BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7644_g1_i1 len=1080 path=[1058:0-576 1635:577-1079]

Length=1080
                                                                      Score     E

dbj|BAF91445.1|  PI/GLO-related transcription factor CONTORTED          433   9e-150   Ipomoea nil [qian niu]
gb|AAS46018.1|  MADS-box protein GLO1                                   344   9e-115   Petunia x hybrida [garden petunia]
sp|Q03488.1|FBP1_PETHY  RecName: Full=Floral homeotic protein FBP...    341   1e-113   Petunia x hybrida [garden petunia]
sp|Q03416.1|GLOB_TOBAC  RecName: Full=Floral homeotic protein GLO...    338   2e-112   Nicotiana tabacum [American tobacco]
ref|XP_009777738.1|  PREDICTED: floral homeotic protein GLOBOSA i...    337   7e-112   
ref|XP_009588903.1|  PREDICTED: floral homeotic protein GLOBOSA i...    334   6e-111   
ref|XP_004245202.1|  PREDICTED: floral homeotic protein FBP1            330   4e-109   
gb|AGN54427.1|  MADS-box protein GLO1                                   328   1e-108   
emb|CDN40862.1|  Type II (MIKC) MADS-box transcription factor           325   2e-107   
emb|CDN40861.1|  Type II (MIKC) MADS-box transcription factor           324   6e-107   
ref|XP_006361522.1|  PREDICTED: floral homeotic protein FBP1-like       322   3e-106   
gb|AEM60213.1|  MADS box transcription factor                           321   6e-106   
emb|CDN40865.1|  Type II (MIKC) MADS-box transcription factor           321   6e-106   
emb|CDN40880.1|  Type II (MIKC) MADS-box transcription factor           318   8e-105   
gb|ABF50238.1|  GLOBOSA/PISTILLATA                                      318   9e-105   Nicotiana langsdorffii x Nicotiana sanderae
ref|XP_009777739.1|  PREDICTED: floral homeotic protein GLOBOSA i...    303   6e-99    
dbj|BAE72882.1|  GLOBOSA homologue                                      303   1e-98    Glandularia x hybrida [garden verbena]
ref|XP_009588907.1|  PREDICTED: floral homeotic protein GLOBOSA i...    301   5e-98    
ref|XP_011081947.1|  PREDICTED: floral homeotic protein GLOBOSA         301   5e-98    
emb|CAJ44133.1|  globosa protein                                        296   5e-96    Misopates orontium
sp|Q03378.1|GLOB_ANTMA  RecName: Full=Floral homeotic protein GLO...    296   7e-96    Antirrhinum majus [garden snapdragon]
gb|ABF50237.1|  GLOBOSA/PISTILLATA                                      295   8e-96    Nicotiana langsdorffii x Nicotiana sanderae
gb|EYU21960.1|  hypothetical protein MIMGU_mgv1a013697mg                295   2e-95    
gb|EYU21961.1|  hypothetical protein MIMGU_mgv1a013697mg                286   5e-92    
gb|AEA76417.1|  putative GLO1                                           280   8e-90    
gb|AAD02250.1|  MADS box protein 26                                     280   2e-89    Cucumis sativus [cucumbers]
ref|XP_009608638.1|  PREDICTED: floral homeotic protein PMADS 2         279   3e-89    
ref|XP_009803901.1|  PREDICTED: floral homeotic protein PMADS 2         279   4e-89    
gb|AHH28258.1|  MADS-box transcription factor                           277   2e-88    
gb|AGA61757.1|  pistillata                                              277   2e-88    
sp|Q07474.1|MADS2_PETHY  RecName: Full=Floral homeotic protein PM...    277   2e-88    Petunia x hybrida [garden petunia]
gb|AEM60220.1|  MADS box transcription factor                           276   3e-88    
gb|ADU15475.1|  PI                                                      275   1e-87    
gb|ADR83606.1|  PPI                                                     275   1e-87    
emb|CAA50549.1|  FBP3                                                   275   1e-87    Petunia x hybrida [garden petunia]
ref|XP_008444207.1|  PREDICTED: floral homeotic protein PMADS 2 i...    276   1e-87    
ref|XP_002520308.1|  mads box protein, putative                         275   2e-87    Ricinus communis
dbj|BAJ53191.1|  JMS09K11.9                                             274   2e-87    
gb|AGN54426.1|  PFGLO2                                                  274   2e-87    
gb|ADM88562.1|  GLO1 MADS-box transcription factor                      273   2e-87    
gb|ADU56835.1|  MADS-box protein GLO subfamily                          273   7e-87    
gb|AHH28269.1|  MADS-box transcription factor                           272   1e-86    
ref|XP_007019220.1|  Mads box protein, putative                         272   1e-86    
gb|AER30449.1|  PISTILLATA                                              271   3e-86    
ref|NP_001267875.1|  PISTILLATA-like MADS-box protein-like              270   9e-86    
ref|XP_006361521.1|  PREDICTED: LOW QUALITY PROTEIN: floral homeo...    268   2e-85    
gb|AGW23352.1|  MADS box protein MADS50                                 268   4e-85    
gb|ADU56834.1|  MADS-box protein GLO subfamily                          268   8e-85    
gb|ADX86812.1|  MADS domain transcription factor                        266   3e-84    
gb|ACJ26767.1|  MADS-12                                                 266   3e-84    Gossypium hirsutum [American cotton]
ref|XP_006365936.1|  PREDICTED: floral homeotic protein PMADS 2-like    266   4e-84    
ref|XP_004498359.1|  PREDICTED: floral homeotic protein PMADS 2-like    267   4e-84    
gb|AEE98378.1|  pistillata MADS-box protein                             265   8e-84    
dbj|BAG24493.1|  GLOBOSA-like MADS-box protein                          266   9e-84    Torenia fournieri [bluewings]
dbj|BAJ15423.1|  GLOBOSA-like MADS-box protein                          265   1e-83    
gb|ADX86813.1|  MADS domain transcription factor                        263   3e-83    
gb|AGH61293.1|  pistillata                                              263   5e-83    
ref|XP_008444208.1|  PREDICTED: floral homeotic protein PMADS 2 i...    263   6e-83    
gb|ABQ51323.1|  B-class MADS-box protein PI                             262   1e-82    Carica papaya [mamon]
emb|CAD32764.1|  PISTILLATA homologue                                   262   1e-82    Betula pendula [white birch]
dbj|BAG68951.1|  PISTILLATA like protein                                262   2e-82    Hydrangea macrophylla
gb|AEM60210.1|  MADS box transcription factor                           261   2e-82    
ref|XP_007161433.1|  hypothetical protein PHAVU_001G068200g             261   3e-82    
dbj|BAK09618.2|  MADS-box transcription factor                          261   3e-82    
gb|AAX13299.1|  MADS box protein PIa                                    261   4e-82    Lotus japonicus
ref|XP_011002438.1|  PREDICTED: floral homeotic protein PMADS 2-l...    260   5e-82    
ref|NP_001241026.1|  uncharacterized protein LOC100817554               260   6e-82    
gb|AIC75373.1|  MADS-box transcription factor GLOBOSA-like protein      260   6e-82    
ref|XP_002300964.1|  MADS-box family protein                            259   1e-81    Populus trichocarpa [western balsam poplar]
ref|XP_002307460.2|  MADS-box family protein                            259   2e-81    Populus trichocarpa [western balsam poplar]
ref|NP_001235385.1|  uncharacterized protein LOC100499997               258   3e-81    
ref|XP_011027463.1|  PREDICTED: floral homeotic protein PMADS 2-l...    258   3e-81    
gb|AGA61772.1|  pistillata                                              258   4e-81    
gb|AIC75374.1|  MADS-box transcription factor GLOBOSA-like protein      258   6e-81    
ref|XP_011002439.1|  PREDICTED: floral homeotic protein PMADS 2-l...    257   8e-81    
ref|XP_006434290.1|  hypothetical protein CICLE_v10002422mg             256   2e-80    
gb|AGL09298.1|  pistillata                                              256   3e-80    
ref|NP_001234075.1|  TPI                                                256   3e-80    
gb|AFN68766.1|  PISTILLATA-like protein                                 255   4e-80    
ref|XP_006472853.1|  PREDICTED: floral homeotic protein GLOBOSA-like    256   5e-80    
gb|ABD78321.1|  Glo protein                                             255   6e-80    Primula vulgaris
gb|AFN68767.1|  PISTILLATA-like protein                                 255   7e-80    
ref|XP_011027462.1|  PREDICTED: floral homeotic protein PMADS 2-l...    255   8e-80    
gb|AFN68742.1|  PISTILLATA-like protein                                 254   1e-79    
emb|CAA56656.1|  SLM2                                                   254   1e-79    Silene latifolia
gb|AFN68726.1|  PISTILLATA-like protein                                 254   2e-79    
gb|AEM60216.1|  MADS box transcription factor                           253   2e-79    
gb|ABD78318.1|  Glo-like protein                                        254   2e-79    Primula vulgaris
gb|AFN68738.1|  PISTILLATA-like protein                                 253   3e-79    
gb|AIE44761.1|  putative MADS-domain transcription factor PI            253   4e-79    
gb|AFN68739.1|  PISTILLATA-like protein                                 253   4e-79    
gb|AFN68724.1|  PISTILLATA-like protein                                 253   4e-79    
gb|AFN68748.1|  PISTILLATA-like protein                                 253   6e-79    
gb|AFN68755.1|  PISTILLATA-like protein                                 253   6e-79    
gb|AEX10628.1|  GLOBOSA                                                 252   7e-79    
gb|AFN68740.1|  PISTILLATA-like protein                                 252   8e-79    
gb|AIC33048.1|  flower development transporter PI                       251   1e-78    
gb|AFN68745.1|  PISTILLATA-like protein                                 252   1e-78    
gb|AFN68725.1|  PISTILLATA-like protein                                 251   2e-78    
ref|XP_010677661.1|  PREDICTED: floral homeotic protein PMADS 2-like    251   2e-78    
gb|AFN68733.1|  PISTILLATA-like protein                                 251   2e-78    
gb|AFN68746.1|  PISTILLATA-like protein                                 251   2e-78    
gb|KCW72539.1|  hypothetical protein EUGRSUZ_E01006                     251   2e-78    
ref|XP_008219575.1|  PREDICTED: floral homeotic protein PMADS 2         251   3e-78    
gb|AAC42576.1|  PISTILLATA homolog SvPI-1                               250   4e-78    Syringa vulgaris
gb|ABP01801.1|  MADS transcription factor PI                            250   5e-78    Aquilegia vulgaris
ref|NP_001289656.1|  floral homeotic protein GLOBOSA-like               250   5e-78    
ref|XP_009358735.1|  PREDICTED: floral homeotic protein PMADS 2         250   5e-78    
gb|AGA61767.1|  pistillata                                              249   6e-78    
gb|AFN68722.1|  PISTILLATA-like protein                                 250   6e-78    
gb|AFN68758.1|  PISTILLATA-like protein                                 250   7e-78    
gb|AGZ63863.1|  PISTILLATA-like protein                                 250   7e-78    
gb|AAO22986.1|  MADS-box transcription factor CDM86                     249   7e-78    Chrysanthemum x morifolium [florist's chrysanthemum]
ref|NP_001280926.1|  floral homeotic protein PMADS 2                    250   7e-78    
gb|AEW50207.1|  PI                                                      249   7e-78    
emb|CAC28022.1|  Pistillata MADS-box protein                            249   1e-77    Malus domestica [apple tree]
gb|ADM72962.1|  PISTILLATA-like protein 1                               249   1e-77    
gb|AFN68759.1|  PISTILLATA-like protein                                 249   1e-77    
gb|AFN68723.1|  PISTILLATA-like protein                                 249   1e-77    
gb|ACY91890.1|  MADS-domain transcription factor                        249   1e-77    Ilex aquifolium [English holly]
gb|AFN68719.1|  PISTILLATA-like protein                                 249   2e-77    
gb|AFN68731.1|  PISTILLATA-like protein                                 249   2e-77    
emb|CAA08804.1|  MADS-box protein, GGLO1                                248   2e-77    Gerbera hybrid cultivar
gb|AEM60218.1|  MADS box transcription factor                           248   2e-77    
gb|AFN68728.1|  PISTILLATA-like protein                                 248   3e-77    
gb|AFN68732.1|  PISTILLATA-like protein                                 248   3e-77    
gb|AGZ63864.1|  PISTILLATA-like protein                                 248   4e-77    
gb|AAW78031.1|  PISTILLATA-like protein                                 248   6e-77    Thalictrum dioicum [early meadow-rue]
gb|AFN68720.1|  PISTILLATA-like protein                                 247   6e-77    
gb|ADM72964.1|  PISTILLATA-like protein 2a                              247   6e-77    
dbj|BAN13571.1|  apetala3/pistillata-like protein                       247   6e-77    
gb|AEN75255.1|  transcription factor MADS2                              247   7e-77    
gb|AFN68762.1|  PISTILLATA-like protein                                 247   7e-77    
gb|AFN68727.1|  PISTILLATA-like protein                                 247   8e-77    
ref|XP_010911271.1|  PREDICTED: MADS-box transcription factor 2-l...    247   8e-77    
ref|XP_008783315.1|  PREDICTED: MADS-box transcription factor 2-like    247   8e-77    
gb|AFN68730.1|  PISTILLATA-like protein                                 247   8e-77    
gb|AGS12591.1|  PI MADS box protein                                     247   1e-76    
gb|AFN68737.1|  PISTILLATA-like protein                                 247   1e-76    
gb|AFN68721.1|  PISTILLATA-like protein                                 247   1e-76    
gb|AFN68763.1|  PISTILLATA-like protein                                 247   1e-76    
gb|AGZ01977.1|  PISTILLATA-like protein                                 246   2e-76    
gb|AFN68734.1|  PISTILLATA-like protein                                 246   2e-76    
gb|ABS32248.1|  PISTILLATA-like protein                                 246   2e-76    Prunus persica
gb|AFN68735.1|  PISTILLATA-like protein                                 246   3e-76    
gb|AIU94284.1|  PISTILLATA-like protein                                 245   4e-76    
gb|KDO80479.1|  hypothetical protein CISIN_1g040096mg                   245   4e-76    
gb|AFN68770.1|  PISTILLATA-like protein                                 245   4e-76    
gb|AFN68750.1|  PISTILLATA-like protein                                 244   7e-76    
gb|ABS29556.1|  PISTILLATA-like MADS box protein                        244   8e-76    Melaleuca quinquenervia
gb|ACD85092.1|  B-class MADS-box protein PI                             244   8e-76    
gb|ACY91919.1|  MADS-domain transcription factor                        244   9e-76    Nasa triphylla
gb|AEM60217.1|  MADS box transcription factor                           243   1e-75    
gb|AAT46101.1|  PISTILLATA-like protein                                 244   1e-75    Akebia trifoliata
gb|ABQ85946.1|  MADS-box transcription factor PI-like 1                 244   1e-75    Trochodendron aralioides
gb|AFN68749.1|  PISTILLATA-like protein                                 244   2e-75    
gb|ACY91891.1|  MADS-domain transcription factor                        243   3e-75    Davidia involucrata
gb|ACY91895.1|  MADS-domain transcription factor                        242   3e-75    Saurauia zahlbruckneri
gb|AFM75884.1|  PISTILLATA-like protein                                 243   3e-75    
dbj|BAF46355.1|  MADS-box transcription factor                          243   3e-75    Alstroemeria ligtu subsp. ligtu
gb|ACY91892.1|  MADS-domain transcription factor                        242   3e-75    Nyssa sylvatica
gb|ACR16039.1|  GLOBOSA-like MADS-box transcription factor              243   3e-75    Gongora galeata
ref|XP_008805866.1|  PREDICTED: MADS-box transcription factor 2-l...    243   4e-75    
gb|AFO83619.1|  PISTILLATA-like protein                                 243   4e-75    
gb|ACD85113.1|  B-class MADS-box protein PI                             243   5e-75    
gb|ACD85106.1|  B-class MADS-box protein PI                             242   5e-75    
gb|ACD85121.1|  B-class MADS-box protein PI                             242   6e-75    
gb|ADM72971.1|  PISTILLATA-like protein 4                               242   6e-75    
gb|ABW96391.2|  PI-related protein                                      242   7e-75    Dendrobium moniliforme
gb|AFN68760.1|  PISTILLATA-like protein                                 242   7e-75    
gb|ACD85100.1|  B-class MADS-box protein PI                             242   7e-75    
ref|XP_006434291.1|  hypothetical protein CICLE_v10002471mg             242   7e-75    
gb|AFN68743.1|  PISTILLATA-like protein                                 242   8e-75    
gb|ABF67491.1|  MADS-domain transcription factor                        241   9e-75    Marcgravia umbellata
gb|AAK77938.1|  MADS box protein-like protein NGL9                      242   9e-75    Medicago sativa [alfalfa]
gb|AFN68744.1|  PISTILLATA-like protein                                 242   9e-75    
gb|AHM92092.1|  MADS-box protein 16                                     242   1e-74    
gb|ADI58461.1|  GLOBOSA                                                 241   1e-74    
gb|AFM75882.1|  PISTILLATA-like protein                                 242   1e-74    
ref|XP_003523422.1|  PREDICTED: LOW QUALITY PROTEIN: floral homeo...    241   1e-74    
gb|ADW76860.1|  PI/GLO                                                  241   1e-74    
gb|ACD85096.1|  B-class MADS-box protein PI                             241   1e-74    
gb|ABQ85947.1|  MADS-box transcription factor PI-like 2                 241   1e-74    Trochodendron aralioides
gb|AFN68769.1|  PISTILLATA-like protein                                 241   1e-74    
gb|AAV28175.1|  MADS box PI-like protein 9                              241   1e-74    Phalaenopsis hybrid cultivar
gb|ACD85088.1|  B-class MADS-box protein PI-2                           241   1e-74    
gb|AFM75883.1|  PISTILLATA-like protein                                 241   2e-74    
ref|XP_004142638.1|  PREDICTED: LOW QUALITY PROTEIN: floral homeo...    241   2e-74    
gb|AEM60219.1|  MADS box transcription factor                           240   2e-74    
gb|AAW78032.1|  PISTILLATA-like protein                                 241   2e-74    Thalictrum dioicum [early meadow-rue]
gb|ACR16048.1|  GLOBOSA-like MADS-box transcription factor              240   3e-74    Phragmipedium longifolium
gb|ACD85108.1|  B-class MADS-box protein PI-2                           240   3e-74    
gb|AFO83617.1|  PISTILLATA-like protein                                 240   5e-74    
gb|AIE44762.1|  putative MADS-domain transcription factor PI2           239   6e-74    
gb|ACY91915.1|  MADS-domain transcription factor                        239   6e-74    Saurauia zahlbruckneri
gb|ACD85103.1|  B-class MADS-box protein PI-2                           239   9e-74    
gb|ACY91917.1|  MADS-domain transcription factor                        238   9e-74    Symplocos chinensis
gb|ACR16053.1|  GLOBOSA-like MADS-box transcription factor              239   9e-74    Spiranthes odorata
gb|ACY91906.1|  MADS-domain transcription factor                        238   1e-73    Nyssa sylvatica
gb|ACD85107.1|  B-class MADS-box protein PI-1                           239   1e-73    
ref|XP_010905324.1|  PREDICTED: MADS-box transcription factor 2-like    239   1e-73    
dbj|BAC75972.1|  MADS-box transcription factor                          239   1e-73    Tulipa gesneriana
gb|ACD85117.1|  B-class MADS-box protein PI                             239   1e-73    
gb|ACY91928.1|  MADS-domain transcription factor                        238   2e-73    Hymenandra wallichii
gb|AEM60214.1|  MADS box transcription factor                           237   2e-73    
ref|XP_010055971.1|  PREDICTED: floral homeotic protein PMADS 2-like    238   3e-73    
gb|ACR16043.1|  GLOBOSA-like MADS-box transcription factor              238   3e-73    Hypoxis villosa
emb|CDP11931.1|  unnamed protein product                                237   4e-73    
gb|ACR16057.1|  GLOBOSA-like MADS-box transcription factor              238   4e-73    Vanilla planifolia [cultivated vanilla]
gb|AAV28490.1|  MADS box PI-like protein 10                             238   4e-73    Phalaenopsis hybrid cultivar
gb|ADC53258.1|  PI MADS-box transcription factor                        237   5e-73    
gb|ACY91914.1|  MADS-domain transcription factor                        236   6e-73    Camellia japonica [common camellia]
dbj|BAL41417.1|  MADS-domain transcription factor                       237   7e-73    
gb|ABR68541.1|  PISTILLATA-like1                                        236   9e-73    Dillenia indica
gb|AAU10471.1|  MADS box protein 1                                      236   9e-73    Litchi chinensis [litchi]
gb|ABP96914.1|  GLOBOSA-like protein                                    236   1e-72    Primula vulgaris
gb|ACR16042.1|  GLOBOSA-like MADS-box transcription factor              236   1e-72    Hypoxis villosa
dbj|BAI78360.1|  GLO-like MADS-box protein                              236   1e-72    Orchis italica
gb|ACD85102.1|  B-class MADS-box protein PI-1                           236   2e-72    
gb|AAO18230.1|  MADS-box transcriptional factor HAM31                   235   2e-72    Helianthus annuus
gb|AFN61593.1|  MADS box transcription factor GLO                       236   2e-72    
gb|ABB22778.1|  PISTILLATA-like MADS box protein                        236   2e-72    Crocus sativus [saffron crocus]
gb|ACY91912.1|  MADS-domain transcription factor                        235   2e-72    Stewartia pseudocamellia [Japanese stewartia]
gb|ABB22777.1|  PISTILLATA-like MADS box protein                        236   2e-72    Crocus sativus [saffron crocus]
gb|ACD85087.1|  B-class MADS-box protein PI-1                           236   2e-72    
gb|AGA12044.1|  MADS-box transcription factor PISTILLATA-like pro...    235   3e-72    
ref|XP_006472854.1|  PREDICTED: floral homeotic protein GLOBOSA-like    235   3e-72    
ref|XP_009399166.1|  PREDICTED: MADS-box transcription factor 2-like    235   3e-72    
gb|AGA12043.1|  MADS-box transcription factor PISTILLATA-like pro...    234   5e-72    
gb|AFV74898.1|  PISTILLATA-like protein                                 234   5e-72    
gb|ACY91897.1|  MADS-domain transcription factor                        234   6e-72    Camellia japonica [common camellia]
gb|ABB22780.1|  PISTILLATA-like MADS box protein                        234   8e-72    Crocus sativus [saffron crocus]
gb|ACY91931.1|  MADS-domain transcription factor                        234   8e-72    Clethra tomentosa
dbj|BAC66962.1|  MADS-box transcription factor PI                       234   1e-71    Agapanthus praecox
gb|AFD36429.1|  GLO-like MADS-BOX transcription factor                  234   1e-71    
gb|ACY91927.1|  MADS-domain transcription factor                        233   1e-71    Cyclamen persicum
gb|ACY91935.1|  MADS-domain transcription factor                        233   1e-71    Stewartia pseudocamellia [Japanese stewartia]
gb|AAF73941.1|AF230712_1  MADS box containing protein PI                234   1e-71    Sagittaria montevidensis
gb|AFV74899.1|  PISTILLATA-like protein                                 234   1e-71    
ref|XP_010269077.1|  PREDICTED: floral homeotic protein PMADS 2         233   2e-71    
gb|AEM60215.1|  MADS box transcription factor                           233   2e-71    
dbj|BAH03321.1|  MADS-box transcription factor                          233   2e-71    Habenaria radiata
gb|AAV28491.1|  MADS box PI-like protein 15                             233   2e-71    Phalaenopsis hybrid cultivar
gb|ADY39748.1|  PISTILLATA-like protein                                 233   2e-71    
gb|ACY91920.1|  MADS-domain transcription factor                        232   2e-71    Napoleonaea vogelii
gb|AEM60212.1|  MADS box transcription factor                           232   3e-71    
gb|AAY63867.1|  PISTILLATA                                              233   4e-71    Brassica juncea [brown mustard]
gb|ACY91911.1|  MADS-domain transcription factor                        231   4e-71    Actinidia chinensis
ref|NP_001236242.1|  uncharacterized protein LOC100306010               231   4e-71    
gb|ACY91926.1|  MADS-domain transcription factor                        232   5e-71    Jacquinia aurantiaca
gb|AEM60207.1|  MADS box transcription factor                           231   5e-71    
gb|AEM60209.1|  MADS box transcription factor                           231   5e-71    
gb|AEM60201.1|  MADS box transcription factor                           231   1e-70    
ref|XP_009131786.1|  PREDICTED: floral homeotic protein PISTILLATA      231   1e-70    
gb|AHH28289.1|  MADS-box transcription factor                           231   1e-70    
ref|XP_010677653.1|  PREDICTED: floral homeotic protein PMADS 2-like    231   1e-70    
gb|ABG90948.1|  PI                                                      231   1e-70    Elegia elephantina
ref|XP_007137476.1|  hypothetical protein PHAVU_009G130000g             230   1e-70    
gb|ABW74344.1|  PISTILLATA-2                                            231   2e-70    Brassica napus [oilseed rape]
gb|ACY91924.1|  MADS-domain transcription factor                        230   2e-70    Phlox paniculata
gb|ACY91929.1|  MADS-domain transcription factor                        230   2e-70    Diospyros digyna [black persimmon]
gb|AEM60211.1|  MADS box transcription factor                           229   2e-70    
ref|NP_001288308.1|  MADS-box transcription factor 2-like               230   2e-70    
gb|ABB22779.1|  PISTILLATA-like MADS box protein                        230   2e-70    Crocus sativus [saffron crocus]
gb|AEG25800.1|  PISTILLATA-like protein                                 230   3e-70    
gb|KCW72540.1|  hypothetical protein EUGRSUZ_E01006                     229   3e-70    
gb|ABG90944.1|  PI2                                                     230   3e-70    Pharus virescens
gb|AHH28256.1|  MADS-box transcription factor                           229   4e-70    
dbj|BAB91551.1|  MADS-box transcription factor                          230   4e-70    Lilium regale
gb|AFI24610.1|  pistillata                                              229   4e-70    
ref|XP_006400591.1|  hypothetical protein EUTSA_v10014683mg             229   5e-70    
gb|ABN55897.1|  GLOBOSA                                                 230   5e-70    Eschscholzia californica
ref|XP_010541718.1|  PREDICTED: floral homeotic protein PISTILLAT...    230   5e-70    
gb|ABB92623.1|  PISTILLATA-like protein                                 229   5e-70    Alpinia oblongifolia
gb|AFK45454.1|  unknown                                                 228   5e-70    
gb|AAW29099.1|  MADS box transcription factor PEAM1                     228   5e-70    Pisum sativum [garden pea]
gb|ABD92703.1|  MADS box protein                                        229   6e-70    Lilium longiflorum [Easter lily]
ref|XP_010532202.1|  PREDICTED: floral homeotic protein PISTILLAT...    229   7e-70    
gb|ACY91932.1|  MADS-domain transcription factor                        228   7e-70    Enkianthus campanulatus
ref|XP_010541719.1|  PREDICTED: floral homeotic protein PISTILLAT...    229   9e-70    
gb|ABR68542.1|  PISTILLATA-like2                                        228   9e-70    
gb|ABD62863.1|  PI.2                                                    229   1e-69    
dbj|BAD12462.1|  PISTILLATA-like MADS box protein                       229   1e-69    
gb|AGA61768.1|  pistillata                                              227   1e-69    
gb|AIT11843.1|  PISTILLATA                                              228   1e-69    
gb|AAT99429.1|  PI-like MADS-box protein                                228   1e-69    
gb|ABW74343.1|  PISTILLATA-1                                            228   2e-69    
gb|ACY91899.1|  MADS-domain transcription factor                        228   2e-69    
gb|AAX13300.1|  MADS box protein PIb                                    227   2e-69    
gb|AFV74897.1|  PISTILLATA-like protein                                 228   2e-69    
gb|AAS89819.1|  globosa                                                 228   2e-69    
emb|CAC81069.1|  MADS box transcription factor                          228   3e-69    
gb|KFK26266.1|  hypothetical protein AALP_AA8G224700                    228   3e-69    
gb|AFP17799.1|  transcription factor PI                                 228   3e-69    
gb|ADM72965.1|  PISTILLATA-like protein 2b                              227   3e-69    
gb|ACJ36228.1|  PISTILLATA                                              226   3e-69    
ref|XP_004502537.1|  PREDICTED: floral homeotic protein PMADS 2-like    226   3e-69    
dbj|BAC22579.2|  PI/GLO-like protein                                    227   4e-69    
gb|ACY91922.1|  MADS-domain transcription factor                        227   4e-69    
gb|AFK49210.1|  unknown                                                 226   4e-69    
ref|XP_010532203.1|  PREDICTED: floral homeotic protein PISTILLAT...    227   5e-69    
ref|XP_010911265.1|  PREDICTED: MADS-box transcription factor 2-l...    228   6e-69    
gb|AHM92062.1|  MADS-box protein 2                                      226   8e-69    
gb|ACJ84116.1|  unknown                                                 225   1e-68    
gb|ACY91905.1|  MADS-domain transcription factor                        226   1e-68    
ref|XP_004970811.1|  PREDICTED: MADS-box transcription factor 2-like    226   1e-68    
gb|KHN44300.1|  Floral homeotic protein PMADS 2                         225   1e-68    
gb|AFM43701.1|  MADS-box homeotic protein GLO1                          226   1e-68    
gb|AAC42577.1|  PISTILLATA homolog DaPI-1                               225   1e-68    
ref|NP_197524.1|  Floral homeotic protein PISTILLATA                    226   1e-68    
dbj|BAB11939.1|  MADS-box protein                                       226   1e-68    
gb|AAD51995.1|  floral homeotic protein PI                              226   1e-68    
emb|CAM59059.1|  MIKC-type MADS-box transcription factor WM15           226   2e-68    
ref|XP_010420863.1|  PREDICTED: floral homeotic protein PISTILLATA      226   2e-68    
gb|ABG90946.1|  PI1                                                     225   2e-68    
gb|AFH66789.1|  PI-like MADS-box protein                                225   2e-68    
ref|XP_004290916.1|  PREDICTED: floral homeotic protein PMADS 2-like    225   2e-68    
gb|AAD51993.1|  floral homeotic protein PI                              225   2e-68    
gb|AAD51997.1|  floral homeotic protein PI                              225   3e-68    
gb|AAF73939.1|AF230710_1  MADS box containing protein PI                224   3e-68    
gb|AAD51988.1|  floral homeotic protein PI                              224   6e-68    
gb|AFV74903.1|  PISTILLATA-like protein                                 224   8e-68    
gb|AGT20516.1|  PI.c                                                    224   9e-68    
gb|ABF67490.1|  MADS-domain protein                                     223   1e-67    
emb|CDY60377.1|  BnaCnng36180D                                          223   1e-67    
gb|AAF25591.1|  pistillata                                              223   1e-67    
gb|AAC42570.1|  APETALA3 homolog PnPI-1                                 224   1e-67    
gb|ACY91894.1|  MADS-domain transcription factor                        223   2e-67    
gb|AAD51994.1|  floral homeotic protein PI                              223   2e-67    
dbj|BAE95640.1|  MADS-box transcription factor                          223   2e-67    
gb|ACY91936.1|  MADS-domain transcription factor                        222   2e-67    
dbj|BAH03322.1|  MADS-box transcription factor                          223   2e-67    
gb|AFK09613.1|  pistillata                                              223   2e-67    
ref|XP_008805865.1|  PREDICTED: MADS-box transcription factor 2-l...    224   2e-67    
ref|XP_010454328.1|  PREDICTED: floral homeotic protein PISTILLAT...    223   2e-67    
gb|AFK09612.1|  pistillata                                              223   3e-67    
gb|ABF57927.1|  MADS-box transcription factor TaAGL26                   223   3e-67    
gb|AAV65054.1|  PISTILLATA-like protein PI                              222   3e-67    
gb|AGT20514.1|  PI.a                                                    222   3e-67    
gb|ACY91900.1|  MADS-domain transcription factor                        221   3e-67    
ref|XP_004962035.1|  PREDICTED: MADS-box transcription factor 4-l...    222   4e-67    
ref|XP_010454329.1|  PREDICTED: floral homeotic protein PISTILLAT...    222   4e-67    
gb|AEM60221.1|  MADS box transcription factor                           221   4e-67    
gb|AAD51991.1|  floral homeotic protein PI                              222   5e-67    
ref|NP_001105136.1|  MADS16                                             222   6e-67    
ref|XP_009126432.1|  PREDICTED: floral homeotic protein PISTILLAT...    221   6e-67    
gb|AEM60222.1|  MADS box transcription factor                           221   7e-67    
ref|XP_002871931.1|  pistillata                                         221   7e-67    
ref|XP_009126431.1|  PREDICTED: floral homeotic protein PISTILLAT...    221   8e-67    
dbj|BAD80746.1|  MADS-box transcription factor                          221   9e-67    
gb|AAD51984.1|  floral homeotic protein PI                              221   1e-66    
gb|ACJ36229.1|  NGL9                                                    220   1e-66    
gb|AAD22493.2|AF134114_1  PISTILLATA protein homolog MADS2              220   1e-66    
gb|KHN46985.1|  Floral homeotic protein GLOBOSA                         220   2e-66    
dbj|BAD13496.1|  MADS-box protein                                       220   2e-66    
gb|AFL03388.1|  MADS box transcription factor PI                        219   2e-66    
ref|XP_002458870.1|  hypothetical protein SORBIDRAFT_03g041860          220   2e-66    
ref|XP_003568421.1|  PREDICTED: MADS-box transcription factor 4-like    220   2e-66    
gb|ACY91918.1|  MADS-domain transcription factor                        219   2e-66    
ref|XP_006288656.1|  hypothetical protein CARUB_v10001962mg             220   2e-66    
gb|AFK09614.1|  pistillata                                              220   3e-66    
gb|AFV74902.1|  PISTILLATA-like protein                                 220   3e-66    
dbj|BAD13495.1|  MADS-box protein                                       219   3e-66    
ref|XP_004962034.1|  PREDICTED: MADS-box transcription factor 4-l...    219   4e-66    
gb|AAF73940.1|AF230711_1  MADS box containing protein PI                219   4e-66    
ref|NP_001045012.1|  Os01g0883100                                       219   5e-66    
ref|XP_006645133.1|  PREDICTED: MADS-box transcription factor 2-like    219   5e-66    
gb|AAS59830.1|  MADS-box protein RMADS219                               219   5e-66    
emb|CBI18965.3|  unnamed protein product                                218   5e-66    
gb|AAV65055.1|  PISTILLATA-like protein PI                              219   5e-66    
gb|AAY86363.1|  PISTILLATA-like MADS box protein                        219   5e-66    
gb|ABG90947.1|  PI                                                      219   7e-66    
gb|ACY91893.1|  MADS-domain transcription factor                        218   8e-66    
dbj|BAD42356.1|  PISTILLATA-like protein                                219   9e-66    
ref|XP_009404965.1|  PREDICTED: MADS-box transcription factor 2-like    218   1e-65    
gb|ABQ59275.2|  GLOBOSA protein                                         217   1e-65    
gb|AIT11844.1|  class-B floral MADS-box protein                         217   1e-65    
gb|ACY91902.1|  MADS-domain transcription factor                        217   1e-65    
gb|ABG90943.1|  PI2                                                     218   2e-65    
gb|ACY91898.1|  MADS-domain transcription factor                        217   2e-65    
ref|XP_002439824.1|  hypothetical protein SORBIDRAFT_09g020770          218   2e-65    
dbj|BAD42349.1|  PISTILLATA-like protein                                218   2e-65    
ref|XP_006654424.1|  PREDICTED: MADS-box transcription factor 4-like    218   2e-65    
gb|ACG35097.1|  MADS-box transcription factor 4                         218   2e-65    
gb|AIE56153.1|  PISTILLATA-like protein                                 218   3e-65    
gb|ABO13927.1|  PISTILLATA-like protein                                 218   3e-65    
ref|XP_009120826.1|  PREDICTED: floral homeotic protein PISTILLAT...    217   3e-65    
gb|ADM88561.1|  GLOBOSA MADS-box transcription factor                   215   8e-65    
gb|ACY91908.1|  MADS-domain transcription factor                        215   8e-65    
gb|ACL52884.1|  unknown                                                 216   1e-64    
gb|ACY91934.1|  MADS-domain transcription factor                        215   1e-64    
gb|ADD25210.1|  PI                                                      216   1e-64    
gb|AFW81889.1|  putative MADS-box transcription factor family pro...    216   1e-64    
gb|AAY25570.1|  PI                                                      215   2e-64    
gb|AFL03396.1|  MADS box transcription factor PI                        215   2e-64    
gb|ACC94196.1|  PISTILLATA-like protein                                 214   2e-64    
emb|CDY45099.1|  BnaA02g04770D                                          215   2e-64    
ref|NP_001289793.1|  MADS-box transcription factor 4-like               215   3e-64    
gb|KCW72541.1|  hypothetical protein EUGRSUZ_E01007                     213   3e-64    
ref|XP_004290915.1|  PREDICTED: floral homeotic protein PMADS 2-like    214   4e-64    
gb|ABG90945.1|  PI1                                                     214   5e-64    
gb|AEG25810.1|  PISTILLATA-like protein                                 213   6e-64    
gb|AAN47199.1|  MADS-box transcription factor PISTILLATA                212   7e-64    
emb|CAC33849.1|  putative MADS-domain transcription factor              214   7e-64    
gb|ADC79697.1|  PISTILLATA-like protein                                 213   9e-64    
gb|AGA61784.1|  pistillata                                              212   1e-63    
gb|ACY91903.1|  MADS-domain transcription factor                        213   1e-63    
gb|AAD22494.2|AF134115_1  PISTILLATA protein homolog HPI2               213   1e-63    
gb|AFP17796.1|  transcription factor PI variant 1                       213   1e-63    
gb|AEG25806.1|  PISTILLATA-like protein                                 213   1e-63    
gb|ACC94210.1|  PISTILLATA-like protein                                 212   2e-63    
gb|AAS48127.1|  PISTILLATA-like protein                                 213   2e-63    
gb|ACY91910.1|  MADS-domain transcription factor                        212   2e-63    
gb|AFX61409.1|  PISTILLATA-like MADS box protein                        212   2e-63    
ref|NP_001105137.1|  MADS29                                             212   3e-63    
gb|AER42185.1|  PISTILLATA-like MADS-box transcription factor           212   3e-63    
gb|EEC79255.1|  hypothetical protein OsI_20021                          212   3e-63    
ref|NP_001288511.1|  MADS-box transcription factor 4-like               212   4e-63    
ref|XP_007223690.1|  hypothetical protein PRUPE_ppa012927mg             209   4e-63    
dbj|BAD42347.1|  PISTILLATA-like protein                                212   4e-63    
gb|AIE44765.1|  putative MADS-domain transcription factor PI1           212   5e-63    
gb|ACY91925.1|  MADS-domain transcription factor                        210   6e-63    
gb|AHM92064.1|  MADS-box protein 4                                      211   7e-63    
gb|AER42188.1|  PISTILLATA-like MADS-box transcription factor           211   8e-63    
gb|AAO26513.1|  PI-1                                                    210   1e-62    
gb|AEG25801.1|  PISTILLATA-like protein                                 210   1e-62    
gb|ADD14337.1|  PISTILLATA                                              210   1e-62    
gb|ACC94229.1|  PISTILLATA-like protein type II                         209   1e-62    
gb|AEM60208.1|  MADS box transcription factor                           209   2e-62    
gb|AER42184.1|  PISTILLATA-like MADS-box transcription factor           209   2e-62    
gb|AAC05723.1|  MADS box protein                                        210   2e-62    
dbj|BAD42357.1|  PISTILLATA-like protein                                210   2e-62    
gb|AER42187.1|  PISTILLATA-like MADS-box transcription factor           209   3e-62    
gb|ACC94228.1|  PISTILLATA-like protein type I                          209   3e-62    
dbj|BAD42443.1|  PISTILLATA-like protein                                209   3e-62    
gb|AAO26537.1|  PI                                                      209   3e-62    
ref|XP_008656271.1|  PREDICTED: MADS-box transcription factor 4-l...    209   3e-62    
ref|XP_010493133.1|  PREDICTED: floral homeotic protein PISTILLATA      210   5e-62    
gb|AER42186.1|  PISTILLATA-like MADS-box transcription factor           208   5e-62    
emb|CAM59058.1|  MIKC-type MADS-box transcription factor WM14           209   6e-62    
gb|AER42190.1|  PISTILLATA-like MADS-box transcription factor           208   6e-62    
dbj|BAD12461.1|  PISTILLATA-like MADS box protein                       209   6e-62    
gb|AAC42578.1|  PISTILLATA homolog MfPI-1                               207   7e-62    
ref|NP_001055590.1|  Os05g0423400                                       209   8e-62    
gb|AAX53101.1|  PI-like protein                                         207   9e-62    
gb|AEM60203.1|  MADS box transcription factor                           207   1e-61    
gb|AER42182.1|  PISTILLATA-like MADS-box transcription factor           207   1e-61    
gb|AAC42579.1|  PISTILLATA homolog LtPI-1                               207   1e-61    
gb|ABB59993.1|  MADS-box protein                                        208   1e-61    
gb|ACC94201.1|  PISTILLATA-like protein                                 207   1e-61    
gb|AFL03393.1|  MADS box transcription factor PI                        207   1e-61    
gb|AER42189.1|  PISTILLATA-like MADS-box transcription factor           207   2e-61    
gb|AFV74895.1|  PISTILLATA-like protein                                 207   2e-61    
ref|XP_006840164.1|  hypothetical protein AMTR_s00089p00081270          207   2e-61    
gb|AAR87679.1|  PISTILLATA-like protein PI                              206   3e-61    
gb|AER42192.1|  PISTILLATA-like MADS-box transcription factor           206   5e-61    
gb|AFP17800.1|  transcription factor PI                                 206   6e-61    
gb|AAT69985.1|  PISTILLATA                                              206   6e-61    
gb|AAR06676.1|  PISTILLATA-like protein                                 205   6e-61    
gb|ADC79701.1|  PISTILLATA-like protein                                 206   6e-61    
gb|AEG25805.1|  PISTILLATA-like protein                                 205   8e-61    
gb|AEX92973.1|  MADS box protein 7                                      205   8e-61    
gb|AER42180.1|  PISTILLATA-like MADS-box transcription factor           205   1e-60    
dbj|BAD42353.1|  PISTILLATA-like protein                                206   1e-60    
gb|AAO26500.1|  PI                                                      204   1e-60    
gb|AER42168.1|  PISTILLATA-like MADS-box transcription factor           205   1e-60    
gb|AER42191.1|  PISTILLATA-like MADS-box transcription factor           205   1e-60    
gb|AER42167.1|  PISTILLATA-like MADS-box transcription factor           205   1e-60    
gb|ACD76819.1|  PISTILLATA-like protein                                 204   2e-60    
gb|AER42128.1|  PISTILLATA-like MADS-box transcription factor           204   2e-60    
gb|ABR09368.1|  PISTILLATA-like protein PI                              204   2e-60    
dbj|BAG69627.1|  MADS-box transcription factor                          203   3e-60    
gb|ACY91904.1|  MADS-domain transcription factor                        203   3e-60    
gb|AAO26515.1|  PI-2 type 1                                             204   3e-60    
dbj|BAB91552.1|  MADS-box transcription factor                          203   5e-60    
dbj|BAC11906.1|  MADS-box protein                                       203   5e-60    
gb|ACD76818.1|  PISTILLATA-like protein                                 203   6e-60    
gb|ACY91901.1|  MADS-domain transcription factor                        203   7e-60    
gb|AER42181.1|  PISTILLATA-like MADS-box transcription factor           203   7e-60    
gb|AAR87680.1|  PISTILLATA-like protein PI                              202   8e-60    
dbj|BAD80743.1|  MADS-box transcription factor                          202   9e-60    
gb|AEG25811.1|  PISTILLATA-like protein                                 202   1e-59    
gb|AER42123.1|  PISTILLATA-like MADS-box transcription factor           202   1e-59    
gb|ACC94214.1|  PISTILLATA-like protein                                 202   1e-59    
gb|AER42129.1|  PISTILLATA-like MADS-box transcription factor           202   1e-59    
gb|AAF73942.1|AF230713_1  MADS box containing protein PI                201   2e-59    
gb|AAR87688.1|  PISTILLATA-like protein PI-1                            201   2e-59    
gb|AFV74900.1|  PISTILLATA-like protein                                 202   2e-59    
gb|AER42160.1|  PISTILLATA-like MADS-box transcription factor           201   3e-59    
gb|ABW74345.1|  PISTILLATA-3                                            200   3e-59    
gb|AER42126.1|  PISTILLATA-like MADS-box transcription factor           201   3e-59    
dbj|BAH37039.1|  MADS-box transcription factor PI-like                  201   3e-59    
gb|AAY21911.1|  putative MADS box protein                               201   4e-59    
gb|AHH28322.1|  MADS-box transcription factor                           201   4e-59    
gb|ACY91916.1|  MADS-domain transcription factor                        201   5e-59    
gb|AAF73937.1|AF230708_1  MADS box containing protein PI-1              200   5e-59    
gb|AFF60759.1|  MADS-box transcription factor PISTILLATA-like pro...    198   6e-59    
gb|AFF60756.1|  MADS-box transcription factor PISTILLATA-like pro...    198   8e-59    
gb|AAC42572.1|  PISTILLATA homolog DePI-1                               201   8e-59    
gb|AER42178.1|  PISTILLATA-like MADS-box transcription factor           200   9e-59    



>dbj|BAF91445.1| PI/GLO-related transcription factor CONTORTED [Ipomoea nil]
Length=212

 Score =   433 bits (1114),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 212/212 (100%), Positives = 212/212 (100%), Gaps = 0/212 (0%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS
Sbjct  1    MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  60

Query  317  SLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRELM  496
            SLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRELM
Sbjct  61   SLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRELM  120

Query  497  ILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLGEM  676
            ILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLGEM
Sbjct  121  ILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLGEM  180

Query  677  GEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
            GEVFNQRESNDYESQMPFTFSVQPMQPNLQDR
Sbjct  181  GEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  212



>gb|AAS46018.1| MADS-box protein GLO1 [Petunia x hybrida]
Length=210

 Score =   344 bits (882),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 166/212 (78%), Positives = 192/212 (91%), Gaps = 3/212 (1%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENSSNRQVT+SKRRNG+LKKAKEISVLCDARVSVIIF SSGKMHEFSS+
Sbjct  1    MGRGKIEIKRIENSSNRQVTYSKRRNGILKKAKEISVLCDARVSVIIFASSGKMHEFSST  60

Query  317  SLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRELM  496
            SLVDILDQYHKLTG+RLWDAKHENL+NEIN++KK+NDNMQIELRHLKGEDI+SLN+RELM
Sbjct  61   SLVDILDQYHKLTGRRLWDAKHENLDNEINKVKKDNDNMQIELRHLKGEDITSLNHRELM  120

Query  497  ILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLGEM  676
            ILEDAL+NGL SI  KQ EV R + K+   +Q + EE +QL+ +LRQLEIA MNRN+GE+
Sbjct  121  ILEDALENGLTSIRNKQNEVLRMMRKK---TQSMEEEQDQLNCQLRQLEIATMNRNMGEI  177

Query  677  GEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
            GEVF QRE++DY++ MPF F VQPMQPNLQ+R
Sbjct  178  GEVFQQRENHDYQNHMPFAFRVQPMQPNLQER  209



>sp|Q03488.1|FBP1_PETHY RecName: Full=Floral homeotic protein FBP1; AltName: Full=Floral-binding 
protein 1 [Petunia x hybrida]
 gb|AAA33731.1| transcription factor [Petunia x hybrida]
Length=210

 Score =   341 bits (875),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 165/212 (78%), Positives = 191/212 (90%), Gaps = 3/212 (1%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENSSNRQVT+SKRRNG+LKKAKEISVLCDARVSVIIF SSGKMHEFSS+
Sbjct  1    MGRGKIEIKRIENSSNRQVTYSKRRNGILKKAKEISVLCDARVSVIIFASSGKMHEFSST  60

Query  317  SLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRELM  496
            SLVDILDQYHKLTG+RL DAKHENL+NEIN++KK+NDNMQIELRHLKGEDI+SLN+RELM
Sbjct  61   SLVDILDQYHKLTGRRLLDAKHENLDNEINKVKKDNDNMQIELRHLKGEDITSLNHRELM  120

Query  497  ILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLGEM  676
            ILEDAL+NGL SI  KQ EV R + K+   +Q + EE +QL+ +LRQLEIA MNRN+GE+
Sbjct  121  ILEDALENGLTSIRNKQNEVLRMMRKK---TQSMEEEQDQLNCQLRQLEIATMNRNMGEI  177

Query  677  GEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
            GEVF QRE++DY++ MPF F VQPMQPNLQ+R
Sbjct  178  GEVFQQRENHDYQNHMPFAFRVQPMQPNLQER  209



>sp|Q03416.1|GLOB_TOBAC RecName: Full=Floral homeotic protein GLOBOSA [Nicotiana tabacum]
 emb|CAA48142.1| NTGLOBOSA [Nicotiana tabacum]
 prf||1916408A NTGLO gene
Length=209

 Score =   338 bits (866),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 164/212 (77%), Positives = 194/212 (92%), Gaps = 4/212 (2%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENSSNRQVT+SKRRNG+LKKAKEISVLCDARVSVIIF SSGKMHEFSS+
Sbjct  1    MGRGKIEIKRIENSSNRQVTYSKRRNGILKKAKEISVLCDARVSVIIFASSGKMHEFSST  60

Query  317  SLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRELM  496
            SLVDILDQYHKLTG+RLWDAKHENL+NEIN++KK+NDNMQIELRHLKGEDI+SLN+RELM
Sbjct  61   SLVDILDQYHKLTGRRLWDAKHENLDNEINKVKKDNDNMQIELRHLKGEDITSLNHRELM  120

Query  497  ILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLGEM  676
            +LEDAL NGL SI  KQ ++ R + K+   +Q + EE +QL+++LRQLEIA+MNRN+GE+
Sbjct  121  MLEDALDNGLTSIRNKQNDLLRMMRKK---TQSMEEEQDQLNWQLRQLEIASMNRNMGEI  177

Query  677  GEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
            GEVF+QRE N+Y++QMPF F VQPMQPNLQ+R
Sbjct  178  GEVFHQRE-NEYQTQMPFAFRVQPMQPNLQER  208



>ref|XP_009777738.1| PREDICTED: floral homeotic protein GLOBOSA isoform X1 [Nicotiana 
sylvestris]
Length=209

 Score =   337 bits (863),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 163/212 (77%), Positives = 194/212 (92%), Gaps = 4/212 (2%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENSSNRQVT+SKRRNG+LKKAKEISVLCDARVSVIIF SSGKMHEFSS+
Sbjct  1    MGRGKIEIKRIENSSNRQVTYSKRRNGILKKAKEISVLCDARVSVIIFASSGKMHEFSST  60

Query  317  SLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRELM  496
            SLVDILDQYHKLTG+RLWDAKHENL+NEIN++KK+NDNMQIELRHLKGEDI+SLN+RELM
Sbjct  61   SLVDILDQYHKLTGRRLWDAKHENLDNEINKVKKDNDNMQIELRHLKGEDITSLNHRELM  120

Query  497  ILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLGEM  676
            +LEDAL NGL SI  KQ ++ + + K+   +Q + EE +QL+++LRQLEIA+MNRN+GE+
Sbjct  121  MLEDALDNGLTSIRNKQNDLLKMMRKK---TQSMEEEQDQLNWQLRQLEIASMNRNMGEI  177

Query  677  GEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
            GEVF+QRE N+Y++QMPF F VQPMQPNLQ+R
Sbjct  178  GEVFHQRE-NEYQTQMPFAFRVQPMQPNLQER  208



>ref|XP_009588903.1| PREDICTED: floral homeotic protein GLOBOSA isoform X1 [Nicotiana 
tomentosiformis]
Length=209

 Score =   334 bits (857),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 163/212 (77%), Positives = 192/212 (91%), Gaps = 4/212 (2%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENSSNRQVT+SKRRNG+LKKAKEISVLCDARVSVIIF SSGKMHEFSS+
Sbjct  1    MGRGKIEIKRIENSSNRQVTYSKRRNGILKKAKEISVLCDARVSVIIFASSGKMHEFSST  60

Query  317  SLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRELM  496
            SLVDILDQYHKLTG+RLWDAK ENL+NEIN++KK+NDNMQIELRHLKGEDI+SLN+RELM
Sbjct  61   SLVDILDQYHKLTGRRLWDAKQENLDNEINKVKKDNDNMQIELRHLKGEDITSLNHRELM  120

Query  497  ILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLGEM  676
            +LEDAL+NGL SI  KQ E  R + K+   +Q + EE +QL+ +LRQLEIA+MNRN+GE+
Sbjct  121  MLEDALENGLTSIRNKQNEFLRMMRKK---TQSMEEEQDQLNCQLRQLEIASMNRNMGEI  177

Query  677  GEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
            GEVF+QRE N+Y++Q+PF F VQPMQPNLQ+R
Sbjct  178  GEVFHQRE-NEYQTQIPFAFRVQPMQPNLQER  208



>ref|XP_004245202.1| PREDICTED: floral homeotic protein FBP1 [Solanum lycopersicum]
Length=210

 Score =   330 bits (845),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 164/213 (77%), Positives = 188/213 (88%), Gaps = 5/213 (2%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENSSNRQVT+SKRRNG+LKKAKEISVLCDA VSVIIF +SGKMHEFSS+
Sbjct  1    MGRGKIEIKRIENSSNRQVTYSKRRNGILKKAKEISVLCDAHVSVIIFATSGKMHEFSST  60

Query  317  SLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRELM  496
            SLVDILDQYHKLTG+RLWDAKHENL+NEIN++KK+NDNMQIELRHLKGEDISSLNYRELM
Sbjct  61   SLVDILDQYHKLTGRRLWDAKHENLDNEINKVKKDNDNMQIELRHLKGEDISSLNYRELM  120

Query  497  ILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLGEM  676
            ILEDAL+NGL  I EKQ E  R + K+   +Q + +E +QL+ +LRQLEIA+MNRN+GE+
Sbjct  121  ILEDALENGLTGIREKQNEFMRMMRKK---TQNMEQEQDQLNCQLRQLEIASMNRNMGEI  177

Query  677  GEVFNQ-RESNDYESQMPFTFSVQPMQPNLQDR  772
            GEVF Q RE++DY  QMPF F VQPMQPNL  R
Sbjct  178  GEVFEQTRENHDY-GQMPFAFRVQPMQPNLHQR  209



>gb|AGN54427.1| MADS-box protein GLO1 [Physalis pubescens]
Length=209

 Score =   328 bits (842),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 163/213 (77%), Positives = 191/213 (90%), Gaps = 6/213 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENSSNRQVT+SKRRNG+LKKAKEIS+LC+ARVSVIIF +SGKMHEFSS+
Sbjct  1    MGRGKIEIKRIENSSNRQVTYSKRRNGILKKAKEISILCEARVSVIIFATSGKMHEFSST  60

Query  317  SLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRELM  496
             LVDILDQYHKLTG+RLWDAKHENL+NEINR+KK+NDNMQIELRHLKGEDISSLNYRELM
Sbjct  61   PLVDILDQYHKLTGRRLWDAKHENLDNEINRVKKDNDNMQIELRHLKGEDISSLNYRELM  120

Query  497  ILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLGEM  676
            ++EDAL+NGL SI +KQ E  R + K+   +Q + EE +QL+ +LRQLEIA+MNRN+GE+
Sbjct  121  LIEDALENGLTSIRDKQNEYMRMMRKK---TQIMEEEQDQLNCQLRQLEIASMNRNMGEI  177

Query  677  GEVFNQR-ESNDYESQMPFTFSVQPMQPNLQDR  772
            GEVF QR E++DY  QMPF F VQPMQPNLQ+R
Sbjct  178  GEVFEQRGENHDY--QMPFAFRVQPMQPNLQER  208



>emb|CDN40862.1| Type II (MIKC) MADS-box transcription factor, partial [Nicotiana 
tabacum]
 emb|CDN40863.1| Type II (MIKC) MADS-box transcription factor, partial [Nicotiana 
tabacum]
 emb|CDN40864.1| Type II (MIKC) MADS-box transcription factor, partial [Nicotiana 
tabacum]
 emb|CDN40873.1| Type II (MIKC) MADS-box transcription factor, partial [Nicotiana 
tabacum]
 emb|CDN40874.1| Type II (MIKC) MADS-box transcription factor, partial [Nicotiana 
tabacum]
 emb|CDN40875.1| Type II (MIKC) MADS-box transcription factor, partial [Nicotiana 
tabacum]
Length=202

 Score =   325 bits (833),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 158/205 (77%), Positives = 187/205 (91%), Gaps = 4/205 (2%)
 Frame = +2

Query  158  IKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSSSLVDILD  337
            IKRIENSSNRQVT+SKRRNG+LKKAKEISVLCDARVSVIIF SSGKMHEFSS+SLVDILD
Sbjct  1    IKRIENSSNRQVTYSKRRNGILKKAKEISVLCDARVSVIIFASSGKMHEFSSTSLVDILD  60

Query  338  QYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRELMILEDALQ  517
            QYHKLTG+RLWDAKHENL+NEIN++KK+NDNMQIELRHLKGEDI+SLN+RELM+LEDAL 
Sbjct  61   QYHKLTGRRLWDAKHENLDNEINKVKKDNDNMQIELRHLKGEDITSLNHRELMMLEDALD  120

Query  518  NGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLGEMGEVFNQR  697
            NGL SI  KQ ++ R + K+   +Q + EE +QL+++LRQLEIA+MNRN+GE+GEVF+QR
Sbjct  121  NGLTSIRNKQNDLLRMMRKK---TQSMEEEQDQLNWQLRQLEIASMNRNMGEIGEVFHQR  177

Query  698  ESNDYESQMPFTFSVQPMQPNLQDR  772
            E N+Y++QMPF F VQPMQPNLQ+R
Sbjct  178  E-NEYQTQMPFAFRVQPMQPNLQER  201



>emb|CDN40861.1| Type II (MIKC) MADS-box transcription factor, partial [Nicotiana 
sylvestris]
 emb|CDN40872.1| Type II (MIKC) MADS-box transcription factor, partial [Nicotiana 
sylvestris]
Length=202

 Score =   324 bits (830),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 157/205 (77%), Positives = 187/205 (91%), Gaps = 4/205 (2%)
 Frame = +2

Query  158  IKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSSSLVDILD  337
            IKRIENSSNRQVT+SKRRNG+LKKAKEISVLCDARVSVIIF SSGKMHEFSS+SLVDILD
Sbjct  1    IKRIENSSNRQVTYSKRRNGILKKAKEISVLCDARVSVIIFASSGKMHEFSSTSLVDILD  60

Query  338  QYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRELMILEDALQ  517
            QYHKLTG+RLWDAKHENL+NEIN++KK+NDNMQIELRHLKGEDI+SLN+RELM+LEDAL 
Sbjct  61   QYHKLTGRRLWDAKHENLDNEINKVKKDNDNMQIELRHLKGEDITSLNHRELMMLEDALD  120

Query  518  NGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLGEMGEVFNQR  697
            NGL SI  KQ ++ + + K+   +Q + EE +QL+++LRQLEIA+MNRN+GE+GEVF+QR
Sbjct  121  NGLTSIRNKQNDLLKMMRKK---TQSMEEEQDQLNWQLRQLEIASMNRNMGEIGEVFHQR  177

Query  698  ESNDYESQMPFTFSVQPMQPNLQDR  772
            E N+Y++QMPF F VQPMQPNLQ+R
Sbjct  178  E-NEYQTQMPFAFRVQPMQPNLQER  201



>ref|XP_006361522.1| PREDICTED: floral homeotic protein FBP1-like [Solanum tuberosum]
Length=210

 Score =   322 bits (826),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 161/213 (76%), Positives = 186/213 (87%), Gaps = 5/213 (2%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENSSNRQVT+SKRRNG+LKKAKEISVLCDA VSVIIF +SGKMHEFSS+
Sbjct  1    MGRGKIEIKRIENSSNRQVTYSKRRNGILKKAKEISVLCDAHVSVIIFATSGKMHEFSST  60

Query  317  SLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRELM  496
             LVDILDQYHKLTG+RLWDAKHENL+NEIN++KK+NDNMQIELRHLKGEDISSLNYRELM
Sbjct  61   PLVDILDQYHKLTGRRLWDAKHENLDNEINKVKKDNDNMQIELRHLKGEDISSLNYRELM  120

Query  497  ILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLGEM  676
            ILEDAL+ GL  I +KQ E  R + K+   +Q + +E +QL+ +LRQLEIA+MNRN+GE+
Sbjct  121  ILEDALEIGLTGIRDKQNEFVRMVRKK---TQNMEQEQDQLNCQLRQLEIASMNRNMGEV  177

Query  677  GEVFNQ-RESNDYESQMPFTFSVQPMQPNLQDR  772
            GEVF Q RE++DY  QMPF F VQPMQPNL  R
Sbjct  178  GEVFEQTRENHDY-GQMPFAFRVQPMQPNLHQR  209



>gb|AEM60213.1| MADS box transcription factor, partial [Iochroma cyaneum]
Length=200

 Score =   321 bits (823),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 158/204 (77%), Positives = 182/204 (89%), Gaps = 5/204 (2%)
 Frame = +2

Query  161  KRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSSSLVDILDQ  340
            KRIENSSNRQVT+SKRRNG+LKKAKEISVLCDARVSVIIF +SGKMHEFSS+ LVDILDQ
Sbjct  1    KRIENSSNRQVTYSKRRNGILKKAKEISVLCDARVSVIIFATSGKMHEFSSAPLVDILDQ  60

Query  341  YHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRELMILEDALQN  520
            YHKLTG+RLWDAKHENL+NEINR+KK+NDNMQIELRHLKGEDISSLNYR LMILEDAL+N
Sbjct  61   YHKLTGRRLWDAKHENLDNEINRVKKDNDNMQIELRHLKGEDISSLNYRALMILEDALEN  120

Query  521  GLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLGEMGEVFNQRE  700
            GL SI +KQ E  R + K+   +Q + +E EQL+ +LRQLEIA+MNRN+GE+GEVF QRE
Sbjct  121  GLTSIRDKQNEFMRMMRKK---TQSMEQEQEQLNCQLRQLEIASMNRNMGEIGEVFEQRE  177

Query  701  SNDYESQMPFTFSVQPMQPNLQDR  772
            +++Y  QMPF F VQPMQPNLQ+R
Sbjct  178  NHEY--QMPFAFRVQPMQPNLQER  199



>emb|CDN40865.1| Type II (MIKC) MADS-box transcription factor, partial [Nicotiana 
tomentosiformis]
 emb|CDN40866.1| Type II (MIKC) MADS-box transcription factor, partial [Nicotiana 
tabacum]
 emb|CDN40876.1| Type II (MIKC) MADS-box transcription factor, partial [Nicotiana 
tomentosiformis]
 emb|CDN40877.1| Type II (MIKC) MADS-box transcription factor, partial [Nicotiana 
tabacum]
Length=202

 Score =   321 bits (823),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 157/205 (77%), Positives = 185/205 (90%), Gaps = 4/205 (2%)
 Frame = +2

Query  158  IKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSSSLVDILD  337
            IKRIENSSNRQVT+SKRRNG+LKKAKEISVLCDARVSVIIF SSGKMHEFSS+SLVDILD
Sbjct  1    IKRIENSSNRQVTYSKRRNGILKKAKEISVLCDARVSVIIFASSGKMHEFSSTSLVDILD  60

Query  338  QYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRELMILEDALQ  517
            QYHKLTG+RLWDAK ENL+NEIN++KK+NDNMQIELRHLKGEDI+SLN+RELM+LEDAL+
Sbjct  61   QYHKLTGRRLWDAKQENLDNEINKVKKDNDNMQIELRHLKGEDITSLNHRELMMLEDALE  120

Query  518  NGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLGEMGEVFNQR  697
            NGL SI  KQ E  R + K+   +Q + EE +QL+ +LRQLEIA+MNRN+GE+GEVF+QR
Sbjct  121  NGLTSIRNKQNEFLRMMRKK---TQSMEEEQDQLNCQLRQLEIASMNRNMGEIGEVFHQR  177

Query  698  ESNDYESQMPFTFSVQPMQPNLQDR  772
            E N+Y++Q+PF F VQPMQPNLQ+R
Sbjct  178  E-NEYQTQIPFAFRVQPMQPNLQER  201



>emb|CDN40880.1| Type II (MIKC) MADS-box transcription factor, partial [Nicotiana 
tabacum]
Length=202

 Score =   318 bits (816),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 184/205 (90%), Gaps = 4/205 (2%)
 Frame = +2

Query  158  IKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSSSLVDILD  337
            IKRIENSSNRQVT+SKRRNG+LKKAKEISVLCDARVSVIIF SSGKMHEFSS+SLVDILD
Sbjct  1    IKRIENSSNRQVTYSKRRNGILKKAKEISVLCDARVSVIIFASSGKMHEFSSTSLVDILD  60

Query  338  QYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRELMILEDALQ  517
            QYHKLTG+RLWDAK ENL+NEIN++KK+NDNMQIEL+HLKGEDI+SLN+RELM+LED L+
Sbjct  61   QYHKLTGRRLWDAKQENLDNEINKVKKDNDNMQIELKHLKGEDITSLNHRELMMLEDVLE  120

Query  518  NGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLGEMGEVFNQR  697
            NGL SI  KQ E  R + K+   +Q + EE +QL+ +LRQLEIA+MNRN+GE+GEVF+QR
Sbjct  121  NGLTSIRNKQNEFLRMMRKK---TQSMEEEQDQLNCQLRQLEIASMNRNMGEIGEVFHQR  177

Query  698  ESNDYESQMPFTFSVQPMQPNLQDR  772
            E N+Y++Q+PF F VQPMQPNLQ+R
Sbjct  178  E-NEYQTQIPFAFRVQPMQPNLQER  201



>gb|ABF50238.1| GLOBOSA/PISTILLATA, partial [Nicotiana langsdorffii x Nicotiana 
sanderae]
Length=199

 Score =   318 bits (815),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 156/203 (77%), Positives = 182/203 (90%), Gaps = 4/203 (2%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENSSNRQVT+SKRRNG+LKKAKEISVLCDARVSVIIF SSGKMHEFSS+
Sbjct  1    MGRGKIEIKRIENSSNRQVTYSKRRNGILKKAKEISVLCDARVSVIIFASSGKMHEFSST  60

Query  317  SLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRELM  496
            SLVDILDQYHKLTG+RLWDAKHENL+NEIN +KK+NDNMQIELRHLKGEDI+SLN+R+LM
Sbjct  61   SLVDILDQYHKLTGRRLWDAKHENLDNEINEVKKDNDNMQIELRHLKGEDITSLNHRDLM  120

Query  497  ILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLGEM  676
            +LEDAL NGL SI  KQ E+ R + K+   +Q + EE +QL+ +LRQLEIA+MNRN+GE+
Sbjct  121  MLEDALDNGLTSIRNKQNELLRMMRKK---TQSMEEEQDQLNCQLRQLEIASMNRNMGEI  177

Query  677  GEVFNQRESNDYESQMPFTFSVQ  745
            GEVF QRE N+Y++QMPF F VQ
Sbjct  178  GEVFQQRE-NEYQTQMPFAFRVQ  199



>ref|XP_009777739.1| PREDICTED: floral homeotic protein GLOBOSA isoform X2 [Nicotiana 
sylvestris]
Length=196

 Score =   303 bits (776),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 152/212 (72%), Positives = 181/212 (85%), Gaps = 17/212 (8%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENSSNRQVT+SKRRNG+LKKAKEISVLCDARVSVIIF SSGKMHEFSS+
Sbjct  1    MGRGKIEIKRIENSSNRQVTYSKRRNGILKKAKEISVLCDARVSVIIFASSGKMHEFSST  60

Query  317  SLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRELM  496
            SLVDILDQYHKLTG+RLWDAKHENL+NEIN++KK+NDNMQIEL             RELM
Sbjct  61   SLVDILDQYHKLTGRRLWDAKHENLDNEINKVKKDNDNMQIEL-------------RELM  107

Query  497  ILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLGEM  676
            +LEDAL NGL SI  KQ ++ + + K+   +Q + EE +QL+++LRQLEIA+MNRN+GE+
Sbjct  108  MLEDALDNGLTSIRNKQNDLLKMMRKK---TQSMEEEQDQLNWQLRQLEIASMNRNMGEI  164

Query  677  GEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
            GEVF+QRE N+Y++QMPF F VQPMQPNLQ+R
Sbjct  165  GEVFHQRE-NEYQTQMPFAFRVQPMQPNLQER  195



>dbj|BAE72882.1| GLOBOSA homologue [Verbena x hybrida]
Length=212

 Score =   303 bits (776),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 146/214 (68%), Positives = 179/214 (84%), Gaps = 5/214 (2%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENSSNRQVT+SKRRNG++KKAKEISVLCDA+VSVIIF SSGKMHEF S 
Sbjct  1    MGRGKIEIKRIENSSNRQVTYSKRRNGIMKKAKEISVLCDAQVSVIIFASSGKMHEFCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  LVD+LDQYHKL+GKRLWDAKHE L+NEINR+KKEND+MQIELRHLKGEDIS+LNY+E
Sbjct  61   STTLVDMLDQYHKLSGKRLWDAKHEQLDNEINRVKKENDSMQIELRHLKGEDISTLNYKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LM+LE+AL+NG+ ++  KQME  R + K    ++ + EEN+ L ++LRQL +  M+ N+ 
Sbjct  121  LMVLEEALENGISTLKAKQMEFVRMMRK---HNEMIEEENQSLQFKLRQLHLDPMDDNVM  177

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
            E   V++ +   DYE+QMPF F VQPMQPNLQ+R
Sbjct  178  EAQAVYDHQGVADYEAQMPFAFRVQPMQPNLQER  211



>ref|XP_009588907.1| PREDICTED: floral homeotic protein GLOBOSA isoform X2 [Nicotiana 
tomentosiformis]
Length=196

 Score =   301 bits (770),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 152/212 (72%), Positives = 179/212 (84%), Gaps = 17/212 (8%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENSSNRQVT+SKRRNG+LKKAKEISVLCDARVSVIIF SSGKMHEFSS+
Sbjct  1    MGRGKIEIKRIENSSNRQVTYSKRRNGILKKAKEISVLCDARVSVIIFASSGKMHEFSST  60

Query  317  SLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRELM  496
            SLVDILDQYHKLTG+RLWDAK ENL+NEIN++KK+NDNMQIEL             RELM
Sbjct  61   SLVDILDQYHKLTGRRLWDAKQENLDNEINKVKKDNDNMQIEL-------------RELM  107

Query  497  ILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLGEM  676
            +LEDAL+NGL SI  KQ E  R + K+   +Q + EE +QL+ +LRQLEIA+MNRN+GE+
Sbjct  108  MLEDALENGLTSIRNKQNEFLRMMRKK---TQSMEEEQDQLNCQLRQLEIASMNRNMGEI  164

Query  677  GEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
            GEVF+QRE N+Y++Q+PF F VQPMQPNLQ+R
Sbjct  165  GEVFHQRE-NEYQTQIPFAFRVQPMQPNLQER  195



>ref|XP_011081947.1| PREDICTED: floral homeotic protein GLOBOSA [Sesamum indicum]
Length=212

 Score =   301 bits (772),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 147/214 (69%), Positives = 180/214 (84%), Gaps = 5/214 (2%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENSSNRQVT+SKRRNG++KKAKEISVLCDA+VSVIIF SSGKMHEF S 
Sbjct  1    MGRGKIEIKRIENSSNRQVTYSKRRNGIMKKAKEISVLCDAQVSVIIFASSGKMHEFCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  LVD+LDQYHKL+GKRLWDAKHE+L+NEINRIKKEND+MQIELRHLKGEDIS+LNY+E
Sbjct  61   STTLVDMLDQYHKLSGKRLWDAKHEHLDNEINRIKKENDSMQIELRHLKGEDISTLNYKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LM+LE+AL+NG+ ++  KQME  R + K    ++ + EEN+ L ++LRQL +  M+ N+ 
Sbjct  121  LMVLEEALENGVSTLKAKQMEFVRMMRK---HNEMIEEENQNLQFKLRQLHLDPMDDNVM  177

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
            E   V++ +   DYE+QMPF F VQPMQPNLQ+R
Sbjct  178  ESQGVYDHQGVADYEAQMPFAFRVQPMQPNLQER  211



>emb|CAJ44133.1| globosa protein [Misopates orontium]
Length=215

 Score =   296 bits (759),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 146/217 (67%), Positives = 175/217 (81%), Gaps = 8/217 (4%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENSSNRQVT+SKRRNG++KKAKEISVLCDA VSVIIF SSGKMHEF S 
Sbjct  1    MGRGKIEIKRIENSSNRQVTYSKRRNGIMKKAKEISVLCDAHVSVIIFASSGKMHEFCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  LVD+LD YHKL+GKRLWD KHE+L+NEINR+KKEND+MQIELRHLKGEDI++LNY+E
Sbjct  61   STTLVDMLDHYHKLSGKRLWDPKHEHLDNEINRVKKENDSMQIELRHLKGEDITTLNYKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LMILEDAL+NG  ++  KQME  R + K    ++ V EEN+ L ++LRQ+ +  MN N+ 
Sbjct  121  LMILEDALENGTSALKNKQMEFVRMMRK---HNEMVEEENQSLQFKLRQMHLDPMNDNVM  177

Query  671  EMGEVFNQRESN---DYESQMPFTFSVQPMQPNLQDR  772
            E   V++        DYE+QMPF F VQPMQPNLQ+R
Sbjct  178  ESQAVYDHHHHQNIADYEAQMPFAFRVQPMQPNLQER  214



>sp|Q03378.1|GLOB_ANTMA RecName: Full=Floral homeotic protein GLOBOSA [Antirrhinum majus]
 emb|CAA48725.1| globosa [Antirrhinum majus]
 dbj|BAI68390.1| GLOBOSA protein [Antirrhinum majus]
Length=215

 Score =   296 bits (758),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 145/217 (67%), Positives = 175/217 (81%), Gaps = 8/217 (4%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENSSNRQVT+SKRRNG++KKAKEISVLCDA VSVIIF SSGKMHEF S 
Sbjct  1    MGRGKIEIKRIENSSNRQVTYSKRRNGIMKKAKEISVLCDAHVSVIIFASSGKMHEFCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  LVD+LD YHKL+GKRLWD KHE+L+NEINR+KKEND+MQIELRHLKGEDI++LNY+E
Sbjct  61   STTLVDMLDHYHKLSGKRLWDPKHEHLDNEINRVKKENDSMQIELRHLKGEDITTLNYKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LM+LEDAL+NG  ++  KQME  R + K    ++ V EEN+ L ++LRQ+ +  MN N+ 
Sbjct  121  LMVLEDALENGTSALKNKQMEFVRMMRK---HNEMVEEENQSLQFKLRQMHLDPMNDNVM  177

Query  671  EMGEVFNQRESN---DYESQMPFTFSVQPMQPNLQDR  772
            E   V++        DYE+QMPF F VQPMQPNLQ+R
Sbjct  178  ESQAVYDHHHHQNIADYEAQMPFAFRVQPMQPNLQER  214



>gb|ABF50237.1| GLOBOSA/PISTILLATA, partial [Nicotiana langsdorffii x Nicotiana 
sanderae]
Length=187

 Score =   295 bits (755),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 170/191 (89%), Gaps = 4/191 (2%)
 Frame = +2

Query  173  NSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSSSLVDILDQYHKL  352
            NSSNRQVT+SKRRNG+LKKAKEISVLCDARVSVIIF SSGKMHEFSS+SLVDILDQYHKL
Sbjct  1    NSSNRQVTYSKRRNGILKKAKEISVLCDARVSVIIFASSGKMHEFSSTSLVDILDQYHKL  60

Query  353  TGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRELMILEDALQNGLRS  532
            TG+RLWDAKHENL+NEIN++KK+NDNMQIELRHLKGEDI+SLN+R+LM+LEDAL NGL S
Sbjct  61   TGRRLWDAKHENLDNEINKVKKDNDNMQIELRHLKGEDITSLNHRDLMMLEDALDNGLTS  120

Query  533  ISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLGEMGEVFNQRESNDY  712
            I  KQ E+ R + K+   +Q + EE +QL+ +LRQLEIA+MNRN+GE+GEVF QR  N+Y
Sbjct  121  IRNKQNELLRMMRKK---TQSMEEEQDQLNCQLRQLEIASMNRNMGEIGEVFQQR-GNEY  176

Query  713  ESQMPFTFSVQ  745
            ++QMPF F VQ
Sbjct  177  QTQMPFAFRVQ  187



>gb|EYU21960.1| hypothetical protein MIMGU_mgv1a013697mg [Erythranthe guttata]
Length=213

 Score =   295 bits (754),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 145/215 (67%), Positives = 179/215 (83%), Gaps = 6/215 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENSSNRQVT+SKRRNG++KKAKEISVLCDA VSVIIF SSGKMHEF S 
Sbjct  1    MGRGKIEIKRIENSSNRQVTYSKRRNGIMKKAKEISVLCDAHVSVIIFASSGKMHEFCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  LVD+LDQYHKL+GKRLWDAKHE+L+NEINRIKKEND+MQIELRHLKGEDI++LNY+E
Sbjct  61   STTLVDMLDQYHKLSGKRLWDAKHEHLDNEINRIKKENDSMQIELRHLKGEDITTLNYKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LM+LE+AL+NG+ ++  KQME  R + K    ++ + EEN+ L ++LRQL +  M+ N+ 
Sbjct  121  LMVLEEALENGISTLKAKQMEFVRMMRK---HNEMIEEENQNLQFKLRQLHLDPMDENVI  177

Query  671  EMGEVFNQRESNDYES-QMPFTFSVQPMQPNLQDR  772
            E   +++ +   DYE+ QMPF F VQPMQPNLQ+R
Sbjct  178  EPHGLYDHQGVPDYEAHQMPFAFRVQPMQPNLQER  212



>gb|EYU21961.1| hypothetical protein MIMGU_mgv1a013697mg [Erythranthe guttata]
Length=211

 Score =   286 bits (732),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 143/215 (67%), Positives = 177/215 (82%), Gaps = 8/215 (4%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENSSNRQVT+SKRRNG++KKAKEISVLCDA VSVIIF SSGKMHEF S 
Sbjct  1    MGRGKIEIKRIENSSNRQVTYSKRRNGIMKKAKEISVLCDAHVSVIIFASSGKMHEFCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  LVD+LDQYHKL+GKRLWDAKHE+L+NEINRIKKEND+MQIELRHLKGEDI++LNY+E
Sbjct  61   STTLVDMLDQYHKLSGKRLWDAKHEHLDNEINRIKKENDSMQIELRHLKGEDITTLNYKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LM+LE+AL+NG+ ++  KQME  R + K    ++ + EEN+ L ++L  L +  M+ N+ 
Sbjct  121  LMVLEEALENGISTLKAKQMEFVRMMRK---HNEMIEEENQNLQFKL--LHLDPMDENVI  175

Query  671  EMGEVFNQRESNDYES-QMPFTFSVQPMQPNLQDR  772
            E   +++ +   DYE+ QMPF F VQPMQPNLQ+R
Sbjct  176  EPHGLYDHQGVPDYEAHQMPFAFRVQPMQPNLQER  210



>gb|AEA76417.1| putative GLO1 [Catharanthus roseus]
Length=211

 Score =   280 bits (717),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 140/214 (65%), Positives = 174/214 (81%), Gaps = 6/214 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENSSNRQVT+SKRRNG++KKAKEI+VLCDA+VS+IIFG+SGKMHE+ S 
Sbjct  1    MGRGKIEIKRIENSSNRQVTYSKRRNGIMKKAKEITVLCDAKVSLIIFGTSGKMHEYISP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  L+D+LD Y K TGK+LWDAKHENL NEI+R+KKEND+MQIELRHLKGEDI+SLN++E
Sbjct  61   STNLIDMLDAYQKATGKKLWDAKHENLSNEIDRVKKENDSMQIELRHLKGEDITSLNHKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LM+LEDAL+NG+ SI ++Q E+ +   K     Q + EEN+QL Y   Q E+A M   + 
Sbjct  121  LMVLEDALENGISSIRDRQSEIVKIARK---NGQILEEENKQLPYFWHQQELANMKNAVE  177

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
            E  +V++QR   DY+SQMPF F VQPMQPNL +R
Sbjct  178  ETEDVYHQR-VRDYQSQMPFAFRVQPMQPNLHER  210



>gb|AAD02250.1| MADS box protein 26 [Cucumis sativus]
Length=211

 Score =   280 bits (715),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 140/214 (65%), Positives = 174/214 (81%), Gaps = 6/214 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENSSNRQVT+SKRRNG++KKAKEI+VLCDA+VS++IF SSGKMHE+ S 
Sbjct  1    MGRGKIEIKRIENSSNRQVTYSKRRNGIIKKAKEITVLCDAQVSLVIFASSGKMHEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  LVDILD+YHK +GKRLWDAKHENL NE++R+KKENDNMQIELRHL+GEDI+SLNY+E
Sbjct  61   STPLVDILDKYHKQSGKRLWDAKHENLSNEMDRVKKENDNMQIELRHLRGEDITSLNYKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LM LE+AL+NGL  + EKQ E  + +       + + EEN++L+Y L Q E+ AM  ++ 
Sbjct  121  LMALEEALENGLTGVREKQSEFMKMMRT---NERMMEEENKRLNYELYQKEMVAMGDSVR  177

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
            EM   +NQR   D+ SQMPF F VQP+QPNLQ+R
Sbjct  178  EMDIGYNQR-MRDFNSQMPFAFRVQPIQPNLQER  210



>ref|XP_009608638.1| PREDICTED: floral homeotic protein PMADS 2 [Nicotiana tomentosiformis]
Length=212

 Score =   279 bits (713),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 141/215 (66%), Positives = 177/215 (82%), Gaps = 7/215 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIENSSNRQVT+SKRRNG++KKAKEI+VLCDA+VS+IIFG+SGKMHE+ S 
Sbjct  1    MGRGKIEIKRIENSSNRQVTYSKRRNGIIKKAKEITVLCDAKVSLIIFGNSGKMHEYCSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             +++ D+LD Y K +G+RLWDAKHENL NEI+RIKKEND+MQ++LRHLKGEDI+SLN++E
Sbjct  61   STTIADMLDGYQKTSGRRLWDAKHENLSNEIDRIKKENDSMQVKLRHLKGEDINSLNHKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LMI+E+ALQNGL SIS KQ E+ R + K     Q + EE++QL Y L Q E+AAM  N+ 
Sbjct  121  LMIMEEALQNGLSSISAKQSEILRMVRK---NDQILEEEHKQLQYALHQKEMAAMGGNMR  177

Query  671  EMG-EVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
             +  EV++QR+  DYE QMPF   VQPMQPNL +R
Sbjct  178  VIQEEVYHQRD-RDYEYQMPFALRVQPMQPNLHER  211



>ref|XP_009803901.1| PREDICTED: floral homeotic protein PMADS 2 [Nicotiana sylvestris]
Length=212

 Score =   279 bits (713),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 140/215 (65%), Positives = 178/215 (83%), Gaps = 7/215 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIENSSNRQVT+SKRRNG++KKAKEI+VLCDA+VS+IIFG+SGKMHE+ S 
Sbjct  1    MGRGKIEIKRIENSSNRQVTYSKRRNGIIKKAKEITVLCDAKVSLIIFGNSGKMHEYCSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             +++ D+LD Y K +G+RLWDAKHENL NEI+RIKKEND+MQ++LRHLKGEDI+SLN++E
Sbjct  61   STTIADMLDGYQKTSGRRLWDAKHENLSNEIDRIKKENDSMQVKLRHLKGEDINSLNHKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LM++E+ALQNGL SIS KQ E+ R + K     Q + EE++QL Y L Q E+AAM  N+ 
Sbjct  121  LMVMEEALQNGLSSISAKQSEILRMVRK---NDQILEEEHKQLQYALHQKEMAAMGGNMR  177

Query  671  EMG-EVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
             +  EV++QR+  DYE QMPF+  VQPMQPNL +R
Sbjct  178  VIQEEVYHQRD-RDYEYQMPFSLRVQPMQPNLHER  211



>gb|AHH28258.1| MADS-box transcription factor, partial [Rhizanthes lowii]
Length=209

 Score =   277 bits (708),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 139/214 (65%), Positives = 175/214 (82%), Gaps = 8/214 (4%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIENSSNRQVT+SKRRNG++KKA EI+VLCDA+VSV+IF SSGKM E+ S 
Sbjct  1    MGRGKIEIKRIENSSNRQVTYSKRRNGIIKKATEITVLCDAQVSVVIFASSGKMTEYCSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             ++L+D+LD+YHK +GKRLWDAKHENL NEI+RIKKEND MQIELRHLKGEDI+SLN++E
Sbjct  61   STTLIDLLDRYHKQSGKRLWDAKHENLSNEIDRIKKENDAMQIELRHLKGEDIASLNHKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LM +E+AL+NGL SI +KQME ++N+ K     + + EEN++LSY L+Q E   M  N+ 
Sbjct  121  LMAIEEALENGLASIRQKQMEYFKNMKK---NERLLEEENKRLSYVLQQTE---MEENVR  174

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
            EM     Q+   +Y SQMPF+F VQP+QPNLQ+R
Sbjct  175  EMECGLQQQRMREYNSQMPFSFRVQPIQPNLQER  208



>gb|AGA61757.1| pistillata [Cornus kousa]
Length=210

 Score =   277 bits (708),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 142/214 (66%), Positives = 175/214 (82%), Gaps = 7/214 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENSSNRQVT+SKRRNG++KKAKEI+VLCDA VS++IF SSGKMHE+ S 
Sbjct  1    MGRGKIEIKRIENSSNRQVTYSKRRNGIMKKAKEITVLCDAHVSLVIFASSGKMHEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  LVDILD+YH  +GKRLWDAKHENL NEI+RIKKEND+MQIELRHLKGEDI+SL+Y+E
Sbjct  61   STKLVDILDRYHTQSGKRLWDAKHENLSNEIDRIKKENDSMQIELRHLKGEDITSLHYKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LM +E+AL+NGL S SEKQ E+ R + K     + + EE + L+Y+L++ E+  M  NL 
Sbjct  121  LMAIEEALENGLTSNSEKQREIIRMMKK---NEKMLEEEYKHLTYQLQKQEL-VMEGNLR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
            EM   F+QR   D++ QMPF+F VQP+QPNLQDR
Sbjct  177  EMENGFHQR-VRDFQPQMPFSFRVQPIQPNLQDR  209



>sp|Q07474.1|MADS2_PETHY RecName: Full=Floral homeotic protein PMADS 2 [Petunia x hybrida]
 emb|CAA49568.1| PMADS2 [Petunia x hybrida]
Length=212

 Score =   277 bits (708),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 142/215 (66%), Positives = 174/215 (81%), Gaps = 7/215 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENSSNRQVT+SKRRNG++KKAKEI+VLCDA+VS+IIFG+SGKMHE+ S 
Sbjct  1    MGRGKIEIKRIENSSNRQVTYSKRRNGIIKKAKEITVLCDAKVSLIIFGNSGKMHEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  L D+LD Y K +G+RLWDAKHENL NEI+RIKKENDNMQ++LRHLKGEDI+SLN++E
Sbjct  61   STTLPDMLDGYQKTSGRRLWDAKHENLSNEIDRIKKENDNMQVKLRHLKGEDINSLNHKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LM+LE+ L NGL SIS KQ E+ R + K     Q + EE++QL Y L Q E+AAM  N+ 
Sbjct  121  LMVLEEGLTNGLSSISAKQSEILRMVRK---NDQILEEEHKQLQYALHQKEMAAMGGNMR  177

Query  671  EMGEVFNQRESNDYE-SQMPFTFSVQPMQPNLQDR  772
             + EV++QR+  DYE  QMPF   VQPMQPNL +R
Sbjct  178  MIEEVYHQRD-RDYEYQQMPFALRVQPMQPNLHER  211



>gb|AEM60220.1| MADS box transcription factor, partial [Halleria lucida]
Length=205

 Score =   276 bits (707),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 135/207 (65%), Positives = 169/207 (82%), Gaps = 6/207 (3%)
 Frame = +2

Query  161  KRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSSS--LVDIL  334
            KRIEN+SNRQVT+SKRRNG++KKAKEISVLCDA+VSVIIF SS KMHEF S S  LVD+L
Sbjct  1    KRIENTSNRQVTYSKRRNGIMKKAKEISVLCDAQVSVIIFASSNKMHEFCSPSTTLVDML  60

Query  335  DQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRELMILEDAL  514
            DQYHKL+GKRLWDAKHE+L+NEINRIKKEND+MQIELRHLKGEDI++LNY+ELM+LE+AL
Sbjct  61   DQYHKLSGKRLWDAKHEHLDNEINRIKKENDSMQIELRHLKGEDITTLNYKELMVLEEAL  120

Query  515  QNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLGEMGEVFNQ  694
            +NG+ ++  KQME  R + K    ++ + EEN+ L ++LRQ+ +  M+ N+ E    ++ 
Sbjct  121  ENGISTLKAKQMEFVRMMRK---HNELIEEENQSLQFKLRQMHLDPMDDNVMESQGAYDH  177

Query  695  RES-NDYESQMPFTFSVQPMQPNLQDR  772
                 DYE+QMPF F VQPMQPNLQ+R
Sbjct  178  HPGVADYEAQMPFAFRVQPMQPNLQER  204



>gb|ADU15475.1| PI [Actinidia chinensis]
Length=208

 Score =   275 bits (703),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 139/214 (65%), Positives = 175/214 (82%), Gaps = 9/214 (4%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIE+SSNRQVT+SKRRNG+LKKAKEISVLCDA+VS++IF SSGKMHE+ S 
Sbjct  1    MGRGKIEIKRIEHSSNRQVTYSKRRNGILKKAKEISVLCDAKVSLVIFASSGKMHEYCSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             ++LVDILD+YHK +GKRLWDAKHENL NE++RIKKEND+MQIELRHLKGEDI+SL+++E
Sbjct  61   STTLVDILDKYHKQSGKRLWDAKHENLSNELDRIKKENDSMQIELRHLKGEDITSLHHKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LM LE+AL+NGL  I EKQMEV++ + K     + + +EN+ L++ L Q  +   +R   
Sbjct  121  LMALEEALENGLSGIREKQMEVFKMMKK---NEKMLEDENKHLNFMLHQQGMTMESR---  174

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
            EM   ++QR   DY+ QMPF F VQP+QPNLQDR
Sbjct  175  EMENGYHQR-VRDYQHQMPFAFHVQPIQPNLQDR  207



>gb|ADR83606.1| PPI [Capsicum annuum]
Length=215

 Score =   275 bits (703),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 177/217 (82%), Gaps = 8/217 (4%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIENS+NRQVT+SKRRNG++KKA+EI+VLCDA+VS+IIFG+SGKMHE+ S 
Sbjct  1    MGRGKIEIKRIENSNNRQVTYSKRRNGIIKKAREITVLCDAKVSLIIFGTSGKMHEYCSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             +++ DILD Y K +G+RLWDAKHENL NEI+RIKKEND+MQ++LRHLKGEDI+SLN++E
Sbjct  61   STTMSDILDGYQKASGRRLWDAKHENLSNEIDRIKKENDSMQVKLRHLKGEDINSLNHKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LM++E+AL+NGL SIS KQ E+ R + K     Q + EE++QL Y L Q E+AAM  N+ 
Sbjct  121  LMVMEEALENGLSSISAKQSEILRMVRK---NDQILEEEHKQLQYALHQKEMAAMGGNMR  177

Query  671  EMGE--VFNQRESNDYE-SQMPFTFSVQPMQPNLQDR  772
             + E  +++QRE  DYE  QMPF   VQPMQPNL +R
Sbjct  178  GIHEEAMYHQREREDYEYQQMPFALRVQPMQPNLHER  214



>emb|CAA50549.1| FBP3 [Petunia x hybrida]
Length=212

 Score =   275 bits (703),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 141/215 (66%), Positives = 176/215 (82%), Gaps = 7/215 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENSSNRQVT+SKRRNG++KKAKEI+VLCDA+VS+IIFG+SGKMHE+ S 
Sbjct  1    MGRGKIEIKRIENSSNRQVTYSKRRNGIIKKAKEITVLCDAKVSLIIFGNSGKMHEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  L D+LD Y K +G+RLWDAKHENL NEI+RIKKEND+MQ++LRHLKGEDI+SLN++E
Sbjct  61   STTLPDMLDGYQKTSGRRLWDAKHENLSNEIDRIKKENDSMQVKLRHLKGEDINSLNHKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LM+LE+ L NGL SIS KQ E+ R + ++ DQ   + EE++QL Y L Q E+AAM  N+ 
Sbjct  121  LMVLEEGLTNGLSSISAKQSEILR-IVRKNDQI--LEEEHKQLQYALHQKEMAAMGGNMR  177

Query  671  EMGEVFNQRESNDYE-SQMPFTFSVQPMQPNLQDR  772
             + EV++QR+  DYE  QMPF   VQPMQPNL +R
Sbjct  178  MIEEVYHQRD-RDYEYQQMPFALRVQPMQPNLHER  211



>ref|XP_008444207.1| PREDICTED: floral homeotic protein PMADS 2 isoform X1 [Cucumis 
melo]
Length=248

 Score =   276 bits (706),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 139/214 (65%), Positives = 173/214 (81%), Gaps = 6/214 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENSSNRQVT+SKRRNG++KKAKEI+VLCDA+VS++IF SSGKMHE+ S 
Sbjct  38   MGRGKIEIKRIENSSNRQVTYSKRRNGIIKKAKEITVLCDAQVSLVIFASSGKMHEYCSP  97

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  LVDILD+YHK +GKRLWDAKHENL NE++R+KKENDNMQIELRHL+GEDI+SLNY+E
Sbjct  98   STPLVDILDKYHKQSGKRLWDAKHENLSNEMDRVKKENDNMQIELRHLRGEDITSLNYKE  157

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LM LE+AL+NGL  + EKQ E  + +       + + EEN++L+Y L Q E+ AM  ++ 
Sbjct  158  LMSLEEALENGLTGVREKQSEFMKMMR---TNERMMEEENKRLNYELYQKEMVAMGDSVR  214

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
            EM   +NQR   D+ SQMPF F VQP+QPN Q+R
Sbjct  215  EMDIGYNQR-MRDFNSQMPFAFRVQPIQPNPQER  247



>ref|XP_002520308.1| mads box protein, putative [Ricinus communis]
 gb|EEF42094.1| mads box protein, putative [Ricinus communis]
Length=234

 Score =   275 bits (703),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 144/236 (61%), Positives = 173/236 (73%), Gaps = 27/236 (11%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRGRIEIKRIENSSNRQVT+SKRRNG++KKAKEI+VLCDA VS+IIF SSGKMHE+ S 
Sbjct  1    MGRGRIEIKRIENSSNRQVTYSKRRNGIIKKAKEITVLCDAEVSLIIFASSGKMHEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  LVD+LD+YHKL+G+RLWDAKHENL NEI+R+KKENDNMQIELRHL GEDISSL Y E
Sbjct  61   STTLVDMLDKYHKLSGQRLWDAKHENLSNEIDRVKKENDNMQIELRHLNGEDISSLKYPE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAA------  652
            L  LEDAL+ GL  I  KQME ++ + KR D+S  +A+EN+ LS+ L QLE+        
Sbjct  121  LQALEDALETGLAGIRNKQMEYYK-MMKRKDKS--LADENQHLSFILHQLEMETKQTVRE  177

Query  653  ----------------MNRNLGEMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
                              +N+ EM   ++Q+   DY SQ+PF F VQP+QPNLQ R
Sbjct  178  MENPYLVSSQHQLQMETKQNMREMENPYHQQRVRDYNSQVPFAFRVQPIQPNLQGR  233



>dbj|BAJ53191.1| JMS09K11.9 [Jatropha curcas]
Length=211

 Score =   274 bits (701),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/214 (63%), Positives = 176/214 (82%), Gaps = 6/214 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIEN+SNRQVT+SKRR G++KKAKEI+VLCDA+VS++IF SSGKMHE+ S 
Sbjct  1    MGRGKIEIKRIENTSNRQVTYSKRRAGIMKKAKEITVLCDAQVSLVIFASSGKMHEYCSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             +SL++ILD+YHK  GKR+WDAKHENL NEI+RIKKEND+MQIELRH+KGEDI+SLN++E
Sbjct  61   STSLIEILDKYHKHAGKRIWDAKHENLSNEIDRIKKENDSMQIELRHMKGEDIASLNHKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LM +E+AL+NGL SI +KQME  + + K     + + EEN++LS+ L+Q E+ A+  N+ 
Sbjct  121  LMHIEEALENGLASIRDKQMEYLKMMKK---NEKILEEENKRLSFILQQQEM-AIEENVR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
            E+   ++Q    DY SQMPF F VQP+QPNLQ+R
Sbjct  177  ELENPYHQHRVRDYSSQMPFAFRVQPIQPNLQER  210



>gb|AGN54426.1| PFGLO2 [Physalis pubescens]
Length=212

 Score =   274 bits (701),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 140/215 (65%), Positives = 175/215 (81%), Gaps = 7/215 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIENS+NR VT+SKRRNG++KKAKEI+VLCDA+VS+IIFG+SGKMHE+ S 
Sbjct  1    MGRGKIEIKRIENSNNRLVTYSKRRNGIIKKAKEITVLCDAKVSLIIFGTSGKMHEYCSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             ++L DILD Y K +G+RLWDAKHENL NEI+RIKKEND+MQ++LRHLKGEDI+SLN++E
Sbjct  61   STTLSDILDGYQKTSGRRLWDAKHENLSNEIDRIKKENDSMQVKLRHLKGEDINSLNHKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNL-  667
            LM++E+ALQNGL SIS KQ E+ R + K     Q + EE++QL Y   Q  +AAM  N+ 
Sbjct  121  LMVMEEALQNGLSSISAKQSEILRMVRK---NDQILEEEHKQLQYIFHQKGMAAMGGNMR  177

Query  668  GEMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
            G   EV++QRE  DYE QMPF+  VQPMQPNL +R
Sbjct  178  GIHEEVYHQRE-RDYEYQMPFSLRVQPMQPNLHER  211



>gb|ADM88562.1| GLO1 MADS-box transcription factor [Nicotiana benthamiana]
Length=184

 Score =   273 bits (698),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 159/180 (88%), Gaps = 4/180 (2%)
 Frame = +2

Query  233  KEISVLCDARVSVIIFGSSGKMHEFSSSSLVDILDQYHKLTGKRLWDAKHENLENEINRI  412
            KEISVLCDARVSVIIF S+GKMHEFSS+ LVDILDQYHKLTG+RLWDAK+EN++NEIN++
Sbjct  8    KEISVLCDARVSVIIFASTGKMHEFSSTPLVDILDQYHKLTGRRLWDAKYENMDNEINKV  67

Query  413  KKENDNMQIELRHLKGEDISSLNYRELMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQ  592
            KK+NDNMQIELRHLKGEDI+SLN+R+LM+LEDAL NGL SI  KQ E+ R + K+   +Q
Sbjct  68   KKDNDNMQIELRHLKGEDITSLNHRDLMMLEDALDNGLTSIRNKQNELLRMMRKK---TQ  124

Query  593  GVAEENEQLSYRLRQLEIAAMNRNLGEMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
             + EE +QL+ +LRQLEIA+MNRN+GE+GEVF QRE N+Y++QMPF F VQPMQPNLQ+R
Sbjct  125  SMEEEQDQLNCQLRQLEIASMNRNMGEIGEVFQQRE-NEYQTQMPFAFRVQPMQPNLQER  183



>gb|ADU56835.1| MADS-box protein GLO subfamily [Coffea arabica]
Length=210

 Score =   273 bits (698),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 137/214 (64%), Positives = 171/214 (80%), Gaps = 7/214 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVT+SKRR G++KKAKEI+VLCDA+VS+IIFG+SGKMHE+ S 
Sbjct  1    MGRGKIEIKRIENSNNRQVTYSKRRTGIMKKAKEITVLCDAKVSLIIFGTSGKMHEYISP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  LV++LD Y + TGK+LWDAKHENL NEI+R+KKEND+MQIELRHLKGEDI+SLNY+E
Sbjct  61   STNLVEMLDAYQRSTGKKLWDAKHENLSNEIDRVKKENDSMQIELRHLKGEDITSLNYKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LMILEDAL+NGL  + EKQ E+ + + K     + + +EN+QL Y   Q E+A M   +G
Sbjct  121  LMILEDALENGLAGLREKQSEIIKMIRK---TGEMLEDENKQLQYIWHQQEMANMKGAIG  177

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
            E  +V+ +    DY SQMPF F VQPMQPNL +R
Sbjct  178  ERDDVYQR--VRDYPSQMPFAFRVQPMQPNLHER  209



>gb|AHH28269.1| MADS-box transcription factor, partial [Rafflesia cantleyi]
Length=209

 Score =   272 bits (696),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 139/214 (65%), Positives = 174/214 (81%), Gaps = 9/214 (4%)
 Frame = +2

Query  140  GRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS--  313
            GRG+IEIKRIENSSNRQVT+SKRRNG++KKA EI+VLCDA+VSV+IF SSGKM E+ S  
Sbjct  1    GRGKIEIKRIENSSNRQVTYSKRRNGIIKKATEITVLCDAQVSVVIFASSGKMTEYCSPS  60

Query  314  SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYREL  493
            ++L+D+LD+YHK +GKRLWDAKHENL NEI+RIKKEND MQIELRHLKGEDI+SLN++EL
Sbjct  61   TTLIDLLDRYHKQSGKRLWDAKHENLSNEIDRIKKENDAMQIELRHLKGEDIASLNHKEL  120

Query  494  MILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLGE  673
            M +E+AL+NGL SI EKQME ++N+ K     + + EEN++LS+ L+Q E   M  N  E
Sbjct  121  MAIEEALENGLASIREKQMEYFKNMKK---NERLLEEENKRLSFVLQQTE---MEENARE  174

Query  674  MGEVFNQRESNDYES-QMPFTFSVQPMQPNLQDR  772
            M   F Q+   +Y S QMPF+F VQP+QPNLQ+R
Sbjct  175  MESGFQQQRMREYNSHQMPFSFRVQPIQPNLQER  208



>ref|XP_007019220.1| Mads box protein, putative [Theobroma cacao]
 gb|EOY16445.1| Mads box protein, putative [Theobroma cacao]
Length=209

 Score =   272 bits (696),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 140/214 (65%), Positives = 173/214 (81%), Gaps = 8/214 (4%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENSSNRQVT+SKRRNG++KKAKEI+VLCDARVS+IIF SSGKMHE+ S 
Sbjct  1    MGRGKIEIKRIENSSNRQVTYSKRRNGIMKKAKEITVLCDARVSLIIFASSGKMHEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  L+DILDQYHK +GKRLWDAKHENL NEI+RIKKEND+M IELRHLKGEDI+SL Y+E
Sbjct  61   STNLIDILDQYHKTSGKRLWDAKHENLSNEIDRIKKENDSMHIELRHLKGEDITSLQYKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LM +EDAL+NGL  +  KQM+V  ++T++   ++ + E+N+QL++ + Q  IA    N  
Sbjct  121  LMAIEDALENGLACVRAKQMDVL-DVTRK--NTKMLEEDNKQLNFIVNQQHIAY--ENAR  175

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
            E  +   QR + DY SQ+PF F VQPMQPNLQ+R
Sbjct  176  EQMDNGYQR-ARDYNSQIPFAFRVQPMQPNLQER  208



>gb|AER30449.1| PISTILLATA [Passiflora edulis]
Length=211

 Score =   271 bits (694),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 134/214 (63%), Positives = 178/214 (83%), Gaps = 6/214 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIENSSNRQVT+SKRRNG++KKAKEI+VLCDA+VS++IFGSSGKMHE+ S 
Sbjct  1    MGRGKIEIKRIENSSNRQVTYSKRRNGIIKKAKEITVLCDAKVSLVIFGSSGKMHEYCSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             ++LVD+LD+YHK +GKRLWDAKHENL NEI+RIKKEND+MQIELRHLKGEDI+SL+++E
Sbjct  61   STTLVDLLDKYHKQSGKRLWDAKHENLSNEIDRIKKENDSMQIELRHLKGEDITSLHHKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ LE AL+NGL  + EKQM+ +R   K    ++ + +E ++LS+ L+Q E+ A+  +  
Sbjct  121  LLALEKALENGLVGVREKQMDYYRMKEK---NNKILEDEGKRLSFILQQQEM-AIEEDAR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
            EM   ++Q++  +Y SQ+PF F VQP+QPNLQ+R
Sbjct  177  EMENAYHQQKLREYSSQIPFAFRVQPIQPNLQER  210



>ref|NP_001267875.1| PISTILLATA-like MADS-box protein-like [Vitis vinifera]
 gb|AAY79173.1| putative PISTILLATA-like MADS-box protein [Vitis vinifera]
 gb|ABK59993.1| B-class MADS-box transcription factor PISTILLATA [Vitis vinifera]
 gb|AFR53062.1| PISTILLATA [Vitis vinifera]
 gb|AFR53063.1| PISTILLATA [Vitis vinifera]
Length=212

 Score =   270 bits (690),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 134/214 (63%), Positives = 169/214 (79%), Gaps = 5/214 (2%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENSSNRQVT+SKRRNG++KKAKEI+VLCDA VS++IF SSGKMHE+ S 
Sbjct  1    MGRGKIEIKRIENSSNRQVTYSKRRNGIMKKAKEITVLCDAHVSLVIFASSGKMHEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  L+DILD+YHK +GKRLWDAKHENL NE++RIKKEND+MQIELRHLKGEDISSL+++E
Sbjct  61   STTLIDILDRYHKQSGKRLWDAKHENLSNELDRIKKENDSMQIELRHLKGEDISSLHHKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LM +EDAL+ GL S+  KQME ++ + K     + + EEN+ L+Y +    +     N+ 
Sbjct  121  LMAIEDALEIGLASVRNKQMEFYKMVKK---NQRILEEENKHLNYIVHHQGMPMEAGNVR  177

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
            E+   ++QR   DY  QMPF F VQP+QPNLQ+R
Sbjct  178  EVESGYHQRAVRDYNPQMPFAFRVQPIQPNLQER  211



>ref|XP_006361521.1| PREDICTED: LOW QUALITY PROTEIN: floral homeotic protein GLOBOSA-like 
[Solanum tuberosum]
Length=194

 Score =   268 bits (686),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 141/199 (71%), Positives = 168/199 (84%), Gaps = 8/199 (4%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHE-FSS  313
            MGRG+IEIKRIENSSN+QVT+SKRRNG+LKKAKEISVLCDA VSVIIF +SGKMHE FSS
Sbjct  1    MGRGKIEIKRIENSSNKQVTYSKRRNGILKKAKEISVLCDAHVSVIIFSTSGKMHEXFSS  60

Query  314  SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLN-YRE  490
            + LVDILDQYHKLTG+ LWDAKHENL+NEIN++KK+NDNMQIEL+HLKGEDISS N  RE
Sbjct  61   TPLVDILDQYHKLTGRILWDAKHENLDNEINKVKKDNDNMQIELKHLKGEDISSFNSCRE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LMILEDAL+NGL  I +KQ E  R + K+   +Q +  E EQL+ +LRQLEIA++NRN+G
Sbjct  121  LMILEDALENGLTRIRDKQNEFLRMMRKK---TQNM--EQEQLNSQLRQLEIASINRNIG  175

Query  671  EMGEVFNQRESNDYESQMP  727
            E+GEVF Q  +N +  + P
Sbjct  176  EIGEVFEQ-TTNAFCLESP  193



>gb|AGW23352.1| MADS box protein MADS50 [Gossypium hirsutum]
Length=209

 Score =   268 bits (686),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 141/214 (66%), Positives = 171/214 (80%), Gaps = 8/214 (4%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENSSNRQVT+SKRRNG++KKAKEI++LCDA+VS+IIFGSSGKMHE+ S 
Sbjct  1    MGRGKIEIKRIENSSNRQVTYSKRRNGIMKKAKEITILCDAKVSLIIFGSSGKMHEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  LVDILDQY K +GK+LWDAKHENL NEI+RIKKENDNMQIELRHLKGEDI+SL Y+E
Sbjct  61   STNLVDILDQYQKTSGKKLWDAKHENLSNEIDRIKKENDNMQIELRHLKGEDITSLPYKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LM +EDAL+NGL  +  KQM+V   L K +  ++ + E+ +QLS+ L Q +IA    +  
Sbjct  121  LMAIEDALENGLTYVRGKQMDV---LDKTWKNTKFLEEDYKQLSFILNQQQIAY--ESAR  175

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
            E  +   QR + DY SQM  TF VQPMQPNLQ+R
Sbjct  176  EQMDHGYQR-ARDYNSQMSSTFQVQPMQPNLQER  208



>gb|ADU56834.1| MADS-box protein GLO subfamily [Coffea arabica]
 gb|AHW58035.1| PI [Coffea arabica]
Length=210

 Score =   268 bits (684),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 133/214 (62%), Positives = 169/214 (79%), Gaps = 7/214 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIEN++NR VT+SKR+ G++KKAKEI+VLCDA+VS+IIFG+SGKMHE+ S 
Sbjct  1    MGRGKIEIKRIENTNNRHVTYSKRKTGIMKKAKEITVLCDAKVSLIIFGTSGKMHEYISP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  LV++LD Y + TGK+LWDAKHENL NEI+R+KKEND+MQIELRHLKGEDI+SLNY+E
Sbjct  61   STNLVEMLDAYQRSTGKKLWDAKHENLSNEIDRVKKENDSMQIELRHLKGEDITSLNYKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LM+LEDAL+NGL  +  KQ E+ + + K     + + EEN+QL Y   Q E+A M   +G
Sbjct  121  LMVLEDALENGLAGLRNKQSEIIKMIRK---TGEMLEEENKQLQYIWHQQEMANMKGAIG  177

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
            E  +V+ +    DY SQMPF F VQPMQPNL +R
Sbjct  178  ERDDVYQR--VRDYPSQMPFAFRVQPMQPNLHER  209



>gb|ADX86812.1| MADS domain transcription factor [Camellia japonica]
Length=209

 Score =   266 bits (680),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 135/214 (63%), Positives = 174/214 (81%), Gaps = 8/214 (4%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIENSSNRQVT+SKRRNG++KKAKEI+VLCDA+VS++IF SSGKMHE+ S 
Sbjct  1    MGRGKIEIKRIENSSNRQVTYSKRRNGIMKKAKEITVLCDAQVSLVIFASSGKMHEYCSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             ++LVDILD+YHK +G+RLWDAKHENL NE++RIKKEND+MQIELRHLKGEDI+SL+++E
Sbjct  61   STTLVDILDKYHKQSGERLWDAKHENLSNELDRIKKENDSMQIELRHLKGEDITSLHHKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LM +E+AL+NGL S+ EKQME    + K     + + EEN+ L++ L Q E+   +    
Sbjct  121  LMAIEEALENGLGSVREKQMEYIDMMEK---NKKTLEEENKHLNFMLHQQEMNMESSR--  175

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
            EM   ++QR   D++SQMPF F VQP+QPNLQ+R
Sbjct  176  EMENGYHQR-VRDFQSQMPFAFRVQPIQPNLQER  208



>gb|ACJ26767.1| MADS-12 [Gossypium hirsutum]
Length=213

 Score =   266 bits (680),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 134/214 (63%), Positives = 170/214 (79%), Gaps = 5/214 (2%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENSSNRQVT+SKRRNG++KKAKEI+VLCDA+VS+IIF SSGKMHE+ S 
Sbjct  1    MGRGKIEIKRIENSSNRQVTYSKRRNGIMKKAKEITVLCDAKVSLIIFASSGKMHEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  L+DILDQY K +GK+LWDAKHENL NEI+RIKKEND+MQIELRHLKGEDI+SL Y+E
Sbjct  61   STKLIDILDQYQKTSGKKLWDAKHENLGNEIDRIKKENDSMQIELRHLKGEDITSLPYKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LM LEDAL+NGL  +  KQM+V  ++ K+   ++ + E+N+QL++ + Q ++   N    
Sbjct  121  LMALEDALENGLTCVRAKQMDVL-DMAKK--NTKFLEEDNKQLNFIVNQQQLTYENVREH  177

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
                 +++    D+ SQMPF F VQPMQPNLQ+R
Sbjct  178  MDYHGYHRAARADFNSQMPFAFRVQPMQPNLQER  211



>ref|XP_006365936.1| PREDICTED: floral homeotic protein PMADS 2-like [Solanum tuberosum]
Length=215

 Score =   266 bits (680),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 135/219 (62%), Positives = 174/219 (79%), Gaps = 12/219 (5%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIEN++NRQVT+SKRRNG++KKAKEI+VLC+A+VS+IIF SSGKMHE+ S 
Sbjct  1    MGRGKIEIKRIENTNNRQVTYSKRRNGIIKKAKEITVLCEAKVSLIIFASSGKMHEYCSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             ++L D+LD Y K +G+RLWDAKHENL NEI+RIKKEND+MQ++LRHLKGEDI+ L ++E
Sbjct  61   STTLSDMLDGYQKASGRRLWDAKHENLSNEIDRIKKENDSMQVKLRHLKGEDINQLTHKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMN----  658
            L+I+E+ALQNGL SIS KQ E+ R + K     Q + EE++QL Y L Q E+ A+     
Sbjct  121  LIIMEEALQNGLSSISAKQSEILRMVRK---NDQILEEEHKQLQYALHQKEMGAIGGSGN  177

Query  659  -RNLGEMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
             R + E  EV++QRE ++YE QMPF   VQPMQPNL +R
Sbjct  178  MRGIHE--EVYHQRERDNYEYQMPFGLRVQPMQPNLHER  214



>ref|XP_004498359.1| PREDICTED: floral homeotic protein PMADS 2-like [Cicer arietinum]
Length=245

 Score =   267 bits (682),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 137/214 (64%), Positives = 174/214 (81%), Gaps = 9/214 (4%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEF--S  310
            MGRG+IEIKRIENSSNRQVT+SKR+NG+LKKAKEI+VLCDA+VS+IIF +SGKMH++   
Sbjct  38   MGRGKIEIKRIENSSNRQVTYSKRKNGILKKAKEITVLCDAKVSLIIFAASGKMHDYISP  97

Query  311  SSSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S++L+DIL++YHK +GKRLWDAKHENL NEI R+KKEND MQ+ELRHLKGEDI+SL+Y+E
Sbjct  98   STTLIDILERYHKTSGKRLWDAKHENLSNEIERLKKENDGMQVELRHLKGEDINSLHYKE  157

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LM LEDAL+NGL +I EKQMEV+R + +R D+   + EEN +L++ L+Q       R   
Sbjct  158  LMSLEDALENGLLTIREKQMEVYR-MIRRNDKI--LEEENRELNFILQQRMAVEGAR---  211

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
            E+   FNQ    D+ SQMPF++ VQPMQPNL +R
Sbjct  212  EVENGFNQ-SGRDFNSQMPFSYRVQPMQPNLHER  244



>gb|AEE98378.1| pistillata MADS-box protein [Paeonia suffruticosa]
Length=211

 Score =   265 bits (677),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 131/214 (61%), Positives = 169/214 (79%), Gaps = 6/214 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEF--S  310
            MGRG+IEIKRIENS+NRQVTFSKRR G+LKKA EI+VLCDA VS++IF +SG MHE+   
Sbjct  1    MGRGKIEIKRIENSNNRQVTFSKRRTGILKKATEITVLCDAHVSLVIFSTSGIMHEYRSP  60

Query  311  SSSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S++++DILD+YHK + K+LWD KHENL NE++R+KKENDNMQIELRHLKGED++SLN +E
Sbjct  61   STTVIDILDRYHKQSTKKLWDPKHENLSNEVDRVKKENDNMQIELRHLKGEDVTSLNIKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LM LE+ L+NGL SI +K+ME  + L KR D+   +A+EN QL+  + Q  +  M+ N+ 
Sbjct  121  LMALEETLENGLTSIRDKKMEFPKRLKKRVDK---LADENRQLNCIVNQYGM-DMDDNVR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
            EM   + QR   DY SQ+PF F VQP+QPNLQ+R
Sbjct  177  EMDTGYRQRAVRDYNSQIPFAFRVQPIQPNLQER  210



>dbj|BAG24493.1| GLOBOSA-like MADS-box protein [Torenia fournieri]
Length=230

 Score =   266 bits (679),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 135/232 (58%), Positives = 173/232 (75%), Gaps = 23/232 (10%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIENSSNRQVT+SKRRNG++KKAKEISVLCDARVSVIIF SSGKM E+ S 
Sbjct  1    MGRGKIEIKRIENSSNRQVTYSKRRNGIMKKAKEISVLCDARVSVIIFASSGKMQEYCSQ  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             ++LVD+LDQY KL+GKR+WD KHE L+NEIN +KK+NDNMQIELRHLKGEDI++LNY++
Sbjct  61   STTLVDMLDQYQKLSGKRIWDPKHEQLDNEINSVKKQNDNMQIELRHLKGEDITTLNYKD  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAM-NRNL  667
            LM++E+AL+NG+ ++  KQME  + + K    ++ + EEN+ L ++LRQL +  M + N+
Sbjct  121  LMVIEEALENGMSALKAKQMEFVQMMRK---HNEMMEEENQTLHFKLRQLHLDPMDDHNV  177

Query  668  GEMG-----------------EVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
             E                   E       + YE+QMPF F VQPMQPNLQ+R
Sbjct  178  METQHNHHQQHQAGMYSNHHHEAAAAAGVSSYEAQMPFAFRVQPMQPNLQER  229



>dbj|BAJ15423.1| GLOBOSA-like MADS-box protein [Torenia fournieri]
Length=231

 Score =   265 bits (678),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 135/233 (58%), Positives = 173/233 (74%), Gaps = 24/233 (10%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIENSSNRQVT+SKRRNG++KKAKEISVLCDARVSVIIF SSGKM E+ S 
Sbjct  1    MGRGKIEIKRIENSSNRQVTYSKRRNGIMKKAKEISVLCDARVSVIIFASSGKMQEYCSQ  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             ++LVD+LDQY KL+GKR+WD KHE L+NEIN +KK+NDNMQIELRHLKGEDI++LNY++
Sbjct  61   STTLVDMLDQYQKLSGKRIWDPKHEQLDNEINSVKKQNDNMQIELRHLKGEDITTLNYKD  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAM-NRNL  667
            LM++E+AL+NG+ ++  KQME  + + K    ++ + EEN+ L ++LRQL +  M + N+
Sbjct  121  LMVIEEALENGMSALKAKQMEFVQMMRK---HNEMMEEENQTLHFKLRQLHLDPMDDHNV  177

Query  668  GEMG------------------EVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
             E                    E       + YE+QMPF F VQPMQPNLQ+R
Sbjct  178  METQHNHHQQHQAAGMYSNHHHEAAAAAGVSSYEAQMPFAFRVQPMQPNLQER  230



>gb|ADX86813.1| MADS domain transcription factor [Camellia japonica]
Length=208

 Score =   263 bits (673),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 134/214 (63%), Positives = 169/214 (79%), Gaps = 9/214 (4%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIEN+SNRQVT+SKRRNG+LKKAKEI+VLCDA+VS+++FGSSGKMHEF S 
Sbjct  1    MGRGKIEIKRIENTSNRQVTYSKRRNGILKKAKEITVLCDAQVSLVVFGSSGKMHEFCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  LVDIL++YHK +GKRLWDAKHENL NE++RIKKEND++QIELRHLKGEDI+SL  R+
Sbjct  61   STTLVDILEKYHKQSGKRLWDAKHENLSNELDRIKKENDSLQIELRHLKGEDITSLQPRD  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LM +E+AL+ GL S+  KQ E+ R + K     + + E+N+QL+  L Q E+   +R   
Sbjct  121  LMAIENALETGLESVRYKQSEIHRMMKK---NGKMLEEDNKQLNLILHQQEMEKGSREF-  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
               E    R+ NDY+ QMPFTF VQP+QPNL +R
Sbjct  177  ---ENGYHRQVNDYQPQMPFTFRVQPIQPNLHER  207



>gb|AGH61293.1| pistillata [Paeonia lactiflora]
Length=209

 Score =   263 bits (672),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 131/214 (61%), Positives = 169/214 (79%), Gaps = 8/214 (4%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVT+SKRR G+LKKA EI+VLCDA VS++IF +SGKMHE+ S 
Sbjct  1    MGRGKIEIKRIENSNNRQVTYSKRRTGILKKATEITVLCDAHVSLVIFATSGKMHEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  ++DILD+YHK + K+LWD KHENL NE++R+KKENDNMQIELRHLKGED++SL+ +E
Sbjct  61   STTVIDILDRYHKQSTKKLWDPKHENLSNEVDRVKKENDNMQIELRHLKGEDVTSLSIKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ LE+ L+NGL SI +KQME+ + L KR D+   + +EN QL+    Q E+  M  N+ 
Sbjct  121  LIALEETLENGLASIRDKQMELPKRLKKRIDK---LEDENRQLTCIASQYEM-DMEDNVR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
            EMG  ++QR    Y SQ+P+ F VQP+QPNLQDR
Sbjct  177  EMGTGYHQR--GGYNSQIPYAFRVQPIQPNLQDR  208



>ref|XP_008444208.1| PREDICTED: floral homeotic protein PMADS 2 isoform X2 [Cucumis 
melo]
Length=233

 Score =   263 bits (673),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 134/214 (63%), Positives = 163/214 (76%), Gaps = 21/214 (10%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENSSNRQVT+SKRRNG++KKAKEI+VLCDA+VS++IF SSGKMHE+ S 
Sbjct  38   MGRGKIEIKRIENSSNRQVTYSKRRNGIIKKAKEITVLCDAQVSLVIFASSGKMHEYCSP  97

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  LVDILD+YHK +GKRLWDAKHENL NE++R+KKENDNMQIELRHL+GEDI+SLNY+E
Sbjct  98   STPLVDILDKYHKQSGKRLWDAKHENLSNEMDRVKKENDNMQIELRHLRGEDITSLNYKE  157

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LM LE+AL+NGL  + EKQ E  + +   Y                  Q E+ AM  ++ 
Sbjct  158  LMSLEEALENGLTGVREKQSEFMKMMRTNY------------------QKEMVAMGDSVR  199

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
            EM   +NQR   D+ SQMPF F VQP+QPN Q+R
Sbjct  200  EMDIGYNQR-MRDFNSQMPFAFRVQPIQPNPQER  232



>gb|ABQ51323.1| B-class MADS-box protein PI [Carica papaya]
Length=210

 Score =   262 bits (669),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 135/214 (63%), Positives = 167/214 (78%), Gaps = 7/214 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIEN SNRQVT+SKRRNG++KKAKEI+VLCDARVS+IIF SSGKMHE+ S 
Sbjct  1    MGRGKIEIKRIENLSNRQVTYSKRRNGIIKKAKEITVLCDARVSLIIFASSGKMHEYCSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             +SL ++LD+YHK    RLWDAKHENL NEI R+KKENDNMQIELRHL+GEDI+SLN+R+
Sbjct  61   STSLTNMLDEYHKAGKPRLWDAKHENLNNEIERVKKENDNMQIELRHLRGEDITSLNHRD  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LM LE+ L+ GL S+  KQMEV + + +     + + EEN +LS+ L+Q EIA  N +  
Sbjct  121  LMALEETLETGLASVRNKQMEVLKMMRR---NEKILEEENRRLSFALQQQEIAIEN-SAR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
            EM   + QR   +Y + MPF F VQP+QPNLQDR
Sbjct  177  EMENGYQQR-MREYNAHMPFAFRVQPIQPNLQDR  209



>emb|CAD32764.1| PISTILLATA homologue [Betula pendula]
Length=211

 Score =   262 bits (669),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 134/214 (63%), Positives = 168/214 (79%), Gaps = 6/214 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENSSNRQVT+SKR  G++KKAKEIS+LCDA+V ++IF SSGKM E+ S 
Sbjct  1    MGRGKIEIKRIENSSNRQVTYSKRMKGIIKKAKEISILCDAKVPLVIFDSSGKMKEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  L++ILD YHK + KRLWDAKHENL NEI RIKKENDNMQIELRH+KGEDI+SLN+RE
Sbjct  61   STTLINILDMYHKRSEKRLWDAKHENLSNEIARIKKENDNMQIELRHMKGEDITSLNHRE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LMILE+ALQNG  SI E+QM++   L +   + + + EEN+ L++ L Q ++A    +  
Sbjct  121  LMILEEALQNGHSSIRERQMDL---LMRARKKDKILEEENKCLNFTLHQQQMAMEAASCR  177

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
            ++ + + QR   DY SQMPF F VQP+QPNLQDR
Sbjct  178  DVEDDYEQR-VRDYNSQMPFAFRVQPIQPNLQDR  210



>dbj|BAG68951.1| PISTILLATA like protein [Hydrangea macrophylla]
Length=212

 Score =   262 bits (669),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 135/215 (63%), Positives = 172/215 (80%), Gaps = 7/215 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIEN+SNRQVT+SKRRNG+LKKAKEI+VLCDA VS+I+  SSGKMHE+ S 
Sbjct  1    MGRGKIEIKRIENTSNRQVTYSKRRNGILKKAKEITVLCDASVSLIVSASSGKMHEYCSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             ++L+DILD+YH  +GKRLWDAKHENL NEI+RIKKENDNMQIELRHLKGED++SLN++E
Sbjct  61   KTTLIDILDKYHTQSGKRLWDAKHENLSNEIDRIKKENDNMQIELRHLKGEDVTSLNHKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LM LE AL+NGL SI +++ EV+  + K   + Q + ++N++L Y L Q E+  M  N+ 
Sbjct  121  LMALELALENGLASIRDRKDEVFETIKKNV-KIQALEDDNKRLIYELHQQEM-NMECNVR  178

Query  671  EMGEVFNQRESNDYES-QMPFTFSVQPMQPNLQDR  772
            EM   + +    DY+S QMPF F VQP+QPNLQ+R
Sbjct  179  EMENGYQR--VGDYQSHQMPFAFRVQPIQPNLQER  211



>gb|AEM60210.1| MADS box transcription factor, partial [Gardenia jasminoides]
Length=202

 Score =   261 bits (667),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 131/206 (64%), Positives = 163/206 (79%), Gaps = 7/206 (3%)
 Frame = +2

Query  161  KRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSSS--LVDIL  334
            KRIENSSNRQVT+SKRRNG++KKAKEI+VLCDA+VS+IIFG+SGKMHE+ S S  L ++L
Sbjct  1    KRIENSSNRQVTYSKRRNGIMKKAKEITVLCDAKVSLIIFGTSGKMHEYISPSTNLTEML  60

Query  335  DQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRELMILEDAL  514
            D Y + TGK+LWDAKHENL NEI+R+KKEND+MQIELRHLKGEDISSLNY+ELM+LEDAL
Sbjct  61   DAYQRSTGKKLWDAKHENLSNEIDRVKKENDSMQIELRHLKGEDISSLNYKELMVLEDAL  120

Query  515  QNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLGEMGEVFNQ  694
            +NGL S+ +KQ E+ + + K     Q + EEN++L Y   Q E+A M   + E  +V+ +
Sbjct  121  ENGLASLRDKQSEIVKMMRK---NGQMLEEENKELQYIWHQQEMATMKGAVAERDDVYQR  177

Query  695  RESNDYESQMPFTFSVQPMQPNLQDR  772
                DY SQMPF F VQPMQPNL +R
Sbjct  178  --VRDYPSQMPFAFRVQPMQPNLHER  201



>ref|XP_007161433.1| hypothetical protein PHAVU_001G068200g [Phaseolus vulgaris]
 gb|ESW33427.1| hypothetical protein PHAVU_001G068200g [Phaseolus vulgaris]
Length=208

 Score =   261 bits (667),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 137/214 (64%), Positives = 173/214 (81%), Gaps = 9/214 (4%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEF--S  310
            MGRG+IEIKRIENSSNRQVT+SKR+NG+LKKAKEI+VLCDA+VS+IIF +SGKMH++   
Sbjct  1    MGRGKIEIKRIENSSNRQVTYSKRKNGILKKAKEITVLCDAQVSLIIFAASGKMHDYISP  60

Query  311  SSSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S++L+DIL++YHK +GKRLWDAKHENL +EI R+KKEND+MQIELRHLKGEDI+SLNY+E
Sbjct  61   STTLIDILERYHKTSGKRLWDAKHENLNSEIERLKKENDSMQIELRHLKGEDINSLNYKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LM LEDAL+ GL S+ EKQM+V+R + +R D+   + EEN +L++ L Q  +A       
Sbjct  121  LMALEDALETGLVSVREKQMDVYR-MFRRNDKI--LEEENRELNF-LWQQRLAVEGAREV  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
            E G  F++    DY S MPF F VQPMQPNLQ+R
Sbjct  177  ENG--FDE-SVRDYNSHMPFAFRVQPMQPNLQER  207



>dbj|BAK09618.2| MADS-box transcription factor [Cyclamen persicum]
Length=206

 Score =   261 bits (667),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 133/215 (62%), Positives = 171/215 (80%), Gaps = 13/215 (6%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIENS+NRQVT+SKRRNG++KKAKEISVLCDA+VS++IF SSGKMHE+ S 
Sbjct  1    MGRGKIEIKRIENSNNRQVTYSKRRNGIVKKAKEISVLCDAQVSLVIFASSGKMHEYVSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             SSL++ILD Y K +G RLWDAKHENL NEI RIKKENDNMQ ELRHLKGEDI+SL+++E
Sbjct  61   NSSLINILDAYQKQSGTRLWDAKHENLSNEIERIKKENDNMQNELRHLKGEDINSLHHKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRY-DQSQGVAEENEQLSYRLRQLEIAAMNRNL  667
            LM +EDAL+NGL  I E+QME++R   K + D+ + + +EN++L+Y++ Q+    M+   
Sbjct  121  LMSIEDALENGLTCIRERQMEIYRMAKKNFADKERLLEDENKRLTYQMHQV----MDMEG  176

Query  668  GEMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
            GEM   +       Y+ QMPF+F VQP+QPNL +R
Sbjct  177  GEMENEY------QYQPQMPFSFRVQPIQPNLHER  205



>gb|AAX13299.1| MADS box protein PIa [Lotus japonicus]
 gb|AFK35672.1| unknown [Lotus japonicus]
Length=208

 Score =   261 bits (666),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 135/214 (63%), Positives = 170/214 (79%), Gaps = 9/214 (4%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEF--S  310
            MGRG+IEIKRIENSSNRQVT+SKR+NG+LKKAKEI+VLCDA+VS+IIF +SGKMH++   
Sbjct  1    MGRGKIEIKRIENSSNRQVTYSKRKNGILKKAKEITVLCDAQVSLIIFAASGKMHDYISP  60

Query  311  SSSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S++LVD+L++YHK +GKRLWDAKHENL  EI R+KKEND MQIELRHLKG+DI+SLNY+E
Sbjct  61   STTLVDMLERYHKTSGKRLWDAKHENLNGEIERLKKENDGMQIELRHLKGDDINSLNYKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LM LE  L+NGL S+ EKQMEV+R + +R D+   + EEN +L++ L+Q       R+  
Sbjct  121  LMALEAGLENGLESVREKQMEVYR-VCRRNDKI--LEEENRELNFILQQRMAVEGARD--  175

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
                 F+Q    D+ SQMPF F VQPMQPNLQ+R
Sbjct  176  -ADNEFDQ-SVRDFNSQMPFAFRVQPMQPNLQER  207



>ref|XP_011002438.1| PREDICTED: floral homeotic protein PMADS 2-like isoform X1 [Populus 
euphratica]
Length=211

 Score =   260 bits (665),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 171/214 (80%), Gaps = 6/214 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIEN+SNRQVT+SKR+NG++KKAKEI+VLCDA+VS++IF SSG+MHE+ S 
Sbjct  1    MGRGKIEIKRIENASNRQVTYSKRKNGIIKKAKEITVLCDAQVSLVIFASSGRMHEYCSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             +++VD+LD+YHK +G+RLWDAKHENL  EI+RIKKEND+MQIELRHLKGEDISSL++ E
Sbjct  61   STTVVDLLDKYHKQSGQRLWDAKHENLSKEIDRIKKENDSMQIELRHLKGEDISSLHHTE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LM +E+AL  GL ++ +KQME    L +     + + EE ++L + L+Q E+ AM  N  
Sbjct  121  LMAIEEALDAGLAAVRKKQMEYHSMLEQ---NEKMLDEEFKRLQFVLQQQEM-AMGENAM  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
            EM   ++Q+   DY SQ+PF F VQP+QPNLQ+R
Sbjct  177  EMENAYHQQRVRDYNSQVPFAFRVQPIQPNLQER  210



>ref|NP_001241026.1| uncharacterized protein LOC100817554 [Glycine max]
 gb|ACU19623.1| unknown [Glycine max]
 gb|KHN05163.1| Floral homeotic protein GLOBOSA [Glycine soja]
Length=208

 Score =   260 bits (665),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 136/214 (64%), Positives = 171/214 (80%), Gaps = 9/214 (4%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEF--S  310
            MGRG+IEIKRIENSSNRQVT+SKR+NG+LKKAKEI+VLCDA+VS+IIF +SGKMH++   
Sbjct  1    MGRGKIEIKRIENSSNRQVTYSKRKNGILKKAKEITVLCDAQVSLIIFAASGKMHDYISP  60

Query  311  SSSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S++L+DIL++YHK +GKRLWDAKHENL  EI R+KKEND+MQIELRHLKG+DI+SLNY+E
Sbjct  61   STTLIDILERYHKTSGKRLWDAKHENLNGEIERLKKENDSMQIELRHLKGDDINSLNYKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LM LEDAL+ GL S+ EKQM+V+R L +R D+   + EEN +L++  +Q       R   
Sbjct  121  LMALEDALETGLVSVREKQMDVYRML-RRNDKI--LEEENRELNFLWQQRLAEEGAR---  174

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
            E+   F+Q    DY S MPF F VQPMQPNLQ+R
Sbjct  175  EVDNGFDQ-SVRDYNSHMPFAFRVQPMQPNLQER  207



>gb|AIC75373.1| MADS-box transcription factor GLOBOSA-like protein [Camellia 
sinensis]
Length=209

 Score =   260 bits (664),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 133/214 (62%), Positives = 173/214 (81%), Gaps = 8/214 (4%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIENS+NRQVT+SKRRNG++KKAKEI+VLCDA+VS++IF SSGKMHE+ S 
Sbjct  1    MGRGKIEIKRIENSNNRQVTYSKRRNGIMKKAKEITVLCDAQVSLVIFASSGKMHEYCSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             ++LVDILD+YHK +G+RLWDAKHENL  E++RIKKEND+MQIELRHLKGEDI+SL+++E
Sbjct  61   STTLVDILDKYHKQSGERLWDAKHENLSIELDRIKKENDSMQIELRHLKGEDITSLHHKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LM +E+AL+NGL S+ EKQME    + K     + + EEN+ L++ L Q E+   +    
Sbjct  121  LMAIEEALENGLGSVREKQMEYIDMMEK---NKKMLEEENKHLNFMLHQQEMNMESSR--  175

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
            EM   ++QR   D++SQMPF F VQP+QPNLQ+R
Sbjct  176  EMENGYHQR-VRDFQSQMPFAFRVQPIQPNLQER  208



>ref|XP_002300964.1| MADS-box family protein [Populus trichocarpa]
 gb|EEE80237.1| MADS-box family protein [Populus trichocarpa]
Length=211

 Score =   259 bits (663),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 131/215 (61%), Positives = 171/215 (80%), Gaps = 8/215 (4%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENSSNRQVT+SKRR+G++KKAKEI+VLCDA+VS++IF SSG+MHE+ S 
Sbjct  1    MGRGKIEIKRIENSSNRQVTYSKRRSGIIKKAKEITVLCDAQVSLVIFASSGRMHEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  +VD+LD+YHK +GKRLWDAKHENL NEI+RIKKEN++MQIELRHLKG+DISSL ++E
Sbjct  61   STTVVDLLDKYHKQSGKRLWDAKHENLSNEIDRIKKENESMQIELRHLKGQDISSLPHKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVA-EENEQLSYRLRQLEIAAMNRNL  667
            LM +E+AL  GL ++ +KQME    L    +Q++ +  EE + L + L+Q E+ AM  N 
Sbjct  121  LMAIEEALDTGLAAVRKKQMEFHSML----EQNEKILDEEFKHLQFVLQQQEM-AMEENA  175

Query  668  GEMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
             EM   ++Q+   DY SQ+P  F VQP+QPNLQ+R
Sbjct  176  MEMENAYHQQRVRDYNSQVPLAFRVQPIQPNLQER  210



>ref|XP_002307460.2| MADS-box family protein [Populus trichocarpa]
 gb|ABS71831.1| MADS box transcription factor [Populus deltoides]
 gb|EEE94456.2| MADS-box family protein [Populus trichocarpa]
Length=211

 Score =   259 bits (662),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 170/214 (79%), Gaps = 6/214 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIEN+SNRQVT+SKR+NG++KKAKEI+VLCDA+VS++IF SSG+MHE+ S 
Sbjct  1    MGRGKIEIKRIENASNRQVTYSKRKNGIIKKAKEITVLCDAQVSLVIFASSGRMHEYCSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             +++VD+LD+YHK +GKRLWDAKHENL  EI+RIKKEND+MQIELRHLKGEDISSL++ E
Sbjct  61   STTVVDLLDKYHKQSGKRLWDAKHENLSKEIDRIKKENDSMQIELRHLKGEDISSLHHTE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LM +E+AL  GL ++ +KQME    L +     + + EE ++L + L+Q E+ AM  N  
Sbjct  121  LMAIEEALDAGLAAVRKKQMEYHSMLEQ---NEKMLDEEFKRLQFVLQQQEM-AMGENAM  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
            EM   ++Q+   DY  Q+PF F VQP+QPNLQ+R
Sbjct  177  EMENAYHQQRMRDYNFQVPFAFRVQPIQPNLQER  210



>ref|NP_001235385.1| uncharacterized protein LOC100499997 [Glycine max]
 gb|ACU14549.1| unknown [Glycine max]
 gb|KHN38979.1| Floral homeotic protein GLOBOSA [Glycine soja]
Length=208

 Score =   258 bits (660),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 134/214 (63%), Positives = 170/214 (79%), Gaps = 9/214 (4%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEF--S  310
            MGRG+IEIKRIENSSNRQVT+SKR+NG+LKKAKEI+VLCDA+VS+IIF +SGKMH++   
Sbjct  1    MGRGKIEIKRIENSSNRQVTYSKRKNGILKKAKEITVLCDAQVSLIIFAASGKMHDYISP  60

Query  311  SSSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S++L+DIL++Y K +GKR+WDAKHENL  EI R+KKEND+MQIELRHLKGEDI+SLNY+E
Sbjct  61   STTLIDILERYQKTSGKRIWDAKHENLNGEIERLKKENDSMQIELRHLKGEDINSLNYKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LM LEDAL+ GL S+ EKQM+V+R + +R D+   + EEN +L++  +Q       R   
Sbjct  121  LMALEDALETGLVSVREKQMDVYR-MFRRNDKI--LEEENRELTFLWQQRLAVEGAR---  174

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
            E+   F+Q    DY S MPF F VQPMQPNLQ+R
Sbjct  175  EVDNGFDQ-SVRDYNSHMPFAFRVQPMQPNLQER  207



>ref|XP_011027463.1| PREDICTED: floral homeotic protein PMADS 2-like isoform X2 [Populus 
euphratica]
Length=211

 Score =   258 bits (660),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 131/215 (61%), Positives = 170/215 (79%), Gaps = 8/215 (4%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENSSNRQVTFSKRR+G++KKAKEI+VLCDA+VS++IF SSG+MHE+ S 
Sbjct  1    MGRGKIEIKRIENSSNRQVTFSKRRSGIIKKAKEITVLCDAQVSLVIFASSGRMHEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  +VD+LD+Y K +GKRLWDAKHENL NEI+RIKKEN++MQIELRHLKG+DISSL ++E
Sbjct  61   STTVVDLLDKYQKQSGKRLWDAKHENLSNEIDRIKKENESMQIELRHLKGQDISSLPHKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVA-EENEQLSYRLRQLEIAAMNRNL  667
            LM +E+ L  GL ++ +KQME    L    +Q++ +  EE + L + L+Q E+ AM  N 
Sbjct  121  LMAIEEVLDTGLAAVRKKQMEFHSML----EQNEKILDEEFKHLQFVLQQQEM-AMEENA  175

Query  668  GEMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
             EM   ++Q+   DY SQ+PF F VQP+QPNLQ+R
Sbjct  176  MEMENAYHQQRVRDYNSQVPFAFRVQPIQPNLQER  210



>gb|AGA61772.1| pistillata, partial [Cornus alba]
Length=204

 Score =   258 bits (659),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 132/208 (63%), Positives = 167/208 (80%), Gaps = 7/208 (3%)
 Frame = +2

Query  155  EIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS--SSLVD  328
            EIKRIENSSNRQVT+SKRRNG++KKAKEI+VLCDA VS++IFGSSGKMHE+ S  ++L+D
Sbjct  1    EIKRIENSSNRQVTYSKRRNGIMKKAKEITVLCDAHVSLVIFGSSGKMHEYCSPATTLID  60

Query  329  ILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRELMILED  508
            ILD+YHK +GKRLWDAKHENL NEI+RIKKE  +MQIELRHLKGEDI+SL+Y+ELM +E+
Sbjct  61   ILDRYHKQSGKRLWDAKHENLSNEIDRIKKEXXSMQIELRHLKGEDITSLHYKELMAIEE  120

Query  509  ALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLGEMGEVF  688
            AL+NGL S  EKQ E+ R + K     + + EE +QL+Y+L + E   M+ N+ EM   +
Sbjct  121  ALENGLTSNREKQREIIRMMKK---NEKMLEEEYKQLTYQLHKQEF-MMDGNVREMENGY  176

Query  689  NQRESNDYESQMPFTFSVQPMQPNLQDR  772
             QR   D++ QMPF F +QP+QPNLQDR
Sbjct  177  QQR-VRDFQPQMPFAFRLQPIQPNLQDR  203



>gb|AIC75374.1| MADS-box transcription factor GLOBOSA-like protein [Camellia 
sinensis]
Length=208

 Score =   258 bits (658),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 131/214 (61%), Positives = 168/214 (79%), Gaps = 9/214 (4%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIE++SNRQVT+SKRRNG+LKKAKEI+VLCDA+VS+++FGSSGKMHEF S 
Sbjct  1    MGRGKIEIKRIEDTSNRQVTYSKRRNGILKKAKEITVLCDAKVSLVVFGSSGKMHEFCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  LVDIL++YH+ +GKRLWDAKHENL NE++RIKKEND++QIELRHLKGEDI+SL  R+
Sbjct  61   STTLVDILEKYHQQSGKRLWDAKHENLSNELDRIKKENDSLQIELRHLKGEDITSLQPRD  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LM +E+ L+ GL S+  KQ E+ R +       + + E+N+QL+  L Q E+   +R L 
Sbjct  121  LMAIENTLETGLESVRYKQSEIHRMMKI---NGKMLEEDNKQLNLILHQQEMERESREL-  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
               E    R+ NDY+ QMPFTF VQP+QPNL +R
Sbjct  177  ---ENGYHRQVNDYQPQMPFTFRVQPIQPNLHER  207



>ref|XP_011002439.1| PREDICTED: floral homeotic protein PMADS 2-like isoform X2 [Populus 
euphratica]
Length=210

 Score =   257 bits (657),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 128/214 (60%), Positives = 169/214 (79%), Gaps = 7/214 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIEN+SNRQVT+SKR+NG++KKAKEI+VLCDA+VS++IF SSG+MHE+ S 
Sbjct  1    MGRGKIEIKRIENASNRQVTYSKRKNGIIKKAKEITVLCDAQVSLVIFASSGRMHEYCSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             +++VD+LD+YHK +G+RLWDAKHENL  EI+RIKKEND+MQIELRHLKGEDISSL++ E
Sbjct  61   STTVVDLLDKYHKQSGQRLWDAKHENLSKEIDRIKKENDSMQIELRHLKGEDISSLHHTE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LM +E+AL  GL ++ +KQME    L +     + + EE ++L + L+Q    AM  N  
Sbjct  121  LMAIEEALDAGLAAVRKKQMEYHSMLEQ---NEKMLDEEFKRLQFVLQQE--MAMGENAM  175

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
            EM   ++Q+   DY SQ+PF F VQP+QPNLQ+R
Sbjct  176  EMENAYHQQRVRDYNSQVPFAFRVQPIQPNLQER  209



>ref|XP_006434290.1| hypothetical protein CICLE_v10002422mg [Citrus clementina]
 gb|ESR47530.1| hypothetical protein CICLE_v10002422mg [Citrus clementina]
Length=219

 Score =   256 bits (655),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 134/221 (61%), Positives = 172/221 (78%), Gaps = 12/221 (5%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIEN SNRQVT+SKRRNG++KKAKEI+VLCDA+VS+IIF +SGKMH++SS+
Sbjct  1    MGRGKIEIKRIENLSNRQVTYSKRRNGLIKKAKEIAVLCDAKVSLIIFATSGKMHDYSSA  60

Query  317  SLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRELM  496
             + +IL+ YHK +GK+LWDAKHENL NEI+RIKKEND+MQI+LRHLKGED++SLN++ELM
Sbjct  61   PMFEILEAYHKQSGKKLWDAKHENLYNEIDRIKKENDSMQIKLRHLKGEDVTSLNHKELM  120

Query  497  ILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIA--------A  652
             LEDAL+NGL  I +KQ EV   + K     + + EE+  L Y LRQ EIA        A
Sbjct  121  ALEDALENGLTGIRDKQSEVMERMRK---NGKMLEEEHNYLKYVLRQQEIAKQQQQQQMA  177

Query  653  MNRNLGEMGE-VFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
            +  N+ E+    ++QRE++ Y S MP  F VQP+QPNLQ+R
Sbjct  178  LENNVREIDPNGYHQRENDGYSSHMPLAFRVQPIQPNLQER  218



>gb|AGL09298.1| pistillata [Populus tomentosa]
Length=211

 Score =   256 bits (654),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 126/214 (59%), Positives = 169/214 (79%), Gaps = 6/214 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIEN+SNRQVT+SKR+NG++KKA+EI+VLCDA+VS++IF SSG+MHE+ S 
Sbjct  1    MGRGKIEIKRIENASNRQVTYSKRKNGIIKKAREITVLCDAQVSLVIFASSGRMHEYCSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             +++VD+LD+YHK +GKRLWDAKHENL  EI+R+KKEND+MQIELRHLKGEDISSL++ E
Sbjct  61   STTVVDLLDKYHKQSGKRLWDAKHENLSKEIDRVKKENDSMQIELRHLKGEDISSLHHTE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LM +E+AL  GL ++ +KQME    L +     + + EE + L + L+Q E+ AM  +  
Sbjct  121  LMAIEEALDAGLAAVRKKQMEYHSMLEQ---NEKMLDEEFKHLQFVLQQQEM-AMGESAM  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
            EM   ++Q+   DY  Q+PF F VQP+QPNLQ+R
Sbjct  177  EMENAYHQQRMRDYNFQVPFAFRVQPIQPNLQER  210



>ref|NP_001234075.1| TPI [Solanum lycopersicum]
 gb|ABG73411.1| TPI [Solanum lycopersicum]
Length=215

 Score =   256 bits (654),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 135/220 (61%), Positives = 173/220 (79%), Gaps = 14/220 (6%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIEN++NRQVT+SKRRNG++KKAKEI+VLC+A+VS+IIF SSGKMHE+ S 
Sbjct  1    MGRGKIEIKRIENTNNRQVTYSKRRNGIIKKAKEITVLCEAKVSLIIFASSGKMHEYCSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             +++ D+LD Y K +G+RLWDAKH NL NEI+RIKKEND+MQ++LRHLKGEDI+ L ++E
Sbjct  61   STTISDMLDGYQKASGRRLWDAKHGNLSNEIDRIKKENDSMQVKLRHLKGEDINQLTHKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMN----  658
            L+I+E+ALQNGL SIS KQ E+ R + ++ DQ     EEN+QL Y L Q E+ A+     
Sbjct  121  LIIMEEALQNGLSSISAKQSEILR-MVRKNDQIX--EEENKQLQYALHQKEMGAIGGSGN  177

Query  659  -RNLGEMGEVFNQRESNDYESQMPFTFSV-QPMQPNLQDR  772
             R + E  EV++QRE  DYE QMPF   V QPMQPNL +R
Sbjct  178  MRGIHE--EVYHQRE-RDYEYQMPFGLRVHQPMQPNLHER  214



>gb|AFN68766.1| PISTILLATA-like protein [Magnolia grandiflora]
Length=211

 Score =   255 bits (652),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 129/213 (61%), Positives = 166/213 (78%), Gaps = 6/213 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVT+SKRR G+LKKAKEI+VLCDA+VS++IF S+GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRGGILKKAKEITVLCDAQVSLVIFSSTGKMSEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  LV ILD+YHK  GK+LWDAKHE+L NE+ RIKKEND+M I+LRHLKGEDI+SL+ +E
Sbjct  61   STELVKILDRYHKSAGKKLWDAKHEHLSNELERIKKENDSMHIKLRHLKGEDITSLHPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+ALQNGL  +  KQME  + L K     + + EEN++LSY L+  +  AM+ N+ 
Sbjct  121  LIPIEEALQNGLACVRSKQMEYLKMLKK---NERCLEEENKRLSYILQHQQQLAMDVNVR  177

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQD  769
            EM   ++QRE  +Y  QMPF F VQP+QPNL +
Sbjct  178  EMDHGYHQRE-REYHPQMPFAFRVQPIQPNLHE  209



>ref|XP_006472853.1| PREDICTED: floral homeotic protein GLOBOSA-like [Citrus sinensis]
 gb|KDO80480.1| hypothetical protein CISIN_1g042044mg [Citrus sinensis]
Length=218

 Score =   256 bits (653),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 133/220 (60%), Positives = 172/220 (78%), Gaps = 11/220 (5%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIEN SNRQVT+SKRRNG++KKAKEI+VLCDA+VS+IIF +SGKMH++SS+
Sbjct  1    MGRGKIEIKRIENLSNRQVTYSKRRNGLIKKAKEIAVLCDAKVSLIIFATSGKMHDYSSA  60

Query  317  SLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRELM  496
             + +IL+ YHK +GK+LWDAKHENL NEI+RIKKEND+MQI+LRHLKGED++SLN++ELM
Sbjct  61   PMFEILEAYHKQSGKKLWDAKHENLYNEIDRIKKENDSMQIKLRHLKGEDVTSLNHKELM  120

Query  497  ILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIA-------AM  655
             LEDAL+NGL  I +KQ E+   + K     + + EE+  L Y LRQ EIA       A+
Sbjct  121  ALEDALENGLTGIRDKQSEMMERMRK---NGKMLEEEHNYLKYVLRQQEIAKQQQQQMAL  177

Query  656  NRNLGEMGE-VFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
              N+ E+    ++QRE++ Y S MP  F VQP+QPNLQ+R
Sbjct  178  ENNVREIDPNGYHQRENDGYSSHMPLAFRVQPIQPNLQER  217



>gb|ABD78321.1| Glo protein [Primula vulgaris]
Length=207

 Score =   255 bits (651),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 126/215 (59%), Positives = 169/215 (79%), Gaps = 12/215 (6%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIENS+NRQVT+SKRRNG++KKAKEISVLCDA+VS++IF +SGKMHE+ S 
Sbjct  1    MGRGKIEIKRIENSNNRQVTYSKRRNGIIKKAKEISVLCDAQVSLVIFANSGKMHEYCSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             + L++ILD Y K +G RLWDAKHENL NEI R+KKENDNMQIELRHLKGED+ SL+++E
Sbjct  61   KTPLINILDAYQKQSGNRLWDAKHENLSNEIERVKKENDNMQIELRHLKGEDVQSLHHKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRY-DQSQGVAEENEQLSYRLRQLEIAAMNRNL  667
            LM +E AL+NGL  + +++ME++R   + + D+ + + +EN  L+Y++  L    M+   
Sbjct  121  LMSIESALENGLACVRQREMEIYRMARENFADKERVLEDENRSLTYQMHHL---VMDIEG  177

Query  668  GEMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
            GE+   +N      Y+SQMPF+F VQP+QPNLQ+R
Sbjct  178  GELENGYN------YQSQMPFSFRVQPIQPNLQER  206



>gb|AFN68767.1| PISTILLATA-like protein [Magnolia grandiflora]
Length=210

 Score =   255 bits (651),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 130/213 (61%), Positives = 167/213 (78%), Gaps = 7/213 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVT+SKRR G+LKKAKEI+VLCDA+VS++IF S+GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRGGILKKAKEITVLCDAQVSLVIFSSTGKMSEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  LV ILD+YHK  GK+LWDAKHE+L NE+ RIKKEND+M I+LRHLKGEDI+SL+ +E
Sbjct  61   STELVKILDRYHKSAGKKLWDAKHEHLSNELERIKKENDSMHIKLRHLKGEDITSLHPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+ALQNGL  +  KQME  + L K     + + EEN++LSY L Q ++ AM+ N+ 
Sbjct  121  LIPIEEALQNGLACVRSKQMEYLKMLKK---NERCLEEENKRLSYILHQQQL-AMDVNVR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQD  769
            EM   ++QRE  +Y  QMPF F VQP+QPNL +
Sbjct  177  EMDHGYHQRE-REYHPQMPFAFRVQPIQPNLHE  208



>ref|XP_011027462.1| PREDICTED: floral homeotic protein PMADS 2-like isoform X1 [Populus 
euphratica]
Length=213

 Score =   255 bits (651),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 129/216 (60%), Positives = 170/216 (79%), Gaps = 8/216 (4%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIENSSNRQVTFSKRR+G++KKAKEI+VLCDA+VS++IF SSG+MHE+ S 
Sbjct  1    MGRGKIEIKRIENSSNRQVTFSKRRSGIIKKAKEITVLCDAQVSLVIFASSGRMHEYCSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             +++VD+LD+Y K +GKRLWDAKHENL NEI+RIKKEN++MQIELRHLKG+DISSL ++E
Sbjct  61   STTVVDLLDKYQKQSGKRLWDAKHENLSNEIDRIKKENESMQIELRHLKGQDISSLPHKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVA-EENEQLSYRL-RQLEIAAMNRN  664
            LM +E+ L  GL ++ +KQME    L    +Q++ +  EE + L + L +Q +  AM  N
Sbjct  121  LMAIEEVLDTGLAAVRKKQMEFHSML----EQNEKILDEEFKHLQFVLTQQQQEMAMEEN  176

Query  665  LGEMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
              EM   ++Q+   DY SQ+PF F VQP+QPNLQ+R
Sbjct  177  AMEMENAYHQQRVRDYNSQVPFAFRVQPIQPNLQER  212



>gb|AFN68742.1| PISTILLATA-like protein [Magnolia delavayi]
Length=211

 Score =   254 bits (650),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 130/214 (61%), Positives = 167/214 (78%), Gaps = 10/214 (5%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVT+SKRR G+LKKAKEI+VLCDA+VS++IF S+GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRGGILKKAKEITVLCDAQVSLVIFSSTGKMSEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  LV ILD+YHK  GK+LWDAKHE+L NE+ RIKKEND+MQI+LRHLKGED++SL+ +E
Sbjct  61   STELVKILDRYHKSAGKKLWDAKHEHLSNEVERIKKENDSMQIKLRHLKGEDLTSLHPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTK--RYDQSQGVAEENEQLSYRLRQLEIAAMNRN  664
            L+ +E+ALQNGL  +  KQME  + L K  RY     + EEN++LSY L+  +  AM+ N
Sbjct  121  LIPIEEALQNGLACVRSKQMEYLKMLKKNERY-----LEEENKRLSYILQHQQQLAMDVN  175

Query  665  LGEMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
            + EM   +++RE  +Y  QMPF F VQP+QPNL 
Sbjct  176  VREMDHGYHERE-REYHPQMPFAFRVQPIQPNLH  208



>emb|CAA56656.1| SLM2 [Silene latifolia subsp. alba]
Length=213

 Score =   254 bits (649),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 133/218 (61%), Positives = 169/218 (78%), Gaps = 12/218 (6%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIENS+NRQVT+SKRRNG++KKA EI+VLC+A+VS+IIF ++GKMH + S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRNGIIKKAGEITVLCEAKVSLIIFSNNGKMHAYHSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             +++ DILDQYHK++GKRLWDAKHENL NEI+R+KKENDNMQIELRHLKGEDI+SL Y +
Sbjct  61   ETAVEDILDQYHKISGKRLWDAKHENLSNEIDRVKKENDNMQIELRHLKGEDITSLPYPD  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LM LEDAL+NGL  + EKQME+++   K +   + + +EN QL+Y L + E   M+ N+ 
Sbjct  121  LMRLEDALENGLVGVREKQMEMYKLHKKNH---KMLEDENNQLAYMLHKQE---MDGNMR  174

Query  671  EM-GEVFNQRESNDYESQ---MPFTFSVQPMQPNLQDR  772
            EM   V +     DY  Q    P+ F VQPMQPNLQDR
Sbjct  175  EMEAGVCSNPSDRDYHYQNPIPPYGFRVQPMQPNLQDR  212



>gb|AFN68726.1| PISTILLATA-like protein [Magnolia grandis]
Length=211

 Score =   254 bits (648),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 128/212 (60%), Positives = 167/212 (79%), Gaps = 6/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRGRIEIKRIENS+NRQVT+SKRR G+LKKAKEI+VLCDA+VS++IF S+GKM E+ S 
Sbjct  1    MGRGRIEIKRIENSTNRQVTYSKRRGGILKKAKEITVLCDAQVSLVIFSSTGKMSEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  LV IL++YHK +GK+LWDAKHE+L NE+ RIKKEND+MQI+LRHLKGEDI+SL+ +E
Sbjct  61   STELVKILERYHKSSGKKLWDAKHEHLSNEVERIKKENDSMQIKLRHLKGEDINSLHPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+AL+NGL  +  KQM+  + L K     + + E+N++LSY L+  +  AM+ NL 
Sbjct  121  LIPIEEALENGLACVRSKQMQYLKRLKK---NERCLEEDNKRLSYILQHQQQLAMDVNLR  177

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
            EM   ++QRE  +Y  QMPF F VQP+QPNL 
Sbjct  178  EMDHGYHQRE-REYHPQMPFAFRVQPIQPNLH  208



>gb|AEM60216.1| MADS box transcription factor, partial [Lantana camara]
Length=187

 Score =   253 bits (646),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 150/189 (79%), Gaps = 5/189 (3%)
 Frame = +2

Query  212  NGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSSS--LVDILDQYHKLTGKRLWDAKHE  385
            NG++KKAKEISVLCDA VSVIIF SSGKMHEF S S  LVD+LDQYHKL+GKRLWDAKHE
Sbjct  1    NGIMKKAKEISVLCDAHVSVIIFASSGKMHEFCSPSTTLVDMLDQYHKLSGKRLWDAKHE  60

Query  386  NLENEINRIKKENDNMQIELRHLKGEDISSLNYRELMILEDALQNGLRSISEKQMEVWRN  565
             L+NEINR+KKEND+MQIELRHLKGEDIS+LNY+ELM+ E+AL+NG+ ++  KQME  R 
Sbjct  61   QLDNEINRVKKENDSMQIELRHLKGEDISTLNYKELMVSEEALENGISTLKAKQMEFVRM  120

Query  566  LTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLGEMGEVFNQRESNDYESQMPFTFSVQ  745
            + K    ++ + EEN+ L ++LRQL +  M  N+ E   V+  +   DYE+QMPF F VQ
Sbjct  121  MRK---HNEMMEEENQSLQFKLRQLHLDPMEENVMEAQAVYEHQAVADYEAQMPFAFRVQ  177

Query  746  PMQPNLQDR  772
            PMQPNLQ+R
Sbjct  178  PMQPNLQER  186



>gb|ABD78318.1| Glo-like protein [Primula vulgaris]
 gb|ABD78320.1| Glo protein [Primula vulgaris]
Length=207

 Score =   254 bits (648),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/215 (58%), Positives = 169/215 (79%), Gaps = 12/215 (6%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIENS+NRQVT+SKRRNG++KKAKEIS+LCDA+VS++IF +SGKMH++ S 
Sbjct  1    MGRGKIEIKRIENSNNRQVTYSKRRNGIIKKAKEISLLCDAQVSLVIFANSGKMHDYCSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             + L++ILD Y K +G RLWDAKHENL NEI R+KKENDNMQIELRHLKGED+ SL+++E
Sbjct  61   KTPLINILDAYQKQSGNRLWDAKHENLSNEIERVKKENDNMQIELRHLKGEDVQSLHHKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRY-DQSQGVAEENEQLSYRLRQLEIAAMNRNL  667
            LM +E AL+NGL  + +++ME++R   + + D+ + + +EN  L+Y++  L    M+   
Sbjct  121  LMSIESALENGLACVRQREMEIYRMARENFADKERVLEDENRSLTYQMHHL---VMDIEG  177

Query  668  GEMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
            GEM   +N      Y+SQMPF+F VQP+QPNLQ+R
Sbjct  178  GEMENGYN------YQSQMPFSFRVQPIQPNLQER  206



>gb|AFN68738.1| PISTILLATA-like protein [Magnolia championii]
 gb|AFN68747.1| PISTILLATA-like protein [Magnolia championii]
Length=211

 Score =   253 bits (647),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 130/213 (61%), Positives = 166/213 (78%), Gaps = 10/213 (5%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVT+SKRR G+LKKAKEI+VLCDA+VS++IF S+GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRGGILKKAKEITVLCDAQVSLVIFSSTGKMSEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  LV ILD+YHK  GK+LWDAKHE+L NE+ RIKKEND+MQI+LR LKGED++SL+ +E
Sbjct  61   STELVKILDRYHKSAGKKLWDAKHEHLSNEVERIKKENDSMQIKLRQLKGEDLTSLHPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTK--RYDQSQGVAEENEQLSYRLRQLEIAAMNRN  664
            L+ +E+ALQNGL  +  KQME  + L K  RY     + EEN++LSY L+  +  AM+ N
Sbjct  121  LIPIEEALQNGLACVRSKQMEYLKMLKKNERY-----LEEENKRLSYLLQHQQQLAMDVN  175

Query  665  LGEMGEVFNQRESNDYESQMPFTFSVQPMQPNL  763
            + EM   ++QRE  +Y  QMPF F VQP+QPNL
Sbjct  176  VREMDHGYHQRE-REYHPQMPFAFRVQPIQPNL  207



>gb|AIE44761.1| putative MADS-domain transcription factor PI [Liriodendron tulipifera]
Length=210

 Score =   253 bits (646),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 130/211 (62%), Positives = 167/211 (79%), Gaps = 7/211 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVT+SKRR G+LKKAKEI+VLCDA+VS++IF S+GK+ E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRGGILKKAKEITVLCDAQVSLVIFSSTGKISEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  LV ILD+Y K +GK+LWDAKHE+L NE+ RIKKEND+MQI+LRHLKGEDI+SL+ RE
Sbjct  61   STTLVKILDRYQKSSGKKLWDAKHEHLSNEVERIKKENDSMQIKLRHLKGEDITSLHPRE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+ALQNGL  +  KQME  + L K     + + EEN++LSY L Q ++ AM+ N  
Sbjct  121  LIPIEEALQNGLACVRSKQMEYLKMLKK---NERTLEEENKRLSYILHQQQL-AMDGNAR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNL  763
            EM   +NQRE  +Y  Q+PFTF +QP+QPNL
Sbjct  177  EMDHGYNQRE-REYHQQLPFTFRLQPIQPNL  206



>gb|AFN68739.1| PISTILLATA-like protein [Magnolia yunnanensis]
Length=211

 Score =   253 bits (646),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 127/212 (60%), Positives = 167/212 (79%), Gaps = 6/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRGRIEIKRIENS+NRQVT+SKRR G+LKKAKEI+VLCDA+VS++IF S+GKM E+ S 
Sbjct  1    MGRGRIEIKRIENSTNRQVTYSKRRGGILKKAKEITVLCDAQVSLVIFSSTGKMSEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  LV IL++YHK +GK+LWDAKHE+L NE+ RIKKEND+MQI+LRHLKGEDI+SL+ +E
Sbjct  61   STELVKILERYHKSSGKKLWDAKHEHLSNEVERIKKENDSMQIKLRHLKGEDINSLHPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+AL+NG+  +  KQM+  + L K     + + E+N++LSY L+  +  AM+ NL 
Sbjct  121  LIPIEEALENGIACVRSKQMQYLKRLKK---NERCLEEDNKRLSYILQHQQQLAMDVNLR  177

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
            EM   ++QRE  +Y  QMPF F VQP+QPNL 
Sbjct  178  EMDHGYHQRE-REYHPQMPFAFRVQPIQPNLH  208



>gb|AFN68724.1| PISTILLATA-like protein [Magnolia paenetalauma]
 gb|AFN68741.1| PISTILLATA-like protein [Magnolia odoratissima]
Length=211

 Score =   253 bits (646),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 130/213 (61%), Positives = 166/213 (78%), Gaps = 10/213 (5%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVT+SKRR G+LKKAKEI+VLCDA+VS++IF S+GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRGGILKKAKEITVLCDAQVSLVIFSSTGKMSEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  LV ILD+YHK  GK+LWDAKHE+L NE+ RIKKEND+MQI+LR LKGED++SL+ +E
Sbjct  61   STELVKILDRYHKSAGKKLWDAKHEHLSNEVERIKKENDSMQIKLRQLKGEDLTSLHPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTK--RYDQSQGVAEENEQLSYRLRQLEIAAMNRN  664
            L+ +E+ALQNGL  +  KQME  + L K  RY     + EEN++LSY L+  +  AM+ N
Sbjct  121  LIPIEEALQNGLACVRSKQMEYLKMLKKNERY-----LEEENKRLSYILQHQQQLAMDVN  175

Query  665  LGEMGEVFNQRESNDYESQMPFTFSVQPMQPNL  763
            + EM   ++QRE  +Y  QMPF F VQP+QPNL
Sbjct  176  VREMDHGYHQRE-REYHPQMPFAFRVQPIQPNL  207



>gb|AFN68748.1| PISTILLATA-like protein [Magnolia championii]
Length=210

 Score =   253 bits (645),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 131/214 (61%), Positives = 167/214 (78%), Gaps = 11/214 (5%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVT+SKRR G+LKKAKEI+VLCDA+VS++IF S+GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRGGILKKAKEITVLCDAQVSLVIFSSTGKMSEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  LV ILD+YHK  GK+LWDAKHE+L NE+ RIKKEND+MQI+LR LKGED++SL+ +E
Sbjct  61   STELVKILDRYHKSAGKKLWDAKHEHLSNEVERIKKENDSMQIKLRQLKGEDLTSLHPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTK--RYDQSQGVAEENEQLSYRLRQLEIAAMNRN  664
            L+ +E+ALQNGL  +  KQME  + L K  RY     + EEN++LSY L Q ++ AM+ N
Sbjct  121  LIPIEEALQNGLACVRSKQMEYLKMLKKNERY-----LEEENKRLSYLLHQQQL-AMDVN  174

Query  665  LGEMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
            + EM   ++QRE  +Y  QMPF F VQP+QPNL 
Sbjct  175  VREMDHGYHQRE-REYHPQMPFAFRVQPIQPNLH  207



>gb|AFN68755.1| PISTILLATA-like protein [Magnolia coco]
Length=211

 Score =   253 bits (645),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 130/214 (61%), Positives = 165/214 (77%), Gaps = 10/214 (5%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVT+SKRR G+LKKAKEI+VLCDA+VS++IF S+GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRGGILKKAKEITVLCDAQVSLVIFSSTGKMSEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  LV ILD+YHK  GK+LWDAKHE+L NE+ RIKKEND+MQI+LR LKGED++SL+ +E
Sbjct  61   STELVKILDRYHKSAGKKLWDAKHEHLSNEVERIKKENDSMQIKLRQLKGEDLTSLHPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTK--RYDQSQGVAEENEQLSYRLRQLEIAAMNRN  664
            L+ +E+ALQNGL  +  KQME  + L K  RY     + EEN++LSY L   +  AM+ N
Sbjct  121  LIPIEEALQNGLACVRSKQMEYLKMLKKNERY-----LEEENKRLSYILHHQQQLAMDVN  175

Query  665  LGEMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
            + EM   ++QRE  +Y  QMPF F VQP+QPNL 
Sbjct  176  VREMDHGYHQRE-REYHPQMPFAFRVQPIQPNLH  208



>gb|AEX10628.1| GLOBOSA, partial [Lophospermum atrosanguineum]
Length=197

 Score =   252 bits (643),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 157/199 (79%), Gaps = 12/199 (6%)
 Frame = +2

Query  203  KRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSSS--LVDILDQYHKLTGKRLWDA  376
            KRRNG++KKAKEISVLCDA+VSVIIF SSGKMHEF S S  LVD+LDQYHKL+GKRLWD 
Sbjct  1    KRRNGIMKKAKEISVLCDAQVSVIIFASSGKMHEFCSPSTTLVDMLDQYHKLSGKRLWDP  60

Query  377  KHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRELMILEDALQNGLRSISEKQMEV  556
            KHENL+NEINR+KKEND+MQIELRHLKGEDI++LNY+ELM+LE+AL+NG  ++  K+ME 
Sbjct  61   KHENLDNEINRVKKENDSMQIELRHLKGEDITTLNYKELMVLEEALENGTSALKNKRMEF  120

Query  557  WRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLGEMGEVFNQRESN-------DYE  715
             R + K    ++ V EEN+ L ++LRQL +  MN N+ E   V++  + +       DYE
Sbjct  121  VRMMRK---HNEMVEEENQSLQFKLRQLHLDPMNDNVMESQGVYDHHQHHHHHQGIADYE  177

Query  716  SQMPFTFSVQPMQPNLQDR  772
            +QMPF F VQPMQPNLQ+R
Sbjct  178  AQMPFAFRVQPMQPNLQER  196



>gb|AFN68740.1| PISTILLATA-like protein [Magnolia yunnanensis]
Length=210

 Score =   252 bits (644),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 128/212 (60%), Positives = 168/212 (79%), Gaps = 7/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRGRIEIKRIENS+NRQVT+SKRR G+LKKAKEI+VLCDA+VS++IF S+GKM E+ S 
Sbjct  1    MGRGRIEIKRIENSTNRQVTYSKRRGGILKKAKEITVLCDAQVSLVIFSSTGKMSEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  LV IL++YHK +GK+LWDAKHE+L NE+ RIKKEND+MQI+LRHLKGEDI+SL+ +E
Sbjct  61   STELVKILERYHKSSGKKLWDAKHEHLSNEVERIKKENDSMQIKLRHLKGEDINSLHPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+AL+NG+  +  KQM+  + L K     + + E+N++LSY L Q ++ AM+ NL 
Sbjct  121  LIPIEEALENGIACVRSKQMQYLKRLKK---NERCLEEDNKRLSYILHQQQL-AMDVNLR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
            EM   ++QRE  +Y  QMPF F VQP+QPNL 
Sbjct  177  EMDHGYHQRE-REYHPQMPFAFRVQPIQPNLH  207



>gb|AIC33048.1| flower development transporter PI [Chrysanthemum lavandulifolium]
Length=196

 Score =   251 bits (642),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 125/214 (58%), Positives = 167/214 (78%), Gaps = 21/214 (10%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIEN+SNRQVT+SKR+NG++KKAKEI+VLCDA VS++I+GSSGKM+E+ S 
Sbjct  1    MGRGKIEIKRIENTSNRQVTYSKRKNGIIKKAKEITVLCDANVSLVIYGSSGKMYEYCSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             ++L+D+LD+Y +L+G +LWDAKHENL+NEI+RIKKEN++MQIELRHLKGEDI+SLNY E
Sbjct  61   KTNLIDMLDRYQRLSGNKLWDAKHENLQNEIDRIKKENESMQIELRHLKGEDITSLNYEE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+  EDAL+NGL +I EK+ ++ + + K     Q + EEN+ L Y ++Q E+AAM     
Sbjct  121  LIAYEDALENGLTNIREKKDDIPKIMRK---HEQVLEEENKHLMYLVQQSEMAAM-----  172

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
                        DY++  PF+F VQPMQPNL +R
Sbjct  173  -----------GDYQAHEPFSFRVQPMQPNLHER  195



>gb|AFN68745.1| PISTILLATA-like protein [Magnolia officinalis subsp. biloba]
Length=211

 Score =   252 bits (643),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/212 (59%), Positives = 166/212 (78%), Gaps = 6/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVT+SKRR G+LKKAKEI+VLCDA+VS++IF S+GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRGGILKKAKEITVLCDAQVSLVIFSSTGKMSEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  LV ILD+YHK  G++LWDAKHE+L NE+ RIKKEND+MQI+LRHLKGED++SL+ +E
Sbjct  61   STELVKILDRYHKSAGQKLWDAKHEHLSNELERIKKENDSMQIKLRHLKGEDLTSLHPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+AL+NG+  +  KQME  + L K     + + EEN++LSY L+  +  AM+ N+ 
Sbjct  121  LIPIEEALENGIACVRSKQMEYLKMLKK---NERCLEEENKRLSYILQHQQQLAMDVNVR  177

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
            EM   ++QRE  +Y  QMPF F VQP+QPNL 
Sbjct  178  EMDHGYHQRE-REYHPQMPFAFRVQPIQPNLH  208



>gb|AFN68725.1| PISTILLATA-like protein [Magnolia grandis]
Length=211

 Score =   251 bits (642),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 127/211 (60%), Positives = 166/211 (79%), Gaps = 6/211 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVT+SKRR G+LKKAKEI+VLCDA+VS++IF S+GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRGGILKKAKEITVLCDAQVSLVIFSSTGKMSEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  LV IL++YHK  GK+LWDAKHE+L NE+ RIKKEND+MQI+LRHLKGEDI+SL+ +E
Sbjct  61   STELVKILERYHKSAGKKLWDAKHEHLNNEVERIKKENDSMQIKLRHLKGEDINSLHPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+AL+NGL  +  KQM+  + L K     + + E+N++LSY L+  +  AM+ NL 
Sbjct  121  LIPIEEALENGLACVRSKQMQYLKMLKK---NERCLEEQNKRLSYLLQHQQQLAMDVNLR  177

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNL  763
            EM   ++QRE  +Y  QMPF F VQP+QPNL
Sbjct  178  EMDHGYHQRE-REYHPQMPFAFRVQPIQPNL  207



>ref|XP_010677661.1| PREDICTED: floral homeotic protein PMADS 2-like [Beta vulgaris 
subsp. vulgaris]
Length=216

 Score =   251 bits (642),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 134/218 (61%), Positives = 166/218 (76%), Gaps = 9/218 (4%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVT+SKRRNG++KKA EI+VLCDA+VSV+IF ++GKMH ++S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRNGLIKKATEITVLCDAKVSVVIFANNGKMHAYNSP  60

Query  317  SLV--DILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S    DIL+ YH++T KRLWDAKHENL NEI+RIKKEN+N+QIELRHLKGED++SL Y E
Sbjct  61   STTVEDILESYHEITRKRLWDAKHENLSNEIDRIKKENENLQIELRHLKGEDVASLAYPE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQL-EIAAMNRNL  667
            LM LEDALQNG+  I +KQME++    K    +  + EE  QL+Y L  L +   M+ ++
Sbjct  121  LMRLEDALQNGIAGIRDKQMEIYAMHKK---NTTMLEEEENQLNYMLHCLHKQEIMDADI  177

Query  668  GEM-GEVFNQR-ESNDYE-SQMPFTFSVQPMQPNLQDR  772
             EM G V N   E  DY   QMPF F VQPMQPNLQ+R
Sbjct  178  REMNGSVCNNTAEERDYHYHQMPFGFRVQPMQPNLQER  215



>gb|AFN68733.1| PISTILLATA-like protein [Magnolia figo]
Length=211

 Score =   251 bits (642),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/212 (59%), Positives = 165/212 (78%), Gaps = 6/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVT+SKRR G+LKKAKEI+VLCDA+VS++IF S+GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRGGILKKAKEITVLCDAQVSLVIFSSTGKMSEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  LV+ILD+YHK  GK+LWDAKHE+L NE+ RIKKEND+M ++LRHLKGEDI+SL+ +E
Sbjct  61   STELVNILDRYHKSAGKKLWDAKHEHLSNELERIKKENDSMHVKLRHLKGEDITSLHPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+AL+NGL  +  +QM+  + L K     + + EEN +LSY L+  +  AM+ N+ 
Sbjct  121  LIPIEEALENGLACVRSRQMQCLKMLKK---NERSLEEENRRLSYILQHQQQLAMDVNVR  177

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
            EM   ++QRE  +Y  QMPF F VQP+QPNL 
Sbjct  178  EMDHGYHQRE-REYHPQMPFAFRVQPIQPNLH  208



>gb|AFN68746.1| PISTILLATA-like protein [Magnolia officinalis subsp. biloba]
Length=210

 Score =   251 bits (641),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 127/212 (60%), Positives = 167/212 (79%), Gaps = 7/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVT+SKRR G+LKKAKEI+VLCDA+VS++IF S+GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRGGILKKAKEITVLCDAQVSLVIFSSTGKMSEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  LV ILD+YHK  G++LWDAKHE+L NE+ RIKKEND+MQI+LRHLKGED++SL+ +E
Sbjct  61   STELVKILDRYHKSAGQKLWDAKHEHLSNELERIKKENDSMQIKLRHLKGEDLTSLHPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+AL+NG+  +  KQME  + L K     + + EEN++LSY L Q ++ AM+ N+ 
Sbjct  121  LIPIEEALENGIACVRSKQMEYLKMLKK---NERCLEEENKRLSYILHQQQL-AMDVNVR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
            EM   ++QRE  +Y  QMPF F VQP+QPNL 
Sbjct  177  EMDHGYHQRE-REYHPQMPFAFRVQPIQPNLH  207



>gb|KCW72539.1| hypothetical protein EUGRSUZ_E01006 [Eucalyptus grandis]
Length=208

 Score =   251 bits (641),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 134/215 (62%), Positives = 169/215 (79%), Gaps = 11/215 (5%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVT+SKRRNG++KKAKEISVLCDA+VSVIIFGSSGKMHE+ SS
Sbjct  1    MGRGKIEIKRIENSNNRQVTYSKRRNGLIKKAKEISVLCDAQVSVIIFGSSGKMHEYCSS  60

Query  317  --SLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
              SLVDILDQYH   GKRLWDAK ENL NE++RIKKENDN+QI+LRHLKGEDI+SLN+RE
Sbjct  61   NTSLVDILDQYHTQCGKRLWDAKQENLSNELDRIKKENDNLQIQLRHLKGEDITSLNHRE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ILED L+NGL  + +++ EV   +T R +Q Q + E+ ++L +  +Q ++  M    G
Sbjct  121  LIILEDTLENGLGCVRDQKDEVL--MTHRRNQKQ-LEEDAKELHFYAQQKDM--MMAETG  175

Query  671  EMG-EVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
              G + ++QR   D+    P T+ VQP+QPNLQ R
Sbjct  176  RAGNDGYHQRMKADFG---PSTYHVQPIQPNLQRR  207



>ref|XP_008219575.1| PREDICTED: floral homeotic protein PMADS 2 [Prunus mume]
Length=210

 Score =   251 bits (640),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 126/214 (59%), Positives = 169/214 (79%), Gaps = 7/214 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENSSNRQVT+SKRRNG++KKAKEI+VLCDA+VS++IF SSGKM E+ S 
Sbjct  1    MGRGKIEIKRIENSSNRQVTYSKRRNGIIKKAKEITVLCDAKVSLVIFASSGKMVEYCSP  60

Query  317  SLV--DILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S+   DILD+YH   GK+LWDAKHENL NE++R+KK+ND+MQ+ELRHLKGEDI+SL ++E
Sbjct  61   SVTVTDILDKYHGQAGKKLWDAKHENLSNEVDRVKKDNDSMQVELRHLKGEDITSLTHKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LM LEDAL+NGL SI +K+ +    L    +  + + EE+++L+Y L + E+  +  N+ 
Sbjct  121  LMALEDALENGLASIRDKKSKFVDILR---ENERALEEEHKRLTYELHKQEM-KIEENVR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
            E+   ++QR  N Y +Q+PF F VQP+QPNLQ+R
Sbjct  177  ELENGYHQRLGN-YNNQIPFAFRVQPIQPNLQER  209



>gb|AAC42576.1| PISTILLATA homolog SvPI-1 [Syringa vulgaris]
Length=200

 Score =   250 bits (638),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 124/201 (62%), Positives = 155/201 (77%), Gaps = 6/201 (3%)
 Frame = +2

Query  182  NRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSSS--LVDILDQYHKLT  355
            NRQVT+S+RRNG++KKAKEISVLCDA+VSV+IF SSGKMHEF S S  L+D+LDQYHKL+
Sbjct  1    NRQVTYSERRNGLMKKAKEISVLCDAQVSVVIFASSGKMHEFCSPSTTLIDMLDQYHKLS  60

Query  356  GKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRELMILEDALQNGLRSI  535
            GK+LWDAKHE+L+NEINRIKKEND MQ ELRHL GEDI++LNY+ELM+LE+ L+NG+ S+
Sbjct  61   GKKLWDAKHEHLDNEINRIKKENDRMQTELRHLVGEDITTLNYKELMVLEEVLENGISSL  120

Query  536  SEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAM--NRNLGEMGEVFNQRESND  709
              KQME    + K  +   G       L ++LRQ+ +       N+ E G+V++Q+   D
Sbjct  121  KAKQMEFVPAMRKHNEMLGG--RRTGGLQFKLRQMHLDPTMDEHNVLENGDVYHQQGVGD  178

Query  710  YESQMPFTFSVQPMQPNLQDR  772
            YE QMPF F VQPMQPNLQDR
Sbjct  179  YEYQMPFAFRVQPMQPNLQDR  199



>gb|ABP01801.1| MADS transcription factor PI [Aquilegia vulgaris]
Length=210

 Score =   250 bits (639),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 125/215 (58%), Positives = 168/215 (78%), Gaps = 11/215 (5%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIENS+NRQVT+SKRRNG+LKKA+EI +LC A ++++IF S+GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRNGILKKAREIHILCGAEIALVIFSSTGKMSEYISP  60

Query  314  ---SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNY  484
               ++L+ ILD+Y K +GK+LWDAKHE L +E++RIKKENDNMQIELRHLKGEDI+SLN 
Sbjct  61   PGPTTLIKILDKYQKTSGKKLWDAKHEYLSSELDRIKKENDNMQIELRHLKGEDINSLNA  120

Query  485  RELMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRN  664
            +EL+ +E+ALQNGL  + +K+ ++WR + K    +  + EEN++LSY L  LEI   +R 
Sbjct  121  KELIPIEEALQNGLSKVRDKKSDIWRMMRK---NTGLLEEENKRLSYHLHSLEIGGNDR-  176

Query  665  LGEMGEVFNQRESNDYESQMPFTFSVQPMQPNLQD  769
              EM   ++Q+   DY +QMPFTF VQP+QPNLQ+
Sbjct  177  --EMENGYHQK-GRDYPAQMPFTFRVQPIQPNLQE  208



>ref|NP_001289656.1| floral homeotic protein GLOBOSA-like [Eucalyptus grandis]
 gb|AAC78283.1| MADS box protein [Eucalyptus grandis]
Length=208

 Score =   250 bits (638),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 133/215 (62%), Positives = 169/215 (79%), Gaps = 11/215 (5%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVT+SKRRNG++KKAKEISVLCDA+VSVIIFGSSGKMHE+ SS
Sbjct  1    MGRGKIEIKRIENSNNRQVTYSKRRNGLIKKAKEISVLCDAQVSVIIFGSSGKMHEYCSS  60

Query  317  --SLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
              SLVDILDQYH   GKRLWDAK ENL NE++RIKKENDN+QI+LRHLKGEDI+SLN+RE
Sbjct  61   NTSLVDILDQYHTQCGKRLWDAKQENLSNELDRIKKENDNLQIQLRHLKGEDITSLNHRE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ILED L+NG+  + +++ EV   +T R +Q Q + E+ ++L +  +Q ++  M    G
Sbjct  121  LIILEDTLENGVGCVRDQKDEVL--MTHRRNQKQ-LEEDAKELHFYAQQKDM--MMAETG  175

Query  671  EMG-EVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
              G + ++QR   D+    P T+ VQP+QPNLQ R
Sbjct  176  RAGNDGYHQRMKADFG---PSTYHVQPIQPNLQRR  207



>ref|XP_009358735.1| PREDICTED: floral homeotic protein PMADS 2 [Pyrus x bretschneideri]
Length=215

 Score =   250 bits (639),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 124/217 (57%), Positives = 171/217 (79%), Gaps = 8/217 (4%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIENSSNRQVT+SKRRNG++KKAKEI+VLCDA+VS+II+ SSGKM E+ S 
Sbjct  1    MGRGKIEIKRIENSSNRQVTYSKRRNGIIKKAKEITVLCDAKVSLIIYSSSGKMVEYCSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             ++L +ILD+YH  +GK+LWDAKHENL NE++R+KK+ND+MQ+ELRHLKGEDI+SLN+ E
Sbjct  61   STTLTEILDKYHGQSGKKLWDAKHENLSNEVDRVKKDNDSMQVELRHLKGEDITSLNHVE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LM LE+AL+NGL SI +KQ +    +    D  + + +EN++L+Y L++ +   +  N+ 
Sbjct  121  LMALEEALENGLTSIRDKQSKFVDMMR---DNGKALEDENKRLTYELQKQQEMKIGENVR  177

Query  671  EMGEVFNQRESNDY---ESQMPFTFSVQPMQPNLQDR  772
             M   ++QR+  +Y   + Q+PF F VQP+QPNLQ+R
Sbjct  178  NMENGYHQRQLGNYNNTQQQIPFAFRVQPIQPNLQER  214



>gb|AGA61767.1| pistillata, partial [Cornus florida]
Length=195

 Score =   249 bits (637),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 161/199 (81%), Gaps = 7/199 (4%)
 Frame = +2

Query  182  NRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSSS--LVDILDQYHKLT  355
            NRQVT+SKRRNG++KKAKEI+VLCDA VS++IF SSGKMHE+ S S  LVDI+D+YH  +
Sbjct  1    NRQVTYSKRRNGIMKKAKEITVLCDAHVSLVIFASSGKMHEYCSPSTKLVDIMDRYHTQS  60

Query  356  GKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRELMILEDALQNGLRSI  535
            GKRLWDAKHENL NEI+RIKKEND+MQIELRHLKGEDI+SL+Y+ELM +E+AL+NGL S 
Sbjct  61   GKRLWDAKHENLSNEIDRIKKENDSMQIELRHLKGEDITSLHYKELMAIEEALENGLTSN  120

Query  536  SEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLGEMGEVFNQRESNDYE  715
            SEKQ E+ R + K     + + EE + L+Y+L++ E+  M  NL EM + F+QR   D++
Sbjct  121  SEKQREIIRMMKK---NEKMLEEEYKHLTYQLQKQEL-VMEGNLREMEDGFHQR-LRDFQ  175

Query  716  SQMPFTFSVQPMQPNLQDR  772
             QMPF+F VQP+QPNLQDR
Sbjct  176  PQMPFSFRVQPIQPNLQDR  194



>gb|AFN68722.1| PISTILLATA-like protein [Magnolia crassipes]
 gb|AFN68729.1| PISTILLATA-like protein [Magnolia insignis]
 gb|AFN68751.1| PISTILLATA-like protein [Magnolia aromatica]
 gb|AFN68753.1| PISTILLATA-like protein [Magnolia rufibarbata]
Length=211

 Score =   250 bits (638),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 125/212 (59%), Positives = 165/212 (78%), Gaps = 6/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVT+SKRR G+LKKAKEI+VLCDA+VS++IF S+GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRGGILKKAKEITVLCDAQVSLVIFSSTGKMSEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  LV ILD+YHK  G +LWDAKHE+L NE+ RIKKEND+MQI+LRHLKGED++SL+ +E
Sbjct  61   STELVKILDRYHKSAGTKLWDAKHEHLSNELERIKKENDSMQIKLRHLKGEDLNSLHPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+AL+NGL  +  +QME  + L K     + + E+N++LSY L+  +  AM+ N+ 
Sbjct  121  LIPIEEALENGLACVRSRQMEYLKTLKK---NERCLEEQNKRLSYILQHQQQLAMDVNVR  177

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
            EM   ++QRE  +Y  QMPF F VQP+QPNL 
Sbjct  178  EMDHGYHQRE-REYHPQMPFAFRVQPIQPNLH  208



>gb|AFN68758.1| PISTILLATA-like protein [Magnolia hookeri]
Length=211

 Score =   250 bits (638),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 125/212 (59%), Positives = 165/212 (78%), Gaps = 6/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVT+SKRR G+LKKAKEI+VLCDA+VS++IF S+GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRGGILKKAKEITVLCDAQVSLVIFSSTGKMSEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  LV ILD+YHK  G +LWDAKHE+L NE+ RIKKEND+MQI+LRHLKGED++SL+ +E
Sbjct  61   STELVKILDRYHKSAGTKLWDAKHEHLSNELERIKKENDSMQIKLRHLKGEDLNSLHPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+AL+NGL  +  +QME  + L K     + + E+N++LSY L+  +  AM+ N+ 
Sbjct  121  LIPIEEALENGLACVRSRQMEYLKTLKK---NERCLEEDNKRLSYILQHQQQLAMDVNVR  177

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
            EM   ++QRE  +Y  QMPF F VQP+QPNL 
Sbjct  178  EMDHGYHQRE-REYHPQMPFAFRVQPIQPNLH  208



>gb|AGZ63863.1| PISTILLATA-like protein [Magnolia baillonii]
Length=211

 Score =   250 bits (638),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 125/212 (59%), Positives = 165/212 (78%), Gaps = 6/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVT+SKRR G+LKKAKEI+VLCDA+VS++IF S+GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRGGILKKAKEITVLCDAQVSLVIFSSTGKMSEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  LV+ILD+YHK  GK+LWDAKHE+L NE+ RIKKEND+M I+LRHLKGEDI+SL+ +E
Sbjct  61   STELVNILDRYHKSAGKKLWDAKHEHLSNELERIKKENDSMHIKLRHLKGEDITSLHPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+AL+NGL  +  +QM+  + L K     + + E+N +LSY L+  +  AM+ N+ 
Sbjct  121  LIPIEEALENGLACVRSRQMQYLKMLKK---NERSLEEDNRRLSYILQHQQQLAMDVNVR  177

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
            EM   ++QRE  +Y  QMPF F VQP+QPNL 
Sbjct  178  EMNHGYHQRE-REYHPQMPFAFRVQPIQPNLH  208



>gb|AAO22986.1| MADS-box transcription factor CDM86 [Chrysanthemum x morifolium]
Length=196

 Score =   249 bits (636),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 124/214 (58%), Positives = 166/214 (78%), Gaps = 21/214 (10%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MG G+IEIKRIEN+SNRQVT+SKR+NG++KKAKEI+VLCDA VS++I+GSSGKM+E+ S 
Sbjct  1    MGTGKIEIKRIENTSNRQVTYSKRKNGIIKKAKEITVLCDANVSLVIYGSSGKMYEYCSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             ++L+D+LD+Y +L+G +LWDAKHENL+NEI+RIKKEN++MQIELRHLKGEDI+SLNY E
Sbjct  61   KTNLIDMLDRYQRLSGNKLWDAKHENLQNEIDRIKKENESMQIELRHLKGEDITSLNYEE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+  EDAL+NGL +I EK+ ++ + + K     Q + EEN+ L Y ++Q E+AAM     
Sbjct  121  LIAYEDALENGLTNIREKKDDIPKIMRK---HEQVLEEENKHLMYLVQQSEMAAM-----  172

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
                        DY++  PF+F VQPMQPNL +R
Sbjct  173  -----------GDYQAHEPFSFRVQPMQPNLHER  195



>ref|NP_001280926.1| floral homeotic protein PMADS 2 [Malus domestica]
 emb|CAC28021.1| Pistillata MADS-box protein [Malus domestica]
Length=215

 Score =   250 bits (638),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 123/217 (57%), Positives = 171/217 (79%), Gaps = 8/217 (4%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG++EIKRIENSSNRQVT+SKRRNG++KKAKEI+VLCDA+VS+II+ SSGKM E+ S 
Sbjct  1    MGRGKVEIKRIENSSNRQVTYSKRRNGIIKKAKEITVLCDAKVSLIIYSSSGKMVEYCSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             ++L +ILD+YH  +GK+LWDAKHENL NE++R+KK+ND+MQ+ELRHLKGEDI+SLN+ E
Sbjct  61   STTLTEILDKYHGQSGKKLWDAKHENLSNEVDRVKKDNDSMQVELRHLKGEDITSLNHVE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LM LE+AL+NGL SI +KQ +    +    D  + + +EN++L+Y L++ +   +  N+ 
Sbjct  121  LMALEEALENGLTSIRDKQSKFVDMMR---DNGKALEDENKRLTYELQKQQEMKIKENVR  177

Query  671  EMGEVFNQRESNDY---ESQMPFTFSVQPMQPNLQDR  772
             M   ++QR+  +Y   + Q+PF F VQP+QPNLQ+R
Sbjct  178  NMENGYHQRQLGNYNNNQQQIPFAFRVQPIQPNLQER  214



>gb|AEW50207.1| PI [Acca sellowiana]
Length=208

 Score =   249 bits (637),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 135/215 (63%), Positives = 167/215 (78%), Gaps = 11/215 (5%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVT+SKRRNG++KKAKEISVLCDA+VSVIIFGSSGKMHE+ SS
Sbjct  1    MGRGKIEIKRIENSNNRQVTYSKRRNGLIKKAKEISVLCDAQVSVIIFGSSGKMHEYCSS  60

Query  317  --SLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
              SLVDILDQYH   GKRLWDAKHENL NE++RIKKENDN+QI LRHLKGEDI+SLN+RE
Sbjct  61   NTSLVDILDQYHTQCGKRLWDAKHENLSNELDRIKKENDNLQIRLRHLKGEDITSLNHRE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLE-IAAMNRNL  667
            L+ILED L+NGL  + +++ EV   +T R +Q Q + EE ++L +  +  + + A N   
Sbjct  121  LIILEDNLENGLACVRDQKDEVV--MTHRRNQKQ-LEEETKELHFYAQHRDMMMAENARA  177

Query  668  GEMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
            G  G  ++QR   D+ S     + VQP+QPNLQ R
Sbjct  178  GNDG--YHQRIKADFGSP---AYRVQPIQPNLQQR  207



>emb|CAC28022.1| Pistillata MADS-box protein [Malus domestica]
Length=215

 Score =   249 bits (637),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/217 (57%), Positives = 171/217 (79%), Gaps = 8/217 (4%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG++EIKRIENSSNRQVT+SKRRNG++KKAKEI+VLCDA+VS+II+ SSGKM E+ S 
Sbjct  1    MGRGKVEIKRIENSSNRQVTYSKRRNGIIKKAKEITVLCDAKVSLIIYSSSGKMVEYCSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             ++L +ILD+YH  +GK+LWDAKHENL NE++R+KK+ND+MQ+ELRHLKGEDI+SLN+ E
Sbjct  61   STTLTEILDKYHGQSGKKLWDAKHENLSNEVDRVKKDNDSMQVELRHLKGEDITSLNHVE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LM LE+AL+NGL SI +KQ +    +    D  + + +EN++L+Y L++ +   +  N+ 
Sbjct  121  LMALEEALENGLTSIRDKQSKFVDMMR---DNGKALEDENKRLTYELQKQQEMKIEENVR  177

Query  671  EMGEVFNQRESNDY---ESQMPFTFSVQPMQPNLQDR  772
             M   ++QR+  +Y   + Q+PF F VQP+QPNLQ+R
Sbjct  178  NMENGYHQRQLGNYNNNQQQIPFAFRVQPIQPNLQER  214



>gb|ADM72962.1| PISTILLATA-like protein 1 [Platanus x acerifolia]
 gb|ADM72963.1| PISTILLATA-like protein 1 [Platanus x acerifolia]
 gb|ADM72970.1| PISTILLATA-like protein 3 [Platanus x acerifolia]
Length=210

 Score =   249 bits (636),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/212 (59%), Positives = 164/212 (77%), Gaps = 7/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIEN +NRQVT+SKR+NG++KKA+E++VLCDA+V++IIF SSGKM E+ S 
Sbjct  1    MGRGKIEIKRIENLTNRQVTYSKRKNGIIKKARELTVLCDAKVNLIIFSSSGKMSEYHSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  + +ILD YHK +G+RLWDAKHE L NE++RIKKENDNMQIELRHLKGED++SL++++
Sbjct  61   SITMTEILDMYHKYSGQRLWDAKHEFLSNELDRIKKENDNMQIELRHLKGEDVNSLHHKD  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L  +E+ALQ GL  +  K+ME  + L K     + + EEN+ LSY L   E+ AMN N  
Sbjct  121  LQNIEEALQKGLSKVRAKEMEFLKTLKK---NEKNLEEENKHLSYMLHHQEM-AMNGNTR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
             M   ++Q+E  DY SQMPF F VQP+QPNLQ
Sbjct  177  AMENEYHQKER-DYHSQMPFNFRVQPIQPNLQ  207



>gb|AFN68759.1| PISTILLATA-like protein [Magnolia hookeri]
Length=210

 Score =   249 bits (636),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/212 (59%), Positives = 166/212 (78%), Gaps = 7/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVT+SKRR G+LKKAKEI+VLCDA+VS++IF S+GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRGGILKKAKEITVLCDAQVSLVIFSSTGKMSEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  LV ILD+YHK  G +LWDAKHE+L NE+ RIKKEND+MQI+LRHLKGED++SL+ +E
Sbjct  61   STELVKILDRYHKSAGTKLWDAKHEHLSNELERIKKENDSMQIKLRHLKGEDLNSLHPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+AL+NGL  +  +QME  + L K     + + E+N++LSY L Q ++ AM+ N+ 
Sbjct  121  LIPIEEALENGLACVRSRQMEYLKTLKK---NERCLEEDNKRLSYILHQQQL-AMDVNVR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
            EM   ++QRE  +Y  QMPF F VQP+QPNL 
Sbjct  177  EMDHGYHQRE-REYHPQMPFAFRVQPIQPNLH  207



>gb|AFN68723.1| PISTILLATA-like protein [Magnolia crassipes]
 gb|AFN68752.1| PISTILLATA-like protein [Magnolia aromatica]
 gb|AFN68754.1| PISTILLATA-like protein [Magnolia rufibarbata]
Length=210

 Score =   249 bits (636),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/212 (59%), Positives = 166/212 (78%), Gaps = 7/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVT+SKRR G+LKKAKEI+VLCDA+VS++IF S+GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRGGILKKAKEITVLCDAQVSLVIFSSTGKMSEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  LV ILD+YHK  G +LWDAKHE+L NE+ RIKKEND+MQI+LRHLKGED++SL+ +E
Sbjct  61   STELVKILDRYHKSAGTKLWDAKHEHLSNELERIKKENDSMQIKLRHLKGEDLNSLHPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+AL+NGL  +  +QME  + L K     + + E+N++LSY L Q ++ AM+ N+ 
Sbjct  121  LIPIEEALENGLACVRSRQMEYLKTLKK---NERCLEEQNKRLSYILHQQQL-AMDVNVR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
            EM   ++QRE  +Y  QMPF F VQP+QPNL 
Sbjct  177  EMDHGYHQRE-REYHPQMPFAFRVQPIQPNLH  207



>gb|ACY91890.1| MADS-domain transcription factor, partial [Ilex aquifolium]
Length=196

 Score =   249 bits (635),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 159/199 (80%), Gaps = 6/199 (3%)
 Frame = +2

Query  182  NRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS--SSLVDILDQYHKLT  355
            NRQVT+SKRRNG++KKAKEI+VLCDA+VS++IF SSGKMHE+ S  ++L+++LD+YH  +
Sbjct  1    NRQVTYSKRRNGIMKKAKEITVLCDAQVSLVIFASSGKMHEYCSPSTTLIEMLDRYHHAS  60

Query  356  GKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRELMILEDALQNGLRSI  535
            GK+LWDAKHENL NEI+R+KKEND+MQIELRHLKGEDI SL Y+ELM +EDAL+ GL  I
Sbjct  61   GKKLWDAKHENLSNEIDRVKKENDSMQIELRHLKGEDIQSLQYKELMAIEDALEIGLSGI  120

Query  536  SEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLGEMGEVFNQRESNDYE  715
              KQME+++  TK     Q + EEN++L   L Q E+AAM+ N+ E+   ++Q    DY+
Sbjct  121  RNKQMEIFKMKTKN---KQMLEEENQELISILHQHEMAAMDGNVREVQSGYHQT-VRDYQ  176

Query  716  SQMPFTFSVQPMQPNLQDR  772
            SQMPF F VQP+QPNLQDR
Sbjct  177  SQMPFAFRVQPIQPNLQDR  195



>gb|AFN68719.1| PISTILLATA-like protein [Michelia alba]
Length=211

 Score =   249 bits (635),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/212 (59%), Positives = 165/212 (78%), Gaps = 6/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVT+SKRR G+LKKAKEI+VLCDA+VS++IF S+GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRGGILKKAKEITVLCDAQVSLVIFSSTGKMSEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  LV+ILD+YHK  GK+LWDAKHE+L NE+ RIKKEND+M I+LRHLKGEDI+SL+ +E
Sbjct  61   STELVNILDRYHKSAGKKLWDAKHEHLSNELERIKKENDSMHIKLRHLKGEDITSLHPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+AL+NGL  +  +QM+  + L K     + + E+N +LSY L+  +  AM+ N+ 
Sbjct  121  LIPIEEALENGLACVRSRQMQYLKMLKK---NERSLEEDNRRLSYILQHQQQLAMDVNVR  177

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
            EM   ++QRE  +Y  QMPF F VQP+QPNL 
Sbjct  178  EMDHGYHQRE-REYHPQMPFGFRVQPIQPNLH  208



>gb|AFN68731.1| PISTILLATA-like protein [Magnolia insignis]
 gb|AFN68736.1| PISTILLATA-like protein [Magnolia fordiana]
 gb|AFN68756.1| PISTILLATA-like protein [Magnolia laevifolia]
Length=211

 Score =   249 bits (635),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/212 (58%), Positives = 165/212 (78%), Gaps = 6/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVT+SKRR G+LKKAKEI+VLCDA+VS++IF S+GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRGGILKKAKEITVLCDAQVSLVIFSSTGKMSEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  LV ILD+YHK  G +LWDAKHE+L NE+ RIKKEND+MQI+LRHLKGED++SL+ ++
Sbjct  61   STELVKILDRYHKSAGTKLWDAKHEHLSNELERIKKENDSMQIKLRHLKGEDLNSLHPKD  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+AL+NGL  +  +QME  + L K     + + E+N++LSY L+  +  AM+ N+ 
Sbjct  121  LIPIEEALENGLACVRSRQMEYLKTLKK---NERCLEEQNKRLSYILQHQQQLAMDVNVR  177

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
            EM   ++QRE  +Y  QMPF F VQP+QPNL 
Sbjct  178  EMDHGYHQRE-REYHPQMPFAFRVQPIQPNLH  208



>emb|CAA08804.1| MADS-box protein, GGLO1 [Gerbera hybrid cultivar]
Length=197

 Score =   248 bits (634),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 126/215 (59%), Positives = 167/215 (78%), Gaps = 22/215 (10%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIEN+SNRQVT+SKR+NG++KKAKEI+VLCDA VS++I+GSSGKM+E+ S 
Sbjct  1    MGRGKIEIKRIENTSNRQVTYSKRKNGIIKKAKEITVLCDANVSLVIYGSSGKMYEYCSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             ++L+D+LD+Y +L+G +LWDAKHENL+NEI+RIKKEN++MQIELRHLKGEDI+SLNY E
Sbjct  61   KTNLIDMLDRYQRLSGNKLWDAKHENLQNEIDRIKKENESMQIELRHLKGEDITSLNYEE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+  EDAL+NGL +I EK+ E+ + + K     Q + EEN+ L Y ++Q E+AAM     
Sbjct  121  LIAYEDALENGLTNIREKKDEIPKIMRK---HEQVLEEENKHLMYLVQQSEMAAM-----  172

Query  671  EMGEVFNQRESNDYE-SQMPFTFSVQPMQPNLQDR  772
                        DY+ +  PF+F VQPMQPNL +R
Sbjct  173  -----------GDYQAAHEPFSFRVQPMQPNLHER  196



>gb|AEM60218.1| MADS box transcription factor, partial [Clerodendrum infortunatum]
Length=188

 Score =   248 bits (632),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 126/190 (66%), Positives = 152/190 (80%), Gaps = 6/190 (3%)
 Frame = +2

Query  212  NGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS--SSLVDILDQYHKLTGKRLWDAKHE  385
            NG++KKAKEISVLC+A+VSVIIF SSGKMHEF S  S+LV++LDQYHKL+GKRLWDAKHE
Sbjct  1    NGIMKKAKEISVLCEAQVSVIIFASSGKMHEFCSPSSTLVNMLDQYHKLSGKRLWDAKHE  60

Query  386  NLENEINRIKKENDNMQIELRHLKGEDISSLNYRELMILEDALQNGLRSISEKQMEVWRN  565
            +L+NEINRIKKEND MQIELRHLKGEDIS+LNYRELM LE+AL+NG+ S+  KQME  R 
Sbjct  61   HLDNEINRIKKENDGMQIELRHLKGEDISTLNYRELMGLEEALENGITSLKAKQMEFVRM  120

Query  566  LTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLGEMGEVFNQRESNDYES-QMPFTFSV  742
            + K    S+ V EEN+ L Y+LRQ+ +  M  N+ E   V++     DYE+ QMPF F V
Sbjct  121  MRK---HSEMVEEENQNLLYKLRQMHLDPMEENVMEAQGVYDHHGVTDYEAQQMPFGFRV  177

Query  743  QPMQPNLQDR  772
            QPMQPNLQ+R
Sbjct  178  QPMQPNLQER  187



>gb|AFN68728.1| PISTILLATA-like protein [Magnolia conifera var. chingii]
Length=211

 Score =   248 bits (634),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 124/211 (59%), Positives = 164/211 (78%), Gaps = 6/211 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVT+SKRR G+LKKAKEI+VLCDA+VS++IF S+GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRGGILKKAKEITVLCDAQVSLVIFSSTGKMSEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  LV ILD+YHK  G +LWDAKHE+L NE+ RIKKEND+MQI+LRHLKGED++SL  +E
Sbjct  61   STELVKILDRYHKSAGTKLWDAKHEHLSNELERIKKENDSMQIKLRHLKGEDLNSLQPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+AL+NGL  +  +QME  + L K     + + E+N++LSY L+  +  AM+ N+ 
Sbjct  121  LIPIEEALENGLACVRSRQMEYLKTLKK---NERCLEEQNKRLSYILQHQQQLAMDVNVR  177

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNL  763
            +M   ++QRE  +Y  QMPF F VQP+QPNL
Sbjct  178  QMDHGYHQRE-REYHPQMPFAFRVQPIQPNL  207



>gb|AFN68732.1| PISTILLATA-like protein [Magnolia insignis]
 gb|AFN68757.1| PISTILLATA-like protein [Magnolia laevifolia]
Length=210

 Score =   248 bits (633),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 125/212 (59%), Positives = 166/212 (78%), Gaps = 7/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVT+SKRR G+LKKAKEI+VLCDA+VS++IF S+GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRGGILKKAKEITVLCDAQVSLVIFSSTGKMSEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  LV ILD+YHK  G +LWDAKHE+L NE+ RIKKEND+MQI+LRHLKGED++SL+ ++
Sbjct  61   STELVKILDRYHKSAGTKLWDAKHEHLSNELERIKKENDSMQIKLRHLKGEDLNSLHPKD  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+AL+NGL  +  +QME  + L K     + + E+N++LSY L Q ++ AM+ N+ 
Sbjct  121  LIPIEEALENGLACVRSRQMEYLKTLKK---NERCLEEQNKRLSYILHQQQL-AMDVNVR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
            EM   ++QRE  +Y  QMPF F VQP+QPNL 
Sbjct  177  EMDHGYHQRE-REYHPQMPFAFRVQPIQPNLH  207



>gb|AGZ63864.1| PISTILLATA-like protein [Magnolia sirindhorniae]
Length=210

 Score =   248 bits (632),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 126/212 (59%), Positives = 166/212 (78%), Gaps = 7/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVT+SKRR G+LKKAKEI+VLCDA+VS++IF S+GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRGGILKKAKEITVLCDAQVSLVIFSSTGKMSEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  LV+ILD+YHK  GK+LWDAKHE+L NE+ RIKKEND+M I+LRHLKGEDI+SL+ +E
Sbjct  61   STELVNILDRYHKSAGKKLWDAKHEHLSNELERIKKENDSMHIKLRHLKGEDITSLHPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+AL+NGL  +  +QM+  + L K     + + E+N +LSY L Q ++ AM+ N+ 
Sbjct  121  LIPIEEALENGLACVRSRQMQYLKMLKK---NERSLEEDNRRLSYILHQQQL-AMDINVR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
            EM   ++QRE  +Y  QMPF F VQP+QPNL 
Sbjct  177  EMDHGYHQRE-REYHPQMPFGFRVQPIQPNLH  207



>gb|AAW78031.1| PISTILLATA-like protein [Thalictrum dioicum]
Length=211

 Score =   248 bits (632),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 125/215 (58%), Positives = 169/215 (79%), Gaps = 12/215 (6%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIEN +NRQVT+SKRR+G+LKKA+EI VLC+A+++++IF S+GKM E+ S 
Sbjct  1    MGRGKIEIKRIENPTNRQVTYSKRRSGILKKAREIHVLCEAQIALVIFSSTGKMSEYISP  60

Query  314  ----SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLN  481
                S+L+ ILD+Y K +GK+LWDAKHE L +E++RIKKEND+MQIELRHLKGEDI+SLN
Sbjct  61   SPGPSTLIGILDKYQKSSGKKLWDAKHEYLSSELDRIKKENDSMQIELRHLKGEDITSLN  120

Query  482  YRELMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNR  661
             +EL+ +E+AL NGL  + +K+ +VWR + K    +  + EEN++LSY L  LEI   +R
Sbjct  121  AKELIPIEEALLNGLSKVRDKKTDVWRMMKK---NTALLEEENKRLSYHLHSLEIGGTDR  177

Query  662  NLGEMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
            ++ E G  ++Q+   DY SQMPFTF VQP+QPNLQ
Sbjct  178  DM-ENG--YHQK-GRDYPSQMPFTFRVQPIQPNLQ  208



>gb|AFN68720.1| PISTILLATA-like protein [Magnolia duclouxii]
Length=211

 Score =   247 bits (631),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 124/212 (58%), Positives = 165/212 (78%), Gaps = 6/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVT+SKRR G+LKKAKEI+VLCDA+VS++IF S+GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRGGILKKAKEITVLCDAQVSLVIFSSTGKMSEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  LV ILD+YHK  G +LWDAKHE+L NE+ RIKKEND+MQI+LRHLKGED++SL+ +E
Sbjct  61   STELVKILDRYHKSAGTKLWDAKHEHLSNELERIKKENDSMQIKLRHLKGEDLNSLHPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+AL+NGL  +  +QM+  + L K     + + E+N++LSY L+  +  AM+ N+ 
Sbjct  121  LIPIEEALENGLACVRSRQMDYLKMLKK---NERCLEEQNKRLSYILQHQQQLAMDVNVR  177

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
            EM   ++QRE  +Y  QMPF F VQP+QPNL 
Sbjct  178  EMDHGYHQRE-REYHPQMPFAFRVQPIQPNLH  208



>gb|ADM72964.1| PISTILLATA-like protein 2a [Platanus x acerifolia]
 gb|ADM72967.1| PISTILLATA-like protein 2a [Platanus x acerifolia]
Length=210

 Score =   247 bits (631),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 125/212 (59%), Positives = 164/212 (77%), Gaps = 7/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIEN +NRQVT+SKR+NG++KKA+E++VLCDA+V++IIF SSGKM E+ S 
Sbjct  1    MGRGKIEIKRIENLTNRQVTYSKRKNGIIKKARELTVLCDAKVNLIIFSSSGKMSEYHSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  + +ILD YHK +G+RLWDAKHE L NE++RIKKENDNMQIELRHLKGED++SL++++
Sbjct  61   SITMTEILDMYHKYSGQRLWDAKHEFLSNELDRIKKENDNMQIELRHLKGEDVNSLHHKD  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L  +E+ALQ GL  +  K+ME  + L K     + + EEN+ LSY L   E+ AM+ N  
Sbjct  121  LQNIEEALQKGLSKVRAKEMEFLKTLKK---NEKNLEEENKHLSYMLHHQEM-AMSGNTR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
             M   ++Q+E  DY SQMPF F VQP+QPNLQ
Sbjct  177  AMENEYHQKER-DYHSQMPFNFRVQPIQPNLQ  207



>dbj|BAN13571.1| apetala3/pistillata-like protein [Chrysanthemum seticuspe f. 
boreale]
Length=196

 Score =   247 bits (630),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 123/214 (57%), Positives = 165/214 (77%), Gaps = 21/214 (10%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+I +KRIEN+SNRQVT+SKR+NG++KKAKEI+VLCDA VS++I+GSSGKM+E+ S 
Sbjct  1    MGRGKIVLKRIENTSNRQVTYSKRKNGIIKKAKEITVLCDANVSLVIYGSSGKMYEYCSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             ++L+D+LD+Y +L+G +LWDAKHENL+NEI+RIKKEN++MQIELRHLKGEDI+SLNY E
Sbjct  61   KTNLIDMLDRYQRLSGNKLWDAKHENLQNEIDRIKKENESMQIELRHLKGEDITSLNYEE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L   EDAL+NGL +I EK+ ++ + + K     Q + EEN+ L Y ++Q E+AAM     
Sbjct  121  LTAYEDALENGLTNIREKKDDIPKIMRK---HEQVLEEENKHLMYLVQQSEMAAM-----  172

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
                        DY++  PF+F VQPMQPNL +R
Sbjct  173  -----------GDYQAHEPFSFRVQPMQPNLHER  195



>gb|AEN75255.1| transcription factor MADS2 [Prunus avium]
Length=210

 Score =   247 bits (631),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 125/214 (58%), Positives = 168/214 (79%), Gaps = 7/214 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENSSNRQVT+SKRRNG++KKAKEI+VLCDA+VS++IF SSGKM E+ S 
Sbjct  1    MGRGKIEIKRIENSSNRQVTYSKRRNGIIKKAKEITVLCDAKVSLVIFASSGKMVEYCSP  60

Query  317  SLV--DILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S+   DILD+YH   GK+LWDAKHENL NE++R+KK+ND+MQ+ELRHLKGEDI+SL ++E
Sbjct  61   SVTVTDILDKYHGQAGKKLWDAKHENLSNEVDRVKKDNDSMQVELRHLKGEDITSLTHKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LM LE+AL+NGL S  +KQ +    L    +  + + EE+++L+Y L + E+  +  N+ 
Sbjct  121  LMALEEALENGLASNRDKQSKFVGMLI---ENGRALEEEHKRLTYELHKQEM-KIEENVR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
            E+   ++QR  N Y +Q+PF F VQP+QPNLQ+R
Sbjct  177  ELENGYHQRLGN-YNNQIPFAFRVQPIQPNLQER  209



>gb|AFN68762.1| PISTILLATA-like protein [Magnolia cylindrica]
 gb|AFN68765.1| PISTILLATA-like protein [Magnolia biondii]
Length=213

 Score =   247 bits (631),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 125/213 (59%), Positives = 166/213 (78%), Gaps = 7/213 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVT+SKRR G++KKAKEI+VLCDA+VS++IF S+GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRGGIMKKAKEITVLCDAQVSLVIFSSTGKMSEYCSP  60

Query  317  S--LVDILDQYHKLTG-KRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYR  487
            S  LV ILD+YHK  G ++LWDAKHE+L NE+ RIKKEND+MQI+LRHLKGEDI+SL+ +
Sbjct  61   STELVKILDRYHKNAGVQKLWDAKHEHLSNELERIKKENDSMQIKLRHLKGEDINSLHPK  120

Query  488  ELMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNL  667
            EL+ +E+AL+NGL  +  KQM+  + L K     + + E+N +LSY L+  +  AM+ N+
Sbjct  121  ELIPIEEALENGLACVRSKQMQCLKTLKK---NERSLEEDNRRLSYILQHQQQLAMDVNV  177

Query  668  GEMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
             EM  V+++RE  +Y  QMPF F VQP+QPNL 
Sbjct  178  REMDHVYHERE-REYHPQMPFAFRVQPIQPNLH  209



>gb|AFN68727.1| PISTILLATA-like protein [Magnolia dandyi]
Length=211

 Score =   247 bits (631),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 164/212 (77%), Gaps = 6/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVT+SKRR G+LKKAKEI+VLCDA+VS++IF S+GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRGGILKKAKEITVLCDAQVSLVIFSSTGKMSEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  LV ILD+YHK  G +LWDAKHE+L NE+ RIKKEND+MQI+LRHLKGED++SL+ ++
Sbjct  61   STELVKILDRYHKSAGTKLWDAKHEHLSNELERIKKENDSMQIKLRHLKGEDLNSLHPKD  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+AL+NGL  +  +QME  + L K     + + E+N++LSY L+  +  AM+ N+ 
Sbjct  121  LIPIEEALENGLACVRSRQMEYLKTLKK---NERCLEEQNKRLSYILQHQQQLAMDVNVR  177

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
            EM   ++QRE  +Y   MPF F VQP+QPNL 
Sbjct  178  EMDHGYHQRE-REYHPHMPFAFRVQPIQPNLH  208



>ref|XP_010911271.1| PREDICTED: MADS-box transcription factor 2-like isoform X2 [Elaeis 
guineensis]
 gb|AAQ13915.1|AF227195_1 MADS box transcription factor [Elaeis guineensis]
Length=210

 Score =   247 bits (631),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 130/213 (61%), Positives = 166/213 (78%), Gaps = 7/213 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVTFSKRRNG++KKA+EISVLCDA+VSV+IF SSGKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTFSKRRNGIIKKAREISVLCDAQVSVVIFSSSGKMSEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  L  IL++Y   +GK+LWDAKHE+L  EI+RIKKENDNMQIELRHLKGED++SL+ +E
Sbjct  61   STTLSRILERYQHNSGKKLWDAKHESLSAEIDRIKKENDNMQIELRHLKGEDLNSLSPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +EDALQNGL S+ +KQME  + L K     + + EEN+ L+Y L Q E+ AM+ N+ 
Sbjct  121  LIPIEDALQNGLISVRDKQMEFLKKLKK---NERLLEEENKHLTYLLHQQEL-AMDANVR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQD  769
            E+ E+    +  D+ S MP  F VQP+QPNLQ+
Sbjct  177  EL-ELGYPSKDRDFASHMPLAFHVQPIQPNLQE  208



>ref|XP_008783315.1| PREDICTED: MADS-box transcription factor 2-like [Phoenix dactylifera]
Length=210

 Score =   247 bits (630),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 129/213 (61%), Positives = 167/213 (78%), Gaps = 7/213 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVTFSKRRNG++KKA+EISVLCD++VSV+IF SSGKM E+ SS
Sbjct  1    MGRGKIEIKRIENSTNRQVTFSKRRNGIIKKAREISVLCDSQVSVVIFSSSGKMSEYCSS  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  L  +L++Y   +GK+LWDA+HENL  EI+RIKKENDNMQIELRHLKGED++SL+ +E
Sbjct  61   SATLSHMLERYQHNSGKKLWDARHENLSAEIDRIKKENDNMQIELRHLKGEDLNSLHPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +EDALQNGL  + +KQME  + L K     + + EEN+ L+Y LR  E+ AM+ N+ 
Sbjct  121  LIPIEDALQNGLIGVRDKQMEYLKKLKK---NERLLEEENKHLTYLLRHQEL-AMDANVR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQD  769
            E+ E+    +  D+ SQMP  F VQP+QPNLQ+
Sbjct  177  EL-ELGYPPKDRDFASQMPLAFHVQPIQPNLQE  208



>gb|AFN68730.1| PISTILLATA-like protein [Magnolia insignis]
Length=211

 Score =   247 bits (630),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 164/212 (77%), Gaps = 6/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVT+SKRR G+LKKAKEI+VLCDA+VS++IF S+GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRGGILKKAKEITVLCDAQVSLVIFSSTGKMSEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  LV ILD+YHK  G +LWDAKHE+L NE+ RIKKEND+MQI+LRHLKGED++SL+ +E
Sbjct  61   STELVKILDRYHKSAGTKLWDAKHEHLSNELERIKKENDSMQIKLRHLKGEDLNSLHPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+AL+NGL  +  +QME  + L K     + + E+N++LSY L+  +  AM+ N+ 
Sbjct  121  LIPIEEALENGLACVRSRQMEYLKTLKK---NERCLEEQNKRLSYILQHQQQLAMDVNVR  177

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
            EM   ++QRE  +Y   MP+ F VQP+QPNL 
Sbjct  178  EMDHGYHQRE-REYHPHMPYAFRVQPIQPNLH  208



>gb|AGS12591.1| PI MADS box protein [Ribes diacanthum]
 gb|AHY19022.1| PI MADS box protein [Ribes diacanthum]
Length=216

 Score =   247 bits (630),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 128/218 (59%), Positives = 167/218 (77%), Gaps = 9/218 (4%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIEN SNRQVT++KRRNG++KKAKEI+VLCDA VS++IF S+GKMHE+ S 
Sbjct  1    MGRGKIEIKRIENQSNRQVTYTKRRNGIIKKAKEITVLCDAHVSLVIFASNGKMHEYCSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             ++LVDIL +YHK +GK+LWDAKHENL NEI+R+KKENDNMQIELRHLKGEDI+SL+++E
Sbjct  61   STTLVDILGKYHKQSGKKLWDAKHENLSNEIDRVKKENDNMQIELRHLKGEDITSLHHKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRL---RQLEIAAMNR  661
            LM +E+ L+NG+  I + + EV     K Y   Q   EE++ L+Y L    Q E+A  + 
Sbjct  121  LMAIEETLENGVDRIRKMKDEVVNRHRKNY---QKEDEEHKYLNYVLNLQHQKEMAFDSN  177

Query  662  NLG-EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
              G  + + ++ +   DY SQMPF F VQP+QPNLQ+R
Sbjct  178  TRGMNIDDGYHLKMRGDYNSQMPFAFRVQPIQPNLQER  215



>gb|AFN68737.1| PISTILLATA-like protein [Magnolia fordiana]
Length=210

 Score =   247 bits (630),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 125/212 (59%), Positives = 166/212 (78%), Gaps = 7/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVT+SKRR G+LKKAKEI+VLCDA+VS++IF S+GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRGGILKKAKEITVLCDAQVSLVIFSSTGKMSEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  LV ILD+YHK  G +LWDAKHE+L NE+ RIKKEND+MQI+LRHLKGED++SL+ ++
Sbjct  61   STELVKILDRYHKSAGTKLWDAKHEHLSNELERIKKENDSMQIKLRHLKGEDLNSLHPKD  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+AL+NGL  +  +QME  + L K     + + E+N++LSY L Q ++ AM+ N+ 
Sbjct  121  LIPIEEALENGLACVRSRQMEYLKMLKK---NERCLEEQNKRLSYILHQQQL-AMDVNVR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
            EM   ++QRE  +Y  QMPF F VQP+QPNL 
Sbjct  177  EMDHGYHQRE-REYHPQMPFAFRVQPIQPNLH  207



>gb|AFN68721.1| PISTILLATA-like protein [Magnolia duclouxii]
Length=210

 Score =   247 bits (630),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 125/212 (59%), Positives = 166/212 (78%), Gaps = 7/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVT+SKRR G+LKKAKEI+VLCDA+VS++IF S+GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRGGILKKAKEITVLCDAQVSLVIFSSTGKMSEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  LV ILD+YHK  G +LWDAKHE+L NE+ RIKKEND+MQI+LRHLKGED++SL+ +E
Sbjct  61   STELVKILDRYHKSAGTKLWDAKHEHLSNELERIKKENDSMQIKLRHLKGEDLNSLHPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+AL+NGL  +  +QM+  + L K     + + E+N++LSY L Q ++ AM+ N+ 
Sbjct  121  LIPIEEALENGLACVRSRQMDYLKMLKK---NERCLEEQNKRLSYILHQQQL-AMDVNVR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
            EM   ++QRE  +Y  QMPF F VQP+QPNL 
Sbjct  177  EMDHGYHQRE-REYHPQMPFAFRVQPIQPNLH  207



>gb|AFN68763.1| PISTILLATA-like protein [Magnolia cylindrica]
Length=212

 Score =   247 bits (630),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 126/213 (59%), Positives = 167/213 (78%), Gaps = 8/213 (4%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVT+SKRR G++KKAKEI+VLCDA+VS++IF S+GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRGGIMKKAKEITVLCDAQVSLVIFSSTGKMSEYCSP  60

Query  317  S--LVDILDQYHKLTG-KRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYR  487
            S  LV ILD+YHK  G ++LWDAKHE+L NE+ RIKKEND+MQI+LRHLKGEDI+SL+ +
Sbjct  61   STELVKILDRYHKNAGVQKLWDAKHEHLSNELERIKKENDSMQIKLRHLKGEDINSLHPK  120

Query  488  ELMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNL  667
            EL+ +E+AL+NGL  +  KQM+  + L K     + + E+N +LSY L Q ++ AM+ N+
Sbjct  121  ELIPIEEALENGLACVRSKQMQCLKTLKK---NERSLEEDNRRLSYILHQQQL-AMDVNV  176

Query  668  GEMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
             EM  V+++RE  +Y  QMPF F VQP+QPNL 
Sbjct  177  REMDHVYHERE-REYHPQMPFAFRVQPIQPNLH  208



>gb|AGZ01977.1| PISTILLATA-like protein [Magnolia dandyi]
Length=210

 Score =   246 bits (628),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 124/212 (58%), Positives = 165/212 (78%), Gaps = 7/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVT+SKRR G+LKKAKEI+VLCDA+VS++IF S+GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRGGILKKAKEITVLCDAQVSLVIFSSTGKMSEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  LV ILD+YHK  G +LWDAKHE+L NE+ RIKKEND+MQI+LRHLKGED++SL+ ++
Sbjct  61   STELVKILDRYHKSAGTKLWDAKHEHLSNELERIKKENDSMQIKLRHLKGEDLNSLHPKD  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+AL+NGL  +  +QME  + L K     + + E+N++LSY L Q ++ AM+ N+ 
Sbjct  121  LIPIEEALENGLACVRSRQMEYLKTLKK---NERCLEEQNKRLSYILHQQQL-AMDVNVR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
            EM   ++QRE  +Y   MPF F VQP+QPNL 
Sbjct  177  EMDHGYHQRE-REYHPHMPFAFRVQPIQPNLH  207



>gb|AFN68734.1| PISTILLATA-like protein [Magnolia salicifolia]
Length=212

 Score =   246 bits (628),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 125/213 (59%), Positives = 165/213 (77%), Gaps = 7/213 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVT+SKRR G++KKAKEI+VLCDA+VS++IF S+GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRGGIMKKAKEITVLCDAQVSLVIFSSTGKMSEYCSP  60

Query  317  S--LVDILDQYHKLTG-KRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYR  487
            S  LV ILD+YHK  G ++LWDAKHE+L NE+ RIKKEND+MQI+LRHLKGEDI+SL+ +
Sbjct  61   STELVKILDRYHKSAGVQKLWDAKHEHLSNELERIKKENDSMQIKLRHLKGEDINSLHPK  120

Query  488  ELMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNL  667
            EL+ +E+AL+NGL  +  KQM+  + L K     + + E+N +LSY L+  +  AM+ N+
Sbjct  121  ELIPIEEALENGLACVRSKQMQCLKTLKK---NERSLEEDNRRLSYILQHQQQLAMDVNV  177

Query  668  GEMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
             EM   ++QRE  +Y  QMPF F VQP+QPNL 
Sbjct  178  REMDHGYHQRE-REYHPQMPFAFRVQPIQPNLH  209



>gb|ABS32248.1| PISTILLATA-like protein [Prunus persica]
Length=210

 Score =   246 bits (627),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 125/214 (58%), Positives = 167/214 (78%), Gaps = 7/214 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENSSNRQVT+SKRRNG++KKAKEI+VLCDA+VS++IF SSGKM E+ S 
Sbjct  1    MGRGKIEIKRIENSSNRQVTYSKRRNGIIKKAKEITVLCDAKVSLVIFASSGKMVEYCSP  60

Query  317  SLV--DILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S+   DILD+YH   GK+LWDAKHENL NE++R+KK+ND+MQ+ELRHLKGEDI+SL ++E
Sbjct  61   SVTVTDILDKYHGQAGKKLWDAKHENLSNEVDRVKKDNDSMQVELRHLKGEDITSLTHKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LM LE+AL+NGL S  +KQ +    L    +  + + EE+++L+Y L + E+  +  N+ 
Sbjct  121  LMALENALENGLASNRDKQSKFVDMLR---ENERALEEEHKRLTYELHKQEM-KIEENVR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
            E+   + QR  N Y +Q+PF F VQP+QPNLQ+R
Sbjct  177  ELENGYRQRLGN-YNNQIPFAFRVQPIQPNLQER  209



>gb|AFN68735.1| PISTILLATA-like protein [Magnolia salicifolia]
Length=211

 Score =   246 bits (627),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 126/213 (59%), Positives = 166/213 (78%), Gaps = 8/213 (4%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVT+SKRR G++KKAKEI+VLCDA+VS++IF S+GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRGGIMKKAKEITVLCDAQVSLVIFSSTGKMSEYCSP  60

Query  317  S--LVDILDQYHKLTG-KRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYR  487
            S  LV ILD+YHK  G ++LWDAKHE+L NE+ RIKKEND+MQI+LRHLKGEDI+SL+ +
Sbjct  61   STELVKILDRYHKSAGVQKLWDAKHEHLSNELERIKKENDSMQIKLRHLKGEDINSLHPK  120

Query  488  ELMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNL  667
            EL+ +E+AL+NGL  +  KQM+  + L K     + + E+N +LSY L Q ++ AM+ N+
Sbjct  121  ELIPIEEALENGLACVRSKQMQCLKTLKK---NERSLEEDNRRLSYILHQQQL-AMDVNV  176

Query  668  GEMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
             EM   ++QRE  +Y  QMPF F VQP+QPNL 
Sbjct  177  REMDHGYHQRE-REYHPQMPFAFRVQPIQPNLH  208



>gb|AIU94284.1| PISTILLATA-like protein [Prunus pseudocerasus]
Length=210

 Score =   245 bits (626),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 124/214 (58%), Positives = 167/214 (78%), Gaps = 7/214 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENSSNRQVT+SKRRNG++KKAKEI+VLCDA+VS++IF SSGKM E+ S 
Sbjct  1    MGRGKIEIKRIENSSNRQVTYSKRRNGIIKKAKEITVLCDAKVSLVIFASSGKMVEYCSP  60

Query  317  SLV--DILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S+   DILD+YH   GK+LWDAKHENL NE++R+KK+ND+MQ+ELRHLKGEDI+SL ++E
Sbjct  61   SVTVTDILDKYHGQAGKKLWDAKHENLSNEVDRVKKDNDSMQVELRHLKGEDITSLTHKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LM LE AL+NGL S  +KQ +    +    +  + + EE+++L+Y L + E+  +  N+ 
Sbjct  121  LMALEAALENGLASNRDKQSKF---IDMVIENDRALEEEHKRLTYELHKQEM-KIEENVR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
            E+   ++QR  N Y +Q+PF F VQP+QPNLQ+R
Sbjct  177  ELENGYHQRLGN-YNNQIPFAFRVQPIQPNLQER  209



>gb|KDO80479.1| hypothetical protein CISIN_1g040096mg [Citrus sinensis]
Length=212

 Score =   245 bits (626),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 127/214 (59%), Positives = 162/214 (76%), Gaps = 5/214 (2%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIEN+SNRQVT+SKRRNG+LKKAKEI+VLCDA+VS+II+ SSGKMH++ S 
Sbjct  1    MGRGKIEIKRIENASNRQVTYSKRRNGILKKAKEITVLCDAKVSLIIYASSGKMHDYCSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             +SLVDIL+QYH+ +G+RLWD KHENL NEI RIK+END MQI+LRHL GEDISSLN +E
Sbjct  61   STSLVDILEQYHRQSGRRLWDPKHENLSNEIERIKRENDRMQIKLRHLNGEDISSLNPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ LEDAL+NGL SI +KQ E    + K     + + EE+  L + LRQ EIA   + L 
Sbjct  121  LIALEDALENGLVSIRDKQSEKMETMRK---NGKMMEEEHNYLKFVLRQQEIARQQQELA  177

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
                V  + ++   E+   + + VQP+QPNLQ+R
Sbjct  178  MENSVSAEIDNYQRENHHDYAYHVQPIQPNLQER  211



>gb|AFN68770.1| PISTILLATA-like protein [Magnolia amoena]
Length=213

 Score =   245 bits (626),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 125/213 (59%), Positives = 165/213 (77%), Gaps = 7/213 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVT+SKRR G++KKAKEI+VLCDA+VS++IF S+GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRGGIMKKAKEITVLCDAQVSLVIFSSTGKMSEYCSP  60

Query  317  S--LVDILDQYHKLTG-KRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYR  487
            S  LV ILD+YHK  G ++LWDAKHE+L NE+ RIKKEND+MQI+LRHLKGEDI+SL+ +
Sbjct  61   STELVKILDRYHKNAGVQKLWDAKHEHLSNELERIKKENDSMQIKLRHLKGEDINSLHPK  120

Query  488  ELMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNL  667
            EL+ +E+AL+NGL  +  KQM+  + L K     + + E+N +LSY L+  +  AM+ N+
Sbjct  121  ELIPIEEALENGLACVRSKQMQCLKTLKK---NERSLEEDNRRLSYILQHQQQLAMDVNV  177

Query  668  GEMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
             EM   ++QRE  +Y  QMPF F VQP+QPNL 
Sbjct  178  REMDHGYHQRE-REYHPQMPFAFRVQPIQPNLH  209



>gb|AFN68750.1| PISTILLATA-like protein [Magnolia stellata]
 gb|AFN68771.1| PISTILLATA-like protein [Magnolia amoena]
Length=212

 Score =   244 bits (624),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 126/213 (59%), Positives = 166/213 (78%), Gaps = 8/213 (4%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVT+SKRR G++KKAKEI+VLCDA+VS++IF S+GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRGGIMKKAKEITVLCDAQVSLVIFSSTGKMSEYCSP  60

Query  317  S--LVDILDQYHKLTG-KRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYR  487
            S  LV ILD+YHK  G ++LWDAKHE+L NE+ RIKKEND+MQI+LRHLKGEDI+SL+ +
Sbjct  61   STELVKILDRYHKNAGVQKLWDAKHEHLSNELERIKKENDSMQIKLRHLKGEDINSLHPK  120

Query  488  ELMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNL  667
            EL+ +E+AL+NGL  +  KQM+  + L K     + + E+N +LSY L Q ++ AM+ N+
Sbjct  121  ELIPIEEALENGLACVRSKQMQCLKTLKK---NERSLEEDNRRLSYILHQQQL-AMDVNV  176

Query  668  GEMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
             EM   ++QRE  +Y  QMPF F VQP+QPNL 
Sbjct  177  REMDHGYHQRE-REYHPQMPFAFRVQPIQPNLH  208



>gb|ABS29556.1| PISTILLATA-like MADS box protein [Melaleuca quinquenervia]
Length=208

 Score =   244 bits (624),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 128/214 (60%), Positives = 165/214 (77%), Gaps = 9/214 (4%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRGR+E+KRIENS+NRQVT+SKRRNG++KKAKEISVLCDA+VS+IIFGSSGKMHE+ SS
Sbjct  1    MGRGRLELKRIENSNNRQVTYSKRRNGLIKKAKEISVLCDAQVSLIIFGSSGKMHEYCSS  60

Query  317  --SLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
              SLVDILDQY    GKRLWDAKHENL NE++RIKKENDN+QI+LRHLKGED++SLN+RE
Sbjct  61   NTSLVDILDQYQTQCGKRLWDAKHENLSNELDRIKKENDNLQIQLRHLKGEDVTSLNHRE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ILED L+NGL  + +++ E    +T+R +Q Q + EE ++L +   Q +   M  N  
Sbjct  121  LIILEDTLENGLACVRDQKDEFV--MTQRRNQKQ-LEEETKELHF-FAQHKDMMMAENAR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
               + ++Q+   D+ S     + VQP+QPNLQ R
Sbjct  177  AANDGYHQKIKADFGSH---AYHVQPIQPNLQRR  207



>gb|ACD85092.1| B-class MADS-box protein PI [Brassavola nodosa]
Length=210

 Score =   244 bits (624),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 127/212 (60%), Positives = 168/212 (79%), Gaps = 7/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVTFSKRRNG++KKAKEISVLCDA+VS++IF S GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTFSKRRNGIMKKAKEISVLCDAQVSLVIFSSLGKMFEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  L  +L++Y + +GK+LWDAKHENL  EI+RIKKENDNMQIELRHLKGED++SLN +E
Sbjct  61   STTLSKMLEKYQQNSGKKLWDAKHENLSAEIDRIKKENDNMQIELRHLKGEDLNSLNPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+ALQNGL S+ +KQM+  + L K     + + EEN++L+Y L   ++ AM  ++ 
Sbjct  121  LIPIEEALQNGLTSVRDKQMDFLKMLKK---NERMLEEENKRLTYLLHHQQL-AMEGSMR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
            E+   F+Q++  +Y +QMP TF VQP+QPNLQ
Sbjct  177  ELDIGFHQKD-REYAAQMPMTFRVQPIQPNLQ  207



>gb|ACY91919.1| MADS-domain transcription factor, partial [Loasa vulcanica]
Length=196

 Score =   244 bits (622),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 159/198 (80%), Gaps = 5/198 (3%)
 Frame = +2

Query  185  RQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS--SSLVDILDQYHKLTG  358
            RQVT+SKRRNG++KKAKEI+VLCDA VS+IIF SS KMH++ S  ++L+ ILD+YHK +G
Sbjct  1    RQVTYSKRRNGIMKKAKEIAVLCDAHVSLIIFASSNKMHDYCSPNTTLISILDRYHKQSG  60

Query  359  KRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRELMILEDALQNGLRSIS  538
            KRLWDAKHENL NEI+RIKKEND+MQIELRHLKGEDISSLN++EL++LE AL+NGL SI 
Sbjct  61   KRLWDAKHENLSNEIDRIKKENDSMQIELRHLKGEDISSLNHKELIVLEGALENGLTSIR  120

Query  539  EKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLGEMGEVFNQRESNDYES  718
            E+Q EV+R + ++  + + + +EN+ L Y L Q E+A    N+ EM   F Q  + DY+S
Sbjct  121  ERQDEVFR-MARKNTKLRVLEDENKHLHYILHQQEMAK-ESNMREMENGF-QSMTTDYDS  177

Query  719  QMPFTFSVQPMQPNLQDR  772
            Q+PF F VQP+QPNLQDR
Sbjct  178  QIPFAFRVQPIQPNLQDR  195



>gb|AEM60217.1| MADS box transcription factor, partial [Salvia coccinea]
Length=188

 Score =   243 bits (621),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 155/191 (81%), Gaps = 8/191 (4%)
 Frame = +2

Query  212  NGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSSS--LVDILDQYHKLTGKRLWDAKHE  385
            NG++KKAKEISVLCDA VSVIIF +SGKMH+F S S  LVD+LDQYHKL+GKRLWDAKHE
Sbjct  1    NGIMKKAKEISVLCDAHVSVIIFANSGKMHDFCSPSTTLVDMLDQYHKLSGKRLWDAKHE  60

Query  386  NLENEINRIKKENDNMQIELRHLKGEDISSLNYRELMILEDALQNGLRSISEKQMEVWRN  565
            +L+NEINRIKKEND+MQI+LRHLKGEDIS LNY+ELM+LE+AL+NG+ ++  KQME  R 
Sbjct  61   HLDNEINRIKKENDSMQIQLRHLKGEDISDLNYKELMVLEEALENGITTLKAKQMEFVRM  120

Query  566  LTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLGEMGEVFNQRESNDYES--QMPFTFS  739
            + K    ++ + EEN+ L ++LRQ+ +  M+ N+ E   V++Q+ + DYE+  QMPF F 
Sbjct  121  MRK---HNETMEEENQNLLFKLRQMHLDPMDDNVMEAQGVYDQQVA-DYEAQQQMPFAFR  176

Query  740  VQPMQPNLQDR  772
            VQPMQPNLQ+R
Sbjct  177  VQPMQPNLQER  187



>gb|AAT46101.1| PISTILLATA-like protein [Akebia trifoliata]
Length=212

 Score =   244 bits (623),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 125/215 (58%), Positives = 159/215 (74%), Gaps = 9/215 (4%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVT+SKRRNG++KKAKEI++LCDA+VS++IF S+GKM ++ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRNGIMKKAKEITILCDAQVSLVIFSSTGKMSDYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  L  +LD+Y K +GKRLWDAKHE L  E++RIKKEND MQIELRHLKGEDI+SLN +E
Sbjct  61   STTLTKVLDRYQKTSGKRLWDAKHEYLSTEVDRIKKENDCMQIELRHLKGEDITSLNPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTK--RYDQSQGVAEENEQLSYRLRQLEIAAMNRN  664
            L+ +E+AL+NGL ++  KQME  + L K  RY     + EEN+ L   L   +I      
Sbjct  121  LIPIEEALENGLVNVRAKQMEYLKMLKKNERY-----LEEENKHLRCILHHQQIEIEGNM  175

Query  665  LGEMGEVFNQRESNDYESQMPFTFSVQPMQPNLQD  769
              EM   +N ++  DY SQMPF F  QPMQPNLQ+
Sbjct  176  RMEMENGYNTQKGRDYPSQMPFAFRAQPMQPNLQE  210



>gb|ABQ85946.1| MADS-box transcription factor PI-like 1 [Trochodendron aralioides]
Length=210

 Score =   244 bits (622),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 126/214 (59%), Positives = 159/214 (74%), Gaps = 7/214 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIEN SNRQVT+SKR+NG++KKA+EI+VLCDA+VS++I  S+G+M EF S 
Sbjct  1    MGRGKIEIKRIENVSNRQVTYSKRKNGIIKKAREIAVLCDAQVSLVIISSNGRMAEFCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  L   LD+YH+ +  +LWDAKHE L  E++RIKKENDNMQIELRHLKGEDI SL   E
Sbjct  61   STTLTKFLDRYHRSSATKLWDAKHEYLSKEVDRIKKENDNMQIELRHLKGEDIVSLKLEE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ LE+ALQNG+ +I  K ME+W+ L K+      + EEN+ LSY L Q E+ AM+  L 
Sbjct  121  LISLEEALQNGVTNIRHKPMELWKTLKKK---ETMLEEENKHLSYMLHQQEM-AMDGRLR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
            EM   +  +   DY  QMPF F +QPMQPNLQD+
Sbjct  177  EMENGYAPK-MRDYLPQMPFAFRLQPMQPNLQDK  209



>gb|AFN68749.1| PISTILLATA-like protein [Magnolia stellata]
Length=212

 Score =   244 bits (622),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 124/213 (58%), Positives = 164/213 (77%), Gaps = 7/213 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVT+SKRR G++KKAKEI+VLCDA+VS++IF S+GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRGGIMKKAKEITVLCDAQVSLVIFSSTGKMSEYCSP  60

Query  317  S--LVDILDQYHKLTG-KRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYR  487
            S  LV ILD+YHK  G ++LWDAKHE+L NE+ RIKKEND+M I+LRHLKGEDI+SL+ +
Sbjct  61   STELVKILDRYHKNAGVQKLWDAKHEHLSNELERIKKENDSMHIKLRHLKGEDINSLHPK  120

Query  488  ELMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNL  667
            EL+ +E+AL+NGL  +  KQM+  + L K     + + E+N +LSY L+  +  AM+ N+
Sbjct  121  ELIPIEEALENGLACVRSKQMQCLKTLKK---NERSLEEDNRRLSYILQHQQQLAMDVNV  177

Query  668  GEMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
             EM   ++QRE  +Y  QMPF F VQP+QPNL 
Sbjct  178  REMDHGYHQRE-REYHPQMPFAFRVQPIQPNLH  209



>gb|ACY91891.1| MADS-domain transcription factor, partial [Davidia involucrata]
Length=196

 Score =   243 bits (619),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 161/200 (81%), Gaps = 9/200 (5%)
 Frame = +2

Query  185  RQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSSS--LVDILDQYHKLTG  358
            RQVT+SKRRNG++KKAKEI+VLCDARVS++IF SSGKMHE+ S S  L+ ILD+YHK +G
Sbjct  1    RQVTYSKRRNGLMKKAKEITVLCDARVSLVIFSSSGKMHEYCSPSTDLIGILDRYHKQSG  60

Query  359  KRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRELMILEDALQNGLRSIS  538
            KRLWDAKHENL NEI+RIKKEND+MQI+LRHLKGEDI+SL+Y+ELM +E+AL+NGL  + 
Sbjct  61   KRLWDAKHENLSNEIDRIKKENDSMQIKLRHLKGEDITSLHYKELMAIEEALENGLAGVR  120

Query  539  EKQMEVWRNLTKR--YDQSQGVAEENEQLSYRLRQLEIAAMNRNLGEMGEVFNQRESNDY  712
            +KQME++ N+ ++    Q + + EENE L Y L+++    +N N+ +M   ++QRE  D+
Sbjct  121  DKQMEIY-NMKRKNLIVQDEMLEEENEHLKYMLQEM---TLNGNVRDMENGYHQRE-RDF  175

Query  713  ESQMPFTFSVQPMQPNLQDR  772
            + QMPF F VQP QPNLQ+R
Sbjct  176  QPQMPFAFRVQPNQPNLQER  195



>gb|ACY91895.1| MADS-domain transcription factor, partial [Saurauia zahlbruckneri]
Length=193

 Score =   242 bits (618),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 162/199 (81%), Gaps = 9/199 (5%)
 Frame = +2

Query  182  NRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS--SSLVDILDQYHKLT  355
            NRQVT+SKRRNG++KKAKEI+VLCDA+VS++IFGSSGK+HE+ S  ++L +ILD+YHK +
Sbjct  1    NRQVTYSKRRNGLIKKAKEITVLCDAQVSLVIFGSSGKLHEYCSPSTTLTNILDKYHKAS  60

Query  356  GKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRELMILEDALQNGLRSI  535
            G+RLWDAKHENL NE++RIKKEND+MQIELRHLKGEDI+SL+++ELM LE+AL+NGL SI
Sbjct  61   GRRLWDAKHENLSNELDRIKKENDSMQIELRHLKGEDITSLHHKELMALEEALENGLASI  120

Query  536  SEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLGEMGEVFNQRESNDYE  715
             EK+MEV++ + K     + + +EN+ L++ L Q  ++  NR   EM   ++QR   DY+
Sbjct  121  REKEMEVFKMMEK---NEKRLEDENKHLNFMLHQQGMSMENR---EMENGYHQR-VLDYQ  173

Query  716  SQMPFTFSVQPMQPNLQDR  772
             QMPFTF VQP+QPNL +R
Sbjct  174  HQMPFTFRVQPIQPNLHER  192



>gb|AFM75884.1| PISTILLATA-like protein [Magnolia wufengensis]
Length=212

 Score =   243 bits (620),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 124/212 (58%), Positives = 164/212 (77%), Gaps = 7/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVT+SKRR G++KKAKEI+VLCDA+VS++IF S+GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRGGIMKKAKEITVLCDAQVSLVIFSSTGKMSEYCSP  60

Query  317  S--LVDILDQYHKLTG-KRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYR  487
            S  LV ILD+YHK  G ++LWDAKHE+L NE+ RIKKEND+MQI+LRHLKGEDI+SL  +
Sbjct  61   STELVKILDRYHKSAGAQKLWDAKHEHLSNELERIKKENDSMQIKLRHLKGEDINSLQPK  120

Query  488  ELMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNL  667
            EL+ +E+AL+NGL  +  +QM+  + L K     + + E+N +LSY L+  +  AM+ N+
Sbjct  121  ELIPVEEALENGLACVRSRQMQYLKRLKK---NERSLEEDNRRLSYILQHQQQLAMDVNV  177

Query  668  GEMGEVFNQRESNDYESQMPFTFSVQPMQPNL  763
             EM   ++QRE  +Y  QMPF F VQP+QPNL
Sbjct  178  REMEHGYHQRE-REYHPQMPFAFRVQPIQPNL  208



>dbj|BAF46355.1| MADS-box transcription factor [Alstroemeria ligtu subsp. ligtu]
Length=210

 Score =   243 bits (620),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 126/213 (59%), Positives = 168/213 (79%), Gaps = 7/213 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIENS+NRQVTFSKRRNG++KKA+EISVLC+A+VSV+IF SSGKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTFSKRRNGIIKKAREISVLCEAQVSVVIFSSSGKMSEYCSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             +SL +IL++Y   +GK+LWDAKHE+L  EI+RIKKENDNMQIELRHLKG+D++SLN +E
Sbjct  61   STSLPNILERYQHNSGKKLWDAKHESLHAEIDRIKKENDNMQIELRHLKGQDLNSLNPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LM +EDALQNGL  + +KQM+  + L K     + + EEN++L+Y L    + AM+  + 
Sbjct  121  LMPIEDALQNGLTGVRDKQMDFLKMLKK---NERLLEEENKRLTYILHHQHL-AMDGGVR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQD  769
            EM   ++Q+E  ++ +QMP  F VQP+QPNLQ+
Sbjct  177  EMEMGYHQKE-REFAAQMPMAFRVQPIQPNLQE  208



>gb|ACY91892.1| MADS-domain transcription factor, partial [Nyssa sylvatica]
Length=194

 Score =   242 bits (618),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 156/198 (79%), Gaps = 7/198 (4%)
 Frame = +2

Query  185  RQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSSS--LVDILDQYHKLTG  358
            RQVTF KRRNG++KKAKEI+VLCDA VS++IF SSGKMHE+ S S  L+DILD+YHK +G
Sbjct  1    RQVTFCKRRNGIMKKAKEITVLCDAHVSLVIFASSGKMHEYCSPSTNLIDILDRYHKQSG  60

Query  359  KRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRELMILEDALQNGLRSIS  538
            KRLWDAKHENL NE++RIKKEND+MQIELRHLKGEDI+SL+Y+ELM +E+AL+NGL  + 
Sbjct  61   KRLWDAKHENLSNELDRIKKENDSMQIELRHLKGEDITSLHYKELMAIEEALENGLAGVR  120

Query  539  EKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLGEMGEVFNQRESNDYES  718
             KQME+    TK     + + EEN+ L Y L Q E+ A+N N+ +M   ++Q+   D++ 
Sbjct  121  NKQMEIHDMKTK---NDKMLEEENKHLKYILHQQEM-ALNGNVRDMENGYHQK-VRDFQP  175

Query  719  QMPFTFSVQPMQPNLQDR  772
            QMPF F VQP+QPNLQ+R
Sbjct  176  QMPFAFRVQPIQPNLQER  193



>gb|ACR16039.1| GLOBOSA-like MADS-box transcription factor [Gongora galeata]
Length=210

 Score =   243 bits (620),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 126/212 (59%), Positives = 168/212 (79%), Gaps = 7/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVTFSKRRNG++KKAKEISVLCDA+VS++IF S GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTFSKRRNGIMKKAKEISVLCDAQVSLVIFSSLGKMFEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  L  +L++Y + +GK+LWDAKHENL  EI+RIKKENDNMQIELRHLKGED++SLN +E
Sbjct  61   STTLSKMLEKYQQNSGKKLWDAKHENLSAEIDRIKKENDNMQIELRHLKGEDLNSLNPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+ALQNGL S+ +KQM+  + L K     + + EEN++L+Y L   ++ AM  ++ 
Sbjct  121  LIPIEEALQNGLTSVRDKQMDFLKMLKK---NERMLEEENKRLAYLLHHQQL-AMEGSMR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
            E+   ++Q++  +Y +QMP TF VQP+QPNLQ
Sbjct  177  ELDIGYHQKD-REYAAQMPITFRVQPIQPNLQ  207



>ref|XP_008805866.1| PREDICTED: MADS-box transcription factor 2-like isoform X2 [Phoenix 
dactylifera]
Length=210

 Score =   243 bits (619),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 130/213 (61%), Positives = 163/213 (77%), Gaps = 7/213 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVTFSKRRNG++KKA+EISVLCDA+VSV+IF SSGKM E  S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTFSKRRNGIIKKAREISVLCDAQVSVVIFSSSGKMSECCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  L  +L++Y   +GK+LWD KHENL  EI+RIKKENDNMQIELRHLKGED++SLN +E
Sbjct  61   STTLPRMLEKYQLNSGKKLWDLKHENLNVEIDRIKKENDNMQIELRHLKGEDLNSLNPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L ++EDALQNGL S+  KQME  R L K     + + EEN+ L++ L   E+ AMN N+ 
Sbjct  121  LNLIEDALQNGLASVRGKQMEFLRKLKK---NERLLEEENKHLTFLLHHQEL-AMNANVR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQD  769
            E+ E+    +  D+ SQ+P  F VQP+QPNLQ+
Sbjct  177  EL-ELGYPLKDRDFASQIPIAFRVQPIQPNLQE  208



>gb|AFO83619.1| PISTILLATA-like protein [Fagopyrum tataricum]
Length=213

 Score =   243 bits (619),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 124/216 (57%), Positives = 167/216 (77%), Gaps = 12/216 (6%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIENSSNRQVT+SKRRNG++KKAKEI+VLCDA+VS++IFGSSGKMHE+ S 
Sbjct  1    MGRGKIEIKRIENSSNRQVTYSKRRNGIIKKAKEITVLCDAKVSLVIFGSSGKMHEYCSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             +++VD+LD+Y   +G+RLWDAKHENL NEI+R+KKEN ++QIELRHL+GEDI+SL Y++
Sbjct  61   NTTVVDVLDKYQSQSGQRLWDAKHENLSNEIDRVKKENGDLQIELRHLRGEDITSLPYQD  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMN---R  661
            L+ +E AL NGL +ISE+QME+ +   K     + + EE+ +L+Y  ++ +  AM    R
Sbjct  121  LIRMEAALNNGLTTISERQMELMKMHQK---NGRLLEEESRELAYVFQEKQQMAMEGSMR  177

Query  662  NLGEMGEVFNQRESNDYESQMPFTFSVQPMQPNLQD  769
             +   G       +++ E QMPF F VQPMQPNLQ+
Sbjct  178  GMDNNGFAI----ADENEQQMPFGFRVQPMQPNLQE  209



>gb|ACD85113.1| B-class MADS-box protein PI [Oncidium hybrid cultivar]
 gb|ADJ67236.1| MADS box transcription factor 8 [Oncidium hybrid cultivar]
Length=210

 Score =   243 bits (619),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 126/212 (59%), Positives = 167/212 (79%), Gaps = 7/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVTFSKRRNG++KKAKEISVLCDA+VS++IF S GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTFSKRRNGIMKKAKEISVLCDAQVSLVIFSSLGKMFEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  L  +L++Y + +GK+LWDAKHENL  EI+RIKKENDNMQIELRHLKGED++SLN +E
Sbjct  61   STTLSKMLEKYQQNSGKKLWDAKHENLSAEIDRIKKENDNMQIELRHLKGEDLNSLNPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+ALQNGL  + +KQM+  + L K     + + EEN++L+Y L   ++ AM  ++ 
Sbjct  121  LIPIEEALQNGLTGVRDKQMDFLKMLKK---NERMLEEENKRLAYLLHHQQL-AMEGSMR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
            E+   F+Q++  +Y +QMP TF VQP+QPNLQ
Sbjct  177  ELDIGFHQKD-REYAAQMPMTFRVQPIQPNLQ  207



>gb|ACD85106.1| B-class MADS-box protein PI [Liparis distans]
Length=210

 Score =   242 bits (618),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 126/212 (59%), Positives = 168/212 (79%), Gaps = 7/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVTFSKRRNG++KKAKEISVLCDA+VS++IF S GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTFSKRRNGIMKKAKEISVLCDAQVSLVIFSSLGKMFEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  L  +L++Y + +GK+LWDAKHENL  EI+RIKKENDNMQIELRHLKGED++SLN +E
Sbjct  61   STTLSKMLEKYQQNSGKKLWDAKHENLSAEIDRIKKENDNMQIELRHLKGEDLNSLNPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+ALQNGL S+ +KQM+  + L K     + + EEN++L+Y L   ++ AM  ++ 
Sbjct  121  LIPIEEALQNGLGSVRDKQMDFLKMLKK---NERMLEEENKRLTYLLHHQQL-AMEGSMR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
            E+   ++Q++  +Y +QMP TF VQP+QPNLQ
Sbjct  177  ELDIGYHQKD-REYAAQMPLTFRVQPIQPNLQ  207



>gb|ACD85121.1| B-class MADS-box protein PI [Phaius tancarvilleae]
Length=210

 Score =   242 bits (618),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 126/212 (59%), Positives = 167/212 (79%), Gaps = 7/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVTFSKRRNG++KKAKEISVLCDA+VS++IF S GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTFSKRRNGIMKKAKEISVLCDAQVSLVIFSSLGKMFEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  L  +L++Y + +GK+LWDAKHENL  EI+RIKKENDNMQIELRHLKGED++SLN +E
Sbjct  61   STTLSKMLEKYQQNSGKKLWDAKHENLSAEIDRIKKENDNMQIELRHLKGEDLNSLNPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+ALQNGL  + +KQME  + L K     + + EEN++L+Y L   ++ AM  ++ 
Sbjct  121  LIPIEEALQNGLSGVRDKQMEFLKMLKK---NERMLEEENKRLTYLLHHQQL-AMEGSMR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
            E+   ++Q++  +Y +QMP TF VQP+QPNLQ
Sbjct  177  ELDIGYHQKD-REYAAQMPMTFRVQPIQPNLQ  207



>gb|ADM72971.1| PISTILLATA-like protein 4 [Platanus x acerifolia]
Length=210

 Score =   242 bits (618),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 163/212 (77%), Gaps = 7/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIEN +NRQVT+SKR+NG++KKA+E++VLCDA+V++IIF SSGKM E+ S 
Sbjct  1    MGRGKIEIKRIENLTNRQVTYSKRKNGIIKKARELTVLCDAKVNLIIFSSSGKMSEYHSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  + +IL  YHK +G+RLWDAKHE L NE++RIKKENDNMQIELRHLKGED++SL++++
Sbjct  61   SITMTEILGMYHKYSGQRLWDAKHEFLSNELDRIKKENDNMQIELRHLKGEDVNSLHHKD  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L  +E+ALQ GL  +  K+ME  + L K     + + EEN+ LSY L   E+ AM+ N  
Sbjct  121  LQNIEEALQKGLSKVRAKEMEFLKTLKK---NEKNLEEENKHLSYMLHHQEM-AMSGNTR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
             M   ++Q+E  D+ SQMPF F VQP+QPNLQ
Sbjct  177  AMENEYHQKER-DHHSQMPFNFRVQPIQPNLQ  207



>gb|ABW96391.2| PI-related protein [Dendrobium moniliforme]
Length=210

 Score =   242 bits (618),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 125/212 (59%), Positives = 168/212 (79%), Gaps = 7/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIENS+NRQVTFSKRRNG++KKAKEISVLCDA+VS++IF S GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTFSKRRNGIMKKAKEISVLCDAQVSLVIFSSLGKMFEYCSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             +SL  +L++Y + +GK+LWDAKHENL  EI+RIKKENDNMQIELRHLKGED++SLN +E
Sbjct  61   STSLSKMLEKYQQNSGKKLWDAKHENLSAEIDRIKKENDNMQIELRHLKGEDLNSLNPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+ALQNGL  + +KQM+  + L K     + + EEN++L+Y L   ++ AM  ++ 
Sbjct  121  LIPIEEALQNGLTGVRDKQMDFLKMLKK---NERMLEEENKRLTYLLHHQQL-AMEGSMR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
            E+   ++Q++  +Y +QMP TF VQP+QPNLQ
Sbjct  177  ELDIGYHQKD-REYAAQMPLTFRVQPIQPNLQ  207



>gb|AFN68760.1| PISTILLATA-like protein [Magnolia zenii]
 gb|AFN68764.1| PISTILLATA-like protein [Magnolia denudata]
 gb|AFN68768.1| PISTILLATA-like protein [Magnolia liliiflora]
Length=212

 Score =   242 bits (618),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 124/212 (58%), Positives = 164/212 (77%), Gaps = 7/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVT+SKRR G++KKAKEI+VLCDA+VS++IF S+GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRGGIMKKAKEITVLCDAQVSLVIFSSTGKMSEYCSP  60

Query  317  S--LVDILDQYHKLTG-KRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYR  487
            S  LV ILD+YHK  G ++LWDAKHE+L NE+ RIKKEND+MQI+LRHLKGEDI+SL  +
Sbjct  61   STELVKILDRYHKNAGVQKLWDAKHEHLSNELERIKKENDSMQIKLRHLKGEDINSLQPK  120

Query  488  ELMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNL  667
            EL+ +E+AL+NGL  +  +QM+  + L K     + + E+N +LSY L+  +  AM+ N+
Sbjct  121  ELIPIEEALENGLACVRSRQMQYLKRLKK---NERSLEEDNRRLSYILQHQQQLAMDVNV  177

Query  668  GEMGEVFNQRESNDYESQMPFTFSVQPMQPNL  763
             EM   ++QRE  +Y  QMPF F VQP+QPNL
Sbjct  178  REMDHGYHQRE-REYHPQMPFAFRVQPIQPNL  208



>gb|ACD85100.1| B-class MADS-box protein PI [Galeola falconeri]
Length=210

 Score =   242 bits (618),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 125/212 (59%), Positives = 168/212 (79%), Gaps = 7/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIENS+NRQVTFSKRRNG++KKA+EISVLCDA+VS++IF S GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTFSKRRNGIMKKAREISVLCDAQVSLVIFSSLGKMSEYCSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             +SL  +L++Y + +GK+LWD+KHENL  EI+RIKKENDNMQIELRHLKGED++SLN +E
Sbjct  61   STSLPKMLERYQQNSGKKLWDSKHENLSAEIDRIKKENDNMQIELRHLKGEDLNSLNPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+ALQNGL  + +KQM+  + L K     + + EEN++L+Y L   ++ AM  ++ 
Sbjct  121  LIPIEEALQNGLSGVRDKQMDFLKMLKK---NERMLEEENKRLTYLLHHQQL-AMEGSMR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
            E+   F+Q++  DY SQMP +F VQP+QPNLQ
Sbjct  177  ELDISFHQKD-RDYASQMPMSFHVQPIQPNLQ  207



>ref|XP_006434291.1| hypothetical protein CICLE_v10002471mg [Citrus clementina]
 gb|ESR47531.1| hypothetical protein CICLE_v10002471mg [Citrus clementina]
Length=211

 Score =   242 bits (618),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 129/218 (59%), Positives = 163/218 (75%), Gaps = 14/218 (6%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIEN+SNRQVT+SKRRNG+LKKAKEI+VLCDA+VS+II+ SSGKMH++ S 
Sbjct  1    MGRGKIEIKRIENASNRQVTYSKRRNGILKKAKEITVLCDAKVSLIIYASSGKMHDYCSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             +SLVDIL+QYH+ +G+RLWD KHENL NEI RIK+END MQI+LRHL GEDISSLN +E
Sbjct  61   STSLVDILEQYHRQSGRRLWDPKHENLSNEIERIKRENDRMQIKLRHLNGEDISSLNPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ LEDAL+NGL SI +KQ E    + K     + + EE+  L + LRQ EIA   + L 
Sbjct  121  LIALEDALENGLVSIRDKQSEKMETMRK---NGKMMEEEHNYLKFVLRQQEIARQQQELA  177

Query  671  ----EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
                   E+  QRE++       + + VQP+QPNLQ+R
Sbjct  178  MENSVSAEIDYQRENHH-----DYAYHVQPIQPNLQER  210



>gb|AFN68743.1| PISTILLATA-like protein [Magnolia sprengeri]
Length=212

 Score =   242 bits (617),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 124/212 (58%), Positives = 164/212 (77%), Gaps = 7/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVT+SKRR G++KKAKEI+VLCDA+VS++IF S+GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRGGIMKKAKEITVLCDAQVSLVIFSSTGKMSEYCSP  60

Query  317  S--LVDILDQYHKLTG-KRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYR  487
            S  LV ILD+YHK  G ++LWDAKHE+L NE+ RIKKEND+MQI+LRHLKGEDI+SL  +
Sbjct  61   STELVKILDRYHKNAGVQKLWDAKHEHLSNELERIKKENDSMQIKLRHLKGEDINSLQPK  120

Query  488  ELMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNL  667
            EL+ +E+AL+NGL  +  +QM+  + L K     + + E+N +LSY L+  +  AM+ N+
Sbjct  121  ELIPIEEALENGLACVRSRQMQYLKRLKK---NERSLEEDNRRLSYILQHQQQLAMDVNV  177

Query  668  GEMGEVFNQRESNDYESQMPFTFSVQPMQPNL  763
             EM   ++QRE  +Y  QMPF F VQP+QPNL
Sbjct  178  REMEHGYHQRE-REYHPQMPFAFRVQPIQPNL  208



>gb|ABF67491.1| MADS-domain transcription factor [Marcgravia umbellata]
Length=196

 Score =   241 bits (616),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 121/201 (60%), Positives = 158/201 (79%), Gaps = 10/201 (5%)
 Frame = +2

Query  182  NRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSSS--LVDILDQYHKLT  355
            NRQVT+SKRRNG++KKAKEI+VLCD++VS++I GSSGK+HE+ S S  L DIL++YHK +
Sbjct  1    NRQVTYSKRRNGLIKKAKEITVLCDSKVSLVIIGSSGKIHEYCSPSTDLPDILEKYHKQS  60

Query  356  GKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRELMILEDALQNGLRSI  535
            GKRLWDAKHENL NEI+RIKKENDNMQIELRHLKGEDI+SL+Y+ELM+LEDAL+NGL S+
Sbjct  61   GKRLWDAKHENLSNEIDRIKKENDNMQIELRHLKGEDIASLHYKELMVLEDALENGLASV  120

Query  536  SEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLGEMGEVFN--QRESND  709
             +KQ EV++ +       + + E+N++L++ L Q E+A   R   EM  V+     +  D
Sbjct  121  RDKQTEVYKAMKT---NDRILEEKNKELTFVLHQKELAGERR---EMENVYGHPHHQLQD  174

Query  710  YESQMPFTFSVQPMQPNLQDR  772
            ++ QMPFTF VQ M PNLQ+R
Sbjct  175  FQPQMPFTFRVQLMHPNLQER  195



>gb|AAK77938.1| MADS box protein-like protein NGL9 [Medicago sativa]
Length=212

 Score =   242 bits (617),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 118/208 (57%), Positives = 166/208 (80%), Gaps = 5/208 (2%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEF--S  310
            MGRG+IEIKRIENSSNRQVT+SKR++G+LKKA EI+VLCDA+VS IIF  SGKMHE+   
Sbjct  1    MGRGKIEIKRIENSSNRQVTYSKRKSGILKKANEINVLCDAQVSTIIFAPSGKMHEYISP  60

Query  311  SSSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S++L+D+L++Y K +GKRLWDAKHENL NEI ++KKEN++M+I+LRHLKG+DI++LNY++
Sbjct  61   STTLIDMLERYQKASGKRLWDAKHENLRNEIEKLKKENEDMEIKLRHLKGKDINTLNYKK  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LM LED L+NGL +I +KQMEV++ +T+     + + EEN +L++ L+Q  +A       
Sbjct  121  LMSLEDVLENGLLTIRDKQMEVYQMVTR---NDKILEEENRELNFILQQQHMAVEGGREM  177

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQ  754
            +  + F++   +D+ SQMPF+F +QPMQ
Sbjct  178  DYNDEFDESSGSDFNSQMPFSFRLQPMQ  205



>gb|AFN68744.1| PISTILLATA-like protein [Magnolia sprengeri]
 gb|AFN68761.1| PISTILLATA-like protein [Magnolia zenii]
Length=211

 Score =   242 bits (617),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 125/212 (59%), Positives = 165/212 (78%), Gaps = 8/212 (4%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVT+SKRR G++KKAKEI+VLCDA+VS++IF S+GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRGGIMKKAKEITVLCDAQVSLVIFSSTGKMSEYCSP  60

Query  317  S--LVDILDQYHKLTG-KRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYR  487
            S  LV ILD+YHK  G ++LWDAKHE+L NE+ RIKKEND+MQI+LRHLKGEDI+SL  +
Sbjct  61   STELVKILDRYHKNAGVQKLWDAKHEHLSNELERIKKENDSMQIKLRHLKGEDINSLQPK  120

Query  488  ELMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNL  667
            EL+ +E+AL+NGL  +  +QM+  + L K     + + E+N +LSY L Q ++ AM+ N+
Sbjct  121  ELIPIEEALENGLACVRSRQMQYLKRLKK---NERSLEEDNRRLSYILHQQQL-AMDVNV  176

Query  668  GEMGEVFNQRESNDYESQMPFTFSVQPMQPNL  763
             EM   ++QRE  +Y  QMPF F VQP+QPNL
Sbjct  177  REMDHGYHQRE-REYHPQMPFAFRVQPIQPNL  207



>gb|AHM92092.1| MADS-box protein 16 [Erycina pusilla]
Length=211

 Score =   242 bits (617),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 125/212 (59%), Positives = 165/212 (78%), Gaps = 6/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVTFSKRRNG++KKAKEISVLCDA+VS++IF S GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTFSKRRNGIMKKAKEISVLCDAQVSLVIFSSLGKMFEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  L  +L++Y + +GK+LWDAKHENL  EI+RIKKENDNMQIELRHLKGED++SLN +E
Sbjct  61   STTLSKMLEKYQQNSGKKLWDAKHENLSAEIDRIKKENDNMQIELRHLKGEDLNSLNPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+ALQNGL  + +KQM+  + L K     + + EEN++L+Y L   ++ AM  ++ 
Sbjct  121  LIPIEEALQNGLTGVRDKQMDFLKMLKK---NERMLEEENKRLAYLLHHQQL-AMEGSMR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
            E+   F+Q++     +QMP TF VQP+QPNLQ
Sbjct  177  ELDIGFHQKDREYAAAQMPMTFRVQPIQPNLQ  208



>gb|ADI58461.1| GLOBOSA [Cymbidium goeringii]
Length=210

 Score =   241 bits (616),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 125/212 (59%), Positives = 167/212 (79%), Gaps = 7/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIENS+NRQVTFSKRRNG++KKAKEISVLCDA+VS++IF S GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTFSKRRNGIMKKAKEISVLCDAQVSLVIFSSLGKMFEYCSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             ++L  IL++Y + +GK+LWDAKHENL  EI+RIKKENDNMQIELRHLKGED++SLN +E
Sbjct  61   ATTLSKILEKYQQNSGKKLWDAKHENLSAEIDRIKKENDNMQIELRHLKGEDLNSLNPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+ LQNGL S+  KQM+  + L K     + + EEN++L+Y L   ++ AM  ++ 
Sbjct  121  LIPIEETLQNGLTSVRNKQMDFLKMLKK---NERMLEEENKRLTYLLHHQQL-AMEGSMR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
            E+   ++Q++  +Y +QMP TF VQP+QPNLQ
Sbjct  177  ELDIGYHQKD-REYAAQMPMTFRVQPIQPNLQ  207



>gb|AFM75882.1| PISTILLATA-like protein [Magnolia wufengensis]
Length=212

 Score =   242 bits (617),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 124/212 (58%), Positives = 164/212 (77%), Gaps = 7/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVT+SKRR G++KKAKEI+VLCDA+VS++IF S+GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRGGIMKKAKEITVLCDAQVSLVIFSSTGKMSEYCSP  60

Query  317  S--LVDILDQYHKLTG-KRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYR  487
            S  LV ILD+YHK  G ++LWDAKHE+L NE+ RIKKEND+MQI+LRHLKGEDI+SL  +
Sbjct  61   STELVKILDRYHKNAGVQKLWDAKHEHLSNELERIKKENDSMQIKLRHLKGEDINSLQPK  120

Query  488  ELMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNL  667
            EL+ +E+AL+NGL  +  +QM+  + L K     + + E+N +LSY L+  +  AM+ N+
Sbjct  121  ELIPVEEALENGLACVRSRQMQYLKRLKK---NERSLEEDNRRLSYILQHQQQLAMDVNV  177

Query  668  GEMGEVFNQRESNDYESQMPFTFSVQPMQPNL  763
             EM   ++QRE  +Y  QMPF F VQP+QPNL
Sbjct  178  REMEHGYHQRE-REYHPQMPFAFRVQPIQPNL  208



>ref|XP_003523422.1| PREDICTED: LOW QUALITY PROTEIN: floral homeotic protein PMADS 
2-like [Glycine max]
Length=207

 Score =   241 bits (616),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 133/219 (61%), Positives = 169/219 (77%), Gaps = 20/219 (9%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEF--S  310
            MGRG+IEIKRIENSSNRQVT+SKR+NG+LKKAKEISVLCDA+VS+IIFG SGKMHE+   
Sbjct  1    MGRGKIEIKRIENSSNRQVTYSKRKNGILKKAKEISVLCDAQVSLIIFGVSGKMHEYISP  60

Query  311  SSSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S++L+D+LD+Y + +GK LWDAKHENL NEI+RIKKEND+MQIELRHLKGEDI+SLNY+E
Sbjct  61   STTLIDVLDRYQRASGKTLWDAKHENLSNEIDRIKKENDSMQIELRHLKGEDITSLNYKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQ---LEIAA--M  655
            LM LEDAL+NGL  + EK+MEV R + KR D+   + E+N++L++ L+Q   LE     M
Sbjct  121  LMALEDALENGLSGVREKKMEVHR-MFKRNDKI--LEEQNKELNFLLQQHLALEGVGNMM  177

Query  656  NRNLGEMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
            +    E+  VFN        S M    S++  QPNL++R
Sbjct  178  DNGFNEIKRVFN--------SHMQRAASLK--QPNLKER  206



>gb|ADW76860.1| PI/GLO [Cymbidium faberi]
 gb|AFH66786.1| PI-like MADS-box 2 protein [Cymbidium ensifolium]
Length=210

 Score =   241 bits (616),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 126/212 (59%), Positives = 166/212 (78%), Gaps = 7/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVTFSKRRNG++KKAKEISVLCDA+VS++IF S GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTFSKRRNGIMKKAKEISVLCDAQVSLVIFSSLGKMFEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  L  IL++Y + +GK+LWDAKHENL  EI+RIKKENDNMQIELRHLKGED++SLN +E
Sbjct  61   STTLSKILEKYQQNSGKKLWDAKHENLSAEIDRIKKENDNMQIELRHLKGEDLNSLNPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+ LQNGL S+  KQM+  + L K     + + EEN++L+Y L   ++ AM  ++ 
Sbjct  121  LIPIEETLQNGLTSVRNKQMDFLKMLKK---NERMLEEENKRLTYLLHHQQL-AMEGSMR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
            E+   ++Q++  +Y +QMP TF VQP+QPNLQ
Sbjct  177  ELDIGYHQKD-REYAAQMPMTFRVQPIQPNLQ  207



>gb|ACD85096.1| B-class MADS-box protein PI [Dendrobium hybrid cultivar]
Length=210

 Score =   241 bits (616),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 125/212 (59%), Positives = 167/212 (79%), Gaps = 7/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVTFSKRRNG++KKAKEISVLCDA+VS++IF S GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTFSKRRNGIMKKAKEISVLCDAQVSLVIFSSLGKMFEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  L  +L++Y + +GK+LWDAKHENL  EI+RIKKENDNMQIELRHLKGED++SLN +E
Sbjct  61   STTLSKMLEKYQQNSGKKLWDAKHENLSAEIDRIKKENDNMQIELRHLKGEDLNSLNPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+ALQNGL  + +KQM+  + L K     + + EEN++L+Y L   ++ AM  ++ 
Sbjct  121  LIPIEEALQNGLTGVRDKQMDFLKMLKK---NERMLEEENKRLTYLLHHQQL-AMEGSMR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
            E+   ++Q++  +Y +QMP TF VQP+QPNLQ
Sbjct  177  ELDIGYHQKD-REYAAQMPLTFRVQPIQPNLQ  207



>gb|ABQ85947.1| MADS-box transcription factor PI-like 2 [Trochodendron aralioides]
Length=211

 Score =   241 bits (616),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 126/215 (59%), Positives = 167/215 (78%), Gaps = 8/215 (4%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENSSNRQVT+SKR+NG+LKKA+EI+VLCDA+VS++I  SSGKMH + S 
Sbjct  1    MGRGKIEIKRIENSSNRQVTYSKRKNGILKKAREITVLCDAQVSLVILASSGKMHYYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLN-YR  487
            S  L +ILD+YHK  G++LWDAKHE L NE+ RIKKEND MQIELRHLKGEDI +++ ++
Sbjct  61   STTLTEILDRYHKNAGEKLWDAKHEYLSNEVERIKKENDRMQIELRHLKGEDIFNMHSHK  120

Query  488  ELMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNL  667
            EL+ +E+AL+NGL ++  K ME    + KR    + + EEN+QL+Y L Q ++ AM+ ++
Sbjct  121  ELISIEEALENGLANVRYKTMEY---VEKRRKNERKLEEENKQLTYYLHQQQM-AMDGSV  176

Query  668  GEMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
             EM   ++++E   Y  QMPFTF V PMQPNLQ+R
Sbjct  177  REMENEYHEKERG-YPPQMPFTFRVLPMQPNLQER  210



>gb|AFN68769.1| PISTILLATA-like protein [Magnolia liliiflora]
Length=212

 Score =   241 bits (616),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 163/212 (77%), Gaps = 7/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVT+SKRR G++KKAKEI+VLCDA+VS++IF S+GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRGGIMKKAKEITVLCDAQVSLVIFSSTGKMSEYCSP  60

Query  317  S--LVDILDQYHKLTG-KRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYR  487
            S  LV ILD+YHK  G ++LWDAKHE+L NE+ RIKKEND MQI+LRHLKGEDI+SL  +
Sbjct  61   STELVKILDRYHKNAGVQKLWDAKHEHLSNELERIKKENDRMQIKLRHLKGEDINSLQPK  120

Query  488  ELMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNL  667
            EL+ +E+AL+NGL  +  +QM+  + L K     + + E+N +LSY L+  +  AM+ N+
Sbjct  121  ELIPIEEALENGLACVRSRQMQCLKTLKK---NERSLEEDNRRLSYILQHQQQLAMDVNV  177

Query  668  GEMGEVFNQRESNDYESQMPFTFSVQPMQPNL  763
             EM   ++QRE  +Y  Q+PF F VQP+QPNL
Sbjct  178  REMDHGYHQRE-REYHHQVPFAFRVQPIQPNL  208



>gb|AAV28175.1| MADS box PI-like protein 9 [Phalaenopsis hybrid cultivar]
 gb|AAV83997.1| MADS box protein 6 [Phalaenopsis equestris]
Length=210

 Score =   241 bits (616),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 125/212 (59%), Positives = 168/212 (79%), Gaps = 7/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVTFSKRRNG++KKAKEISVLCDA+VS++IF S GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTFSKRRNGIMKKAKEISVLCDAQVSLVIFSSLGKMFEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  L  +L++Y + +GK+LWDAKHENL  EI+RIKKENDNMQIELRHLKGED++SLN +E
Sbjct  61   STTLSKMLEKYQQNSGKKLWDAKHENLSAEIDRIKKENDNMQIELRHLKGEDLNSLNPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+ALQNGL S+ +KQM+  + L K     + + +EN++L+Y L Q ++ AM  ++ 
Sbjct  121  LIPIEEALQNGLTSVRDKQMDYLKMLKK---NERMLEDENKRLTYLLHQQQM-AMEGSMR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
            E+   ++ ++  +Y +QMP TF VQP+QPNLQ
Sbjct  177  ELDIGYHHKD-REYAAQMPMTFRVQPIQPNLQ  207



>gb|ACD85088.1| B-class MADS-box protein PI-2 [Anoectochilus formosanus]
Length=210

 Score =   241 bits (615),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 125/212 (59%), Positives = 166/212 (78%), Gaps = 7/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIENS+NRQVTFSKRRNG++KKAKEISVLCDA+VS++IF S GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTFSKRRNGIMKKAKEISVLCDAQVSLVIFSSLGKMFEYCSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             +SL  +L++Y + +GK+LWDAKHENL  EI+RIKKENDNMQIELRHLKGED++SLN +E
Sbjct  61   STSLSKMLEKYQQNSGKKLWDAKHENLSAEIDRIKKENDNMQIELRHLKGEDLNSLNPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+ALQNGL S+ +KQME  + L K     + + EEN++L+Y L   ++ AM  ++ 
Sbjct  121  LIPIEEALQNGLASVRDKQMEFLKMLKK---NERMLEEENKRLTYLLHHQQL-AMEGSMR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
            E+   ++Q++  DY   +P  F VQP+QPNLQ
Sbjct  177  ELDISYHQKD-RDYAPPIPIAFRVQPIQPNLQ  207



>gb|AFM75883.1| PISTILLATA-like protein [Magnolia wufengensis]
Length=211

 Score =   241 bits (615),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 125/212 (59%), Positives = 165/212 (78%), Gaps = 8/212 (4%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVT+SKRR G++KKAKEI+VLCDA+VS++IF S+GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRGGIMKKAKEITVLCDAQVSLVIFSSTGKMSEYCSP  60

Query  317  S--LVDILDQYHKLTG-KRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYR  487
            S  LV ILD+YHK  G ++LWDAKHE+L NE+ RIKKEND+MQI+LRHLKGEDI+SL  +
Sbjct  61   STELVKILDRYHKNAGVQKLWDAKHEHLSNELERIKKENDSMQIKLRHLKGEDINSLQPK  120

Query  488  ELMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNL  667
            EL+ +E+AL+NGL  +  +QM+  + L K     + + E+N +LSY L Q ++ AM+ N+
Sbjct  121  ELIPVEEALENGLACVRSRQMQYLKRLKK---NERSLEEDNRRLSYILHQQQL-AMDVNV  176

Query  668  GEMGEVFNQRESNDYESQMPFTFSVQPMQPNL  763
             EM   ++QRE  +Y  QMPF F VQP+QPNL
Sbjct  177  REMEHGYHQRE-REYHPQMPFAFRVQPIQPNL  207



>ref|XP_004142638.1| PREDICTED: LOW QUALITY PROTEIN: floral homeotic protein PMADS 
2-like [Cucumis sativus]
Length=201

 Score =   241 bits (614),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 128/214 (60%), Positives = 160/214 (75%), Gaps = 16/214 (7%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENSSNRQVT+SKRRNG++KKAKEI+VLCDA+VS++IF SSGKMHE+ S 
Sbjct  1    MGRGKIEIKRIENSSNRQVTYSKRRNGIIKKAKEITVLCDAQVSLVIFASSGKMHEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  LVDILD+YHK +GKRLWDAKHE +       K EN N     RHL+GEDI+SLNY+E
Sbjct  61   STPLVDILDKYHKQSGKRLWDAKHERIMR-----KXENKN-----RHLRGEDITSLNYKE  110

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LM LE+AL+NGL  + EKQ E  + +       + + EEN++L+Y L Q E+ AM  ++ 
Sbjct  111  LMALEEALENGLTGVREKQSEFMKMMR---TNERMMEEENKRLNYELYQKEMVAMGDSVR  167

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
            EM   +NQR   D+ SQMPF F VQP+QPNLQ+R
Sbjct  168  EMDIGYNQR-MRDFNSQMPFAFRVQPIQPNLQER  200



>gb|AEM60219.1| MADS box transcription factor, partial [Buddleja davidii]
Length=189

 Score =   240 bits (613),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/191 (62%), Positives = 153/191 (80%), Gaps = 7/191 (4%)
 Frame = +2

Query  212  NGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSSS--LVDILDQYHKLTGKRLWDAKHE  385
            NG++KKAKEISVLCDA+VSVIIF +SGKMHEF S S  LVD+LDQYHKL+GKRLWDAKHE
Sbjct  1    NGIMKKAKEISVLCDAQVSVIIFATSGKMHEFCSPSTTLVDMLDQYHKLSGKRLWDAKHE  60

Query  386  NLENEINRIKKENDNMQIELRHLKGEDISSLNYRELMILEDALQNGLRSISEKQMEVWRN  565
            +L+NEINRIKKEND MQIELRHLKGEDIS+LNY+ELM+LE+AL+NG+ ++  KQME  R 
Sbjct  61   HLDNEINRIKKENDGMQIELRHLKGEDISTLNYKELMVLEEALENGISTLKAKQMEFVRM  120

Query  566  LTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRN-LGEMGEVFNQRE-SNDYESQMPFTFS  739
            + K    ++ + +EN+ L ++LR + +  M+ N + E   V++  +   D+E+QMPF F 
Sbjct  121  MRK---HNEMIEDENQNLQFKLRLMHLDPMDDNHVMEAQGVYDHHQVVADHEAQMPFAFR  177

Query  740  VQPMQPNLQDR  772
            VQPMQPNLQ+R
Sbjct  178  VQPMQPNLQER  188



>gb|AAW78032.1| PISTILLATA-like protein [Thalictrum dioicum]
Length=214

 Score =   241 bits (615),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 127/219 (58%), Positives = 169/219 (77%), Gaps = 15/219 (7%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEF---  307
            MGRG+IEIKRIEN +NRQVT+SKRRNG+LKKA+EI VLCDA ++++I  S+GKM ++   
Sbjct  1    MGRGKIEIKRIENPTNRQVTYSKRRNGILKKAREIHVLCDAEIALVISSSTGKMSDYISP  60

Query  308  -----SSSSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDIS  472
                 SSSSL+ ILD+Y K +GK+LWDAKHE L +E++RIKKEND+MQIELRHLKGEDI+
Sbjct  61   STTSPSSSSLIKILDKYQKTSGKKLWDAKHEYLSSELDRIKKENDSMQIELRHLKGEDIT  120

Query  473  SLNYRELMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAA  652
            SLN +EL+ +E+AL NGL  I +K+ +VW  ++K    +  + EEN++LSY L  LEI  
Sbjct  121  SLNAKELIPIEEALLNGLSKIRDKKTDVWSMMSK---NTALLEEENKRLSYHLHSLEIGG  177

Query  653  MNRNLGEMGEVFNQRESNDYESQMPFTFSVQPMQPNLQD  769
             +R++ E G  +NQ+   DY +QMPFTF VQP+QPNLQ+
Sbjct  178  SDRDM-ENG--YNQK-GRDYPAQMPFTFRVQPIQPNLQE  212



>gb|ACR16048.1| GLOBOSA-like MADS-box transcription factor [Phragmipedium longifolium]
Length=210

 Score =   240 bits (613),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 126/212 (59%), Positives = 166/212 (78%), Gaps = 7/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVTFSKRRNG++KKAKEISVLCDA+VS++IF S GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTFSKRRNGIMKKAKEISVLCDAQVSLVIFSSLGKMSEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  L  +L++Y + +GK+LWDAKHENL  EI+RIKKENDNMQIELRHLKGED++SLN +E
Sbjct  61   STTLSKMLEKYQQNSGKKLWDAKHENLSAEIDRIKKENDNMQIELRHLKGEDLNSLNPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+ALQNGL S+ +KQM   + L K     + + EEN++L+Y L   E+ AM  ++ 
Sbjct  121  LIPIEEALQNGLTSVRDKQMNFLKMLKK---NERMLEEENKRLTYLLHHQEL-AMEGSMR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
            E+   ++Q++  +Y +QMP  F VQP+QPNLQ
Sbjct  177  ELDISYHQKD-REYGNQMPMAFRVQPIQPNLQ  207



>gb|ACD85108.1| B-class MADS-box protein PI-2 [Ludisia discolor]
Length=210

 Score =   240 bits (613),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 125/212 (59%), Positives = 166/212 (78%), Gaps = 7/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIENS+NRQVTFSKRRNG++KKAKEISVLCDA+VS++IF S GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTFSKRRNGIMKKAKEISVLCDAQVSLVIFSSLGKMFEYCSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             +SL  +L++Y + +GK+LWDAKHENL  EI+RIKKENDNMQIELRHLKGED++SLN +E
Sbjct  61   STSLSKMLEKYQQNSGKKLWDAKHENLSAEIDRIKKENDNMQIELRHLKGEDLNSLNPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+ALQNGL S+ +KQME  + L K     + + EEN++L+Y L   ++ AM  ++ 
Sbjct  121  LIPIEEALQNGLASVRDKQMEFLKMLKK---NERMLEEENKRLTYLLHHQQL-AMEGSMR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
            E+   ++Q++  DY   +P  F VQP+QPNLQ
Sbjct  177  ELDIGYHQKD-RDYPPPIPMAFRVQPIQPNLQ  207



>gb|AFO83617.1| PISTILLATA-like protein [Fagopyrum esculentum]
Length=213

 Score =   240 bits (612),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 122/214 (57%), Positives = 166/214 (78%), Gaps = 8/214 (4%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIENSSNRQVT++KRRNG++KKAKEI+VLCDA+VS++IF SSG+MHE+ S 
Sbjct  1    MGRGKIEIKRIENSSNRQVTYTKRRNGIIKKAKEITVLCDAKVSLVIFASSGRMHEYCSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             +++VD+LD+Y   +G+RLWDAKHENL NEI+R+KKEN ++QIELRHL+GEDI+SL Y++
Sbjct  61   NTTVVDVLDKYQSQSGQRLWDAKHENLSNEIDRVKKENGDLQIELRHLRGEDITSLPYQD  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E AL NGL +ISE+QME+ +   K     + + EE+ +L+Y  ++ +  AM  ++ 
Sbjct  121  LIRMEAALNNGLTAISERQMELMKMHQK---NGRLLEEESRELAYVFQEKQQMAMEGSMR  177

Query  671  EM-GEVFNQRESNDYESQMPFTFSVQPMQPNLQD  769
             M    F   + N  E QMPF F VQPMQPNLQ+
Sbjct  178  AMDNNGFAMADEN--EQQMPFGFRVQPMQPNLQE  209



>gb|AIE44762.1| putative MADS-domain transcription factor PI2 [Liriodendron tulipifera]
Length=209

 Score =   239 bits (611),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 120/214 (56%), Positives = 169/214 (79%), Gaps = 7/214 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEI+RIEN +NRQVT+SKRRNG+LKKAKEI+VLCDA VS++IF S+GKM E+ SS
Sbjct  1    MGRGKIEIRRIENLANRQVTYSKRRNGILKKAKEITVLCDAEVSLVIFSSTGKMSEYCSS  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  L+ +LD+Y K TGK+LWDAKHE L  E++RIKKEND+M+++LRHLKGED++SL+ +E
Sbjct  61   SATLIKMLDRYQKATGKKLWDAKHEFLSKEVDRIKKENDSMRMKLRHLKGEDLTSLHPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+ALQ+GL ++  +Q+E+W+ L K     + + +EN+ LSY LR  ++  M+ N  
Sbjct  121  LIPIEEALQDGLTNVRSRQVELWKMLQK---NERKLEDENKHLSYILRHQQL-VMDMNER  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
            EMG  +++RES +Y   +P  F VQP+QPNLQ++
Sbjct  177  EMGYGYHERES-EYPLHVPCAFRVQPIQPNLQNK  209



>gb|ACY91915.1| MADS-domain transcription factor, partial [Saurauia zahlbruckneri]
Length=194

 Score =   239 bits (610),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 157/198 (79%), Gaps = 7/198 (4%)
 Frame = +2

Query  185  RQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS--SSLVDILDQYHKLTG  358
            RQVT+SKRRNG++KKAKEI+VLCDA+VS+++F SSGKMHE+ S  +SLV+ILD+YHK +G
Sbjct  1    RQVTYSKRRNGIIKKAKEITVLCDAKVSLVVFASSGKMHEYCSPSTSLVEILDKYHKASG  60

Query  359  KRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRELMILEDALQNGLRSIS  538
            KRLWDAKHENL NEI+RIKKENDNMQIELRHLKGEDI+SL+++ELM LE+AL+NGL  I 
Sbjct  61   KRLWDAKHENLSNEIDRIKKENDNMQIELRHLKGEDITSLHHKELMALEEALENGLAGIR  120

Query  539  EKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLGEMGEVFNQRESNDYES  718
             KQ E+++ + K       + +EN++LSY L Q ++  M    GEM   ++ +   +++ 
Sbjct  121  AKQSEIYKIMKK---NETMLEDENKRLSYMLHQ-KVMDMEGG-GEMENGYHDQRVQEFQP  175

Query  719  QMPFTFSVQPMQPNLQDR  772
            QMPF F VQP+QPNLQ+R
Sbjct  176  QMPFAFRVQPIQPNLQER  193



>gb|ACD85103.1| B-class MADS-box protein PI-2 [Habenaria petelotii]
Length=211

 Score =   239 bits (610),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 124/212 (58%), Positives = 164/212 (77%), Gaps = 6/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIENS+NRQVTFSKRRNG++KKAKEISVLCDA+VS++IF S GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTFSKRRNGIMKKAKEISVLCDAQVSLVIFSSLGKMFEYCSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             +SL  +L++Y + +GK+LWDAKHENL  EI+RIKKENDNMQIELRHLKGED++SLN +E
Sbjct  61   STSLSKMLEKYQQNSGKKLWDAKHENLSAEIDRIKKENDNMQIELRHLKGEDLNSLNPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+ALQNGL  + +KQME  + L K     + + EEN++L+Y L   ++ AM  ++ 
Sbjct  121  LIPIEEALQNGLTGVRDKQMEFLKMLKK---NERMLEEENKRLTYLLHHQQL-AMEGSMR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
            E+   ++Q++       MP TF VQP+QPNLQ
Sbjct  177  ELDIGYHQKDREYAPPPMPMTFRVQPIQPNLQ  208



>gb|ACY91917.1| MADS-domain transcription factor, partial [Symplocos chinensis]
Length=188

 Score =   238 bits (608),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 159/198 (80%), Gaps = 13/198 (7%)
 Frame = +2

Query  185  RQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS--SSLVDILDQYHKLTG  358
            RQVT+SKRRNG++KKAKEI++LCDA+VS++IF SSGKMHE+ S  +SL++ILD+Y K +G
Sbjct  1    RQVTYSKRRNGIIKKAKEITILCDAKVSLVIFASSGKMHEYCSPSTSLIEILDKYQKQSG  60

Query  359  KRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRELMILEDALQNGLRSIS  538
            +RLWDAKHENL NEI+RIKKENDNMQIELRHLKGEDI+SL+++ELM++E+AL+NG+ SI 
Sbjct  61   QRLWDAKHENLSNEIDRIKKENDNMQIELRHLKGEDITSLHHKELMVIEEALENGIASIR  120

Query  539  EKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLGEMGEVFNQRESN-DYE  715
            +KQME+   + K+ +    + EEN+ L+Y+L ++E        G+M   +NQ+  +  Y+
Sbjct  121  DKQMEIVEMMRKKENM---MEEENKHLNYKLMKIE-------GGQMENEYNQQVRDYQYQ  170

Query  716  SQMPFTFSVQPMQPNLQD  769
            SQMPFTF VQP  PNLQD
Sbjct  171  SQMPFTFRVQPFHPNLQD  188



>gb|ACR16053.1| GLOBOSA-like MADS-box transcription factor [Spiranthes odorata]
Length=210

 Score =   239 bits (610),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 124/212 (58%), Positives = 167/212 (79%), Gaps = 7/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIENS+NRQVTFSKRRNG++KKAKEISVLCDA+VS++IF S GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTFSKRRNGIMKKAKEISVLCDAQVSLVIFSSLGKMFEYCSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             +SL  +L++Y + +GK+LWDAKHENL  EI+RIKKENDNMQIELRHLKGED++SLN +E
Sbjct  61   STSLSKMLEKYQQNSGKKLWDAKHENLSAEIDRIKKENDNMQIELRHLKGEDLNSLNPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+ALQNGL S+ +KQM+  + L K     + + +EN++L+Y L   ++ AM  ++ 
Sbjct  121  LIPIEEALQNGLSSVRDKQMDFLKMLKK---NERLLEDENKRLTYLLHHQQL-AMEGSMR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
            E+   ++Q++  +Y   MP TF VQP+QPNLQ
Sbjct  177  ELDIGYHQKD-REYAPPMPMTFRVQPIQPNLQ  207



>gb|ACY91906.1| MADS-domain transcription factor, partial [Nyssa sylvatica]
Length=195

 Score =   238 bits (608),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 161/198 (81%), Gaps = 6/198 (3%)
 Frame = +2

Query  185  RQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSSS--LVDILDQYHKLTG  358
            RQVTF KRRNG++KKAKEI+VLCDA VS++I  SSGKMHE+ S S  L+D+LD+Y K +G
Sbjct  1    RQVTFCKRRNGLMKKAKEITVLCDAHVSLVILASSGKMHEYCSPSTNLIDVLDRYQKQSG  60

Query  359  KRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRELMILEDALQNGLRSIS  538
            K+LWDAKHENL NEI+RIKKEND+MQIELRHLKGEDI+SL++++LM +E+AL+NGL S+ 
Sbjct  61   KKLWDAKHENLSNEIDRIKKENDSMQIELRHLKGEDITSLHHKDLMAIEEALENGLASVR  120

Query  539  EKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLGEMGEVFNQRESNDYES  718
            +KQ+E+++ + K++D+   + EEN+ L+Y+LR  +  AM+ NL ++   + Q+   D++ 
Sbjct  121  DKQLEIYK-MIKKHDKM--LEEENKHLNYKLRWQQEMAMDGNLRDLENGYLQK-VRDFQP  176

Query  719  QMPFTFSVQPMQPNLQDR  772
            QMPF F VQP+QPNLQ+R
Sbjct  177  QMPFAFRVQPIQPNLQER  194



>gb|ACD85107.1| B-class MADS-box protein PI-1 [Ludisia discolor]
Length=209

 Score =   239 bits (609),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 127/213 (60%), Positives = 162/213 (76%), Gaps = 10/213 (5%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVTFSKRRNG++KKAKEISVLCDA+VS++IF S GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTFSKRRNGIMKKAKEISVLCDAQVSLVIFSSLGKMSEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  L  IL++Y + +GK+LWDA HENL  EI+RIKKENDNMQIELRHLKGED++SLN +E
Sbjct  61   STTLSKILEKYQQNSGKKLWDATHENLSAEIDRIKKENDNMQIELRHLKGEDLNSLNPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRL-RQLEIAAMNRNL  667
            L+ +E+ALQNGL S+  KQM+  + L K     + + EEN++L+Y L +QL I    R L
Sbjct  121  LIPIEEALQNGLTSVRSKQMDFLKMLKK---NEKMLEEENKRLTYLLHQQLNIEGSMREL  177

Query  668  GEMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
                ++   ++  +Y +QMP TF VQP QPNLQ
Sbjct  178  ----DISYHQKDREYANQMPMTFRVQPYQPNLQ  206



>ref|XP_010905324.1| PREDICTED: MADS-box transcription factor 2-like [Elaeis guineensis]
 gb|AAQ03229.1|AF411848_1 MADS box transcription factor [Elaeis guineensis]
Length=210

 Score =   239 bits (609),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 124/213 (58%), Positives = 164/213 (77%), Gaps = 7/213 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVTFSKRRNG++KKA+EISVLCDA+VS++IF SSGKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTFSKRRNGIIKKAREISVLCDAQVSLVIFSSSGKMSEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  L  +L++Y   +GK+LWD KHENL  EI+RIKKENDNMQIELRHLKG D++SLN +E
Sbjct  61   STTLSRLLEKYQVNSGKKLWDVKHENLSVEIDRIKKENDNMQIELRHLKGGDLNSLNPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+++ED LQNGL S+  KQM+  + L K     + + EEN+ L++ L   E+ AMN N+ 
Sbjct  121  LILIEDVLQNGLTSVRGKQMDFLKKLKK---NERLLEEENKHLTFLLHHQEL-AMNGNVR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQD  769
            E+ E+ +  ++ D+  Q+P  F VQP+QPNLQ+
Sbjct  177  EL-ELGDPLKARDFACQIPIAFRVQPIQPNLQE  208



>dbj|BAC75972.1| MADS-box transcription factor [Tulipa gesneriana]
Length=211

 Score =   239 bits (609),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 123/213 (58%), Positives = 163/213 (77%), Gaps = 6/213 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVTFSKRRNG++KKA+EISVLCDA VSV+IF SSGKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTFSKRRNGIIKKAREISVLCDAWVSVVIFSSSGKMSEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            +  L  +LD+Y +  G +LWDAKH+NL  EI+RIKKENDNMQIELRHLKGED++SL  +E
Sbjct  61   TITLPKMLDKYQQNCGNKLWDAKHQNLSEEIDRIKKENDNMQIELRHLKGEDLNSLQPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+AL+NG RS+ EKQ +V   L  R    + + E+N++L+Y L   +  AM+ N+ 
Sbjct  121  LIPIEEALENGFRSVREKQDDV---LMTRKKNMRLMEEDNKRLNYVLHHQQQQAMDENIR  177

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQD  769
            +M   ++Q+   ++ SQMP TF VQP+QPNL +
Sbjct  178  DMELAYHQKHR-EFNSQMPMTFRVQPIQPNLHE  209



>gb|ACD85117.1| B-class MADS-box protein PI [Paphiopedilum hybrid cultivar]
Length=210

 Score =   239 bits (609),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 124/212 (58%), Positives = 167/212 (79%), Gaps = 7/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIENS+NRQVTFSKRRNG++KKAKEISVLCDA+VS++IF S GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTFSKRRNGIMKKAKEISVLCDAQVSLVIFSSLGKMSEYCSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             ++L  +L++Y + +GK+LWDAKHENL  EI+RIKKENDNMQIELRHLKGED++SLN +E
Sbjct  61   ATTLSKMLEKYQQNSGKKLWDAKHENLSAEIDRIKKENDNMQIELRHLKGEDLNSLNPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+ALQNGL S+ +KQM   + L K     + + +EN++L+Y L   E+ AM  ++ 
Sbjct  121  LIPIEEALQNGLTSVRDKQMNFLKLLKK---NERMLEDENKRLTYLLHHQEL-AMEGSMR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
            E+   ++Q++  +Y +QMP  F VQP+QPNLQ
Sbjct  177  ELDISYHQKD-REYGNQMPMAFRVQPIQPNLQ  207



>gb|ACY91928.1| MADS-domain transcription factor, partial [Hymenandra wallichii]
Length=192

 Score =   238 bits (606),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 121/200 (61%), Positives = 155/200 (78%), Gaps = 12/200 (6%)
 Frame = +2

Query  182  NRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS--SSLVDILDQYHKLT  355
            +RQVT+SKRRNG++KKAKEISVLCDA+VS++IF SSGKMHE+ S  SSL++ILD Y K +
Sbjct  1    HRQVTYSKRRNGIIKKAKEISVLCDAQVSLVIFASSGKMHEYVSPNSSLINILDAYQKQS  60

Query  356  GKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRELMILEDALQNGLRSI  535
            G RLWDAKHENL +EI RIKKENDNMQIELRHLKGEDI+SL+++ELM +EDAL+NGL  I
Sbjct  61   GTRLWDAKHENLSHEIERIKKENDNMQIELRHLKGEDINSLHHKELMSIEDALENGLTCI  120

Query  536  SEKQMEVWRNLTKRY-DQSQGVAEENEQLSYRLRQLEIAAMNRNLGEMGEVFNQRESNDY  712
             E+QME++R   K + D+ + + +EN++LSY   Q+    M    GEM   +N      Y
Sbjct  121  RERQMEIYRTAKKNFADKERILEDENKRLSY---QMHHQVMEMESGEMENDYN------Y  171

Query  713  ESQMPFTFSVQPMQPNLQDR  772
            + QMPF+F VQP+QPNL +R
Sbjct  172  QPQMPFSFRVQPIQPNLHER  191



>gb|AEM60214.1| MADS box transcription factor, partial [Jasminum mesnyi]
Length=189

 Score =   237 bits (605),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/191 (61%), Positives = 151/191 (79%), Gaps = 7/191 (4%)
 Frame = +2

Query  212  NGMLKKAKEISVLCDARVSVIIFGSSGKMHEF--SSSSLVDILDQYHKLTGKRLWDAKHE  385
            NG++KKAKEISVLCDA+VSVIIF SSGKMHEF   S+SL+D+LDQYHKL+GK+LWDAKHE
Sbjct  1    NGIMKKAKEISVLCDAQVSVIIFASSGKMHEFVSPSTSLIDMLDQYHKLSGKKLWDAKHE  60

Query  386  NLENEINRIKKENDNMQIELRHLKGEDISSLNYRELMILEDALQNGLRSISEKQMEVWRN  565
            +L++EI RIKKE+D MQ ELRHL  EDI++LNY+ELM+LE+AL+NG+ S+  KQME    
Sbjct  61   HLDHEITRIKKESDRMQTELRHLSREDITTLNYKELMVLEEALENGISSLKAKQMEFVPM  120

Query  566  LTKRYDQSQGVAEENEQLSYRLRQLEIAAMN--RNLGEMGEVFNQRESNDYESQMPFTFS  739
            + K    ++ + +EN  L ++LRQ+ +  M+   N+ E G+V++Q    DYESQMPF F 
Sbjct  121  MRK---HNEMLEDENRGLQFKLRQMHLNPMDDHNNVMENGDVYHQHGVGDYESQMPFAFR  177

Query  740  VQPMQPNLQDR  772
            VQPMQPNLQDR
Sbjct  178  VQPMQPNLQDR  188



>ref|XP_010055971.1| PREDICTED: floral homeotic protein PMADS 2-like [Eucalyptus grandis]
Length=210

 Score =   238 bits (607),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 125/216 (58%), Positives = 167/216 (77%), Gaps = 11/216 (5%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIEN++NRQVT+SKRRNG++KKAKEISVLC+A+VS+IIFG S KMHE+ + 
Sbjct  1    MGRGKIEIKRIENTNNRQVTYSKRRNGLIKKAKEISVLCNAKVSLIIFGGSKKMHEYCTP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  L DILD+YH+  GKRLWDAKHENL  EI+RIKKENDN+QI+LRHL G+DI+SLN++E
Sbjct  61   STKLTDILDEYHRQCGKRLWDAKHENLNGEIDRIKKENDNLQIKLRHLNGQDINSLNHKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L++L+D L+NGL  + +++MEV  N  +R    + + EEN++L+Y  + L       N+ 
Sbjct  121  LIVLDDVLENGLAFVRDQKMEVI-NTHRR--NHKMLEEENKELNYYAQILSFY----NVL  173

Query  671  EMGEVFNQRESNDYES--QMPFTFSVQPMQPNLQDR  772
                + N ++  DY+S   MPFTF VQP+QPNLQ+R
Sbjct  174  FSLLLGNLQQLQDYKSHHHMPFTFRVQPLQPNLQER  209



>gb|ACR16043.1| GLOBOSA-like MADS-box transcription factor [Hypoxis villosa]
Length=210

 Score =   238 bits (607),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 121/213 (57%), Positives = 168/213 (79%), Gaps = 7/213 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIEN +NRQVTFSKRR+G++KKA+EISVLCDA+VS++IF S G++ EF S 
Sbjct  1    MGRGKIEIKRIENPTNRQVTFSKRRHGIIKKAREISVLCDAQVSLVIFSSLGRISEFCSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             +SL  IL++Y   +GK+LWDAKHENL  EI+RIKKENDNMQIELRHLKGED++SL+ +E
Sbjct  61   ATSLPKILEKYQTNSGKKLWDAKHENLSMEIDRIKKENDNMQIELRHLKGEDLNSLSPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +EDAL+NGL  + +KQ E+ + + K+    + + EEN++L+Y L   ++ AM  N+ 
Sbjct  121  LIPIEDALENGLIGVRDKQSEIMKMMKKK---GRLIEEENQKLTYMLHHQQL-AMEGNVR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQD  769
            E+ + + Q+ + +Y SQMP +F VQP+QPNLQ+
Sbjct  177  ELEQDYQQK-NREYASQMPISFRVQPIQPNLQE  208



>emb|CDP11931.1| unnamed protein product [Coffea canephora]
Length=193

 Score =   237 bits (605),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 123/214 (57%), Positives = 156/214 (73%), Gaps = 24/214 (11%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIEN++NR VT+SKR+ G++KKAKEI+VLCDA+VS+IIFG+SGKMHE+ S 
Sbjct  1    MGRGKIEIKRIENTNNRHVTYSKRKTGIMKKAKEITVLCDAKVSLIIFGTSGKMHEYISP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  LV++LD Y + TGK+LWDAKHENL NEI+R+KKEND+MQIELRHLKGEDI+SLNY+E
Sbjct  61   STNLVEMLDAYQRSTGKKLWDAKHENLSNEIDRVKKENDSMQIELRHLKGEDITSLNYKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LM                  E+ + + K     + + EEN+QL Y   Q E+A M   +G
Sbjct  121  LM-----------------SEIIKMIRK---TGEMLEEENKQLQYIWHQQEMANMKGAIG  160

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
            E  +V+ +    DY SQMPF F VQPMQPNL +R
Sbjct  161  ERDDVYQR--VRDYPSQMPFAFRVQPMQPNLHER  192



>gb|ACR16057.1| GLOBOSA-like MADS-box transcription factor [Vanilla planifolia]
Length=210

 Score =   238 bits (606),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 167/212 (79%), Gaps = 7/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIENS+NRQVTFSKRRNG++KKA+EISVLCDA+VS++IF S GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTFSKRRNGIMKKAREISVLCDAQVSLVIFSSLGKMSEYCSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             +SL  +L++Y + +GK+LWDAKHENL  EI+RIKKENDNMQIELRHLKGED++SLN +E
Sbjct  61   STSLPKMLERYQQNSGKKLWDAKHENLSAEIDRIKKENDNMQIELRHLKGEDLNSLNPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+ALQNGL  + +KQM+  + L K     + + EEN++L+Y L   ++ AM  ++ 
Sbjct  121  LIPIEEALQNGLSGVRDKQMDFLKMLKK---NERMLEEENKRLTYLLHHQQL-AMEGSMR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
            E+   ++Q++  DY SQ+P +F VQP+Q NLQ
Sbjct  177  ELDISYHQKD-RDYASQLPMSFHVQPIQTNLQ  207



>gb|AAV28490.1| MADS box PI-like protein 10 [Phalaenopsis hybrid cultivar]
Length=210

 Score =   238 bits (606),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 167/212 (79%), Gaps = 7/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVTFSKRRNG++KKAKEISVLCDA+VS++IF S GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTFSKRRNGIMKKAKEISVLCDAQVSLVIFSSLGKMFEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  L  +L++Y + +GK+LWDAKHENL  EI+RIKKENDNMQIELRH +GED++SLN +E
Sbjct  61   STTLSKMLEKYQQNSGKKLWDAKHENLSAEIDRIKKENDNMQIELRHYEGEDLNSLNPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+ALQNGL S+ +KQM+  + L K     + + +EN++L+Y L Q ++ AM  ++ 
Sbjct  121  LIPIEEALQNGLTSVRDKQMDYLKMLKK---NERMLEDENKRLTYLLHQQQM-AMEGSMR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
            E+   ++ ++  +Y +QMP TF VQP+QPNLQ
Sbjct  177  ELDIGYHHKD-REYAAQMPMTFRVQPIQPNLQ  207



>gb|ADC53258.1| PI MADS-box transcription factor [Lacandonia schismatica]
Length=210

 Score =   237 bits (605),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 122/213 (57%), Positives = 164/213 (77%), Gaps = 7/213 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFS--  310
            MGRG+IEI+RIEN++NRQVTFSKRRNG++KKAKEISVLCDA+VSV+IF SS KM E+   
Sbjct  1    MGRGKIEIRRIENATNRQVTFSKRRNGIIKKAKEISVLCDAKVSVVIFSSSNKMFEYCTP  60

Query  311  SSSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S++L  IL+ Y    GK+LWDAKHENL  EI+RIKKENDNMQIELRHLKGED++SL  +E
Sbjct  61   STTLSKILENYQINCGKKLWDAKHENLNAEIDRIKKENDNMQIELRHLKGEDLNSLGAKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+AL NG+  + +KQM++W+ L K     + + EEN++LS+ L Q  + +M+ N+ 
Sbjct  121  LIPIEEALSNGITKVRDKQMDLWKLLKK---NGRMLEEENKRLSFLLHQQHL-SMDGNVR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQD  769
            E+   ++ ++ N Y SQ+P  F VQP QPNLQ+
Sbjct  177  ELELGYHHKDRN-YASQIPVAFRVQPFQPNLQE  208



>gb|ACY91914.1| MADS-domain transcription factor, partial [Camellia japonica]
Length=193

 Score =   236 bits (603),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 154/199 (77%), Gaps = 9/199 (5%)
 Frame = +2

Query  182  NRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSSS--LVDILDQYHKLT  355
            NRQVT+SKRRNG+LKKAKEI+VLCDA+VS+++FGSSGKMHEF S S  LVDIL++YHK +
Sbjct  1    NRQVTYSKRRNGILKKAKEITVLCDAQVSLVVFGSSGKMHEFCSPSTTLVDILEKYHKQS  60

Query  356  GKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRELMILEDALQNGLRSI  535
            GKRLWDAKHENL NE++RIKKEND++QIELRHLKGEDI+SL  R+LM +E+AL+ GL S+
Sbjct  61   GKRLWDAKHENLSNELDRIKKENDSLQIELRHLKGEDITSLQPRDLMAIENALETGLESV  120

Query  536  SEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLGEMGEVFNQRESNDYE  715
              KQ E+ R + K     + + E+N+QL+  L Q E+   +R      E    R+ NDY+
Sbjct  121  RYKQSEIHRMMKK---NGKMLEEDNKQLNLILHQQEMEKGSREF----ENGYHRQVNDYQ  173

Query  716  SQMPFTFSVQPMQPNLQDR  772
             QMPFTF VQP+QPNL +R
Sbjct  174  PQMPFTFRVQPIQPNLHER  192



>dbj|BAL41417.1| MADS-domain transcription factor [Rhododendron mucronatum var. 
ripense]
Length=222

 Score =   237 bits (605),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 125/227 (55%), Positives = 171/227 (75%), Gaps = 21/227 (9%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIEN+SNRQVT+SKRRNG++KKAKEISVLCDA VSV+IF S+GKMHE+ S 
Sbjct  1    MGRGKIEIKRIENTSNRQVTYSKRRNGLIKKAKEISVLCDAHVSVVIFASTGKMHEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLN-YR  487
            S  LVDIL++YHK +GK+LWDAKHENL +EI+RIKKEND+MQIELRHL+GEDI+SL+ ++
Sbjct  61   STTLVDILERYHKHSGKKLWDAKHENLSSEIDRIKKENDSMQIELRHLRGEDITSLHGHK  120

Query  488  ELMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNL  667
            ELM LE+AL+ GL SI +++ME+++ + K     + + ++N +L   L Q     ++   
Sbjct  121  ELMALEEALETGLASIRDREMELFKGMKK---NERMLEDDNRRLQCMLHQ---QGIDMEG  174

Query  668  GEMGEVFNQRESN---------DYESQMPFTF---SVQPMQPNLQDR  772
            G+M   ++ +  +         +Y+ QMPF F    +QP+QPNLQ+R
Sbjct  175  GDMENGYHHQHQHQHHHHHQVREYQPQMPFAFHNLQIQPIQPNLQER  221



>gb|ABR68541.1| PISTILLATA-like1 [Dillenia indica]
Length=189

 Score =   236 bits (602),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 120/192 (63%), Positives = 152/192 (79%), Gaps = 7/192 (4%)
 Frame = +2

Query  206  RRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSSS--LVDILDQYHKLTGKRLWDAK  379
            RRNG++KKAKEI+VLCDA VS++IFGSSGKM E+ S S  + DILD+YHK +GKRLWDAK
Sbjct  1    RRNGIIKKAKEITVLCDAHVSLVIFGSSGKMVEYCSPSTTVTDILDRYHKQSGKRLWDAK  60

Query  380  HENLENEINRIKKENDNMQIELRHLKGEDISSLNYRELMILEDALQNGLRSISEKQMEVW  559
            HENL  EI RIKKENDNMQIELRHLKGEDI+SL ++ELM+LE+AL+ GL S+ +KQME+W
Sbjct  61   HENLSKEIERIKKENDNMQIELRHLKGEDITSLPHKELMVLEEALETGLASVRDKQMEIW  120

Query  560  RNLTKRYDQSQGVAEENEQL-SYRLRQLEIAAMNRNLGEMGEVFNQRESNDYESQMPFTF  736
            R + K     + + EEN++L S+ L Q E+ +M+ N+ EM   ++QR   DY +QMPF F
Sbjct  121  RMMRK---NDRDLEEENKRLTSFLLHQQEM-SMDGNVREMENGYHQRGVRDYHTQMPFAF  176

Query  737  SVQPMQPNLQDR  772
             VQPMQPNLQ+R
Sbjct  177  RVQPMQPNLQER  188



>gb|AAU10471.1| MADS box protein 1 [Litchi chinensis]
Length=208

 Score =   236 bits (603),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 122/209 (58%), Positives = 161/209 (77%), Gaps = 13/209 (6%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENSS+RQVT+SKRRNG++KKAKEI+VLCDA+VS+IIF SSGKMHE+ S 
Sbjct  1    MGRGKIEIKRIENSSDRQVTYSKRRNGIIKKAKEITVLCDAKVSLIIFASSGKMHEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  LV+ILDQYHK +GK+LWD KHENL +EI+RIKKEND+MQI+LRHLKGED++SLN+RE
Sbjct  61   STTLVEILDQYHKQSGKKLWDPKHENLSSEIDRIKKENDSMQIKLRHLKGEDLTSLNHRE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LM +E+AL+NGL  + +KQ E    + +   +   + E ++ L++ +RQ E+ AM  N+ 
Sbjct  121  LMAIEEALENGLAGLRDKQSEHVEGMRENLKE---LEETHKHLNFVMRQREM-AMENNVR  176

Query  671  EMGEVFNQRE-------SNDYESQMPFTF  736
            E+   ++Q+         NDY  QMPF F
Sbjct  177  ELESGYHQQPYQRAAVNHNDYNPQMPFAF  205



>gb|ABP96914.1| GLOBOSA-like protein [Primula vulgaris]
Length=193

 Score =   236 bits (601),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 120/215 (56%), Positives = 159/215 (74%), Gaps = 26/215 (12%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG++EIKRIENS+ RQVT+S RRNG+LKKAKEISVLCDA+VS+IIF SSGKMH++ S 
Sbjct  1    MGRGKVEIKRIENSNIRQVTYSNRRNGILKKAKEISVLCDAQVSLIIFSSSGKMHDYCSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             SSL++ILD Y K +G RLWDA+HENL NEI R+KKENDNMQIELR+LKGEDI SL+++E
Sbjct  61   NSSLINILDAYQKQSGIRLWDARHENLSNEIERVKKENDNMQIELRYLKGEDIQSLHHKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRY-DQSQGVAEENEQLSYRLRQLEIAAMNRNL  667
            LM +EDAL+NGL  + E+QME++R     + D+ + + +EN++L Y+ +Q+         
Sbjct  121  LMSIEDALENGLTRVRERQMEIYRMAKDNFADKERLLEDENKRLGYKFQQV---------  171

Query  668  GEMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
                           + QMP ++ VQP+QPNL D+
Sbjct  172  --------------MDMQMPCSYRVQPLQPNLHDQ  192



>gb|ACR16042.1| GLOBOSA-like MADS-box transcription factor [Hypoxis villosa]
Length=210

 Score =   236 bits (603),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 118/213 (55%), Positives = 165/213 (77%), Gaps = 7/213 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIENS+NRQVTFSKRR+G++KKA+EISVLCDA+V+V++F SSGKM +F + 
Sbjct  1    MGRGKIEIKRIENSTNRQVTFSKRRSGIMKKAREISVLCDAKVAVVVFSSSGKMFDFCTP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             ++L  IL++Y + +GK+LWDAKHENL  +I+RIKKEND+MQIELRHLKGEDI+SLN ++
Sbjct  61   TTTLPGILEKYQQNSGKKLWDAKHENLSAQIDRIKKENDSMQIELRHLKGEDINSLNAQD  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+ L NGL+ +  KQME+W+         + + EE ++LSY L   E+ AM  NL 
Sbjct  121  LIPIEEVLSNGLKGVRNKQMEIWK---MHMHNKRLLEEEQKRLSYVLHHQEL-AMEENLR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQD  769
            E+G  ++Q++  ++  Q+P  F VQP+QPNL +
Sbjct  177  EVGIRYHQKD-REFAPQIPIAFRVQPIQPNLHE  208



>dbj|BAI78360.1| GLO-like MADS-box protein [Orchis italica]
Length=211

 Score =   236 bits (603),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 122/212 (58%), Positives = 163/212 (77%), Gaps = 6/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIENS+NRQVTFSKRRNG++KKAKEISVLCDA+VS++IF S GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTFSKRRNGIMKKAKEISVLCDAQVSLVIFSSLGKMFEYCSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             +SL  +L++Y + +GK+LWDAKHENL  EI+RIKKENDNMQIE RHLKGED++SLN +E
Sbjct  61   STSLSKMLEKYQQNSGKKLWDAKHENLSTEIDRIKKENDNMQIEPRHLKGEDLNSLNPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+ALQNGL  + +KQM+  + L K     + + EEN++L+Y L   ++ AM  ++ 
Sbjct  121  LIPIEEALQNGLAGVRDKQMDFLKMLKK---NERMLEEENKRLTYLLHHQQL-AMEGSMR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
            E+   ++Q++       MP TF VQP+QPNLQ
Sbjct  177  ELDIGYHQKDREYAPPPMPMTFRVQPIQPNLQ  208



>gb|ACD85102.1| B-class MADS-box protein PI-1 [Habenaria petelotii]
Length=209

 Score =   236 bits (602),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 125/213 (59%), Positives = 162/213 (76%), Gaps = 10/213 (5%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVTFSKRR+G++KKA+EISVLCDA+VS++IF S GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTFSKRRSGIIKKAREISVLCDAQVSLVIFSSLGKMSEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  L  IL++Y + +GK+LWDA HENL  EI+RIKKENDNMQIELRHLKGED++SLN +E
Sbjct  61   STTLSKILEKYQQNSGKKLWDATHENLSAEIDRIKKENDNMQIELRHLKGEDLNSLNPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRL-RQLEIAAMNRNL  667
            L+ +E+ALQNGL  + +KQME  + L K     + + EEN++L+Y L +QL I    R L
Sbjct  121  LIPIEEALQNGLTGVRDKQMEFLKMLKK---NERMLEEENKRLTYLLHQQLNIEGSMREL  177

Query  668  GEMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
                ++   ++  +Y +QMP TF VQP QPNLQ
Sbjct  178  ----DISYHQKDREYANQMPMTFRVQPFQPNLQ  206



>gb|AAO18230.1| MADS-box transcriptional factor HAM31 [Helianthus annuus]
Length=196

 Score =   235 bits (600),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/214 (55%), Positives = 162/214 (76%), Gaps = 21/214 (10%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEI+RI+N+ +R VT+SKR+NG+++KAKEI+VLCDA VS++++GSSGKM+E+ S 
Sbjct  1    MGRGKIEIQRIDNTIHRLVTYSKRKNGIIRKAKEITVLCDANVSLVVYGSSGKMYEYCSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             ++L D+LD+Y +L+G +LWDAKHENL+ EI+RIKKEN++MQIELRHLKGEDI+SLNY E
Sbjct  61   NTNLTDMLDRYPRLSGNKLWDAKHENLQIEIDRIKKENESMQIELRHLKGEDITSLNYEE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+  EDAL+NGL  I EK+ E+ + + K     Q + EEN+ L Y ++Q E+AAM     
Sbjct  121  LIAFEDALENGLTHIREKKDEIPQIMRK---HEQVLEEENKHLMYMVQQSEMAAM-----  172

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
                        DY++  PF+F VQPMQPNL +R
Sbjct  173  -----------GDYQADGPFSFRVQPMQPNLHER  195



>gb|AFN61593.1| MADS box transcription factor GLO [Paphiopedilum concolor]
Length=210

 Score =   236 bits (601),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 122/212 (58%), Positives = 166/212 (78%), Gaps = 7/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVTFS+RRNG++KKAKEISVLCDA+VS++IF S GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTFSRRRNGIMKKAKEISVLCDAQVSLVIFSSLGKMSEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  L  +L++Y + +GK+LWDAKHENL  EI+RIKKENDNMQIELRH+KGED++SLN +E
Sbjct  61   STTLSKMLEKYQQNSGKKLWDAKHENLSAEIDRIKKENDNMQIELRHMKGEDLNSLNPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+ALQNGL S+ +KQM   + L +     + + +EN++L+Y L   E+ AM  ++ 
Sbjct  121  LIPIEEALQNGLTSVRDKQMNFLKMLKR---NERMLEDENKRLTYLLHHQEL-AMEGSMR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
            E+   ++Q++  +Y +QMP  F VQP+QPNLQ
Sbjct  177  ELDISYHQKD-REYGNQMPMAFRVQPIQPNLQ  207



>gb|ABB22778.1| PISTILLATA-like MADS box protein [Crocus sativus]
Length=210

 Score =   236 bits (601),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 122/212 (58%), Positives = 166/212 (78%), Gaps = 7/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVTFSKRRNG++KKA+EISVLC+++VSV+IF +SGK+ ++ SS
Sbjct  1    MGRGKIEIKRIENSTNRQVTFSKRRNGIIKKAREISVLCESQVSVVIFSNSGKLSDYCSS  60

Query  317  --SLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
              SL  IL++Y    GK+LWDAKHENL  +I+RIKKENDNMQIELRHLKGED++SLN +E
Sbjct  61   NTSLPKILERYQLNCGKKLWDAKHENLSAQIDRIKKENDNMQIELRHLKGEDLNSLNPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+AL NGL S+ +KQM+  + L K     + + EEN++L+Y L   ++ AM  N+ 
Sbjct  121  LIPIEEALTNGLTSVQDKQMDYLKMLKK---NERFLEEENKRLTYILHHQQL-AMEGNMR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
            E+ ++ +Q E  ++ +QMP  F+VQP QPNLQ
Sbjct  177  EL-DLGHQHEDREHATQMPMAFTVQPFQPNLQ  207



>gb|ACY91912.1| MADS-domain transcription factor, partial [Stewartia pseudocamellia]
Length=189

 Score =   235 bits (599),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 156/199 (78%), Gaps = 13/199 (7%)
 Frame = +2

Query  182  NRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS--SSLVDILDQYHKLT  355
            NRQVT+SKRR+G++KKAKEI+VLCDA+VS++IF SSGKMHE+ S  ++L+DIL++YHK +
Sbjct  1    NRQVTYSKRRSGIIKKAKEITVLCDAQVSLVIFASSGKMHEYCSPSTTLLDILEKYHKQS  60

Query  356  GKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRELMILEDALQNGLRSI  535
            GKRLWDAKHENL NE++RIKKEND+MQIELRHLKGEDI+SL+++ELM +E+AL+NGL  +
Sbjct  61   GKRLWDAKHENLSNELDRIKKENDSMQIELRHLKGEDITSLHHKELMAIEEALENGLAGV  120

Query  536  SEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLGEMGEVFNQRESNDYE  715
             EKQMEV   L  +      + EE ++LS+ L Q E+   N         ++QR   D++
Sbjct  121  REKQMEV---LEMKVKNENMLEEETKRLSFMLHQQEMIMENNG-------YHQR-VRDFQ  169

Query  716  SQMPFTFSVQPMQPNLQDR  772
            SQMPF F VQP+QPNLQ+R
Sbjct  170  SQMPFAFRVQPIQPNLQER  188



>gb|ABB22777.1| PISTILLATA-like MADS box protein [Crocus sativus]
Length=210

 Score =   236 bits (601),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 122/212 (58%), Positives = 166/212 (78%), Gaps = 7/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVTFSKRRNG++KKA+EISVLC+++VSV+IF +SGK+ ++ SS
Sbjct  1    MGRGKIEIKRIENSTNRQVTFSKRRNGIIKKAREISVLCESQVSVVIFSNSGKLSDYCSS  60

Query  317  --SLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
              SL  IL++Y    GK+LWDAKHENL  +I+RIKKENDNMQIELRHLKGED++SLN +E
Sbjct  61   NTSLPKILERYQLNCGKKLWDAKHENLSAQIDRIKKENDNMQIELRHLKGEDLNSLNPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+AL NGL S+ +KQM+  + L K     + + EEN++L+Y L   ++ AM  N+ 
Sbjct  121  LIPIEEALTNGLTSVQDKQMDYLKMLKK---NERLLEEENKRLTYILHHQQL-AMEGNMR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
            E+ ++ +Q E  ++ +QMP  F+VQP QPNLQ
Sbjct  177  EL-DLGHQHEDREHATQMPMAFTVQPFQPNLQ  207



>gb|ACD85087.1| B-class MADS-box protein PI-1 [Anoectochilus formosanus]
Length=209

 Score =   236 bits (601),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 125/213 (59%), Positives = 162/213 (76%), Gaps = 10/213 (5%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVTFSKRR+G++KKA+EISVLCDA+VS++IF S GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTFSKRRSGIIKKAREISVLCDAQVSLVIFSSLGKMSEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  L  IL++Y + +GK+LWDA HENL  EI+RIKKENDNMQIELRHLKGED++SLN +E
Sbjct  61   STTLSKILEKYQQNSGKKLWDATHENLSAEIDRIKKENDNMQIELRHLKGEDLNSLNPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRL-RQLEIAAMNRNL  667
            L+ +E+ALQNGL S+  KQM+  + L K     + + EEN++L+Y L +QL I    R L
Sbjct  121  LIPIEEALQNGLTSVRGKQMDFLKMLKK---NEKMLEEENKRLTYLLHQQLNIEGSMREL  177

Query  668  GEMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
                ++   ++  +Y +QMP TF VQP QPNLQ
Sbjct  178  ----DISYHQKDREYANQMPMTFRVQPFQPNLQ  206



>gb|AGA12044.1| MADS-box transcription factor PISTILLATA-like protein, partial 
[Clermontia parviflora]
Length=200

 Score =   235 bits (600),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 118/202 (58%), Positives = 158/202 (78%), Gaps = 8/202 (4%)
 Frame = +2

Query  182  NRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSSS--LVDILDQYHKLT  355
            NRQVT+SKRRNG++KKAKEI++LCDA+VS++I+G+SGKMHE+ S S  LVD+LD+Y  L+
Sbjct  1    NRQVTYSKRRNGIIKKAKEITILCDAKVSLVIYGTSGKMHEYCSPSTNLVDMLDRYQTLS  60

Query  356  GKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRELMILEDALQNGLRSI  535
            GK+LWDAKHENL  EI RIKKENDNMQIELRHLKGEDI+SL++++L+ LEDAL+NGL +I
Sbjct  61   GKKLWDAKHENLNGEIERIKKENDNMQIELRHLKGEDITSLHHKDLIALEDALENGLLNI  120

Query  536  SEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLGE-MGEVFNQ--RESN  706
              K+ E+ + ++K     Q + EEN  L Y L+Q E+AAM  N+ + M   ++Q  R+ N
Sbjct  121  RSKKSEIPKMMSK---HGQILEEENRHLQYILQQTEMAAMEGNVADQMDNGYHQRMRDYN  177

Query  707  DYESQMPFTFSVQPMQPNLQDR  772
              + Q+PF F VQP+QPNL +R
Sbjct  178  QPDHQVPFAFRVQPIQPNLHER  199



>ref|XP_006472854.1| PREDICTED: floral homeotic protein GLOBOSA-like [Citrus sinensis]
Length=207

 Score =   235 bits (600),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 125/215 (58%), Positives = 163/215 (76%), Gaps = 12/215 (6%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIEN+SNRQVT+SKRRNG+LKKAKEI+VLCDA+VS+II+ SSGKMH++ S 
Sbjct  1    MGRGKIEIKRIENASNRQVTYSKRRNGILKKAKEITVLCDAKVSLIIYASSGKMHDYCSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             +SLVDIL+QYH+ +G+RLWD KHENL NEI RIK+END MQI+LRHL GEDISSLN +E
Sbjct  61   STSLVDILEQYHRQSGRRLWDPKHENLSNEIERIKRENDRMQIKLRHLNGEDISSLNPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRL-RQLEIAAMNRNL  667
            L+ LEDAL+NGL SI +KQ E    + K     + + EE+  L + + RQ +  AM  ++
Sbjct  121  LIALEDALENGLVSIRDKQSEKMERMRK---NGKMMEEEHNYLKFEIARQQQELAMENSV  177

Query  668  GEMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
                E+ N +  N ++    + + VQP+QPNLQ+R
Sbjct  178  S--AEIDNYQRENHHD----YAYHVQPIQPNLQER  206



>ref|XP_009399166.1| PREDICTED: MADS-box transcription factor 2-like [Musa acuminata 
subsp. malaccensis]
 gb|ACJ64683.1| MADS-box protein MADS6 [Musa acuminata AAA Group]
Length=211

 Score =   235 bits (600),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 122/213 (57%), Positives = 167/213 (78%), Gaps = 6/213 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIENS+NRQVTFSKRRNG++KKA+EIS+LC+A+VSV+IF SSGKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTFSKRRNGIIKKAREISILCEAQVSVVIFSSSGKMSEYCSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             ++L  IL++Y + +G++LWDAKHE+L  EI+RIKKENDNMQIELRHLKGED++SLN +E
Sbjct  61   AATLPKILERYQQNSGRKLWDAKHESLSAEIDRIKKENDNMQIELRHLKGEDLNSLNPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +EDALQ GL S+ +KQME+W+ L K+ ++   + EEN+QL+Y L   ++ AM+ N+ 
Sbjct  121  LIPIEDALQIGLTSVRDKQMEIWK-LHKKNERL--LEEENKQLTYMLHHQQL-AMDGNVR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQD  769
            E+   ++Q+            F VQP+QPNLQ+
Sbjct  177  ELEIGYHQKGREFAPHMTTMAFHVQPIQPNLQE  209



>gb|AGA12043.1| MADS-box transcription factor PISTILLATA-like protein, partial 
[Clermontia parviflora]
Length=200

 Score =   234 bits (598),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 117/202 (58%), Positives = 159/202 (79%), Gaps = 8/202 (4%)
 Frame = +2

Query  182  NRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSSS--LVDILDQYHKLT  355
            NRQVT+SKRRNG++KKAKEI++LCDA+VS++I+G+SGKMHE+ S S  LVD+LD+Y  L+
Sbjct  1    NRQVTYSKRRNGIIKKAKEITILCDAKVSLVIYGTSGKMHEYCSPSTNLVDMLDRYQTLS  60

Query  356  GKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRELMILEDALQNGLRSI  535
            GK+LWDAKHENL NEI RIKKENDNMQIELRHLKGEDI+SL++++L+ LEDAL+NGL +I
Sbjct  61   GKKLWDAKHENLNNEIARIKKENDNMQIELRHLKGEDITSLHHKDLIALEDALENGLLNI  120

Query  536  SEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLGE-MGEVFNQ--RESN  706
              K+ E+ + ++K     Q + EEN  L Y ++Q E+AAM  N+ + M   ++Q  R+ N
Sbjct  121  RSKKSEIPKMMSK---HGQILEEENRHLQYIVQQTEMAAMEGNVADQMDNGYHQRMRDYN  177

Query  707  DYESQMPFTFSVQPMQPNLQDR  772
              + Q+PF F VQP+QPNL ++
Sbjct  178  QPDHQVPFAFRVQPIQPNLHEQ  199



>gb|AFV74898.1| PISTILLATA-like protein, partial [Olax imbricata]
Length=203

 Score =   234 bits (598),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 122/205 (60%), Positives = 161/205 (79%), Gaps = 6/205 (3%)
 Frame = +2

Query  167  IENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSSS--LVDILDQ  340
            IENSSNRQVT+SKRRNG++KKAKEI+VLCDA+VS++IF S+GKMHE+ S S  L+++LD+
Sbjct  1    IENSSNRQVTYSKRRNGIIKKAKEITVLCDAQVSLVIFASTGKMHEYCSPSTTLIELLDK  60

Query  341  YHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRELMILEDALQN  520
            YHK +GKRLWDAKHENL NEI+RIKKEND+MQIELRHLKGEDIS+LN++ELM +E+AL+N
Sbjct  61   YHKQSGKRLWDAKHENLNNEIDRIKKENDSMQIELRHLKGEDISNLNHKELMAIEEALEN  120

Query  521  GLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLE-IAAMNRNLGEMGEVFNQR  697
            GL SI EKQ E ++ + KR D+   + +E ++LSY   Q +    M  ++ EM   ++  
Sbjct  121  GLSSIREKQSEFFK-MMKRKDKM--LEDEYKELSYAWAQHQRKMGMEGSVREMEGGYHSG  177

Query  698  ESNDYESQMPFTFSVQPMQPNLQDR  772
              + +   +PF F VQP+QPNLQDR
Sbjct  178  PRDYHPHDVPFLFRVQPIQPNLQDR  202



>gb|ACY91897.1| MADS-domain transcription factor, partial [Camellia japonica]
Length=195

 Score =   234 bits (596),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 158/200 (79%), Gaps = 9/200 (5%)
 Frame = +2

Query  182  NRQVTFSKRR-NGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSSS--LVDILDQYHKL  352
            NRQVT+SKRR NG++KKAKEI+VLCDA+VS++IF SSGKMHE+ S S  LVDILD+YHK 
Sbjct  1    NRQVTYSKRRRNGIMKKAKEITVLCDAQVSLVIFASSGKMHEYCSPSTTLVDILDKYHKQ  60

Query  353  TGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRELMILEDALQNGLRS  532
            +G+RLWDAKHENL NE++RIKKEND+MQIELRHLKGEDI+SL+++ELM +E+AL+NGL S
Sbjct  61   SGERLWDAKHENLSNELDRIKKENDSMQIELRHLKGEDITSLHHKELMAIEEALENGLGS  120

Query  533  ISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLGEMGEVFNQRESNDY  712
            + EKQME    + K     + + EEN+ L++ L Q E+   +    EM   ++QR   D+
Sbjct  121  VREKQMEYIDMMEK---NKKTLEEENKHLNFMLHQQEMNMESSR--EMENGYHQR-VRDF  174

Query  713  ESQMPFTFSVQPMQPNLQDR  772
            +SQMPF F VQP+QPNLQ+R
Sbjct  175  QSQMPFAFRVQPIQPNLQER  194



>gb|ABB22780.1| PISTILLATA-like MADS box protein [Crocus sativus]
 gb|ABB22781.1| PISTILLATA-like MADS box protein [Crocus sativus]
Length=210

 Score =   234 bits (597),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 122/213 (57%), Positives = 163/213 (77%), Gaps = 7/213 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIENS+NRQVTFSKRRNG++KKA+EISVLC+  VS++IF S GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTFSKRRNGIIKKAREISVLCECEVSLVIFSSLGKMSEYCSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             + L  IL++Y + +GKRLW+AKHENL  EI RIK+ENDNMQIELRHLKGED++SL+ +E
Sbjct  61   NTKLPKILEKYQQNSGKRLWEAKHENLSAEIERIKRENDNMQIELRHLKGEDLNSLHPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+ALQNGL  + EKQM+  + + K     + + EEN++L+Y L   ++ AM  N+ 
Sbjct  121  LIPIEEALQNGLTGVREKQMDFLKMMKK---NERLMEEENKRLTYLLHHQQL-AMEGNMR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQD  769
            +M   + Q+E   Y SQMP TF +QP+QPNLQ+
Sbjct  177  DMDLGYQQKE-RAYPSQMPMTFRMQPIQPNLQE  208



>gb|ACY91931.1| MADS-domain transcription factor, partial [Clethra tomentosa]
Length=193

 Score =   234 bits (596),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 159/199 (80%), Gaps = 9/199 (5%)
 Frame = +2

Query  182  NRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSSS--LVDILDQYHKLT  355
            NRQVT+SKRRNG++KKAKEI+VLCDA+VS++IF SSGKMHE+ S S  LV+ILD+YHK +
Sbjct  1    NRQVTYSKRRNGIIKKAKEITVLCDAQVSLVIFASSGKMHEYCSPSAPLVNILDKYHKHS  60

Query  356  GKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRELMILEDALQNGLRSI  535
            GK+LWDAKHENL NE++RIKKEND+MQI+LRHLKGEDI+SL++ ELM +E+AL+NGL S+
Sbjct  61   GKKLWDAKHENLSNEVDRIKKENDSMQIQLRHLKGEDITSLHHTELMAMEEALENGLASV  120

Query  536  SEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLGEMGEVFNQRESNDYE  715
             E+Q EV+ N+ K     + + +EN++L+  L Q  ++  +R   EM   +NQ   +DY+
Sbjct  121  RERQNEVYINMKK---NEKYMEDENKRLNIVLHQQGMSMESR---EMESGYNQ-SVHDYQ  173

Query  716  SQMPFTFSVQPMQPNLQDR  772
            S MPF+F VQP+QPNL +R
Sbjct  174  SHMPFSFRVQPIQPNLHER  192



>dbj|BAC66962.1| MADS-box transcription factor PI [Agapanthus praecox]
Length=210

 Score =   234 bits (596),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 121/212 (57%), Positives = 163/212 (77%), Gaps = 7/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIENS+NRQVTFSKRRNG++KKA+EISVLC+++VSV+IF S GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTFSKRRNGIIKKAREISVLCESQVSVVIFSSCGKMSEYCSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             +S   IL++Y    GK+LWDAKHENL  +I+R+KKENDNMQIELRHLKGED++SLN +E
Sbjct  61   NTSFPRILERYQHNCGKKLWDAKHENLNAQIDRVKKENDNMQIELRHLKGEDLNSLNPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+AL+NGL  +  KQME  + L K     + + EEN++L+Y LR  ++ AM  N+ 
Sbjct  121  LIPIEEALENGLNGVRAKQMEYLKMLKK---NERLLEEENKRLTYILRHQQL-AMEGNVR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
            ++   ++QRE  ++ +QMP  F VQP+ PNLQ
Sbjct  177  QLDLGYHQRER-EFAAQMPMAFRVQPIHPNLQ  207



>gb|AFD36429.1| GLO-like MADS-BOX transcription factor [Canna indica]
 gb|AFD36430.1| PI-like MADS box transcription factor [Canna indica]
Length=210

 Score =   234 bits (596),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 120/213 (56%), Positives = 168/213 (79%), Gaps = 7/213 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEF--S  310
            MGRG+IEIKRIENS+NRQVTFSKRRNG++KKA+EIS+LC+A+VSV+IF SSGKM E+   
Sbjct  1    MGRGKIEIKRIENSTNRQVTFSKRRNGIIKKAREISILCEAQVSVVIFSSSGKMSEYRSP  60

Query  311  SSSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S+SL +IL++Y + +G++LWDAKHE+L  EI+RIKKENDNMQIELRHLKGED++SL  +E
Sbjct  61   STSLSEILERYQQNSGEKLWDAKHESLSAEIDRIKKENDNMQIELRHLKGEDLNSLYPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+ALQ GL S+ EKQME+W+      +  + + +EN+QL+Y L   ++ AM+  + 
Sbjct  121  LIPIEEALQIGLTSVREKQMEIWK---MHKNNEKLLEDENKQLTYMLHHQQL-AMDGGVR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQD  769
            E+   ++Q++  ++  QM   F VQP+QPNLQ+
Sbjct  177  ELELGYHQKD-REFAPQMTMAFRVQPIQPNLQE  208



>gb|ACY91927.1| MADS-domain transcription factor, partial [Cyclamen persicum]
Length=192

 Score =   233 bits (595),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/200 (60%), Positives = 154/200 (77%), Gaps = 12/200 (6%)
 Frame = +2

Query  182  NRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS--SSLVDILDQYHKLT  355
            NRQVT+SKRRNG++KKAKEISVLCDA+VS++IF +SGKMHE+ S  SSL++ILD Y K +
Sbjct  1    NRQVTYSKRRNGIIKKAKEISVLCDAQVSLVIFATSGKMHEYVSPNSSLINILDAYQKQS  60

Query  356  GKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRELMILEDALQNGLRSI  535
            G RLWDAKHE+L NEI RIKKENDNMQIELRHLKGEDI+SL+++ELM +ED L+NGL  I
Sbjct  61   GTRLWDAKHESLSNEIERIKKENDNMQIELRHLKGEDINSLHHKELMSIEDGLENGLTCI  120

Query  536  SEKQMEVWRNLTKRY-DQSQGVAEENEQLSYRLRQLEIAAMNRNLGEMGEVFNQRESNDY  712
             E+QME++R   K + D+ + + +EN++LSY   Q+    M+   GEM   +       Y
Sbjct  121  RERQMEIYRMAKKNFADKERILEDENKRLSY---QMHHQVMDMEGGEMDNEYQ------Y  171

Query  713  ESQMPFTFSVQPMQPNLQDR  772
            + QMPF+F VQP+QPNL +R
Sbjct  172  QPQMPFSFRVQPIQPNLHER  191



>gb|ACY91935.1| MADS-domain transcription factor, partial [Stewartia pseudocamellia]
Length=185

 Score =   233 bits (594),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 152/199 (76%), Gaps = 16/199 (8%)
 Frame = +2

Query  182  NRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSSS--LVDILDQYHKLT  355
            NRQVT+SKRRNG+LKKAKEISVLCDA+VS++IF SSGKM EF S S  LV+ILD+YHK +
Sbjct  1    NRQVTYSKRRNGILKKAKEISVLCDAQVSLVIFSSSGKMQEFCSPSTTLVEILDKYHKQS  60

Query  356  GKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRELMILEDALQNGLRSI  535
            GK+LWDAKHENL NE++RIK+END+MQIELRHLKGEDI+SL  +ELM +E+AL++GL SI
Sbjct  61   GKKLWDAKHENLSNELDRIKQENDSMQIELRHLKGEDITSLQPKELMAIEEALESGLESI  120

Query  536  SEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLGEMGEVFNQRESNDYE  715
              KQ E+ R + K  +    + EEN+QL+  L Q           EM   +N+R  NDY+
Sbjct  121  RHKQSEIHRMMKKNENM---MEEENKQLNCLLHQ----------QEMENGYNRR-VNDYQ  166

Query  716  SQMPFTFSVQPMQPNLQDR  772
             QMPFTF VQP+QPNL DR
Sbjct  167  PQMPFTFRVQPIQPNLHDR  185



>gb|AAF73941.1|AF230712_1 MADS box containing protein PI [Sagittaria montevidensis]
Length=208

 Score =   234 bits (596),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 116/211 (55%), Positives = 163/211 (77%), Gaps = 5/211 (2%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVT+SKRRNG++KKA+EISVLC   VS++IF SSGKM EF S+
Sbjct  1    MGRGKIEIKRIENSANRQVTYSKRRNGIIKKAREISVLCGCEVSLVIFSSSGKMSEFHST  60

Query  317  SLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRELM  496
            +L  IL+ + +  G+ LW AKHE+L+ EI+R+KKENDNM+I+LRH+KGED++S+  R+L 
Sbjct  61   TLSKILETFQQNQGQTLWGAKHESLKAEIDRMKKENDNMRIQLRHMKGEDLTSMEPRDLY  120

Query  497  ILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLGEM  676
             +E AL NG+ ++  KQME+++   K+    + + EEN+QL+Y L Q  + AMN NL EM
Sbjct  121  TIETALINGIANVRGKQMEIFK---KKAKNQKALEEENKQLAYILHQQSL-AMNGNLREM  176

Query  677  GEVFNQRESNDYESQMPFTFSVQPMQPNLQD  769
             + ++Q++  D+ + +PF F VQPMQPNLQ+
Sbjct  177  PQDYHQKD-RDFTAPVPFGFRVQPMQPNLQE  206



>gb|AFV74899.1| PISTILLATA-like protein [Schoepfia jasminodora]
Length=218

 Score =   234 bits (597),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 165/221 (75%), Gaps = 13/221 (6%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            M RG++EIKRIENSSNRQVT+SKRRNG++KKAKEI+VLCDA+VS++IF SSGKMHEF S 
Sbjct  1    MARGKMEIKRIENSSNRQVTYSKRRNGIIKKAKEITVLCDAQVSLVIFASSGKMHEFCSP  60

Query  317  S--LVDILDQYHK---LTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLN  481
            S  +VDILD+YHK    +GK+LWDAKHE+L +E+ RIKKEND+MQI+LRHLKG DI+SL 
Sbjct  61   STQVVDILDRYHKHCGSSGKKLWDAKHEDLSHELERIKKENDSMQIQLRHLKGHDITSLP  120

Query  482  YRELMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNR  661
             +ELM  E+AL  GL  I EKQ E+ + + KR   ++ + +EN +L++ L+++ +   + 
Sbjct  121  LKELMATEEALDTGLDGIREKQSELVK-MIKR--NAKMLEDENRELTFTLQKMAMEGGDD  177

Query  662  NL----GEMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
                  G + +  N R    + +QMPF F VQPMQPNLQ+R
Sbjct  178  GKDMTNGYIHQAGNARNYG-HHNQMPFAFRVQPMQPNLQER  217



>ref|XP_010269077.1| PREDICTED: floral homeotic protein PMADS 2 [Nelumbo nucifera]
Length=211

 Score =   233 bits (595),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 120/213 (56%), Positives = 162/213 (76%), Gaps = 6/213 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIENS+NRQVT+SKRRNG++KKAKEI+VLCDA VS++IF S+GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRNGIMKKAKEITVLCDAEVSLVIFSSTGKMSEYCSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             ++L+ +LD+Y K +GKRLWDAKHE L NEI+RIKKEND MQIELRHLKGEDI+SL  +E
Sbjct  61   NTTLIKLLDRYQKSSGKRLWDAKHEFLSNEIDRIKKENDAMQIELRHLKGEDINSLTPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+AL+NGL ++  KQME  + L K     + + E+N +L++ L   ++  ++  + 
Sbjct  121  LIPIEEALENGLVNVRAKQMEYLKMLEK---NGRTLEEDNNRLNFILHHQQM-GIDNGVR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQD  769
            EM   ++Q+  N   S MP  F VQP+QPNLQ+
Sbjct  177  EMENGYHQKGRNYSSSSMPLAFRVQPIQPNLQE  209



>gb|AEM60215.1| MADS box transcription factor, partial [Osmanthus fragrans]
Length=189

 Score =   233 bits (593),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/191 (60%), Positives = 152/191 (80%), Gaps = 7/191 (4%)
 Frame = +2

Query  212  NGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSSS--LVDILDQYHKLTGKRLWDAKHE  385
            +G++KKAKEISVLCDA+VSV+IF SSGKMHEF S S  L+D+LDQYHKL+GK+LWDAKHE
Sbjct  1    SGIMKKAKEISVLCDAQVSVVIFASSGKMHEFCSPSTTLIDMLDQYHKLSGKKLWDAKHE  60

Query  386  NLENEINRIKKENDNMQIELRHLKGEDISSLNYRELMILEDALQNGLRSISEKQMEVWRN  565
            +L+NEINRIKK+ND MQ ELR L GEDI++LNY+ELM+LE+AL+NG+ S+  KQME    
Sbjct  61   HLDNEINRIKKDNDRMQTELRRLSGEDITTLNYKELMVLEEALENGISSLKAKQMECVPM  120

Query  566  LTKRYDQSQGVAEENEQLSYRLRQLEIAAM-NRNLGEMGEVFNQRES-NDYESQMPFTFS  739
            + K    ++ + +EN  L ++LRQ+ +  M ++N+ E G+V++ ++   DYE QMPF F 
Sbjct  121  MRK---HNEMLEDENRGLQFKLRQMHLNPMDDQNVLENGDVYHHQQGVGDYEYQMPFAFR  177

Query  740  VQPMQPNLQDR  772
            VQPMQPNLQDR
Sbjct  178  VQPMQPNLQDR  188



>dbj|BAH03321.1| MADS-box transcription factor [Habenaria radiata]
Length=210

 Score =   233 bits (595),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/212 (58%), Positives = 164/212 (77%), Gaps = 7/212 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIENS+NRQVTFSKRRNG++KKAKEISVLCDA+VS++IF S GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTFSKRRNGIMKKAKEISVLCDAQVSLVIFSSLGKMFEYCSP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             +SL  +L++Y + +GK+LWDAKHENL  EI+RIKKENDNMQIELRHLKGED++SLN +E
Sbjct  61   STSLSKMLEKYQQNSGKKLWDAKHENLSAEIDRIKKENDNMQIELRHLKGEDLNSLNPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+ALQNGL  + +KQ +  + L K+    + + EEN++L+Y L   ++ AM  ++ 
Sbjct  121  LIPIEEALQNGLAGVRDKQSDFLKMLKKK---ERMLEEENKRLTYLLHHQQL-AMEGSMR  176

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
            E+ ++  Q++       MP TF VQP+QPNLQ
Sbjct  177  EL-DIGYQKDREYAPPPMPMTFRVQPIQPNLQ  207



>gb|AAV28491.1| MADS box PI-like protein 15 [Phalaenopsis hybrid cultivar]
Length=217

 Score =   233 bits (595),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 125/219 (57%), Positives = 168/219 (77%), Gaps = 14/219 (6%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVTFSKRRNG++KKAKEISVLCDA+VS++IF S GKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTFSKRRNGIMKKAKEISVLCDAQVSLVIFSSLGKMFEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIEL-------RHLKGEDI  469
            S  L  +L++Y + +GK+LWDAKHENL  EI+RIKKENDNMQIEL       RHLKGED+
Sbjct  61   STTLSKMLEKYQQNSGKKLWDAKHENLSAEIDRIKKENDNMQIELRFSWVLSRHLKGEDL  120

Query  470  SSLNYRELMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIA  649
            +SLN +EL+ +E+ALQNGL S+ +KQM+  + L K     + + +EN++L+Y L Q ++ 
Sbjct  121  NSLNPKELIPIEEALQNGLTSVRDKQMDYLKMLKK---NERMLEDENKRLTYLLHQQQM-  176

Query  650  AMNRNLGEMGEVFNQRESNDYESQMPFTFSVQPMQPNLQ  766
            AM  ++ E+   ++ ++  +Y +QMP TF VQP+QPNLQ
Sbjct  177  AMEGSMRELDIGYHHKD-REYAAQMPMTFRVQPIQPNLQ  214



>gb|ADY39748.1| PISTILLATA-like protein [Ananas comosus]
Length=197

 Score =   233 bits (593),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 123/213 (58%), Positives = 160/213 (75%), Gaps = 20/213 (9%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIENS+NRQVTFSKRRNG++KKA+EISVLCDA+VSV+IF SSGKM E+ S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTFSKRRNGIIKKAREISVLCDAQVSVVIFSSSGKMSEYCSP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  L  +L++Y + +GK+LWDAKHENL  EI+RIKKENDNMQIELRH+KGED++SL+ +E
Sbjct  61   STTLPKLLEKYQQNSGKKLWDAKHENLSAEIDRIKKENDNMQIELRHMKGEDLNSLHPKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            L+ +E+ALQNGL  + +KQM+  R + K     + + EEN+QL++ L   E+ AMN N+ 
Sbjct  121  LIPIEEALQNGLTVVRDKQMDYLRMMKK---NGRLLEEENKQLAFMLHHQEM-AMNGNM-  175

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQD  769
                          E Q+P  F VQP+QPNLQ+
Sbjct  176  -------------REPQIPMGFRVQPIQPNLQE  195



>gb|ACY91920.1| MADS-domain transcription factor, partial [Napoleonaea vogelii]
Length=179

 Score =   232 bits (591),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/189 (61%), Positives = 151/189 (80%), Gaps = 13/189 (7%)
 Frame = +2

Query  212  NGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSSS--LVDILDQYHKLTGKRLWDAKHE  385
            NG++KKAKEISVLCDA VS+IIF SSGKMHE+ S S  L+ ILD+YHKL+GKRLWDAKHE
Sbjct  1    NGIIKKAKEISVLCDAEVSLIIFASSGKMHEYCSPSTKLIQILDKYHKLSGKRLWDAKHE  60

Query  386  NLENEINRIKKENDNMQIELRHLKGEDISSLNYRELMILEDALQNGLRSISEKQMEVWRN  565
            NL NE++RIKKEND+MQIELRHLKGE+ISSL+++ELM +E+AL+NGL SI ++QMEV++ 
Sbjct  61   NLSNELDRIKKENDSMQIELRHLKGEEISSLHHKELMAIEEALENGLASIRDRQMEVYKM  120

Query  566  LTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLGEMGEVFNQRESNDYESQMPFTFSVQ  745
            + K     + + EEN+QLS+ LR++ +        E  E+ N+    +Y++QMPF+F +Q
Sbjct  121  MKKN---GKMLEEENQQLSFMLREMTM--------EGQEMENEYHQQEYQAQMPFSFRIQ  169

Query  746  PMQPNLQDR  772
            PMQPNLQDR
Sbjct  170  PMQPNLQDR  178



>gb|AEM60212.1| MADS box transcription factor, partial [Borago sp. VFI-2011]
Length=203

 Score =   232 bits (592),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 120/206 (58%), Positives = 160/206 (78%), Gaps = 7/206 (3%)
 Frame = +2

Query  161  KRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS--SSLVDIL  334
            KRIENSSNRQVT+SKRRNG+LKKAKEI+VLCDA+VS++IFG+SGKM+EF S  ++++D+L
Sbjct  1    KRIENSSNRQVTYSKRRNGILKKAKEITVLCDAKVSLVIFGTSGKMYEFISPGTTMIDVL  60

Query  335  DQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRELMILEDAL  514
            D Y K TGK+LWDAKHENL NEI+RIKKEND+MQIELRHLKGEDI SL+++ELM+LED L
Sbjct  61   DTYQKATGKKLWDAKHENLSNEIDRIKKENDSMQIELRHLKGEDIQSLSHKELMLLEDGL  120

Query  515  QNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLGEMGEVFNQ  694
              GL  I +KQ E  + + +++++   + EEN+QL Y  ++ E  A     G  G++++ 
Sbjct  121  DKGLACIRDKQSEFVK-IARKHEEM--LEEENKQLLYEWQRREAVAAANGGGGGGDMYHH  177

Query  695  RESNDYESQMPFTFSVQPMQPNLQDR  772
            ++       MPF+F VQPMQPNL +R
Sbjct  178  QQQQ--HQMMPFSFRVQPMQPNLHER  201



>gb|AAY63867.1| PISTILLATA [Brassica juncea]
Length=208

 Score =   233 bits (593),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 121/214 (57%), Positives = 163/214 (76%), Gaps = 15/214 (7%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSS  316
            MGRG+IEIKRIEN++NR VTFSKRRNG++KKAKEI+VLCDA+V++I+F S+GKM ++   
Sbjct  1    MGRGKIEIKRIENANNRVVTFSKRRNGLVKKAKEITVLCDAKVALIVFASNGKMTDYCCP  60

Query  317  S--LVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
            S  L  +LDQY KL+GK+LWDAKHENL NEI+RIKKENDN+Q+ELRHLKGEDI SLN + 
Sbjct  61   SMDLGAMLDQYQKLSGKKLWDAKHENLSNEIDRIKKENDNLQLELRHLKGEDIQSLNLKN  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLG  670
            LM +E A+++GL  + + QME +  +TKR ++   +AEEN QLS++L+Q E+A  +   G
Sbjct  121  LMAVEHAIEHGLDKVRDHQMEYF--MTKRRNEKM-LAEENRQLSFQLQQQEMAIASNARG  177

Query  671  EMGEVFNQRESNDYESQMPFTFSVQPMQPNLQDR  772
             M          D++ Q  F + VQP+QPNLQ++
Sbjct  178  MM--------MRDHDGQ--FGYRVQPIQPNLQEK  201



>gb|ACY91911.1| MADS-domain transcription factor, partial [Actinidia chinensis]
Length=183

 Score =   231 bits (590),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 150/189 (79%), Gaps = 9/189 (5%)
 Frame = +2

Query  212  NGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSSSS--LVDILDQYHKLTGKRLWDAKHE  385
            NG++KKAKEISVLCDA+VS++IF SSGKMHE+ S S  LVDILD+YHK +GKRLWDAKHE
Sbjct  1    NGIMKKAKEISVLCDAKVSLVIFASSGKMHEYCSPSTTLVDILDKYHKQSGKRLWDAKHE  60

Query  386  NLENEINRIKKENDNMQIELRHLKGEDISSLNYRELMILEDALQNGLRSISEKQMEVWRN  565
            NL NEI+RIKKEND+MQIELRHLKGEDI+SL+++ELM LE+AL+NGL  I EKQMEV++ 
Sbjct  61   NLSNEIDRIKKENDSMQIELRHLKGEDITSLHHKELMALEEALENGLSGIREKQMEVFKM  120

Query  566  LTKRYDQSQGVAEENEQLSYRLRQLEIAAMNRNLGEMGEVFNQRESNDYESQMPFTFSVQ  745
            + K     + + +EN+ L++ L Q  +   +R   EM   ++QR  +DY+ QMPF F VQ
Sbjct  121  MKKN---EKMLEDENKHLNFMLHQQGMTMESR---EMENGYHQR-VHDYQHQMPFAFHVQ  173

Query  746  PMQPNLQDR  772
            P+QPNLQDR
Sbjct  174  PIQPNLQDR  182



>ref|NP_001236242.1| uncharacterized protein LOC100306010 [Glycine max]
 gb|ACU13979.1| unknown [Glycine max]
Length=181

 Score =   231 bits (590),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 115/169 (68%), Positives = 145/169 (86%), Gaps = 5/169 (3%)
 Frame = +2

Query  137  MGRGRIEIKRIENSSNRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS-  313
            MGRG+IEIKRIENSSNRQVT+SKR+NG+LKKAKEISVLCDA+VS+IIFG SGKMHE+ S 
Sbjct  1    MGRGKIEIKRIENSSNRQVTYSKRKNGILKKAKEISVLCDAQVSLIIFGVSGKMHEYISP  60

Query  314  -SSLVDILDQYHKLTGKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRE  490
             ++L+D+LD+Y + +GK LWDAKHENL NEI+R+KKEND+MQIELRHLKGEDI+SLNY+E
Sbjct  61   YTTLIDVLDRYQRASGKTLWDAKHENLSNEIDRLKKENDSMQIELRHLKGEDITSLNYKE  120

Query  491  LMILEDALQNGLRSISEKQMEVWRNLTKRYDQSQGVAEENEQLSYRLRQ  637
            LM LEDAL+NGL  + EK+MEV R   +     + + E+N++LS+ L+Q
Sbjct  121  LMALEDALENGLSGVREKKMEVHRMFKR---NGKILEEQNKELSFLLQQ  166



>gb|ACY91926.1| MADS-domain transcription factor, partial [Jacquinia aurantiaca]
Length=196

 Score =   232 bits (591),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 117/201 (58%), Positives = 152/201 (76%), Gaps = 10/201 (5%)
 Frame = +2

Query  182  NRQVTFSKRRNGMLKKAKEISVLCDARVSVIIFGSSGKMHEFSS--SSLVDILDQYHKLT  355
            NRQVT+SKRR G++KKAKEISVLCDA+VS++IF SSGKMHEF S  SSL++ILD Y + +
Sbjct  1    NRQVTYSKRRTGIIKKAKEISVLCDAQVSLVIFASSGKMHEFCSPNSSLINILDAYQRQS  60

Query  356  GKRLWDAKHENLENEINRIKKENDNMQIELRHLKGEDISSLNYRELMILEDALQNGLRSI  535
            G +LWDAKHENL NEI RIKKENDNMQ+ELRHLKGEDI SL+++ELM +E+AL+NGL  +
Sbjct  61   GIKLWDAKHENLYNEIERIKKENDNMQVELRHLKGEDIQSLHHKELMAIEEALENGLTCV  120

Query  536  SEKQMEVWRNLTKRYDQSQ-GVAEENEQLSYRLR-QLEIAAMNRNLGEMGEVFNQRESND  709
             EKQME++R   K + + Q  + +EN+QLS+++        M+   G+M   +N      
Sbjct  121  REKQMEIFRMAKKAFAEKQRALEDENKQLSFQIAGTTHHQVMDMEGGDMENEYN------  174

Query  710  YESQMPFTFSVQPMQPNLQDR  772
            Y+ QMPF+F VQP+QPNL  R
Sbjct  175  YQPQMPFSFRVQPIQPNLHGR  195



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2533093496640