjct  430  KTPQELFTKEHRTLMRQGEKWMKETATSCLLVATIIATVVFSAAFSIPGGTDDKTGKPNF  489

Query  555  IKRASFTVFTISDAVAMIFSMVSILTFLSILIWRNTDDDFHLALK-RLFVGFAALGVSIC  379
            +   +F  FTI+D VA+  S  ++L FL IL  R  ++DF ++L  +L VG + L +SI 
Sbjct  490  LTEKAFLYFTIADGVALFSSSTAMLMFLFILTSRYAENDFLMSLPLKLMVGLSCLFISIA  549

Query  378  GMlfaftaa--fflAYGRAWQPILIAAFVALPIASFLYLNARLWIDVVGSMLLKLLPF  211
             M+ AF+ A      YG  W P L   F  +P+A + +L   L  D+  S     L F
Sbjct  550  SMMMAFSTAFYLSCQYGSKWVPDLTFFFAIVPVALYAFLQFPLVSDMSSSTFCSSLLF  607



>ref|XP_007024885.1| Ankyrin repeat-containing protein, putative isoform 2 [Theobroma 
cacao]
 gb|EOY27507.1| Ankyrin repeat-containing protein, putative isoform 2 [Theobroma 
cacao]
Length=715

 Score =   159 bits (402),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 93/204 (46%), Positives = 128/204 (63%), Gaps = 3/204 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  VEK V   +  MR+ +G+TP+ LF +EH KL    EK ++ TA
Sbjct  504  VSGAALQMQRELLWFKEVEKNVQPLYKEMRDINGRTPRMLFTEEHAKLVKEGEKWMKSTA  563

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
             SCM+VATLI TV F+A FT PGGND++ G P+F++  SF +F ISDA+A+  S+ SIL 
Sbjct  564  SSCMLVATLITTVMFAAIFTVPGGNDNEKGTPLFLEAKSFIIFAISDALALFSSVTSILM  623

Query  477  FLSILIWRNTDDDF-HLALKRLFVGFAALGVSICGMlfaftaafflAYGR--AWQPILIA  307
            FLSIL  R  ++DF  L  +RL VG A L +SI  ML AF A F +   +  AW  +  A
Sbjct  624  FLSILTSRYAEEDFLRLLPQRLIVGLATLFLSIAAMLVAFGATFCIVLSQRLAWIAVPAA  683

Query  306  AFVALPIASFLYLNARLWIDVVGS  235
                +P+  F +L   L +D++ S
Sbjct  684  LIACIPVTLFAFLQFPLLVDMIQS  707



>ref|XP_010260576.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X1 [Nelumbo nucifera]
Length=460

 Score =   157 bits (397),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 95/226 (42%), Positives = 134/226 (59%), Gaps = 3/226 (1%)
 Frame = -1

Query  903  NKKNDDQVEEEEDIMQESSALRLSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPK  724
            +  N++ +    ++   S    +S AAL  +RE  WF  VEK++   +  M+N +GKTP+
Sbjct  219  DGNNNNMLHLAGNLAPSSRLNTISGAALQMQREHQWFKEVEKVMQPLYMEMKNSEGKTPR  278

Query  723  QLFLKEHMKLKINAEKSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRA  544
             LF ++H  L    EK ++ TA SCMIVATLIATV F+AAFT PGGN D  GIP+F++  
Sbjct  279  TLFTEKHANLVKEGEKWMKDTASSCMIVATLIATVVFAAAFTVPGGNYDDKGIPVFLEVR  338

Query  543  SFTVFTISDAVAMIFSMVSILTFLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlf  367
            SF VF ISDA+A+  S+ S+L FLSIL  R   +DF   L +R+ +G   L VSI  M+ 
Sbjct  339  SFIVFAISDALALFSSITSVLMFLSILTSRYAAEDFLETLPRRMVLGLTTLFVSIATMVI  398

Query  366  aftaafflAYGRA--WQPILIAAFVALPIASFLYLNARLWIDVVGS  235
            AF+A  F+       W  I IA    +P+  F  L   L++D++ S
Sbjct  399  AFSATLFIVLRSRLDWIAIPIAILACVPVTMFALLQFPLFMDIIHS  444



>ref|XP_010090151.1| Ankyrin repeat-containing protein [Morus notabilis]
 gb|EXB38948.1| Ankyrin repeat-containing protein [Morus notabilis]
Length=881

 Score =   160 bits (406),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 89/206 (43%), Positives = 133/206 (65%), Gaps = 4/206 (2%)
 Frame = -1

Query  843  LRLSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRG  664
            L +S+ AL  +RE+ WF  VEK++     ++++KDG+TP+++F KEH  L    EK ++ 
Sbjct  485  LSVSSPALQMQRELQWFRAVEKLINPCLTNLKDKDGRTPREIFTKEHKTLAEAGEKWMKD  544

Query  663  TADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSI  484
            T++SCMIV+TLIAT  F+AAFT PGGND+  G+PIF+   SF VF +SDA+A+  S+ S+
Sbjct  545  TSNSCMIVSTLIATFVFAAAFTVPGGNDE-AGLPIFLWTQSFLVFVVSDALALFSSITSL  603

Query  483  LTFLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAYGRA--WQPIL  313
            L F SIL  R  +DDFH+ L K+L +G A+L  SI  M+ AF A   +   +   W  I 
Sbjct  604  LIFFSILTARYAEDDFHMLLPKKLIIGLASLFFSIATMMVAFGATLLIVLSKRVDWVAIP  663

Query  312  IAAFVALPIASFLYLNARLWIDVVGS  235
            I    ++P++ F+ L   L+I++  S
Sbjct  664  IILLASVPVSIFVLLQFPLFIEMYRS  689



>emb|CAN68568.1| hypothetical protein VITISV_029434 [Vitis vinifera]
Length=1697

 Score =   162 bits (409),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 126/201 (63%), Gaps = 3/201 (1%)
 Frame = -1

Query  834  STAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTAD  655
            S AA   +RE+ WF  VEKI+  S+  M+N+ G+TP+ LF +EH  L    EK ++ TA 
Sbjct  548  SGAAFQLQRELHWFKEVEKIIQPSYTEMKNEQGRTPQILFTEEHKDLVREGEKWMKDTAS  607

Query  654  SCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILTF  475
            SCM+VATLIATV F+AAF+ PGGNDD TG PIF+ + SF VF ISDA+A+  S  SIL F
Sbjct  608  SCMVVATLIATVMFAAAFSVPGGNDDDTGRPIFLTKKSFLVFAISDALALFSSATSILIF  667

Query  474  LSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAYGR--AWQPILIAA  304
            LSIL  R  ++DF  +L  RL +G A L +S+  M+ AF A  F+  G    W    +A 
Sbjct  668  LSILTSRYAEEDFLESLPNRLIIGLATLFISVATMMIAFCATLFIVLGPELVWVANPMAL  727

Query  303  FVALPIASFLYLNARLWIDVV  241
               +P+  F  L   L+ID++
Sbjct  728  VACVPVTLFPLLKFPLFIDMI  748



>ref|XP_008440640.1| PREDICTED: uncharacterized protein LOC103484989 isoform X2 [Cucumis 
melo]
Length=589

 Score =   158 bits (399),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 95/208 (46%), Positives = 129/208 (62%), Gaps = 9/208 (4%)
 Frame = -1

Query  840  RLSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGK------TPKQLFLKEHMKLKINAE  679
            R+S AAL  +RE+ WF  VEKIV  S   +++ D        TP+QLF ++H +L+   E
Sbjct  362  RVSGAALQMQREMLWFKEVEKIVLPSQLEVKSNDPDPSIPKLTPRQLFTEKHKRLRKEGE  421

Query  678  KSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIF  499
            + ++ TA+SCM+VATLI+TV F+AAFT PGGNDD TG PIF  +  F +F +SDA+A+  
Sbjct  422  EWMKNTANSCMLVATLISTVVFAAAFTVPGGNDDNTGTPIFQNKFWFAMFVVSDAIALFS  481

Query  498  SMVSILTFLSILIWRNTDDDF-HLALKRLFVGFAALGVSICGMlfaftaafflAYGRA--  328
            S  SIL FLSIL  R  ++DF H    +L  G A+L +SI  M  AF++ FFL Y  A  
Sbjct  482  SSTSILMFLSILTSRYAEEDFLHSLPSKLLFGLASLFISIVFMAIAFSSTFFLIYHNANI  541

Query  327  WQPILIAAFVALPIASFLYLNARLWIDV  244
              P ++ A   +PI  F  L   LWID+
Sbjct  542  SIPTMVTAMAIIPITCFCLLQFTLWIDI  569



>ref|XP_004145202.1| PREDICTED: uncharacterized protein LOC101216177 [Cucumis sativus]
Length=1316

 Score =   161 bits (407),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 99/219 (45%), Positives = 126/219 (58%), Gaps = 9/219 (4%)
 Frame = -1

Query  840   RLSTAALHYEREISWFMGVEKIV-PSSFHHMRNKDGK-----TPKQLFLKEHMKLKINAE  679
             R++ AA   +RE+ WF  VEKIV PS      N         TP++LF + H  L+   E
Sbjct  1089  RVTGAAFQMQRELLWFKEVEKIVLPSQLMGKSNDPNPQLSKLTPRELFTENHKDLRKAGE  1148

Query  678   KSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIF  499
             + ++ TA+SCMIVA LI TV F+AAFT PGG DD TG PIF  +  FTVF ISDA A++ 
Sbjct  1149  EWMKNTANSCMIVAALITTVVFAAAFTVPGGCDDNTGNPIFQHKPWFTVFVISDAAALVS  1208

Query  498   SMVSILTFLSILIWRNTDDDF-HLALKRLFVGFAALGVSICGMlfaftaafflAYGRA--  328
             S  SIL F+SIL  R  +DDF H    RL +G  +L VSI  M+  FTA FFL Y  A  
Sbjct  1209  SSTSILMFMSILTSRYAEDDFLHSLPSRLLIGLTSLFVSIVCMVVTFTATFFLLYQNAKL  1268

Query  327   WQPILIAAFVALPIASFLYLNARLWIDVVGSMLLKLLPF  211
             W P+ +A    LP+  F  L  +LW+D   +  L    F
Sbjct  1269  WVPLTVAVMTILPVCCFCRLQFKLWVDTFHNTYLSRFLF  1307


 Score =   155 bits (391),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 95/218 (44%), Positives = 131/218 (60%), Gaps = 19/218 (9%)
 Frame = -1

Query  840  RLSTAALHYEREISWFMGVEKIV-PSSFH---------------HMRNKDGKTPKQLFLK  709
            R+S AAL  +RE+ WF  VEKIV PS                  +  N    TP+QLF +
Sbjct  406  RVSGAALQMQREMLWFKEVEKIVLPSQLEAKSNVTSSQQLEAKFNYPNTPKLTPRQLFTQ  465

Query  708  EHMKLKINAEKSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVF  529
            EH  L+ + E+ ++ TA+SCM+VATLI+TV F+AAFT PGG+++  G P+F ++  FTVF
Sbjct  466  EHKDLRKDGEEWMKHTANSCMLVATLISTVVFAAAFTVPGGSNNNEGTPVFQQKFWFTVF  525

Query  528  TISDAVAMIFSMVSILTFLSILIWRNTDDDF-HLALKRLFVGFAALGVSICGMlfaftaa  352
             +SDAVA+  S  SIL F+SIL  R  +DDF H    RL  G A L +SI  M+ AF+A 
Sbjct  526  AMSDAVALFSSSTSILMFMSILTSRYAEDDFMHSLPSRLLFGLATLFISIVCMVVAFSAT  585

Query  351  fflAYGRA--WQPILIAAFVALPIASFLYLNARLWIDV  244
            FF+ Y +A    P +++A   LP+  F  L  +LW D+
Sbjct  586  FFILYHKANICIPTIVSAMAILPVICFCVLQCKLWADI  623



>ref|XP_004153711.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like, 
partial [Cucumis sativus]
 ref|XP_004170523.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like, 
partial [Cucumis sativus]
Length=335

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 99/241 (41%), Positives = 141/241 (59%), Gaps = 20/241 (8%)
 Frame = -1

Query  903  NKKNDDQVEEEEDIMQESSALRLSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGK-TP  727
            +++N   +E   ++   S   ++S AA    RE+ WF  VEKIV  +   MR K GK +P
Sbjct  93   DEENMSLLELAAEMPDPSHLNQVSGAAFQMHRELLWFKQVEKIVELT---MRRKKGKRSP  149

Query  726  KQLFLKEHMKLKINAEKSIRGTADSCMIVATLIATVAFSAAFTAPGG-------------  586
            ++LF ++H  L  + EK ++ TA+SCM+VATLI TV F+A FT PGG             
Sbjct  150  RELFTQQHKGLVEDGEKWMKKTANSCMLVATLITTVVFAAIFTVPGGYTNTTSTTGSVIE  209

Query  585  NDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILTFLSILIWRNTDDDFHLALK-RLFV  409
            N++ TG P+F+    FTVF ISDA A+I S  +IL FLSIL  R  ++DF L L  +L  
Sbjct  210  NNNNTGTPLFLYHKWFTVFVISDATALISSSTAILLFLSILTSRCAEEDFLLWLPLKLVF  269

Query  408  GFAALGVSICGMlfaftaafflAYGR--AWQPILIAAFVALPIASFLYLNARLWIDVVGS  235
            G   L +S+  M+ AF+A FFL YG+  AW P+L+A    +P+  F  L  RLW D + +
Sbjct  270  GLGTLFLSVVTMVLAFSATFFLFYGKDTAWVPLLVAGMAIVPVYCFGVLQFRLWADAIAA  329

Query  234  M  232
            +
Sbjct  330  L  330



>ref|XP_004145193.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Cucumis 
sativus]
Length=702

 Score =   158 bits (399),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 91/203 (45%), Positives = 126/203 (62%), Gaps = 3/203 (1%)
 Frame = -1

Query  840  RLSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGT  661
            R++ AAL  +RE+ WF  VEKI     H MR  DG TP+++F KEH +L+ + E+ ++ T
Sbjct  483  RVAGAALQMQRELLWFKEVEKISVPMHHEMRCADGLTPREIFTKEHRQLQKDGEEWMKKT  542

Query  660  ADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSIL  481
            A SCM+ ATL+AT+ F+AAFT PGGNDDK GIPI  +  +FTVF ISDA A++ S+ SIL
Sbjct  543  ASSCMVAATLVATIVFAAAFTVPGGNDDKDGIPILEQNKAFTVFIISDAAALVTSITSIL  602

Query  480  TFLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfaftaafflAYGRAWQ--PILI  310
              LSI   R   +DF + L  +L +  A+L VSI  M  +F A  FL Y +     P++I
Sbjct  603  VSLSIFTSRYAAEDFLVTLPWKLALELASLFVSIGFMTISFCATLFLVYHKTETKLPLVI  662

Query  309  AAFVALPIASFLYLNARLWIDVV  241
            A     P   F  L+  L+ D++
Sbjct  663  AVVTIFPSVYFSLLHFELFTDII  685



>ref|XP_008440580.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X2 [Cucumis melo]
Length=753

 Score =   158 bits (400),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 100/217 (46%), Positives = 130/217 (60%), Gaps = 7/217 (3%)
 Frame = -1

Query  840  RLSTAALHYEREISWFMGVEKIV-PSSFHHMRNKDGKT---PKQLFLKEHMKLKINAEKS  673
            R+S AAL  +RE+ WF  VEKIV PS        D  T   P +LF +EH  L+   E+ 
Sbjct  500  RVSGAALQMQRELLWFKEVEKIVLPSQRGAKCEVDSLTKLTPCELFTREHKDLRKEGEEW  559

Query  672  IRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSM  493
            ++ TA+SCM+V+TLIATV F+AAFT PGGND  +G PIF     FT+F ISDA A++ S 
Sbjct  560  MKNTANSCMLVSTLIATVVFAAAFTVPGGNDGNSGTPIFQHEFWFTIFVISDAFALVSSS  619

Query  492  VSILTFLSILIWRNTDDDF-HLALKRLFVGFAALGVSICGMlfaftaafflAYGRA--WQ  322
             SIL FLSIL  R  + DF H    +L VG A+L +SI  M+ AF+A FF+ Y +   W 
Sbjct  620  TSILMFLSILTSRYAEGDFLHSLPSKLLVGIASLFISIVCMVIAFSATFFMLYNKENIWI  679

Query  321  PILIAAFVALPIASFLYLNARLWIDVVGSMLLKLLPF  211
            P  + A   +PI+ F  L+  LWID   +  L  L F
Sbjct  680  PATVTAIAIVPISCFFALHFGLWIDTFHNTYLSRLLF  716



>ref|XP_004145197.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Cucumis 
sativus]
 ref|XP_004153487.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Cucumis 
sativus]
 gb|KGN64477.1| hypothetical protein Csa_1G058120 [Cucumis sativus]
Length=650

 Score =   157 bits (397),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 96/212 (45%), Positives = 128/212 (60%), Gaps = 7/212 (3%)
 Frame = -1

Query  840  RLSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGK---TPKQLFLKEHMKLKINAEKSI  670
            R+S  AL  +RE+ W+  VEKIV       +  DG    TP++LF KEH +L+ + E+ +
Sbjct  408  RVSGPALQMQRELLWYKEVEKIVLPCQREAKCNDGSIQLTPRELFTKEHTELRKHGEEWM  467

Query  669  RGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMV  490
            + TA+SCM+VATLI TV F+AAFT PGGNDD+TG P    +  F VF ISDAVA++ S  
Sbjct  468  KNTANSCMLVATLITTVVFAAAFTVPGGNDDETGDPTLQTKNWFVVFVISDAVALLSSST  527

Query  489  SILTFLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAY---GRAWQ  322
            SIL FLSIL  R  +DDF  +L  +L  G   L +SI  M+  F+A FFL Y      W 
Sbjct  528  SILMFLSILTSRYREDDFLRSLPSKLLSGLVLLFISIVCMVVTFSATFFLLYRHPSNIWL  587

Query  321  PILIAAFVALPIASFLYLNARLWIDVVGSMLL  226
            P+ IAA   +P++ F  L  +L ID   +  L
Sbjct  588  PMTIAAMAIIPVSCFWGLQFKLSIDTFHNTYL  619



>ref|XP_010260578.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X3 [Nelumbo nucifera]
Length=636

 Score =   157 bits (397),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 95/223 (43%), Positives = 133/223 (60%), Gaps = 3/223 (1%)
 Frame = -1

Query  894  NDDQVEEEEDIMQESSALRLSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLF  715
            N++ +    ++   S    +S AAL  +RE  WF  VEK++   +  M+N +GKTP+ LF
Sbjct  398  NNNMLHLAGNLAPSSRLNTISGAALQMQREHQWFKEVEKVMQPLYMEMKNSEGKTPRTLF  457

Query  714  LKEHMKLKINAEKSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFT  535
             ++H  L    EK ++ TA SCMIVATLIATV F+AAFT PGGN D  GIP+F++  SF 
Sbjct  458  TEKHANLVKEGEKWMKDTASSCMIVATLIATVVFAAAFTVPGGNYDDKGIPVFLEVRSFI  517

Query  534  VFTISDAVAMIFSMVSILTFLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaft  358
            VF ISDA+A+  S+ S+L FLSIL  R   +DF   L +R+ +G   L VSI  M+ AF+
Sbjct  518  VFAISDALALFSSITSVLMFLSILTSRYAAEDFLETLPRRMVLGLTTLFVSIATMVIAFS  577

Query  357  aafflAYGRA--WQPILIAAFVALPIASFLYLNARLWIDVVGS  235
            A  F+       W  I IA    +P+  F  L   L++D++ S
Sbjct  578  ATLFIVLRSRLDWIAIPIAILACVPVTMFALLQFPLFMDIIHS  620



>ref|XP_008440674.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X2 [Cucumis melo]
Length=648

 Score =   157 bits (397),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 98/212 (46%), Positives = 130/212 (61%), Gaps = 7/212 (3%)
 Frame = -1

Query  840  RLSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGK---TPKQLFLKEHMKLKINAEKSI  670
            R+S  AL  +RE+ WF  VEKIV       +  DG    TP++LF +EH +L+ + E+ +
Sbjct  406  RVSGPALQMQRELLWFKEVEKIVLPCQLEAKCNDGSIQLTPRELFTEEHAELRKHGEEWM  465

Query  669  RGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMV  490
            + TA+SCM+VATLIATV F+AAFT PGGNDDKTG P    ++ F VF ISDAVA++ S  
Sbjct  466  KNTANSCMLVATLIATVVFAAAFTVPGGNDDKTGDPTLQTKSWFAVFVISDAVALLSSST  525

Query  489  SILTFLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAY---GRAWQ  322
            SIL FLSIL  R  +DDF  +L  +L  G   L +SI  M+ AF+A FFL Y      W 
Sbjct  526  SILMFLSILTSRYGEDDFLKSLPSKLLSGLVLLFISIVCMVVAFSATFFLLYRDPSNIWL  585

Query  321  PILIAAFVALPIASFLYLNARLWIDVVGSMLL  226
            P+ IA    +P++ F  L  +L ID   +  L
Sbjct  586  PMTIATMAIIPVSCFWGLQFKLSIDTFHNTYL  617



>ref|XP_008440666.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X1 [Cucumis melo]
Length=650

 Score =   157 bits (397),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 98/212 (46%), Positives = 130/212 (61%), Gaps = 7/212 (3%)
 Frame = -1

Query  840  RLSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGK---TPKQLFLKEHMKLKINAEKSI  670
            R+S  AL  +RE+ WF  VEKIV       +  DG    TP++LF +EH +L+ + E+ +
Sbjct  408  RVSGPALQMQRELLWFKEVEKIVLPCQLEAKCNDGSIQLTPRELFTEEHAELRKHGEEWM  467

Query  669  RGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMV  490
            + TA+SCM+VATLIATV F+AAFT PGGNDDKTG P    ++ F VF ISDAVA++ S  
Sbjct  468  KNTANSCMLVATLIATVVFAAAFTVPGGNDDKTGDPTLQTKSWFAVFVISDAVALLSSST  527

Query  489  SILTFLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAY---GRAWQ  322
            SIL FLSIL  R  +DDF  +L  +L  G   L +SI  M+ AF+A FFL Y      W 
Sbjct  528  SILMFLSILTSRYGEDDFLKSLPSKLLSGLVLLFISIVCMVVAFSATFFLLYRDPSNIWL  587

Query  321  PILIAAFVALPIASFLYLNARLWIDVVGSMLL  226
            P+ IA    +P++ F  L  +L ID   +  L
Sbjct  588  PMTIATMAIIPVSCFWGLQFKLSIDTFHNTYL  619



>ref|XP_008440571.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X1 [Cucumis melo]
Length=764

 Score =   158 bits (399),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 100/217 (46%), Positives = 130/217 (60%), Gaps = 7/217 (3%)
 Frame = -1

Query  840  RLSTAALHYEREISWFMGVEKIV-PSSFHHMRNKDGKT---PKQLFLKEHMKLKINAEKS  673
            R+S AAL  +RE+ WF  VEKIV PS        D  T   P +LF +EH  L+   E+ 
Sbjct  511  RVSGAALQMQRELLWFKEVEKIVLPSQRGAKCEVDSLTKLTPCELFTREHKDLRKEGEEW  570

Query  672  IRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSM  493
            ++ TA+SCM+V+TLIATV F+AAFT PGGND  +G PIF     FT+F ISDA A++ S 
Sbjct  571  MKNTANSCMLVSTLIATVVFAAAFTVPGGNDGNSGTPIFQHEFWFTIFVISDAFALVSSS  630

Query  492  VSILTFLSILIWRNTDDDF-HLALKRLFVGFAALGVSICGMlfaftaafflAYGRA--WQ  322
             SIL FLSIL  R  + DF H    +L VG A+L +SI  M+ AF+A FF+ Y +   W 
Sbjct  631  TSILMFLSILTSRYAEGDFLHSLPSKLLVGIASLFISIVCMVIAFSATFFMLYNKENIWI  690

Query  321  PILIAAFVALPIASFLYLNARLWIDVVGSMLLKLLPF  211
            P  + A   +PI+ F  L+  LWID   +  L  L F
Sbjct  691  PATVTAIAIVPISCFFALHFGLWIDTFHNTYLSRLLF  727



>ref|XP_009113887.1| PREDICTED: ankyrin repeat-containing protein At3g12360 isoform 
X1 [Brassica rapa]
Length=397

 Score =   154 bits (389),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 91/204 (45%), Positives = 127/204 (62%), Gaps = 3/204 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  V+KIVP S+   +N  G+  + LF ++H +L+   EK ++ TA
Sbjct  177  VSGAALQMQRELLWFKAVKKIVPHSYIKAKNSKGEVAQDLFTEQHKELRKEGEKWMKDTA  236

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
             SCM+V+TLIATV F+A FT PGG +D TG PIF  +  F VF +SDAVA+  S +SI+ 
Sbjct  237  TSCMLVSTLIATVVFAAPFTVPGGINDTTGFPIFKNKLWFNVFLLSDAVALFSSSISIVI  296

Query  477  FLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflA--YGRAWQPILIA  307
            FLSIL  R  +DDF ++L  RL +G  AL VSI  M+ +F+A  FL   +  AW   L+ 
Sbjct  297  FLSILTSRYAEDDFLVSLPSRLMLGLLALFVSINSMVISFSATLFLIPDWSFAWNLTLLI  356

Query  306  AFVALPIASFLYLNARLWIDVVGS  235
                +   SF  L+ +LW D + S
Sbjct  357  CLAFIISLSFALLHVKLWFDTLRS  380



>ref|XP_004153560.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Cucumis 
sativus]
Length=656

 Score =   157 bits (396),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 94/208 (45%), Positives = 127/208 (61%), Gaps = 8/208 (4%)
 Frame = -1

Query  840  RLSTAALHYEREISWFMGVEKIVPSSFHHMRNKD-GKTPKQLFLKEHMKLKINAEKSIRG  664
            R+S A     RE+ WF  VE I   +   MR K   KTP++LF +EH +L   AEK ++ 
Sbjct  435  RVSGAVFQMHRELLWFKEVEDIAERT---MRIKQRKKTPQELFTQEHRQLVKEAEKWVKS  491

Query  663  TADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSI  484
            TA+SCM+VATLIATV F+AAFT PGGN+D  G P+F+    F VF ISD++A+I S  +I
Sbjct  492  TANSCMLVATLIATVVFTAAFTVPGGNNDNNGFPLFLHHKWFIVFVISDSIALISSSTAI  551

Query  483  LTFLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfaftaafflAYGR---AWQPI  316
            L FLSIL  R  + DF   L   L  G   L +S+ GM+ AF+A  FL YG+   +W P+
Sbjct  552  LLFLSILTSRCVETDFLFWLPLELVFGLGFLFLSVLGMVLAFSACLFLHYGKDHFSWIPL  611

Query  315  LIAAFVALPIASFLYLNARLWIDVVGSM  232
            LI+    +PI  F  L  +LW D + ++
Sbjct  612  LISGMTIVPIFWFCMLQWKLWADGLAAL  639



>ref|XP_010090147.1| Ankyrin repeat-containing protein [Morus notabilis]
 gb|EXB38944.1| Ankyrin repeat-containing protein [Morus notabilis]
Length=644

 Score =   156 bits (395),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 91/204 (45%), Positives = 129/204 (63%), Gaps = 3/204 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AA   +RE+ WF  VEK+V      + N+ GKT K+LF +EH KL    EK ++ T+
Sbjct  430  VSGAAFQMQREMKWFKEVEKLVRPYSKTLLNERGKTAKELFTEEHKKLAEAGEKWMKDTS  489

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
            +SCMIVATLIATV F+AAFT PGGN+  TG+PIF++  +F VF ISDA+A+  S+ S+L 
Sbjct  490  NSCMIVATLIATVVFTAAFTVPGGNNSDTGVPIFLRTNAFLVFAISDALALFSSLTSVLM  549

Query  477  FLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAYGRA--WQPILIA  307
            FLSIL  R  +DDF  +L KRL +G A+L ++I  M+ AF A   +   +   W  +   
Sbjct  550  FLSILTARYAEDDFLRSLPKRLIIGLASLFLAITTMMIAFGATLSIVLSKRLDWISVPTV  609

Query  306  AFVALPIASFLYLNARLWIDVVGS  235
               ++P+A F  L   L+I++  S
Sbjct  610  LLASVPVAIFTLLQLPLFIEMARS  633



>ref|XP_004172299.1| PREDICTED: LOW QUALITY PROTEIN: ankyrin repeat-containing protein 
At5g02620-like [Cucumis sativus]
Length=653

 Score =   156 bits (395),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 94/208 (45%), Positives = 127/208 (61%), Gaps = 8/208 (4%)
 Frame = -1

Query  840  RLSTAALHYEREISWFMGVEKIVPSSFHHMRNKD-GKTPKQLFLKEHMKLKINAEKSIRG  664
            R+S A     RE+ WF  VE I   +   MR K   KTP++LF +EH +L   AEK ++ 
Sbjct  432  RVSGAVFQMHRELLWFKEVEDIAERT---MRIKQRKKTPQELFTQEHRQLVKEAEKWVKS  488

Query  663  TADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSI  484
            TA+SCM+VATLIATV F+AAFT PGGN+D  G P+F+    F VF ISD++A+I S  +I
Sbjct  489  TANSCMLVATLIATVVFTAAFTVPGGNNDNNGFPLFLHHKWFIVFVISDSIALISSSTAI  548

Query  483  LTFLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfaftaafflAYGR---AWQPI  316
            L FLSIL  R  + DF   L   L  G   L +S+ GM+ AF+A  FL YG+   +W P+
Sbjct  549  LLFLSILTSRCVETDFLFWLPLELVFGLGFLFLSVLGMVLAFSACLFLHYGKDHFSWIPL  608

Query  315  LIAAFVALPIASFLYLNARLWIDVVGSM  232
            LI+    +PI  F  L  +LW D + ++
Sbjct  609  LISGMAIVPIFWFCMLQWKLWADGLAAL  636



>ref|XP_004145185.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Cucumis 
sativus]
Length=395

 Score =   153 bits (387),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 99/241 (41%), Positives = 141/241 (59%), Gaps = 20/241 (8%)
 Frame = -1

Query  903  NKKNDDQVEEEEDIMQESSALRLSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGK-TP  727
            +++N   +E   ++   S   ++S AA    RE+ WF  VEKIV  +   MR K GK +P
Sbjct  93   DEENMSLLELAAEMPDPSHLNQVSGAAFQMHRELLWFKQVEKIVELT---MRRKKGKRSP  149

Query  726  KQLFLKEHMKLKINAEKSIRGTADSCMIVATLIATVAFSAAFTAPGG-------------  586
            ++LF ++H  L  + EK ++ TA+SCM+VATLI TV F+A FT PGG             
Sbjct  150  RELFTQQHKGLVEDGEKWMKKTANSCMLVATLITTVVFAAIFTVPGGYTNTTSTTGSVIE  209

Query  585  NDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILTFLSILIWRNTDDDFHLALK-RLFV  409
            N++ TG P+F+    FTVF ISDA A+I S  +IL FLSIL  R  ++DF L L  +L  
Sbjct  210  NNNNTGTPLFLYHKWFTVFVISDATALISSSTAILLFLSILTSRCAEEDFLLWLPLKLVF  269

Query  408  GFAALGVSICGMlfaftaafflAYGR--AWQPILIAAFVALPIASFLYLNARLWIDVVGS  235
            G   L +S+  M+ AF+A FFL YG+  AW P+L+A    +P+  F  L  RLW D + +
Sbjct  270  GLGTLFLSVVTMVLAFSATFFLFYGKDTAWVPLLVAGMAIVPVYCFGVLQFRLWADAIAA  329

Query  234  M  232
            +
Sbjct  330  L  330



>gb|KHN47695.1| Ankyrin repeat and death domain-containing protein 1B [Glycine 
soja]
Length=584

 Score =   155 bits (393),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 93/202 (46%), Positives = 126/202 (62%), Gaps = 3/202 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AA     E++WF  V+KI+  SF  M N +G  P++LF  +H  L    E  ++ TA
Sbjct  365  VSGAAFQMMLELTWFEEVKKIMLPSFVEMPNYEGIIPRELFTNQHEDLLKKGESWMKRTA  424

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
             SCM+V+TLIAT  FSAAF+ PGG DDK G P ++K+  FTVF +SDA+A+  S  S L 
Sbjct  425  SSCMVVSTLIATGVFSAAFSVPGGIDDKLGSPNYLKKPLFTVFALSDALALTLSTTSTLI  484

Query  477  FLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfaftaafflAY--GRAWQPILIA  307
            FLSILI R  ++DF  +L  +L  G  +L  SI  M+ AF++ FF+AY   + W PI IA
Sbjct  485  FLSILISRYAEEDFLRSLPFKLIFGLVSLFFSIISMMVAFSSTFFIAYYHAKTWVPITIA  544

Query  306  AFVALPIASFLYLNARLWIDVV  241
             FV  PI  F+ L  RLW D++
Sbjct  545  VFVCFPIFLFICLQFRLWHDIM  566



>ref|XP_004163109.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Cucumis 
sativus]
Length=665

 Score =   156 bits (394),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 133/216 (62%), Gaps = 7/216 (3%)
 Frame = -1

Query  840  RLSTAALHYEREISWFMGVEKIVPSSFHHMRNKD--GKTPKQLFLKEHMKLKINAEKSIR  667
            R+S AAL  +RE+ WF  VEKIV SS    +  D    TP++LF KEH  L+ + E  +R
Sbjct  317  RVSGAALQMQRELLWFKEVEKIVLSSQLEAKCDDPLKLTPRELFTKEHKDLRKDGEAWMR  376

Query  666  GTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVS  487
             TA+SCM+V+TLIATV F+AAFT PGG DD  G PIF KR  FT+F ISDAV +I S  S
Sbjct  377  NTANSCMLVSTLIATVIFAAAFTIPGG-DDNEGTPIFQKRFWFTIFVISDAVGLISSSSS  435

Query  486  ILTFLSILIWRNTDDDF-HLALKRLFVGFAALGVSICGMlfaftaafflAY---GRAWQP  319
            IL FLSIL  R+ +DDF H    RL +G  +L +SI  M+ AF+A FF+ Y      W P
Sbjct  436  ILVFLSILTSRHAEDDFLHSLPSRLLIGLTSLFISIVCMVVAFSATFFMHYHNNANIWVP  495

Query  318  ILIAAFVALPIASFLYLNARLWIDVVGSMLLKLLPF  211
             ++A    +P+  F  L  +LW+D+  +  L    F
Sbjct  496  KIVATTTIVPVCCFCMLQFKLWVDIFHNTYLSKFLF  531



>ref|XP_010059716.1| PREDICTED: uncharacterized protein LOC104447703 [Eucalyptus grandis]
Length=869

 Score =   157 bits (397),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 100/238 (42%), Positives = 142/238 (60%), Gaps = 5/238 (2%)
 Frame = -1

Query  930  ATQKEVVPANK-KNDDQVEEEEDIMQESSALRL-STAALHYEREISWFMGVEKIVPSSFH  757
              +K+++ A K +ND+ +      +     L++ S AAL  + E+ WF  VE IV  S+ 
Sbjct  617  GARKDMIAAYKDENDNNILHLAGKLAPRIQLKIDSGAALQMQEELLWFKEVEVIVQPSYR  676

Query  756  HMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTADSCMIVATLIATVAFSAAFTAPGGNDD  577
             M+N +GKTP  LF +EH +L+  AEK ++ TA SCM+VATLI T+AFSA FT PGGND+
Sbjct  677  EMKNSEGKTPYLLFTEEHKELRQEAEKWMKHTASSCMVVATLICTMAFSATFTIPGGNDN  736

Query  576  KTGIPIFIKRASFTVFTISDAVAMIFSMVSILTFLSILIWRNTDDDFHLAL-KRLFVGFA  400
             TG PIF+    F +FT+S A+A+  S  S+L FLSIL  R  ++DF  +L  RL +G  
Sbjct  737  NTGKPIFLHNRLFMIFTVSTALAVFSSATSVLMFLSILTSRYAEEDFLYSLPSRLVLGIG  796

Query  399  ALGVSICGMlfaftaafflAYGRAWQ--PILIAAFVALPIASFLYLNARLWIDVVGSM  232
            +L VSI  M+ AF A  F+  G  +    I IAAF +  +  F  L   L  D++G +
Sbjct  797  SLFVSIASMMVAFGATHFIFLGHDYARIAIPIAAFASGTVTLFALLQFPLLSDLIGHI  854


 Score = 58.5 bits (140),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 43/80 (54%), Gaps = 1/80 (1%)
 Frame = -1

Query  609  AAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILTFLSILIWRNTDDDF-H  433
            A FT PGG DD + +PI +   +F  F I DA  +   + SIL  LSIL     ++DF  
Sbjct  80   AIFTVPGGTDDNSAVPILLDSNAFITFAIGDAFTLFSLVTSILMLLSILTSCYAEEDFLE  139

Query  432  LALKRLFVGFAALGVSICGM  373
             + KRL +G   L +SI  M
Sbjct  140  SSPKRLIIGLTTLFLSIASM  159


 Score = 23.9 bits (50),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 23/50 (46%), Gaps = 0/50 (0%)
 Frame = -3

Query  796  VYGGGEDCAVIISPHEK*GRQNPKAIVFERAHEIEDKRRKIH*RHSRFMH  647
            + G GE+C   I   E     N + ++  RA     +RR ++ +H   +H
Sbjct  18   ILGSGENCTHFIKADEGQKWLNTEDVIHGRAQSSGQRRRGLYEKHRFILH  67



>ref|XP_010256492.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Nelumbo 
nucifera]
Length=312

 Score =   150 bits (380),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 91/204 (45%), Positives = 124/204 (61%), Gaps = 3/204 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S  AL  +RE+ WF  VE IV      ++N  GKTP+ LF ++H +L    EK ++ TA
Sbjct  90   VSGPALQMQRELQWFKEVEAIVQPRCTELKNFQGKTPRVLFSEQHKELVKEGEKWMKDTA  149

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
             SCM+VATLIATV F+AAFT PGGN+  TGIPIF++  SF VF+ISDA+A+  S  S+L 
Sbjct  150  TSCMVVATLIATVMFAAAFTVPGGNNSNTGIPIFLETNSFMVFSISDALALFSSSTSVLM  209

Query  477  FLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfa--ftaafflAYGRAWQPILIA  307
            FL+IL  R  +DDF   L ++L +G   L VSI  M+ A   T    L +   W  I I 
Sbjct  210  FLAILTSRYAEDDFLKFLPQKLIIGLFFLFVSIVAMMVAFGATIFIILCHRIVWLTIPIT  269

Query  306  AFVALPIASFLYLNARLWIDVVGS  235
               ++P+  F  L   L+ID++ S
Sbjct  270  LLASVPVTLFALLQFPLFIDMIVS  293



>ref|XP_008440848.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X1 [Cucumis melo]
Length=563

 Score =   155 bits (391),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 97/222 (44%), Positives = 132/222 (59%), Gaps = 22/222 (10%)
 Frame = -1

Query  840  RLSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGK-TPKQLFLKEHMKLKINAEKSIRG  664
            R+S AA    RE+ WF  VEKIV  +   MR K GK +P++LF ++H  L  + EK ++ 
Sbjct  329  RISGAAFQMHRELLWFKQVEKIVELT---MRRKKGKRSPRELFTQQHKGLVEDGEKWMKK  385

Query  663  TADSCMIVATLIATVAFSAAFTAPGG---------------NDDKTGIPIFIKRASFTVF  529
            TA+SCM+VATLI TV F+A FT PGG               N++ TG P+F+    FTVF
Sbjct  386  TANSCMLVATLITTVVFAAIFTVPGGYTNTTTTSTTGSVIENNNNTGTPLFLYHKWFTVF  445

Query  528  TISDAVAMIFSMVSILTFLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfaftaa  352
             ISDA A+I S  +IL FLSIL  R  ++DF L L  +L  G   L +S+  M+ AF+A 
Sbjct  446  VISDATALISSSTAILLFLSILTSRCAEEDFLLWLPLKLVFGLGTLFLSVVTMVLAFSAT  505

Query  351  fflAYGR--AWQPILIAAFVALPIASFLYLNARLWIDVVGSM  232
            FFL YG+  AW P+L+A    +P+  F  L  RLW D + ++
Sbjct  506  FFLFYGKDTAWVPLLVAGMAIVPVYCFGVLQFRLWADTIAAL  547



>ref|XP_003534875.1| PREDICTED: uncharacterized protein LOC100808896 isoform X1 [Glycine 
max]
 ref|XP_006586967.1| PREDICTED: uncharacterized protein LOC100808896 isoform X2 [Glycine 
max]
 ref|XP_006586968.1| PREDICTED: uncharacterized protein LOC100808896 isoform X3 [Glycine 
max]
 ref|XP_006586969.1| PREDICTED: uncharacterized protein LOC100808896 isoform X4 [Glycine 
max]
 ref|XP_006586970.1| PREDICTED: uncharacterized protein LOC100808896 isoform X5 [Glycine 
max]
 ref|XP_006586971.1| PREDICTED: uncharacterized protein LOC100808896 isoform X6 [Glycine 
max]
 ref|XP_006586972.1| PREDICTED: uncharacterized protein LOC100808896 isoform X7 [Glycine 
max]
Length=638

 Score =   155 bits (392),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 87/204 (43%), Positives = 124/204 (61%), Gaps = 3/204 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AA     EISWF  V KI+P SF  M+N +G T ++LF KEH  L+ NAE  ++ TA
Sbjct  410  VSGAAFQMSLEISWFEEVNKIMPPSFRWMKNSEGLTARELFTKEHADLRKNAESWMKRTA  469

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
            +SCM+++T+IAT  FSAA + PGG +D++  P ++ + SF +F +SDA ++I S  +IL 
Sbjct  470  ESCMLISTVIATGVFSAAISTPGGMNDESKEPNYLDKTSFLIFAVSDATSLISSATAILI  529

Query  477  FLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfaftaa--fflAYGRAWQPILIA  307
            FLSILI R  + DFH +L  +L  G  +L +SI  M+ AF  +      YG  W P  I+
Sbjct  530  FLSILISRYAEYDFHKSLPLKLIFGLISLFISITSMMVAFGCSFFITYYYGMKWVPSFIS  589

Query  306  AFVALPIASFLYLNARLWIDVVGS  235
                LPI  F+ L   LW  ++ S
Sbjct  590  VLACLPILLFIGLQFSLWSVIIYS  613



>ref|XP_007224368.1| hypothetical protein PRUPE_ppa020961mg [Prunus persica]
 gb|EMJ25567.1| hypothetical protein PRUPE_ppa020961mg [Prunus persica]
Length=705

 Score =   155 bits (393),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 123/201 (61%), Gaps = 3/201 (1%)
 Frame = -1

Query  834  STAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTAD  655
            + AAL   RE+ WF  VEKIV   +  MRN  GKTP+ LF +EH +L    E  ++GTA 
Sbjct  429  TGAALKLRRELLWFKEVEKIVQPLYKEMRNSIGKTPQILFTEEHKELLREGEVWMKGTAS  488

Query  654  SCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILTF  475
            SCM+VATLIATV F+A  T PGGN++ TGIPIF++  +F VF ISDAV++I S  SIL+F
Sbjct  489  SCMVVATLIATVMFAAFSTVPGGNNNDTGIPIFLQSRAFIVFAISDAVSLISSAASILSF  548

Query  474  LSILIWRNTDDDF-HLALKRLFVGFAALGVSICGMlfaftaafflAYGRAWQPI--LIAA  304
            LS+L+ R  + DF H    RL VG A L +SI  M+  F A  F+  G  +  I   IA 
Sbjct  549  LSVLMSRYAEGDFLHSLPNRLIVGLATLFISITAMMITFVATVFIVLGSEFHGIKVPIAL  608

Query  303  FVALPIASFLYLNARLWIDVV  241
               +P+  +  L   L  D++
Sbjct  609  VAGVPVGFYALLQFPLLADMI  629



>ref|XP_004164877.1| PREDICTED: uncharacterized LOC101218503 [Cucumis sativus]
 gb|KGN64473.1| hypothetical protein Csa_1G058080 [Cucumis sativus]
Length=642

 Score =   155 bits (391),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 95/218 (44%), Positives = 131/218 (60%), Gaps = 19/218 (9%)
 Frame = -1

Query  840  RLSTAALHYEREISWFMGVEKIV-PSSFH---------------HMRNKDGKTPKQLFLK  709
            R+S AAL  +RE+ WF  VEKIV PS                  +  N    TP+QLF +
Sbjct  406  RVSGAALQMQREMLWFKEVEKIVLPSQLEAKSNVTSSQQLEAKFNYPNTPKLTPRQLFTQ  465

Query  708  EHMKLKINAEKSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVF  529
            EH  L+ + E+ ++ TA+SCM+VATLI+TV F+AAFT PGG+++  G P+F ++  FTVF
Sbjct  466  EHKDLRKDGEEWMKHTANSCMLVATLISTVVFAAAFTVPGGSNNNEGTPVFQQKFWFTVF  525

Query  528  TISDAVAMIFSMVSILTFLSILIWRNTDDDF-HLALKRLFVGFAALGVSICGMlfaftaa  352
             +SDAVA+  S  SIL F+SIL  R  +DDF H    RL  G A L +SI  M+ AF+A 
Sbjct  526  AMSDAVALFSSSTSILMFMSILTSRYAEDDFMHSLPSRLLFGLATLFISIVCMVVAFSAT  585

Query  351  fflAYGRA--WQPILIAAFVALPIASFLYLNARLWIDV  244
            FF+ Y +A    P +++A   LP+  F  L  +LW D+
Sbjct  586  FFILYHKANICIPTIVSAMAILPVICFCVLQCKLWADI  623



>ref|XP_006381090.1| hypothetical protein POPTR_0006s06170g [Populus trichocarpa]
 gb|ABK95894.1| unknown [Populus trichocarpa]
 gb|ERP58887.1| hypothetical protein POPTR_0006s06170g [Populus trichocarpa]
Length=354

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 92/227 (41%), Positives = 137/227 (60%), Gaps = 4/227 (2%)
 Frame = -1

Query  903  NKKNDDQVEEEEDIMQESSALR-LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTP  727
            + + ++ +     +++  S L  +  AAL  +RE+ WF  V+K+V       +N  GKTP
Sbjct  103  DTEGNNMLHLAAKVLESPSRLNAIPGAALQLQRELLWFEEVKKVVQPRHIEEKNFHGKTP  162

Query  726  KQLFLKEHMKLKINAEKSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKR  547
              LF+++H  L    E+ +R TADSCM+VATLIATV F+AAFT PGGN    G P+F+K 
Sbjct  163  GALFIEQHRDLMKEGEQWMRDTADSCMLVATLIATVVFAAAFTVPGGNFQDKGTPVFLKE  222

Query  546  ASFTVFTISDAVAMIFSMVSILTFLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMl  370
             +F  F ISDA++++ S  S+LTFLSI   R  + +F  +L  RL +G   L +SI  M+
Sbjct  223  IAFKFFAISDAISLVTSASSLLTFLSIRTSRYAEQNFLWSLPNRLIIGLTTLFISIGAMM  282

Query  369  faftaafflAYGRAWQP--ILIAAFVALPIASFLYLNARLWIDVVGS  235
             AF A FFL +G    P  I IA   +LP+  F++ + RL++D++ S
Sbjct  283  VAFMATFFLVFGNKLLPYSIPIAVVASLPVIFFIWQHFRLFVDMIHS  329



>ref|XP_008229278.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Prunus 
mume]
 ref|XP_008229285.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Prunus 
mume]
Length=437

 Score =   153 bits (386),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 87/201 (43%), Positives = 119/201 (59%), Gaps = 3/201 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  V+KIV      M+NKDGKTP++LF  EH  L    E  ++ TA
Sbjct  218  VSGAALQMQRELVWFEEVKKIVQPLSIDMKNKDGKTPRELFTSEHEGLLCKGESWMKNTA  277

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
            +SCM+VAT+I TV FSAAFT PGG  D TG P F+K  +F +F ISD VA+  S  S+L 
Sbjct  278  NSCMLVATIITTVVFSAAFTIPGGIADNTGAPKFLKDTAFLIFVISDGVALFSSSTSMLM  337

Query  477  FLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlf--aftaafflAYGRAWQPILIA  307
            FL IL  R  ++DF  +L  +L VG A+L +S+  M+   +        YG  + P  I 
Sbjct  338  FLYILTSRYAENDFLKSLPLKLMVGLASLFISLTSMMIAFSTAFYLSCHYGLGFVPDFIF  397

Query  306  AFVALPIASFLYLNARLWIDV  244
             F  +P+  F++L   L  D+
Sbjct  398  IFAFVPVVLFVFLQYPLLCDM  418



>ref|XP_006586973.1| PREDICTED: uncharacterized protein LOC100808896 isoform X8 [Glycine 
max]
 ref|XP_006586974.1| PREDICTED: uncharacterized protein LOC100808896 isoform X9 [Glycine 
max]
 gb|KHN24824.1| Ankyrin-1 [Glycine soja]
Length=568

 Score =   154 bits (389),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 87/204 (43%), Positives = 124/204 (61%), Gaps = 3/204 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AA     EISWF  V KI+P SF  M+N +G T ++LF KEH  L+ NAE  ++ TA
Sbjct  340  VSGAAFQMSLEISWFEEVNKIMPPSFRWMKNSEGLTARELFTKEHADLRKNAESWMKRTA  399

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
            +SCM+++T+IAT  FSAA + PGG +D++  P ++ + SF +F +SDA ++I S  +IL 
Sbjct  400  ESCMLISTVIATGVFSAAISTPGGMNDESKEPNYLDKTSFLIFAVSDATSLISSATAILI  459

Query  477  FLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfaftaa--fflAYGRAWQPILIA  307
            FLSILI R  + DFH +L  +L  G  +L +SI  M+ AF  +      YG  W P  I+
Sbjct  460  FLSILISRYAEYDFHKSLPLKLIFGLISLFISITSMMVAFGCSFFITYYYGMKWVPSFIS  519

Query  306  AFVALPIASFLYLNARLWIDVVGS  235
                LPI  F+ L   LW  ++ S
Sbjct  520  VLACLPILLFIGLQFSLWSVIIYS  543



>ref|XP_002322392.1| ankyrin repeat family protein [Populus trichocarpa]
 gb|EEF06519.1| ankyrin repeat family protein [Populus trichocarpa]
Length=743

 Score =   155 bits (392),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 92/204 (45%), Positives = 126/204 (62%), Gaps = 3/204 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  VEK V  S   MR+K+G+TP+ LF +EH  L    EK ++ TA
Sbjct  524  ISGAALQMQRELLWFKEVEKNVQPSLKEMRDKNGRTPRMLFTEEHRGLVKEGEKWMKNTA  583

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
             SCM++ATLI TV F+A FT PGGND+  G P+ +   SF VF ++DA A+  S+ SIL 
Sbjct  584  SSCMLLATLITTVMFAAIFTVPGGNDNSKGTPLVLASTSFIVFAVADAFALFSSVTSILM  643

Query  477  FLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaa--fflAYGRAWQPILIA  307
            FLSIL  R  ++DF  +L KRL VG A L  SI  ML AF A     L +  AW  + I+
Sbjct  644  FLSILTSRYAEEDFVESLPKRLVVGLATLFCSIAAMLVAFAATFCIVLDHRLAWIVVPIS  703

Query  306  AFVALPIASFLYLNARLWIDVVGS  235
               ++P+  F +L   L++D++ S
Sbjct  704  LGSSVPVTLFAFLQFPLFVDMIHS  727



>ref|XP_004289303.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Fragaria 
vesca subsp. vesca]
Length=704

 Score =   155 bits (391),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 98/238 (41%), Positives = 135/238 (57%), Gaps = 6/238 (3%)
 Frame = -1

Query  906  ANKKNDDQVEEEEDIMQESSALRLST---AALHYEREISWFMGVEKIVPSSFHHMRNKDG  736
            A+ K+D+         + + A RL+T   AA    RE+ WF  VEKIV   +  MRN DG
Sbjct  459  ASHKDDNNNNMLHLAAKLAPANRLNTDTGAAFQLRRELLWFKEVEKIVQPLYKEMRNSDG  518

Query  735  KTPKQLFLKEHMKLKINAEKSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIF  556
            KTP+ LF +EH  L    EK ++ TA SCM+VATLIATV F+   T PGGN++ TG+P+F
Sbjct  519  KTPQILFTEEHKDLLKEGEKWMKSTASSCMVVATLIATVMFAVFSTVPGGNNNDTGLPVF  578

Query  555  IKRASFTVFTISDAVAMIFSMVSILTFLSILIWRNTDDDF-HLALKRLFVGFAALGVSIC  379
            IK+ +  VF ISDAV+++ S  SIL+FLSIL  R ++ DF H    RL VG A L +SI 
Sbjct  579  IKKTALKVFAISDAVSLVSSATSILSFLSILTSRYSEGDFLHSLPNRLIVGLATLFISIA  638

Query  378  GMlfaftaafflAYGRAWQPI--LIAAFVALPIASFLYLNARLWIDVVGSMLLKLLPF  211
             M+  + A  FL  G     I   I     +P++ +  L   L  D++    +  + F
Sbjct  639  TMMITYVATVFLVLGHGNGGIKAQITLVAVIPVSFYALLQFPLLSDMISHAYISRVSF  696



>ref|XP_004143703.1| PREDICTED: uncharacterized protein LOC101207503 [Cucumis sativus]
Length=1234

 Score =   157 bits (397),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 133/216 (62%), Gaps = 7/216 (3%)
 Frame = -1

Query  840  RLSTAALHYEREISWFMGVEKIVPSSFHHMRNKD--GKTPKQLFLKEHMKLKINAEKSIR  667
            R+S AAL  +RE+ WF  VEKIV SS    +  D    TP++LF KEH  L+ + E  +R
Sbjct  376  RVSGAALQMQRELLWFKEVEKIVLSSQLEAKCDDPLKLTPRELFTKEHKDLRKDGEAWMR  435

Query  666  GTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVS  487
             TA+SCM+V+TLIATV F+AAFT PGG DD  G PIF KR  FT+F ISDAV +I S  S
Sbjct  436  NTANSCMLVSTLIATVIFAAAFTIPGG-DDNEGTPIFQKRFWFTIFVISDAVGLISSSSS  494

Query  486  ILTFLSILIWRNTDDDF-HLALKRLFVGFAALGVSICGMlfaftaafflAY---GRAWQP  319
            IL FLSIL  R+ +DDF H    RL +G  +L +SI  M+ AF+A FF+ Y      W P
Sbjct  495  ILVFLSILTSRHAEDDFLHSLPSRLLIGLTSLFISIVCMVVAFSATFFMHYHNNANIWVP  554

Query  318  ILIAAFVALPIASFLYLNARLWIDVVGSMLLKLLPF  211
             ++A    +P+  F  L  +LW+D+  +  L    F
Sbjct  555  KIVATTTIVPVCCFCMLQFKLWVDIFHNTYLSKFLF  590


 Score =   135 bits (340),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 124/199 (62%), Gaps = 8/199 (4%)
 Frame = -1

Query  840   RLSTAALHYEREISWFMGVEKIVPSSFHHMRNKD--GKTPKQLFLKEHMKLKINAEKSIR  667
             R+S AAL  +RE+ W+  VEKIV SS    +  D    TP++LF  EH  L+ + E  +R
Sbjct  1035  RVSGAALQMQRELLWYKEVEKIVLSSQLEAKCDDPLKLTPRELFTIEHKDLRKDGEAWMR  1094

Query  666   GTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVS  487
              TA+SCM+V+TLIATV F+AAFT PGG DD  G PIF ++  FT+F ISDAV +I S  S
Sbjct  1095  NTANSCMLVSTLIATVIFAAAFTVPGG-DDIEGTPIFRRKFWFTIFVISDAVGLISSSSS  1153

Query  486   ILTFLSILIWRNTDDDF-HLALKRLFVGFAALGVSICGMlfaftaafflAY---GRAWQP  319
             IL FLSIL  R  + DF H    RL +GF +L VSI  M+ AF+A FF+ Y      W P
Sbjct  1154  ILVFLSILTSRYAEHDFLHSLPSRLLIGFTSLFVSIVCMVVAFSATFFIHYHNNANIWVP  1213

Query  318   ILIAAFVALPIASFL-YLN  265
              ++A    +P+   L Y+N
Sbjct  1214  KIVATTTIVPVQLRLDYIN  1232



>emb|CDY13083.1| BnaA09g17340D [Brassica napus]
Length=610

 Score =   154 bits (389),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 91/204 (45%), Positives = 127/204 (62%), Gaps = 3/204 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  V+KIVP S+   +N  G+  + LF ++H +L+   EK ++ TA
Sbjct  390  VSGAALQMQRELLWFKAVKKIVPHSYIKAKNSKGEVAQDLFTEQHKELRKEGEKWMKDTA  449

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
             SCM+V+TLIATV F+A FT PGG +D TG PIF  +  F VF +SDAVA+  S +SI+ 
Sbjct  450  TSCMLVSTLIATVVFAAPFTVPGGINDTTGFPIFKNKLWFNVFLLSDAVALFSSSISIVI  509

Query  477  FLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflA--YGRAWQPILIA  307
            FLSIL  R  +DDF ++L  RL +G  AL VSI  M+ +F+A  FL   +  AW   L+ 
Sbjct  510  FLSILTSRYAEDDFLVSLPSRLMLGLLALFVSINSMVISFSATLFLIPDWSFAWNLTLLI  569

Query  306  AFVALPIASFLYLNARLWIDVVGS  235
                +   SF  L+ +LW D + S
Sbjct  570  CLAFIISLSFALLHVKLWFDTLRS  593



>ref|XP_011000169.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Populus 
euphratica]
Length=785

 Score =   155 bits (393),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 92/204 (45%), Positives = 126/204 (62%), Gaps = 3/204 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  VEK V  S   MR+K+G+TP+ LF +EH  L    EK ++ TA
Sbjct  566  ISGAALQMQRELLWFKEVEKNVQPSLKEMRDKNGRTPRMLFTEEHRGLVKEGEKWMKNTA  625

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
             SCM++ATLI TV F+A FT PGGND+  G P+ +   SF VF ++DA A+  S+ SIL 
Sbjct  626  SSCMLLATLITTVMFAAIFTVPGGNDNSKGTPLVLASTSFIVFAVADAFALFSSVTSILM  685

Query  477  FLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaa--fflAYGRAWQPILIA  307
            FLSIL  R  ++DF  +L KRL VG A L  SI  ML AF A     L +  AW  + I+
Sbjct  686  FLSILTSRYAEEDFVESLPKRLVVGLATLFCSIAAMLVAFAATFCIVLDHRLAWIGVPIS  745

Query  306  AFVALPIASFLYLNARLWIDVVGS  235
               ++P+  F +L   L++D++ S
Sbjct  746  LGSSVPVTLFAFLQFPLFVDMIHS  769



>ref|XP_004287295.1| PREDICTED: uncharacterized protein LOC101314594 [Fragaria vesca 
subsp. vesca]
Length=1120

 Score =   157 bits (396),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 88/208 (42%), Positives = 123/208 (59%), Gaps = 9/208 (4%)
 Frame = -1

Query  840   RLSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGT  661
             R+  AAL  +RE+ WF  VE IVP     + N DG TP +LF K H  LK  AE S++GT
Sbjct  896   RIRGAALQMQRELHWFKAVEDIVPLQMREIPNSDGMTPHELFTKNHEALKKEAEDSMKGT  955

Query  660   ADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSIL  481
             A SC +V  LI T+ F+AAFT PGGND  TG+P+F+ +  F VF ISD ++++ S  S++
Sbjct  956   ATSCTVVGALIVTMMFAAAFTVPGGNDGSTGVPMFLAKKLFMVFIISDTLSLVSSTTSVI  1015

Query  480   TFLSILIWRNTDDDF--HLALKRLFVGFAALGVSICGM----lfaftaafflAYGRAWQP  319
              FL IL  R  +DDF  HL  K + +G + L +SI  M      A     +  Y  A  P
Sbjct  1016  LFLGILTSRYAEDDFLKHLPTK-MMLGLSTLFISIATMMIAFSSALIIMLYKEYSWAVIP  1074

Query  318   ILIAAFVALPIASFLYLNARLWIDVVGS  235
              + AA  ++P+ASF++L   L I+++ S
Sbjct  1075  SIFAA--SIPVASFIWLQFPLLIEIIWS  1100



>ref|XP_004291592.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Fragaria 
vesca subsp. vesca]
Length=603

 Score =   154 bits (388),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 94/212 (44%), Positives = 126/212 (59%), Gaps = 3/212 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  V+K V      M+N+ GKTP++LF  EH +L    E  ++ TA
Sbjct  384  VSGAALQMQRELVWFEEVKKTVQPPSIRMKNQKGKTPRELFTSEHEELLHKGEAWMKHTA  443

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
            +SCMIVA LIATV FSAAF+ PGG  D TG P F+K  +F  F I+D VA++ S  SIL 
Sbjct  444  NSCMIVAALIATVVFSAAFSVPGGTSDNTGEPHFLKETAFLFFAIADGVALVSSSTSILM  503

Query  477  FLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfaftaaffl--AYGRAWQPILIA  307
            FL IL  R  + DF  +L  +L +G  +L +SI  M+ AF+  F+L   YG  W P LI 
Sbjct  504  FLFILTSRYAEGDFLRSLPLKLMIGLTSLFISIASMMVAFSTTFYLDCHYGLGWLPNLIF  563

Query  306  AFVALPIASFLYLNARLWIDVVGSMLLKLLPF  211
             F  +P+A F +L+  L  D+  S     L F
Sbjct  564  VFAFVPVALFAFLHFPLLSDMFSSTYCSTLLF  595



>ref|XP_008355241.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X2 [Malus domestica]
Length=606

 Score =   153 bits (386),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 94/212 (44%), Positives = 126/212 (59%), Gaps = 3/212 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  VEKIV   F  M+NK GKTP++LF  EH  L    E  ++ TA
Sbjct  388  VSGAALQMQRELVWFEEVEKIVQPPFIDMKNKQGKTPRELFTSEHEDLLRKGESWMKDTA  447

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
            +SCM+V+TLIATV FSAAF+ PGG +D  G P  IK  +F +F ISD VA+  S  +IL 
Sbjct  448  NSCMLVSTLIATVVFSAAFSIPGGINDHKGTPXSIKEPAFLIFAISDGVALFSSSTAILM  507

Query  477  FLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfaftaafflAY--GRAWQPILIA  307
            FL IL  R  ++DF  +L  +L +G  +L VSI  M+  F+  F+L+   G  W P +I 
Sbjct  508  FLYILTSRYAENDFLKSLPLKLMIGLTSLFVSITSMMVTFSTTFYLSCHDGLIWVPDIIF  567

Query  306  AFVALPIASFLYLNARLWIDVVGSMLLKLLPF  211
             F  +P+A F +L   L  D+  S     L F
Sbjct  568  IFAFVPVALFAFLQYPLLFDMFFSTYYSSLLF  599



>ref|XP_006448682.1| hypothetical protein CICLE_v10018102mg [Citrus clementina]
 gb|ESR61922.1| hypothetical protein CICLE_v10018102mg [Citrus clementina]
Length=633

 Score =   153 bits (386),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 91/204 (45%), Positives = 126/204 (62%), Gaps = 3/204 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL   RE+ WF  VEKIV  +F  M+N +GK P++LF  EH  L  + E  ++ TA
Sbjct  414  VSGAALQMHRELLWFKEVEKIVQPTFREMKNSEGKAPRELFSIEHSSLLRSGELWMKNTA  473

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
            +SCM+VATLIAT+ F+AAF+ PGGND+  GIPI ++   F VF +SD +A+  S +SIL 
Sbjct  474  ESCMLVATLIATIMFAAAFSVPGGNDNNKGIPIHLRETLFQVFAMSDVIALSASSISILM  533

Query  477  FLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfaftaafflAYGRA--WQPILIA  307
            FLSIL  R  + DF  +L  +L +G +AL +SI  M+ AF+  FFLAY     W   +  
Sbjct  534  FLSILTSRYAETDFLKSLPLKLMIGLSALFISIINMMVAFSTTFFLAYHDRLNWVTTVTT  593

Query  306  AFVALPIASFLYLNARLWIDVVGS  235
               A+P+  F+ L   L  D+  S
Sbjct  594  VLAAVPVTLFVLLQYPLLNDIFYS  617



>ref|XP_008355240.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X1 [Malus domestica]
Length=611

 Score =   153 bits (386),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 94/212 (44%), Positives = 126/212 (59%), Gaps = 3/212 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  VEKIV   F  M+NK GKTP++LF  EH  L    E  ++ TA
Sbjct  393  VSGAALQMQRELVWFEEVEKIVQPPFIDMKNKQGKTPRELFTSEHEDLLRKGESWMKDTA  452

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
            +SCM+V+TLIATV FSAAF+ PGG +D  G P  IK  +F +F ISD VA+  S  +IL 
Sbjct  453  NSCMLVSTLIATVVFSAAFSIPGGINDHKGTPXSIKEPAFLIFAISDGVALFSSSTAILM  512

Query  477  FLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfaftaafflAY--GRAWQPILIA  307
            FL IL  R  ++DF  +L  +L +G  +L VSI  M+  F+  F+L+   G  W P +I 
Sbjct  513  FLYILTSRYAENDFLKSLPLKLMIGLTSLFVSITSMMVTFSTTFYLSCHDGLIWVPDIIF  572

Query  306  AFVALPIASFLYLNARLWIDVVGSMLLKLLPF  211
             F  +P+A F +L   L  D+  S     L F
Sbjct  573  IFAFVPVALFAFLQYPLLFDMFFSTYYSSLLF  604



>ref|XP_007138825.1| hypothetical protein PHAVU_009G240400g [Phaseolus vulgaris]
 gb|ESW10819.1| hypothetical protein PHAVU_009G240400g [Phaseolus vulgaris]
Length=720

 Score =   153 bits (387),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 92/202 (46%), Positives = 124/202 (61%), Gaps = 3/202 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  VEKI+      +++ +G+TP+ LF +EH  L    EK ++ TA
Sbjct  508  VSGAALQMQRELLWFKEVEKIIQPLLKEIKDSEGRTPQMLFTEEHKGLAKEGEKWLKNTA  567

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
             SCM+V+TLI TV F+A FT PGGN++  G PIF++  SF VF +SDA+ +  S+VSIL 
Sbjct  568  SSCMLVSTLITTVMFAALFTVPGGNNNSNGYPIFMRTTSFKVFALSDALGLFSSVVSILM  627

Query  477  FLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAYGR--AWQPILIA  307
            FLSIL  R   +DF ++L KRL VG A L  SI  ML AF A FF+  G   AW  I I 
Sbjct  628  FLSILTSRYAQEDFLVSLPKRLSVGIATLFFSIITMLIAFGATFFIVLGHQLAWIVIPIT  687

Query  306  AFVALPIASFLYLNARLWIDVV  241
                +P   F +L   L +D +
Sbjct  688  LVACIPAILFAFLQFPLLVDTI  709



>ref|XP_007207550.1| hypothetical protein PRUPE_ppa017666mg, partial [Prunus persica]
 gb|EMJ08749.1| hypothetical protein PRUPE_ppa017666mg, partial [Prunus persica]
Length=546

 Score =   152 bits (383),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 95/212 (45%), Positives = 131/212 (62%), Gaps = 3/212 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  V+KIV      M+NK+GKTP++LF  EH +L    E  ++ TA
Sbjct  327  VSGAALQMQRELVWFEEVKKIVQPLSTEMKNKNGKTPRELFTSEHKELLRKGESWMKNTA  386

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
            +SCM+VAT+IATV FSAAF+ PGG  DKTG P F+K  +F +F ISD VA+  S  S+L 
Sbjct  387  NSCMLVATIIATVVFSAAFSIPGGIADKTGAPNFVKETAFLIFAISDGVALFSSSTSMLM  446

Query  477  FLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfaftaafflA--YGRAWQPILIA  307
            FL IL  R  ++DF  +L  +L VG A+L +S+  M+ AF+ AF+L+  YG  +    I 
Sbjct  447  FLYILTSRYAENDFLKSLPLKLMVGLASLFISMTSMMIAFSTAFYLSCHYGLGFVSDFIF  506

Query  306  AFVALPIASFLYLNARLWIDVVGSMLLKLLPF  211
             F  +P+  FL+L   L  D+  S     L F
Sbjct  507  IFAFVPVVLFLFLQYPLLSDMFLSTYCSSLIF  538



>emb|CDP11284.1| unnamed protein product [Coffea canephora]
Length=352

 Score =   149 bits (376),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 91/204 (45%), Positives = 126/204 (62%), Gaps = 3/204 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  VEK V   +  MR+ +G+ P  LF +EH  L  + E+ ++ TA
Sbjct  133  VSGAALQMQRELLWFKEVEKNVQPLYKEMRDSEGRMPHMLFTQEHKALLKSGERWMKDTA  192

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
             SCM+VATLI TV F+A FT PGGN+++TG PIF+K  +F +F+ISDA+A+  S+ SIL 
Sbjct  193  SSCMLVATLITTVMFAAIFTVPGGNNNETGTPIFLKDKAFIIFSISDALALFSSVTSILM  252

Query  477  FLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAYGR--AWQPILIA  307
            FLSIL  R  + DF   L KRL +G   L  SI  ML AF+A+F + +G   AW  I +A
Sbjct  253  FLSILTSRYAEVDFMETLPKRLIIGLMTLFFSIASMLIAFSASFSIVHGHKIAWIIIPVA  312

Query  306  AFVALPIASFLYLNARLWIDVVGS  235
                +P+  F +    L  D+  S
Sbjct  313  LAACIPVLLFAFSQFPLVADMFHS  336



>emb|CDY61717.1| BnaC09g51990D [Brassica napus]
Length=608

 Score =   152 bits (384),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 90/204 (44%), Positives = 126/204 (62%), Gaps = 3/204 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  V+KIVP S+   +N  G+  + LF ++H +L+   EK ++ TA
Sbjct  388  VSGAALQMQRELLWFKAVKKIVPHSYIKAKNSKGEVAQDLFTEKHKELRKEGEKWMKDTA  447

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
             SCM+V+TLIATV F+A FT PGG +D TG PI   +  F VF +SDAVA+  S +SI+ 
Sbjct  448  TSCMLVSTLIATVVFAAPFTVPGGINDTTGFPILKNKVWFNVFLLSDAVALFSSSISIVI  507

Query  477  FLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflA--YGRAWQPILIA  307
            FLSIL  R  +DDF ++L  RL +G  AL VSI  M+ +F+A  FL   +  AW   L+ 
Sbjct  508  FLSILTSRYAEDDFLVSLPSRLMLGLLALFVSINSMVISFSATLFLIPDWSFAWNLTLLI  567

Query  306  AFVALPIASFLYLNARLWIDVVGS  235
                +   SF  L+ +LW D + S
Sbjct  568  CLAFIISLSFALLHVKLWFDTLRS  591



>ref|XP_010248105.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X2 [Nelumbo nucifera]
 ref|XP_010248106.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X2 [Nelumbo nucifera]
 ref|XP_010248107.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X2 [Nelumbo nucifera]
 ref|XP_010248108.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X2 [Nelumbo nucifera]
 ref|XP_010248109.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X2 [Nelumbo nucifera]
 ref|XP_010248110.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X2 [Nelumbo nucifera]
 ref|XP_010248111.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X2 [Nelumbo nucifera]
 ref|XP_010248112.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X2 [Nelumbo nucifera]
 ref|XP_010248113.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X2 [Nelumbo nucifera]
 ref|XP_010248114.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X2 [Nelumbo nucifera]
 ref|XP_010248116.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X2 [Nelumbo nucifera]
 ref|XP_010248117.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X2 [Nelumbo nucifera]
 ref|XP_010248118.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X2 [Nelumbo nucifera]
 ref|XP_010248119.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X2 [Nelumbo nucifera]
 ref|XP_010248120.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X2 [Nelumbo nucifera]
 ref|XP_010248121.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X2 [Nelumbo nucifera]
 ref|XP_010248122.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X2 [Nelumbo nucifera]
 ref|XP_010248123.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X2 [Nelumbo nucifera]
 ref|XP_010248124.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X2 [Nelumbo nucifera]
 ref|XP_010248125.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X2 [Nelumbo nucifera]
 ref|XP_010248126.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X2 [Nelumbo nucifera]
 ref|XP_010248127.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X2 [Nelumbo nucifera]
 ref|XP_010248128.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X2 [Nelumbo nucifera]
Length=245

 Score =   146 bits (368),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 119/200 (60%), Gaps = 4/200 (2%)
 Frame = -1

Query  840  RLSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGT  661
            R+S AAL  +RE+ WF  VEK +P      RN +GKTP+ LF +EH  L    EK ++ T
Sbjct  45   RVSGAALQMQRELQWFKEVEKFIPPKHRESRNNNGKTPQALFTEEHKDLVKEGEKWMKDT  104

Query  660  ADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSIL  481
            A SCM+VATLIAT  F+AAF  PGGN++ TGIPIF+   +F VF ISDA+++  S  S+L
Sbjct  105  AQSCMLVATLIATFTFAAAFILPGGNNNDTGIPIFLHTTAFLVFIISDALSLFSSSTSVL  164

Query  480  TFLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfa-ftaafflAYGRA-WQPILI  310
                IL  R  + DF ++L +RL +G A L  S+  M+ A     F + + RA W  I I
Sbjct  165  IVSGILTSRYAEQDFLVSLHRRLIIGLATLFFSVATMMVAFGATLFLVLHHRAQWVAIQI  224

Query  309  AAFVALPIASFLYLNARLWI  250
                ++P+   LY +   W+
Sbjct  225  TLLGSVPVC-LLYRSFPYWL  243



>ref|XP_010248129.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X3 [Nelumbo nucifera]
Length=243

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 119/200 (60%), Gaps = 4/200 (2%)
 Frame = -1

Query  840  RLSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGT  661
            R+S AAL  +RE+ WF  VEK +P      RN +GKTP+ LF +EH  L    EK ++ T
Sbjct  43   RVSGAALQMQRELQWFKEVEKFIPPKHRESRNNNGKTPQALFTEEHKDLVKEGEKWMKDT  102

Query  660  ADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSIL  481
            A SCM+VATLIAT  F+AAF  PGGN++ TGIPIF+   +F VF ISDA+++  S  S+L
Sbjct  103  AQSCMLVATLIATFTFAAAFILPGGNNNDTGIPIFLHTTAFLVFIISDALSLFSSSTSVL  162

Query  480  TFLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfa-ftaafflAYGRA-WQPILI  310
                IL  R  + DF ++L +RL +G A L  S+  M+ A     F + + RA W  I I
Sbjct  163  IVSGILTSRYAEQDFLVSLHRRLIIGLATLFFSVATMMVAFGATLFLVLHHRAQWVAIQI  222

Query  309  AAFVALPIASFLYLNARLWI  250
                ++P+   LY +   W+
Sbjct  223  TLLGSVPVC-LLYRSFPYWL  241



>ref|XP_007022427.1| Ankyrin repeat family protein, putative [Theobroma cacao]
 gb|EOY13952.1| Ankyrin repeat family protein, putative [Theobroma cacao]
Length=601

 Score =   152 bits (383),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 101/249 (41%), Positives = 146/249 (59%), Gaps = 15/249 (6%)
 Frame = -1

Query  936  STATQKEVVPANKKNDDQVEEEEDIMQESSAL----RL---STAALHYEREISWFMGVEK  778
            S  + K+VV A K   ++ E  ++++  ++ L    RL   S AAL  +RE+ WF  V  
Sbjct  334  SIGSIKDVVVAYKIPGNECEVWDNMLHLAAKLPSPHRLDMVSGAALQMQRELLWFEEVRS  393

Query  777  IVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTADSCMIVATLIATVAFSAAFT  598
            +V  S    +   G TP++LF ++H  L    EK +R T++SCMIVATLI TV +SA F+
Sbjct  394  VVQPSDRERKGLKGLTPRKLFSRQHEGLLERGEKWMRDTSESCMIVATLITTVVYSAGFS  453

Query  597  APGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILTFLSILIWRNTDDDFHLALK-  421
             PGGND+  G P+ I    F VF +S+AVA+ FS+ S L FL IL  R  ++DF  +L  
Sbjct  454  TPGGNDNTKGTPVLINHTLFHVFAVSEAVALSFSITSTLMFLCILTSRYAEEDFLKSLPL  513

Query  420  RLFVGFAALGVSICGMlfaftaafflAYGRA-------WQPILIAAFVALPIASFLYLNA  262
            +L  G A L +S+  M+ AF+AAFFLAY  +       W P+L++AF  LP   F+ L  
Sbjct  514  KLMAGLATLFISMMAMIVAFSAAFFLAYRDSYNHHRLRWVPLLVSAFAFLPAVLFVLLQY  573

Query  261  RLWIDVVGS  235
            RL++D+  S
Sbjct  574  RLFLDMFHS  582



>gb|KEH37408.1| ankyrin repeat plant-like protein [Medicago truncatula]
Length=581

 Score =   152 bits (383),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 92/204 (45%), Positives = 127/204 (62%), Gaps = 3/204 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL    E+SWF  V+K +      M+N +G TP++LF KEH +L    E  ++ TA
Sbjct  362  VSGAALQMMLELSWFEEVKKNMQPHMIEMKNSEGMTPRELFTKEHAELLKKGESWMKQTA  421

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
            +SCM+V+TLIAT  FSAAF+ PGGN+D    P ++ + +F VF +SD++A+I S  SIL 
Sbjct  422  NSCMVVSTLIATGVFSAAFSLPGGNNDNKESPNYLDKPAFLVFALSDSMALISSSTSILI  481

Query  477  FLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfaftaafflAY--GRAWQPILIA  307
            FLSILI R  + DF  +L  +L  G  AL VSI  M+ AF++AF++ Y  G  W P  I+
Sbjct  482  FLSILISRYAEQDFLKSLPLKLISGLVALFVSIISMMIAFSSAFYITYYHGLKWVPNFIS  541

Query  306  AFVALPIASFLYLNARLWIDVVGS  235
                LPI  F+ L   LW D+V S
Sbjct  542  VLAFLPIPLFICLQFSLWSDIVYS  565



>ref|XP_010248103.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X1 [Nelumbo nucifera]
Length=264

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 119/200 (60%), Gaps = 4/200 (2%)
 Frame = -1

Query  840  RLSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGT  661
            R+S AAL  +RE+ WF  VEK +P      RN +GKTP+ LF +EH  L    EK ++ T
Sbjct  64   RVSGAALQMQRELQWFKEVEKFIPPKHRESRNNNGKTPQALFTEEHKDLVKEGEKWMKDT  123

Query  660  ADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSIL  481
            A SCM+VATLIAT  F+AAF  PGGN++ TGIPIF+   +F VF ISDA+++  S  S+L
Sbjct  124  AQSCMLVATLIATFTFAAAFILPGGNNNDTGIPIFLHTTAFLVFIISDALSLFSSSTSVL  183

Query  480  TFLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfa-ftaafflAYGRA-WQPILI  310
                IL  R  + DF ++L +RL +G A L  S+  M+ A     F + + RA W  I I
Sbjct  184  IVSGILTSRYAEQDFLVSLHRRLIIGLATLFFSVATMMVAFGATLFLVLHHRAQWVAIQI  243

Query  309  AAFVALPIASFLYLNARLWI  250
                ++P+   LY +   W+
Sbjct  244  TLLGSVPVC-LLYRSFPYWL  262



>gb|KCW75498.1| hypothetical protein EUGRSUZ_E04257 [Eucalyptus grandis]
Length=379

 Score =   149 bits (376),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 89/204 (44%), Positives = 126/204 (62%), Gaps = 3/204 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  VEK V +    MR+K G+TP+ LF +EH  L    E  ++ TA
Sbjct  159  VSGAALQMQRELLWFKEVEKTVHTLSKQMRDKSGRTPRMLFTEEHRALVKEGEDWMKSTA  218

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
             SCM+VATLI TV F+A FT PGG ++ +G+PI ++  +F  F I+DA A+  S+ SIL 
Sbjct  219  SSCMLVATLITTVMFAAIFTVPGGTNNNSGVPILLESTAFITFAIADAFALFSSVTSILM  278

Query  477  FLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAYGR--AWQPILIA  307
            FLSIL  R  ++DF  +L KRL +G   L +SI  ML AF+A  F+ +G   AW  + +A
Sbjct  279  FLSILTSRYAEEDFLESLPKRLIIGLTTLFLSIASMLIAFSATIFIVFGSHLAWILVPVA  338

Query  306  AFVALPIASFLYLNARLWIDVVGS  235
                +PI  F +L+  L  D++ S
Sbjct  339  LASCIPITLFAFLHFPLLNDMLCS  362



>ref|XP_004171826.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Cucumis 
sativus]
Length=611

 Score =   151 bits (382),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 99/231 (43%), Positives = 141/231 (61%), Gaps = 18/231 (8%)
 Frame = -1

Query  840  RLSTAALHYEREISWFMGVEKIVPSSFHHMRNKD------GKT---------PKQLFLKE  706
            R+S AAL  +RE+ WF  VEKIV S    ++ KD      G+T         P++LF ++
Sbjct  376  RVSGAALQMQRELLWFKEVEKIVYSYHIQVKCKDLPNLTRGETKLDPADTFTPRELFSRQ  435

Query  705  HMKLKINAEKSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFT  526
            H +L  + E+ ++ TA+SCM+VATLIATV F+AAFT PGGN+DK G PIF +  +FT+F 
Sbjct  436  HKQLLKDGEEWMKNTANSCMVVATLIATVVFAAAFTFPGGNNDKDGTPIFRQNQAFTMFV  495

Query  525  ISDAVAMIFSMVSILTFLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfaftaaf  349
            I+D  A++ S  SILTFLSIL  R  ++DF ++L  +L  G   L +SI  M+ AF+  F
Sbjct  496  ITDVAALVLSTTSILTFLSILTSRYAEEDFLMSLPGKLLFGLLTLFLSIACMVVAFSMTF  555

Query  348  flAYGR--AWQPILIAAFVALPIASFLYLNARLWIDVVGSMLLKLLPFTKQ  202
            F+AY +  A  P+ IAA   +PI  F   + RL +D++ S       F K+
Sbjct  556  FIAYDKTNAKFPLAIAAVTVIPIGCFCVFHVRLVVDILRSTYWSYFSFRKR  606



>ref|XP_004145188.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Cucumis 
sativus]
Length=614

 Score =   151 bits (382),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 99/231 (43%), Positives = 141/231 (61%), Gaps = 18/231 (8%)
 Frame = -1

Query  840  RLSTAALHYEREISWFMGVEKIVPSSFHHMRNKD------GKT---------PKQLFLKE  706
            R+S AAL  +RE+ WF  VEKIV S    ++ KD      G+T         P++LF ++
Sbjct  379  RVSGAALQMQRELLWFKEVEKIVYSYHIQVKCKDLPNLTRGETKLDPADTFTPRELFSRQ  438

Query  705  HMKLKINAEKSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFT  526
            H +L  + E+ ++ TA+SCM+VATLIATV F+AAFT PGGN+DK G PIF +  +FT+F 
Sbjct  439  HKQLLKDGEEWMKNTANSCMVVATLIATVVFAAAFTFPGGNNDKDGTPIFRQNQAFTMFV  498

Query  525  ISDAVAMIFSMVSILTFLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfaftaaf  349
            I+D  A++ S  SILTFLSIL  R  ++DF ++L  +L  G   L +SI  M+ AF+  F
Sbjct  499  ITDVAALVLSTTSILTFLSILTSRYAEEDFLMSLPGKLLFGLLTLFLSIACMVVAFSMTF  558

Query  348  flAYGR--AWQPILIAAFVALPIASFLYLNARLWIDVVGSMLLKLLPFTKQ  202
            F+AY +  A  P+ IAA   +PI  F   + RL +D++ S       F K+
Sbjct  559  FIAYDKTNAKFPLAIAAVTVIPIGCFCVFHVRLVVDILRSTYWSYFSFRKR  609



>ref|XP_007012652.1| Ankyrin repeat-containing-like protein [Theobroma cacao]
 gb|EOY30271.1| Ankyrin repeat-containing-like protein [Theobroma cacao]
Length=558

 Score =   151 bits (381),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 87/205 (42%), Positives = 126/205 (61%), Gaps = 3/205 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S+AAL  +RE+ WF  VEK+VPS +   RN +GKTP+ +F  +H +L    EK ++ TA
Sbjct  339  VSSAALQMQRELQWFKEVEKLVPSIYRDARNYEGKTPRMVFTDKHKELVKEGEKWMKDTA  398

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
            +SC +VA LIATV F+AA T PGG +  +G P+F    +F +F +SDA+++  S  +IL 
Sbjct  399  NSCSVVAALIATVVFAAAITVPGGTNGDSGFPVFSSEKAFVIFAVSDALSLFSSTAAILM  458

Query  477  FLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAYGR--AWQPILIA  307
            FLSIL  R   D+F  AL KRL +G   L +SI  M+ AF+A  +L +G    W    +A
Sbjct  459  FLSILTARYAGDNFLQALPKRLIMGLLTLLISITTMMIAFSATLYLVFGNDETWILTSVA  518

Query  306  AFVALPIASFLYLNARLWIDVVGSM  232
            A   L +  F+YL   L +D+  S+
Sbjct  519  ASACLLVILFVYLQFSLLVDMFSSI  543



>gb|KDO52574.1| hypothetical protein CISIN_1g0076771mg, partial [Citrus sinensis]
Length=239

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 83/201 (41%), Positives = 120/201 (60%), Gaps = 3/201 (1%)
 Frame = -1

Query  789  GVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTADSCMIVATLIATVAFS  610
             V+ +VP      +N  G TPK LF KEH +LK N E  ++ TA SCMIVATLIAT+ F+
Sbjct  1    AVKDVVPPKLRDAKNNKGLTPKALFSKEHEELKRNGETWMKDTASSCMIVATLIATIVFA  60

Query  609  AAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILTFLSILIWRNTDDDF-H  433
            AA T PGGN + TG+P F ++ASF +F +S+ ++++ S VSI+ FLSI+  R  ++DF  
Sbjct  61   AAITVPGGNKEDTGLPFFRQKASFKIFAVSNVISLVASSVSIVNFLSIVAPRYAEEDFLR  120

Query  432  LALKRLFVGFAALGVSICGMlfaftaafflAY--GRAWQPILIAAFVALPIASFLYLNAR  259
            L   +L VGFA L V+I  M+  F+A  ++ +  G  W  IL     ++P+  F+  + R
Sbjct  121  LLPTKLLVGFATLFVAIAAMMVVFSATSYIVFEDGSLWIAILATVISSMPVILFVKQHFR  180

Query  258  LWIDVVGSMLLKLLPFTKQTT  196
             + DV+ S      P  K  T
Sbjct  181  FFYDVLRSTYASHYPIPKGKT  201



>ref|XP_008391125.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X1 [Malus domestica]
Length=622

 Score =   151 bits (382),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 93/221 (42%), Positives = 129/221 (58%), Gaps = 10/221 (5%)
 Frame = -1

Query  876  EEEDIMQESSALR-------LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQL  718
            E+ +I+ +++ L        +S AAL  +RE+ WF  VEKIV   F  M+N   KTP++L
Sbjct  378  EKNNILHQAAKLAPQDQLNLVSGAALQMQRELVWFEEVEKIVQPPFIDMKNNQDKTPREL  437

Query  717  FLKEHMKLKINAEKSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASF  538
            F  EH  L    E  ++ TA+SCM+V+T+IATV FSAAF+ PGG  D  G P F+K  +F
Sbjct  438  FTSEHKDLLRKGESWMKNTANSCMLVSTIIATVVFSAAFSIPGGISDNKGTPNFVKDTAF  497

Query  537  TVFTISDAVAMIFSMVSILTFLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfaf  361
             +FTISD VA+  S  +IL FL IL  R  ++DF  +L  +L +G  +L VSI  M+ AF
Sbjct  498  LIFTISDGVALFSSSTAILMFLYILTSRYAENDFLKSLPLKLMIGLTSLFVSITSMMVAF  557

Query  360  taa--fflAYGRAWQPILIAAFVALPIASFLYLNARLWIDV  244
            + A      Y   W P LI  F  +P+A F +L   L  D+
Sbjct  558  STAFYLSCHYELRWVPDLIFIFSFVPVALFAFLQYPLLSDM  598



>gb|KDP37317.1| hypothetical protein JCGZ_06771 [Jatropha curcas]
Length=574

 Score =   151 bits (381),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 91/230 (40%), Positives = 140/230 (61%), Gaps = 15/230 (7%)
 Frame = -1

Query  828  AALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTADSC  649
            AAL  + E+ WF  V K +       +N DG TP+++FL+EH +L+   E+ +R TA+SC
Sbjct  347  AALQLQHELVWFEEVMKAMSPQLIDAKNYDGLTPREVFLEEHKELRKEGEEWMRNTANSC  406

Query  648  MIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILTFLS  469
            M+VATLIATV F++AFT PGG+    GIPIF++  +F VF +SDA++++FS+ ++L+FLS
Sbjct  407  MVVATLIATVVFASAFTVPGGHGQDNGIPIFLELTTFKVFIVSDAISLVFSVSTVLSFLS  466

Query  468  ILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAY--GRAWQPILIAAFV  298
            IL  R + DDF ++L  +L +G + L +SI  M+ AF A FF+ +  G+      +A   
Sbjct  467  ILTSRYSIDDFRMSLPTKLILGLSFLFISILAMMIAFIATFFIIFKHGQLKFAYPVAVIA  526

Query  297  ALPIASFLYLNARLWIDVVGSMLLKLLPFTKQTTYVGG**SRPN*ERW*R  148
            ++PI  F++ +A L+  V+ S  +  L F            RPN  R  R
Sbjct  527  SVPIFLFIWQHALLFYQVIRSTFISSLLF------------RPNKNRLFR  564



>gb|KHN24819.1| Ankyrin-1 [Glycine soja]
Length=585

 Score =   151 bits (381),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 128/205 (62%), Gaps = 4/205 (2%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL    E++WF  V+K +  S+    N +G  P++LF ++H  L    E  ++ TA
Sbjct  365  VSGAALQMMLELTWFEEVKKNMQPSYIERPNHEGIVPRELFTEQHKDLLKKGESWMKRTA  424

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
             SCM+V+TLIAT  FSAAF+ PGG  D +G P ++K+  FTVF ISDA+A+  S  S L 
Sbjct  425  SSCMVVSTLIATGVFSAAFSVPGGTKDDSGSPNYLKKHLFTVFAISDALALTLSTASTLI  484

Query  477  FLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfaftaafflAY--GRAW-QPILI  310
            FLSILI R  ++DF  +L  +L  G  +L +SI  M+ AF++AFF+ Y   + W  PI I
Sbjct  485  FLSILISRYAEEDFLRSLPFKLIFGLVSLFLSIVSMMGAFSSAFFITYYHAKTWVVPITI  544

Query  309  AAFVALPIASFLYLNARLWIDVVGS  235
            A FV  PI  F+YL  RLW D+V S
Sbjct  545  AVFVLFPILLFIYLQFRLWHDIVYS  569



>ref|XP_008229257.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X1 [Prunus mume]
Length=621

 Score =   151 bits (381),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 93/212 (44%), Positives = 126/212 (59%), Gaps = 3/212 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  V+KIV +    M+NK+GKTP++LF  EH  L    E  ++ TA
Sbjct  402  VSGAALQMQRELVWFEEVKKIVQALSTEMKNKNGKTPRELFTSEHKGLLHKGESWMKNTA  461

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
             SCM+VAT+IATV FSAAF+ PGG  DKTG P F+K  +F +F ISD VA+  S  S+L 
Sbjct  462  KSCMLVATIIATVVFSAAFSMPGGIADKTGAPNFVKETAFLIFAISDGVALFSSSTSMLM  521

Query  477  FLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfaftaa--fflAYGRAWQPILIA  307
            FL IL  R  ++DF  +L  +L VG A+L +S+  M+ AF+ A      YG  +    I 
Sbjct  522  FLYILTSRYAENDFLKSLPLKLMVGLASLFISMTSMMIAFSTAFYLSCHYGLGFVSDFIF  581

Query  306  AFVALPIASFLYLNARLWIDVVGSMLLKLLPF  211
             F  +P+  FL+L   L  D+  S     L F
Sbjct  582  IFAFVPVVMFLFLQYPLLSDMFLSTYCSSLIF  613



>ref|XP_011020234.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X2 [Populus euphratica]
Length=559

 Score =   150 bits (380),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 90/227 (40%), Positives = 137/227 (60%), Gaps = 4/227 (2%)
 Frame = -1

Query  903  NKKNDDQVEEEEDIMQESSALR-LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTP  727
            +++ ++ +     +++  S L  +  AAL  +RE+ WF  V+K+V       +N +GKTP
Sbjct  308  DREGNNMLHLAAKVLESPSRLNVIPGAALQLQRELLWFEEVKKVVQPRHIEEKNTNGKTP  367

Query  726  KQLFLKEHMKLKINAEKSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKR  547
              LF+++H  L    E+ +R TADSCM+VATLIATV F+AAFT PGGN    G P+F+K 
Sbjct  368  GALFIEQHKDLMKEGEQWMRDTADSCMLVATLIATVVFAAAFTVPGGNLQDKGTPVFLKE  427

Query  546  ASFTVFTISDAVAMIFSMVSILTFLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMl  370
             +F  F ISDA++++ S  S+LTFLSI   R  + +F  +L  RL +G   L +SI  M+
Sbjct  428  IAFKFFAISDAISLVTSASSLLTFLSIRTSRYAEQNFLWSLPNRLIIGLTTLFISIGAMM  487

Query  369  faftaafflAYGRAWQP--ILIAAFVALPIASFLYLNARLWIDVVGS  235
             AF A FFL +     P  I IA   + P+  F++ + RL++D++ S
Sbjct  488  VAFMATFFLVFSNKLLPYSIPIAVVASFPVIFFIWQHFRLFVDMIHS  534



>ref|XP_008467210.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Cucumis 
melo]
Length=625

 Score =   151 bits (381),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 99/216 (46%), Positives = 131/216 (61%), Gaps = 7/216 (3%)
 Frame = -1

Query  840  RLSTAALHYEREISWFMGVEKIVPSSFHHMRNKD--GKTPKQLFLKEHMKLKINAEKSIR  667
            R+S AAL  +RE+ W+  VEKIV SS    +  D    TP++LF  EH  L+ + E  +R
Sbjct  359  RVSGAALQMQRELIWYKEVEKIVLSSQLEAKCDDHLKLTPRELFTIEHQDLRKDGEAWMR  418

Query  666  GTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVS  487
             TA+SCM+V+TLIATV F+AAFT PGG DD  G PIF ++  FT+F ISDAV +I S  S
Sbjct  419  NTANSCMLVSTLIATVIFAAAFTVPGG-DDSEGTPIFRRKFWFTIFVISDAVGLISSSSS  477

Query  486  ILTFLSILIWRNTDDDF-HLALKRLFVGFAALGVSICGMlfaftaafflAY---GRAWQP  319
            IL FLSIL  R  + DF H    RL +GF +L VSI  M+ AF+A FF+ Y      W P
Sbjct  478  ILVFLSILTSRYAEHDFLHSLPSRLLIGFTSLFVSIVCMVVAFSATFFIHYHNNANMWVP  537

Query  318  ILIAAFVALPIASFLYLNARLWIDVVGSMLLKLLPF  211
             ++A    +P+  F  L  +LW+D+  +  L    F
Sbjct  538  TIVATTTIVPVCCFCVLQFKLWVDIYYNTYLSKFLF  573



>ref|XP_004145201.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Cucumis 
sativus]
Length=257

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 95/206 (46%), Positives = 122/206 (59%), Gaps = 7/206 (3%)
 Frame = -1

Query  807  EISWFMGVEKIV-PSSFHHMRNKDGK---TPKQLFLKEHMKLKINAEKSIRGTADSCMIV  640
             I WF  VEKIV PS        D     TP +LF KEH  L+ + E+ ++ TA+SCM+V
Sbjct  15   NILWFKEVEKIVLPSQRGAKCEVDSLIKLTPCELFTKEHKDLRKDGEEWMKNTANSCMLV  74

Query  639  ATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILTFLSILI  460
            +TLIATV F+AAFT PGGND  +G PIF     FT+F ISDA  ++ S  SIL FLSIL 
Sbjct  75   STLIATVVFAAAFTVPGGNDGNSGTPIFQHEFWFTIFVISDAFGLVSSSTSILMFLSILT  134

Query  459  WRNTDDDF-HLALKRLFVGFAALGVSICGMlfaftaafflAYGRA--WQPILIAAFVALP  289
             R  +DDF H    +L VG A+L +SI  M+ AF+A FF+ Y +   W P  + A   +P
Sbjct  135  SRYAEDDFLHSLPSKLLVGIASLFISIVCMVIAFSATFFMLYNKKNMWIPATVTAIAIVP  194

Query  288  IASFLYLNARLWIDVVGSMLLKLLPF  211
            I+ F  L+  LWID   +  L  L F
Sbjct  195  ISCFFALHFGLWIDTFHNTYLSRLLF  220



>gb|EYU28337.1| hypothetical protein MIMGU_mgv11b016979mg, partial [Erythranthe 
guttata]
Length=328

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 86/204 (42%), Positives = 120/204 (59%), Gaps = 3/204 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ W+  VEK +  S     N + K+P  +F +EH  LK   EK ++ T+
Sbjct  109  ISGAALQMQREMQWYKQVEKTISPSSRERMNNERKSPNMIFTEEHKNLKQEGEKWMKDTS  168

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
             SC I A LI T+ F+AA T PGG+  +TG P+F     F VF ISDA+++  S  S+L 
Sbjct  169  GSCTIAAALIVTIMFAAAITVPGGSKSETGFPVFATDKMFLVFAISDAISLFASTTSLLM  228

Query  477  FLSILIWRNTDDDF-HLALKRLFVGFAALGVSICGMlfaftaafflAYGR--AWQPILIA  307
            FLSIL  R  ++DF H+  KRL  G   L +SI  M+ AF+A  +L +GR  AW  I +A
Sbjct  229  FLSILTSRYAEEDFLHVLPKRLIFGLGTLFLSITFMMVAFSATLYLVFGRKNAWVLIPVA  288

Query  306  AFVALPIASFLYLNARLWIDVVGS  235
            A   LP+ SF+ L   L  D++ S
Sbjct  289  ALACLPVTSFVLLQYPLLADLISS  312



>ref|XP_011020233.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X1 [Populus euphratica]
Length=612

 Score =   150 bits (380),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 90/227 (40%), Positives = 137/227 (60%), Gaps = 4/227 (2%)
 Frame = -1

Query  903  NKKNDDQVEEEEDIMQESSALR-LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTP  727
            +++ ++ +     +++  S L  +  AAL  +RE+ WF  V+K+V       +N +GKTP
Sbjct  361  DREGNNMLHLAAKVLESPSRLNVIPGAALQLQRELLWFEEVKKVVQPRHIEEKNTNGKTP  420

Query  726  KQLFLKEHMKLKINAEKSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKR  547
              LF+++H  L    E+ +R TADSCM+VATLIATV F+AAFT PGGN    G P+F+K 
Sbjct  421  GALFIEQHKDLMKEGEQWMRDTADSCMLVATLIATVVFAAAFTVPGGNLQDKGTPVFLKE  480

Query  546  ASFTVFTISDAVAMIFSMVSILTFLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMl  370
             +F  F ISDA++++ S  S+LTFLSI   R  + +F  +L  RL +G   L +SI  M+
Sbjct  481  IAFKFFAISDAISLVTSASSLLTFLSIRTSRYAEQNFLWSLPNRLIIGLTTLFISIGAMM  540

Query  369  faftaafflAYGRAWQP--ILIAAFVALPIASFLYLNARLWIDVVGS  235
             AF A FFL +     P  I IA   + P+  F++ + RL++D++ S
Sbjct  541  VAFMATFFLVFSNKLLPYSIPIAVVASFPVIFFIWQHFRLFVDMIHS  587



>ref|XP_010644722.1| PREDICTED: uncharacterized protein LOC100258383 isoform X2 [Vitis 
vinifera]
Length=388

 Score =   148 bits (373),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 90/224 (40%), Positives = 128/224 (57%), Gaps = 4/224 (2%)
 Frame = -1

Query  894  NDDQVEEEEDIMQESSALRL-STAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQL  718
            N+D +      +     L L S AAL  +RE+ WF  +EK  P +F    N+DG  PK  
Sbjct  149  NNDNILHLAGKLAPPHRLSLVSGAALQMQRELHWFKEIEKYAPRAFSESENRDGDKPKMA  208

Query  717  FLKEHMKLKINAEKSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASF  538
            F+KEH KL    EK ++GTA    + A LIATV F+AA T PGGN D TGIP F K  +F
Sbjct  209  FIKEHKKLIKEGEKWMKGTAKFYTLAAALIATVVFAAAITIPGGNHDDTGIPNFSKEKAF  268

Query  537  TVFTISDAVAMIFSMVSILTFLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaf  361
             VF  +DA+++  S+ S+L  LSIL  R  +DDF  AL +RL  G   L +S+  M+ A+
Sbjct  269  KVFAAADALSLFLSIASVLICLSILTARYAEDDFIFALPRRLIFGLVTLFLSVTFMMIAY  328

Query  360  taafflAYG--RAWQPILIAAFVALPIASFLYLNARLWIDVVGS  235
            ++A +L +G  +AW  I +AA    P+  +  L   L ++++ S
Sbjct  329  SSAIYLLFGENKAWILITLAALACFPVTLYGILQFPLLVELIYS  372



>gb|KHN47696.1| Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat 
subunit C, partial [Glycine soja]
Length=736

 Score =   151 bits (382),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 90/222 (41%), Positives = 125/222 (56%), Gaps = 5/222 (2%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AA     EI WF  V+KI+P SF  ++N DG T ++LF KEH  L+   E+ ++ TA
Sbjct  508  VSGAAFQMCLEIIWFKEVKKIMPPSFIKLKNSDGLTAEELFTKEHEGLRKEGEEWMKRTA  567

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
            + CM+++T+IAT  F+AA   PGG DD T  P ++ +ASF VF ISDA A +FS  +IL 
Sbjct  568  EFCMLISTVIATAVFAAAINIPGGIDDGTNKPNYLNKASFQVFAISDAAAFVFSATAILI  627

Query  477  FLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfa--ftaafflAYGRAWQPILIA  307
            FLSILI R  + DFH +L  +L  G   L +SI  M+ A          YG    P +IA
Sbjct  628  FLSILISRYAEYDFHQSLPLKLICGLITLFISIACMMVAFGSAFFITYYYGLKAVPDIIA  687

Query  306  AFVALPIASFLYLNARLWIDVVGSMLL--KLLPFTKQTTYVG  187
                LP+  ++ L   LW D++ S      L   +K+  YV 
Sbjct  688  VLACLPLLLYIGLQFSLWSDIIYSTFYCRNLFKPSKRMIYVA  729



>ref|XP_010276715.1| PREDICTED: uncharacterized protein LOC104611391 isoform X3 [Nelumbo 
nucifera]
Length=592

 Score =   150 bits (378),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 93/208 (45%), Positives = 125/208 (60%), Gaps = 9/208 (4%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  VEKI    ++   N   K  K +F +EH  L   AEK ++ TA
Sbjct  357  VSGAALQMQRELQWFKEVEKIPTPGYNTRPNNSSKIAKDMFTEEHKDLLEKAEKWMKDTA  416

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKT------GIPIFIKRASFTVFTISDAVAMIFS  496
             SCM+VATLIATV F+AAFT PGGN+  +      G PIF++  SF VF ISDA+A+ FS
Sbjct  417  ASCMVVATLIATVVFTAAFTVPGGNNSDSGNNYDKGSPIFLEEKSFMVFAISDAIALFFS  476

Query  495  MVSILTFLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAYGR--AW  325
              S+L FLSIL  R  ++DF  +L  +L +G   L  SI  M+ AF+A FF+ +    +W
Sbjct  477  TSSVLMFLSILTSRYAEEDFLKSLPTKLIIGLVTLFFSIAAMMIAFSATFFIIFSHRFSW  536

Query  324  QPILIAAFVALPIASFLYLNARLWIDVV  241
              ILIAA    P+  F   +ARL  ++V
Sbjct  537  LSILIAALATFPVTLFALSHARLLAEIV  564



>ref|XP_003547425.2| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X1 [Glycine max]
 ref|XP_006597773.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X4 [Glycine max]
 ref|XP_006597774.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X5 [Glycine max]
 ref|XP_006597775.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X6 [Glycine max]
Length=730

 Score =   151 bits (381),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 90/222 (41%), Positives = 125/222 (56%), Gaps = 5/222 (2%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AA     EI WF  V+KI+P SF  ++N DG T ++LF KEH  L+   E+ ++ TA
Sbjct  502  VSGAAFQMCLEIIWFKEVKKIMPPSFIKLKNSDGLTAEELFTKEHEGLRKEGEEWMKRTA  561

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
            + CM+++T+IAT  F+AA   PGG DD T  P ++ +ASF VF ISDA A +FS  +IL 
Sbjct  562  EFCMLISTVIATAVFAAAINIPGGIDDGTNKPNYLNKASFQVFAISDAAAFVFSATAILI  621

Query  477  FLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfa--ftaafflAYGRAWQPILIA  307
            FLSILI R  + DFH +L  +L  G   L +SI  M+ A          YG    P +IA
Sbjct  622  FLSILISRYAEYDFHKSLPLKLICGLITLFISIACMMVAFGSAFFITYYYGLKAVPDIIA  681

Query  306  AFVALPIASFLYLNARLWIDVVGSMLL--KLLPFTKQTTYVG  187
                LP+  ++ L   LW D++ S      L   +K+  YV 
Sbjct  682  VLACLPLLLYIGLQFSLWSDIIYSTFYCRNLFKPSKRMIYVA  723



>ref|XP_010644721.1| PREDICTED: uncharacterized protein LOC100258383 isoform X1 [Vitis 
vinifera]
Length=404

 Score =   147 bits (372),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 90/224 (40%), Positives = 128/224 (57%), Gaps = 4/224 (2%)
 Frame = -1

Query  894  NDDQVEEEEDIMQESSALRL-STAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQL  718
            N+D +      +     L L S AAL  +RE+ WF  +EK  P +F    N+DG  PK  
Sbjct  165  NNDNILHLAGKLAPPHRLSLVSGAALQMQRELHWFKEIEKYAPRAFSESENRDGDKPKMA  224

Query  717  FLKEHMKLKINAEKSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASF  538
            F+KEH KL    EK ++GTA    + A LIATV F+AA T PGGN D TGIP F K  +F
Sbjct  225  FIKEHKKLIKEGEKWMKGTAKFYTLAAALIATVVFAAAITIPGGNHDDTGIPNFSKEKAF  284

Query  537  TVFTISDAVAMIFSMVSILTFLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaf  361
             VF  +DA+++  S+ S+L  LSIL  R  +DDF  AL +RL  G   L +S+  M+ A+
Sbjct  285  KVFAAADALSLFLSIASVLICLSILTARYAEDDFIFALPRRLIFGLVTLFLSVTFMMIAY  344

Query  360  taafflAYG--RAWQPILIAAFVALPIASFLYLNARLWIDVVGS  235
            ++A +L +G  +AW  I +AA    P+  +  L   L ++++ S
Sbjct  345  SSAIYLLFGENKAWILITLAALACFPVTLYGILQFPLLVELIYS  388



>ref|XP_010276714.1| PREDICTED: uncharacterized protein LOC104611391 isoform X2 [Nelumbo 
nucifera]
Length=595

 Score =   149 bits (377),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 93/208 (45%), Positives = 125/208 (60%), Gaps = 9/208 (4%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  VEKI    ++   N   K  K +F +EH  L   AEK ++ TA
Sbjct  360  VSGAALQMQRELQWFKEVEKIPTPGYNTRPNNSSKIAKDMFTEEHKDLLEKAEKWMKDTA  419

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKT------GIPIFIKRASFTVFTISDAVAMIFS  496
             SCM+VATLIATV F+AAFT PGGN+  +      G PIF++  SF VF ISDA+A+ FS
Sbjct  420  ASCMVVATLIATVVFTAAFTVPGGNNSDSGNNYDKGSPIFLEEKSFMVFAISDAIALFFS  479

Query  495  MVSILTFLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAYGR--AW  325
              S+L FLSIL  R  ++DF  +L  +L +G   L  SI  M+ AF+A FF+ +    +W
Sbjct  480  TSSVLMFLSILTSRYAEEDFLKSLPTKLIIGLVTLFFSIAAMMIAFSATFFIIFSHRFSW  539

Query  324  QPILIAAFVALPIASFLYLNARLWIDVV  241
              ILIAA    P+  F   +ARL  ++V
Sbjct  540  LSILIAALATFPVTLFALSHARLLAEIV  567



>ref|XP_009344348.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X3 [Pyrus x bretschneideri]
Length=553

 Score =   149 bits (377),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 93/212 (44%), Positives = 125/212 (59%), Gaps = 3/212 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  V+KIV   F  M+N  GKTP++LF  EH  L    E  ++ TA
Sbjct  335  VSGAALQMQRELVWFEEVQKIVQPPFIVMKNMQGKTPRELFTSEHEDLLRKGESWMKDTA  394

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
            +SCM+V+TLIATV FSAAF+ PGG +D  G P  IK  +F +F ISD VA+  S  +IL 
Sbjct  395  NSCMLVSTLIATVVFSAAFSIPGGINDNKGTPNSIKETAFLIFAISDGVALFSSSTAILM  454

Query  477  FLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfaftaafflAY--GRAWQPILIA  307
            FL IL  R  ++DF  +L  +L +G  +L VSI  M+  F+  F+L+   G  W P LI 
Sbjct  455  FLYILTSRYAENDFLKSLPLKLMIGLTSLFVSITSMMVTFSTTFYLSCHDGLIWVPDLIF  514

Query  306  AFVALPIASFLYLNARLWIDVVGSMLLKLLPF  211
             F  +P+A F +L   L  D+  S     L F
Sbjct  515  IFAFVPVALFAFLQYPLLFDMFFSTYYSSLLF  546



>ref|XP_008229300.1| PREDICTED: uncharacterized protein LOC103328663 isoform X2 [Prunus 
mume]
Length=276

 Score =   144 bits (364),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 92/227 (41%), Positives = 134/227 (59%), Gaps = 3/227 (1%)
 Frame = -1

Query  915  VVPANKKNDDQVEEEEDIMQESSALRLSTAALHYEREISWFMGVEKIVPSSFHHMRNKDG  736
            V   + +N++ +     +  ++    +S AAL  +RE+ WF  V+KIV      M+NKDG
Sbjct  31   VTYTDDENNNILHLAAKLAPQNQLNLVSGAALQMQRELVWFEEVKKIVQPLSIDMKNKDG  90

Query  735  KTPKQLFLKEHMKLKINAEKSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIF  556
            KTP++LF  EH  L    E  ++ TA+SCM+VAT+I TV FSAAFT PGG  D TG P F
Sbjct  91   KTPQELFTSEHEGLLCKGESWMKNTANSCMLVATIITTVVFSAAFTIPGGIADNTGAPKF  150

Query  555  IKRASFTVFTISDAVAMIFSMVSILTFLSILIWRNTDDDFHLALK-RLFVGFAALGVSIC  379
            +K  +F +F ISD VA+  S  S+L FL IL  R  ++DF  +L  +L VG A+L +S+ 
Sbjct  151  LKDTAFLIFVISDGVALFSSSTSMLMFLYILTSRYAENDFLKSLPLKLMVGLASLFISMT  210

Query  378  GMlfaftaafflAY--GRAWQPILIAAFVALPIASFLYLNARLWIDV  244
             M+ AF+ AF+L+   G  +    I  F  +P+  F++L   L  D+
Sbjct  211  SMMIAFSTAFYLSCHDGLGFVSDFIFIFAFVPVVLFVFLQYPLLCDM  257



>ref|XP_006597772.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X3 [Glycine max]
Length=763

 Score =   151 bits (381),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 90/222 (41%), Positives = 125/222 (56%), Gaps = 5/222 (2%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AA     EI WF  V+KI+P SF  ++N DG T ++LF KEH  L+   E+ ++ TA
Sbjct  535  VSGAAFQMCLEIIWFKEVKKIMPPSFIKLKNSDGLTAEELFTKEHEGLRKEGEEWMKRTA  594

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
            + CM+++T+IAT  F+AA   PGG DD T  P ++ +ASF VF ISDA A +FS  +IL 
Sbjct  595  EFCMLISTVIATAVFAAAINIPGGIDDGTNKPNYLNKASFQVFAISDAAAFVFSATAILI  654

Query  477  FLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfa--ftaafflAYGRAWQPILIA  307
            FLSILI R  + DFH +L  +L  G   L +SI  M+ A          YG    P +IA
Sbjct  655  FLSILISRYAEYDFHKSLPLKLICGLITLFISIACMMVAFGSAFFITYYYGLKAVPDIIA  714

Query  306  AFVALPIASFLYLNARLWIDVVGSMLL--KLLPFTKQTTYVG  187
                LP+  ++ L   LW D++ S      L   +K+  YV 
Sbjct  715  VLACLPLLLYIGLQFSLWSDIIYSTFYCRNLFKPSKRMIYVA  756



>ref|XP_010276713.1| PREDICTED: uncharacterized protein LOC104611391 isoform X1 [Nelumbo 
nucifera]
Length=642

 Score =   149 bits (377),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 93/208 (45%), Positives = 125/208 (60%), Gaps = 9/208 (4%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  VEKI    ++   N   K  K +F +EH  L   AEK ++ TA
Sbjct  407  VSGAALQMQRELQWFKEVEKIPTPGYNTRPNNSSKIAKDMFTEEHKDLLEKAEKWMKDTA  466

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKT------GIPIFIKRASFTVFTISDAVAMIFS  496
             SCM+VATLIATV F+AAFT PGGN+  +      G PIF++  SF VF ISDA+A+ FS
Sbjct  467  ASCMVVATLIATVVFTAAFTVPGGNNSDSGNNYDKGSPIFLEEKSFMVFAISDAIALFFS  526

Query  495  MVSILTFLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAYGR--AW  325
              S+L FLSIL  R  ++DF  +L  +L +G   L  SI  M+ AF+A FF+ +    +W
Sbjct  527  TSSVLMFLSILTSRYAEEDFLKSLPTKLIIGLVTLFFSIAAMMIAFSATFFIIFSHRFSW  586

Query  324  QPILIAAFVALPIASFLYLNARLWIDVV  241
              ILIAA    P+  F   +ARL  ++V
Sbjct  587  LSILIAALATFPVTLFALSHARLLAEIV  614



>gb|KGN50436.1| hypothetical protein Csa_5G174620 [Cucumis sativus]
Length=625

 Score =   149 bits (377),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 99/216 (46%), Positives = 131/216 (61%), Gaps = 7/216 (3%)
 Frame = -1

Query  840  RLSTAALHYEREISWFMGVEKIVPSSFHHMRNKD--GKTPKQLFLKEHMKLKINAEKSIR  667
            R+S AAL  +RE+ W+  VEKIV SS    +  D    TP++LF  EH  L+ + E  +R
Sbjct  359  RVSGAALQMQRELLWYKEVEKIVLSSQLEAKCDDPLKLTPRELFTIEHKDLRKDGEAWMR  418

Query  666  GTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVS  487
             TA+SCM+V+TLIATV F+AAFT PGG DD  G PIF ++  FT+F ISDAV +I S  S
Sbjct  419  NTANSCMLVSTLIATVIFAAAFTVPGG-DDIEGTPIFRRKFWFTIFVISDAVGLISSSSS  477

Query  486  ILTFLSILIWRNTDDDF-HLALKRLFVGFAALGVSICGMlfaftaafflAY---GRAWQP  319
            IL FLSIL  R  + DF H    RL +GF +L VSI  M+ AF+A FF+ Y      W P
Sbjct  478  ILVFLSILTSRYAEHDFLHSLPSRLLIGFTSLFVSIVCMVVAFSATFFIHYHNNANIWVP  537

Query  318  ILIAAFVALPIASFLYLNARLWIDVVGSMLLKLLPF  211
             ++A    +P+  F  L  +LW+D+  +  L    F
Sbjct  538  TIVATTTIVPVCCFCMLQFKLWVDIYYNTYLSKFLF  573



>ref|XP_006597771.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X2 [Glycine max]
Length=784

 Score =   151 bits (381),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 90/222 (41%), Positives = 125/222 (56%), Gaps = 5/222 (2%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AA     EI WF  V+KI+P SF  ++N DG T ++LF KEH  L+   E+ ++ TA
Sbjct  556  VSGAAFQMCLEIIWFKEVKKIMPPSFIKLKNSDGLTAEELFTKEHEGLRKEGEEWMKRTA  615

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
            + CM+++T+IAT  F+AA   PGG DD T  P ++ +ASF VF ISDA A +FS  +IL 
Sbjct  616  EFCMLISTVIATAVFAAAINIPGGIDDGTNKPNYLNKASFQVFAISDAAAFVFSATAILI  675

Query  477  FLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfa--ftaafflAYGRAWQPILIA  307
            FLSILI R  + DFH +L  +L  G   L +SI  M+ A          YG    P +IA
Sbjct  676  FLSILISRYAEYDFHKSLPLKLICGLITLFISIACMMVAFGSAFFITYYYGLKAVPDIIA  735

Query  306  AFVALPIASFLYLNARLWIDVVGSMLL--KLLPFTKQTTYVG  187
                LP+  ++ L   LW D++ S      L   +K+  YV 
Sbjct  736  VLACLPLLLYIGLQFSLWSDIIYSTFYCRNLFKPSKRMIYVA  777



>ref|XP_009344347.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X2 [Pyrus x bretschneideri]
Length=607

 Score =   149 bits (376),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 93/212 (44%), Positives = 125/212 (59%), Gaps = 3/212 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  V+KIV   F  M+N  GKTP++LF  EH  L    E  ++ TA
Sbjct  389  VSGAALQMQRELVWFEEVQKIVQPPFIVMKNMQGKTPRELFTSEHEDLLRKGESWMKDTA  448

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
            +SCM+V+TLIATV FSAAF+ PGG +D  G P  IK  +F +F ISD VA+  S  +IL 
Sbjct  449  NSCMLVSTLIATVVFSAAFSIPGGINDNKGTPNSIKETAFLIFAISDGVALFSSSTAILM  508

Query  477  FLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfaftaafflAY--GRAWQPILIA  307
            FL IL  R  ++DF  +L  +L +G  +L VSI  M+  F+  F+L+   G  W P LI 
Sbjct  509  FLYILTSRYAENDFLKSLPLKLMIGLTSLFVSITSMMVTFSTTFYLSCHDGLIWVPDLIF  568

Query  306  AFVALPIASFLYLNARLWIDVVGSMLLKLLPF  211
             F  +P+A F +L   L  D+  S     L F
Sbjct  569  IFAFVPVALFAFLQYPLLFDMFFSTYYSSLLF  600



>ref|XP_008229250.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Prunus 
mume]
Length=584

 Score =   149 bits (376),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 92/212 (43%), Positives = 123/212 (58%), Gaps = 3/212 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  V KIV      M+N DGKTP++LF  EH  L    E  ++ TA
Sbjct  365  VSGAALQMQRELVWFEEVTKIVQPLSIDMKNNDGKTPRELFTSEHEGLLCKGESWMKNTA  424

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
            +SCM+VAT+I TV FSAAF+ PGG  D TG P F+K  +F +F ISD VA+  S  S+L 
Sbjct  425  NSCMLVATIITTVVFSAAFSIPGGIADNTGAPKFLKDTAFLIFVISDGVALFSSSTSMLM  484

Query  477  FLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfaftaa--fflAYGRAWQPILIA  307
            FL IL  R  ++DF  +L  +L VGFA+L VS+  M+ AF+ A      YG  +    I 
Sbjct  485  FLYILTSRYAENDFLKSLPLKLMVGFASLFVSVTSMMIAFSTAFYLSCHYGLGFVSDFIF  544

Query  306  AFVALPIASFLYLNARLWIDVVGSMLLKLLPF  211
             F  +P+  F++L   L  D+  S     L F
Sbjct  545  IFAFVPVVLFVFLQYPLLCDMFLSTYYSSLIF  576



>ref|XP_010665704.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Beta 
vulgaris subsp. vulgaris]
Length=694

 Score =   150 bits (378),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 90/204 (44%), Positives = 127/204 (62%), Gaps = 4/204 (2%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +REI WF  V+K+V + +    NKD KTP  LF +EH +L+   E+ ++ TA
Sbjct  410  VSGAALQMQREIQWFKAVKKVVSTEYAEAENKDLKTPHSLFSEEHEELRAKGEEWMKKTA  469

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
            +SC +VATLIATV FSAAF  PGG D + G P  + RASF VF +S+AV++  S  S+L 
Sbjct  470  ESCALVATLIATVVFSAAFQLPGGVDSE-GSPNLMTRASFVVFALSNAVSLFTSTASVLM  528

Query  477  FLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfaftaafflAYGRA--WQPILIA  307
            FLSIL  R  + DF ++L  +L +G   L +SI  M+ AFTA F++   R   W P+ +A
Sbjct  529  FLSILTSRYAESDFLISLPLKLMMGLTLLFLSIATMMVAFTATFYMTLDRGVKWAPLPVA  588

Query  306  AFVALPIASFLYLNARLWIDVVGS  235
             F ++P+A F      L +D+  S
Sbjct  589  LFASIPVALFALQQYPLLVDIFRS  612



>ref|XP_009344346.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X1 [Pyrus x bretschneideri]
Length=612

 Score =   149 bits (376),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 90/201 (45%), Positives = 122/201 (61%), Gaps = 3/201 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  V+KIV   F  M+N  GKTP++LF  EH  L    E  ++ TA
Sbjct  394  VSGAALQMQRELVWFEEVQKIVQPPFIVMKNMQGKTPRELFTSEHEDLLRKGESWMKDTA  453

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
            +SCM+V+TLIATV FSAAF+ PGG +D  G P  IK  +F +F ISD VA+  S  +IL 
Sbjct  454  NSCMLVSTLIATVVFSAAFSIPGGINDNKGTPNSIKETAFLIFAISDGVALFSSSTAILM  513

Query  477  FLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfaftaafflAY--GRAWQPILIA  307
            FL IL  R  ++DF  +L  +L +G  +L VSI  M+  F+  F+L+   G  W P LI 
Sbjct  514  FLYILTSRYAENDFLKSLPLKLMIGLTSLFVSITSMMVTFSTTFYLSCHDGLIWVPDLIF  573

Query  306  AFVALPIASFLYLNARLWIDV  244
             F  +P+A F +L   L  D+
Sbjct  574  IFAFVPVALFAFLQYPLLFDM  594



>ref|XP_010256489.1| PREDICTED: uncharacterized protein LOC104596860 [Nelumbo nucifera]
Length=782

 Score =   150 bits (379),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 87/201 (43%), Positives = 122/201 (61%), Gaps = 3/201 (1%)
 Frame = -1

Query  828  AALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTADSC  649
            AAL  +RE+ WF+ VEK+VP  F   + K G T   LF KEH +L    EK ++ TA SC
Sbjct  574  AALQMQRELQWFVEVEKMVPPYFREYKKKKGMTAYTLFSKEHKELVSEGEKWMKETAASC  633

Query  648  MIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILTFLS  469
             IVATL+ T+ F+AAFT PGGN +  G+P+ ++   F VF ISDA+++  S  S+L FLS
Sbjct  634  TIVATLVITIMFAAAFTVPGGNKESEGVPLLLRTKPFMVFVISDALSLFSSTTSVLMFLS  693

Query  468  ILIWRNTDDDFHLALKR-LFVGFAALGVSICGMlfaftaafflAYGRA--WQPILIAAFV  298
            IL  R T++ F  +L R L +G   L VS+  M+ AF A  F+       W  I++A+F 
Sbjct  694  ILTSRYTEEAFLESLPRKLILGLVTLFVSLAAMMAAFCATIFILLDGHLRWISIVLASFA  753

Query  297  ALPIASFLYLNARLWIDVVGS  235
            + P+  FL L   L++D+V S
Sbjct  754  SFPVTMFLLLQLPLFVDMVRS  774



>ref|XP_004487934.1| PREDICTED: uncharacterized protein LOC101490749 [Cicer arietinum]
Length=199

 Score =   141 bits (356),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 114/176 (65%), Gaps = 3/176 (2%)
 Frame = -1

Query  753  MRNKDGKTPKQLFLKEHMKLKINAEKSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDK  574
            M+N +G TP QLF KEH +L    E  ++ TA SCM+V+TLIAT  FSA F+ PGGN+D 
Sbjct  8    MQNSEGSTPCQLFTKEHEELLQRGESWMQRTASSCMVVSTLIATGVFSAPFSLPGGNNDD  67

Query  573  TGIPIFIKRASFTVFTISDAVAMIFSMVSILTFLSILIWRNTDDDFHLALK-RLFVGFAA  397
            T  P ++ + SF VF++SD++A+I S  S+L FLSILI R  ++DF  +L  +L  G   
Sbjct  68   TRSPNYLDKPSFLVFSLSDSMALISSSTSVLIFLSILISRYAEEDFLKSLPFKLLAGLVT  127

Query  396  LGVSICGMlfaftaafflAY--GRAWQPILIAAFVALPIASFLYLNARLWIDVVGS  235
            L VSI  M+ AF++AFF+ Y  G  W P  IAA   LPI  F++L   LW D+V S
Sbjct  128  LFVSIISMMVAFSSAFFITYYHGLKWVPNFIAALAFLPIPLFIFLQFSLWSDIVYS  183



>ref|XP_008229295.1| PREDICTED: ankyrin repeat-containing protein At5g02620 isoform 
X1 [Prunus mume]
Length=316

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 95/238 (40%), Positives = 137/238 (58%), Gaps = 3/238 (1%)
 Frame = -1

Query  915  VVPANKKNDDQVEEEEDIMQESSALRLSTAALHYEREISWFMGVEKIVPSSFHHMRNKDG  736
            V   + +N++ +     +  ++    +S AAL  +RE+ WF  V+KIV      M+NKDG
Sbjct  71   VTYTDDENNNILHLAAKLAPQNQLNLVSGAALQMQRELVWFEEVKKIVQPLSIDMKNKDG  130

Query  735  KTPKQLFLKEHMKLKINAEKSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIF  556
            KTP++LF  EH  L    E  ++ TA+SCM+VAT+I TV FSAAFT PGG  D TG P F
Sbjct  131  KTPQELFTSEHEGLLCKGESWMKNTANSCMLVATIITTVVFSAAFTIPGGIADNTGAPKF  190

Query  555  IKRASFTVFTISDAVAMIFSMVSILTFLSILIWRNTDDDFHLALK-RLFVGFAALGVSIC  379
            +K  +F +F ISD VA+  S  S+L FL IL  R  ++DF  +L  +L VG A+L +S+ 
Sbjct  191  LKDTAFLIFVISDGVALFSSSTSMLMFLYILTSRYAENDFLKSLPLKLMVGLASLFISMT  250

Query  378  GMlfaftaafflAY--GRAWQPILIAAFVALPIASFLYLNARLWIDVVGSMLLKLLPF  211
             M+ AF+ AF+L+   G  +    I  F  +P+  F++L   L  D+  S     L F
Sbjct  251  SMMIAFSTAFYLSCHDGLGFVSDFIFIFAFVPVVLFVFLQYPLLCDMFLSTYYSSLIF  308



>ref|XP_008440652.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Cucumis 
melo]
Length=676

 Score =   149 bits (375),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 102/218 (47%), Positives = 127/218 (58%), Gaps = 9/218 (4%)
 Frame = -1

Query  840  RLSTAALHYEREISWFMGVEKIV-PSSFHHMRNKDGK----TPKQLFLKEHMKLKINAEK  676
            ++S AAL  +RE+ WF  VEKIV PS      + D      TP++LF KEH  L+   E+
Sbjct  437  KVSGAALQMQRELLWFKEVEKIVLPSQLEAKCDTDDVSIKLTPRELFTKEHAHLRRKGEE  496

Query  675  SIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFS  496
             ++ TA+SCM+VATLIATV F+AAFT PGG D+ TG PI  +   FTVF +SDA  +I S
Sbjct  497  WMKNTANSCMLVATLIATVVFAAAFTVPGGGDNSTGTPIHRREVWFTVFVMSDAAGLITS  556

Query  495  MVSILTFLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfaftaafflAYGRA--W  325
              SIL FLS+L  R  +DDF  +L  RL  G   L  SI  M+ AFTA FFL Y  A   
Sbjct  557  SSSILMFLSMLTSRYAEDDFLHSLPLRLLFGLTMLFFSIVCMVVAFTATFFLLYHEAKIG  616

Query  324  QPILIAAFVALPIASFLYLNARLWIDVVGSMLLKLLPF  211
             PI IAA   +PI     L  +LWID   +  L    F
Sbjct  617  VPITIAAMAIIPIGC-CALQFKLWIDTFHNTFLSRFLF  653



>ref|XP_009346492.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X1 [Pyrus x bretschneideri]
Length=622

 Score =   148 bits (374),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 92/246 (37%), Positives = 137/246 (56%), Gaps = 5/246 (2%)
 Frame = -1

Query  933  TATQKEVVPA--NKKNDDQVEEEEDIMQESSALRLSTAALHYEREISWFMGVEKIVPSSF  760
            T + K+++    + +N++ + +   +  +     +S AAL  +RE+ WF  VEKIV   F
Sbjct  364  TGSIKDIIATYIDNENNNILHQAAKLAPQDQLNLVSGAALQMQRELVWFEEVEKIVQPPF  423

Query  759  HHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTADSCMIVATLIATVAFSAAFTAPGGND  580
              M+N   KTP++LF  EH  L    E  ++ TA+ CM+V+T+IATV FSAAF+ PGG  
Sbjct  424  MDMKNNQDKTPRELFTSEHKDLLCKGESWMKDTANYCMLVSTIIATVVFSAAFSIPGGIS  483

Query  579  DKTGIPIFIKRASFTVFTISDAVAMIFSMVSILTFLSILIWRNTDDDFHLALK-RLFVGF  403
            D  G P F+K  +F +FTISD +A+  S  +IL FL IL  R  ++DF  +L  +L +G 
Sbjct  484  DNKGTPNFVKETAFLIFTISDGIALFSSSTAILMFLYILTSRYAENDFLKSLPLKLMIGL  543

Query  402  AALGVSICGMlfaftaa--fflAYGRAWQPILIAAFVALPIASFLYLNARLWIDVVGSML  229
             +L VSI  M+ AF+ A      +   W P L+  F  +P+A F +L   L  D+  S  
Sbjct  544  TSLFVSITSMMVAFSTAFYLSCHHELRWVPDLLFIFSFVPVALFAFLQYPLLSDMFFSTY  603

Query  228  LKLLPF  211
               L F
Sbjct  604  CSSLLF  609



>emb|CAN70012.1| hypothetical protein VITISV_017115 [Vitis vinifera]
Length=561

 Score =   148 bits (373),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 110/184 (60%), Gaps = 3/184 (2%)
 Frame = -1

Query  915  VVPANKKNDDQVEEEEDIMQESSALRLST-AALHYEREISWFMGVEKIVPSSFHHMRNKD  739
            +VP   +ND+ +      +       +   AAL  +RE+ WF  VEK+V  SF   +N+D
Sbjct  338  IVPNKDENDNNILHLAGRLAPPRQRNIVVGAALQMQRELLWFREVEKMVLPSFRERKNRD  397

Query  738  GKTPKQLFLKEHMKLKINAEKSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPI  559
            G+TP  LF KEH  L    EK +RGTA   M+VATLIATV F+AA T PGG++  TGIP+
Sbjct  398  GETPWDLFTKEHKDLMKEGEKWMRGTAAQSMLVATLIATVVFAAALTVPGGSNQDTGIPV  457

Query  558  FIKRASFTVFTISDAVAMIFSMVSILTFLSI-LIWRNTDDDF-HLALKRLFVGFAALGVS  385
             +++ SF +F +SDA+A+  S+ SIL FLSI L  R  DDDF  L   RL  G   L +S
Sbjct  458  LLRKKSFIIFAVSDAIALFTSLTSILVFLSIVLTSRYADDDFLELLPSRLMFGLFTLFIS  517

Query  384  ICGM  373
            I  M
Sbjct  518  IISM  521



>emb|CDP11257.1| unnamed protein product [Coffea canephora]
Length=691

 Score =   149 bits (375),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 91/204 (45%), Positives = 125/204 (61%), Gaps = 3/204 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  VEK V   +  MR+ +G+ P  LF +EH  L  + E+ ++ TA
Sbjct  472  VSGAALQMQRELLWFKEVEKNVQPLYKEMRDSEGRMPHMLFTQEHKALLKSGERWMKDTA  531

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
             SCM+VATLI TV F+A FT PGGN++ TG PIF+K  +F +F+ISDA+A+  S+ SIL 
Sbjct  532  SSCMLVATLITTVMFAAIFTVPGGNNNDTGTPIFLKDKAFIIFSISDALALFSSVTSILM  591

Query  477  FLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAYGR--AWQPILIA  307
            FLSIL  R  + DF   L KRL +G   L  SI  ML AF+A+F + +G   AW  I +A
Sbjct  592  FLSILTSRYAEVDFMETLPKRLIIGLMTLFFSIASMLIAFSASFSIVHGHKIAWIIIPVA  651

Query  306  AFVALPIASFLYLNARLWIDVVGS  235
                +P+  F +    L  D+  S
Sbjct  652  LAACIPVLLFAFSQFPLVADMFHS  675



>ref|XP_010058027.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Eucalyptus 
grandis]
Length=745

 Score =   149 bits (376),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 89/204 (44%), Positives = 126/204 (62%), Gaps = 3/204 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  VEK V +    MR+K G+TP+ LF +EH  L    E  ++ TA
Sbjct  525  VSGAALQMQRELLWFKEVEKTVHTLSKQMRDKSGRTPRMLFTEEHRALVKEGEDWMKSTA  584

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
             SCM+VATLI TV F+A FT PGG ++ +G+PI ++  +F  F I+DA A+  S+ SIL 
Sbjct  585  SSCMLVATLITTVMFAAIFTVPGGTNNNSGVPILLESTAFITFAIADAFALFSSVTSILM  644

Query  477  FLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAYGR--AWQPILIA  307
            FLSIL  R  ++DF  +L KRL +G   L +SI  ML AF+A  F+ +G   AW  + +A
Sbjct  645  FLSILTSRYAEEDFLESLPKRLIIGLTTLFLSIASMLIAFSATIFIVFGSHLAWILVPVA  704

Query  306  AFVALPIASFLYLNARLWIDVVGS  235
                +PI  F +L+  L  D++ S
Sbjct  705  LASCIPITLFAFLHFPLLNDMLCS  728



>ref|XP_010665509.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Beta 
vulgaris subsp. vulgaris]
Length=494

 Score =   147 bits (370),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 89/204 (44%), Positives = 123/204 (60%), Gaps = 4/204 (2%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S +AL  +RE+ WF  VEK+V   +    NKD  +P  LF +EH  L+   E+ ++ TA
Sbjct  274  VSGSALQMQRELLWFQAVEKVVRPEYAEAENKDHISPHVLFTREHNNLRTKGEEWMKQTA  333

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
             SC +VATLIATV F+AAFT PGG D K G P+F+ +ASF VF++ +A+++  S  SIL 
Sbjct  334  QSCSVVATLIATVVFAAAFTLPGGVDSK-GTPVFVNQASFIVFSLCNALSLFSSSTSILM  392

Query  477  FLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfaftaafflAY--GRAWQPILIA  307
            FLSIL  R  + DF  +L  +L  G   L VSI  M+ AF+  FF+ +  G  W PI I 
Sbjct  393  FLSILTSRYAEQDFLKSLPLKLMTGLIGLFVSIVTMMAAFSVTFFITFRQGVQWIPIPII  452

Query  306  AFVALPIASFLYLNARLWIDVVGS  235
             F A+P+A F      L +D+  S
Sbjct  453  LFAAIPVALFALQQYPLLLDIYCS  476



>emb|CAN81449.1| hypothetical protein VITISV_011174 [Vitis vinifera]
Length=891

 Score =   149 bits (376),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 95/204 (47%), Positives = 120/204 (59%), Gaps = 8/204 (4%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  VEK++  ++   +N+ GKTP  LF +EH  L  + EK +R TA
Sbjct  676  ISGAALQMQRELLWFKEVEKLMQPTYREKKNRQGKTPWVLFTEEHRDLMKDGEKWMRETA  735

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
               M+VATLIATV FSAAFT PGG+  +T  PI +      VF +SD +A+  S  SIL 
Sbjct  736  AQSMLVATLIATVVFSAAFTVPGGHSQQTDTPILL-----MVFAVSDGLALFTSSTSILM  790

Query  477  FLSILIWRNTDDDF-HLALKRLFVGFAALGVSICGMlfaftaafflAY--GRAWQPILIA  307
            FLSIL  R  + DF H    RL  G  AL VSI  M+  FT  FF+ Y  G AW PILIA
Sbjct  791  FLSILTSRYAEQDFLHSLPSRLMFGLTALFVSIITMMVTFTITFFIVYHHGFAWVPILIA  850

Query  306  AFVALPIASFLYLNARLWIDVVGS  235
             F   P++ F  L   L  DV+ S
Sbjct  851  LFATGPVSLFASLQYPLLADVINS  874



>ref|XP_011078078.1| PREDICTED: uncharacterized protein LOC105161921 [Sesamum indicum]
Length=763

 Score =   148 bits (373),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 88/204 (43%), Positives = 120/204 (59%), Gaps = 3/204 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  + EI W+  VE  V        N  GK+PK +F +EH  LK   EK ++ T+
Sbjct  544  ISGAALQMQHEIQWYKEVENFVHPHSRERLNYAGKSPKMVFTEEHKILKEEGEKWMKDTS  603

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
            +SC I A LIATV F+AA T PGGND   G PIF   ++F +F ISDAV++  S  S+L 
Sbjct  604  NSCTIAAALIATVMFAAAITVPGGNDSSNGFPIFSGNSAFIMFAISDAVSLFTSATSLLM  663

Query  477  FLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAYGR--AWQPILIA  307
            FL+IL  R  ++DF   L KRL +G   L +SI  M+ AF+A  +L +GR  +W  I + 
Sbjct  664  FLAILTSRYAEEDFLYVLPKRLIIGLGTLFLSITFMMVAFSATLYLVFGRKESWVLIPVG  723

Query  306  AFVALPIASFLYLNARLWIDVVGS  235
                LP+ SF+ L   L +D+V S
Sbjct  724  VLACLPVTSFVLLQFPLLVDLVYS  747



>ref|XP_008364280.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Malus 
domestica]
Length=256

 Score =   141 bits (356),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 82/206 (40%), Positives = 122/206 (59%), Gaps = 8/206 (4%)
 Frame = -1

Query  828  AALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPK-----QLFLKEHMKLKINAEKSIRG  664
            +AL  +RE+ WF  VEK +   F   +  +GKTP+     ++F++EH  L+   EK ++ 
Sbjct  42   SALQLQRELQWFKAVEKFMCPVFREWKTPEGKTPEGKTAIZVFVEEHKGLREEGEKWMKD  101

Query  663  TADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSI  484
            T+ SCM+VA L+A+V FSAAFTAPGGN    G PIF+ + +F VF ISDA+++  S+ S+
Sbjct  102  TSTSCMVVAILVASVMFSAAFTAPGGNHTDKGTPIFLSKTTFKVFAISDALSLFSSLTSV  161

Query  483  LTFLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAYGRA--WQPIL  313
            L FLS+L  R  + DF  AL KRL +G  +L  S+  M+ AF  A  +   +   W  + 
Sbjct  162  LIFLSLLTXRYAEKDFLEALPKRLILGLGSLFFSLATMMVAFGTALSIVLTQRLDWIYVP  221

Query  312  IAAFVALPIASFLYLNARLWIDVVGS  235
            I      P+A F+ L   L+I ++ S
Sbjct  222  ITLLACFPVAMFVILQLPLFIQMIRS  247



>ref|XP_008229901.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Prunus 
mume]
Length=622

 Score =   146 bits (369),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 92/212 (43%), Positives = 123/212 (58%), Gaps = 3/212 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  V+K V      M+NK GKTP++LF  EH  L    E  ++ TA
Sbjct  403  VSGAALQMQRELVWFEEVKKNVQPLSTEMKNKKGKTPRELFTSEHKGLLHKGESWMKNTA  462

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
             SCM+VAT+IATV FSAAF+ PGG  DKTG P F+K  +F +F ISD VA+  S  S+L 
Sbjct  463  KSCMLVATIIATVVFSAAFSIPGGIADKTGAPNFVKETAFLIFAISDGVALFSSSTSMLM  522

Query  477  FLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfaftaa--fflAYGRAWQPILIA  307
            FL IL  R  ++DF  +L  +L VG A+L +S+  M+ AF+ A      YG  +    I 
Sbjct  523  FLYILTSRYAENDFLKSLPLKLMVGLASLFISMTSMMIAFSTAFYLSCHYGLGFVSDFIF  582

Query  306  AFVALPIASFLYLNARLWIDVVGSMLLKLLPF  211
             F  +P+  FL+L   L  D+  S     L F
Sbjct  583  IFAFVPVVLFLFLQYPLLSDMFLSTYCSSLIF  614



>ref|XP_004153918.1| PREDICTED: uncharacterized protein LOC101219138, partial [Cucumis 
sativus]
Length=635

 Score =   146 bits (369),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 101/150 (67%), Gaps = 1/150 (1%)
 Frame = -1

Query  840  RLSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGT  661
            R++ AAL  +RE+ WF  VEKI     H MR  DG TP+++F KEH +L+ + E+ ++ T
Sbjct  486  RVAGAALQMQRELLWFKEVEKISVPMHHEMRCADGLTPREIFTKEHRQLQKDGEEWMKKT  545

Query  660  ADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSIL  481
            A SCM+ ATL+AT+ F+AAFT PGGNDDK GIPI  +  +FTVF ISDA A++ S+ SIL
Sbjct  546  ASSCMVAATLVATIVFAAAFTVPGGNDDKDGIPILEQNKAFTVFIISDAAALVTSITSIL  605

Query  480  TFLSILIWRNTDDDFHLALK-RLFVGFAAL  394
              LSI   R   +DF + L  +L +  A+L
Sbjct  606  VSLSIFTSRYAAEDFLVTLPWKLALELASL  635



>ref|XP_006427804.1| hypothetical protein CICLE_v10025204mg [Citrus clementina]
 gb|ESR41044.1| hypothetical protein CICLE_v10025204mg [Citrus clementina]
Length=603

 Score =   145 bits (367),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 92/242 (38%), Positives = 132/242 (55%), Gaps = 5/242 (2%)
 Frame = -1

Query  945  LRLSTATQKEVVPAN-KKNDDQVEEEEDIMQESSAL-RLSTAALHYEREISWFMGVEKIV  772
            L  +   +K  V  N  K  + +  +   +  SS L R+S AAL  +RE+ WF  VE IV
Sbjct  343  LIYTMGAKKNSVATNWDKAHNNILHQAAFLAPSSQLDRVSGAALQMQRELQWFKEVESIV  402

Query  771  PSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTADSCMIVATLIATVAFSAAFTAP  592
               +  M N   KTP+ LF  +H KL    EK ++ TA+SC +VA LIAT+ FSAAFT P
Sbjct  403  QPKYKEMVNLHYKTPRALFSDQHKKLVEQGEKWMKETAESCTVVAALIATIMFSAAFTVP  462

Query  591  GGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILTFLSILIWRNTDDDFHLALKR-L  415
            GG D+ TGIP+++ R SF VF ++DA+++  S  S+L FL IL  R  ++DF  +L R L
Sbjct  463  GGYDEYTGIPLYLHRNSFMVFIVADAMSLFSSCTSVLMFLGILTSRYGEEDFLKSLPRKL  522

Query  414  FVGFAALGVSICGMlfaftaafflAYGR--AWQPILIAAFVALPIASFLYLNARLWIDVV  241
             +G ++L  SI  M+  F     +      AW    I    +LP+  F  L   L +++ 
Sbjct  523  IIGLSSLFFSIATMMVTFGVTLVIILKARIAWVSFPIILLASLPVTLFALLQFPLLVEIF  582

Query  240  GS  235
             S
Sbjct  583  YS  584



>ref|XP_007030435.1| Ankyrin repeat family protein, putative [Theobroma cacao]
 gb|EOY10937.1| Ankyrin repeat family protein, putative [Theobroma cacao]
Length=613

 Score =   145 bits (367),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 87/205 (42%), Positives = 126/205 (61%), Gaps = 8/205 (4%)
 Frame = -1

Query  834  STAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTAD  655
            S AAL  +RE+ W+  +E I       + +  GKT    F +   +++ NAEK ++ T+D
Sbjct  387  SCAALQMQREVQWYKAIESIQHPRMKQLTSAKGKTAFDCFSENRKQMRENAEKWMKDTSD  446

Query  654  SCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILTF  475
            SCM+V+TLIATVAF+ AFT PGGN+++ GIPIF+ + SF VF  SDA+A+  S+ SIL F
Sbjct  447  SCMLVSTLIATVAFAVAFTVPGGNNEQ-GIPIFLNKTSFRVFVYSDALALFSSVTSILMF  505

Query  474  LSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAYGR----AWQPILI  310
            LSIL     ++DFH AL KR+ +G A+L  +I  M+ AF AA  +         W PI+ 
Sbjct  506  LSILTSSYKEEDFHRALPKRMIIGLASLFFAIATMMVAFGAALAIVLSERLKWVWGPIIF  565

Query  309  AAFVALPIASFLYLNARLWIDVVGS  235
            +A  + P   F+ L   L+I++V S
Sbjct  566  SA--SFPATLFIMLQLPLFIEMVQS  588



>gb|KDO77346.1| hypothetical protein CISIN_1g044420mg, partial [Citrus sinensis]
Length=545

 Score =   145 bits (366),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 92/204 (45%), Positives = 127/204 (62%), Gaps = 3/204 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL   RE+ WF  VEKIV  +F  M+N +GKTP++LF  EH  L  + E  ++ TA
Sbjct  328  VSGAALQMHRELLWFKEVEKIVQPTFREMKNSEGKTPRELFSIEHSSLLRSGELWMKNTA  387

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
            +SCM+VATLIAT+ F+AAF+ PGGND+  GIPI ++   F VF +SD +A+  S +SIL 
Sbjct  388  ESCMLVATLIATIMFAAAFSVPGGNDNNKGIPIHLRETLFQVFAMSDVMALSSSSISILM  447

Query  477  FLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfaftaafflAYGRA--WQPILIA  307
            FLSIL  R  + DF  +L  +L +G +AL +SI  M+ AF+  FFLAY     W   +  
Sbjct  448  FLSILTSRYAETDFLKSLPLKLMIGLSALFISIINMMVAFSTTFFLAYHDRLNWVTTVTT  507

Query  306  AFVALPIASFLYLNARLWIDVVGS  235
               A+P+  F+ L   L  D+  S
Sbjct  508  VLAAVPVTLFVLLQYPLLNDIFYS  531



>ref|XP_009790150.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X1 [Nicotiana sylvestris]
Length=725

 Score =   147 bits (370),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 87/187 (47%), Positives = 121/187 (65%), Gaps = 3/187 (2%)
 Frame = -1

Query  786  VEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTADSCMIVATLIATVAFSA  607
            V+ IV +S+  MR+  G+TP  LF +EH +L    EK ++ TA SCM+VA LI TV F+A
Sbjct  523  VKTIVQASYKEMRDSKGRTPGMLFAEEHKELVKEGEKWMKETASSCMLVAALITTVMFAA  582

Query  606  AFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILTFLSILIWRNTDDDFHLA  427
             FT PGGN+D TG PIF+K  +F +F+I+DA+A+  S+ SIL FLSIL  R  ++DF   
Sbjct  583  IFTVPGGNNDDTGTPIFLKEKTFILFSITDALALFSSVTSILMFLSILTSRYAEEDFLST  642

Query  426  L-KRLFVGFAALGVSICGMlfaftaafflAYGR--AWQPILIAAFVALPIASFLYLNARL  256
            L KRL +GF  L V+I  ML AF+++FF+  G   AW  I +A   ++PI  F +L   L
Sbjct  643  LPKRLILGFITLFVAIAAMLVAFSSSFFIVLGHQMAWIIIPVAVLASIPITLFAFLQFPL  702

Query  255  WIDVVGS  235
              D++ S
Sbjct  703  LADMIRS  709



>ref|XP_007207536.1| hypothetical protein PRUPE_ppa015617mg, partial [Prunus persica]
 gb|EMJ08735.1| hypothetical protein PRUPE_ppa015617mg, partial [Prunus persica]
Length=449

 Score =   144 bits (364),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 93/216 (43%), Positives = 130/216 (60%), Gaps = 7/216 (3%)
 Frame = -1

Query  837  LSTAALHYEREISWF----MGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSI  670
            +S AAL  +RE+ WF    + V+KIV      M+NKDGKTP++LF  EH  L    E  +
Sbjct  226  VSGAALQMQRELVWFEVPLLEVKKIVQPVSIDMKNKDGKTPRELFTSEHEGLLCKGESWM  285

Query  669  RGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMV  490
            + TA+SCM+VAT+I TV FSAAF+ PGG  D TG P F+K  +F +F ISD VA+  S  
Sbjct  286  KNTANSCMLVATIITTVVFSAAFSIPGGIADNTGAPKFLKDTAFLIFAISDGVALFSSST  345

Query  489  SILTFLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfaftaafflA--YGRAWQP  319
            S+L FL IL  R  ++DF  +L  +L VG A+L +S+  M+ AF+ AF+L+  YG  +  
Sbjct  346  SMLMFLYILTSRYAENDFLKSLPLKLMVGLASLFISMTSMMIAFSTAFYLSCHYGLRFVS  405

Query  318  ILIAAFVALPIASFLYLNARLWIDVVGSMLLKLLPF  211
              I  F  +P+  F++L  +L  D+  S     L F
Sbjct  406  DFIFIFAFVPVVLFVFLQYQLLCDMFLSTYYSSLIF  441



>ref|XP_010665694.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=694

 Score =   146 bits (369),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 91/204 (45%), Positives = 124/204 (61%), Gaps = 4/204 (2%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S A L  +REI WF  V+KIV   +    N D KTP  LF +EH +L+   E+ ++ TA
Sbjct  389  VSGATLQMQREILWFKAVKKIVRPEYIEAENNDRKTPHALFREEHERLRTKGEEWMKKTA  448

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
            +SC +VATLIATV FSAAF  PGG ++K G P+  KRASF VF+IS+ V++  S  S+L 
Sbjct  449  ESCALVATLIATVVFSAAFQLPGGINEK-GYPVLQKRASFVVFSISNGVSLFTSTASVLM  507

Query  477  FLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfaftaafflAY--GRAWQPILIA  307
            FLSIL  R  + DF ++L  +L  G   L +SI  M+ AFTA FF+ +  G  W PI IA
Sbjct  508  FLSILTSRYAEQDFLVSLPLKLMSGLILLLISIATMIVAFTATFFITFREGVTWAPIPIA  567

Query  306  AFVALPIASFLYLNARLWIDVVGS  235
               ++P+  F      L +D+  S
Sbjct  568  LIASIPVTLFTLQQYPLLMDIYQS  591



>ref|XP_007216370.1| hypothetical protein PRUPE_ppa019187mg [Prunus persica]
 gb|EMJ17569.1| hypothetical protein PRUPE_ppa019187mg [Prunus persica]
Length=733

 Score =   146 bits (369),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 81/198 (41%), Positives = 124/198 (63%), Gaps = 3/198 (2%)
 Frame = -1

Query  828  AALHYEREISWFMGVEKIVPSSFHHMRNKDGK-TPKQLFLKEHMKLKINAEKSIRGTADS  652
            AAL  +RE+ WF  VE+I+      +RNK  + T ++LF K H KL    E+S++GTA S
Sbjct  518  AALQMQRELQWFKEVERILHPQHLEIRNKTEQITARELFTKNHKKLVKEGEESMKGTATS  577

Query  651  CMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILTFL  472
            C +V  LI T+ F+AAFT PGGN+  TG PIF+++  F VF ISD++++  S  S++ FL
Sbjct  578  CTVVGALIVTIMFAAAFTVPGGNNQDTGFPIFLRKKFFRVFLISDSISLFSSTTSVMIFL  637

Query  471  SILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAY-GRAWQPILIAAFV  298
             IL  R  +DDF  +L  ++ +G   L +SI  M+ AF++  F+   G +W  I I+   
Sbjct  638  GILTSRYAEDDFLRSLPTKMLLGLFTLFLSIAAMMVAFSSTLFIMLEGESWVSIPISLLA  697

Query  297  ALPIASFLYLNARLWIDV  244
             +PIASF+++   L++D+
Sbjct  698  GVPIASFVWMQFPLFLDI  715



>ref|XP_010644720.1| PREDICTED: uncharacterized protein LOC100248044 [Vitis vinifera]
Length=581

 Score =   145 bits (366),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 85/204 (42%), Positives = 123/204 (60%), Gaps = 3/204 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  +EK  P +F    N++   PK +F+KEH KL    EK ++GTA
Sbjct  362  VSGAALQMQRELHWFKEIEKYAPRAFSESENENKDKPKMVFIKEHEKLIKEGEKWMKGTA  421

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
                + A LIATV F+AA T PGGN D TGIP F K  +F VF  SD++++  S+ S+L 
Sbjct  422  KCYALAAALIATVVFAAAITIPGGNHDDTGIPNFSKEKAFKVFAASDSLSLFLSIASVLI  481

Query  477  FLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAYG--RAWQPILIA  307
             LSIL  R  +DDF  AL +RL  G   L +S+  M+ A+++A +L +G  +AW  I +A
Sbjct  482  CLSILTARYAEDDFLFALPRRLIFGLVTLFLSVTFMMIAYSSAIYLLFGEKKAWILITLA  541

Query  306  AFVALPIASFLYLNARLWIDVVGS  235
            A   LP+  +  L   L ++++ S
Sbjct  542  ALACLPVTLYGILQFPLLVELIYS  565



>ref|XP_010244048.1| PREDICTED: uncharacterized protein LOC104587960 [Nelumbo nucifera]
Length=884

 Score =   147 bits (372),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 92/233 (39%), Positives = 134/233 (58%), Gaps = 3/233 (1%)
 Frame = -1

Query  924  QKEVVPANKKNDDQVEEEEDIMQESSALRLSTAALHYEREISWFMGVEKIVPSSFHHMRN  745
            Q  + P + +++  +     +   S   R+S AAL  +RE+ W+  V K VP  F    N
Sbjct  494  QSHITPFDNQDNSLLHLAAMLSPYSQLSRVSGAALQMQRELQWYKEVGKFVPPVFAERIN  553

Query  744  KDGKTPKQLFLKEHMKLKINAEKSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGI  565
            K+G+ P  LF ++H  L    E  ++GTA SC +VA LIAT+ F+AAFT PGGN+  TGI
Sbjct  554  KNGQIPPTLFTEQHKDLVKEGETWMKGTASSCTVVAALIATIMFTAAFTVPGGNNSDTGI  613

Query  564  PIFIKRASFTVFTISDAVAMIFSMVSILTFLSILIWRNTDDDFHLAL-KRLFVGFAALGV  388
            PIF+ R +F +F ISDA ++  S  S+L FL IL  R  ++DF ++L KRL +G A L  
Sbjct  614  PIFLHRKAFMIFIISDAFSLFSSSASMLMFLGILTSRYAEEDFLVSLPKRLIIGLATLFF  673

Query  387  SICGMlfa-ftaafflAYGRA-WQPILIAAFVALPIASFLYLNARLWIDVVGS  235
            S+  M+ A     F + + RA W  I I    ++P+A F+ L   L +D+V S
Sbjct  674  SVATMMIAFGATLFIVLHHRAQWTAIPITLLGSVPVALFVLLQFPLLVDMVVS  726



>ref|XP_004301924.1| PREDICTED: uncharacterized protein LOC101300157 [Fragaria vesca 
subsp. vesca]
Length=275

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 92/263 (35%), Positives = 140/263 (53%), Gaps = 11/263 (4%)
 Frame = -1

Query  1011  PANKKNDDQVEEEEDIMQESSALRLSTATQKEVVPANKKNDDQVEEEEDIMQESSALRLS  832
             P  +K   Q+ + ED M +S +  L    Q   +P     D            SS  R +
Sbjct  7     PLVEKAIKQLVDGEDAMHDSFSPPLPVPNQFGSLP-----DAGTPSRPP--NYSSLTRTN  59

Query  831   T-AALHYEREISWFMGVEKIVPSSFH-HMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
               A+L  +RE+ WF  VE I+P   H ++ + DG T ++LF   H +LK  AE+S++GTA
Sbjct  60    QDASLQMQRELQWFKEVESILPFETHEYLNSSDGLTARELFTTNHAELKKEAEESMKGTA  119

Query  657   DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
              SC  V  LI T+ F+ AFT PGGND  TG+P+F+ +  F VF +SD +++I S  S++T
Sbjct  120   TSCTTVGALIVTIMFAVAFTVPGGNDSATGLPMFMHKKLFRVFILSDTISLISSATSVIT  179

Query  477   FLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAY-GRAWQPILIAA  304
             FL +L     +DDF  +L K + VG + L +SI  M+  F+ A  +   G A   I +  
Sbjct  180   FLGLLTSTYAEDDFLWSLPKEMMVGLSTLFISIAAMMITFSCALTIMLDGEAKMIIPVIV  239

Query  303   FVALPIASFLYLNARLWIDVVGS  235
             F ++P+ SF +    L  ++  S
Sbjct  240   FASVPVVSFAFYLFPLLFEICRS  262



>ref|XP_006464617.1| PREDICTED: uncharacterized protein LOC102609031 [Citrus sinensis]
Length=653

 Score =   145 bits (367),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 92/242 (38%), Positives = 132/242 (55%), Gaps = 5/242 (2%)
 Frame = -1

Query  945  LRLSTATQKEVVPAN-KKNDDQVEEEEDIMQESSAL-RLSTAALHYEREISWFMGVEKIV  772
            L  +   +K  V  N  K  + +  +   +  SS L R+S AAL  +RE+ WF  VE IV
Sbjct  393  LIYTMGAKKNSVATNWDKAHNNILHQAAFLAPSSQLDRVSGAALQMQRELQWFKEVESIV  452

Query  771  PSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTADSCMIVATLIATVAFSAAFTAP  592
               +  M N   KTP+ LF  +H KL    EK ++ TA+SC +VA LIAT+ FSAAFT P
Sbjct  453  QPKYKEMVNLHYKTPRALFSDQHKKLVEQGEKWMKETAESCTVVAALIATIMFSAAFTVP  512

Query  591  GGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILTFLSILIWRNTDDDFHLALKR-L  415
            GG D+ TGIP+++ R SF VF ++DA+++  S  S+L FL IL  R  ++DF  +L R L
Sbjct  513  GGYDEYTGIPLYLHRNSFMVFIVADAMSLFSSCTSVLMFLGILTSRYGEEDFLKSLPRKL  572

Query  414  FVGFAALGVSICGMlfaftaafflAYGR--AWQPILIAAFVALPIASFLYLNARLWIDVV  241
             +G ++L  SI  M+  F     +      AW    I    +LP+  F  L   L +++ 
Sbjct  573  IIGLSSLFFSIATMMVTFGVTLVIILKARIAWVSFPIILLASLPVTLFALLQFPLLVEIF  632

Query  240  GS  235
             S
Sbjct  633  YS  634



>ref|XP_009361709.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Pyrus 
x bretschneideri]
Length=284

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 86/206 (42%), Positives = 126/206 (61%), Gaps = 6/206 (3%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S+AAL  + E+ WF  VEK+V   +   RNK+ +T ++LF  EH  L  + EK ++ T+
Sbjct  71   ISSAALQMQIELQWFKMVEKLVHPYYKESRNKNEETARELFTNEHKALAESGEKWLKDTS  130

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRAS--FTVFTISDAVAMIFSMVSI  484
            +SCM+VATLIATV F+AAFT PGGND++ G P F+++ S  F VF +SD++A+  S+ S+
Sbjct  131  NSCMLVATLIATVVFAAAFTVPGGNDNE-GAPNFLEKKSVIFLVFVVSDSIALFSSLTSL  189

Query  483  LTFLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAYGRA--WQPIL  313
            L FLSIL  R  ++DF  +L KRL +G A L  +I   + AF A   +  G+   W  I 
Sbjct  190  LMFLSILTARYAEEDFLESLPKRLIIGLATLFFAIAATMVAFGATLLIVLGKKFNWVSIP  249

Query  312  IAAFVALPIASFLYLNARLWIDVVGS  235
            I    + P+  F      L+I +V S
Sbjct  250  ITFLASFPVTLFALQQLPLFIQMVRS  275



>ref|XP_007041075.1| Ankyrin repeat family protein, putative [Theobroma cacao]
 gb|EOX96906.1| Ankyrin repeat family protein, putative [Theobroma cacao]
Length=619

 Score =   145 bits (365),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 90/207 (43%), Positives = 126/207 (61%), Gaps = 9/207 (4%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  VE++V  S    RN +  TP +LF+++H  L    E+ ++ TA
Sbjct  392  VSGAALQMQRELLWFQEVERLVQPSCREQRNNEHFTPWELFMEQHKGLMKEGEEWMKKTA  451

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
            +S ++V TLIATVAF++ FT PGG+ D +G P F++R SF VF  SDA A+  ++ SIL 
Sbjct  452  ESSLMVPTLIATVAFASIFTVPGGSKDNSGEPNFLRRMSFLVFVTSDATALFSALASILM  511

Query  477  FLSILIWRNTDDDFHLALKR----LFVGFAALGVSICGMlfaftaafflAY--GRAWQPI  316
            FLSIL  R  + DF   +KR    L +G A   +SI  ++ AF+A  F+ Y  G  W P 
Sbjct  512  FLSILTSRYKEHDF---IKRLPFMLMIGLATFFMSIGSVIVAFSATVFIIYYHGHLWVPA  568

Query  315  LIAAFVALPIASFLYLNARLWIDVVGS  235
             IA   ++PIA F  LN  L+IDV  S
Sbjct  569  AIAILGSVPIALFASLNLPLFIDVWNS  595



>ref|XP_007213190.1| hypothetical protein PRUPE_ppa026120mg [Prunus persica]
 gb|EMJ14389.1| hypothetical protein PRUPE_ppa026120mg [Prunus persica]
Length=683

 Score =   145 bits (365),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 79/198 (40%), Positives = 125/198 (63%), Gaps = 3/198 (2%)
 Frame = -1

Query  828  AALHYEREISWFMGVEKIVPSSFHHMRNKDGK-TPKQLFLKEHMKLKINAEKSIRGTADS  652
            AAL  +RE+ WF  VE I+P     +RN   K T +++F K H KL+   E+S++GTA S
Sbjct  468  AALQMQRELQWFKEVESILPPQDREIRNVTEKMTAREVFTKNHNKLRKEGEESMKGTATS  527

Query  651  CMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILTFL  472
            C +V  LI T+ F+AAFT PGG++  TG PIF+++  F +F ISD++++  S  S++ FL
Sbjct  528  CTVVGALIVTIMFAAAFTVPGGSNQDTGFPIFLRKKLFRIFIISDSISLFSSTTSVMIFL  587

Query  471  SILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAY-GRAWQPILIAAFV  298
             IL  R  +DDF  +L  ++ +G   L +SI  M+ AF++  F+ + G +W  I I    
Sbjct  588  GILTSRYAEDDFLRSLPTKMLLGLFTLFLSIATMMVAFSSTLFIMFEGESWVSIPIILLA  647

Query  297  ALPIASFLYLNARLWIDV  244
            ++PIASF+ + + L++D+
Sbjct  648  SVPIASFVLMQSPLFLDI  665



>ref|XP_009366066.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Pyrus 
x bretschneideri]
Length=263

 Score =   139 bits (350),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 76/197 (39%), Positives = 120/197 (61%), Gaps = 2/197 (1%)
 Frame = -1

Query  828  AALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTADSC  649
            AAL  +RE+ WF  VE IV        NKD KTP+++F + H +L   AEKS++ T+ SC
Sbjct  49   AALQMQRELQWFKEVESIVDPKDCESVNKDNKTPRKVFTENHKELGREAEKSMKETSTSC  108

Query  648  MIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILTFLS  469
             +V  LI T+ F+AAFT PGGND+KTG+P F+ +  FT F +SDA+++  S  S++ FL 
Sbjct  109  TVVGALIVTIMFAAAFTVPGGNDEKTGLPTFLTKKVFTTFIVSDAISLFSSTTSVIMFLG  168

Query  468  ILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAY-GRAWQPILIAAFVA  295
            IL  R ++DDFH  L  ++  G   L +SI  M+  F+ A ++   G++   +      +
Sbjct  169  ILTSRYSEDDFHKFLPTKMIAGLFTLFLSIVTMMIVFSCALYIMLDGKSSIVVPSMLLAS  228

Query  294  LPIASFLYLNARLWIDV  244
            +P+ SF+++   L +++
Sbjct  229  VPVTSFIWMQFPLLVEL  245



>ref|XP_007154755.1| hypothetical protein PHAVU_003G144900g [Phaseolus vulgaris]
 ref|XP_007154756.1| hypothetical protein PHAVU_003G144900g [Phaseolus vulgaris]
 gb|ESW26749.1| hypothetical protein PHAVU_003G144900g [Phaseolus vulgaris]
 gb|ESW26750.1| hypothetical protein PHAVU_003G144900g [Phaseolus vulgaris]
Length=588

 Score =   144 bits (362),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 93/204 (46%), Positives = 123/204 (60%), Gaps = 3/204 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AA     E++WF  V+KI+ + F    N +G  P+ LF K+H +L    E  ++ TA
Sbjct  369  VSGAAFQMMLELTWFEEVKKIMQTLFIEHPNNNGIIPQDLFTKKHEELLKKGESWMKRTA  428

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
             SCM+V+TLIAT  FSAAF+ PGG  D+TG P ++K+  FTVF  SDA+A+I S  S L 
Sbjct  429  SSCMVVSTLIATGVFSAAFSVPGGYKDETGSPNYLKKPLFTVFACSDALALISSSTSTLI  488

Query  477  FLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfaftaafflAY--GRAWQPILIA  307
            FLSILI R  + DF  +L  +L  G   L VSI  M+ AF++AFF+ Y  G    P  IA
Sbjct  489  FLSILISRYAEQDFLSSLPFKLISGLVTLFVSIISMMVAFSSAFFITYYHGSKGVPFSIA  548

Query  306  AFVALPIASFLYLNARLWIDVVGS  235
                LPI  F+ L  RLW D+V S
Sbjct  549  VLAFLPIFLFICLQFRLWHDIVYS  572



>ref|XP_008363461.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Malus 
domestica]
Length=350

 Score =   141 bits (355),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 78/210 (37%), Positives = 131/210 (62%), Gaps = 6/210 (3%)
 Frame = -1

Query  852  SSALRLS---TAALHYEREISWFMGVEKI-VPSSFHHMRNKDGKTPKQLFLKEHMKLKIN  685
            SSA R++    AAL  +RE+ WF  V+ + + S+F  + + D  TP++LF K H ++   
Sbjct  114  SSAARINHIRGAALQMQRELQWFEEVKHMSIASAFDAISDTDKMTPRELFTKGHEEMVKA  173

Query  684  AEKSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAM  505
             EK+++GTA SC +V  LI T+ F+AAFT PGGN+  TG+PIF+ + +F  F +SDA+++
Sbjct  174  GEKAMKGTATSCTVVGALIVTITFAAAFTVPGGNNQDTGLPIFLSKRAFKTFIVSDAISL  233

Query  504  IFSMVSILTFLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfa-ftaafflAYGR  331
              S  S++ FL IL  R  +DDF  +L  ++ +G   L +SI  M+ A  +A   + +G+
Sbjct  234  FSSTTSVMIFLGILTSRYAEDDFLKSLPTKMILGLITLFLSIAAMMIAFSSALSIMLHGK  293

Query  330  AWQPILIAAFVALPIASFLYLNARLWIDVV  241
            +   IL+    ++P+ASF+++   L +++V
Sbjct  294  SSIAILLTLLASVPVASFMWMQFPLLLELV  323



>ref|XP_010694923.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X4 [Beta vulgaris subsp. vulgaris]
Length=586

 Score =   143 bits (361),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 82/207 (40%), Positives = 127/207 (61%), Gaps = 8/207 (4%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  VEK V  ++   +N  GKTP  +F + H  L    EK ++ TA
Sbjct  362  VSGAALQMQRELQWFKEVEKFVQPAYKAWKNAKGKTPSFVFSEAHQNLVKEGEKWMKDTA  421

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFI-----KRASFTVFTISDAVAMIFSM  493
             SC + A LIATV F+AA T PGGND  +G P+++     ++ +F VF + DA+++  S+
Sbjct  422  TSCTVAAALIATVVFAAAITVPGGNDQNSGTPLYVMPEQHQQRAFAVFGVFDAISLFSSV  481

Query  492  VSILTFLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAYG--RAWQ  322
             SIL FLSIL  R  + DF  AL KRL +G + L +SI  ++ AF++A +L  G  + W+
Sbjct  482  TSILMFLSILTSRYAEADFLYALPKRLIIGLSMLLISITSLMVAFSSALYLVLGQNKPWR  541

Query  321  PILIAAFVALPIASFLYLNARLWIDVV  241
             +L+ A  +LP+  F++L   L ++++
Sbjct  542  LLLVGALASLPVTLFIFLQFPLLLEIM  568



>ref|XP_010644712.1| PREDICTED: uncharacterized protein LOC100265216 [Vitis vinifera]
Length=659

 Score =   144 bits (362),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 85/204 (42%), Positives = 121/204 (59%), Gaps = 3/204 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  +EK  P +F    N +   PK +F+KEH KL    EK ++GTA
Sbjct  440  VSGAALQMQRELHWFKEIEKYAPRAFSESENNNEDKPKTVFIKEHEKLIKEGEKWMKGTA  499

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
                + A LIATV F+AA T PGGN D TGIP F K  +F VF  SDA+++  S+ S+L 
Sbjct  500  KCYALAAALIATVVFAAAITIPGGNHDDTGIPNFSKEKAFKVFAASDALSLFLSIASVLI  559

Query  477  FLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAYG--RAWQPILIA  307
             LSIL  R  +DDF  AL +RL  G   L +S+  M+ A+++A +L +G  +AW    +A
Sbjct  560  CLSILTARYAEDDFLFALPRRLIFGLVTLFLSVTFMMIAYSSAIYLLFGEKKAWILTTLA  619

Query  306  AFVALPIASFLYLNARLWIDVVGS  235
            A   LP+  +  L   L ++++ S
Sbjct  620  ALACLPVTLYGILQFPLLVELIYS  643



>ref|XP_010694915.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X3 [Beta vulgaris subsp. vulgaris]
Length=597

 Score =   143 bits (361),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 82/207 (40%), Positives = 127/207 (61%), Gaps = 8/207 (4%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  VEK V  ++   +N  GKTP  +F + H  L    EK ++ TA
Sbjct  373  VSGAALQMQRELQWFKEVEKFVQPAYKAWKNAKGKTPSFVFSEAHQNLVKEGEKWMKDTA  432

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFI-----KRASFTVFTISDAVAMIFSM  493
             SC + A LIATV F+AA T PGGND  +G P+++     ++ +F VF + DA+++  S+
Sbjct  433  TSCTVAAALIATVVFAAAITVPGGNDQNSGTPLYVMPEQHQQRAFAVFGVFDAISLFSSV  492

Query  492  VSILTFLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAYG--RAWQ  322
             SIL FLSIL  R  + DF  AL KRL +G + L +SI  ++ AF++A +L  G  + W+
Sbjct  493  TSILMFLSILTSRYAEADFLYALPKRLIIGLSMLLISITSLMVAFSSALYLVLGQNKPWR  552

Query  321  PILIAAFVALPIASFLYLNARLWIDVV  241
             +L+ A  +LP+  F++L   L ++++
Sbjct  553  LLLVGALASLPVTLFIFLQFPLLLEIM  579



>ref|XP_010694908.1| PREDICTED: uncharacterized protein LOC104907637 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=610

 Score =   143 bits (360),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 82/207 (40%), Positives = 127/207 (61%), Gaps = 8/207 (4%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  VEK V  ++   +N  GKTP  +F + H  L    EK ++ TA
Sbjct  386  VSGAALQMQRELQWFKEVEKFVQPAYKAWKNAKGKTPSFVFSEAHQNLVKEGEKWMKDTA  445

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFI-----KRASFTVFTISDAVAMIFSM  493
             SC + A LIATV F+AA T PGGND  +G P+++     ++ +F VF + DA+++  S+
Sbjct  446  TSCTVAAALIATVVFAAAITVPGGNDQNSGTPLYVMPEQHQQRAFAVFGVFDAISLFSSV  505

Query  492  VSILTFLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAYG--RAWQ  322
             SIL FLSIL  R  + DF  AL KRL +G + L +SI  ++ AF++A +L  G  + W+
Sbjct  506  TSILMFLSILTSRYAEADFLYALPKRLIIGLSMLLISITSLMVAFSSALYLVLGQNKPWR  565

Query  321  PILIAAFVALPIASFLYLNARLWIDVV  241
             +L+ A  +LP+  F++L   L ++++
Sbjct  566  LLLVGALASLPVTLFIFLQFPLLLEIM  592



>ref|XP_010694898.1| PREDICTED: uncharacterized protein LOC104907637 isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010694904.1| PREDICTED: uncharacterized protein LOC104907637 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=639

 Score =   143 bits (360),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 82/207 (40%), Positives = 127/207 (61%), Gaps = 8/207 (4%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  VEK V  ++   +N  GKTP  +F + H  L    EK ++ TA
Sbjct  415  VSGAALQMQRELQWFKEVEKFVQPAYKAWKNAKGKTPSFVFSEAHQNLVKEGEKWMKDTA  474

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFI-----KRASFTVFTISDAVAMIFSM  493
             SC + A LIATV F+AA T PGGND  +G P+++     ++ +F VF + DA+++  S+
Sbjct  475  TSCTVAAALIATVVFAAAITVPGGNDQNSGTPLYVMPEQHQQRAFAVFGVFDAISLFSSV  534

Query  492  VSILTFLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAYG--RAWQ  322
             SIL FLSIL  R  + DF  AL KRL +G + L +SI  ++ AF++A +L  G  + W+
Sbjct  535  TSILMFLSILTSRYAEADFLYALPKRLIIGLSMLLISITSLMVAFSSALYLVLGQNKPWR  594

Query  321  PILIAAFVALPIASFLYLNARLWIDVV  241
             +L+ A  +LP+  F++L   L ++++
Sbjct  595  LLLVGALASLPVTLFIFLQFPLLLEIM  621



>ref|XP_011096818.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Sesamum 
indicum]
Length=660

 Score =   143 bits (361),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 101/207 (49%), Positives = 133/207 (64%), Gaps = 8/207 (4%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  VEK+VP S   +RN+ G  P+QLF KEH  L    E  ++ TA
Sbjct  440  VSGAALQMQRELLWFKEVEKVVPPSCLEIRNRQGLRPRQLFSKEHEPLLTKGETWMKETA  499

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
            ++CMIVATLIATVAF+AAFT PGGN+  TG+PI  KR  FTVF +S+AVA+  S  SI+ 
Sbjct  500  NNCMIVATLIATVAFAAAFTLPGGNNGDTGMPILKKRTWFTVFAVSNAVALFCSTASIIM  559

Query  477  FLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAYGRAWQPILIAAF  301
            FLSIL  R  +DDF ++L  +L  G  AL  SI G++FAFT  FFL +    +  L+  +
Sbjct  560  FLSILTSRYQEDDFLVSLPTKLMFGLTALFTSIVGVVFAFTTTFFLLFHE--EETLVLKW  617

Query  300  VA-----LPIASFLYLNARLWIDVVGS  235
            +A     L I  F  L+ +LWID + S
Sbjct  618  IAVSACILLITLFAGLHIKLWIDTIRS  644



>ref|XP_004153308.1| PREDICTED: uncharacterized protein LOC101218503, partial [Cucumis 
sativus]
Length=608

 Score =   142 bits (358),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 123/203 (61%), Gaps = 19/203 (9%)
 Frame = -1

Query  840  RLSTAALHYEREISWFMGVEKIV-PSSFH---------------HMRNKDGKTPKQLFLK  709
            R+S AAL  +RE+ WF  VEKIV PS                  +  N    TP+QLF +
Sbjct  406  RVSGAALQMQREMLWFKEVEKIVLPSQLEAKSNVTSSQQLEAKFNYPNTPKLTPRQLFTQ  465

Query  708  EHMKLKINAEKSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVF  529
            EH  L+ + E+ ++ TA+SCM+VATLI+TV F+AAFT PGG+++  G P+F ++  FTVF
Sbjct  466  EHKDLRKDGEEWMKHTANSCMLVATLISTVVFAAAFTVPGGSNNNEGTPVFQQKFWFTVF  525

Query  528  TISDAVAMIFSMVSILTFLSILIWRNTDDDF-HLALKRLFVGFAALGVSICGMlfaftaa  352
             +SDAVA+  S  SIL F+SIL  R  +DDF H    RL  G A L +SI  M+ AF+A 
Sbjct  526  AMSDAVALFSSSTSILMFMSILTSRYAEDDFMHSLPSRLLFGLATLFISIVCMVVAFSAT  585

Query  351  fflAYGRA--WQPILIAAFVALP  289
            FF+ Y +A    P +++A   LP
Sbjct  586  FFILYHKANICIPTIVSAMAILP  608



>ref|XP_006432670.1| hypothetical protein CICLE_v10003360mg [Citrus clementina]
 gb|ESR45910.1| hypothetical protein CICLE_v10003360mg [Citrus clementina]
Length=505

 Score =   141 bits (356),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 75/153 (49%), Positives = 105/153 (69%), Gaps = 1/153 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+  +  VE IV  S+  M+N DGKTP++LF  EH++L    E+ ++  A
Sbjct  296  VSGAALEMQRELLIYKEVEMIVQPSYKEMKNYDGKTPRELFTVEHLELLRRGEQWMKSRA  355

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
             S MIVATL+AT+ F+AAFT PGG DDKTG+PI ++   F VF I+DA+A   S++S+L 
Sbjct  356  SSSMIVATLVATMVFAAAFTVPGGKDDKTGLPIHLRENWFQVFAIADAIAFSCSIISVLF  415

Query  477  FLSILIWRNTDDDFHLALK-RLFVGFAALGVSI  382
            FLSIL  +  +DDF ++L  +L  G +AL VSI
Sbjct  416  FLSILTSQFAEDDFLMSLPLKLLGGLSALFVSI  448



>ref|XP_007145674.1| hypothetical protein PHAVU_007G2588001g, partial [Phaseolus vulgaris]
 gb|ESW17668.1| hypothetical protein PHAVU_007G2588001g, partial [Phaseolus vulgaris]
Length=548

 Score =   142 bits (357),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 95/205 (46%), Positives = 131/205 (64%), Gaps = 4/205 (2%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL    E+SWF  V+K++P S     N  G TP+Q+F  EH +L    E  ++ TA
Sbjct  328  VSGAALQMMLELSWFEEVKKMMPLSSIEEPNCIGITPRQVFTVEHEELVEKEESWMKRTA  387

Query  657  DSCMIVATLIATVAFSAAFTAPGG-NDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSIL  481
             SCM+V+TLI T  F+AAF+ PGG NDDK G P ++++ +F VF +SD++A+I S  SIL
Sbjct  388  KSCMVVSTLITTGVFTAAFSVPGGTNDDKGGSPNYLQKPAFLVFALSDSIALISSSTSIL  447

Query  480  TFLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfaftaafflAY--GRAWQPILI  310
             FLSILI R  +DDF  +L  +L  G  AL +SI  M+ AF++AFF+ Y  G  W P LI
Sbjct  448  IFLSILISRYAEDDFLTSLPLKLMSGLLALFISIVSMMVAFSSAFFITYWEGVKWVPNLI  507

Query  309  AAFVALPIASFLYLNARLWIDVVGS  235
            +A   +PI  F++L   LW D+V S
Sbjct  508  SAIAFVPIPVFIFLQFSLWSDIVYS  532



>ref|XP_008391127.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X3 [Malus domestica]
Length=585

 Score =   142 bits (357),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 108/176 (61%), Gaps = 8/176 (5%)
 Frame = -1

Query  876  EEEDIMQESSALR-------LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQL  718
            E+ +I+ +++ L        +S AAL  +RE+ WF  VEKIV   F  M+N   KTP++L
Sbjct  378  EKNNILHQAAKLAPQDQLNLVSGAALQMQRELVWFEEVEKIVQPPFIDMKNNQDKTPREL  437

Query  717  FLKEHMKLKINAEKSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASF  538
            F  EH  L    E  ++ TA+SCM+V+T+IATV FSAAF+ PGG  D  G P F+K  +F
Sbjct  438  FTSEHKDLLRKGESWMKNTANSCMLVSTIIATVVFSAAFSIPGGISDNKGTPNFVKDTAF  497

Query  537  TVFTISDAVAMIFSMVSILTFLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGM  373
             +FTISD VA+  S  +IL FL IL  R  ++DF  +L  +L +G  +L VSI  M
Sbjct  498  LIFTISDGVALFSSSTAILMFLYILTSRYAENDFLKSLPLKLMIGLTSLFVSITSM  553



>ref|XP_008388249.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X1 [Malus domestica]
Length=245

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/205 (36%), Positives = 121/205 (59%), Gaps = 3/205 (1%)
 Frame = -1

Query  840  RLSTAALHYEREISWFMGVEKIVPSSFHHMRNK-DGKTPKQLFLKEHMKLKINAEKSIRG  664
            R+   AL  +RE+ WF  VE+      H + NK D  TP++LF K H  L    EK+++ 
Sbjct  16   RIQGXALQMQRELQWFKEVERXAXXVDHEVINKTDEMTPRELFTKVHKDLVKEGEKAMKD  75

Query  663  TADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSI  484
            TA SC +V  LI T+ F+AAFT PGGN   TG+P+F+ + +F  F +SD +++  S  S+
Sbjct  76   TATSCTVVGALIVTIMFAAAFTVPGGNKQDTGLPVFLSKTAFITFIVSDVISLFSSTTSV  135

Query  483  LTFLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfa-ftaafflAYGRAWQPILI  310
            + FL IL  R  ++DF L+L  ++ +G   L +SI  M+    +A   + +G++   IL+
Sbjct  136  MIFLGILTSRYAENDFLLSLPXKMILGHITLFISIVAMMITFSSALSIMLHGKSSIAILL  195

Query  309  AAFVALPIASFLYLNARLWIDVVGS  235
                ++P+ASF+++   L ++++ S
Sbjct  196  TLLTSVPVASFIWMQFPLLLELIIS  220



>gb|KDO39998.1| hypothetical protein CISIN_1g037666mg, partial [Citrus sinensis]
Length=375

 Score =   139 bits (351),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 116/188 (62%), Gaps = 3/188 (2%)
 Frame = -1

Query  789  GVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTADSCMIVATLIATVAFS  610
            GVE +VP       N  G TP  LF ++H +LK   E  ++ TA SCMIVATLIAT+ F+
Sbjct  178  GVENVVPKKLAEAINTGGLTPTALFSEKHKELKRKGETWMKDTASSCMIVATLIATIVFA  237

Query  609  AAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILTFLSILIWRNTDDDF-H  433
            AA T PGGN + TG+P F ++ASF +F +S+ ++++ S VSI+ FLSI+  R  ++DF H
Sbjct  238  AAITVPGGNKEDTGLPFFRQKASFKIFAVSNVISLVASSVSIVNFLSIVAPRYAEEDFLH  297

Query  432  LALKRLFVGFAALGVSICGMlfaftaafflAY--GRAWQPILIAAFVALPIASFLYLNAR  259
            L  ++L VGFA L V+I  M+  F+A  ++ +  G  W  IL     ++P+  F+  +  
Sbjct  298  LLPRKLLVGFATLFVAIAAMMVVFSATSYIVFKDGSLWIAILAIVISSIPVILFVKQHFL  357

Query  258  LWIDVVGS  235
             + DV+ S
Sbjct  358  FFYDVLRS  365



>ref|XP_008391126.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X2 [Malus domestica]
Length=585

 Score =   141 bits (356),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 108/176 (61%), Gaps = 8/176 (5%)
 Frame = -1

Query  876  EEEDIMQESSALR-------LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQL  718
            E+ +I+ +++ L        +S AAL  +RE+ WF  VEKIV   F  M+N   KTP++L
Sbjct  378  EKNNILHQAAKLAPQDQLNLVSGAALQMQRELVWFEEVEKIVQPPFIDMKNNQDKTPREL  437

Query  717  FLKEHMKLKINAEKSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASF  538
            F  EH  L    E  ++ TA+SCM+V+T+IATV FSAAF+ PGG  D  G P F+K  +F
Sbjct  438  FTSEHKDLLRKGESWMKNTANSCMLVSTIIATVVFSAAFSIPGGISDNKGTPNFVKDTAF  497

Query  537  TVFTISDAVAMIFSMVSILTFLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGM  373
             +FTISD VA+  S  +IL FL IL  R  ++DF  +L  +L +G  +L VSI  M
Sbjct  498  LIFTISDGVALFSSSTAILMFLYILTSRYAENDFLKSLPLKLMIGLTSLFVSITSM  553



>gb|KEH33946.1| ankyrin repeat protein [Medicago truncatula]
Length=351

 Score =   139 bits (350),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 83/195 (43%), Positives = 119/195 (61%), Gaps = 3/195 (2%)
 Frame = -1

Query  852  SSALRLSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKS  673
            S A  ++ AA   +RE+ WF  VEK+       ++N DGKT  Q+F +EH  L    +  
Sbjct  136  SQAESIACAAFQMKRELHWFKEVEKLDHPLHKDVKNNDGKTAWQVFKEEHKTLLEEGKNW  195

Query  672  IRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSM  493
            ++ T++SCM+VATLIAT+ F+AA T PGGN+   GIPIF+   +F +F +SDA+A+  SM
Sbjct  196  MKDTSNSCMLVATLIATITFAAAITVPGGNNQDKGIPIFLSDKTFMLFIVSDALALFSSM  255

Query  492  VSILTFLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAYGR--AWQ  322
            VS+L FLSI+  R   +DF +AL KRL +G AAL  ++   + AF AA  +   +   W 
Sbjct  256  VSLLMFLSIIHGRYAKEDFVVALPKRLILGMAALFFAVGTTMIAFGAALSMLLEKRLVWA  315

Query  321  PILIAAFVALPIASF  277
            PI IA    +P+  F
Sbjct  316  PIPIALLACVPVTLF  330



>ref|XP_009346494.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X3 [Pyrus x bretschneideri]
Length=585

 Score =   141 bits (356),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 76/190 (40%), Positives = 113/190 (59%), Gaps = 3/190 (2%)
 Frame = -1

Query  933  TATQKEVVPA--NKKNDDQVEEEEDIMQESSALRLSTAALHYEREISWFMGVEKIVPSSF  760
            T + K+++    + +N++ + +   +  +     +S AAL  +RE+ WF  VEKIV   F
Sbjct  364  TGSIKDIIATYIDNENNNILHQAAKLAPQDQLNLVSGAALQMQRELVWFEEVEKIVQPPF  423

Query  759  HHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTADSCMIVATLIATVAFSAAFTAPGGND  580
              M+N   KTP++LF  EH  L    E  ++ TA+ CM+V+T+IATV FSAAF+ PGG  
Sbjct  424  MDMKNNQDKTPRELFTSEHKDLLCKGESWMKDTANYCMLVSTIIATVVFSAAFSIPGGIS  483

Query  579  DKTGIPIFIKRASFTVFTISDAVAMIFSMVSILTFLSILIWRNTDDDFHLALK-RLFVGF  403
            D  G P F+K  +F +FTISD +A+  S  +IL FL IL  R  ++DF  +L  +L +G 
Sbjct  484  DNKGTPNFVKETAFLIFTISDGIALFSSSTAILMFLYILTSRYAENDFLKSLPLKLMIGL  543

Query  402  AALGVSICGM  373
             +L VSI  M
Sbjct  544  TSLFVSITSM  553



>ref|XP_010644786.1| PREDICTED: uncharacterized protein LOC100250505 isoform X2 [Vitis 
vinifera]
Length=333

 Score =   138 bits (348),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 83/204 (41%), Positives = 119/204 (58%), Gaps = 3/204 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  +EK  P +F    N++   PK  F+KEH  L    EK ++GTA
Sbjct  114  VSGAALQMQRELHWFKEIEKYAPRAFSESENENKDKPKMAFIKEHENLIKEGEKWMKGTA  173

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
                + A LIATV F+AA T PGGN D TGI  F K  +F VF +SDA+++  S+ S+L 
Sbjct  174  KFYTLAAALIATVVFAAAITIPGGNHDDTGIRNFSKEIAFKVFAVSDALSLFLSIASVLI  233

Query  477  FLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAYG--RAWQPILIA  307
             LSIL  R  +DDF  AL +RL  G   L +S+  M+ A++ A +L +G  +AW  I +A
Sbjct  234  CLSILTARYAEDDFLFALPRRLIFGLVTLFLSVTFMMIAYSGAIYLLFGEKKAWILIALA  293

Query  306  AFVALPIASFLYLNARLWIDVVGS  235
            A    P+  +  L   L ++++ S
Sbjct  294  ALACFPVTLYGNLQFPLLVELIYS  317



>ref|XP_007204827.1| hypothetical protein PRUPE_ppa004153mg [Prunus persica]
 gb|EMJ06026.1| hypothetical protein PRUPE_ppa004153mg [Prunus persica]
Length=526

 Score =   140 bits (354),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 87/206 (42%), Positives = 125/206 (61%), Gaps = 6/206 (3%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S  AL  +RE+ WF  VEK+V   +    NK G+T ++LF KEH +L    EK ++ T+
Sbjct  299  VSCPALQMQRELQWFKVVEKLVHPYYKDNLNKKGETARELFTKEHKELAQRGEKWLKDTS  358

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKR--ASFTVFTISDAVAMIFSMVSI  484
            +SCM+VATLIATV F+AAFT PGGND+  G P  +++  ++F VF +SDA+A+  S+ S+
Sbjct  359  NSCMLVATLIATVVFAAAFTVPGGNDND-GSPNLLRKNSSTFMVFVVSDAIALFASLTSL  417

Query  483  LTFLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAYGRA--WQPIL  313
            L FLSIL  R  ++DF  +L +RL +G A+L  +I  M+ AF A   L       W  I 
Sbjct  418  LMFLSILTARYAEEDFLQSLPRRLMIGLASLFFAIASMMVAFGATIVLVLNNRFNWVSIT  477

Query  312  IAAFVALPIASFLYLNARLWIDVVGS  235
            I +     +A F  L   L+I +V S
Sbjct  478  ITSLATCLVALFAMLQLPLFIQMVRS  503



>ref|XP_009346493.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X2 [Pyrus x bretschneideri]
Length=585

 Score =   141 bits (355),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 76/190 (40%), Positives = 113/190 (59%), Gaps = 3/190 (2%)
 Frame = -1

Query  933  TATQKEVVPA--NKKNDDQVEEEEDIMQESSALRLSTAALHYEREISWFMGVEKIVPSSF  760
            T + K+++    + +N++ + +   +  +     +S AAL  +RE+ WF  VEKIV   F
Sbjct  364  TGSIKDIIATYIDNENNNILHQAAKLAPQDQLNLVSGAALQMQRELVWFEEVEKIVQPPF  423

Query  759  HHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTADSCMIVATLIATVAFSAAFTAPGGND  580
              M+N   KTP++LF  EH  L    E  ++ TA+ CM+V+T+IATV FSAAF+ PGG  
Sbjct  424  MDMKNNQDKTPRELFTSEHKDLLCKGESWMKDTANYCMLVSTIIATVVFSAAFSIPGGIS  483

Query  579  DKTGIPIFIKRASFTVFTISDAVAMIFSMVSILTFLSILIWRNTDDDFHLALK-RLFVGF  403
            D  G P F+K  +F +FTISD +A+  S  +IL FL IL  R  ++DF  +L  +L +G 
Sbjct  484  DNKGTPNFVKETAFLIFTISDGIALFSSSTAILMFLYILTSRYAENDFLKSLPLKLMIGL  543

Query  402  AALGVSICGM  373
             +L VSI  M
Sbjct  544  TSLFVSITSM  553



>ref|XP_010694148.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Beta 
vulgaris subsp. vulgaris]
Length=632

 Score =   141 bits (356),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 90/214 (42%), Positives = 123/214 (57%), Gaps = 16/214 (7%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKD-------------GKTPKQLFLKEHMK  697
            +S AAL  +RE+ WF  V+ +V   +   +NK              GKTP+ LF +EH  
Sbjct  388  VSGAALQMQRELLWFEVVKNVVQPHYAAAKNKSKVTSQDVGNTSKSGKTPQALFTEEHKD  447

Query  696  LKINAEKSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISD  517
            L+I  E  ++ TA+SC +VATLI TV F+AAFT PGGND+  G PI +   SF VF IS+
Sbjct  448  LRIQGEAWMKKTAESCTLVATLITTVVFTAAFTLPGGNDESNGFPILLSEISFKVFAISN  507

Query  516  AVAMIFSMVSILTFLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfaftaafflA  340
            A+++  +  SIL FLSIL  R  + DF   L  +L VG  +L VSI  M+ AFTA FF+ 
Sbjct  508  AISLFAASTSILMFLSILTSRYAESDFLRLLPFKLMVGLTSLFVSIATMMVAFTATFFIT  567

Query  339  YGR--AWQPILIAAFVALPIASFLYLNARLWIDV  244
            + R   W P+ IA   A+P+  F +    L  D+
Sbjct  568  FQRDSIWIPVPIALLAAIPVLLFGFQQYPLLWDI  601



>gb|KDO57160.1| hypothetical protein CISIN_1g040056mg [Citrus sinensis]
Length=536

 Score =   140 bits (354),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 75/153 (49%), Positives = 105/153 (69%), Gaps = 1/153 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+  +  VE IV  S+  M+N DGKTP++LF  EH++L    E+ ++  A
Sbjct  327  VSGAALEMQRELLIYKEVEMIVQPSYKEMKNYDGKTPRELFTVEHLELLRRGEQWMKSRA  386

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
             S MIVATL+AT+ F+AAFT PGG DDKTG+PI ++   F VF I+DA+A   S++S+L 
Sbjct  387  SSGMIVATLVATMVFAAAFTVPGGKDDKTGLPIHLRENWFQVFAIADAIAFSCSIISVLF  446

Query  477  FLSILIWRNTDDDFHLALK-RLFVGFAALGVSI  382
            FLSIL  +  +DDF ++L  +L  G +AL VSI
Sbjct  447  FLSILTSQFAEDDFLMSLPLKLLGGLSALFVSI  479



>ref|XP_006586964.1| PREDICTED: uncharacterized protein LOC100808366 isoform X1 [Glycine 
max]
 ref|XP_006586965.1| PREDICTED: uncharacterized protein LOC100808366 isoform X2 [Glycine 
max]
 ref|XP_006586966.1| PREDICTED: uncharacterized protein LOC100808366 isoform X3 [Glycine 
max]
Length=709

 Score =   142 bits (358),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 86/206 (42%), Positives = 125/206 (61%), Gaps = 3/206 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AA     E+ WF  V+KI+P SF  ++N + KT ++LF +EH  L+  AE  ++ TA
Sbjct  486  VSGAAFQMSHELIWFEEVKKIMPPSFIMLKNSEDKTAQELFTREHEGLRRKAEDWMKRTA  545

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
            + C++++T+IAT  FSAA   PGG DD+T  P ++ + SF VF ISD +A I S  SIL 
Sbjct  546  EFCILISTVIATAVFSAAINIPGGIDDQTKKPNYLDKTSFLVFAISDGIAFISSATSILI  605

Query  477  FLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfaftaafflAY--GRAWQPILIA  307
            FLSILI R  + DFH +L  +L  G   L +SI  M+ AF +AFF+ Y  G    P  I+
Sbjct  606  FLSILISRYAEYDFHKSLPFKLICGLVTLFISITCMMVAFGSAFFITYDSGLKVVPDSIS  665

Query  306  AFVALPIASFLYLNARLWIDVVGSML  229
               ++PI  ++ L   LW D++ S +
Sbjct  666  ILASVPILLYITLQFSLWKDIIYSTI  691



>gb|EYU43670.1| hypothetical protein MIMGU_mgv1a022389mg [Erythranthe guttata]
Length=563

 Score =   140 bits (354),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 87/198 (44%), Positives = 118/198 (60%), Gaps = 3/198 (2%)
 Frame = -1

Query  828  AALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTADSC  649
            AAL  +RE+ W+  VEKIV  S+ + +N  GKTP +LF+ EH +L    EK ++ TA SC
Sbjct  349  AALQMQREVLWYKEVEKIVQPSYRNKKNSSGKTPWELFVSEHEELMKQGEKMMKQTAKSC  408

Query  648  MIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILTFLS  469
            M+V  LIATV F+AAFT PGG D+  G PI      F VF IS+AVA + S+ S+L FLS
Sbjct  409  MLVTILIATVVFTAAFTVPGGYDNANGTPILKNHRLFVVFPISEAVATLSSLTSMLMFLS  468

Query  468  ILIWRNTDDDFHLALKR-LFVGFAALGVSICGMlfa-ftaafflAYGRAWQPILIAAFVA  295
            IL  R + +DF   L   + VG AAL VSI  M+ A  T   F  +G     +L+  F +
Sbjct  469  ILTSRYSGNDFLNTLPFWMVVGVAALFVSIVAMMVAFCTCLLFYQHGFGAVTVLLVMFAS  528

Query  294  LPIASFLYLNARLWIDVV  241
            +PI  F+ L   L + ++
Sbjct  529  VPII-FIVLKYPLLVTIL  545



>emb|CAN68331.1| hypothetical protein VITISV_030161 [Vitis vinifera]
Length=476

 Score =   140 bits (352),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 83/203 (41%), Positives = 118/203 (58%), Gaps = 3/203 (1%)
 Frame = -1

Query  834  STAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTAD  655
            S AAL  +RE+ WF  +EK  P +F    N++   PK  F+KEH  L    EK ++GTA 
Sbjct  258  SGAALQMQRELHWFKEIEKYAPRAFSESENENKDKPKMAFIKEHENLIKEGEKWMKGTAK  317

Query  654  SCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILTF  475
               + A LIATV F+AA T PGGN D TGI  F K  +F VF +SDA+++  S+ S+L  
Sbjct  318  FYTLAAALIATVVFAAAITIPGGNHDDTGIXNFSKEIAFKVFAVSDALSLFLSIASVLIC  377

Query  474  LSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAYG--RAWQPILIAA  304
            LSIL  R  +DDF  AL +RL  G   L +S+  M+ A++ A +L +G  +AW  I +AA
Sbjct  378  LSILTARYAEDDFLFALPRRLIFGLVTLFLSVTFMMIAYSGAIYLLFGEKKAWILIALAA  437

Query  303  FVALPIASFLYLNARLWIDVVGS  235
                P+  +  L   L ++++ S
Sbjct  438  LACFPVTLYGXLQFPLLVELIYS  460



>ref|XP_010644785.1| PREDICTED: uncharacterized protein LOC100250505 isoform X1 [Vitis 
vinifera]
Length=358

 Score =   138 bits (348),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 83/204 (41%), Positives = 119/204 (58%), Gaps = 3/204 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  +EK  P +F    N++   PK  F+KEH  L    EK ++GTA
Sbjct  139  VSGAALQMQRELHWFKEIEKYAPRAFSESENENKDKPKMAFIKEHENLIKEGEKWMKGTA  198

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
                + A LIATV F+AA T PGGN D TGI  F K  +F VF +SDA+++  S+ S+L 
Sbjct  199  KFYTLAAALIATVVFAAAITIPGGNHDDTGIRNFSKEIAFKVFAVSDALSLFLSIASVLI  258

Query  477  FLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAYG--RAWQPILIA  307
             LSIL  R  +DDF  AL +RL  G   L +S+  M+ A++ A +L +G  +AW  I +A
Sbjct  259  CLSILTARYAEDDFLFALPRRLIFGLVTLFLSVTFMMIAYSGAIYLLFGEKKAWILIALA  318

Query  306  AFVALPIASFLYLNARLWIDVVGS  235
            A    P+  +  L   L ++++ S
Sbjct  319  ALACFPVTLYGNLQFPLLVELIYS  342



>gb|KEH33948.1| ankyrin repeat protein [Medicago truncatula]
Length=414

 Score =   139 bits (350),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 83/195 (43%), Positives = 117/195 (60%), Gaps = 3/195 (2%)
 Frame = -1

Query  852  SSALRLSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKS  673
            S A  ++ AA   +RE+ WF  VEK+       ++N DGKT  Q+F +EH  L    +  
Sbjct  199  SQAESIACAAFQMKRELHWFKEVEKLDHPLHKDVKNNDGKTAWQVFKEEHKTLLEEGKNW  258

Query  672  IRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSM  493
            ++ T++SCM+VATLIAT+ F+AA T PGGN+   GIPIF+   +F +F +SDA+A+  SM
Sbjct  259  MKDTSNSCMLVATLIATITFAAAITVPGGNNQDKGIPIFLSDKTFMLFIVSDALALFSSM  318

Query  492  VSILTFLSILIWRNTDDDFHLAL-KRLFVGFAALGVSI-CGMlfaftaafflAYGR-AWQ  322
            VS+L FLSI+  R   +DF +AL KRL +G AAL  ++   M+    A   L   R  W 
Sbjct  319  VSLLMFLSIIHGRYAKEDFVVALPKRLILGMAALFFAVGTTMIAFGAALSMLLEKRLVWA  378

Query  321  PILIAAFVALPIASF  277
            PI IA    +P+  F
Sbjct  379  PIPIALLACVPVTLF  393



>ref|XP_011022999.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X2 [Populus euphratica]
Length=628

 Score =   141 bits (355),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 83/223 (37%), Positives = 121/223 (54%), Gaps = 3/223 (1%)
 Frame = -1

Query  903  NKKNDDQVEEEEDIMQESSALRLSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPK  724
            +K  ++ + +   I   S   R+S A L  +RE+ W+  VE IV   +  M N   KTP+
Sbjct  387  DKYQNNMLHQAAFIAPSSQLDRVSGAPLQMQRELQWYKEVESIVQPKYREMSNSSHKTPQ  446

Query  723  QLFLKEHMKLKINAEKSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRA  544
             LF ++H KL    EK ++ TA+SC +VA LIAT+ FSA FT PGG D  +GIPI++ R 
Sbjct  447  TLFTEQHKKLVEEGEKWMKATAESCTVVAALIATIMFSAIFTVPGGYDQYSGIPIYLNRN  506

Query  543  SFTVFTISDAVAMIFSMVSILTFLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlf  367
            SF VF +SDA+++  S  S+L F  IL  R  ++DF  +L  +L VG + L  SI  M+ 
Sbjct  507  SFMVFIVSDAMSLFASSASLLMFFGILTSRYREEDFLKSLPTKLIVGLSCLFFSIATMMI  566

Query  366  aftaafflAYGR--AWQPILIAAFVALPIASFLYLNARLWIDV  244
            AF     +       W    I    +LP+  F  L   L +++
Sbjct  567  AFGITLVMMLRERFHWVSFPITLLASLPVTLFALLQFPLLVEI  609



>ref|XP_004288982.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Fragaria 
vesca subsp. vesca]
Length=316

 Score =   137 bits (345),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 86/203 (42%), Positives = 120/203 (59%), Gaps = 5/203 (2%)
 Frame = -1

Query  828  AALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTADSC  649
            AAL  +RE+ WF  VE +V   +   +N+  +T K+LF KEH  L    EK ++ T++SC
Sbjct  104  AALQMQRELQWFKVVETLVHPYYKQSKNEANQTAKELFTKEHENLAEKGEKWLKDTSNSC  163

Query  648  MIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRAS--FTVFTISDAVAMIFSMVSILTF  475
            M+VATLIATV  +AAFT PGGND+  G P F+ +    F VF ISDAVA+  S+ S+L F
Sbjct  164  MVVATLIATVVVAAAFTVPGGNDEADGNPNFLMKKPFIFMVFLISDAVALFSSLTSLLMF  223

Query  474  LSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAYGR--AWQPILIAA  304
            LSIL  R  ++DF  +L KRL +G A+L  +I   + AF A   +   +  +W  I I  
Sbjct  224  LSILTARFAEEDFIDSLPKRLIIGLASLFFAIAATIVAFGATISIVLSKRFSWVSIPITL  283

Query  303  FVALPIASFLYLNARLWIDVVGS  235
              + P+  F  L   L+I +V S
Sbjct  284  LASFPVTLFAMLQLPLFIQMVRS  306



>ref|XP_010092701.1| Splicing factor 3B subunit 4 [Morus notabilis]
 gb|EXB51998.1| Splicing factor 3B subunit 4 [Morus notabilis]
Length=749

 Score =   142 bits (357),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 90/215 (42%), Positives = 131/215 (61%), Gaps = 11/215 (5%)
 Frame = -1

Query  843  LRLSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRG  664
            L +S  AL  +REI WF  VEK++  +     N++  T  +LF +EH +L    EK ++ 
Sbjct  530  LSVSGVALQMQREIQWFKAVEKLMYPTTVENTNEENLTAWELFKREHKQLAEAGEKWMKD  589

Query  663  TADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSI  484
            T+DSCMIV+TLI TV F+AAFT PGGND   G+PIF+   +F VF +SDA+A+  S+ S+
Sbjct  590  TSDSCMIVSTLITTVVFAAAFTVPGGNDSNDGVPIFLWSKAFLVFAVSDALALFSSLTSL  649

Query  483  LTFLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAYGRAWQ----P  319
            L FLSIL  R  ++DF  +L +RL +G A+L  +I  M+ AF A  F+   +  Q    P
Sbjct  650  LMFLSILTARYAEEDFLKSLPERLIIGLASLFFAIATMMIAFAATLFIVLSKRLQWVFGP  709

Query  318  ILIAAFVALPIASFLYLNARLWIDVV----GSMLL  226
            I++ +F   P++ F  L   L+I ++    GS LL
Sbjct  710  IILLSF--FPVSIFGLLKLPLFIQMIQSTYGSTLL  742



>emb|CDP03067.1| unnamed protein product [Coffea canephora]
Length=337

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 86/205 (42%), Positives = 123/205 (60%), Gaps = 5/205 (2%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEK-IVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGT  661
            +S AAL  +RE+ W+  VEK ++P S  H +N  G+TP   F  EH  L    EK ++  
Sbjct  118  VSGAALQMQRELQWYKEVEKHVLPESKAH-KNSSGRTPAVEFSVEHKDLVKEGEKWMKDA  176

Query  660  ADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSIL  481
            A+SC + ATLIAT+AF+A+ T PGGN+  TG PIF    +F +F  +DA+++  S  S+L
Sbjct  177  ANSCTVSATLIATIAFAASITVPGGNNGDTGSPIFSNDLAFNIFAAADALSLFSSTASLL  236

Query  480  TFLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAYG--RAWQPILI  310
             FLSIL  R  + DF  +L +RL +G   L +SI  M+ AF+A  +L +G  RAW  + I
Sbjct  237  MFLSILTARYAEVDFLYSLPRRLIIGLVTLFISITTMMIAFSATIYLVFGDKRAWTIVPI  296

Query  309  AAFVALPIASFLYLNARLWIDVVGS  235
            AA   LP+  F  L   L +D++ S
Sbjct  297  AAIACLPVTLFATLQFPLLMDMIRS  321



>ref|XP_008230430.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Prunus 
mume]
Length=564

 Score =   140 bits (353),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 78/202 (39%), Positives = 120/202 (59%), Gaps = 3/202 (1%)
 Frame = -1

Query  840  RLSTAALHYEREISWFMGVEKIVPSSFHHMRN-KDGKTPKQLFLKEHMKLKINAEKSIRG  664
            R+  AAL  +RE+ WF  +EKIVP     + N  DG T + LF K H +L    E+S++ 
Sbjct  338  RIQGAALQMQRELQWFKEIEKIVPPKILEVVNVTDGMTARDLFTKNHKELAKEGERSMKE  397

Query  663  TADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSI  484
            TA SC +V  LI T+ F+AAFT PGGN+  TG+P+F+++  F VF +SDA+++  S  S+
Sbjct  398  TATSCTVVGALIITIMFTAAFTVPGGNNGNTGMPMFLEKKLFKVFIVSDALSLFASTTSV  457

Query  483  LTFLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAYG-RAWQPILI  310
            +TFL +L  R  + DF  +L K++ +G   L  SI  M+ AF +   +  G ++W  I I
Sbjct  458  MTFLGVLTSRYAEADFLESLPKKMIIGLFTLFFSIATMMIAFVSTLCIMLGEKSWIVIPI  517

Query  309  AAFVALPIASFLYLNARLWIDV  244
                + PI SF ++   L +++
Sbjct  518  TLLSSAPIVSFAWMQFPLLVEI  539



>ref|XP_011022998.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X1 [Populus euphratica]
Length=643

 Score =   140 bits (354),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 83/223 (37%), Positives = 121/223 (54%), Gaps = 3/223 (1%)
 Frame = -1

Query  903  NKKNDDQVEEEEDIMQESSALRLSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPK  724
            +K  ++ + +   I   S   R+S A L  +RE+ W+  VE IV   +  M N   KTP+
Sbjct  402  DKYQNNMLHQAAFIAPSSQLDRVSGAPLQMQRELQWYKEVESIVQPKYREMSNSSHKTPQ  461

Query  723  QLFLKEHMKLKINAEKSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRA  544
             LF ++H KL    EK ++ TA+SC +VA LIAT+ FSA FT PGG D  +GIPI++ R 
Sbjct  462  TLFTEQHKKLVEEGEKWMKATAESCTVVAALIATIMFSAIFTVPGGYDQYSGIPIYLNRN  521

Query  543  SFTVFTISDAVAMIFSMVSILTFLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlf  367
            SF VF +SDA+++  S  S+L F  IL  R  ++DF  +L  +L VG + L  SI  M+ 
Sbjct  522  SFMVFIVSDAMSLFASSASLLMFFGILTSRYREEDFLKSLPTKLIVGLSCLFFSIATMMI  581

Query  366  aftaafflAYGR--AWQPILIAAFVALPIASFLYLNARLWIDV  244
            AF     +       W    I    +LP+  F  L   L +++
Sbjct  582  AFGITLVMMLRERFHWVSFPITLLASLPVTLFALLQFPLLVEI  624



>ref|XP_007221373.1| hypothetical protein PRUPE_ppa017363mg, partial [Prunus persica]
 gb|EMJ22572.1| hypothetical protein PRUPE_ppa017363mg, partial [Prunus persica]
Length=342

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 77/200 (39%), Positives = 119/200 (60%), Gaps = 2/200 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  VE IV        N DG TP++LF K H +L    E+ ++GTA
Sbjct  125  ISGAALQMQRELQWFKEVETIVLPRTKDSTNNDGMTPRKLFTKNHKELVKEGERWMKGTA  184

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
             SC +V  LI T+ F+AAFT PGGN+ +TG PIF+ +  F  F +SDA+++  S  S+L 
Sbjct  185  SSCTVVGALIITIMFAAAFTIPGGNNGETGFPIFLHKKLFMAFIVSDAISLFSSTTSVLM  244

Query  477  FLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfa-ftaafflAYGRAWQPILIAA  304
            FL IL  R  +DDF  +L  ++ +G + L  SI  M+ A  +A F + + ++W  I +  
Sbjct  245  FLGILTSRYAEDDFLKSLPTKMIIGLSTLFFSIAAMMVAFSSALFIMVHEQSWIVIPMIF  304

Query  303  FVALPIASFLYLNARLWIDV  244
              ++PI  F+++   L +++
Sbjct  305  LASIPITLFIWMQFPLLVEM  324



>gb|KHN24825.1| hypothetical protein glysoja_044103 [Glycine soja]
Length=783

 Score =   141 bits (356),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 86/206 (42%), Positives = 125/206 (61%), Gaps = 3/206 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AA     E+ WF  V+KI+P SF  ++N + KT ++LF +EH  L+  AE  ++ TA
Sbjct  560  VSGAAFQMSHELIWFEEVKKIMPPSFIMLKNSEDKTAQELFTREHEGLRRKAEDWMKRTA  619

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
            + C++++T+IAT  FSAA   PGG DD+T  P ++ + SF VF ISD +A I S  SIL 
Sbjct  620  EFCILISTVIATAVFSAAINIPGGIDDQTKKPNYLDKTSFLVFAISDGIAFISSATSILI  679

Query  477  FLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfaftaafflAY--GRAWQPILIA  307
            FLSILI R  + DFH +L  +L  G   L +SI  M+ AF +AFF+ Y  G    P  I+
Sbjct  680  FLSILISRYAEYDFHKSLPFKLICGLVTLFISITCMMVAFGSAFFITYDSGLKVVPDSIS  739

Query  306  AFVALPIASFLYLNARLWIDVVGSML  229
               ++PI  ++ L   LW D++ S +
Sbjct  740  ILASVPILLYITLQFSLWKDIIYSTI  765



>ref|XP_009628824.1| PREDICTED: uncharacterized protein LOC104119112 [Nicotiana tomentosiformis]
Length=528

 Score =   139 bits (350),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 88/202 (44%), Positives = 118/202 (58%), Gaps = 8/202 (4%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  VEK V  +    RN  GKTPK +F +EH +L    EK ++ TA
Sbjct  318  ISGAALQMQRELQWFQEVEKFVHPTLRTNRNSYGKTPKMVFTEEHKELVKEGEKWMKETA  377

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
            +SC  VA L ATV F+AA T PGGN  K G PIF K  +FTVF +S A  +  S+ S+L 
Sbjct  378  NSCTFVAALTATVGFAAAITVPGGNQSK-GFPIFSKEPAFTVFAVSVAFCLFSSVASVLM  436

Query  477  FLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAYGRAWQPILIAAF  301
            FLSIL  R  + DF  +L KRL +G   L +S+  ++ AF A+ +L +G+    ILI   
Sbjct  437  FLSILTARYAEMDFLRSLPKRLIIGLGTLFISMTSLMIAFGASIYLVFGQKNGLILI---  493

Query  300  VALPIASFLYLNARLWIDVVGS  235
               P+  F  L  RL +D+  S
Sbjct  494  ---PVILFESLQFRLLLDICMS  512



>gb|AES70441.2| ankyrin repeat protein [Medicago truncatula]
Length=466

 Score =   139 bits (349),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 83/195 (43%), Positives = 119/195 (61%), Gaps = 3/195 (2%)
 Frame = -1

Query  852  SSALRLSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKS  673
            S A  ++ AA   +RE+ WF  VEK+       ++N DGKT  Q+F +EH  L    +  
Sbjct  251  SQAESIACAAFQMKRELHWFKEVEKLDHPLHKDVKNNDGKTAWQVFKEEHKTLLEEGKNW  310

Query  672  IRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSM  493
            ++ T++SCM+VATLIAT+ F+AA T PGGN+   GIPIF+   +F +F +SDA+A+  SM
Sbjct  311  MKDTSNSCMLVATLIATITFAAAITVPGGNNQDKGIPIFLSDKTFMLFIVSDALALFSSM  370

Query  492  VSILTFLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAYGR--AWQ  322
            VS+L FLSI+  R   +DF +AL KRL +G AAL  ++   + AF AA  +   +   W 
Sbjct  371  VSLLMFLSIIHGRYAKEDFVVALPKRLILGMAALFFAVGTTMIAFGAALSMLLEKRLVWA  430

Query  321  PILIAAFVALPIASF  277
            PI IA    +P+  F
Sbjct  431  PIPIALLACVPVTLF  445



>ref|XP_009783301.1| PREDICTED: uncharacterized protein LOC104231927 isoform X2 [Nicotiana 
sylvestris]
Length=859

 Score =   142 bits (357),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 88/204 (43%), Positives = 120/204 (59%), Gaps = 4/204 (2%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  VEK V  +    RN  GKTPK +F +EH +L    EK ++ TA
Sbjct  641  ISGAALQMQRELQWFQEVEKFVHPTLRTNRNSYGKTPKMVFTEEHKELVKEGEKWMKETA  700

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
            +SC  VA L ATV F+AA T PGGN  K G PIF K  +FT+F +S A  +  S+ S+L 
Sbjct  701  NSCTFVAALTATVGFAAAITVPGGNQSK-GFPIFSKEPAFTIFAVSVAFCLFSSVASVLM  759

Query  477  FLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAYGRAWQPILIAAF  301
            FLSIL  R  + DF  +L KRL +G   L +S+  ++ AF A  +L +G+    ILI   
Sbjct  760  FLSILTARYAETDFLRSLPKRLIIGLGTLFISMTSLMIAFGATIYLVFGQKNGLILIPVG  819

Query  300  VA--LPIASFLYLNARLWIDVVGS  235
            +A  +P+  F  L  RL +D+  S
Sbjct  820  IAGLIPVILFESLQFRLLLDMCMS  843



>ref|XP_009783300.1| PREDICTED: uncharacterized protein LOC104231927 isoform X1 [Nicotiana 
sylvestris]
Length=860

 Score =   142 bits (357),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 88/204 (43%), Positives = 120/204 (59%), Gaps = 4/204 (2%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  VEK V  +    RN  GKTPK +F +EH +L    EK ++ TA
Sbjct  642  ISGAALQMQRELQWFQEVEKFVHPTLRTNRNSYGKTPKMVFTEEHKELVKEGEKWMKETA  701

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
            +SC  VA L ATV F+AA T PGGN  K G PIF K  +FT+F +S A  +  S+ S+L 
Sbjct  702  NSCTFVAALTATVGFAAAITVPGGNQSK-GFPIFSKEPAFTIFAVSVAFCLFSSVASVLM  760

Query  477  FLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAYGRAWQPILIAAF  301
            FLSIL  R  + DF  +L KRL +G   L +S+  ++ AF A  +L +G+    ILI   
Sbjct  761  FLSILTARYAETDFLRSLPKRLIIGLGTLFISMTSLMIAFGATIYLVFGQKNGLILIPVG  820

Query  300  VA--LPIASFLYLNARLWIDVVGS  235
            +A  +P+  F  L  RL +D+  S
Sbjct  821  IAGLIPVILFESLQFRLLLDMCMS  844



>ref|XP_008440858.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X2 [Cucumis melo]
Length=559

 Score =   139 bits (350),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 120/198 (61%), Gaps = 22/198 (11%)
 Frame = -1

Query  840  RLSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGK-TPKQLFLKEHMKLKINAEKSIRG  664
            R+S AA    RE+ WF  VEKIV  +   MR K GK +P++LF ++H  L  + EK ++ 
Sbjct  329  RISGAAFQMHRELLWFKQVEKIVELT---MRRKKGKRSPRELFTQQHKGLVEDGEKWMKK  385

Query  663  TADSCMIVATLIATVAFSAAFTAPGG---------------NDDKTGIPIFIKRASFTVF  529
            TA+SCM+VATLI TV F+A FT PGG               N++ TG P+F+    FTVF
Sbjct  386  TANSCMLVATLITTVVFAAIFTVPGGYTNTTTTSTTGSVIENNNNTGTPLFLYHKWFTVF  445

Query  528  TISDAVAMIFSMVSILTFLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfaftaa  352
             ISDA A+I S  +IL FLSIL  R  ++DF L L  +L  G   L +S+  M+ AF+A 
Sbjct  446  VISDATALISSSTAILLFLSILTSRCAEEDFLLWLPLKLVFGLGTLFLSVVTMVLAFSAT  505

Query  351  fflAYGR--AWQPILIAA  304
            FFL YG+  AW P+L+A 
Sbjct  506  FFLFYGKDTAWVPLLVAG  523



>ref|XP_003547429.2| PREDICTED: uncharacterized protein LOC100814943 [Glycine max]
Length=430

 Score =   138 bits (348),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 93/206 (45%), Positives = 124/206 (60%), Gaps = 5/206 (2%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AA    RE+ WF  V+K++P  F   RN +GKTP++LF +EH +L   AE  ++G A
Sbjct  209  VSGAAFQMMRELRWFEVVKKVMPPCFIEKRNSNGKTPRELFTEEHTELLTKAECWMKGMA  268

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRAS-FTVFTISDAVAMIFSMVSIL  481
             SCMIV+TLIAT  F+AAF+ P G+         +   S F +F ISDA A+I S VSIL
Sbjct  269  KSCMIVSTLIATEVFTAAFSIPRGDGGDDNNNGNLNCNSIFIIFAISDATALISSSVSIL  328

Query  480  TFLSIL-IWRNTDDDFHLALK-RLFVGFAALGVSICGMlfaftaafflAY--GRAWQPIL  313
             FLS+L I R  +DDF  +L  +L  G   L +SI  M+ AF++AFF+ Y  G  W PIL
Sbjct  329  IFLSMLVISRYAEDDFFKSLPMKLICGLVTLFISIASMMVAFSSAFFITYYHGLKWVPIL  388

Query  312  IAAFVALPIASFLYLNARLWIDVVGS  235
            I+     PI  F +L   LW D+V S
Sbjct  389  ISVLAIAPITLFTFLLFPLWSDIVCS  414



>ref|NP_190975.1| ankyrin repeat-containing protein [Arabidopsis thaliana]
 emb|CAB70981.1| putative protein [Arabidopsis thaliana]
 gb|AEE79183.1| ankyrin repeat-containing protein [Arabidopsis thaliana]
Length=574

 Score =   139 bits (350),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 85/217 (39%), Positives = 126/217 (58%), Gaps = 9/217 (4%)
 Frame = -1

Query  834  STAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTAD  655
            S AALH ++E+ WF  V++IVP S+   +N  G+    +F ++H  L+   E+ ++ TA 
Sbjct  347  SGAALHMQKELLWFKAVKEIVPRSYIETKNTKGELAHDIFTEQHENLRKEGERWMKETAT  406

Query  654  SCMIVATLIATVAFSAAFTAPGGNDDK------TGIPIFIKRASFTVFTISDAVAMIFSM  493
            +CM+ ATLIATV F+AA T PGGNDD        G P F KR  F +FT+SD+VA+  SM
Sbjct  407  ACMLGATLIATVVFAAAITIPGGNDDSGDKANTLGFPNFRKRLLFDIFTLSDSVALFSSM  466

Query  492  VSILTFLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAY--GRAWQ  322
            +SI+ FLSI   R  ++DF   L  +L  G +AL +SI  M+ AFT +  L      +  
Sbjct  467  MSIVIFLSIFTSRYAEEDFRYDLPTKLMFGLSALFISIISMILAFTFSMILIRVEKASLS  526

Query  321  PILIAAFVALPIASFLYLNARLWIDVVGSMLLKLLPF  211
             +LI+   +L   +F YL   LW + + S+ + +  F
Sbjct  527  LVLISCLASLTALTFAYLYFHLWFNTLRSVYISMFLF  563



>ref|XP_008348268.1| PREDICTED: uncharacterized protein LOC103411410 [Malus domestica]
Length=359

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 77/201 (38%), Positives = 123/201 (61%), Gaps = 4/201 (2%)
 Frame = -1

Query  828  AALHYEREISWFMGVE-KIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTADS  652
            AAL  +RE+ WF  VE    P    H+ N D  TP+++F++ H ++   AEKS++ T+ S
Sbjct  137  AALQMQRELQWFKEVESHAYPKDREHV-NGDNMTPREIFMENHKEMGKEAEKSMKETSTS  195

Query  651  CMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILTFL  472
            C +V  LI T+ F+AAFT PGGND+ TG+P F+ +  FT F +SDA+++  S  S++ FL
Sbjct  196  CTVVGALIVTIMFAAAFTVPGGNDENTGLPKFLTKKVFTTFIVSDAISLFSSTTSVIMFL  255

Query  471  SILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAY-GRAWQPILIAAFV  298
             IL  R ++DDFH +L  ++ +G   L +SI  M+  F+ A ++   G+    I I    
Sbjct  256  GILTSRYSEDDFHKSLPTKMIIGLFTLFLSIATMMIVFSCALYIMLDGKPSIVIPIILLA  315

Query  297  ALPIASFLYLNARLWIDVVGS  235
            ++PIASF+++   L + ++ S
Sbjct  316  SVPIASFIWMQFPLLVALIIS  336



>gb|KEH33947.1| ankyrin repeat protein [Medicago truncatula]
Length=494

 Score =   139 bits (349),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 82/195 (42%), Positives = 115/195 (59%), Gaps = 3/195 (2%)
 Frame = -1

Query  852  SSALRLSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKS  673
            S A  ++ AA   +RE+ WF  VEK+       ++N DGKT  Q+F +EH  L    +  
Sbjct  279  SQAESIACAAFQMKRELHWFKEVEKLDHPLHKDVKNNDGKTAWQVFKEEHKTLLEEGKNW  338

Query  672  IRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSM  493
            ++ T++SCM+VATLIAT+ F+AA T PGGN+   GIPIF+   +F +F +SDA+A+  SM
Sbjct  339  MKDTSNSCMLVATLIATITFAAAITVPGGNNQDKGIPIFLSDKTFMLFIVSDALALFSSM  398

Query  492  VSILTFLSILIWRNTDDDFHLAL-KRLFVGFAAL--GVSICGMlfaftaafflAYGRAWQ  322
            VS+L FLSI+  R   +DF +AL KRL +G AAL   V    + F    +  L     W 
Sbjct  399  VSLLMFLSIIHGRYAKEDFVVALPKRLILGMAALFFAVGTTMIAFGAALSMLLEKRLVWA  458

Query  321  PILIAAFVALPIASF  277
            PI IA    +P+  F
Sbjct  459  PIPIALLACVPVTLF  473



>ref|XP_003600190.1| hypothetical protein MTR_3g055310 [Medicago truncatula]
 gb|KEH33950.1| ankyrin repeat protein [Medicago truncatula]
Length=492

 Score =   139 bits (349),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 83/195 (43%), Positives = 119/195 (61%), Gaps = 3/195 (2%)
 Frame = -1

Query  852  SSALRLSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKS  673
            S A  ++ AA   +RE+ WF  VEK+       ++N DGKT  Q+F +EH  L    +  
Sbjct  277  SQAESIACAAFQMKRELHWFKEVEKLDHPLHKDVKNNDGKTAWQVFKEEHKTLLEEGKNW  336

Query  672  IRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSM  493
            ++ T++SCM+VATLIAT+ F+AA T PGGN+   GIPIF+   +F +F +SDA+A+  SM
Sbjct  337  MKDTSNSCMLVATLIATITFAAAITVPGGNNQDKGIPIFLSDKTFMLFIVSDALALFSSM  396

Query  492  VSILTFLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAYGR--AWQ  322
            VS+L FLSI+  R   +DF +AL KRL +G AAL  ++   + AF AA  +   +   W 
Sbjct  397  VSLLMFLSIIHGRYAKEDFVVALPKRLILGMAALFFAVGTTMIAFGAALSMLLEKRLVWA  456

Query  321  PILIAAFVALPIASF  277
            PI IA    +P+  F
Sbjct  457  PIPIALLACVPVTLF  471



>ref|XP_008337866.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Malus 
domestica]
Length=520

 Score =   139 bits (349),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 84/209 (40%), Positives = 127/209 (61%), Gaps = 12/209 (6%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  VEK+V   +   RN++G++ ++LF KEH  L  + EK ++ T+
Sbjct  303  ISGAALQMQRELQWFKEVEKLVHPYYKESRNQNGESARELFTKEHKLLAESGEKWLKDTS  362

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRAS--FTVFTISDAVAMIFSMVSI  484
            +SCM+V+TL+ATV F+AAFT PG ND++ G PIF+++ S  F VF +SD VA+  S+ S+
Sbjct  363  NSCMLVSTLVATVVFAAAFTVPGCNDNE-GAPIFLQKKSAIFLVFVVSDTVALFSSLTSL  421

Query  483  LTFLSILIWRNTDDDFHLAL-KRLFVG----FAALGVSICGMlfaftaafflAYGRAWQP  319
            L FLSIL  R  ++DF  +L KRL +G    F A+  ++       +      +     P
Sbjct  422  LMFLSILTARYAEEDFLESLPKRLIIGLGTLFFAIAATMVAFGPTLSIVLSKRFNGVSVP  481

Query  318  I-LIAAFVALPIASFLYLNARLWIDVVGS  235
            I L+A+F   P+  F  L   L+I +V S
Sbjct  482  ITLLASF---PVTLFALLQLPLFIQMVRS  507



>ref|XP_011096899.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Sesamum 
indicum]
Length=673

 Score =   140 bits (352),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 102/222 (46%), Positives = 135/222 (61%), Gaps = 8/222 (4%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  VEK+VP S   MRN +G  P++LF  EH  L I  E  ++ TA
Sbjct  453  VSGAALQMQRELLWFKEVEKVVPPSCLEMRNGEGLRPRELFSLEHKSLLIKGETWMKDTA  512

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
            ++CMIVA LIATVAF+AAFT PGGN+  TG+PI +K+  FT F +S+ VA+  S  SI+ 
Sbjct  513  NNCMIVAALIATVAFAAAFTLPGGNNSDTGMPILMKKTYFTFFAVSNGVALFSSTASIIM  572

Query  477  FLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAYGRAWQPIL----  313
            FLSIL  R  +DDF ++L  +L  G A L  SI GM+ AFT  FFL +      +L    
Sbjct  573  FLSILTSRYQEDDFLVSLPTKLIFGLATLFTSIVGMVIAFTTTFFLLFHEEKTSVLKWIA  632

Query  312  IAAFVALPIASFLYLNARLWIDVVGSMLLKLLPF--TKQTTY  193
            ++A V L I  F  L+ +LWID + S       F  +K T Y
Sbjct  633  VSACVYL-ITLFAGLHIQLWIDTICSAYRSRFLFGKSKHTLY  673



>ref|XP_002513462.1| ankyrin repeat-containing protein, putative [Ricinus communis]
 gb|EEF48865.1| ankyrin repeat-containing protein, putative [Ricinus communis]
Length=590

 Score =   139 bits (350),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 103/164 (63%), Gaps = 3/164 (2%)
 Frame = -1

Query  861  MQESSALRLSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINA  682
            +Q SS  ++S AAL  +RE+ WF  VEK++  S+  +++K+G+TP+Q+F + H  L    
Sbjct  365  LQPSS--KISGAALQMQRELQWFKEVEKVIQPSYKELKDKNGRTPRQVFTEGHKSLVEQG  422

Query  681  EKSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMI  502
            EK ++ TA SC  VA L+ TV F+AAFT PGGN+   GIPI++   +F +F ISDA+ + 
Sbjct  423  EKWMKDTATSCATVAALVITVVFAAAFTVPGGNNSDQGIPIYLNETAFVIFAISDALGLF  482

Query  501  FSMVSILTFLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGM  373
             S  S+L FL IL  R ++ DF  AL  RL +G   L  SI  M
Sbjct  483  SSSTSLLMFLGILTSRYSEGDFLKALPMRLSIGLITLFFSIASM  526



>ref|XP_011093854.1| PREDICTED: alpha-latrocrustotoxin-Lt1a-like isoform X2 [Sesamum 
indicum]
Length=648

 Score =   139 bits (351),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 82/204 (40%), Positives = 119/204 (58%), Gaps = 3/204 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S+AAL  +RE+ W+  VE  V   F   +N   +TP   F  EH  L    EK ++ TA
Sbjct  429  VSSAALQMQRELQWYKEVETFVLPDFKDSKNSKRRTPAVEFSVEHKDLIKEGEKWMKDTA  488

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
            +SC + A LIAT+AF+A+ T PGGN+  +G PIF    +F +F + DA+++  S  S+L 
Sbjct  489  NSCTVAAALIATIAFAASITVPGGNNGDSGFPIFSNNPAFNIFALFDALSLFSSTASMLM  548

Query  477  FLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAYG--RAWQPILIA  307
            FLSIL  R  + DF  +L KRL +G   L +SI  M+ AF+A  +L +G  +AW  I +A
Sbjct  549  FLSILTARYAEGDFLYSLPKRLIIGLVTLFLSITSMMIAFSATLYLVFGQKKAWTLIPVA  608

Query  306  AFVALPIASFLYLNARLWIDVVGS  235
            A   LP+  F+ L   L + +V S
Sbjct  609  ALACLPVTLFVTLQFPLLVGIVRS  632



>ref|XP_007203639.1| hypothetical protein PRUPE_ppa004188mg [Prunus persica]
 gb|EMJ04838.1| hypothetical protein PRUPE_ppa004188mg [Prunus persica]
Length=524

 Score =   139 bits (349),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 89/228 (39%), Positives = 136/228 (60%), Gaps = 13/228 (6%)
 Frame = -1

Query  882  VEEEEDIMQESSAL-------RLSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPK  724
            +E  E I+  ++ L        +S AAL  +RE+ WF  VE +V   +    N + +T +
Sbjct  285  LEPRETILHLAAKLPPLSQLSSISGAALQMQRELQWFKVVENLVHPYYKEYPNTNLETAR  344

Query  723  QLFLKEHMKLKINAEKSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRA  544
            +LF KEH +L  + EK ++ T++SCM+VATL+ATV F+AAFTAPGGN+D  G P F+ + 
Sbjct  345  ELFTKEHKQLAESGEKWLKDTSNSCMLVATLVATVVFAAAFTAPGGNNDD-GDPNFLDKK  403

Query  543  S--FTVFTISDAVAMIFSMVSILTFLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGM  373
            +  F VF +SDA+++  S+ S+L FLSIL  R  ++DF  +L K+L +G A+L ++I  M
Sbjct  404  TIMFMVFAVSDAISLFASLTSLLMFLSILTARYAEEDFLESLPKKLIIGLASLFIAIATM  463

Query  372  lfaftaafflAYGRA--WQPILIAAFVALPIASFLYLNARLWIDVVGS  235
            + AF A F +   +   W  I I    + P+  F  L   L+I +V S
Sbjct  464  MVAFGATFTIVLSKKFNWVYIPITLLASFPVTLFALLQLPLFIQMVRS  511



>ref|XP_008379536.1| PREDICTED: uncharacterized protein LOC103442515 [Malus domestica]
Length=829

 Score =   140 bits (354),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 77/197 (39%), Positives = 119/197 (60%), Gaps = 2/197 (1%)
 Frame = -1

Query  828  AALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTADSC  649
            AAL  +RE+ WF  VE +         N DG TP++LF + H K+   AEKS++ TA SC
Sbjct  608  AALQMQRELQWFKEVESVTDPKDRECLNDDGMTPQELFKENHKKMGEEAEKSMKETATSC  667

Query  648  MIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILTFLS  469
             +V  LI T+ F+AAFT PGGND+KT +P F+ +  FT F +SDA+++  S  S++ FL 
Sbjct  668  TVVGALIVTIMFAAAFTVPGGNDEKTSLPKFLTKKVFTAFIVSDAISLFSSTTSVIMFLG  727

Query  468  ILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAY-GRAWQPILIAAFVA  295
            IL  R ++DDF  +L  ++ +G   L +SI  M+  F+ A ++   G++   I I    +
Sbjct  728  ILTSRYSEDDFFKSLPTKMIIGLFTLFLSITTMMIVFSCALYIMLDGKSSIVIPIILIAS  787

Query  294  LPIASFLYLNARLWIDV  244
            +P+ASF+ +   L +D+
Sbjct  788  VPVASFISMQFPLLVDI  804



>ref|XP_002869960.1| hypothetical protein ARALYDRAFT_354764 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46219.1| hypothetical protein ARALYDRAFT_354764 [Arabidopsis lyrata subsp. 
lyrata]
Length=644

 Score =   139 bits (350),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 89/216 (41%), Positives = 123/216 (57%), Gaps = 5/216 (2%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  V++IVP S+   +NKDG+    LF KEH  L+   EK ++ TA
Sbjct  422  VSGAALQMQRELLWFKAVKEIVPRSYIKTKNKDGQVAHDLFTKEHENLRKEGEKWMKETA  481

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDK-TGIPIFIKRASFTVFTISDAVAMIFSMVSIL  481
             +CM+VA LIATV F+A FT PGG D    G P F     FT+F +SD+ A+  S+++I+
Sbjct  482  TACMLVAALIATVVFAATFTLPGGTDTGLPGFPQFRGELWFTIFILSDSAALFSSVIAIV  541

Query  480  TFLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAYG---RAWQPIL  313
             FLSIL  R  +DDF   L  +L +G  AL +SI  M+ AFTA+  L        W+ IL
Sbjct  542  LFLSILTSRYAEDDFRTKLPTKLMLGLFALFISINTMVLAFTASMILIRRVDEPVWRLIL  601

Query  312  IAAFVALPIASFLYLNARLWIDVVGSMLLKLLPFTK  205
            I    +L   +F  L+ +LW   + S       F K
Sbjct  602  IVCLSSLAAITFALLHVKLWFITLRSAYFSKFLFRK  637



>gb|KEH33949.1| ankyrin repeat protein [Medicago truncatula]
Length=519

 Score =   138 bits (348),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 83/195 (43%), Positives = 117/195 (60%), Gaps = 3/195 (2%)
 Frame = -1

Query  852  SSALRLSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKS  673
            S A  ++ AA   +RE+ WF  VEK+       ++N DGKT  Q+F +EH  L    +  
Sbjct  304  SQAESIACAAFQMKRELHWFKEVEKLDHPLHKDVKNNDGKTAWQVFKEEHKTLLEEGKNW  363

Query  672  IRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSM  493
            ++ T++SCM+VATLIAT+ F+AA T PGGN+   GIPIF+   +F +F +SDA+A+  SM
Sbjct  364  MKDTSNSCMLVATLIATITFAAAITVPGGNNQDKGIPIFLSDKTFMLFIVSDALALFSSM  423

Query  492  VSILTFLSILIWRNTDDDFHLAL-KRLFVGFAALGVSI-CGMlfaftaafflAYGR-AWQ  322
            VS+L FLSI+  R   +DF +AL KRL +G AAL  ++   M+    A   L   R  W 
Sbjct  424  VSLLMFLSIIHGRYAKEDFVVALPKRLILGMAALFFAVGTTMIAFGAALSMLLEKRLVWA  483

Query  321  PILIAAFVALPIASF  277
            PI IA    +P+  F
Sbjct  484  PIPIALLACVPVTLF  498



>ref|XP_011093852.1| PREDICTED: uncharacterized protein LOC105173694 isoform X2 [Sesamum 
indicum]
Length=630

 Score =   139 bits (350),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 81/204 (40%), Positives = 120/204 (59%), Gaps = 3/204 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ W+  VE  V  S+    N DGKTP  +F +EH  L + AE+ ++ TA
Sbjct  404  VSGAALQMQRELQWYKEVENFVTPSYKGKENTDGKTPAMVFAEEHKDLIVEAEEWLKDTA  463

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
             SC   ATLIATV F+AA T PGG+  ++G+PIF K+  F VF +S+AV++  S+ S+L 
Sbjct  464  KSCTFAATLIATVVFAAAITVPGGSSTESGLPIFQKQRPFVVFAVSNAVSLFSSVTSVLM  523

Query  477  FLSILIWRNTDDDF-HLALKRLFVGFAALGVSICGMlfaftaafflAYG--RAWQPILIA  307
            FL IL  R  + DF ++    L +G   L +S+  M+ AF++A +  +G  R W    + 
Sbjct  524  FLFILTSRCAEADFLYMLPNTLIIGLVNLFLSLASMMLAFSSAMYAVFGHNRTWFLAPLT  583

Query  306  AFVALPIASFLYLNARLWIDVVGS  235
                LP+  FL+L   L  D++ S
Sbjct  584  LVACLPVTLFLFLQYPLLKDMIRS  607



>ref|XP_010665693.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=700

 Score =   140 bits (352),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 91/210 (43%), Positives = 124/210 (59%), Gaps = 10/210 (5%)
 Frame = -1

Query  837  LSTAALHYEREISWFM------GVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEK  676
            +S A L  +REI WF        V+KIV   +    N D KTP  LF +EH +L+   E+
Sbjct  389  VSGATLQMQREILWFKVLVKSKAVKKIVRPEYIEAENNDRKTPHALFREEHERLRTKGEE  448

Query  675  SIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFS  496
             ++ TA+SC +VATLIATV FSAAF  PGG ++K G P+  KRASF VF+IS+ V++  S
Sbjct  449  WMKKTAESCALVATLIATVVFSAAFQLPGGINEK-GYPVLQKRASFVVFSISNGVSLFTS  507

Query  495  MVSILTFLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfaftaafflAY--GRAW  325
              S+L FLSIL  R  + DF ++L  +L  G   L +SI  M+ AFTA FF+ +  G  W
Sbjct  508  TASVLMFLSILTSRYAEQDFLVSLPLKLMSGLILLLISIATMIVAFTATFFITFREGVTW  567

Query  324  QPILIAAFVALPIASFLYLNARLWIDVVGS  235
             PI IA   ++P+  F      L +D+  S
Sbjct  568  APIPIALIASIPVTLFTLQQYPLLMDIYQS  597



>ref|XP_007207788.1| hypothetical protein PRUPE_ppa025725mg, partial [Prunus persica]
 gb|EMJ08987.1| hypothetical protein PRUPE_ppa025725mg, partial [Prunus persica]
Length=312

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 94/237 (40%), Positives = 134/237 (57%), Gaps = 25/237 (11%)
 Frame = -1

Query  879  EEEEDIMQESSALR-------LSTAALHYEREISWF---------------MGVEKIVPS  766
            +E+ +I+  ++ L        +S AAL  +RE+ WF               + V+KIV  
Sbjct  74   DEDNNILHLAAKLAPQNQLNLVSGAALQMQRELVWFEVLLLLSLQSLLLLHLEVKKIVQP  133

Query  765  SFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTADSCMIVATLIATVAFSAAFTAPGG  586
                M+NK GKTP++LF  EH  L    E  ++ TA SCM+VAT+IATV FSAAF+ PGG
Sbjct  134  LSTEMKNKKGKTPRELFTSEHKGLLHKGESWMKNTAKSCMLVATIIATVVFSAAFSIPGG  193

Query  585  NDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILTFLSILIWRNTDDDFHLALK-RLFV  409
              DKTG P F+K  +F +F ISD VA+  S  S+L FL IL  R  ++DF  +L  +L V
Sbjct  194  IADKTGAPNFVKETAFLIFAISDGVALFSSSTSMLMFLYILTSRYAENDFLKSLPLKLMV  253

Query  408  GFAALGVSICGMlfaftaafflA--YGRAWQPILIAAFVALPIASFLYLNARLWIDV  244
            G A+L +S+  M+ AF+ AF+L+   G  +    I  F  +P+  FL+L   L  D+
Sbjct  254  GLASLFISMTSMMIAFSTAFYLSCHCGLGFVSDFIFIFAFVPVVLFLFLQYPLLPDM  310



>ref|XP_008242231.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X2 [Prunus mume]
Length=637

 Score =   139 bits (350),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 89/228 (39%), Positives = 136/228 (60%), Gaps = 13/228 (6%)
 Frame = -1

Query  882  VEEEEDIMQESSAL-------RLSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPK  724
            +E  E I+  ++ L        +S AAL  +RE+ WF  VE +V   +    N + +T +
Sbjct  398  LEPRETILHLAAKLPPLSQLSSISGAALQMQRELQWFKVVENLVHPYYKEYPNTNLETAR  457

Query  723  QLFLKEHMKLKINAEKSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRA  544
            +LF KEH +L  + EK ++ T++SCM+VATL+ATV F+AAFTAPGGN+D  G P F+ + 
Sbjct  458  ELFTKEHKQLAESGEKWLKDTSNSCMLVATLVATVVFAAAFTAPGGNNDD-GDPNFLDKK  516

Query  543  S--FTVFTISDAVAMIFSMVSILTFLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGM  373
            +  F VF +SDA+++  S+ S+L FLSIL  R  ++DF  +L K+L +G A+L ++I  M
Sbjct  517  TIMFMVFAVSDAISLFASLTSLLMFLSILTARYAEEDFLESLPKKLIIGLASLFIAIATM  576

Query  372  lfaftaafflAYGRA--WQPILIAAFVALPIASFLYLNARLWIDVVGS  235
            + AF A F +   +   W  I I    + P+  F  L   L+I +V S
Sbjct  577  MVAFGATFTIVLSKKFNWVYIPITLLASFPVTLFALLQLPLFIQMVRS  624



>ref|XP_011093848.1| PREDICTED: uncharacterized protein LOC105173694 isoform X1 [Sesamum 
indicum]
 ref|XP_011093849.1| PREDICTED: uncharacterized protein LOC105173694 isoform X1 [Sesamum 
indicum]
 ref|XP_011093850.1| PREDICTED: uncharacterized protein LOC105173694 isoform X1 [Sesamum 
indicum]
 ref|XP_011093851.1| PREDICTED: uncharacterized protein LOC105173694 isoform X1 [Sesamum 
indicum]
Length=649

 Score =   139 bits (350),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 81/204 (40%), Positives = 120/204 (59%), Gaps = 3/204 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ W+  VE  V  S+    N DGKTP  +F +EH  L + AE+ ++ TA
Sbjct  423  VSGAALQMQRELQWYKEVENFVTPSYKGKENTDGKTPAMVFAEEHKDLIVEAEEWLKDTA  482

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
             SC   ATLIATV F+AA T PGG+  ++G+PIF K+  F VF +S+AV++  S+ S+L 
Sbjct  483  KSCTFAATLIATVVFAAAITVPGGSSTESGLPIFQKQRPFVVFAVSNAVSLFSSVTSVLM  542

Query  477  FLSILIWRNTDDDF-HLALKRLFVGFAALGVSICGMlfaftaafflAYG--RAWQPILIA  307
            FL IL  R  + DF ++    L +G   L +S+  M+ AF++A +  +G  R W    + 
Sbjct  543  FLFILTSRCAEADFLYMLPNTLIIGLVNLFLSLASMMLAFSSAMYAVFGHNRTWFLAPLT  602

Query  306  AFVALPIASFLYLNARLWIDVVGS  235
                LP+  FL+L   L  D++ S
Sbjct  603  LVACLPVTLFLFLQYPLLKDMIRS  626



>ref|XP_011093853.1| PREDICTED: alpha-latrocrustotoxin-Lt1a-like isoform X1 [Sesamum 
indicum]
Length=678

 Score =   139 bits (351),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 82/204 (40%), Positives = 119/204 (58%), Gaps = 3/204 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S+AAL  +RE+ W+  VE  V   F   +N   +TP   F  EH  L    EK ++ TA
Sbjct  459  VSSAALQMQRELQWYKEVETFVLPDFKDSKNSKRRTPAVEFSVEHKDLIKEGEKWMKDTA  518

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
            +SC + A LIAT+AF+A+ T PGGN+  +G PIF    +F +F + DA+++  S  S+L 
Sbjct  519  NSCTVAAALIATIAFAASITVPGGNNGDSGFPIFSNNPAFNIFALFDALSLFSSTASMLM  578

Query  477  FLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfaftaafflAYG--RAWQPILIA  307
            FLSIL  R  + DF  +L KRL +G   L +SI  M+ AF+A  +L +G  +AW  I +A
Sbjct  579  FLSILTARYAEGDFLYSLPKRLIIGLVTLFLSITSMMIAFSATLYLVFGQKKAWTLIPVA  638

Query  306  AFVALPIASFLYLNARLWIDVVGS  235
            A   LP+  F+ L   L + +V S
Sbjct  639  ALACLPVTLFVTLQFPLLVGIVRS  662



>ref|XP_008242230.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X1 [Prunus mume]
Length=639

 Score =   139 bits (349),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 89/228 (39%), Positives = 136/228 (60%), Gaps = 13/228 (6%)
 Frame = -1

Query  882  VEEEEDIMQESSAL-------RLSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPK  724
            +E  E I+  ++ L        +S AAL  +RE+ WF  VE +V   +    N + +T +
Sbjct  400  LEPRETILHLAAKLPPLSQLSSISGAALQMQRELQWFKVVENLVHPYYKEYPNTNLETAR  459

Query  723  QLFLKEHMKLKINAEKSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRA  544
            +LF KEH +L  + EK ++ T++SCM+VATL+ATV F+AAFTAPGGN+D  G P F+ + 
Sbjct  460  ELFTKEHKQLAESGEKWLKDTSNSCMLVATLVATVVFAAAFTAPGGNNDD-GDPNFLDKK  518

Query  543  S--FTVFTISDAVAMIFSMVSILTFLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGM  373
            +  F VF +SDA+++  S+ S+L FLSIL  R  ++DF  +L K+L +G A+L ++I  M
Sbjct  519  TIMFMVFAVSDAISLFASLTSLLMFLSILTARYAEEDFLESLPKKLIIGLASLFIAIATM  578

Query  372  lfaftaafflAYGRA--WQPILIAAFVALPIASFLYLNARLWIDVVGS  235
            + AF A F +   +   W  I I    + P+  F  L   L+I +V S
Sbjct  579  MVAFGATFTIVLSKKFNWVYIPITLLASFPVTLFALLQLPLFIQMVRS  626



>ref|XP_008244948.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Prunus 
mume]
Length=322

 Score =   135 bits (340),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 75/200 (38%), Positives = 120/200 (60%), Gaps = 2/200 (1%)
 Frame = -1

Query  837  LSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTA  658
            +S AAL  +RE+ WF  VE IV        N DG TP++LF K H +L    E+ ++GTA
Sbjct  105  ISGAALQMQREVQWFKEVETIVLPRIKESINYDGMTPRELFTKNHKELVKEGERWMKGTA  164

Query  657  DSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILT  478
             SC +V  LI T+ F+AAFT PGGN+ +TG PIF+ +  F  F ++DA+++  S  S+L 
Sbjct  165  SSCTVVGALIITIMFAAAFTIPGGNNGETGFPIFLHKKLFMAFIVADAMSLFSSTTSVLM  224

Query  477  FLSILIWRNTDDDFHLAL-KRLFVGFAALGVSICGMlfa-ftaafflAYGRAWQPILIAA  304
            FL IL  R  ++DF  +L  ++ +G + L +SI  M+ A  +A F + + ++W  I I  
Sbjct  225  FLGILTSRYAEEDFLKSLPTKMIIGLSTLFISIATMMVAFSSALFIMIHEQSWIVIPIIF  284

Query  303  FVALPIASFLYLNARLWIDV  244
              ++P+  F+++   L +++
Sbjct  285  VASVPVTLFIWMQFPLLVEM  304



>emb|CDP00887.1| unnamed protein product [Coffea canephora]
Length=368

 Score =   136 bits (342),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 80/198 (40%), Positives = 115/198 (58%), Gaps = 3/198 (2%)
 Frame = -1

Query  825  ALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQLFLKEHMKLKINAEKSIRGTADSCM  646
            A   + E  WF  VE IV       +N +GKTP++LF   H KL  NA+   +  ++SCM
Sbjct  151  AFQMQLEFQWFKAVEAIVYYELRIKKNDEGKTPRELFSDTHEKLLKNAKGWTKDLSNSCM  210

Query  645  IVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRASFTVFTISDAVAMIFSMVSILTFLSI  466
            +VATL+ATVAF+A  TAPGGND +TG+P+  ++  FTVF+IS+A++MI S  S+L FLSI
Sbjct  211  VVATLVATVAFAAMITAPGGNDSETGMPVLARKKLFTVFSISNALSMISSAASLLMFLSI  270

Query  465  LIWRNTDDDFHLALKRLFV-GFAALGVSICGMlfaftaafflAYG--RAWQPILIAAFVA  295
               R T+DDF  +L R+ V G   L +++  M+ +F     L+    + W  I I     
Sbjct  271  QTSRYTEDDFLKSLPRILVRGLVFLSIAVITMMISFGTTIGLSLQTRQKWAYIPITIVAC  330

Query  294  LPIASFLYLNARLWIDVV  241
             P   F +L+  L +  V
Sbjct  331  FPAIIFFWLHLPLLLQTV  348



>ref|XP_007154757.1| hypothetical protein PHAVU_003G145000g [Phaseolus vulgaris]
 gb|ESW26751.1| hypothetical protein PHAVU_003G145000g [Phaseolus vulgaris]
Length=717

 Score =   139 bits (351),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 92/225 (41%), Positives = 132/225 (59%), Gaps = 3/225 (1%)
 Frame = -1

Query  900  KKNDDQVEEEEDIMQESSALRLSTAALHYEREISWFMGVEKIVPSSFHHMRNKDGKTPKQ  721
            KKN++ +     +        +S AAL    EI WF  V+KI+P+S+  M N DG T + 
Sbjct  474  KKNNNLLHMAAKLAPTGQLELVSGAALQMCLEIIWFEEVKKIMPASYIIMENSDGLTAQD  533

Query  720  LFLKEHMKLKINAEKSIRGTADSCMIVATLIATVAFSAAFTAPGGNDDKTGIPIFIKRAS  541
            LF KEH +L+   E  ++ TA+ C++++T+IAT  FSAA   PGG DD+T  P ++ + S
Sbjct  534  LFTKEHEELRKKGEVWMKRTAEFCILISTVIATAVFSAAINIPGGIDDETKKPKYMDQTS  593

Query  540  FTVFTISDAVAMIFSMVSILTFLSILIWRNTDDDFHLALK-RLFVGFAALGVSICGMlfa  364
            F +F ISDA A I S  +IL FLSILI R    DF+ +L  +L  G   L +SI  M+ A
Sbjct  594  FLIFAISDAAAFISSSTAILIFLSILISRYAQYDFYKSLPLKLISGLMTLFLSITFMMVA  653

Query  363  ftaafflAYGRAWQ--PILIAAFVALPIASFLYLNARLWIDVVGS  235
            F +AFF+ Y  + +  P LIA FV  P+  ++ L   LW D++ S
Sbjct  654  FGSAFFITYTYSSRLIPDLIAVFVCPPLLLYIALQFSLWSDILYS  698



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2351319000596