BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7643_g2_i1 len=1407 path=[727:0-1406]

Length=1407
                                                                      Score     E

ref|XP_009615644.1|  PREDICTED: uncharacterized protein LOC104108341    514   2e-177   
ref|XP_009768395.1|  PREDICTED: uncharacterized protein LOC104219404    504   1e-173   
ref|XP_006345971.1|  PREDICTED: uncharacterized protein LOC102585143    492   2e-168   
ref|XP_004253418.1|  PREDICTED: uncharacterized protein LOC101255382    491   3e-168   
ref|XP_011100808.1|  PREDICTED: uncharacterized protein LOC105178...    486   1e-165   
gb|EYU43999.1|  hypothetical protein MIMGU_mgv1a008330mg                484   2e-165   
ref|XP_011100805.1|  PREDICTED: uncharacterized protein LOC105178...    485   3e-165   
ref|XP_010259401.1|  PREDICTED: uncharacterized protein LOC104598850    448   2e-151   
ref|XP_010027097.1|  PREDICTED: uncharacterized protein LOC104417538    425   3e-142   
ref|XP_002302744.1|  hypothetical protein POPTR_0002s20070g             423   2e-141   Populus trichocarpa [western balsam poplar]
ref|XP_011042195.1|  PREDICTED: uncharacterized protein LOC105137943    422   3e-141   
ref|XP_010268074.1|  PREDICTED: uncharacterized protein LOC104605139    420   3e-140   
ref|XP_002320319.2|  hypothetical protein POPTR_0014s11930g             420   9e-140   Populus trichocarpa [western balsam poplar]
emb|CDO98801.1|  unnamed protein product                                414   8e-139   
gb|KDP28221.1|  hypothetical protein JCGZ_13992                         415   3e-138   
ref|XP_011041693.1|  PREDICTED: uncharacterized protein LOC105137594    413   1e-137   
ref|XP_002515325.1|  ATP binding protein, putative                      412   3e-137   Ricinus communis
ref|XP_010684627.1|  PREDICTED: uncharacterized protein LOC104899186    411   9e-137   
gb|KHG15240.1|  Lipid A export ATP-binding/permease MsbA                405   3e-133   
ref|XP_006480038.1|  PREDICTED: uncharacterized protein LOC102624124    402   4e-133   
ref|XP_007051046.1|  P-loop containing nucleoside triphosphate hy...    402   4e-133   
ref|XP_010103392.1|  hypothetical protein L484_007461                   399   4e-132   
ref|XP_006444445.1|  hypothetical protein CICLE_v10020446mg             399   8e-132   
gb|KDO87080.1|  hypothetical protein CISIN_1g016817mg                   398   1e-131   
ref|XP_010038259.1|  PREDICTED: uncharacterized protein LOC104426797    395   1e-130   
ref|XP_008779019.1|  PREDICTED: uncharacterized protein LOC103698753    395   2e-130   
ref|XP_010931701.1|  PREDICTED: uncharacterized protein LOC105052...    392   3e-129   
ref|XP_009599706.1|  PREDICTED: uncharacterized protein LOC104095312    387   1e-127   
ref|XP_009789343.1|  PREDICTED: uncharacterized protein LOC104236985    387   3e-127   
ref|XP_010931699.1|  PREDICTED: uncharacterized protein LOC105052...    383   3e-125   
ref|XP_010914516.1|  PREDICTED: uncharacterized protein LOC105039...    380   9e-125   
ref|XP_010914514.1|  PREDICTED: uncharacterized protein LOC105039...    379   4e-124   
ref|XP_010914515.1|  PREDICTED: uncharacterized protein LOC105039...    378   1e-123   
ref|XP_010914513.1|  PREDICTED: uncharacterized protein LOC105039...    377   2e-123   
ref|XP_003632400.1|  PREDICTED: uncharacterized protein LOC100854991    375   1e-122   
ref|XP_007200164.1|  hypothetical protein PRUPE_ppa016669mg             369   8e-121   
ref|XP_006359890.1|  PREDICTED: uncharacterized protein LOC102585765    369   2e-120   
ref|XP_004247531.1|  PREDICTED: uncharacterized protein LOC101256518    365   5e-119   
ref|XP_008235172.1|  PREDICTED: uncharacterized protein LOC103334029    366   5e-119   
ref|XP_008345237.1|  PREDICTED: uncharacterized protein LOC103408149    365   2e-118   
ref|XP_009378682.1|  PREDICTED: uncharacterized protein LOC103967150    363   1e-117   
ref|XP_004300478.1|  PREDICTED: uncharacterized protein LOC101306923    355   4e-114   
gb|KCW61261.1|  hypothetical protein EUGRSUZ_H04024                     349   7e-114   
ref|XP_009408742.1|  PREDICTED: uncharacterized protein LOC103991108    350   2e-112   
ref|XP_009418862.1|  PREDICTED: uncharacterized protein LOC103998953    330   2e-105   
emb|CBI36917.3|  unnamed protein product                                312   1e-99    
ref|XP_006444446.1|  hypothetical protein CICLE_v10020446mg             256   7e-78    
gb|KDO87081.1|  hypothetical protein CISIN_1g016817mg                   256   7e-78    
gb|KHG23132.1|  Phosphate import ATP-binding PstB                       139   8e-33    
ref|XP_001766514.1|  predicted protein                                  137   5e-32    
ref|XP_008458046.1|  PREDICTED: uncharacterized protein LOC103497...    129   1e-29    
ref|XP_004149770.1|  PREDICTED: uncharacterized protein LOC101208586    129   1e-29    
ref|XP_004242425.1|  PREDICTED: uncharacterized protein LOC101254004    129   3e-29    
ref|XP_006352825.1|  PREDICTED: uncharacterized protein LOC102585619    127   1e-28    
ref|XP_008458043.1|  PREDICTED: uncharacterized protein LOC103497...    125   5e-28    
ref|XP_008382590.1|  PREDICTED: uncharacterized protein LOC103445...    125   1e-27    
ref|XP_007140679.1|  hypothetical protein PHAVU_008G132700g             122   2e-27    
ref|XP_007049663.1|  P-loop containing nucleoside triphosphate hy...    123   2e-27    
ref|XP_007049662.1|  P-loop containing nucleoside triphosphate hy...    122   3e-27    
ref|XP_008235423.1|  PREDICTED: uncharacterized protein LOC103334259    124   3e-27    
ref|XP_009348367.1|  PREDICTED: uncharacterized protein LOC103940...    122   3e-27    
ref|XP_002531083.1|  ATP binding protein, putative                      122   4e-27    Ricinus communis
ref|NP_193039.3|  P-loop containing nucleoside triphosphate hydro...    122   4e-27    Arabidopsis thaliana [mouse-ear cress]
ref|NP_849371.2|  P-loop containing nucleoside triphosphate hydro...    122   4e-27    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009372213.1|  PREDICTED: uncharacterized protein LOC103961...    123   8e-27    
gb|KFK22499.1|  hypothetical protein AALP_AAs67487U000400               122   8e-27    
ref|XP_010550900.1|  PREDICTED: uncharacterized protein LOC104821...    121   9e-27    
ref|XP_010550901.1|  PREDICTED: uncharacterized protein LOC104821...    120   1e-26    
ref|XP_007199783.1|  hypothetical protein PRUPE_ppa003940mg             122   1e-26    
ref|XP_010243477.1|  PREDICTED: uncharacterized protein LOC104587528    119   1e-26    
ref|XP_008382591.1|  PREDICTED: uncharacterized protein LOC103445...    122   2e-26    
ref|XP_010696232.1|  PREDICTED: uncharacterized protein LOC104908778    122   2e-26    
ref|XP_010926162.1|  PREDICTED: uncharacterized protein LOC105048...    119   2e-26    
gb|KHN43753.1|  hypothetical protein glysoja_049903                     119   3e-26    
ref|XP_010069619.1|  PREDICTED: uncharacterized protein LOC104456512    119   3e-26    
ref|XP_006602478.1|  PREDICTED: uncharacterized protein LOC100783...    119   4e-26    
ref|XP_006602477.1|  PREDICTED: uncharacterized protein LOC100783...    119   4e-26    
ref|XP_006602476.1|  PREDICTED: uncharacterized protein LOC100783...    119   4e-26    
ref|XP_003552104.1|  PREDICTED: uncharacterized protein LOC100783...    119   5e-26    
ref|XP_008372522.1|  PREDICTED: uncharacterized protein LOC103435...    120   5e-26    
ref|XP_009348369.1|  PREDICTED: uncharacterized protein LOC103940...    119   7e-26    
ref|XP_010926161.1|  PREDICTED: uncharacterized protein LOC105048...    117   9e-26    
ref|XP_009372214.1|  PREDICTED: uncharacterized protein LOC103961...    120   1e-25    
ref|XP_008458044.1|  PREDICTED: uncharacterized protein LOC103497...    118   1e-25    
ref|XP_010100781.1|  Serine/threonine-protein kinase MHK                120   1e-25    
ref|XP_002863279.1|  hypothetical protein ARALYDRAFT_497092             118   1e-25    
ref|XP_009610772.1|  PREDICTED: uncharacterized protein LOC104104...    117   2e-25    
ref|XP_008780970.1|  PREDICTED: uncharacterized protein LOC103700...    116   2e-25    
ref|XP_009610773.1|  PREDICTED: uncharacterized protein LOC104104...    116   2e-25    
ref|XP_011024603.1|  PREDICTED: uncharacterized protein LOC105125...    118   2e-25    
ref|XP_008780962.1|  PREDICTED: uncharacterized protein LOC103700...    116   2e-25    
ref|XP_009787336.1|  PREDICTED: uncharacterized protein LOC104235...    116   5e-25    
ref|XP_011024602.1|  PREDICTED: uncharacterized protein LOC105125...    118   5e-25    
ref|XP_008780954.1|  PREDICTED: uncharacterized protein LOC103700...    115   5e-25    
gb|AES79089.2|  ATP-binding protein, putative                           116   6e-25    
gb|AFK38535.1|  unknown                                                 116   6e-25    
ref|XP_010450267.1|  PREDICTED: uncharacterized protein LOC104732...    116   6e-25    
ref|XP_008372523.1|  PREDICTED: uncharacterized protein LOC103435...    116   7e-25    
ref|XP_010450266.1|  PREDICTED: uncharacterized protein LOC104732...    116   7e-25    
ref|XP_003622871.1|  hypothetical protein MTR_7g055720                  115   8e-25    
ref|XP_009408995.1|  PREDICTED: uncharacterized protein LOC103991312    114   9e-25    
ref|XP_004290170.1|  PREDICTED: uncharacterized protein LOC101307548    116   2e-24    
ref|XP_009372211.1|  PREDICTED: uncharacterized protein LOC103961...    116   2e-24    
ref|XP_004292355.1|  PREDICTED: uncharacterized protein LOC101301843    112   2e-24    
ref|XP_002303066.1|  hypothetical protein POPTR_0002s24880g             115   3e-24    Populus trichocarpa [western balsam poplar]
ref|XP_009787339.1|  PREDICTED: uncharacterized protein LOC104235...    113   3e-24    
ref|XP_009787338.1|  PREDICTED: uncharacterized protein LOC104235...    113   4e-24    
ref|XP_009787337.1|  PREDICTED: uncharacterized protein LOC104235...    113   5e-24    
ref|XP_008458042.1|  PREDICTED: uncharacterized protein LOC103497...    114   5e-24    
ref|XP_009787335.1|  PREDICTED: uncharacterized protein LOC104235...    112   7e-24    
ref|XP_010435316.1|  PREDICTED: uncharacterized protein LOC104719...    112   1e-23    
ref|XP_010435315.1|  PREDICTED: uncharacterized protein LOC104719...    112   1e-23    
ref|XP_010440644.1|  PREDICTED: uncharacterized protein LOC104723...    111   3e-23    
ref|XP_009372212.1|  PREDICTED: uncharacterized protein LOC103961...    112   3e-23    
gb|AAQ22612.1|  At4g13030                                               110   3e-23    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010440643.1|  PREDICTED: uncharacterized protein LOC104723...    111   3e-23    
emb|CDY34538.1|  BnaA08g04930D                                          111   3e-23    
ref|XP_009107671.1|  PREDICTED: uncharacterized protein LOC103833338    110   3e-23    
ref|XP_008780979.1|  PREDICTED: uncharacterized protein LOC103700...    109   6e-23    
gb|KDP45291.1|  hypothetical protein JCGZ_15156                         110   6e-23    
ref|XP_006443541.1|  hypothetical protein CICLE_v10020463mg             109   7e-23    
gb|EYU26986.1|  hypothetical protein MIMGU_mgv1a020328mg                108   8e-23    
ref|XP_006443540.1|  hypothetical protein CICLE_v10020463mg             109   8e-23    
ref|XP_006443543.1|  hypothetical protein CICLE_v10020463mg             109   8e-23    
ref|XP_006479215.1|  PREDICTED: uncharacterized protein LOC102623...    109   8e-23    
ref|XP_006443539.1|  hypothetical protein CICLE_v10020463mg             108   8e-23    
ref|XP_002265228.1|  PREDICTED: uncharacterized protein LOC100246...    108   9e-23    Vitis vinifera
gb|KDO65996.1|  hypothetical protein CISIN_1g015952mg                   108   1e-22    
ref|XP_003622872.1|  hypothetical protein MTR_7g055730                  109   2e-22    
ref|XP_011089056.1|  PREDICTED: uncharacterized protein LOC105170...    107   4e-22    
gb|KDO65997.1|  hypothetical protein CISIN_1g015952mg                   106   5e-22    
ref|NP_001150449.1|  ATP binding protein                                106   5e-22    Zea mays [maize]
gb|KDO65999.1|  hypothetical protein CISIN_1g015952mg                   106   5e-22    
ref|XP_011089055.1|  PREDICTED: uncharacterized protein LOC105170...    107   5e-22    
gb|KDO66000.1|  hypothetical protein CISIN_1g015952mg                   106   5e-22    
gb|KDO66001.1|  hypothetical protein CISIN_1g015952mg                   106   6e-22    
gb|AFW74481.1|  ATP binding protein                                     106   1e-21    
ref|XP_010646542.1|  PREDICTED: uncharacterized protein LOC100246...    104   1e-21    
ref|XP_010926164.1|  PREDICTED: uncharacterized protein LOC105048...    105   2e-21    
emb|CDP03923.1|  unnamed protein product                                104   4e-21    
tpg|DAA47951.1|  TPA: hypothetical protein ZEAMMB73_985826              102   1e-20    
ref|XP_008666477.1|  PREDICTED: uncharacterized protein LOC103645140    101   2e-20    
emb|CAB45502.1|  putative protein                                       100   6e-20    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004492277.1|  PREDICTED: uncharacterized protein LOC101507...    101   9e-20    
gb|EEC78892.1|  hypothetical protein OsI_19263                        99.8    1e-19    Oryza sativa Indica Group [Indian rice]
ref|NP_001055071.1|  Os05g0274300                                     99.4    2e-19    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006655162.1|  PREDICTED: uncharacterized protein LOC102705435  99.4    2e-19    
gb|AAS82599.1|  hypothetical protein S250_18C08.34                    97.4    3e-19    Sorghum bicolor [broomcorn]
ref|XP_004958573.1|  PREDICTED: uncharacterized protein LOC101768...  97.1    1e-18    
ref|XP_002443812.1|  hypothetical protein SORBIDRAFT_07g002570        96.7    2e-18    Sorghum bicolor [broomcorn]
ref|XP_004958572.1|  PREDICTED: uncharacterized protein LOC101768...  95.5    4e-18    
gb|EYU39220.1|  hypothetical protein MIMGU_mgv1a026429mg              92.8    1e-17    
gb|EMT26532.1|  hypothetical protein F775_07111                       89.7    5e-16    
ref|XP_004492279.1|  PREDICTED: uncharacterized protein LOC101507...  88.6    1e-15    
ref|XP_004492276.1|  PREDICTED: uncharacterized protein LOC101507...  88.6    2e-15    
gb|EMS54578.1|  hypothetical protein TRIUR3_09023                     88.2    2e-15    
gb|EPS71715.1|  hypothetical protein M569_03045                       85.5    2e-15    
ref|XP_004492278.1|  PREDICTED: uncharacterized protein LOC101507...  86.3    6e-15    
ref|XP_006443542.1|  hypothetical protein CICLE_v10020463mg           85.1    1e-14    
gb|KDO65998.1|  hypothetical protein CISIN_1g015952mg                 82.0    8e-14    
ref|XP_009610774.1|  PREDICTED: uncharacterized protein LOC104104...  82.4    9e-14    
ref|XP_006284430.1|  hypothetical protein CARUB_v10005599mg           73.2    3e-11    
ref|XP_006843770.1|  hypothetical protein AMTR_s00007p00242150        73.2    6e-11    
gb|AFK48527.1|  unknown                                               71.2    8e-11    
ref|WP_035751619.1|  daunorubicin resistance protein DrrC             58.9    6e-06    
ref|WP_006360361.1|  ABC transporter                                  58.2    1e-05    
gb|EMP12725.1|  ABC transporter family protein                        57.0    3e-05    
ref|WP_013863686.1|  ABC transporter                                  56.2    5e-05    
ref|WP_005194993.1|  excinuclease ABC subunit A                       53.1    3e-04    
ref|WP_006864756.1|  ABC transporter                                  53.1    4e-04    



>ref|XP_009615644.1| PREDICTED: uncharacterized protein LOC104108341 [Nicotiana tomentosiformis]
Length=382

 Score =   514 bits (1325),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 250/377 (66%), Positives = 302/377 (80%), Gaps = 4/377 (1%)
 Frame = -1

Query  1353  QLSFSDED-QSELLKTAAWWWRTLPEFDENGRFKEDISS-GGLSPRLKLLREMQRLAFIS  1180
              LSFSDED QSEL KTA WWWRT  +FDENG  K DIS+   L+PRLKLLREM+RLA IS
Sbjct  3     NLSFSDEDNQSELPKTAIWWWRTPQDFDENGHLKVDISNLSNLTPRLKLLREMERLALIS  62

Query  1179  MEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVL  1000
              EG++ LRHKL +Y+ GD W+PVGGIKK DMDIP VITLLLVGL+ SGKSSLVN+MYSVL
Sbjct  63    SEGIEDLRHKLITYRCGDFWLPVGGIKKEDMDIPPVITLLLVGLSASGKSSLVNYMYSVL  122

Query  999   GRSGLIPFAQTSSQPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWM  820
             GRSGLIPFAQTSS  + +TTM LEEHNVLRS ++GFCVYDTRGLD + M+EG+E+V SWM
Sbjct  123   GRSGLIPFAQTSSGNSHYTTMFLEEHNVLRSMRSGFCVYDTRGLDSNDMNEGLEEVSSWM  182

Query  819   SDGVRHNQPCCRGSDDDREMMEYSMAG--RCANKYCKRRVNCVLVVADMEEAFKDFSSGD  646
             + GVRHNQPC R  D        + A   R   +Y KR+++CV+VVAD+ E  K F+SGD
Sbjct  183   TRGVRHNQPCLRHGDYKLINGGGTDASSLRSNTRYTKRKIDCVVVVADLSEINKAFNSGD  242

Query  645   LKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYDI  466
             LK VE +K +F++P IR+SNE P+LILTHGD ++AEER+ +RLK+CE LGI ETTGAYDI
Sbjct  243   LKPVETLKNLFNNPCIRKSNENPLLILTHGDKISAEERITSRLKICEYLGIPETTGAYDI  302

Query  465   ACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKDWVLAFASWVLCCFSSF  286
             ACL+E GI  EE DPV+AFALTEAVYRSL+QSDR HLPK+ +KDW++ F +W++CC  SF
Sbjct  303   ACLTEQGILPEESDPVAAFALTEAVYRSLMQSDRNHLPKKNWKDWIVLFVAWIMCCIGSF  362

Query  285   FAMLANFFSRFGGNNKR  235
             FAMLA+FFSRF  +N +
Sbjct  363   FAMLAHFFSRFSHHNNK  379



>ref|XP_009768395.1| PREDICTED: uncharacterized protein LOC104219404 [Nicotiana sylvestris]
Length=373

 Score =   504 bits (1299),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 244/375 (65%), Positives = 297/375 (79%), Gaps = 9/375 (2%)
 Frame = -1

Query  1353  QLSFSDED-QSELLKTAAWWWRTLPEFDENGRFKEDISS-GGLSPRLKLLREMQRLAFIS  1180
               SFSDED Q EL KTA WWWRT  +FDENG  K DIS    L+PRLK+LREM+RLA IS
Sbjct  3     NFSFSDEDNQRELPKTAIWWWRTPQDFDENGHLKVDISDLSNLTPRLKVLREMERLALIS  62

Query  1179  MEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVL  1000
              EG++  RHKL +Y++GD W+PVGGIKK DMDIPAVITLLLVGL+ SGKSSLVN+MYSVL
Sbjct  63    TEGIEDHRHKLITYRSGDFWLPVGGIKKEDMDIPAVITLLLVGLSASGKSSLVNYMYSVL  122

Query  999   GRSGLIPFAQTSSQPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWM  820
             GRSGLIPFAQ+SS  + +TTM LEEHNVLRS ++GFCVYD+RGLD + M EG+E+V +WM
Sbjct  123   GRSGLIPFAQSSSGNSHYTTMFLEEHNVLRSMRSGFCVYDSRGLDSNDMIEGLEEVSTWM  182

Query  819   SDGVRHNQPCCRGSDDDREMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDFSSGDLK  640
             + GVRHNQPC R  D         + G    +Y KR+V+CV+VVAD+ E  K F+SGDLK
Sbjct  183   TRGVRHNQPCFRHGDK-------LINGGSNTRYAKRKVDCVVVVADLSEINKAFNSGDLK  235

Query  639   HVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYDIAC  460
              VEA+K++F +  IR+SNE P+LILTHGD ++ EER+ +RLK+CE LGI ETTGAYDIAC
Sbjct  236   PVEALKILFTNHCIRKSNENPLLILTHGDTISTEERITSRLKICEYLGIPETTGAYDIAC  295

Query  459   LSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKDWVLAFASWVLCCFSSFFA  280
             L+E GI  EE DPV+AFALTEAVYRSL+QSDR HLPK+K+KDWV+ F +W++CC  SFFA
Sbjct  296   LTEQGILPEESDPVTAFALTEAVYRSLMQSDRNHLPKKKWKDWVVIFVAWIMCCIGSFFA  355

Query  279   MLANFFSRFGGNNKR  235
             MLA+FFS F  +N +
Sbjct  356   MLAHFFSTFTHHNNK  370



>ref|XP_006345971.1| PREDICTED: uncharacterized protein LOC102585143 [Solanum tuberosum]
Length=375

 Score =   492 bits (1266),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 237/379 (63%), Positives = 297/379 (78%), Gaps = 11/379 (3%)
 Frame = -1

Query  1353  QLSFSDEDQSELL-KTAAWWWRTLPEFDENGRFKEDISS-GGLSPRLKLLREMQRLAFIS  1180
              +SFSDE+QS++L KTA  WWRT  +FDENG  K DIS    L+PRLK+LREM+RLAFIS
Sbjct  3     NISFSDEEQSDILPKTATLWWRTPQDFDENGHLKVDISDLSKLTPRLKILREMERLAFIS  62

Query  1179  MEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVL  1000
              EGL+ LRHKL +Y+AGD W+PVGG+KK DM+I  VIT++LVGL  SGKSSLVN+MYSVL
Sbjct  63    TEGLEDLRHKLITYRAGDFWLPVGGVKKEDMEIAPVITIVLVGLCASGKSSLVNYMYSVL  122

Query  999   GRSGLIPFAQTSSQPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWM  820
             GRSGLIPFAQTSS  + +TTM LEEHNVLRS ++GFCVYDTRGLD + M EG+++V +WM
Sbjct  123   GRSGLIPFAQTSSGNSHYTTMFLEEHNVLRSMRSGFCVYDTRGLDTNDMIEGLDEVSTWM  182

Query  819   SDGVRHNQPCCRGSDDDREMMEYSMAGRCANK-YCKRRVNCVLVVADMEEAFKDFSSGDL  643
             + GV+HNQPC R  D       Y+   +  NK Y KR V+C ++VAD+ E    F SGDL
Sbjct  183   TRGVQHNQPCFRHDD-------YNNNNKITNKRYTKRNVDCAIIVADLSEINTAFISGDL  235

Query  642   KHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYDIA  463
             K V A+K +F++ SIR+SNE P+LILTHGD ++AEER+ +RLK+CE LGI ETTG YD+A
Sbjct  236   KDVVALKSLFNNSSIRKSNENPLLILTHGDTISAEERINSRLKICEFLGIPETTGVYDVA  295

Query  462   CLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKDWVLAFASWVLCCFSSFF  283
             CL+E GI  EE DP++AFALTEAVYRSL+QSDR H PK+K KDW++ F +W+LCC  +FF
Sbjct  296   CLTEQGILPEESDPITAFALTEAVYRSLMQSDRNHQPKKKLKDWIVLFLTWILCCIGAFF  355

Query  282   AMLANFFSRFGG-NNKRHR  229
             A+LANFFS+    +NKRH+
Sbjct  356   AILANFFSKCSQPHNKRHK  374



>ref|XP_004253418.1| PREDICTED: uncharacterized protein LOC101255382 [Solanum lycopersicum]
Length=375

 Score =   491 bits (1263),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 238/377 (63%), Positives = 297/377 (79%), Gaps = 11/377 (3%)
 Frame = -1

Query  1353  QLSFSDEDQSELL-KTAAWWWRTLPEFDENGRFKEDISS-GGLSPRLKLLREMQRLAFIS  1180
              +SFSDE+QS+   KTA+ WWRT  +FDENG  K DIS    L+PRLK+LREM+RLAFIS
Sbjct  3     NISFSDEEQSDSSPKTASLWWRTPEDFDENGHLKIDISDLSKLTPRLKILREMERLAFIS  62

Query  1179  MEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVL  1000
              EGL+ LRHKL SY+AGD W+P+GGIKK DM+IP +IT+LLVGL+ SGKSSL+N+MYSVL
Sbjct  63    TEGLEDLRHKLISYRAGDFWLPIGGIKKEDMEIPPMITILLVGLSASGKSSLINYMYSVL  122

Query  999   GRSGLIPFAQTSSQPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWM  820
             GRSGLIPFAQTSS  + +TTM LEEHNVLRS ++GFCVYDTRGLD + M EG+++V +WM
Sbjct  123   GRSGLIPFAQTSSGSSHYTTMFLEEHNVLRSMRSGFCVYDTRGLDTNDMIEGLDEVSTWM  182

Query  819   SDGVRHNQPCCRGSDDDREMMEYSMAGRCANK-YCKRRVNCVLVVADMEEAFKDFSSGDL  643
             + GVRHNQPC R  D       Y    + +NK Y KR V+C ++VAD+ E  K F+SGDL
Sbjct  183   TRGVRHNQPCFRHDD-------YDNNNKISNKRYTKRDVDCAIIVADLSEINKAFNSGDL  235

Query  642   KHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYDIA  463
             K V A+K +F++ SIR+SNE P+LILTHGD ++ EER+ +RLK+CE LGI ETTG YDIA
Sbjct  236   KDVVALKSLFNNSSIRKSNENPLLILTHGDTISTEERINSRLKICEFLGIPETTGVYDIA  295

Query  462   CLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKDWVLAFASWVLCCFSSFF  283
             CL+E GI  +E DPV+AFALTEAVYRSL+QSDR H PK+K KDW++ F +W+LCC  +FF
Sbjct  296   CLTEQGILPDESDPVTAFALTEAVYRSLMQSDRNHQPKKKLKDWIVLFLTWILCCIGAFF  355

Query  282   AMLANFFSRFG-GNNKR  235
             A+LANFFS+    +NKR
Sbjct  356   AILANFFSKCSQSHNKR  372



>ref|XP_011100808.1| PREDICTED: uncharacterized protein LOC105178916 isoform X2 [Sesamum 
indicum]
 ref|XP_011100809.1| PREDICTED: uncharacterized protein LOC105178916 isoform X2 [Sesamum 
indicum]
Length=405

 Score =   486 bits (1250),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 228/384 (59%), Positives = 297/384 (77%), Gaps = 2/384 (1%)
 Frame = -1

Query  1374  HRKIMRSQLSFSDEDQSELLKTAAWWWRTLPEFDENGRFKEDISS-GGLSPRLKLLREMQ  1198
             +R++    +  SDE+++ +  +   WWRT  EFDENG FK +IS    L+PR K+LREM+
Sbjct  23    NRQMRNHHIFLSDEEENGVPTSPFCWWRTAEEFDENGHFKLEISDLSKLTPRFKVLREME  82

Query  1197  RLAFISMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVN  1018
             RLA I+ EGLD LRHKL  Y+AGD W+P+GGIKK +MDIP  +T+LL GLT SGKSSL+N
Sbjct  83    RLALIAGEGLDDLRHKLLCYRAGDFWLPIGGIKKEEMDIPPAVTILLTGLTASGKSSLIN  142

Query  1017  FMYSVLGRSGLIPFAQTSSQPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGME  838
              MYSVLGRSGLIPFAQTS +P+  TTM LEEHNVLRS ++GFCVYDTRGLD + M EG+ 
Sbjct  143   LMYSVLGRSGLIPFAQTSGEPSNHTTMYLEEHNVLRSPRSGFCVYDTRGLDQNHMMEGLG  202

Query  837   DVWSWMSDGVRHNQPCCRGSDDDREMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDF  658
             +V +WMSDGVRHNQPC R  ++  + ++    G   ++Y KR+VNCV+VVAD+ +  K F
Sbjct  203   EVSTWMSDGVRHNQPCYRSVNEKDKGLD-GPVGLTNSRYIKRKVNCVMVVADLSQIHKAF  261

Query  657   SSGDLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTG  478
               GDL  +E ++ +FH  +++ SNE P+LILTHGD L AEER+ +RLK+CE LGI ET+G
Sbjct  262   QCGDLMSIEVLRALFHFSAVKSSNESPILILTHGDTLNAEERINSRLKICEYLGIPETSG  321

Query  477   AYDIACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKDWVLAFASWVLCC  298
             AYDI CL+E GI AE+ DPV+AFALTEAV+R+LLQSDRTHLPK  FKDW++ F +W++CC
Sbjct  322   AYDIPCLTEQGILAEQSDPVTAFALTEAVFRALLQSDRTHLPKWNFKDWLIWFLTWIMCC  381

Query  297   FSSFFAMLANFFSRFGGNNKRHRL  226
              +SFFA+LA+FFSRFG ++K+ R+
Sbjct  382   LASFFAVLADFFSRFGHHDKKLRM  405



>gb|EYU43999.1| hypothetical protein MIMGU_mgv1a008330mg [Erythranthe guttata]
Length=377

 Score =   484 bits (1245),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 225/380 (59%), Positives = 293/380 (77%), Gaps = 4/380 (1%)
 Frame = -1

Query  1362  MRSQLSFSDEDQSELLKTAAWWWRTLPEFDENGRFKEDISS-GGLSPRLKLLREMQRLAF  1186
             M++ L  SDE+Q+   ++A  WWRT  EFDENG FK D+S    L+PR K+LREM+RLAF
Sbjct  1     MKNHLFSSDEEQNGGRRSAYSWWRTADEFDENGHFKIDVSEFSNLTPRYKILREMERLAF  60

Query  1185  ISMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYS  1006
             I+ +GLD LRHKL SY+AGD W+P+GG+KK DMDIP V+T+LL GLT SGKSS  N MYS
Sbjct  61    IATDGLDDLRHKLLSYRAGDFWLPIGGLKKEDMDIPPVVTILLAGLTASGKSSFTNLMYS  120

Query  1005  VLGRSGLIPFAQTSSQPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWS  826
             VLGRSGLIPFAQTS + + +TTM LEEHNVLRS ++G CVYDTRGLD   M+EG+++V +
Sbjct  121   VLGRSGLIPFAQTSGESSNYTTMFLEEHNVLRSPRSGLCVYDTRGLDKDEMEEGLDEVST  180

Query  825   WMSDGVRHNQPCCRGSDDDREMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDFSSGD  646
             WMS GVRHNQPC R  D D+  +   +     ++Y +R+VNCV+VVAD+ +  + F  GD
Sbjct  181   WMSVGVRHNQPCHRPGDGDKSQLSDELTN---SRYLRRKVNCVMVVADLSQIHRSFKCGD  237

Query  645   LKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYDI  466
             L  +EA++ +FH  +++ SNE P+LILTHGD L AEER+  RL++CE LGI ET+GAYDI
Sbjct  238   LNSMEALRDLFHLSAVKNSNENPILILTHGDKLNAEERINGRLRICEYLGIPETSGAYDI  297

Query  465   ACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKDWVLAFASWVLCCFSSF  286
              C++E GI AEE DPV+AF+LTEAVYR+LLQSDRTHLPK+KFKDW++ F  W++ C +  
Sbjct  298   PCMTEQGIMAEESDPVTAFSLTEAVYRALLQSDRTHLPKKKFKDWLIFFCKWIMWCIACL  357

Query  285   FAMLANFFSRFGGNNKRHRL  226
             F +LANFFS+FG +NK+ ++
Sbjct  358   FVILANFFSKFGHHNKKLKM  377



>ref|XP_011100805.1| PREDICTED: uncharacterized protein LOC105178916 isoform X1 [Sesamum 
indicum]
 ref|XP_011100806.1| PREDICTED: uncharacterized protein LOC105178916 isoform X1 [Sesamum 
indicum]
 ref|XP_011100807.1| PREDICTED: uncharacterized protein LOC105178916 isoform X1 [Sesamum 
indicum]
Length=416

 Score =   485 bits (1248),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 228/384 (59%), Positives = 297/384 (77%), Gaps = 2/384 (1%)
 Frame = -1

Query  1374  HRKIMRSQLSFSDEDQSELLKTAAWWWRTLPEFDENGRFKEDISS-GGLSPRLKLLREMQ  1198
             +R++    +  SDE+++ +  +   WWRT  EFDENG FK +IS    L+PR K+LREM+
Sbjct  34    NRQMRNHHIFLSDEEENGVPTSPFCWWRTAEEFDENGHFKLEISDLSKLTPRFKVLREME  93

Query  1197  RLAFISMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVN  1018
             RLA I+ EGLD LRHKL  Y+AGD W+P+GGIKK +MDIP  +T+LL GLT SGKSSL+N
Sbjct  94    RLALIAGEGLDDLRHKLLCYRAGDFWLPIGGIKKEEMDIPPAVTILLTGLTASGKSSLIN  153

Query  1017  FMYSVLGRSGLIPFAQTSSQPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGME  838
              MYSVLGRSGLIPFAQTS +P+  TTM LEEHNVLRS ++GFCVYDTRGLD + M EG+ 
Sbjct  154   LMYSVLGRSGLIPFAQTSGEPSNHTTMYLEEHNVLRSPRSGFCVYDTRGLDQNHMMEGLG  213

Query  837   DVWSWMSDGVRHNQPCCRGSDDDREMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDF  658
             +V +WMSDGVRHNQPC R  ++  + ++    G   ++Y KR+VNCV+VVAD+ +  K F
Sbjct  214   EVSTWMSDGVRHNQPCYRSVNEKDKGLD-GPVGLTNSRYIKRKVNCVMVVADLSQIHKAF  272

Query  657   SSGDLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTG  478
               GDL  +E ++ +FH  +++ SNE P+LILTHGD L AEER+ +RLK+CE LGI ET+G
Sbjct  273   QCGDLMSIEVLRALFHFSAVKSSNESPILILTHGDTLNAEERINSRLKICEYLGIPETSG  332

Query  477   AYDIACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKDWVLAFASWVLCC  298
             AYDI CL+E GI AE+ DPV+AFALTEAV+R+LLQSDRTHLPK  FKDW++ F +W++CC
Sbjct  333   AYDIPCLTEQGILAEQSDPVTAFALTEAVFRALLQSDRTHLPKWNFKDWLIWFLTWIMCC  392

Query  297   FSSFFAMLANFFSRFGGNNKRHRL  226
              +SFFA+LA+FFSRFG ++K+ R+
Sbjct  393   LASFFAVLADFFSRFGHHDKKLRM  416



>ref|XP_010259401.1| PREDICTED: uncharacterized protein LOC104598850 [Nelumbo nucifera]
Length=379

 Score =   448 bits (1152),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 207/380 (54%), Positives = 290/380 (76%), Gaps = 3/380 (1%)
 Frame = -1

Query  1362  MRSQLSFSDEDQSELLKTAAWWWRTLPEFDENGRFKEDISS-GGLSPRLKLLREMQRLAF  1186
             MR+ +SFSDED++E  K+   WWR+   F++ G+ K D+S+   L+PR+K+LREM+RLA 
Sbjct  1     MRNHISFSDEDENESSKSPFCWWRSAEHFNDQGQLKLDLSNLSNLTPRVKVLREMERLAL  60

Query  1185  ISMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYS  1006
             I+ EGLD LRHKL +Y++GD W+P+GGIKK +MD+P+V+T+LLVG +GSGKSSLVN +YS
Sbjct  61    IAPEGLDDLRHKLLAYRSGDFWLPIGGIKKENMDVPSVVTILLVGFSGSGKSSLVNLLYS  120

Query  1005  VLGRSGLIPFAQTSSQPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWS  826
             VLGRSGLIPFA TS   + +TT  LEEHNVLRS ++GFCVYD+RGLD + +DE +E +  
Sbjct  121   VLGRSGLIPFAHTSGNTSNYTTTFLEEHNVLRSLRSGFCVYDSRGLDYNGVDESLERLSG  180

Query  825   WMSDGVRHNQPCCRGSDDDREMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDFSSGD  646
             W++DGV H+Q C + +D++ + +  SMA    +K+ +RRVNCV+VVA++ E ++    GD
Sbjct  181   WLADGVHHHQLCQKSADEESKPLIGSMAS--PSKFTRRRVNCVMVVANIAEIYQALKKGD  238

Query  645   LKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYDI  466
             LK +EA K +F+ P+IR+ NE P+LILTHGD L+ EER++ R+K+C+ LGISETTG YDI
Sbjct  239   LKPMEATKTLFNCPAIRKCNENPILILTHGDKLSPEERIDGRVKICKFLGISETTGTYDI  298

Query  465   ACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKDWVLAFASWVLCCFSSF  286
              CL+E G   +E DP++A+ALTEA+YR+L+ SDRTH PKR  KDWV    SW++C  ++ 
Sbjct  299   VCLTEHGFLPDEADPITAYALTEAMYRALILSDRTHPPKRSVKDWVELLVSWLMCSIAAI  358

Query  285   FAMLANFFSRFGGNNKRHRL  226
             FA+LA FFS+ G  + + +L
Sbjct  359   FALLAYFFSKLGRKDNKLKL  378



>ref|XP_010027097.1| PREDICTED: uncharacterized protein LOC104417538 [Eucalyptus grandis]
Length=378

 Score =   425 bits (1092),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 210/374 (56%), Positives = 278/374 (74%), Gaps = 8/374 (2%)
 Frame = -1

Query  1341  SDEDQ-SELLKTAAWWWRTLPEFDENG-RFKEDISS-GGLSPRLKLLREMQRLAFISMEG  1171
             S EDQ ++ L ++  WWR+  EF +N  R    ++    L+PRLK+LREM+RLA I+ EG
Sbjct  4     STEDQETDPLISSCSWWRSAREFKDNDHRLSSPLADLSNLTPRLKVLREMERLALIAPEG  63

Query  1170  LDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRS  991
             L+ LRHKL +Y++GD W+PVGG+K+ DM IP ++ ++LVGL+GSGKSSLVN MYSVLGRS
Sbjct  64    LNELRHKLVAYRSGDFWLPVGGVKREDMVIPPIMMVVLVGLSGSGKSSLVNLMYSVLGRS  123

Query  990   GLIPFAQTSS-QPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSD  814
             GLIPF+QTS+ + +++TTM LEEHNVLRS ++GFC+YDTRGLD ++M EG+++V  WM++
Sbjct  124   GLIPFSQTSTDESSRYTTMYLEEHNVLRSLRSGFCIYDTRGLDVNQMKEGLDEVSEWMNN  183

Query  813   GVRHNQPCCRGSDD--DREMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDFSSGDLK  640
             GVRH Q C R  DD   RE +   M G    ++  R+VNC LVVA+M +      SGDLK
Sbjct  184   GVRHYQLCLRPGDDVFRREALVTPMMGNA--RFGTRQVNCALVVANMAQICNGVQSGDLK  241

Query  639   HVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYDIAC  460
              +EA K +FH P++R+S+E P+LILTHGD L+ EER+  RLK+ E LG++ETTG YDI C
Sbjct  242   PLEATKDLFHCPALRKSSESPILILTHGDELSPEERIIGRLKISEYLGVAETTGLYDIPC  301

Query  459   LSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKDWVLAFASWVLCCFSSFFA  280
             L+E GI  EE DPV+A+AL EAVYR+LLQ+DR HLPK+K +D V    SW +C   SFFA
Sbjct  302   LTEQGILPEESDPVTAYALAEAVYRALLQADRAHLPKKKLRDRVSLVLSWFMCSIGSFFA  361

Query  279   MLANFFSRFGGNNK  238
             +LA FFS+ G NNK
Sbjct  362   LLAYFFSKLGRNNK  375



>ref|XP_002302744.1| hypothetical protein POPTR_0002s20070g [Populus trichocarpa]
 gb|EEE82017.1| hypothetical protein POPTR_0002s20070g [Populus trichocarpa]
Length=381

 Score =   423 bits (1087),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 207/383 (54%), Positives = 275/383 (72%), Gaps = 6/383 (2%)
 Frame = -1

Query  1362  MRSQLSFSDEDQSELLKTAAWWWRTLPEFDENGRFKEDISS-GGLSPRLKLLREMQRLAF  1186
             M+SQ S +DED+ +L      WWR+  +FDE  R K DI +   L+PR+++LRE++RLA 
Sbjct  1     MKSQHSSNDEDEHQLSSLGYCWWRSAAKFDECVRLKSDIPNIASLTPRVRVLRELERLAL  60

Query  1185  ISMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYS  1006
             IS EGL+ +R+KL  Y++GD WVP GGIKK +MDIP VIT+LLVG +GSGKSSLVN MYS
Sbjct  61    ISHEGLNEVRYKLQMYRSGDFWVPTGGIKKEEMDIPPVITILLVGFSGSGKSSLVNLMYS  120

Query  1005  VLGRSGLIPFAQTSSQ-PTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVW  829
             VLGRSGLIPFAQTSS   +K+TTM +EEHNV+RS + GFCVYD+RG    ++ + +E++ 
Sbjct  121   VLGRSGLIPFAQTSSGCASKYTTMYMEEHNVMRSLQGGFCVYDSRGFSYGKIGDALEELS  180

Query  828   SWMSDGVRHNQPCCRGSDDDREMMEYSMAG-RCANKYCKRRVNCVLVVADMEEAFKDFSS  652
             SWMSDGV HNQ C R  DD     +   AG R ++K+ +R VN  +VV ++ E +K   +
Sbjct  181   SWMSDGVHHNQLCLRSGDDVLLEDDAETAGLRPSSKFVQRTVNFSMVVVNIAEVYKALKA  240

Query  651   GDLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAY  472
              D K +EA + +FHSP +R  NE PMLILTHGD+LT E+R++ R+KLCE LGISET G Y
Sbjct  241   SDSKPLEATRELFHSPGLRNCNENPMLILTHGDLLTTEQRIDIRIKLCERLGISETNGVY  300

Query  471   DIACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKDWVLAFASWVLCCFS  292
             DI CL+E G  AEE DPV+A+A+TEAVYR+LL +DR H PK+  +DW +   SW++C   
Sbjct  301   DIVCLTEYGFLAEESDPVTAYAVTEAVYRALLIADRGHFPKKNLQDWAVFLFSWLMCLTG  360

Query  291   SFFAMLANFFSRFGGNNKRHRLK  223
             + FA LA+  S+ G   +R +LK
Sbjct  361   ALFAFLADLCSKLG---RRDKLK  380



>ref|XP_011042195.1| PREDICTED: uncharacterized protein LOC105137943 [Populus euphratica]
Length=381

 Score =   422 bits (1086),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 206/378 (54%), Positives = 273/378 (72%), Gaps = 3/378 (1%)
 Frame = -1

Query  1362  MRSQLSFSDEDQSELLKTAAWWWRTLPEFDENGRFKEDISS-GGLSPRLKLLREMQRLAF  1186
             MRSQ S SDED+ +L      WWR+  +FDE  RFK DI +   L+PR+++LRE++RLA 
Sbjct  1     MRSQHSSSDEDEHQLSSLGYCWWRSAAKFDECVRFKSDIPNMASLTPRVRVLRELERLAL  60

Query  1185  ISMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYS  1006
             I+ EGL+ +R+KL  Y++GD WVP GGIKK +MDIP VIT+LLVG +GSGKSSLVN MYS
Sbjct  61    IAHEGLNEVRYKLQMYRSGDFWVPTGGIKKEEMDIPPVITILLVGFSGSGKSSLVNLMYS  120

Query  1005  VLGRSGLIPFAQTSS-QPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVW  829
             VLGRSGLIPFA TSS   +K+TTM +EEHNV+RS + GFCVYD+RG    ++ + +E++ 
Sbjct  121   VLGRSGLIPFALTSSGSASKYTTMYMEEHNVMRSLQGGFCVYDSRGFSYGKIGDALEELS  180

Query  828   SWMSDGVRHNQPCCRGSDDDREMMEYSMAG-RCANKYCKRRVNCVLVVADMEEAFKDFSS  652
             SWMSDGV HNQ C R  DD     +   AG R ++K+ +R VN  +VV ++ E +K   +
Sbjct  181   SWMSDGVHHNQLCLRSGDDVMLGDDAETAGLRPSSKFVQRTVNFSMVVVNIAEVYKALKA  240

Query  651   GDLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAY  472
              D K +EA + +FHSP++R  NE P+LILTHGD+LT EER++ R++LCE LGISET G Y
Sbjct  241   SDSKPLEASRELFHSPALRFCNENPILILTHGDLLTTEERIDIRIRLCERLGISETNGVY  300

Query  471   DIACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKDWVLAFASWVLCCFS  292
             DI CL+E G  AEE DPV+A+A+TEAVYR+LL SDR H PK+  +DW +   SW++C   
Sbjct  301   DIVCLTEYGFLAEESDPVTAYAVTEAVYRALLISDRGHFPKKNLQDWAVFLFSWLMCLTG  360

Query  291   SFFAMLANFFSRFGGNNK  238
             + FA LA+  S+ G  +K
Sbjct  361   ALFAFLADLCSKLGRRDK  378



>ref|XP_010268074.1| PREDICTED: uncharacterized protein LOC104605139 [Nelumbo nucifera]
Length=381

 Score =   420 bits (1080),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 206/381 (54%), Positives = 290/381 (76%), Gaps = 2/381 (1%)
 Frame = -1

Query  1362  MRSQLSFSDEDQSELLKTAAWWWRTLPEFDENGRFKEDISS-GGLSPRLKLLREMQRLAF  1186
             MR+ LS SDED++E  K    WWR++  F++ G+ K D+S+   L+PR+K+LREM+RLA 
Sbjct  1     MRNPLSLSDEDENESSKLPFCWWRSVEHFNDQGQLKLDLSNLSNLTPRVKVLREMERLAL  60

Query  1185  ISMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYS  1006
             I+ EGLD LRHKL +Y+AGD W+P GGIKK DMDIP ++T+LLVG +GSGKSSLVN MYS
Sbjct  61    IAPEGLDDLRHKLITYRAGDFWLPTGGIKKEDMDIPPIVTILLVGFSGSGKSSLVNLMYS  120

Query  1005  VLGRSGLIPFAQTSSQPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWS  826
             VLGRSGLIPFAQTS   + +TTM +EEHNVLRS ++GFCVYD+RGLD +R++E +E +  
Sbjct  121   VLGRSGLIPFAQTSGNSSNYTTMFMEEHNVLRSLRSGFCVYDSRGLDYNRVEESLEGLSG  180

Query  825   WMSDGVRHNQPCCRGSDD-DREMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDFSSG  649
             W+ +GV H+Q C R  D+  + ++    +    +K+  R+VNCV+VVA++ E ++    G
Sbjct  181   WLVNGVHHHQLCFRSGDEASKPLVGSVPSSSSLSKFSWRKVNCVVVVANIAEIYQALKKG  240

Query  648   DLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYD  469
             D K +EA K +F+ P+IR+ NE P+LI THGD L+++ER++ RLK+ + LGISET+G YD
Sbjct  241   DAKPMEATKALFNCPAIRKCNENPILIFTHGDKLSSDERIDGRLKVSKFLGISETSGEYD  300

Query  468   IACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKDWVLAFASWVLCCFSS  289
             + CL+E G+  +E DPV+A+ALTEA+YR+L+QSDR+H PK +FKDWV+   +W+LCC ++
Sbjct  301   VVCLTEHGLLPDESDPVTAYALTEAIYRALIQSDRSHPPKIRFKDWVVMLVTWLLCCIAA  360

Query  288   FFAMLANFFSRFGGNNKRHRL  226
             FFA LA+FFS+ G  +K+ +L
Sbjct  361   FFAFLADFFSKLGRKDKKLKL  381



>ref|XP_002320319.2| hypothetical protein POPTR_0014s11930g [Populus trichocarpa]
 gb|EEE98634.2| hypothetical protein POPTR_0014s11930g [Populus trichocarpa]
Length=411

 Score =   420 bits (1079),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 206/385 (54%), Positives = 276/385 (72%), Gaps = 6/385 (2%)
 Frame = -1

Query  1368  KIMRSQLSFSDEDQSELLKTAAWWWRTLPEFDENGRFKEDISS-GGLSPRLKLLREMQRL  1192
             K M+SQLS +DED+ +L +    WWR+  +FDE  R K D+     L+PRL++L+E++RL
Sbjct  29    KDMKSQLSSNDEDECQLSRLGYCWWRSAAKFDECVRLKLDLPHIASLTPRLRVLKELERL  88

Query  1191  AFISMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFM  1012
             A I+ EGL+ LR+KL  Y++GD WVP GG+KK +MDIP VIT+LLVG +GSGKSSLVN M
Sbjct  89    ALIAHEGLNELRYKLQMYRSGDFWVPTGGLKKEEMDIPPVITILLVGFSGSGKSSLVNLM  148

Query  1011  YSVLGRSGLIPFAQTSSQ-PTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMED  835
             YSV GRSGLIPFA+TSS   TK+TTM +EEHNV+RS + GFCVYD+RG +  ++ + +E+
Sbjct  149   YSVFGRSGLIPFARTSSGGATKYTTMYMEEHNVMRSMQGGFCVYDSRGFNYGKIGDALEE  208

Query  834   VWSWMSDGVRHNQPCCRGSDDDREMMEYSMAG-RCANKYCKRRVNCVLVVADMEEAFKDF  658
             + SWMSDG+ HNQ C R  DD     +    G R ++K+ +R VN  +VV ++ E  K  
Sbjct  209   LSSWMSDGIHHNQLCLRSGDDVLLEADTETVGLRSSSKFVQRTVNIPMVVVNIAEVHKAS  268

Query  657   SSGDLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTG  478
              + D K +EA + +FHSP++R+ NE P+LILTHGD+LT EER++ RL+LCE LGISET G
Sbjct  269   KASDSKPLEATRELFHSPALRKCNENPILILTHGDLLTTEERMDMRLRLCERLGISETNG  328

Query  477   AYDIACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKDWVLAFASWVLCC  298
              YDI CL+E G  AEE DPV+A+AL EAVYR+LL SDR H PK+  +DW L   SW++C 
Sbjct  329   VYDIVCLTEYGFLAEESDPVTAYALAEAVYRALLISDRGHSPKKNLQDWALFVLSWLMCF  388

Query  297   FSSFFAMLANFFSRFGGNNKRHRLK  223
               + F+ LA+  S+ G   +R RLK
Sbjct  389   MGALFSFLADLCSKLG---QRDRLK  410



>emb|CDO98801.1| unnamed protein product [Coffea canephora]
Length=330

 Score =   414 bits (1065),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 199/323 (62%), Positives = 251/323 (78%), Gaps = 9/323 (3%)
 Frame = -1

Query  1203  MQRLAFISMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSL  1024
             M+RLAF++ EGLD LRHKL +Y +GD W+PVGGIKK D+DIP VIT+LL GLT SGKSSL
Sbjct  1     MERLAFVAPEGLDDLRHKLITYGSGDFWLPVGGIKKEDLDIPPVITILLAGLTSSGKSSL  60

Query  1023  VNFMYSVLGRSGLIPFAQTSSQPT-KFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDE  847
             VN MYSVLGRSGLIPFAQTS   + +  T+ LEEH V+RS ++GFCV+DTRGLDC++M+ 
Sbjct  61    VNMMYSVLGRSGLIPFAQTSGGSSHRSRTVFLEEHIVVRSARSGFCVFDTRGLDCNQMNA  120

Query  846   GMEDVWSWMSDGVRHNQPCCRGSDDDREMMEYSMAGR-----CANKYCKRRVNCVLVVAD  682
             G+EDV +WMS GVR NQPCCR  D   EM+  + A R      +++Y  RRVNC +VVA+
Sbjct  121   GLEDVSTWMSLGVRQNQPCCRPGD---EMLGTATAVRGSSFNTSSRYMNRRVNCAMVVAN  177

Query  681   MEEAFKDFSSGDLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCES  502
             + E  K F SGDLK VEAI+ +F  P I++ NE P+LILTHGD+L+ E+R+ +RLK+CE 
Sbjct  178   LAEIHKAFRSGDLKPVEAIRALFQYPCIQKCNESPILILTHGDMLSTEDRINSRLKICEY  237

Query  501   LGISETTGAYDIACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKDWVLA  322
             +GISET+GAYDIACL+E GI  +E D V+AFALTEAVYRSL+ SDR HLPK++FKDW+  
Sbjct  238   MGISETSGAYDIACLTEQGILPDEADAVTAFALTEAVYRSLMVSDRCHLPKKRFKDWIWL  297

Query  321   FASWVLCCFSSFFAMLANFFSRF  253
               SW++ C +SFF  LAN FS+F
Sbjct  298   LVSWIMGCIASFFRFLANLFSKF  320



>gb|KDP28221.1| hypothetical protein JCGZ_13992 [Jatropha curcas]
Length=388

 Score =   415 bits (1066),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 205/390 (53%), Positives = 278/390 (71%), Gaps = 14/390 (4%)
 Frame = -1

Query  1362  MRSQLSFSDEDQSELLKTA----AWWWRTLPEFDENGRFKE---DISSGGLSPRLKLLRE  1204
             M+SQLS SD+D+ +   ++    + WWR+  +F+E  R K    +ISS  L+PRL+L RE
Sbjct  1     MKSQLSSSDDDEVDAYPSSPLVTSCWWRSAAKFEECARLKHGFPNISS--LTPRLRLFRE  58

Query  1203  MQRLAFISMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSL  1024
             ++RLA I+ EGL+ LR+KL  Y++GD WVP GG+KK +MDIP ++T+LLVG + SGKSSL
Sbjct  59    LERLALIAHEGLNELRYKLQIYRSGDYWVPTGGLKKEEMDIPPIVTILLVGFSSSGKSSL  118

Query  1023  VNFMYSVLGRSGLIPFAQTSSQPTK--FTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMD  850
             VN MYSVLGR+GL+ FAQT S   K  +TTM +EEHNVLRS K+GFCVYD+RG +  ++ 
Sbjct  119   VNLMYSVLGRTGLVLFAQTKSGSGKKNYTTMFMEEHNVLRSIKSGFCVYDSRGFNYDKVG  178

Query  849   EGMEDVWSWMSDGVRHNQPCCRGSDDD---REMMEYSMAGRCANKYCKRRVNCVLVVADM  679
             E +E++ SWMSDGV HNQ C R  D +   +++    ++ R ++K+ +RRVNC +VV ++
Sbjct  179   EALEELSSWMSDGVHHNQLCLRSGDHNVLLKDIDAEQLSSRNSSKFIQRRVNCAMVVVNV  238

Query  678   EEAFKDFSSGDLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESL  499
              E +K   +GD K +EA K +F S ++R  NE P+LILTHGD+LT+EER+E RLK+CESL
Sbjct  239   AEVYKALKAGDSKPLEATKELFCSSALRNCNENPILILTHGDLLTSEERIEGRLKICESL  298

Query  498   GISETTGAYDIACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKDWVLAF  319
             GISET G YD+ CL+E G  AEE DPVSA+ + EAVYR+LL SDR HLPK+  +DW L  
Sbjct  299   GISETNGIYDVVCLTEYGFLAEESDPVSAYNVAEAVYRALLISDREHLPKKTLQDWTLFI  358

Query  318   ASWVLCCFSSFFAMLANFFSRFGGNNKRHR  229
              SW++   + FFA LA   S  G +NK  R
Sbjct  359   LSWLMSLMAIFFAFLAQICSALGHSNKLKR  388



>ref|XP_011041693.1| PREDICTED: uncharacterized protein LOC105137594 [Populus euphratica]
Length=381

 Score =   413 bits (1062),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 202/383 (53%), Positives = 274/383 (72%), Gaps = 6/383 (2%)
 Frame = -1

Query  1362  MRSQLSFSDEDQSELLKTAAWWWRTLPEFDENGRFKEDISS-GGLSPRLKLLREMQRLAF  1186
             M++QLS +DED+ +L +    WWR+  +FDE  R K D+     L+PRL++L+E++RLA 
Sbjct  1     MKNQLSSNDEDECQLSRLGYCWWRSAAKFDECVRLKLDLPHIASLTPRLRVLKELERLAL  60

Query  1185  ISMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYS  1006
             I+ EGL+ LR+KL  Y++GD WVP GG+KK +MDIP VIT+LLVG +GSGKSSL+N MYS
Sbjct  61    IAHEGLNELRYKLQMYRSGDFWVPTGGLKKEEMDIPPVITILLVGFSGSGKSSLLNLMYS  120

Query  1005  VLGRSGLIPFAQTSSQ-PTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVW  829
             V GRSGLIPFA+TSS   TK+TTM +EEHNV+RS + GFCVYD+RG +  ++ + +E++ 
Sbjct  121   VFGRSGLIPFARTSSGGATKYTTMYMEEHNVMRSMQGGFCVYDSRGFNYGKIGDALEELS  180

Query  828   SWMSDGVRHNQPCCRGSDDDREMMEYSMAG-RCANKYCKRRVNCVLVVADMEEAFKDFSS  652
             SWMSDG+ HNQ C R  DD     +    G R ++K+ +R VN  +VV ++ E  K   +
Sbjct  181   SWMSDGIHHNQLCLRSGDDVLLEADTETIGLRSSSKFVQRTVNIPMVVVNIAEVHKASKA  240

Query  651   GDLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAY  472
              D K +EA + +FHSP++R+ NE P+LILTHGD+LT EER++ RL+LCE LGISET G Y
Sbjct  241   SDSKPLEATRELFHSPALRKCNENPILILTHGDLLTTEERIDIRLRLCERLGISETNGVY  300

Query  471   DIACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKDWVLAFASWVLCCFS  292
             DI CL+E G  AEE DPVSA+AL EAVYR+LL SDR H PK+  +DW +   SW++    
Sbjct  301   DIVCLTEYGFLAEESDPVSAYALAEAVYRALLISDRGHFPKKNLQDWAVFVLSWLMFFMG  360

Query  291   SFFAMLANFFSRFGGNNKRHRLK  223
             + F+ LA+  S+ G   +R RLK
Sbjct  361   ALFSFLADLCSKLG---QRDRLK  380



>ref|XP_002515325.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF47309.1| ATP binding protein, putative [Ricinus communis]
Length=382

 Score =   412 bits (1060),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 203/389 (52%), Positives = 276/389 (71%), Gaps = 17/389 (4%)
 Frame = -1

Query  1362  MRSQLSFSDEDQSELLKTAAWWWRTLPEFDENGRFK---EDISSGGLSPRLKLLREMQRL  1192
             M++QLS SDED     +    WWR+  +F+E  R K    +ISS  L+PR+++LRE++RL
Sbjct  1     MKNQLSSSDEDDYPPSRMLYCWWRSTAKFEECARLKLGLPNISS--LTPRIRVLRELERL  58

Query  1191  AFISMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFM  1012
             A IS EGL+ LR+KL  Y++GD WVP GGI+K +MDIP+VIT+LLVG + SGKSSLVN M
Sbjct  59    ALISHEGLNELRYKLQMYKSGDYWVPTGGIEKEEMDIPSVITILLVGFSSSGKSSLVNLM  118

Query  1011  YSVLGRSGLIPFAQTSSQPTK-FTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMED  835
             YSVLGR+GL+PFAQTSS   K +TTM +EEHNV+RS ++GFCV+D+RG +  ++ E +E+
Sbjct  119   YSVLGRTGLVPFAQTSSGGAKNYTTMYMEEHNVMRSMQSGFCVFDSRGFNYDKIGEALEE  178

Query  834   VWSWMSDGVRHNQPCCRGSD-----DDREMMEYSMAGRCANKYCKRRVNCVLVVADMEEA  670
             + SWM+DGV HNQ C R  D     DD E    + A R ++K+  RRVNC +VV ++ E 
Sbjct  179   LSSWMTDGVHHNQLCLRSGDATLLKDDIE----AAASRSSSKFLIRRVNCAMVVVNIAEV  234

Query  669   FKDFSSGDLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGIS  490
             +K   +GD K +EA + +F SP++R+ NE P+LILTHGD+LT EER+E R+K+CE LGI 
Sbjct  235   YKALKAGDSKQLEATRELFCSPALRKCNENPILILTHGDLLTNEERIEGRIKICERLGIQ  294

Query  489   ETTGAYDIACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKDWVLAFASW  310
             ET G YD+ CL+E G  AEE DPV+A+A+ EAVYR+LL SDR H P +KF+DW +   SW
Sbjct  295   ETNGVYDVVCLTEYGFLAEESDPVTAYAVAEAVYRALLISDRGHFPSKKFQDWAIFILSW  354

Query  309   VLCCFSSFFAMLANFFSRFGGNNKRHRLK  223
             ++      FA LA   +  G   +R++LK
Sbjct  355   LMSFLGIVFAFLAEICTALG--QRRNKLK  381



>ref|XP_010684627.1| PREDICTED: uncharacterized protein LOC104899186 [Beta vulgaris 
subsp. vulgaris]
Length=379

 Score =   411 bits (1056),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 201/377 (53%), Positives = 271/377 (72%), Gaps = 13/377 (3%)
 Frame = -1

Query  1344  FSDEDQSELLKTAAWWWRTLPEFDENGRFK-EDISS-GGLSPRLKLLREMQRLAFISMEG  1171
              SD+ + E   T   WWR+    +E    K  D+S  G L+PRLK++RE++RL+ ++ EG
Sbjct  6     LSDDGEGEE-STEFCWWRSCATAEEISNLKVNDVSDVGCLTPRLKVMRELERLSMVASEG  64

Query  1170  LDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRS  991
             LD LRH+L +Y++GDLWVP+GGIKK +MDIP +IT+LLVG  G GKSSLVN MYSVLGR+
Sbjct  65    LDDLRHRLVAYRSGDLWVPMGGIKKEEMDIPPMITILLVGFGGGGKSSLVNLMYSVLGRA  124

Query  990   GLIPFAQTS--SQPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCH-RMDEGMEDVWSWM  820
             G+IPFAQTS  S  ++ TTMLLEEHNVLRS + GFCVYD+RG + + R +E + ++  W 
Sbjct  125   GIIPFAQTSGSSVASESTTMLLEEHNVLRSMRAGFCVYDSRGFNYNDRTNESLNELSQWT  184

Query  819   SDGVRHNQPCCRGSDDDREMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDFSSGDLK  640
              +GV+HNQPCCR  D+ R        G  + ++ +R+VNC +VVA+M + +K    GD K
Sbjct  185   GEGVQHNQPCCRAMDESR----IETIGSTSRRFARRQVNCAMVVANMADVYKSLKDGDSK  240

Query  639   HVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYDIAC  460
             H+EA + +F  P ++R N+ P+L+LTHGD L+AEER++ RLK+C+ LGISET+G YDI C
Sbjct  241   HLEATRDVFGFPGLKRGNQNPILVLTHGDKLSAEERIDARLKICQFLGISETSGVYDIVC  300

Query  459   LSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKDWVLAFASWVLCCFSSFFA  280
             L+E G+ AEE DPV+A+ALTEAVYR+LL +D +HLPK+ FKD  +   SW LC   +FFA
Sbjct  301   LTECGVVAEECDPVTAYALTEAVYRALLVADMSHLPKKHFKDRAIFAVSWFLCLIGAFFA  360

Query  279   MLANFFSRFGGNNKRHR  229
              LA  FS   G N+RHR
Sbjct  361   FLARLFS---GPNQRHR  374



>gb|KHG15240.1| Lipid A export ATP-binding/permease MsbA [Gossypium arboreum]
Length=475

 Score =   405 bits (1042),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 208/404 (51%), Positives = 279/404 (69%), Gaps = 16/404 (4%)
 Frame = -1

Query  1407  WIHLPESELRSHRKI--------MRSQLSFSDEDQSELLKTAAWWWRTLPEFDENGRFKE  1252
             W +     L  HR++        M+SQ+S  DED  E  + A  WWRT  EFD+  + K 
Sbjct  60    WFNNHRCTLSCHRRVDECRWKQEMKSQVSCVDEDDCESCRLAYCWWRTAAEFDKCAKLKL  119

Query  1251  DISSGG-LSPRLKLLREMQRLAFISMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPA  1075
                +   L+PRL+LLRE++RLA ++ +GL+ L+HKL  Y++GD WVP GGI + DMDIP 
Sbjct  120   GFPNVSILTPRLRLLRELERLALVAPDGLNELQHKLLEYRSGDFWVPTGGITREDMDIPP  179

Query  1074  VITLLLVGLTGSGKSSLVNFMYSVLGRSGLIPFAQTSSQPTKFTTMLLEEHNVLRSKKNG  895
             V T+LLVG +GSGKSSL+N MYS+LGRSGLIPFAQTSS  + +TTM +EEHNVLRS ++G
Sbjct  180   VNTILLVGFSGSGKSSLINLMYSILGRSGLIPFAQTSSGSSNYTTMYMEEHNVLRSTRSG  239

Query  894   FCVYDTRGLDCHRMDEGMEDVWSWMSDGVRHNQPCCRGSD-----DDREMMEYSMAGRCA  730
             FC+YD+RG D H   E +E++ SWMS+G+ HNQPC R +D     DD  M   ++  R +
Sbjct  240   FCIYDSRGFDYHSTREALEEMSSWMSEGIHHNQPCFRYNDRATTADDAAMENITL--RSS  297

Query  729   NKYCKRRVNCVLVVADMEEAFKDFSSGDLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDI  550
             + + +R VNCV+VVA++ + +K   +GDLK +EA + +F  P++R+SNE P+LILTHGD+
Sbjct  298   SNFLQREVNCVMVVANIAQIYKALKAGDLKPLEATRQLFSFPALRKSNENPLLILTHGDL  357

Query  549   LTAEERVETRLKLCESLGISETTGAYDIACLSESGIPAEEGDPVSAFALTEAVYRSLLQS  370
             L+ EER++ R+K+CE L ISET G YDI CL+E G P EE DPVSA+ALTEAVYR+LL S
Sbjct  358   LSTEERIDGRMKICEHLEISETNGVYDILCLNEYGFPVEESDPVSAYALTEAVYRALLIS  417

Query  369   DRTHLPKRKFKDWVLAFASWVLCCFSSFFAMLANFFSRFGGNNK  238
             DR+H PK KFKDW +    W++      FA LA+  S  G   K
Sbjct  418   DRSHFPKMKFKDWAMLILLWLMRFMGFCFAFLADVCSNLGKKQK  461



>ref|XP_006480038.1| PREDICTED: uncharacterized protein LOC102624124 [Citrus sinensis]
Length=402

 Score =   402 bits (1034),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 195/390 (50%), Positives = 278/390 (71%), Gaps = 11/390 (3%)
 Frame = -1

Query  1374  HRKIMRSQLSFSDEDQSELLKTAAWWWRTLPEFDENGRFKEDISS-GGLSPRLKLLREMQ  1198
              ++ M+SQLS  + D+ +       WWR+  +FDE  + K D+ +   L+PRL++LREM+
Sbjct  17    QKREMKSQLSCGEVDEYDPSGLVYCWWRSAAKFDECVKLKLDLPNVSTLTPRLRVLREME  76

Query  1197  RLAFISMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVN  1018
             RLA I+ +GL+ LRHK  SY++GD W+P+GGI+K  MDIP VIT+LLVG +GSGKSSLVN
Sbjct  77    RLALIAPDGLNELRHKFLSYRSGDFWIPIGGIQKGGMDIPPVITILLVGFSGSGKSSLVN  136

Query  1017  FMYSVLGRSGLIPFAQTSSQPTKFT-TMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGM  841
              MYSVL RSGL+ FAQTSS  +  T TM +EEHNV+RS ++GFCVYD+RG + +R+ EG+
Sbjct  137   LMYSVLSRSGLVLFAQTSSGNSSHTITMYMEEHNVMRSLQSGFCVYDSRGFNYNRVHEGL  196

Query  840   EDVWSWMSDGVRHNQPCCRGSD-----DDREMMEYSMAGRCANKYCKRRVNCVLVVADME  676
             E++ SWMS+GV HNQ C R  D     +D E+ +     + + KY  RRVN  +VV+++ 
Sbjct  197   EELSSWMSEGVHHNQRCLRSDDCALMKNDAEIDDL----KSSPKYVLRRVNFAMVVSNIA  252

Query  675   EAFKDFSSGDLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLG  496
             E +K   +GD K ++A K +F +P +R+ NE P+LILTHGD+L+ EER++ RLK+CE LG
Sbjct  253   EIYKALKAGDSKPLDATKRLFSAPGLRKCNENPILILTHGDMLSTEERLDARLKICEYLG  312

Query  495   ISETTGAYDIACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKDWVLAFA  316
             +SE +G YDI CL+E G PAEE DPV+A+++ EA+YR+LL SDR H PK+ F+DW +   
Sbjct  313   VSEISGVYDIVCLTEYGFPAEECDPVTAYSIAEAIYRALLISDRGHSPKKTFRDWAVLIL  372

Query  315   SWVLCCFSSFFAMLANFFSRFGGNNKRHRL  226
             S +LC  +SF ++LA+  SR G   ++ ++
Sbjct  373   SCMLCFIASFLSLLADLCSRLGQRGQKLKM  402



>ref|XP_007051046.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Theobroma cacao]
 gb|EOX95203.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Theobroma cacao]
Length=381

 Score =   402 bits (1032),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 210/382 (55%), Positives = 271/382 (71%), Gaps = 11/382 (3%)
 Frame = -1

Query  1362  MRSQLSFSDEDQSELLKTAAWWWRTLPEFDENGRFKEDISSGG-LSPRLKLLREMQRLAF  1186
             M+SQ+S  DED  E  + A  WWRT  +FDE  + K D      L+PRL+LLRE++RLA 
Sbjct  1     MKSQVSCVDEDDCESCRLAYCWWRTAAKFDECAKLKLDFPDVSILTPRLRLLRELERLAL  60

Query  1185  ISMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYS  1006
             I+ EGL+ LRHKL  Y++GD WVP GGIKK DMDIP V T+LLVG +GSGKSSL+N MYS
Sbjct  61    IAPEGLNELRHKLLGYRSGDFWVPTGGIKKEDMDIPPVSTILLVGFSGSGKSSLINLMYS  120

Query  1005  VLGRSGLIPFAQTSSQP-TKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVW  829
             +LGRSGLIPFAQTSS   + +TTM +EEHNVLRS ++GFCVYD+RG D  R  E + ++ 
Sbjct  121   ILGRSGLIPFAQTSSGSRSNYTTMYMEEHNVLRSMRSGFCVYDSRGFDYVRTTEALGELS  180

Query  828   SWMSDGVRHNQPCCRGSD-----DDREMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFK  664
             SWM +G+ HNQ C R  D     DD E    ++  R ++K+ +RRVNCV+VVA++ E + 
Sbjct  181   SWMIEGIHHNQLCFRYGDCTTMTDDVE----NIVTRSSSKFVQRRVNCVMVVANIAEIYN  236

Query  663   DFSSGDLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISET  484
                +GD K +EA + +F SP++R+SNE P+LILTHGD+L+ EER++ RLK+CE L ISET
Sbjct  237   ALKAGDFKPLEATRQLFCSPALRKSNENPLLILTHGDLLSTEERIDGRLKICECLDISET  296

Query  483   TGAYDIACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKDWVLAFASWVL  304
              G YDI CL+E G   EE DPVSA+ALTEAVYR+LL SDR H PK+KF+DW L    W++
Sbjct  297   NGVYDIVCLTEYGFLVEESDPVSAYALTEAVYRALLISDRGHFPKKKFQDWALLILLWLV  356

Query  303   CCFSSFFAMLANFFSRFGGNNK  238
                   FA+LA+  S+ G   K
Sbjct  357   RFIGVCFAILADVCSKLGQKEK  378



>ref|XP_010103392.1| hypothetical protein L484_007461 [Morus notabilis]
 gb|EXB95711.1| hypothetical protein L484_007461 [Morus notabilis]
Length=381

 Score =   399 bits (1025),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 191/379 (50%), Positives = 272/379 (72%), Gaps = 5/379 (1%)
 Frame = -1

Query  1362  MRSQLSFSDEDQSELLKTAAWWWRTLPEFDENGRFKEDISSG-GLSPRLKLLREMQRLAF  1186
             M++QL  SDED+         WWR+  EF+E  + K D  +   L+PR+++LRE++RL+ 
Sbjct  1     MKNQLCSSDEDEYCESSNTYCWWRSAAEFEECVKLKLDPPNVVALTPRIRILRELERLSL  60

Query  1185  ISMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYS  1006
             ++ +GL+ LRHKL  Y++GD W+P GGI K   DIP V+T+LLVG +GSGKSSLVN MY 
Sbjct  61    VAQDGLNELRHKLVMYRSGDFWMPTGGIPKEKTDIPPVVTVLLVGFSGSGKSSLVNLMYC  120

Query  1005  VLGRSGLIPFAQTSS-QPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVW  829
             VLGRSGL+PFAQTSS   +K+T+M LEEHNV+RS ++GFCVYD+RG D  ++ E +E+++
Sbjct  121   VLGRSGLVPFAQTSSGNSSKYTSMFLEEHNVIRSLRSGFCVYDSRGFDYDQIGESLEELY  180

Query  828   SWMSDGVRHNQPCCRGSDD--DREMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDFS  655
             +W++DGV HNQ C R  D    R+ +E  MA R ++K+ +RRVNC +VVA++ E ++ + 
Sbjct  181   NWINDGVHHNQLCLRSGDHFLQRDEVELLMA-RSSSKFLRRRVNCAMVVANIAEIYEAYK  239

Query  654   SGDLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGA  475
             +G+ K +E  K ++ S + ++  E P+LILTHGD+L+ EER+E R+K+CE L ISET+G 
Sbjct  240   AGNYKPLETTKELYCSTAFKKCAENPILILTHGDMLSTEERIEGRIKICEWLHISETSGV  299

Query  474   YDIACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKDWVLAFASWVLCCF  295
             YDI CL+E G  AE+ DPVSA+ALTEAVYR+LL SDR+H PKR   DW +   SW++C  
Sbjct  300   YDIVCLTEYGFIAEDSDPVSAYALTEAVYRALLISDRSHPPKRNILDWTMLVLSWLMCFI  359

Query  294   SSFFAMLANFFSRFGGNNK  238
             ++ FA LA   S+ G  ++
Sbjct  360   AALFAFLAEICSKVGHRDR  378



>ref|XP_006444445.1| hypothetical protein CICLE_v10020446mg [Citrus clementina]
 gb|ESR57685.1| hypothetical protein CICLE_v10020446mg [Citrus clementina]
Length=402

 Score =   399 bits (1025),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 193/390 (49%), Positives = 278/390 (71%), Gaps = 11/390 (3%)
 Frame = -1

Query  1374  HRKIMRSQLSFSDEDQSELLKTAAWWWRTLPEFDENGRFKEDISS-GGLSPRLKLLREMQ  1198
              ++ M+SQLS  + D+ +       WWR+  +FDE  + K D+ +   L+PRL++LREM+
Sbjct  17    QKREMKSQLSCGEVDEYDPSGLVYCWWRSAAKFDECVKLKLDLPNVSTLTPRLRVLREME  76

Query  1197  RLAFISMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVN  1018
             RLA I+ +GL+ LRHK  SY++GD W+P+GGI+K  MDIP VIT+LL+G +GSGKSSLVN
Sbjct  77    RLALIAPDGLNELRHKFLSYRSGDFWIPIGGIQKGGMDIPPVITILLMGFSGSGKSSLVN  136

Query  1017  FMYSVLGRSGLIPFAQTSSQPTKFT-TMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGM  841
              MYSVL RSGL+ FAQTSS  +  T TM +EEHNV+RS ++GFCVYD+RG + +R+ EG+
Sbjct  137   LMYSVLSRSGLVLFAQTSSGNSSHTITMYMEEHNVMRSLQSGFCVYDSRGFNYNRVHEGL  196

Query  840   EDVWSWMSDGVRHNQPCCRGSD-----DDREMMEYSMAGRCANKYCKRRVNCVLVVADME  676
             E++ SWMS+GV HNQ C R  D     +D E+ +     + + KY  RRV+  +VV+++ 
Sbjct  197   EELSSWMSEGVHHNQRCLRSDDCALMKNDAEIDDL----KSSPKYVLRRVDFAMVVSNIA  252

Query  675   EAFKDFSSGDLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLG  496
             E +K   +GD K ++A K +F +P +R+ NE P+LILTHGD+L+ EER++ RLK+CE LG
Sbjct  253   EIYKALKAGDSKPLDATKRLFSAPGLRKCNENPILILTHGDMLSTEERLDARLKICEYLG  312

Query  495   ISETTGAYDIACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKDWVLAFA  316
             +SE +G YDI CL+E G PAEE DPV+A+++ EA+YR+LL SDR H PK+ F+DW +   
Sbjct  313   VSEISGVYDIVCLTEYGFPAEECDPVTAYSIAEAIYRALLISDRGHSPKKTFRDWAVLIL  372

Query  315   SWVLCCFSSFFAMLANFFSRFGGNNKRHRL  226
             S +LC  +SF ++LA+  SR G   ++ ++
Sbjct  373   SCMLCFIASFLSLLADLCSRLGQRGQKLKM  402



>gb|KDO87080.1| hypothetical protein CISIN_1g016817mg [Citrus sinensis]
Length=382

 Score =   398 bits (1022),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 193/386 (50%), Positives = 276/386 (72%), Gaps = 11/386 (3%)
 Frame = -1

Query  1362  MRSQLSFSDEDQSELLKTAAWWWRTLPEFDENGRFKEDISS-GGLSPRLKLLREMQRLAF  1186
             M+SQLS  + D+ +       WWR+  +FDE  + K D+ +   L+PRL++LREM+RLA 
Sbjct  1     MKSQLSCGEVDEYDPSGLVYCWWRSAAKFDECVKLKLDLPNVSTLTPRLRVLREMERLAL  60

Query  1185  ISMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYS  1006
             I+ +GL+ LRHK  SY++GD W+P+GGI+K  MDIP VIT+LL+G +GSGKSSLVN MYS
Sbjct  61    IAPDGLNELRHKFLSYRSGDFWIPIGGIQKGGMDIPPVITILLMGFSGSGKSSLVNLMYS  120

Query  1005  VLGRSGLIPFAQTSSQPTKFT-TMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVW  829
             VL RSGL+ FAQTSS  +  T TM +EEHNV+RS ++GFCVYD+RG + +R+ EG+E++ 
Sbjct  121   VLSRSGLVLFAQTSSGNSSHTITMYMEEHNVMRSLQSGFCVYDSRGFNYNRVHEGLEELS  180

Query  828   SWMSDGVRHNQPCCRGSD-----DDREMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFK  664
             SWMS+GV HNQ C R  D     +D E+ +     + + KY  RRV+  +VV+++ E +K
Sbjct  181   SWMSEGVHHNQRCLRSDDCALMKNDAEIDDL----KSSPKYVLRRVDFAMVVSNIAEIYK  236

Query  663   DFSSGDLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISET  484
                +GD K ++A K +F +P +R+ NE P+LILTHGD+L+ EER++ RLK+CE LG+SE 
Sbjct  237   ALKAGDSKPLDATKRLFSAPGLRKCNENPILILTHGDMLSTEERLDARLKICEYLGVSEI  296

Query  483   TGAYDIACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKDWVLAFASWVL  304
             +G YDI CL+E G PAEE DPV+A+++ EA+YR+LL SDR H PK+ F+DW +   S +L
Sbjct  297   SGVYDIVCLTEYGFPAEECDPVTAYSIAEAIYRALLISDRGHSPKKTFRDWAVLILSCML  356

Query  303   CCFSSFFAMLANFFSRFGGNNKRHRL  226
             C  +SF ++LA+  SR G   ++ ++
Sbjct  357   CFIASFLSLLADLCSRLGQRGQKLKM  382



>ref|XP_010038259.1| PREDICTED: uncharacterized protein LOC104426797 [Eucalyptus grandis]
 gb|KCW50083.1| hypothetical protein EUGRSUZ_K03520 [Eucalyptus grandis]
Length=385

 Score =   395 bits (1016),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 195/390 (50%), Positives = 270/390 (69%), Gaps = 16/390 (4%)
 Frame = -1

Query  1362  MRSQLSFSDEDQSELLKTAAWWWRTLPEFDENGRF--KEDISS---GGLSPRLKLLREMQ  1198
             M+S++S +DED+ +    A  WWR+   ++E  R   + ++++    GLSPR+++LREM+
Sbjct  1     MKSRISSTDEDEGDD-HAAYLWWRSAAGYEECARLAGQPEVAARVASGLSPRVRVLREME  59

Query  1197  RLAFISMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVN  1018
             RLA ++ EGLD +R KL  Y+AGD WVP GG+ K +MDIPA  T+LL G  GSGKSSL+N
Sbjct  60    RLAMVAPEGLDEVRQKLFLYRAGDFWVPTGGLSKEEMDIPATNTVLLTGFAGSGKSSLIN  119

Query  1017  FMYSVLGRSGLIPFAQTS-SQPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGM  841
              MYSVLGR+GLIPFAQTS  + + +TTM LEEHNV+RS ++GFCVYD+RG D  R+ E +
Sbjct  120   LMYSVLGRAGLIPFAQTSCGKSSNYTTMYLEEHNVVRSMRSGFCVYDSRGFDYGRVGEAL  179

Query  840   EDVWSWMSDGVRHNQPCCR-----GSDDDREMMEYSMAGRCANKYCKRRVNCVLVVADME  676
             E++  WM++GV HNQ C R      SDD+ E        R + K+ KRRVNCV+VV ++ 
Sbjct  180   EELSDWMTEGVHHNQLCSRPGDRASSDDESEFC----PPRASAKFAKRRVNCVMVVVNIA  235

Query  675   EAFKDFSSGDLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLG  496
             E  +   +GDL+ + A K +F +P++R+ NE P+LILTHGD+LT EER+E RL++CE LG
Sbjct  236   EVHEAMKAGDLQPLRATKELFSAPALRKCNESPLLILTHGDLLTTEERIEARLQICECLG  295

Query  495   ISETTGAYDIACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKDWVLAFA  316
             ISE++G YDI CL+E G  AEE DP++A+ L EAVYR+LL SDR H+PK  F+DWV    
Sbjct  296   ISESSGVYDIVCLTEYGFLAEEADPITAYTLAEAVYRALLISDRDHVPKNNFRDWVCIAF  355

Query  315   SWVLCCFSSFFAMLANFFSRFGGNNKRHRL  226
             S ++  F + F  LA   ++ G   K  R+
Sbjct  356   SCLMWIFGALFGFLAVICNKLGQQRKGFRI  385



>ref|XP_008779019.1| PREDICTED: uncharacterized protein LOC103698753 [Phoenix dactylifera]
Length=394

 Score =   395 bits (1015),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 189/364 (52%), Positives = 255/364 (70%), Gaps = 4/364 (1%)
 Frame = -1

Query  1302  WWWRTLPEFDENGRFK--EDISSGGLSPRLKLLREMQRLAFISMEGLDLLRHKLTSYQAG  1129
             +WWR+LPEFD  GR +     +SGGL+PRL++++E++RLA ++ E LD LRHKL +Y+AG
Sbjct  29    YWWRSLPEFDGGGRGEVFSSRASGGLTPRLRVVKELERLAMLAHESLDDLRHKLLTYRAG  88

Query  1128  DLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIPFAQTSSQPTK  949
             DLW P GGI K + DIP VIT+LL+G  GSGKSSLVN MYSV GRSG +PFA ++S   K
Sbjct  89    DLWFPAGGIPKQETDIPPVITILLLGFAGSGKSSLVNLMYSVFGRSGFVPFAHSASPAGK  148

Query  948   -FTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSDGVRHNQPCCRGSDD  772
                T  LEEHNVLRS +NGFCV+D+RGLD  R+ EG+ +V  WM DGVRH QPC   +  
Sbjct  149   DGRTQYLEEHNVLRSTRNGFCVFDSRGLDYDRVAEGLVEVAEWMEDGVRHRQPCRGSALP  208

Query  771   DREMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDFSSGDLKHVEAIKMIFHSPSIRR  592
             +      S A   A ++ +RRVNC +VVAD+ E  +   SGDL+ +EA + +FHSPS + 
Sbjct  209   EPASAGPSSAVAAAKRFVRRRVNCAMVVADLSELNQSLVSGDLRPLEATRGLFHSPSTQT  268

Query  591   -SNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYDIACLSESGIPAEEGDPVS  415
               N+ P+L+LTHGD LTAEER+ TR+++CE LG+SET G YD+AC +E G   +E DPV+
Sbjct  269   YCNDNPILVLTHGDELTAEERINTRVQVCEYLGVSETVGVYDVACANEHGSLVDETDPVT  328

Query  414   AFALTEAVYRSLLQSDRTHLPKRKFKDWVLAFASWVLCCFSSFFAMLANFFSRFGGNNKR  235
             A+A+ EAVYR+LL +DR H PK   KDW++   SW +C  S+FFA L+   S+    ++ 
Sbjct  329   AYAVAEAVYRALLVADRGHPPKPNVKDWLILVLSWAMCALSAFFAFLSASCSKVAKASRE  388

Query  234   HRLK  223
              + +
Sbjct  389   QKFR  392



>ref|XP_010931701.1| PREDICTED: uncharacterized protein LOC105052558 isoform X2 [Elaeis 
guineensis]
Length=396

 Score =   392 bits (1008),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 193/373 (52%), Positives = 262/373 (70%), Gaps = 10/373 (3%)
 Frame = -1

Query  1317  LKTAAWWWRTLPEFDENGRFK--EDISSGGLSPRLKLLREMQRLAFISMEGLDLLRHKLT  1144
             L ++ +WWR+LPEFD  GR +     +SGGL+P L++++E++RLA ++ E LD LRHKL 
Sbjct  24    LFSSVYWWRSLPEFDAGGRAEVFSSRASGGLTPWLRVVKELERLAVLAHESLDDLRHKLL  83

Query  1143  SYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIPFAQTS  964
             +Y+AGDLW P GGI K + DIP VIT+LL+GL GSGKSSLVN MYSV GRSG +PFA T+
Sbjct  84    TYRAGDLWFPAGGIPKQETDIPPVITILLLGLAGSGKSSLVNLMYSVFGRSGFVPFAHTA  143

Query  963   SQPTK-FTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSDGVRHNQPCC  787
             S   K   T  LEEHNVLRS +NGFCV+D+RGLD +R+ EG+++V  WM DG+RH QP C
Sbjct  144   SPAGKDGRTQYLEEHNVLRSTRNGFCVFDSRGLDYNRLAEGLDEVAEWMEDGIRHRQP-C  202

Query  786   RGS----DDDREMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDFSSGDLKHVEAIKM  619
             RGS             + A   A ++ +RRVNC +VV D+ E  +   SGDL+ +EA + 
Sbjct  203   RGSALPEPASAGPSSAAAAAAAAKRFVRRRVNCAMVVVDLSELHQSLVSGDLRPLEATRE  262

Query  618   IFHSPSIRR-SNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYDIACLSESGI  442
             +FHSPSI+   N+ P+L+LTHGD LTAEER+ TR+++CE LG+SET G YD+AC++E G 
Sbjct  263   LFHSPSIQTYCNDNPILVLTHGDELTAEERINTRVRVCEYLGVSETVGVYDVACVNEHGC  322

Query  441   PAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKDWVLAFASWVLCCFSSFFAMLANFF  262
               +E DPV+A+A+ EAVYR+LL SDR H PK   KDW++   SW +C  S+FFA L+   
Sbjct  323   -VDEADPVTAYAVAEAVYRALLVSDRGHPPKPNVKDWLILVLSWAMCALSAFFAFLSASC  381

Query  261   SRFGGNNKRHRLK  223
             S+    ++  + +
Sbjct  382   SKMAKASREQKFR  394



>ref|XP_009599706.1| PREDICTED: uncharacterized protein LOC104095312 [Nicotiana tomentosiformis]
Length=379

 Score =   387 bits (995),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 190/381 (50%), Positives = 269/381 (71%), Gaps = 13/381 (3%)
 Frame = -1

Query  1362  MRSQLSFSDEDQSELLKTAAWWWRTLPEFDENGRFKEDISS-GGLSPRLKLLREMQRLAF  1186
             MR + +F +++  E  +   +WW++  +FDE  +FK ++ +   ++P LK+LREM+RLA 
Sbjct  1     MRDE-NFVNQNDEEESRAMYYWWKSAAKFDECVKFKFEMPNLSKMTPTLKVLREMERLAL  59

Query  1185  ISMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYS  1006
             +S E LD LR KL SY+AGD WVP+GGI K DMDIP + T++LVG   +GKSSLVN MYS
Sbjct  60    MSSESLDELRQKLMSYRAGDFWVPIGGINKEDMDIPPLNTIVLVGFHNAGKSSLVNLMYS  119

Query  1005  VLGRSGLIPFAQTSSQ-PTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVW  829
             VLGRSGLIPFAQTSS   + +T++++EEHNVLRS ++GFC+YDTRG D  ++DEG++++ 
Sbjct  120   VLGRSGLIPFAQTSSGIASAYTSLIMEEHNVLRSTRSGFCIYDTRGFDYDKVDEGLQELK  179

Query  828   SWMSDGVRHNQPCCRGSDD----DREMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKD  661
              WMSDGV H + C R  D     D E+ + S      + +  R+VNCV++VA+  E +K 
Sbjct  180   EWMSDGVHHKKLCSRLGDILPKLDNELEDAS------SMFVNRKVNCVMLVANASEIYKS  233

Query  660   FSSGDLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETT  481
                GDLK ++A+K +F SP +++S+  PMLILTHGD L+ E+R++ RLK+C+ LG SETT
Sbjct  234   LRVGDLKPLDALKQLFCSPVLKKSSGNPMLILTHGDKLSTEDRIDCRLKICKHLGTSETT  293

Query  480   GAYDIACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKDWVLAFASWVLC  301
             G YDI C++E G+ A+E DP+SA+A+TEAVYR+LL SDR    K+KF DW L   SW++C
Sbjct  294   GTYDIVCVTEYGLLADEYDPISAYAVTEAVYRALLVSDRAQRVKQKFLDWALFALSWLMC  353

Query  300   CFSSFFAMLANFFSRFGGNNK  238
               +  FA LA+ F+     +K
Sbjct  354   FLAGIFAFLAHVFNVLAQKHK  374



>ref|XP_009789343.1| PREDICTED: uncharacterized protein LOC104236985 [Nicotiana sylvestris]
Length=379

 Score =   387 bits (993),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 186/377 (49%), Positives = 268/377 (71%), Gaps = 5/377 (1%)
 Frame = -1

Query  1362  MRSQLSFSDEDQSELLKTAAWWWRTLPEFDENGRFKEDISS-GGLSPRLKLLREMQRLAF  1186
             MR +   +  D+ E  +   +WW++  +F+E  +FK ++ +   ++P LK+LREM+RLA 
Sbjct  1     MRDEFFVNQHDEEEN-RAIYYWWKSAAKFNECVKFKFEMPNLSKMTPTLKVLREMERLAL  59

Query  1185  ISMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYS  1006
             +S E LD LR KL SY+AGD WVP+GGI K D+DIP + T++LVG   +GKSSLVN MYS
Sbjct  60    MSSESLDELRQKLMSYRAGDFWVPIGGINKEDIDIPPMNTIVLVGFHNAGKSSLVNLMYS  119

Query  1005  VLGRSGLIPFAQTSS-QPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVW  829
             VLGRSGLIPFAQTSS   + +TT+++EEHNVLRS +NGFC+YDTRG D  ++DEG++++ 
Sbjct  120   VLGRSGLIPFAQTSSGNASAYTTLIMEEHNVLRSTRNGFCIYDTRGFDYDKVDEGLQELK  179

Query  828   SWMSDGVRHNQPCCRGSDDDREMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDFSSG  649
              WM+DGV HN+  C    D    ++  +    ++ + KR+VNCV++VA+  E +K    G
Sbjct  180   EWMADGV-HNKKLCSRPGDILPKLDSKLED-ASSMFVKRKVNCVMLVANASEIYKSLRVG  237

Query  648   DLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYD  469
             DLK ++A+K +F SP++++SN  P+LILTHGD L+ E+R++ RLK+C+ LG SETTG YD
Sbjct  238   DLKPLDALKQLFCSPALKKSNGNPILILTHGDKLSTEDRIDCRLKICKHLGASETTGTYD  297

Query  468   IACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKDWVLAFASWVLCCFSS  289
             I C++E G+ A+E DP++A+A+TEAVYR+LL SDR  L K+ F DW L   SW++C  + 
Sbjct  298   IVCVTEYGLLADEYDPITAYAVTEAVYRALLISDRAQLVKQTFLDWALFALSWLMCFLAG  357

Query  288   FFAMLANFFSRFGGNNK  238
              FA LA+ F+     +K
Sbjct  358   IFAFLAHVFNVLAQKHK  374



>ref|XP_010931699.1| PREDICTED: uncharacterized protein LOC105052558 isoform X1 [Elaeis 
guineensis]
 ref|XP_010931700.1| PREDICTED: uncharacterized protein LOC105052558 isoform X1 [Elaeis 
guineensis]
Length=420

 Score =   383 bits (983),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 192/397 (48%), Positives = 262/397 (66%), Gaps = 34/397 (9%)
 Frame = -1

Query  1317  LKTAAWWWRTLPEFDENGRFK--EDISSGGLSPRLKLLREMQRLAFISMEGLDLLRHKLT  1144
             L ++ +WWR+LPEFD  GR +     +SGGL+P L++++E++RLA ++ E LD LRHKL 
Sbjct  24    LFSSVYWWRSLPEFDAGGRAEVFSSRASGGLTPWLRVVKELERLAVLAHESLDDLRHKLL  83

Query  1143  SYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIPFAQTS  964
             +Y+AGDLW P GGI K + DIP VIT+LL+GL GSGKSSLVN MYSV GRSG +PFA T+
Sbjct  84    TYRAGDLWFPAGGIPKQETDIPPVITILLLGLAGSGKSSLVNLMYSVFGRSGFVPFAHTA  143

Query  963   SQPTKFT-------------------------TMLLEEHNVLRSKKNGFCVYDTRGLDCH  859
             S     +                         T  LEEHNVLRS +NGFCV+D+RGLD +
Sbjct  144   SPAAGASIGFSPDFLSKALNFRTASGVRKDGRTQYLEEHNVLRSTRNGFCVFDSRGLDYN  203

Query  858   RMDEGMEDVWSWMSDGVRHNQPCCRGS----DDDREMMEYSMAGRCANKYCKRRVNCVLV  691
             R+ EG+++V  WM DG+RH QP CRGS             + A   A ++ +RRVNC +V
Sbjct  204   RLAEGLDEVAEWMEDGIRHRQP-CRGSALPEPASAGPSSAAAAAAAAKRFVRRRVNCAMV  262

Query  690   VADMEEAFKDFSSGDLKHVEAIKMIFHSPSIRR-SNEKPMLILTHGDILTAEERVETRLK  514
             V D+ E  +   SGDL+ +EA + +FHSPSI+   N+ P+L+LTHGD LTAEER+ TR++
Sbjct  263   VVDLSELHQSLVSGDLRPLEATRELFHSPSIQTYCNDNPILVLTHGDELTAEERINTRVR  322

Query  513   LCESLGISETTGAYDIACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKD  334
             +CE LG+SET G YD+AC++E G   +E DPV+A+A+ EAVYR+LL SDR H PK   KD
Sbjct  323   VCEYLGVSETVGVYDVACVNEHGC-VDEADPVTAYAVAEAVYRALLVSDRGHPPKPNVKD  381

Query  333   WVLAFASWVLCCFSSFFAMLANFFSRFGGNNKRHRLK  223
             W++   SW +C  S+FFA L+   S+    ++  + +
Sbjct  382   WLILVLSWAMCALSAFFAFLSASCSKMAKASREQKFR  418



>ref|XP_010914516.1| PREDICTED: uncharacterized protein LOC105039897 isoform X4 [Elaeis 
guineensis]
Length=391

 Score =   380 bits (977),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 185/371 (50%), Positives = 256/371 (69%), Gaps = 9/371 (2%)
 Frame = -1

Query  1338  DEDQSELLKTAAWWWRTLPEFDENGRFK--EDISSGGLSPRLKLLREMQRLAFISMEGLD  1165
             DED+ + L ++ +WWR+L EFD+ GR +     +S GL+PRL+++RE++RLA ++ E LD
Sbjct  16    DEDRRKDLVSSVYWWRSLAEFDDRGRPEAFSSTASAGLTPRLRVVRELERLAVLAHESLD  75

Query  1164  LLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGL  985
              LRHKL +Y+AGDLW P GGI K + DIP VIT+LL+G  GSGKSSL+N MYSV GRSG 
Sbjct  76    NLRHKLLTYRAGDLWFPAGGIPKQETDIPPVITILLLGFVGSGKSSLINLMYSVFGRSGF  135

Query  984   IPFAQTSSQPTK-FTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSDGV  808
             +PFA T+S+  K   T  LEEH+V RS +NGFCV+D+RGLD  R+ EG+ +V  WM  GV
Sbjct  136   VPFAHTASRAGKDGRTQYLEEHSVSRSMRNGFCVFDSRGLDYDRVAEGLVEVAEWMEHGV  195

Query  807   RHNQPCCRGSDDDREM-----MEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDFSSGDL  643
             RH QPC RG+           +  S A   A ++ +R+VNC +VV D+ E  +   SGDL
Sbjct  196   RHRQPC-RGAALPEPAFAVPSLASSSATATAKRFVRRQVNCAMVVVDLLELHRSLVSGDL  254

Query  642   KHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYDIA  463
             + +EA + +FHSPSI   +E P+L+LTHGD LTAEER+ETR++ C+ +G+ ET G YD+ 
Sbjct  255   RPLEATRELFHSPSINNYDENPILVLTHGDELTAEERIETRVRACDYMGVPETAGVYDVV  314

Query  462   CLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKDWVLAFASWVLCCFSSFF  283
             C++E G+ A+E DPV+A+A+ EAVYR LL +DR H PK   +DW++   S  +C  S+ F
Sbjct  315   CVNEHGLLADEMDPVTAYAVAEAVYRGLLLADRGHPPKPIIRDWLILVLSRSMCTLSAVF  374

Query  282   AMLANFFSRFG  250
             A L+   S+  
Sbjct  375   AFLSACCSKIA  385



>ref|XP_010914514.1| PREDICTED: uncharacterized protein LOC105039897 isoform X2 [Elaeis 
guineensis]
Length=392

 Score =   379 bits (973),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 186/372 (50%), Positives = 256/372 (69%), Gaps = 10/372 (3%)
 Frame = -1

Query  1338  DEDQSELLKTAAWWWRTLPEFDENGRFK--EDISSGGLSPRLKLLREMQRLAFISMEGLD  1165
             DED+ + L ++ +WWR+L EFD+ GR +     +S GL+PRL+++RE++RLA ++ E LD
Sbjct  16    DEDRRKDLVSSVYWWRSLAEFDDRGRPEAFSSTASAGLTPRLRVVRELERLAVLAHESLD  75

Query  1164  LLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGL  985
              LRHKL +Y+AGDLW P GGI K + DIP VIT+LL+G  GSGKSSL+N MYSV GRSG 
Sbjct  76    NLRHKLLTYRAGDLWFPAGGIPKQETDIPPVITILLLGFVGSGKSSLINLMYSVFGRSGF  135

Query  984   IPFAQTSSQPTK-FTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSDGV  808
             +PFA T+S+  K   T  LEEH+V RS +NGFCV+D+RGLD  R+ EG+ +V  WM  GV
Sbjct  136   VPFAHTASRAGKDGRTQYLEEHSVSRSMRNGFCVFDSRGLDYDRVAEGLVEVAEWMEHGV  195

Query  807   RHNQPCCRGSDDDREM-----MEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDFSSGDL  643
             RH QP CRG+           +  S A   A ++ +R+VNC +VV D+ E  +   SGDL
Sbjct  196   RHRQP-CRGAALPEPAFAVPSLASSSATATAKRFVRRQVNCAMVVVDLLELHRSLVSGDL  254

Query  642   KHVEAIKMIFHSPSIRR-SNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYDI  466
             + +EA + +FHSPSI    NE P+L+LTHGD LTAEER+ETR++ C+ +G+ ET G YD+
Sbjct  255   RPLEATRELFHSPSINNYGNENPILVLTHGDELTAEERIETRVRACDYMGVPETAGVYDV  314

Query  465   ACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKDWVLAFASWVLCCFSSF  286
              C++E G+ A+E DPV+A+A+ EAVYR LL +DR H PK   +DW++   S  +C  S+ 
Sbjct  315   VCVNEHGLLADEMDPVTAYAVAEAVYRGLLLADRGHPPKPIIRDWLILVLSRSMCTLSAV  374

Query  285   FAMLANFFSRFG  250
             FA L+   S+  
Sbjct  375   FAFLSACCSKIA  386



>ref|XP_010914515.1| PREDICTED: uncharacterized protein LOC105039897 isoform X3 [Elaeis 
guineensis]
Length=392

 Score =   378 bits (970),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 185/372 (50%), Positives = 257/372 (69%), Gaps = 10/372 (3%)
 Frame = -1

Query  1338  DEDQSELLKTAAWWWRTLPEFDENGRFK--EDISSGGLSPRLKLLREMQRLAFISMEGLD  1165
             DED+ + L ++ +WWR+L EFD+ GR +     +S GL+PRL+++RE++RLA ++ E LD
Sbjct  16    DEDRRKDLVSSVYWWRSLAEFDDRGRPEAFSSTASAGLTPRLRVVRELERLAVLAHESLD  75

Query  1164  LLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGL  985
              LRHKL +Y+AGDLW P GGI K + DIP VIT+LL+G  GSGKSSL+N MYSV GRSG 
Sbjct  76    NLRHKLLTYRAGDLWFPAGGIPKQETDIPPVITILLLGFVGSGKSSLINLMYSVFGRSGF  135

Query  984   IPFAQTSSQPTK-FTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSDGV  808
             +PFA T+S+  K   T  LEEH+V RS +NGFCV+D+RGLD  R+ EG+ +V  WM  GV
Sbjct  136   VPFAHTASRAGKDGRTQYLEEHSVSRSMRNGFCVFDSRGLDYDRVAEGLVEVAEWMEHGV  195

Query  807   RHNQPCCRGSDDDREM-----MEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDFSSGDL  643
             RH QP CRG+           +  S A   A ++ +R+VNC +VV D+ E  +   SGDL
Sbjct  196   RHRQP-CRGAALPEPAFAVPSLASSSATATAKRFVRRQVNCAMVVVDLLELHRSLVSGDL  254

Query  642   KHVEAIKMIFHSPSIRR-SNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYDI  466
             + +EA + +FHSPSI   ++E P+L+LTHGD LTAEER+ETR++ C+ +G+ ET G YD+
Sbjct  255   RPLEATRELFHSPSINNYADENPILVLTHGDELTAEERIETRVRACDYMGVPETAGVYDV  314

Query  465   ACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKDWVLAFASWVLCCFSSF  286
              C++E G+ A+E DPV+A+A+ EAVYR LL +DR H PK   +DW++   S  +C  S+ 
Sbjct  315   VCVNEHGLLADEMDPVTAYAVAEAVYRGLLLADRGHPPKPIIRDWLILVLSRSMCTLSAV  374

Query  285   FAMLANFFSRFG  250
             FA L+   S+  
Sbjct  375   FAFLSACCSKIA  386



>ref|XP_010914513.1| PREDICTED: uncharacterized protein LOC105039897 isoform X1 [Elaeis 
guineensis]
Length=393

 Score =   377 bits (968),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 185/373 (50%), Positives = 257/373 (69%), Gaps = 11/373 (3%)
 Frame = -1

Query  1338  DEDQSELLKTAAWWWRTLPEFDENGRFK--EDISSGGLSPRLKLLREMQRLAFISMEGLD  1165
             DED+ + L ++ +WWR+L EFD+ GR +     +S GL+PRL+++RE++RLA ++ E LD
Sbjct  16    DEDRRKDLVSSVYWWRSLAEFDDRGRPEAFSSTASAGLTPRLRVVRELERLAVLAHESLD  75

Query  1164  LLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGL  985
              LRHKL +Y+AGDLW P GGI K + DIP VIT+LL+G  GSGKSSL+N MYSV GRSG 
Sbjct  76    NLRHKLLTYRAGDLWFPAGGIPKQETDIPPVITILLLGFVGSGKSSLINLMYSVFGRSGF  135

Query  984   IPFAQTSSQPTK-FTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSDGV  808
             +PFA T+S+  K   T  LEEH+V RS +NGFCV+D+RGLD  R+ EG+ +V  WM  GV
Sbjct  136   VPFAHTASRAGKDGRTQYLEEHSVSRSMRNGFCVFDSRGLDYDRVAEGLVEVAEWMEHGV  195

Query  807   RHNQPCCRGSDDDREM-----MEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDFSSGDL  643
             RH QP CRG+           +  S A   A ++ +R+VNC +VV D+ E  +   SGDL
Sbjct  196   RHRQP-CRGAALPEPAFAVPSLASSSATATAKRFVRRQVNCAMVVVDLLELHRSLVSGDL  254

Query  642   KHVEAIKMIFHSPSIRR--SNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYD  469
             + +EA + +FHSPSI    ++E P+L+LTHGD LTAEER+ETR++ C+ +G+ ET G YD
Sbjct  255   RPLEATRELFHSPSINNYGTDENPILVLTHGDELTAEERIETRVRACDYMGVPETAGVYD  314

Query  468   IACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKDWVLAFASWVLCCFSS  289
             + C++E G+ A+E DPV+A+A+ EAVYR LL +DR H PK   +DW++   S  +C  S+
Sbjct  315   VVCVNEHGLLADEMDPVTAYAVAEAVYRGLLLADRGHPPKPIIRDWLILVLSRSMCTLSA  374

Query  288   FFAMLANFFSRFG  250
              FA L+   S+  
Sbjct  375   VFAFLSACCSKIA  387



>ref|XP_003632400.1| PREDICTED: uncharacterized protein LOC100854991 [Vitis vinifera]
Length=379

 Score =   375 bits (962),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 202/378 (53%), Positives = 266/378 (70%), Gaps = 2/378 (1%)
 Frame = -1

Query  1362  MRSQLSFSDEDQSELLKTAAWWWRTLPEFDENGRFKEDISS-GGLSPRLKLLREMQRLAF  1186
             M+SQ S + ED  E L     WWR+   F E  +FK ++ +   L+P LKLLRE++RLA 
Sbjct  1     MKSQFSSTYEDDYESLMLVYCWWRSAVTFGEAAKFKVELPNVSTLTPTLKLLRELERLAL  60

Query  1185  ISMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYS  1006
             ++ EGL  LR KL SY++GD WVP GG+K+ DMDIP VIT+LLVG +GSGKSSLVN MYS
Sbjct  61    MAREGLSELRQKLVSYRSGDFWVPTGGMKREDMDIPPVITILLVGFSGSGKSSLVNLMYS  120

Query  1005  VLGRSGLIPFAQTSSQPT-KFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVW  829
             VLGRSGLIPFA TSS+ + K TT  +EEHNVLRS ++GFCVYD+RGLD   M E +E+V 
Sbjct  121   VLGRSGLIPFATTSSENSAKCTTKFMEEHNVLRSMQSGFCVYDSRGLDYDLMGESIEEVS  180

Query  828   SWMSDGVRHNQPCCRGSDDDREMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDFSSG  649
              WM++GV HNQ C R  D+     E S     ++K+  R+VNC +VV ++ E FK    G
Sbjct  181   EWMTNGVHHNQLCLRTGDNLMSEEELSEVPGSSSKFTPRKVNCAMVVVNIAEIFKSLKKG  240

Query  648   DLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYD  469
             D K +EA + +F  P++++ NE P+LI+THGD+L+ EER++ RL LCE LGISETTG YD
Sbjct  241   DWKPLEATRELFRCPALKKCNENPILIMTHGDLLSTEERIKIRLTLCEFLGISETTGVYD  300

Query  468   IACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKDWVLAFASWVLCCFSS  289
             I CL+E G  A+E DPV+++AL+EAVYR+LL SDR H+PKR   DW L   + ++C  ++
Sbjct  301   IVCLTEYGFLADESDPVTSYALSEAVYRALLISDRGHIPKRSILDWTLLALALLMCYLAA  360

Query  288   FFAMLANFFSRFGGNNKR  235
             FF  LA FFS+ G   K+
Sbjct  361   FFEFLAEFFSKLGQKKKK  378



>ref|XP_007200164.1| hypothetical protein PRUPE_ppa016669mg, partial [Prunus persica]
 gb|EMJ01363.1| hypothetical protein PRUPE_ppa016669mg, partial [Prunus persica]
Length=353

 Score =   369 bits (947),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 186/351 (53%), Positives = 253/351 (72%), Gaps = 16/351 (5%)
 Frame = -1

Query  1257  KEDISSGGLSPRLKLLREMQRLAFISM----EGLDLLRHKLTSYQAGDLWVPVGGIKKTD  1090
             K D+    + PR++++RE++RLA ++     EGL+ LRHKL  Y++GD W+P+GGI K +
Sbjct  5     KFDVKMMKVDPRMRVVRELERLALVATHSHHEGLNELRHKLHMYRSGDFWMPIGGITKEN  64

Query  1089  MDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIPFAQTSSQPTKF-TTMLLEEHNVL  913
             MDIP + T+LLVG + SGK+SLVN MYSVLGRSGL+PFAQTS   T   ++M+L+EHNVL
Sbjct  65    MDIPPLATILLVGFSASGKTSLVNLMYSVLGRSGLVPFAQTSPPETGTKSSMVLKEHNVL  124

Query  912   RSKKNGFCVYDTRGLDCHRMDEGMED-VWSWMSDGVRHNQPCCRGSDDDR--EMMEYSMA  742
             RS ++GFCV+D+RG +  +  EG+E+ V +WMSDGVRHNQ C R  DD    E  EYS  
Sbjct  125   RSLRSGFCVFDSRGFEYDQTGEGVEEQVSNWMSDGVRHNQVCLRPGDDAALMEHEEYS--  182

Query  741   GRCANKYCKRRVNCVLVVADMEEAFKDFSSGDLKHVEAIKMIFHSPSIRRS---NEKPML  571
                A+K  +RRVNC +VVA+M E +K   +GD K +EA + +F S +   +   +E+P+L
Sbjct  183   ---ASKCVRRRVNCAMVVANMAEIYKALQAGDSKPMEATRQLFCSVNAFTNCNDDERPIL  239

Query  570   ILTHGDILTAEERVETRLKLCESLGISETTGAYDIACLSESGIPAEEGDPVSAFALTEAV  391
             ILTHGD+L+ EER+E RLK+CES+G+SET+G YDI CL+E G  AEE DPVSA+A+TEAV
Sbjct  240   ILTHGDMLSTEERIEGRLKICESVGVSETSGVYDIVCLTEYGFLAEESDPVSAYAVTEAV  299

Query  390   YRSLLQSDRTHLPKRKFKDWVLAFASWVLCCFSSFFAMLANFFSRFGGNNK  238
             YR+LL SDRTH PK+  +DW L   SW++C   S FA+LA    + G ++K
Sbjct  300   YRALLISDRTHSPKKSLEDWALLVLSWIMCFLGSLFALLAQICLKLGRHSK  350



>ref|XP_006359890.1| PREDICTED: uncharacterized protein LOC102585765 [Solanum tuberosum]
Length=384

 Score =   369 bits (947),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 189/380 (50%), Positives = 256/380 (67%), Gaps = 6/380 (2%)
 Frame = -1

Query  1362  MRSQLSFSDEDQSELLKTAAWWWRTLPEFDENGRFK-EDISS-GGLSPRLKLLREMQRLA  1189
             MR + +F+   Q E  +   +WWR   +FDE  +FK E I +   L+P LK+LREM+RL 
Sbjct  1     MRDE-NFNLNKQDEESRAMHYWWRLASKFDECVKFKFEKIQNLSKLTPILKVLREMERLY  59

Query  1188  FISMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMY  1009
              +S+E  D LR KL SY+ GD WVP+GGI K D+DIP V T+LLVG   +GKSSLVN MY
Sbjct  60    LMSIESFDELRQKLMSYKVGDFWVPIGGINKEDLDIPPVNTILLVGFHNAGKSSLVNLMY  119

Query  1008  SVLGRSGLIPFAQTS-SQPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDV  832
             SVLG+SGLIPFAQTS      +TT+ +EEHNVLRS ++GFC+YDTRG D  R+DE + ++
Sbjct  120   SVLGQSGLIPFAQTSLGNDCGYTTLTMEEHNVLRSTRSGFCIYDTRGFDYDRVDEALLEL  179

Query  831   WSWMS-DGVRHNQPCCRGSDDDR-EMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDF  658
               WM+ DGV H + C R  D     M+   +    ++ + KRRVNCV+VVA+  E +K  
Sbjct  180   KEWMAPDGVHHKKLCSRQEDHVLVPMLNNELEDASSSMFIKRRVNCVMVVANAYEIYKSL  239

Query  657   SSGDLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTG  478
                D K ++A+K ++ S S+ +SN  P+LILTHGD L+ E+R++ RLK+C+ LG SET G
Sbjct  240   KLDDFKPLDALKQLYCSSSLNKSNGNPILILTHGDKLSTEDRIDCRLKICKHLGTSETNG  299

Query  477   AYDIACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKDWVLAFASWVLCC  298
              YDI C++E G+ A+E DP+SA+++TEAVYRSLL SDR  L K+ FKDW L   S ++C 
Sbjct  300   IYDIVCVTEYGLLADEYDPISAYSVTEAVYRSLLISDRAQLVKKTFKDWALFALSCLMCF  359

Query  297   FSSFFAMLANFFSRFGGNNK  238
              +S FA LA  F+     +K
Sbjct  360   IASIFACLAQLFNVLAQKHK  379



>ref|XP_004247531.1| PREDICTED: uncharacterized protein LOC101256518 [Solanum lycopersicum]
Length=384

 Score =   365 bits (938),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 187/380 (49%), Positives = 254/380 (67%), Gaps = 6/380 (2%)
 Frame = -1

Query  1362  MRSQLSFSDEDQSELLKTAAWWWRTLPEFDENGRFK-EDISS-GGLSPRLKLLREMQRLA  1189
             MR + SF    Q E  +   +WWR   +FDE  +F  E I +   L+P LK+LREM+RL 
Sbjct  1     MRDE-SFDLNKQDEESRAMNYWWRLASKFDECIKFNFEKIQNLSKLTPILKVLREMERLY  59

Query  1188  FISMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMY  1009
              +S+E  D LR KL SY+ GD WVP+GGI K D+DIP V T+LLVG   +GKSSLVN MY
Sbjct  60    LMSIESFDELRQKLMSYKVGDFWVPIGGINKEDLDIPPVNTILLVGFHNAGKSSLVNLMY  119

Query  1008  SVLGRSGLIPFAQTSS-QPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDV  832
             SVLG+SGLIPFAQTSS     +TT+ +EEHNVLRS ++GFC+YDTRG D  R+DE + ++
Sbjct  120   SVLGQSGLIPFAQTSSGNDCGYTTLTMEEHNVLRSTRSGFCIYDTRGFDYDRVDEALLEL  179

Query  831   WSWMS-DGVRHNQPCCRGSDDDR-EMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDF  658
               WM+ DGV H + C R  D     M+   +    ++ + KR VNCV+VV +  E +K  
Sbjct  180   KEWMAPDGVHHKKLCSRQEDHLLLPMLNNELEDASSSMFIKRSVNCVMVVVNAYEIYKSL  239

Query  657   SSGDLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTG  478
                D K ++A+K ++ S S+ +SN  P+LILTHGD L+ E+R++ RLK+C+ LG SET G
Sbjct  240   KLDDFKPLDALKQLYCSSSLNKSNGNPILILTHGDKLSTEDRIDCRLKICKHLGASETNG  299

Query  477   AYDIACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKDWVLAFASWVLCC  298
              YDI C++E G+ A+E DP+SA+++TEAVYRSLL SDR  L K+ FKDW L   S ++C 
Sbjct  300   IYDIVCVTEYGLLADEYDPISAYSVTEAVYRSLLSSDRAQLVKKTFKDWALFALSCLMCF  359

Query  297   FSSFFAMLANFFSRFGGNNK  238
              ++ FA LA+ F+     +K
Sbjct  360   IATVFAFLAHIFNVLAQKHK  379



>ref|XP_008235172.1| PREDICTED: uncharacterized protein LOC103334029 [Prunus mume]
Length=398

 Score =   366 bits (939),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 188/374 (50%), Positives = 256/374 (68%), Gaps = 32/374 (9%)
 Frame = -1

Query  1299  WWRTLPEFDENGRFKEDISSGGLSPRLKLLREMQRLAFISM----EGLDLLRHKLTSYQA  1132
             WWR+          K D+    + PR++++RE++RLA ++     EGL+ LRHKL  Y++
Sbjct  34    WWRSWGA-------KFDVKMMKVDPRMRVVRELERLALVATHSHHEGLNELRHKLHMYRS  86

Query  1131  GDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIPFAQTSSQPT  952
             GD W+P+GGI K +MDIP + T+LLVG + SGK+SLVN MYSVLGRSGL+PFAQTS   T
Sbjct  87    GDFWMPIGGIIKENMDIPPLATILLVGFSASGKTSLVNLMYSVLGRSGLVPFAQTSPPET  146

Query  951   KF----------TTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMED-VWSWMSDGVR  805
                          +M+L+EHNVLRS ++GFCV+D+RG +  +M EG+E+ V +WM+DGVR
Sbjct  147   GSYSSNHSSKSRASMVLKEHNVLRSSRSGFCVFDSRGFEYDQMGEGVEEQVSNWMNDGVR  206

Query  804   HNQPCCRGSDDDR--EMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDFSSGDLKHVE  631
             HNQ C R  DD    E  EYS     A+K+ +RRVNC +VVA+M E +K   +GD K +E
Sbjct  207   HNQVCLRPGDDAALMEHEEYS-----ASKFVRRRVNCAMVVANMAEIYKALKAGDSKPME  261

Query  630   AIKMIFHSPSIRRS---NEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYDIAC  460
             A + +F S +   +   +E+P+LILTHGD+L+ EER+E RLK+CES+G+SET+G YDI C
Sbjct  262   ATRQLFCSVNAFTNCNDDERPILILTHGDMLSTEERIEGRLKICESVGVSETSGVYDIVC  321

Query  459   LSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKDWVLAFASWVLCCFSSFFA  280
             L+E G  AEE DPVSA+A+TEAVYR+LL SDRTH PK+  +DW L   SW++    S FA
Sbjct  322   LTEYGFLAEESDPVSAYAVTEAVYRALLISDRTHSPKKSLEDWALLVLSWIMYLLGSLFA  381

Query  279   MLANFFSRFGGNNK  238
             +LA    + G + K
Sbjct  382   LLAQICLKLGRHTK  395



>ref|XP_008345237.1| PREDICTED: uncharacterized protein LOC103408149 [Malus domestica]
Length=424

 Score =   365 bits (938),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 189/383 (49%), Positives = 256/383 (67%), Gaps = 28/383 (7%)
 Frame = -1

Query  1302  WWWRTLPEFDENGRFKED------ISSGG--------LSPRLKLLREMQRLAFIS--MEG  1171
             +WWR   EFD   + +        I  GG         + R++++RE++RLA +S   EG
Sbjct  40    YWWRWAAEFDHVKKMQMKLDHERLIFPGGGRASSHFTAAARMRVVRELERLALVSTHQEG  99

Query  1170  LDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRS  991
             ++ LRHKL  Y++GD W+P GG+ K +MDIP V T+LLVG + SGKSSLVN MYSVLGRS
Sbjct  100   VNELRHKLLMYRSGDFWMPTGGLAKENMDIPPVATILLVGFSASGKSSLVNLMYSVLGRS  159

Query  990   GLIPFAQTSSQPTKF------TTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVW  829
             GL+PFAQTS  P  F      T+M+L+EHNVLRS ++GFCVYD+RG D +R+ EG++++ 
Sbjct  160   GLVPFAQTSPPPGSFSNNPKSTSMILKEHNVLRSLRSGFCVYDSRGFDYNRIGEGLQELS  219

Query  828   SWMSDGVRHNQPCCRGSDDDREMMEYSMAGR-CANKYCKRRVNCVLVVADMEEAFKDFSS  652
             SWMSDG+ HNQ C R  DD  E +  ++      +K+ +R+VNC +VVA+M E +K F +
Sbjct  220   SWMSDGIHHNQVCLRPGDDVEESVLTNLPDMDVISKFARRKVNCAMVVANMAEIYKAFQA  279

Query  651   GDLKHVEAIKMIFHSPSIRRSN----EKPMLILTHGDILTAEERVETRLKLCESLGISET  484
             GD K ++A K +F S +   +N    E  +LILTHGD+LT EER+E RLK+CE LG+SET
Sbjct  280   GDSKPMDATKQLFCSVNNAFTNIYNDESTILILTHGDMLTTEERIEGRLKICECLGVSET  339

Query  483   TGAYDIA-CLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKDWVLAFASWV  307
             +G YDI  CLSE G  AEE DPVSA+AL+EAVY +LL SDRTH PK+   DW +   S +
Sbjct  340   SGVYDIVTCLSEYGFLAEESDPVSAYALSEAVYMALLLSDRTHSPKKTLGDWAVLILSSI  399

Query  306   LCCFSSFFAMLANFFSRFGGNNK  238
             +C  +S F +LA      G ++K
Sbjct  400   MCFLASIFGLLAQICLTLGRHSK  422



>ref|XP_009378682.1| PREDICTED: uncharacterized protein LOC103967150 [Pyrus x bretschneideri]
Length=424

 Score =   363 bits (933),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 189/383 (49%), Positives = 256/383 (67%), Gaps = 28/383 (7%)
 Frame = -1

Query  1302  WWWRTLPEFDENGRFKED------ISSGG--------LSPRLKLLREMQRLAFIS--MEG  1171
             +WWR   EFD   + +        I  GG         + R++++RE++RLA +S   EG
Sbjct  40    YWWRWAAEFDHVKKMQMKLDHERLIFPGGGRASSHFTAAARMRVVRELERLALVSTHQEG  99

Query  1170  LDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRS  991
             ++ LRHKL  Y++GD W+P GG+ K +MDIP V T+LLVG + SGKSSLVN MYSVLGRS
Sbjct  100   VNELRHKLLMYRSGDFWMPTGGLAKENMDIPPVATILLVGFSASGKSSLVNLMYSVLGRS  159

Query  990   GLIPFAQTSSQPTKF------TTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVW  829
             GL+PFAQTS  P  F      T+M+L+EHNVLRS ++GFCVYD+RG D +R+ EG+E++ 
Sbjct  160   GLVPFAQTSPPPGSFSNNPKSTSMILKEHNVLRSLRSGFCVYDSRGFDYNRIGEGLEELS  219

Query  828   SWMSDGVRHNQPCCRGSDDDREMMEYSMAGR-CANKYCKRRVNCVLVVADMEEAFKDFSS  652
             SWMSDG+ HNQ C R  DD  E +  ++      +K+ +R+VNC +VVA+M E +K F +
Sbjct  220   SWMSDGIHHNQVCLRPGDDVEESVLMNLPDMDVISKFARRKVNCAMVVANMAEIYKAFQA  279

Query  651   GDLKHVEAIKMIFHSPSIRRSN----EKPMLILTHGDILTAEERVETRLKLCESLGISET  484
             GD K ++A K +F S +   +N    E  +LILTHGD+LT EER+E RLK+CE LG+SET
Sbjct  280   GDSKPMDATKQLFCSVNNAFTNIYNDESTILILTHGDMLTTEERIEGRLKICECLGVSET  339

Query  483   TGAYDIA-CLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKDWVLAFASWV  307
             +G YDI  CLSE G  AEE DPVSA+AL+EAVY +LL SDRTH PK+   D  +   S +
Sbjct  340   SGVYDIVTCLSEYGFLAEESDPVSAYALSEAVYMALLLSDRTHSPKKTLGDLAVLILSSI  399

Query  306   LCCFSSFFAMLANFFSRFGGNNK  238
             +C  +S F +LA    + G ++K
Sbjct  400   MCFLASIFGLLAQICLKLGRHSK  422



>ref|XP_004300478.1| PREDICTED: uncharacterized protein LOC101306923 [Fragaria vesca 
subsp. vesca]
Length=426

 Score =   355 bits (910),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 193/400 (48%), Positives = 263/400 (66%), Gaps = 43/400 (11%)
 Frame = -1

Query  1308  AAWWWRTLPEFDENGRFK-----EDISSGGLSPRLKLLREMQRLAFISME----------  1174
             A  WWR+  ++DE  + K      D+S   L+ R+++ +E++RLA ++            
Sbjct  28    AYCWWRSAAKYDEYVKLKFEGGLPDVSR--LTRRMRVFKELERLALLASGNTTGTHEYQG  85

Query  1173  -----GLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMY  1009
                  G++ LRHKL +Y++GD WVP GGI K  MDIP V T+LLVG + SGKSSLVN MY
Sbjct  86    QYIEGGVNELRHKLLTYRSGDFWVPTGGISKDMMDIPPVATILLVGFSASGKSSLVNLMY  145

Query  1008  SVLGRSGLIPFAQTSSQPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRM--DEGMED  835
             SVLGRSGL+PFAQTSS     TTMLL+EHNV+RS ++GFCVYD+RG D + +  D   E+
Sbjct  146   SVLGRSGLVPFAQTSSSSGS-TTMLLKEHNVVRSLRSGFCVYDSRGFDYNDIGDDSVREE  204

Query  834   VWSWMSDGVRHNQPCCRGSDDDREMMEYSMAG-------------RCANKYCKRRVNCVL  694
             +  WM+ G+  NQ C R  D D  +  +++AG               ++K+ +R VNCV+
Sbjct  205   LSCWMNYGIHQNQRCLRSGDPD-NIPHHNVAGDDMHDEFHTMSEYNWSSKFVRRTVNCVM  263

Query  693   VVADMEEAFKDFSSGDLKHVEAIKMIFHSPSIRR-SNEKPMLILTHGDILTAEERVETRL  517
             +VA+M E +K F +GD   +EA + +F S + R   +EKP+LILTHGD+L+ EER+E RL
Sbjct  264   LVANMAEIYKAFKAGDSNLIEATRQLFCSSAFRNCDDEKPILILTHGDMLSTEERIEGRL  323

Query  516   KLCESLGISETTGAYDIACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFK  337
             K+CE +G+SETTG YDI CL+E G  AEE DPVSA+ALTEAVYR+LL SDRTHLPK+  K
Sbjct  324   KICEYVGVSETTGVYDIVCLTEYGFLAEESDPVSAYALTEAVYRALLISDRTHLPKKTHK  383

Query  336   DWVLAFASWVLCCFSSFFAMLANFFSRFGGNNKR---HRL  226
             DW L   SW++C  +S FA++A    + GG  ++   HRL
Sbjct  384   DWALLVVSWIMCFIASLFALIAEICFKLGGGGRQRDHHRL  423



>gb|KCW61261.1| hypothetical protein EUGRSUZ_H04024 [Eucalyptus grandis]
Length=287

 Score =   349 bits (895),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 167/286 (58%), Positives = 216/286 (76%), Gaps = 4/286 (1%)
 Frame = -1

Query  1089  MDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIPFAQTSSQPTKFTTMLLEEHNVLR  910
             M IP ++ ++LVGL+GSGKSSLVN MYSVLGRSGLIPF+QTS++ +++TTM LEEHNVLR
Sbjct  1     MVIPPIMMVVLVGLSGSGKSSLVNLMYSVLGRSGLIPFSQTSNESSRYTTMYLEEHNVLR  60

Query  909   SKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSDGVRHNQPCCRGSDD--DREMMEYSMAGR  736
             S ++GFC+YDTRGLD ++M EG+++V  WM++GVRH Q C R  DD   RE +   M G 
Sbjct  61    SLRSGFCIYDTRGLDVNQMKEGLDEVSEWMNNGVRHYQLCLRPGDDVFRREALVTPMMGN  120

Query  735   CANKYCKRRVNCVLVVADMEEAFKDFSSGDLKHVEAIKMIFHSPSIRRSNEKPMLILTHG  556
                ++  R+VNC LVVA+M +      SGDLK +EA K +FH P++R+S+E P+LILTHG
Sbjct  121   A--RFGTRQVNCALVVANMAQICNGVQSGDLKPLEATKDLFHCPALRKSSESPILILTHG  178

Query  555   DILTAEERVETRLKLCESLGISETTGAYDIACLSESGIPAEEGDPVSAFALTEAVYRSLL  376
             D L+ EER+  RLK+ E LG++ETTG YDI CL+E GI  EE DPV+A+AL EAVYR+LL
Sbjct  179   DELSPEERIIGRLKISEYLGVAETTGLYDIPCLTEQGILPEESDPVTAYALAEAVYRALL  238

Query  375   QSDRTHLPKRKFKDWVLAFASWVLCCFSSFFAMLANFFSRFGGNNK  238
             Q+DR HLPK+K +D V    SW +C   SFFA+LA FFS+ G NNK
Sbjct  239   QADRAHLPKKKLRDRVSLVLSWFMCSIGSFFALLAYFFSKLGRNNK  284



>ref|XP_009408742.1| PREDICTED: uncharacterized protein LOC103991108 [Musa acuminata 
subsp. malaccensis]
Length=420

 Score =   350 bits (898),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 176/382 (46%), Positives = 251/382 (66%), Gaps = 10/382 (3%)
 Frame = -1

Query  1356  SQLSFSDEDQSELLKTAAWWWRTLPEFD---ENGRFKEDISSGGL--SPRLKLLREMQRL  1192
             S +   D+        A  WWR+L EFD   E GR +    S G   SPR+++LRE++RL
Sbjct  36    SSVQGGDDASEASAALANCWWRSLIEFDGDSEGGRTEAAAGSRGAVASPRVRVLRELERL  95

Query  1191  AFISMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFM  1012
             A  +   LD +RHKL +Y AGDLW+P GGI K + DIP VIT+LL+GL G+GK++LV+ M
Sbjct  96    AAAANVSLDDIRHKLLTYNAGDLWLPAGGIPKHETDIPPVITILLLGLAGTGKTALVDLM  155

Query  1011  YSVLGRSGLIPFAQTSS-QPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMED  835
             Y VLGR+G +PFAQ+         T  LEEHNVLRS ++GFC++D+RGLDC RM +G+E+
Sbjct  156   YCVLGRAGFLPFAQSIPLAGNDGRTQCLEEHNVLRSMRSGFCIFDSRGLDCDRMADGLEE  215

Query  834   VWSWMSDGVRHNQPCCRGSDDDREMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDFS  655
             V  WM++GVRH QPC RG++        S     A ++ +RRVNC +VVA++ E      
Sbjct  216   VAEWMNEGVRHGQPC-RGANPPDAPAPASAPP--ATRFLRRRVNCPVVVANLYELHHSLL  272

Query  654   SGDLKHVEAIKMIFHSPSIRRS-NEKPMLILTHGDILTAEERVETRLKLCESLGISETTG  478
             SGD + +EA + +FH P I+ S  + P+L+LTHGD L+ EER++ R+K CE LG+SET G
Sbjct  273   SGDPRPLEATRDLFHYPPIKISPTDSPILVLTHGDELSPEERIQARVKTCEYLGVSETNG  332

Query  477   AYDIACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKDWVLAFASWVLCC  298
              YDI+CL+E G   +E DP +++A+ EA++R+L+ +DRTH  K   K+W+L   +W +C 
Sbjct  333   VYDISCLNEYGTAVDEMDPATSYAVAEAIFRALVVADRTHPAKASIKEWLLVVITWAMCA  392

Query  297   FSSFFAMLANFFSRFGGNNKRH  232
              S+FFA L+   S+    N+ +
Sbjct  393   LSTFFAFLSCCCSKLAKANREY  414



>ref|XP_009418862.1| PREDICTED: uncharacterized protein LOC103998953 [Musa acuminata 
subsp. malaccensis]
Length=366

 Score =   330 bits (846),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 171/382 (45%), Positives = 246/382 (64%), Gaps = 18/382 (5%)
 Frame = -1

Query  1362  MRSQLSFSDEDQSELLKTAAWWWRTLPEFDENGRFKEDISSGGLSPRLKLLREMQRLAFI  1183
             MRS +   D+        A++WWR  P  +  G   E         R+++LREM+RLA  
Sbjct  1     MRSSVQAGDDGGEGGAALASYWWR--PLVEHGGSEGEAARR-----RVRVLREMERLAAA  53

Query  1182  SMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSV  1003
             + E LD LRHKL +Y+AGDLW P GG+ K +MDIP V+++LL+GL G+GKS+LV+ MY V
Sbjct  54    ANESLDDLRHKLLTYKAGDLWFPAGGVPKQEMDIPPVVSVLLIGLAGAGKSTLVDLMYYV  113

Query  1002  LGRSGLIPFAQTSSQPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSW  823
             LGR+G +PF  TS       T+ LEEHNVLRS +NGFCV+D+RGLD  RM +G+E+V  W
Sbjct  114   LGRAGFVPF--TSPADKDGRTLCLEEHNVLRSMRNGFCVFDSRGLDRDRMGDGLEEVAEW  171

Query  822   MSDGVRHNQPCCRGSDDDREMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDFSSGDL  643
             M  GVRH QPC RG+     +++ S     A ++ +RRVNCV++V ++ E  +   SGD 
Sbjct  172   MEKGVRHRQPC-RGTG----LLDASAP---AKRFVRRRVNCVIIVVNLRELHRSLLSGDA  223

Query  642   KHVEAIKMIFHSPSIR-RSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYDI  466
               +EA   + H P+I+  S E P+L+LTHGD L+ EER+E R+K CE LG+ ET   YDI
Sbjct  224   GPLEATYDLVHHPTIKINSTEIPILVLTHGDELSPEERMEARVKACEHLGVPETNAVYDI  283

Query  465   ACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKDWVLAFASWVLCCFSSF  286
              C++E G   +E DP +A+A+ E + R+L+ +DR+H PK + KD +L   SW +C  S++
Sbjct  284   PCVNEHGAAVDEMDPTTAYAVAEVILRALVVADRSHRPKARIKDRLLLVLSWAMCALSAW  343

Query  285   FAMLANFFSRFGGNNKRHRLKI  220
             FA L+   ++ G  N+  +L++
Sbjct  344   FAFLSRCCAKLGRANREAKLRV  365



>emb|CBI36917.3| unnamed protein product [Vitis vinifera]
Length=287

 Score =   312 bits (800),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 158/286 (55%), Positives = 206/286 (72%), Gaps = 1/286 (0%)
 Frame = -1

Query  1089  MDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIPFAQTSSQPT-KFTTMLLEEHNVL  913
             MDIP VIT+LLVG +GSGKSSLVN MYSVLGRSGLIPFA TSS+ + K TT  +EEHNVL
Sbjct  1     MDIPPVITILLVGFSGSGKSSLVNLMYSVLGRSGLIPFATTSSENSAKCTTKFMEEHNVL  60

Query  912   RSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSDGVRHNQPCCRGSDDDREMMEYSMAGRC  733
             RS ++GFCVYD+RGLD   M E +E+V  WM++GV HNQ C R  D+     E S     
Sbjct  61    RSMQSGFCVYDSRGLDYDLMGESIEEVSEWMTNGVHHNQLCLRTGDNLMSEEELSEVPGS  120

Query  732   ANKYCKRRVNCVLVVADMEEAFKDFSSGDLKHVEAIKMIFHSPSIRRSNEKPMLILTHGD  553
             ++K+  R+VNC +VV ++ E FK    GD K +EA + +F  P++++ NE P+LI+THGD
Sbjct  121   SSKFTPRKVNCAMVVVNIAEIFKSLKKGDWKPLEATRELFRCPALKKCNENPILIMTHGD  180

Query  552   ILTAEERVETRLKLCESLGISETTGAYDIACLSESGIPAEEGDPVSAFALTEAVYRSLLQ  373
             +L+ EER++ RL LCE LGISETTG YDI CL+E G  A+E DPV+++AL+EAVYR+LL 
Sbjct  181   LLSTEERIKIRLTLCEFLGISETTGVYDIVCLTEYGFLADESDPVTSYALSEAVYRALLI  240

Query  372   SDRTHLPKRKFKDWVLAFASWVLCCFSSFFAMLANFFSRFGGNNKR  235
             SDR H+PKR   DW L   + ++C  ++FF  LA FFS+ G   K+
Sbjct  241   SDRGHIPKRSILDWTLLALALLMCYLAAFFEFLAEFFSKLGQKKKK  286



>ref|XP_006444446.1| hypothetical protein CICLE_v10020446mg [Citrus clementina]
 gb|ESR57686.1| hypothetical protein CICLE_v10020446mg [Citrus clementina]
Length=293

 Score =   256 bits (655),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 131/278 (47%), Positives = 191/278 (69%), Gaps = 11/278 (4%)
 Frame = -1

Query  1374  HRKIMRSQLSFSDEDQSELLKTAAWWWRTLPEFDENGRFKEDISS-GGLSPRLKLLREMQ  1198
              ++ M+SQLS  + D+ +       WWR+  +FDE  + K D+ +   L+PRL++LREM+
Sbjct  17    QKREMKSQLSCGEVDEYDPSGLVYCWWRSAAKFDECVKLKLDLPNVSTLTPRLRVLREME  76

Query  1197  RLAFISMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVN  1018
             RLA I+ +GL+ LRHK  SY++GD W+P+GGI+K  MDIP VIT+LL+G +GSGKSSLVN
Sbjct  77    RLALIAPDGLNELRHKFLSYRSGDFWIPIGGIQKGGMDIPPVITILLMGFSGSGKSSLVN  136

Query  1017  FMYSVLGRSGLIPFAQTSSQPTKFT-TMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGM  841
              MYSVL RSGL+ FAQTSS  +  T TM +EEHNV+RS ++GFCVYD+RG + +R+ EG+
Sbjct  137   LMYSVLSRSGLVLFAQTSSGNSSHTITMYMEEHNVMRSLQSGFCVYDSRGFNYNRVHEGL  196

Query  840   EDVWSWMSDGVRHNQPCCRGSD-----DDREMMEYSMAGRCANKYCKRRVNCVLVVADME  676
             E++ SWMS+GV HNQ C R  D     +D E+ +     + + KY  RRV+  +VV+++ 
Sbjct  197   EELSSWMSEGVHHNQRCLRSDDCALMKNDAEIDDL----KSSPKYVLRRVDFAMVVSNIA  252

Query  675   EAFKDFSSGDLKHVEAIKMIFHSPSIRRSNEKPMLILT  562
             E +K   +GD K ++A K +F +P +R+ ++    IL 
Sbjct  253   EIYKALKAGDSKPLDATKRLFSAPGLRKCSKISFCILV  290



>gb|KDO87081.1| hypothetical protein CISIN_1g016817mg [Citrus sinensis]
Length=273

 Score =   256 bits (653),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 131/274 (48%), Positives = 189/274 (69%), Gaps = 11/274 (4%)
 Frame = -1

Query  1362  MRSQLSFSDEDQSELLKTAAWWWRTLPEFDENGRFKEDISS-GGLSPRLKLLREMQRLAF  1186
             M+SQLS  + D+ +       WWR+  +FDE  + K D+ +   L+PRL++LREM+RLA 
Sbjct  1     MKSQLSCGEVDEYDPSGLVYCWWRSAAKFDECVKLKLDLPNVSTLTPRLRVLREMERLAL  60

Query  1185  ISMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYS  1006
             I+ +GL+ LRHK  SY++GD W+P+GGI+K  MDIP VIT+LL+G +GSGKSSLVN MYS
Sbjct  61    IAPDGLNELRHKFLSYRSGDFWIPIGGIQKGGMDIPPVITILLMGFSGSGKSSLVNLMYS  120

Query  1005  VLGRSGLIPFAQTSSQPTKFT-TMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVW  829
             VL RSGL+ FAQTSS  +  T TM +EEHNV+RS ++GFCVYD+RG + +R+ EG+E++ 
Sbjct  121   VLSRSGLVLFAQTSSGNSSHTITMYMEEHNVMRSLQSGFCVYDSRGFNYNRVHEGLEELS  180

Query  828   SWMSDGVRHNQPCCRGSD-----DDREMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFK  664
             SWMS+GV HNQ C R  D     +D E+ +     + + KY  RRV+  +VV+++ E +K
Sbjct  181   SWMSEGVHHNQRCLRSDDCALMKNDAEIDDL----KSSPKYVLRRVDFAMVVSNIAEIYK  236

Query  663   DFSSGDLKHVEAIKMIFHSPSIRRSNEKPMLILT  562
                +GD K ++A K +F +P +R+ ++    IL 
Sbjct  237   ALKAGDSKPLDATKRLFSAPGLRKCSKISFCILV  270



>gb|KHG23132.1| Phosphate import ATP-binding PstB [Gossypium arboreum]
Length=426

 Score =   139 bits (349),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 103/307 (34%), Positives = 160/307 (52%), Gaps = 27/307 (9%)
 Frame = -1

Query  1218  KLLREMQRLAFISMEGLDLLRHKLTSYQAGDLWVP-VGGIKKTDMDIPAVITLLLVGLTG  1042
             ++L+   +L   SM  L+  ++K+ SY  G +W+  VGG K +D D+P   +LLL+G  G
Sbjct  84    EVLQSYDQLRVRSM-SLNEAKYKVLSYFPG-IWIENVGGKKFSDYDVPKTTSLLLIGPKG  141

Query  1041  SGKSSLVNFMYSVLGRSGLIP-FAQTSSQPTKFT-TMLLEEHNVLRSKKNGFCVYDTRGL  868
              GKSSLVN +  V       P  AQ S  P+    T  L+ + + R   + FC+YD+RGL
Sbjct  142   CGKSSLVNKISRVFEDDNFAPERAQISYNPSVGDGTYYLQGYMIPRGSAS-FCLYDSRGL  200

Query  867   DCHRMDEGMEDVWSWMSDGVRHNQPCCRGSDDD--REMMEYSMAGRCANKYCK-RRVNCV  697
                   E +  V +WM++GVRH +P  R SDD   R  M++        K+C+ + VN V
Sbjct  201   -ADGTSENINVVQNWMNNGVRHGEPVIRKSDDSSLRRRMKFK-PRELGWKFCRPQMVNFV  258

Query  696   LVVADMEEAFKDFSSG---DLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVE  526
             + V D     K        DL  ++ I  +F  P +   ++KP++++THGD+L+  +RV 
Sbjct  259   IFVVDAVSVLKSIEGHGVEDLLCLQMINEVFKHPCLSFKDDKPVVVITHGDLLSIADRVR  318

Query  525   TRLKLCESLGISETTGAYDIACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKR  346
              R+ L E LGI      +DI          E  DPV+   + + +  SL  +DR +LP  
Sbjct  319   ARVYLGELLGIPPAKQIFDI---------PENHDPVTELTIVDMLRYSLEHADR-NLP--  366

Query  345   KFKDWVL  325
              +K+W+L
Sbjct  367   -YKNWLL  372



>ref|XP_001766514.1| predicted protein [Physcomitrella patens]
 gb|EDQ68579.1| predicted protein [Physcomitrella patens]
Length=524

 Score =   137 bits (346),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 93/280 (33%), Positives = 145/280 (52%), Gaps = 9/280 (3%)
 Frame = -1

Query  1170  LDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVL-GR  994
             ++ +R KL  Y+ G   V  GG++K+D  IP V TLL+VG  G+GKS+L+N +  VL  +
Sbjct  185   IEEMRLKLQRYEPGQWLVESGGMRKSDFAIPEVTTLLVVGSMGAGKSTLINNLIRVLNNK  244

Query  993   SGLIPFAQTSSQPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSD  814
             S     AQ    P +  T  L E+ +L   KN  CV+D+RG+   ++ +G+E +  WM  
Sbjct  245   SQDFDRAQVCGDPGENGTYFLNEY-MLNESKNNICVFDSRGMPELKVADGLEVLEDWMVK  303

Query  813   GVRHNQPCCRGSDDDREMMEYSMAGRCANKYC--KRRVNCVLVVADMEEAFKDFSSGDLK  640
             GVRH Q   R SD  R         R  +     KR +N V+ V +     K   SGD  
Sbjct  304   GVRHGQMVIRTSDSSRVKEAVERKARQGHHKLSKKRHINFVIFVINATTVHKIRHSGDTL  363

Query  639   HVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYDIAC  460
                    IF  P I   +++P++++THGD L+ ++R+  R+ L   LG+S     +DIA 
Sbjct  364   SRPNFLRIFKFPLITFKDDRPVVVMTHGDELSEDDRLAARIYLGNLLGVSPVDHVFDIAG  423

Query  459   LSESGIPAEEGDPVSA--FALTEAVYRSLLQSDRTHLPKR  346
                +G   E+GD  +     L + +  +L ++DR +LP +
Sbjct  424   F--TGRVMEDGDQCAENDLLLLDMLEYALQRADR-NLPYK  460



>ref|XP_008458046.1| PREDICTED: uncharacterized protein LOC103497586 isoform X4 [Cucumis 
melo]
Length=436

 Score =   129 bits (325),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 93/284 (33%), Positives = 139/284 (49%), Gaps = 18/284 (6%)
 Frame = -1

Query  1176  EGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLG  997
             E L   + K  SY  G     VGG+K +D DIP  I+L+L+G  GSGKSSL+N +  V  
Sbjct  103   ENLKQAKQKNLSYSPGAWIEQVGGMKLSDYDIPQTISLILIGPKGSGKSSLINRISKVFE  162

Query  996   RSGLIP-FAQTSSQPT-KFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSW  823
                  P  AQ S   + +  T  L E+ +LR  K+ FC+YDTRGL     D  +E +  W
Sbjct  163   EDHFAPERAQVSCNSSGEGGTFFLHEYMILRKSKS-FCLYDTRGLSDDPSD-NIETLKQW  220

Query  822   MSDGVRHNQPCCRGSDDDREMMEYSMAGRCANKYCK--RRVNCVLVVADMEEAFKDFSSG  649
             MS GVRH +   R SD    +       R +    +  R +N V+ V D     K     
Sbjct  221   MSKGVRHGELVTRKSDASNFINRMKCKARQSFPRSRVIRIINFVIFVVDGLSVLKSIDGD  280

Query  648   DLK--HVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGA  475
             D +  +   I   F+ P +   ++KP+++LTHGD+L+  +RV  R  L   LGI  T   
Sbjct  281   DKQKDYDRVITTAFNCPYLSYGDDKPVVVLTHGDLLSFADRVRVRGHLGNLLGIPSTKQI  340

Query  474   YDIACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRK  343
             +DI          +  DPV+   + + ++  L  +D+ +LP ++
Sbjct  341   FDI---------PDRYDPVTELTIIDMLHYCLEHADK-NLPHKR  374



>ref|XP_004149770.1| PREDICTED: uncharacterized protein LOC101208586 [Cucumis sativus]
 ref|XP_004167475.1| PREDICTED: uncharacterized protein LOC101225331 [Cucumis sativus]
 gb|KGN44624.1| hypothetical protein Csa_7G351880 [Cucumis sativus]
Length=436

 Score =   129 bits (325),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 93/286 (33%), Positives = 137/286 (48%), Gaps = 17/286 (6%)
 Frame = -1

Query  1185  ISMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYS  1006
             I  E L+  + K+ SY  G     VGG+K +D DIP   +L+L+G  GSGKSSL+N +  
Sbjct  100   IRSENLNQAKQKILSYSPGAWIEQVGGMKLSDYDIPQTTSLILIGPKGSGKSSLINRISK  159

Query  1005  VLGRSGLIP-FAQTSSQPT-KFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDV  832
             V       P  AQ S   + +  T  L E+ +LR  K+ FC+YDTRGL     D  +E +
Sbjct  160   VFEEDHFAPERAQVSCNSSGEDGTFFLHEYMILRKSKS-FCLYDTRGLSNDPSD-NIEML  217

Query  831   WSWMSDGVRHNQPCCRGSDDDREMMEYSMAGRCANKYCK--RRVNCVLVVADMEEAFKDF  658
               WMS GV H +   R SD    +       R +    +  R +N V+ V D     K  
Sbjct  218   KQWMSKGVHHGKLVTRKSDASSLINRMRCKARQSFPRSRVVRIINFVIFVVDGLSVLKSI  277

Query  657   SSGDLK--HVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISET  484
                D +  +   I   F+ P +   ++KP+++LTHGD+L+  E V  R  L   LGI  T
Sbjct  278   DGDDKQKDYDRVITTAFNCPYLSYGDDKPVVVLTHGDLLSFAENVRVRGHLGNLLGIPST  337

Query  483   TGAYDIACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKR  346
                +DI          +  DPV+   + + ++  L  +D+   PKR
Sbjct  338   KQIFDI---------PDRYDPVTELTIIDMLHYCLEHADKNLPPKR  374



>ref|XP_004242425.1| PREDICTED: uncharacterized protein LOC101254004 [Solanum lycopersicum]
Length=523

 Score =   129 bits (324),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 86/256 (34%), Positives = 130/256 (51%), Gaps = 9/256 (4%)
 Frame = -1

Query  1221  LKLLREMQRLAFISMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTG  1042
             + +L+  + L F   + L+  ++K+ SY  G     VGG+K +D +IP   TLLL+G  G
Sbjct  74    MDVLKSYEELQF-HKDHLEEAKNKILSYTPGSWIEEVGGMKASDYNIPKKTTLLLIGPRG  132

Query  1041  SGKSSLVNFMYSVLGRSGLIP-FAQTSSQPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLD  865
             SGKSSLVN +  V       P  AQ S       T  L E+ + +   + FC+YDTRGL 
Sbjct  133   SGKSSLVNKISRVFDDDPFTPERAQVSYSSDGDGTYFLHEYTMPKG-SSSFCLYDTRGL-  190

Query  864   CHRMDEGMEDVWSWMSDGVRHNQPCCRGSDDDREMMEYSMAGRCANKYCKRRVNCVLVVA  685
                ++E ++ V  WM  GVRH +   R SDD     +      CA++     VNCV+ V 
Sbjct  191   SDDLNENIKIVDRWMKKGVRHGKLITRDSDDANPKSKVRRNRYCASE--TNVVNCVIFVV  248

Query  684   DMEEAFKDFSSGD---LKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLK  514
                +  +   S D    +   A+   F+ P +   +EKP+++LTHGD+L+  +R   R+ 
Sbjct  249   SAVQILQSMDSDDETKRQQTRAVASNFNYPLLSFKDEKPIVVLTHGDLLSLSDRTRIRMH  308

Query  513   LCESLGISETTGAYDI  466
             L + LGI      +DI
Sbjct  309   LGQLLGIHPKKQIFDI  324



>ref|XP_006352825.1| PREDICTED: uncharacterized protein LOC102585619 [Solanum tuberosum]
Length=528

 Score =   127 bits (319),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 85/259 (33%), Positives = 129/259 (50%), Gaps = 15/259 (6%)
 Frame = -1

Query  1221  LKLLREMQRLAFISMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTG  1042
             + +L+  + L F   + L   + K+ SY  G     VGG+K +D +IP  +TLLL+G  G
Sbjct  79    MDVLKSYEELQF-HKDYLKEAKSKILSYTPGSWIEEVGGMKASDYNIPKKMTLLLIGPRG  137

Query  1041  SGKSSLVNFMYSVLGRSGLIP-FAQTSSQPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLD  865
             SGKS L+N +  V       P  AQ S       T  L E+ + +   + FC+YDTRGL 
Sbjct  138   SGKSCLINKISRVFDDDPFTPERAQVSYSSDGDGTYFLHEYTMPKG-SSSFCLYDTRGL-  195

Query  864   CHRMDEGMEDVWSWMSDGVRHNQPCCRGSDDDREMMEYSMAGRCANKYCKRR---VNCVL  694
                ++E  + V  WM+ GVRH +   R SDD      +  +    N+YC      VNCV+
Sbjct  196   SDDLNENKKIVDRWMTKGVRHGKLIMRDSDD-----AHPKSNVSRNRYCASETNVVNCVI  250

Query  693   VVADMEEAFKDFSSGD---LKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVET  523
              V    +  +   S D    +   A+   F+ P +   +EKP+++LTHGD+L+  +R   
Sbjct  251   FVVSAVQILQSMDSDDETKRQQTRAVATNFNYPLLSFKDEKPIVVLTHGDLLSLSDRTRI  310

Query  522   RLKLCESLGISETTGAYDI  466
             R+ L + LGI      +DI
Sbjct  311   RMHLGQLLGIHPKKQIFDI  329



>ref|XP_008458043.1| PREDICTED: uncharacterized protein LOC103497586 isoform X2 [Cucumis 
melo]
Length=470

 Score =   125 bits (313),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 89/272 (33%), Positives = 134/272 (49%), Gaps = 18/272 (7%)
 Frame = -1

Query  1140  YQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIP-FAQTS  964
             Y  G     VGG+K +D DIP  I+L+L+G  GSGKSSL+N +  V       P  AQ S
Sbjct  149   YSPGAWIEQVGGMKLSDYDIPQTISLILIGPKGSGKSSLINRISKVFEEDHFAPERAQVS  208

Query  963   SQPT-KFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSDGVRHNQPCC  787
                + +  T  L E+ +LR  K+ FC+YDTRGL     D  +E +  WMS GVRH +   
Sbjct  209   CNSSGEGGTFFLHEYMILRKSKS-FCLYDTRGLSDDPSD-NIETLKQWMSKGVRHGELVT  266

Query  786   RGSDDDREMMEYSMAGRCANKYCK--RRVNCVLVVADMEEAFKDFSSGDLK--HVEAIKM  619
             R SD    +       R +    +  R +N V+ V D     K     D +  +   I  
Sbjct  267   RKSDASNFINRMKCKARQSFPRSRVIRIINFVIFVVDGLSVLKSIDGDDKQKDYDRVITT  326

Query  618   IFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYDIACLSESGIP  439
              F+ P +   ++KP+++LTHGD+L+  +RV  R  L   LGI  T   +DI         
Sbjct  327   AFNCPYLSYGDDKPVVVLTHGDLLSFADRVRVRGHLGNLLGIPSTKQIFDI---------  377

Query  438   AEEGDPVSAFALTEAVYRSLLQSDRTHLPKRK  343
              +  DPV+   + + ++  L  +D+ +LP ++
Sbjct  378   PDRYDPVTELTIIDMLHYCLEHADK-NLPHKR  408



>ref|XP_008382590.1| PREDICTED: uncharacterized protein LOC103445369 isoform X1 [Malus 
domestica]
Length=655

 Score =   125 bits (315),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 98/297 (33%), Positives = 147/297 (49%), Gaps = 30/297 (10%)
 Frame = -1

Query  1185  ISMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYS  1006
             I  + L+  + K+ SY+ G     VG +K  + D+P + TLLLVG  GSGKSSLVN +  
Sbjct  86    IRSKDLEEAKSKILSYRPGAWIDRVGSVKPRNYDVPKMTTLLLVGPKGSGKSSLVNRISX  145

Query  1005  VLGRSGLIPFAQTSSQPTKFT-----TMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGM  841
             V        FA   +Q +  +     T  L  + + R   + FC+YDTR L  + + E M
Sbjct  146   VFEDDE---FACERAQVSYNSSVGDGTFFLHGYMIPRCS-SSFCLYDTRSLSDNSL-ENM  200

Query  840   EDVWSWMSDGVRHNQPCCRGSDDD--REMMEYSMAGRCANKYCK---RRVNCVLVVADME  676
               +  WM +GVRH +   R SD    R  M Y     C + Y     R VN V+ V +  
Sbjct  201   IILKHWMENGVRHGELVIRDSDSQSLRSTMMYKA---CDDGYLSSEIRNVNFVIFVVNGL  257

Query  675   EAFKDFSS---GDLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCE  505
                K   S    + ++ E I   F+S  +   ++KP+L++THGD+L+ +ER   R+ L E
Sbjct  258   SVLKSMESDEDAETRYTEMIASAFNSRYLAFKDDKPLLVVTHGDLLSLDERARVRVHLGE  317

Query  504   SLGISETTGAYDIACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKD  334
              LGI  TT  +D        IP E  DPV+   + + +  SL  +++  LP+R+  D
Sbjct  318   LLGIPPTTQIFD--------IPVESSDPVTELTIVDMIRYSLEHAEKN-LPRRRKVD  365



>ref|XP_007140679.1| hypothetical protein PHAVU_008G132700g [Phaseolus vulgaris]
 gb|ESW12673.1| hypothetical protein PHAVU_008G132700g [Phaseolus vulgaris]
Length=417

 Score =   122 bits (307),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 96/290 (33%), Positives = 143/290 (49%), Gaps = 28/290 (10%)
 Frame = -1

Query  1158  RHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIP  979
             + K+  Y+ G     VGG++ +D D+P    LL+VG +GSGKSSL+N +  VL      P
Sbjct  90    KQKILRYKPGAWIEKVGGLETSDHDVPNTTCLLMVGPSGSGKSSLINRISKVLDDDKFAP  149

Query  978   -FAQTSSQ-PTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCH-RMDEGMEDVWSWMSDGV  808
               AQ S    T+  T  L+E+ + R   N  C+YDTR L      DE +  +  WM  GV
Sbjct  150   PRAQESYNLHTENGTYFLQEYMMPRYS-NSICLYDTRSLSYKLDKDEDIRMLKGWMKKGV  208

Query  807   RHNQPCCRGSDDDREMMEYSMAGRCANKYC----KRRVNCVLVVAD---MEEAFKDFSSG  649
             RH +   R +D+ R  +  S+  +  NK       R+VN V+ V +   + +A K+  + 
Sbjct  209   RHGELVVRKTDNAR--LRKSLESKDHNKGYFSSETRKVNFVIYVVNGLLVLKAMKNAGAL  266

Query  648   DLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYD  469
             + ++VE I   F+ P +   ++KP+L+ THGD+L+  ER   R  L   LGI  T   +D
Sbjct  267   EKQYVETIVSTFNCPFLSFKDDKPVLVFTHGDLLSYTERAHVRGHLGRILGIPPTKQIFD  326

Query  468   IA---CLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKDWV  328
             I    C            P +A A+   +  SL  +DR  L K K  D V
Sbjct  327   IPDCDC------------PATASAIIGMLRYSLAHADRNFLQKCKVVDKV  364



>ref|XP_007049663.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Theobroma cacao]
 gb|EOX93820.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Theobroma cacao]
Length=450

 Score =   123 bits (308),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 93/299 (31%), Positives = 145/299 (48%), Gaps = 30/299 (10%)
 Frame = -1

Query  1170  LDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRS  991
             LD  + K+ SY  G  W+   G   +D D+P   TLLLVG  G GKSSL+N +  +    
Sbjct  97    LDEAKSKILSYVPG-AWIDNVG---SDYDVPKTTTLLLVGPKGCGKSSLINKISRIFEDD  152

Query  990   GLIP-FAQTSSQPTKFT-TMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMS  817
                   AQ S  P+    T  L+E+ + R     FC+YDTR L   +  E ++ +  WM+
Sbjct  153   KFASERAQVSYNPSVGDGTYFLQEYMIPRGS-TSFCLYDTRSLSDAK-SENIDMIKCWMT  210

Query  816   DGVRHNQPCCRGSDDDREMMEYSMAGRCANKYCK----RRVNCVLVVADMEEAFKDFSSG  649
              GVRH +   R SD  R  +   M  +     C+    R+VN V+ V       K     
Sbjct  211   KGVRHGELIIRESDGSR--LRSRMKCKTQEDNCQSTEMRKVNFVIFVVHGVSFLKSMEGD  268

Query  648   D---LKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTG  478
             D    ++++ I  +F+ P +   ++KP++++THGD+L+  +R+  R+ L E LGI     
Sbjct  269   DNEGKQYIQLITKVFNCPHLSFKDDKPVVVVTHGDLLSLSDRLRIRVHLGELLGIPPAKQ  328

Query  477   AYDIACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKDWVLAFASWVLC  301
              +DI          E  DP++   + E +  SL  +DR +LP+   K+WVL   +   C
Sbjct  329   IFDI---------PESCDPITELTIVEMLRYSLEHADR-NLPR---KNWVLDRGAQSFC  374



>ref|XP_007049662.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein, putative [Theobroma cacao]
 gb|EOX93819.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein, putative [Theobroma cacao]
Length=424

 Score =   122 bits (306),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 91/288 (32%), Positives = 138/288 (48%), Gaps = 22/288 (8%)
 Frame = -1

Query  1170  LDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRS  991
             L+ ++ K+ SY  G     VGG+K +D D+P    LLL+G  G GKSSLVN +  V    
Sbjct  101   LNEVKSKVLSYVPGAWIENVGGMKSSDYDVPKTTALLLIGPKGCGKSSLVNKISRVFEDD  160

Query  990   GLIPF-AQTS-SQPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMS  817
                P  AQ S +      T  L+E+ + R   + FC+YD+R L C+   + +  +  WM+
Sbjct  161   KFAPARAQVSFNLSVGDGTCYLQEYTIPRGSAS-FCLYDSRSL-CNDTSDNINMIKCWMT  218

Query  816   DGVRHNQPCCRGSDDD--REMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDFSS---  652
              GVRH +   R S     R  M+     R       R VN V+ V D     K       
Sbjct  219   KGVRHEELVVRKSHQSSLRRRMKCKTRERSWKSCETRTVNFVIFVVDGITVLKSMEGDGP  278

Query  651   GDLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAY  472
              + +++E I   F  P +   ++KP +++THGD+L+  +R   R+ L E LGI      +
Sbjct  279   DETQYMEMITRAFMCPYLSFKDDKPAVVITHGDLLSLADRARVRVHLGELLGIPPAKQIF  338

Query  471   DIACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKDWV  328
             DI          E  DP +A  + + +  SL  +DR +LP+   K+WV
Sbjct  339   DI---------PESDDPATALTIVDMLRYSLEHADR-NLPR---KNWV  373



>ref|XP_008235423.1| PREDICTED: uncharacterized protein LOC103334259 [Prunus mume]
Length=550

 Score =   124 bits (310),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 95/297 (32%), Positives = 145/297 (49%), Gaps = 34/297 (11%)
 Frame = -1

Query  1185  ISMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYS  1006
             I  +GL+  + K+ SY  G     VG +K  D D+P    +LLVG  GSGKSSLVN +  
Sbjct  92    IRSKGLEEAKIKVLSYTPGAWIESVGAVKLRDYDVPKTTNVLLVGPKGSGKSSLVNRISK  151

Query  1005  VLGRSGLIPFAQTSSQPTKFT-----TMLLEEHNVLRSKKNGFCVYDTRGL--DCHRMDE  847
             V        FA   +Q +  +     T  L+E+ + R   + FC+YDTR L  D H   E
Sbjct  152   VFEDDK---FASERAQVSYNSSVGDGTFFLQEYMIPRCSTS-FCLYDTRSLSDDSH---E  204

Query  846   GMEDVWSWMSDGVRHNQPCCRGSDDD--REMMEYSMAGRCANKYCK---RRVNCVLVVAD  682
              ++ +  WM +GVRH +   R SD    R MM   M     + Y     R+VN V+ V +
Sbjct  205   NIKILQHWMKNGVRHGELVIRDSDSQSLRTMM---MCKARDDGYLSSEIRKVNFVIFVVN  261

Query  681   MEEAFKDFSS---GDLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKL  511
                  K   S    + ++ + I   F+ P +   ++KP++++THGD+L+  +R   R+ L
Sbjct  262   GLSVLKSIESDEDAETRYTQMIASAFNCPYLAFKDDKPLVVVTHGDLLSPVQRAHVRVHL  321

Query  510   CESLGISETTGAYDIACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKF  340
              E LGI   T  +DI          E  DPV+  A+ + +  SL ++++    KRK 
Sbjct  322   GELLGIPPATQVFDI---------PESSDPVTELAIVDMLRYSLERAEKNLPHKRKV  369



>ref|XP_009348367.1| PREDICTED: uncharacterized protein LOC103940015 isoform X1 [Pyrus 
x bretschneideri]
Length=490

 Score =   122 bits (307),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 94/295 (32%), Positives = 139/295 (47%), Gaps = 27/295 (9%)
 Frame = -1

Query  1185  ISMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYS  1006
             I  + L+  + K+ SY  G     VG +K  D D+P   TLLLVG  GSGKSSLVN +  
Sbjct  89    IRSKDLEEAKSKILSYTPGAWIDRVGAVKPRDYDVPNTTTLLLVGPKGSGKSSLVNRISK  148

Query  1005  VLGRSGLIPFAQTSSQPTKFT-----TMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGM  841
             V        FA   +Q +  +     T  L E+ + R   N FC+YDTR L      E +
Sbjct  149   VFEDDK---FASERAQVSYNSSIGDGTFFLHEYMIPRCS-NSFCLYDTRSL-SDNSPENI  203

Query  840   EDVWSWMSDGVRHNQPCCRGSDDDREMMEYSMAGRCANKYC----KRRVNCVLVVADMEE  673
             + +  WM  GVRH +   R  D D   +  +M  +  +  C     + VN V+ V     
Sbjct  204   KILKHWMEHGVRHGELVVR--DSDSPSLRNTMMYKDRDDGCLFSEIKNVNFVIFVVSGLS  261

Query  672   AFKDFSS---GDLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCES  502
               K   S    + ++ E I   F S  +   ++KP+L++THGD+L+ +ER   R+ L E 
Sbjct  262   VLKSMESDEDAETQYTEMIASAFKSRYLAFKDDKPLLVVTHGDLLSLDERARVRVHLGEL  321

Query  501   LGISETTGAYDIACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFK  337
             LGI  TT  +D        IP E  D V+   + + +  SL  +++    KRK +
Sbjct  322   LGIPPTTQIFD--------IPVESSDAVTQLTIVDMIRYSLEHAEKNLPRKRKVE  368



>ref|XP_002531083.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF31297.1| ATP binding protein, putative [Ricinus communis]
Length=419

 Score =   122 bits (305),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 93/306 (30%), Positives = 138/306 (45%), Gaps = 17/306 (6%)
 Frame = -1

Query  1176  EGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLG  997
             E LD  + K+ SY  G     VGG+K +D ++P   TLLLVG  GSGKSSLVN +  V  
Sbjct  93    ESLDEAKSKILSYTPGGWKEKVGGMKLSDYNVPKTTTLLLVGPRGSGKSSLVNRISKVFD  152

Query  996   RSGLIP-FAQTSSQPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWM  820
                  P  AQ S  P+        +  ++      FC+YDTRG   +  D  +E +  WM
Sbjct  153   DDKFAPERAQVSYNPSAGEGTYFLQEYMIPGCSTSFCLYDTRGFFDNSYD-NIEMLKYWM  211

Query  819   SDGVRHNQPCCRGSDDD--REMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDFSSGD  646
             + GV H +   R  DD   R  M+  +    +     R VN V+ V +     K   S  
Sbjct  212   TRGVCHGELTVRKCDDSSLRTRMKCKVRYNGSQSKKNRTVNFVIFVVNGLAVLKSMGSEV  271

Query  645   LKHVEAIKMI---FHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGA  475
              K  +   MI   F+ P     ++KP++++THGD+L+  +R   R+ L E LGI      
Sbjct  272   EKGNQYTDMIASAFNCPYASFKDDKPVVVVTHGDLLSLSDRTRIRVHLGELLGIPPAKQI  331

Query  474   YDIACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKDWVLAFASWVLCCF  295
             +DI          E  DPV+   + + +  SL  +D  +LP+    + V      +  C 
Sbjct  332   FDI---------PESCDPVTELTIIDMLRYSLEHAD-NNLPQDTVAEKVHRVIGSLYACV  381

Query  294   SSFFAM  277
               F  +
Sbjct  382   HLFIML  387



>ref|NP_193039.3| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Arabidopsis thaliana]
 gb|AEE83219.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Arabidopsis thaliana]
Length=481

 Score =   122 bits (307),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 89/297 (30%), Positives = 142/297 (48%), Gaps = 20/297 (7%)
 Frame = -1

Query  1218  KLLREMQRLAFISMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGS  1039
             ++L+    L   S   L   R+++ SY  G  W     +K +D +IP   +++LVG  G+
Sbjct  62    EILQSHDLLLRTSKRKLRQARNEILSYTPGS-W---SDVKLSDYNIPKTTSIMLVGPKGA  117

Query  1038  GKSSLVNFMYSVLGRSG-LIPFAQTS-SQPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLD  865
             GKSSLVN +  V+     L+  AQ S   P+K  T  ++E+ + R     FC+YDTRGL 
Sbjct  118   GKSSLVNKITRVIEDDAFLLDRAQESFGTPSKGGTYFVQEYMISRGGSASFCLYDTRGLS  177

Query  864   CHRMDEGMEDVWSWMSDGVRHNQPCCRGSDDDREMMEYSMAGRCANKYCKRRVNCVLVVA  685
                  +    +  WM+ GV H +P    SD     ++  +       Y +R+VN ++ V 
Sbjct  178   RISSSDNTSMIEQWMTRGVLHGEPVIWASDSSD--LKDRLIRDGGTGYERRKVNSIIFVV  235

Query  684   DMEEAFKDFSSGDLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCE  505
             +  E  K     +  +   I   F+SP +   ++KP +++THGD+L+ EER   R+ L E
Sbjct  236   NAVEILKSMEC-ETSYASMITTAFNSPILLFKDDKPAVVMTHGDMLSREERARVRVFLGE  294

Query  504   SLGISETTGAYDIACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRT--HLPKRKF  340
              LGI      +DI          E  D  +A  +   +  SL  +D+    LPK+ F
Sbjct  295   LLGIPPHKQIFDI---------PESRDTATAITICNLLCYSLQHADKNFVFLPKKNF  342



>ref|NP_849371.2| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Arabidopsis thaliana]
 gb|AEE83220.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Arabidopsis thaliana]
Length=479

 Score =   122 bits (306),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 89/297 (30%), Positives = 142/297 (48%), Gaps = 20/297 (7%)
 Frame = -1

Query  1218  KLLREMQRLAFISMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGS  1039
             ++L+    L   S   L   R+++ SY  G  W     +K +D +IP   +++LVG  G+
Sbjct  60    EILQSHDLLLRTSKRKLRQARNEILSYTPGS-W---SDVKLSDYNIPKTTSIMLVGPKGA  115

Query  1038  GKSSLVNFMYSVLGRSG-LIPFAQTS-SQPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLD  865
             GKSSLVN +  V+     L+  AQ S   P+K  T  ++E+ + R     FC+YDTRGL 
Sbjct  116   GKSSLVNKITRVIEDDAFLLDRAQESFGTPSKGGTYFVQEYMISRGGSASFCLYDTRGLS  175

Query  864   CHRMDEGMEDVWSWMSDGVRHNQPCCRGSDDDREMMEYSMAGRCANKYCKRRVNCVLVVA  685
                  +    +  WM+ GV H +P    SD     ++  +       Y +R+VN ++ V 
Sbjct  176   RISSSDNTSMIEQWMTRGVLHGEPVIWASDSSD--LKDRLIRDGGTGYERRKVNSIIFVV  233

Query  684   DMEEAFKDFSSGDLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCE  505
             +  E  K     +  +   I   F+SP +   ++KP +++THGD+L+ EER   R+ L E
Sbjct  234   NAVEILKSMEC-ETSYASMITTAFNSPILLFKDDKPAVVMTHGDMLSREERARVRVFLGE  292

Query  504   SLGISETTGAYDIACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRT--HLPKRKF  340
              LGI      +DI          E  D  +A  +   +  SL  +D+    LPK+ F
Sbjct  293   LLGIPPHKQIFDI---------PESRDTATAITICNLLCYSLQHADKNFVFLPKKNF  340



>ref|XP_009372213.1| PREDICTED: uncharacterized protein LOC103961399 isoform X3 [Pyrus 
x bretschneideri]
Length=640

 Score =   123 bits (309),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 94/292 (32%), Positives = 140/292 (48%), Gaps = 30/292 (10%)
 Frame = -1

Query  1170  LDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRS  991
             L+  + K+ SY+ G     VG +K  + D+P   TLLLVG  GSGKSSLVN +  V    
Sbjct  91    LEEAKSKILSYRPGAWIDRVGSVKPRNYDVPKTTTLLLVGPKGSGKSSLVNRISKVFEDD  150

Query  990   GLIPFAQTSSQPTKFT-----TMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVW-  829
                 FA   +Q +  +     T  L  + + R   + FC+YDTR L     D  +E++  
Sbjct  151   E---FASERAQVSYNSSVGEGTFFLHGYMIPRCS-SSFCLYDTRSLS----DNSLENIII  202

Query  828   --SWMSDGVRHNQPCCRGSDDD--REMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKD  661
                WM +GVRH +   R SD    R  M Y            R VN V+ V +     K 
Sbjct  203   LKHWMENGVRHGELVTRDSDSQSLRNTMMYKARDDGYLSSEIRNVNFVIFVVNGLSVLKS  262

Query  660   FSS---GDLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGIS  490
                    + ++ E I   F+S  +   ++KP+L++THGD+L+ +ER   R+ L E LGI 
Sbjct  263   MEGDEDAETRYTEMITSAFNSGYLAFKDDKPLLVVTHGDLLSLDERARVRVHLGELLGIP  322

Query  489   ETTGAYDIACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKD  334
              TT  +D        IP E  DPV+   + + +  SL  +++  LP+R+  D
Sbjct  323   PTTQIFD--------IPVESSDPVTELTIVDMIRYSLEHAEKN-LPRRRKVD  365



>gb|KFK22499.1| hypothetical protein AALP_AAs67487U000400 [Arabis alpina]
Length=540

 Score =   122 bits (306),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 94/289 (33%), Positives = 139/289 (48%), Gaps = 28/289 (10%)
 Frame = -1

Query  1182  SMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSV  1003
             S   L L R ++ SY  G  W  V     +D D P + +++++G  G+GKSSLVN +  V
Sbjct  72    SKRKLKLARLQILSYTPGS-WADVN---LSDYDAPKMTSIIVLGPKGAGKSSLVNKITKV  127

Query  1002  LGRSGLIPF-AQTS-SQPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVW  829
             +      P  AQ S    T+  T  +EE+ + R     FC+YDTRGL+ +   +    + 
Sbjct  128   IEDDEFTPARAQESYGTQTQGGTFFVEEYMIPRGGSASFCLYDTRGLNQNSSSDNTSMIE  187

Query  828   SWMSDGVRHNQPCCRGSDD----DREMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKD  661
              W++ GV H +P    SD     DR + E S  GR       R+VN V+ V +  E  K 
Sbjct  188   QWITRGVCHGEPVIWNSDSSDLRDRLIRE-SGTGREF-----RKVNSVIFVVNAVEILKS  241

Query  660   FSSGDLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETT  481
               SG   +   I   F+ P +   ++KP +++THGDIL+ EER   R+ L E LGI    
Sbjct  242   MESG-TSYTRMISTAFNCPLLSFKDDKPAVVMTHGDILSQEERARVRVFLGELLGIPPEK  300

Query  480   GAYDIACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRT--HLPKRKF  340
               +DI          E  D  +A  + + +  SL  +D+    LPKR F
Sbjct  301   QIFDI---------PESRDAATALTICDLLCYSLEHADKNLHFLPKRNF  340



>ref|XP_010550900.1| PREDICTED: uncharacterized protein LOC104821658 isoform X1 [Tarenaya 
hassleriana]
Length=445

 Score =   121 bits (303),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 93/320 (29%), Positives = 148/320 (46%), Gaps = 33/320 (10%)
 Frame = -1

Query  1179  MEGLDLLRHKLTSYQAGDLWVPVGG-----IKKTDMDIPAVITLLLVGLTGSGKSSLVNF  1015
             +  L+  R KL SY  G  W   GG     +K  + D+P   +++LVGL GSGKSSL+N 
Sbjct  96    ISSLNASRLKLLSYSPG-AW---GGRRASEVKLKEYDVPETTSIILVGLKGSGKSSLINR  151

Query  1014  MYSVLGRSGLIPFAQTSSQPTKFT--TMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGM  841
             +  V+      P +   S  +  +  T  L+E+ + R+    F +YDTRGL C    + +
Sbjct  152   IIRVIEDDRFAPDSAQISNGSSSSEGTFFLQEYEIPRASPT-FSLYDTRGL-CQNSSDNI  209

Query  840   EDVWSWMSDGVRHNQPCCRGSD--DDREMMEYSMAGRCA-NKYCKRRVNCVLVVADMEEA  670
               +  W++ GVRH  P    SD  D ++M++    G        ++++N V+ V +  + 
Sbjct  210   STIKRWITQGVRHGNPVIWKSDCPDVKKMLKLKTHGLSGIGSKTRKKINFVIFVVNAVDV  269

Query  669   FKDFSSG---DLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESL  499
              K   S       H + I   F+ P +   ++KP +++THGDIL+ EER   R+ L + L
Sbjct  270   LKSMESSSPTQSSHAQMISTAFNCPFLSFKDDKPAVVMTHGDILSREERARARVFLGDLL  329

Query  498   GISETTGAYDIACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRT---HLP-KRKFKDW  331
             GI      +DI          E  D  +   + + +   L  +D+     LP K  F   
Sbjct  330   GIPADRQIFDI---------PESQDAATELTICDLLRHCLEHADKNLLQFLPSKNSFNFQ  380

Query  330   VLAFASWVLCCFSSFFAMLA  271
                   W +C  SSF  +LA
Sbjct  381   ENGVIQWTICT-SSFILLLA  399



>ref|XP_010550901.1| PREDICTED: uncharacterized protein LOC104821658 isoform X2 [Tarenaya 
hassleriana]
Length=428

 Score =   120 bits (302),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 93/320 (29%), Positives = 148/320 (46%), Gaps = 33/320 (10%)
 Frame = -1

Query  1179  MEGLDLLRHKLTSYQAGDLWVPVGG-----IKKTDMDIPAVITLLLVGLTGSGKSSLVNF  1015
             +  L+  R KL SY  G  W   GG     +K  + D+P   +++LVGL GSGKSSL+N 
Sbjct  79    ISSLNASRLKLLSYSPG-AW---GGRRASEVKLKEYDVPETTSIILVGLKGSGKSSLINR  134

Query  1014  MYSVLGRSGLIPFAQTSSQPTKFT--TMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGM  841
             +  V+      P +   S  +  +  T  L+E+ + R+    F +YDTRGL C    + +
Sbjct  135   IIRVIEDDRFAPDSAQISNGSSSSEGTFFLQEYEIPRASPT-FSLYDTRGL-CQNSSDNI  192

Query  840   EDVWSWMSDGVRHNQPCCRGSD--DDREMMEYSMAGRCA-NKYCKRRVNCVLVVADMEEA  670
               +  W++ GVRH  P    SD  D ++M++    G        ++++N V+ V +  + 
Sbjct  193   STIKRWITQGVRHGNPVIWKSDCPDVKKMLKLKTHGLSGIGSKTRKKINFVIFVVNAVDV  252

Query  669   FKDFSSG---DLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESL  499
              K   S       H + I   F+ P +   ++KP +++THGDIL+ EER   R+ L + L
Sbjct  253   LKSMESSSPTQSSHAQMISTAFNCPFLSFKDDKPAVVMTHGDILSREERARARVFLGDLL  312

Query  498   GISETTGAYDIACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRT---HLP-KRKFKDW  331
             GI      +DI          E  D  +   + + +   L  +D+     LP K  F   
Sbjct  313   GIPADRQIFDI---------PESQDAATELTICDLLRHCLEHADKNLLQFLPSKNSFNFQ  363

Query  330   VLAFASWVLCCFSSFFAMLA  271
                   W +C  SSF  +LA
Sbjct  364   ENGVIQWTICT-SSFILLLA  382



>ref|XP_007199783.1| hypothetical protein PRUPE_ppa003940mg [Prunus persica]
 gb|EMJ00982.1| hypothetical protein PRUPE_ppa003940mg [Prunus persica]
Length=539

 Score =   122 bits (305),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 92/292 (32%), Positives = 142/292 (49%), Gaps = 24/292 (8%)
 Frame = -1

Query  1185  ISMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYS  1006
             I  +GL+  + K+ SY  G     VG +K  D D+P   T+LLVG  GSGKSSLVN +  
Sbjct  92    IRGKGLEEAKIKVLSYTPGAWIESVGAVKLRDYDVPKTTTVLLVGPKGSGKSSLVNRISK  151

Query  1005  VL--GRSGLIPFAQTSSQPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDV  832
             V    +S       + +      T  L+E+ + R   + FC+YDTR L C    E ++ +
Sbjct  152   VFEDDKSASERAQVSYNSSVGDGTFFLQEYMIPRCSTS-FCLYDTRSL-CDDSHENIKIL  209

Query  831   WSWMSDGVRHNQPCCRGSDDD--REMMEYSMAGRCANKYCK---RRVNCVLVVADMEEAF  667
               WM +GVR  +   R SD    R MM   M     + Y     R+VN V+ V +     
Sbjct  210   QHWMKNGVRQGELVIRDSDSQSLRTMM---MCKARDDGYLSSEIRKVNFVIFVVNGLSVL  266

Query  666   KDFSS---GDLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLG  496
             K   S    + ++ + I   F+ P +   ++KP++++THGD+L+  +R   R+ L E LG
Sbjct  267   KAIESDEDAETRYTQMIASAFNCPYLAFKDDKPLVVVTHGDLLSPVQRARVRVHLGELLG  326

Query  495   ISETTGAYDIACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKF  340
             I   T  +DI          E  DPV+  A+ + +  SL ++++    KRK 
Sbjct  327   IPPATQVFDI---------PESSDPVTELAIVDMLRYSLERAEKNLPHKRKV  369



>ref|XP_010243477.1| PREDICTED: uncharacterized protein LOC104587528 [Nelumbo nucifera]
Length=323

 Score =   119 bits (297),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 98/286 (34%), Positives = 141/286 (49%), Gaps = 25/286 (9%)
 Frame = -1

Query  1152  KLTSYQAGDLWVP-VGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIPF  976
             +L  Y  G LW+  VGG+K +D ++P   TLLLVG  GSGKSSLVN +  V       P 
Sbjct  7     ELMLYTPG-LWIEEVGGMKISDYELPKTTTLLLVGPGGSGKSSLVNRISKVFENDKFAPL  65

Query  975   -AQTS-SQPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSDGVRH  802
              AQ S + P    T  L+E+ + R   + FC+YDTR L      E  E + + M+ GVRH
Sbjct  66    RAQISYNSPVGEGTYFLQEYMIPRGSTS-FCLYDTRSLS-ENSSENFEMIKNXMTKGVRH  123

Query  801   NQPCCRGSDDD---REMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDFSSGDLKHVE  631
              +   R  DD    + MM  +    C +    RRV+ V+ V +     +  S+G+    +
Sbjct  124   GELVTRCFDDSSVRKSMMCKAQQIGCYSSVV-RRVDFVIFVVNALSVLQ--STGNDHDHK  180

Query  630   AIKMI----FHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYDIA  463
             + K I    F  P +   ++KP++++THGD+LT  +R   R+KL E LGI      +DI 
Sbjct  181   SYKDILANSFSCPYLSFKDDKPVVVVTHGDLLTIYQRALVRIKLGELLGIPPDKQIFDI-  239

Query  462   CLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKDWVL  325
                         DP +  A+ E +  SL  +DR    KR   D VL
Sbjct  240   --------PGNCDPATELAIVEMLRYSLEHADRNLPCKRWVVDKVL  277



>ref|XP_008382591.1| PREDICTED: uncharacterized protein LOC103445369 isoform X2 [Malus 
domestica]
Length=654

 Score =   122 bits (306),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 97/297 (33%), Positives = 146/297 (49%), Gaps = 31/297 (10%)
 Frame = -1

Query  1185  ISMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYS  1006
             I  + L+  + K+ SY+ G     VG +K  + D+P + TLLLVG  GSGKSSLVN +  
Sbjct  86    IRSKDLEEAKSKILSYRPGAWIDRVGSVKPRNYDVPKMTTLLLVGPKGSGKSSLVNRISX  145

Query  1005  VLGRSGLIPFAQTSSQPTKFT-----TMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGM  841
             V        FA   +Q +  +     T  L  + + R   + FC+YDTR L  + + E M
Sbjct  146   VFEDDE---FACERAQVSYNSSVGDGTFFLHGYMIPRCS-SSFCLYDTRSLSDNSL-ENM  200

Query  840   EDVWSWMSDGVRHNQPCCRGSDDD--REMMEYSMAGRCANKYCK---RRVNCVLVVADME  676
               +  WM +GVRH +   R SD    R  M Y     C + Y     R VN V+ V +  
Sbjct  201   IILKHWMENGVRHGELVIRDSDSQSLRSTMMYKA---CDDGYLSSEIRNVNFVIFVVNGL  257

Query  675   EAFKDFSS---GDLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCE  505
                K   S    + ++ E I   F+S  +   ++KP+L++THGD+L+ +ER   R+ L E
Sbjct  258   SVLKSMESDEDAETRYTEMIASAFNSRYLAFKDDKPLLVVTHGDLLSLDERARVRVHLGE  317

Query  504   SLGISETTGAYDIACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKD  334
              LGI  TT  +DI          E  DPV+   + + +  SL  +++  LP+R+  D
Sbjct  318   LLGIPPTTQIFDI---------PESSDPVTELTIVDMIRYSLEHAEKN-LPRRRKVD  364



>ref|XP_010696232.1| PREDICTED: uncharacterized protein LOC104908778 [Beta vulgaris 
subsp. vulgaris]
Length=590

 Score =   122 bits (305),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 89/294 (30%), Positives = 139/294 (47%), Gaps = 19/294 (6%)
 Frame = -1

Query  1188  FISMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMY  1009
             ++  EGL   + K+  Y  G      GG K ++  IP   TLLL+G  GSGKSSLVN + 
Sbjct  97    WVRKEGLYQAKSKILRYSPGSWISNAGGKKLSNYVIPKTTTLLLIGPKGSGKSSLVNRIS  156

Query  1008  SVL--GRSGLIPFAQTSSQPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMED  835
              V    R        T +Q T   T  L+E+ + R     FC++DTR L    + +  E 
Sbjct  157   RVFEDDRYASERAQVTYNQSTGEGTYFLQEYMIPRG-STSFCLFDTRSL-SENVSDNDEM  214

Query  834   VWSWMSDGVRHNQPCCRGSDDDREMMEYSMAGRCANKYCK--RRVNCVLVVADMEEAFKD  661
             +  WM+ GVRH +   R SD     M      + +       R+VN V+ V +  +  + 
Sbjct  215   LQHWMTKGVRHGELIIRDSDAPSLKMSLKCKAQQSGSPSSVIRKVNFVIFVVNGFQVLRS  274

Query  660   FSSG---DLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGIS  490
              +S    D  +VE +  IF  P +   ++KP++ +THGD+L+  +R    + L E LGI 
Sbjct  275   INSDKKEDRAYVEMVAKIFSCPYMSYKDDKPVIAVTHGDLLSLGDRARVLVYLGEKLGIP  334

Query  489   ETTGAYDIACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKDWV  328
                  +DI          E  DP S  A+ + +  +L  +D+ ++P +  +DWV
Sbjct  335   PVKQIFDI---------PENSDPTSELAIVDMIRYALEHADK-YIPCKDSRDWV  378



>ref|XP_010926162.1| PREDICTED: uncharacterized protein LOC105048535 isoform X2 [Elaeis 
guineensis]
Length=403

 Score =   119 bits (299),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 90/282 (32%), Positives = 133/282 (47%), Gaps = 21/282 (7%)
 Frame = -1

Query  1173  GLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGR  994
              L   ++ +  ++ GD    VGG K +D DIP   TLLLVG  GSGKS+LVN +  V   
Sbjct  94    ALQAAKNIIARHRPGDWIEEVGGTKASDYDIPETTTLLLVGPRGSGKSTLVNRITRVFQD  153

Query  993   SGLIPFAQTSSQPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSD  814
                 PFA    Q ++  +  L+E+ + R+ K+  CVYDTR L     D   + +  WM  
Sbjct  154   D---PFAPDRGQVSQ-GSCFLQEYMIPRNSKS-LCVYDTRSLSTLSSDN-FKLLQHWMMQ  207

Query  813   GVRHNQPCCRGSDDDREMMEYSMAGRCAN-KYC---KRRVNCVLVVADMEEAFKDFSSGD  646
             GV H Q   R SDD   +    + G     ++C   KR VN V+ V D     K     D
Sbjct  208   GVSHRQMVIRDSDD--VVTRKRIKGTAQQGQFCPCQKRMVNFVIFVVDGISVLKSMDDKD  265

Query  645   LKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYDI  466
              ++ + +   F+ P +   + KP++++THGD L+  +R   R  L E LGI   T  +DI
Sbjct  266   TQYNDMLAETFNYPFLSFHDNKPVVVVTHGDELSVSDRAHIRTYLGELLGIPPLTQIFDI  325

Query  465   ACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKF  340
                +E           +  A+ + +  S+  SDR    K  F
Sbjct  326   PGRNEYD---------TELAIVDMLRYSIEHSDRNLPFKHNF  358



>gb|KHN43753.1| hypothetical protein glysoja_049903 [Glycine soja]
Length=429

 Score =   119 bits (299),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 91/281 (32%), Positives = 140/281 (50%), Gaps = 23/281 (8%)
 Frame = -1

Query  1158  RHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIP  979
             + K+  Y+ G      GG+K +D D+P    LLLVG  GSGKSSL+N +  V+      P
Sbjct  100   KQKILRYKPGAWIEKAGGLKISDYDVPKTTCLLLVGPRGSGKSSLINRISKVVEDDRFAP  159

Query  978   FAQTSSQPTKF--TTMLLEEHNVLRSKKNGFCVYDTRGL-DCHRMDEGMEDVWSWMSDGV  808
                  S  +     T  L+E+ + R   N  C+YDTR L D    DE +  + SWM+ GV
Sbjct  160   ARAQESYNSLLGDGTSFLQEYMIPRY-SNSICLYDTRSLSDNSEKDENIRMLKSWMTKGV  218

Query  807   RHNQPCCRGSDDDREMMEYSMAGRCANK-YCK---RRVNCVLVVAD---MEEAFKDFSSG  649
              H +   R +D+ R  +  S+ G+   K Y     R+VN V+ V +   + +A ++  + 
Sbjct  219   HHGELVVRKTDNQR--LRKSLKGKAHKKGYLSSKTRKVNFVIYVVNGLLVLKAMENDGAL  276

Query  648   DLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYD  469
             + + V++I   F+ P +   ++KP+L+ THGD+L+  ER   R  L   LGI  T   +D
Sbjct  277   ETQCVQSIVSTFNCPFLSFKDDKPVLVFTHGDLLSFSERALVREHLGTLLGIPPTKQIFD  336

Query  468   IACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKR  346
             I    +   PA E       A+   +  SL  +DR H P+R
Sbjct  337   IP---DCDCPATES------AIIRMLRYSLAHADR-HFPQR  367



>ref|XP_010069619.1| PREDICTED: uncharacterized protein LOC104456512 [Eucalyptus grandis]
 gb|KCW58028.1| hypothetical protein EUGRSUZ_H00756 [Eucalyptus grandis]
Length=430

 Score =   119 bits (299),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 94/302 (31%), Positives = 148/302 (49%), Gaps = 38/302 (13%)
 Frame = -1

Query  1185  ISMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYS  1006
             + +E L   + K+ SY  G     VGG +  D ++P   +L+L+G  GSGKSSLVN M  
Sbjct  94    VPIESLGRAKSKILSYHPGAWIEEVGGTRSFDYNVPQTTSLVLIGPRGSGKSSLVNRMSK  153

Query  1005  VLGRSGLIP-FAQTSSQPTKFT-TMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMED-  835
             +L         AQ S  P+    T  L+E+ + R   + FC+YDTR L    MD   ++ 
Sbjct  154   LLEDDNFASERAQVSYNPSVGDGTYFLQEYMIPRGSTS-FCLYDTRSLS---MDPSEDNK  209

Query  834   -VWSWMSDGVRHNQPCCRGSDD--DREMMEYSMAGRCANKY------CKRRVNCVLVVAD  682
              +  WM+ GVRH +   R SD+   R+ M      RC  ++        RRVN V+ V +
Sbjct  210   IIKRWMTKGVRHGELVIRESDNWSLRKRM------RCKARWGGHPFSVIRRVNFVIFVVN  263

Query  681   MEEAFKDFSS---GDLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKL  511
                  K   +   G  ++ + I   ++ P +   ++KP++++THGD+L+  ER   R+ L
Sbjct  264   GLTVLKSMDNNHDGQSQYTQLIADTYNCPYLSFKDDKPVVVVTHGDLLSNPERARVRVYL  323

Query  510   CESLGISETTGAYDIACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKDW  331
              E  GI  T   +DI          +  D ++ F + + +  SL  +DR +LP+   K W
Sbjct  324   GELCGIPPTKQIFDI---------PDNSDLLTQFTIVDMLRYSLEHADR-NLPR---KTW  370

Query  330   VL  325
             VL
Sbjct  371   VL  372



>ref|XP_006602478.1| PREDICTED: uncharacterized protein LOC100783278 isoform X4 [Glycine 
max]
Length=419

 Score =   119 bits (297),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 91/281 (32%), Positives = 140/281 (50%), Gaps = 23/281 (8%)
 Frame = -1

Query  1158  RHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIP  979
             + K+  Y+ G      GG+K +D D+P    LLLVG  GSGKSSL+N +  V+      P
Sbjct  90    KQKILRYKPGAWIEKAGGLKISDYDVPKTTCLLLVGPRGSGKSSLINRISKVVEDDRFAP  149

Query  978   FAQTSSQPTKF--TTMLLEEHNVLRSKKNGFCVYDTRGL-DCHRMDEGMEDVWSWMSDGV  808
                  S  +     T  L+E+ + R   N  C+YDTR L D    DE +  + SWM+ GV
Sbjct  150   ARAQESYNSLLGDGTSFLQEYMIPRY-SNSICLYDTRSLSDNSEKDENIRMLKSWMTKGV  208

Query  807   RHNQPCCRGSDDDREMMEYSMAGRCANK-YCK---RRVNCVLVVAD---MEEAFKDFSSG  649
              H +   R +D+ R  +  S+ G+   K Y     R+VN V+ V +   + +A ++  + 
Sbjct  209   HHGELVVRKTDNQR--LRKSLKGKAHKKGYLSSKTRKVNFVIYVVNGLLVLKAMENDGAL  266

Query  648   DLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYD  469
             + + V++I   F+ P +   ++KP+L+ THGD+L+  ER   R  L   LGI  T   +D
Sbjct  267   ETQCVQSIVSTFNCPFLSFKDDKPVLVFTHGDLLSFSERALVREHLGTLLGIPPTKQIFD  326

Query  468   IACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKR  346
             I    +   PA E       A+   +  SL  +DR H P+R
Sbjct  327   IP---DCDCPATES------AIIGMLRYSLAHADR-HFPQR  357



>ref|XP_006602477.1| PREDICTED: uncharacterized protein LOC100783278 isoform X3 [Glycine 
max]
Length=421

 Score =   119 bits (297),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 91/281 (32%), Positives = 140/281 (50%), Gaps = 23/281 (8%)
 Frame = -1

Query  1158  RHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIP  979
             + K+  Y+ G      GG+K +D D+P    LLLVG  GSGKSSL+N +  V+      P
Sbjct  92    KQKILRYKPGAWIEKAGGLKISDYDVPKTTCLLLVGPRGSGKSSLINRISKVVEDDRFAP  151

Query  978   FAQTSSQPTKF--TTMLLEEHNVLRSKKNGFCVYDTRGL-DCHRMDEGMEDVWSWMSDGV  808
                  S  +     T  L+E+ + R   N  C+YDTR L D    DE +  + SWM+ GV
Sbjct  152   ARAQESYNSLLGDGTSFLQEYMIPRY-SNSICLYDTRSLSDNSEKDENIRMLKSWMTKGV  210

Query  807   RHNQPCCRGSDDDREMMEYSMAGRCANK-YCK---RRVNCVLVVAD---MEEAFKDFSSG  649
              H +   R +D+ R  +  S+ G+   K Y     R+VN V+ V +   + +A ++  + 
Sbjct  211   HHGELVVRKTDNQR--LRKSLKGKAHKKGYLSSKTRKVNFVIYVVNGLLVLKAMENDGAL  268

Query  648   DLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYD  469
             + + V++I   F+ P +   ++KP+L+ THGD+L+  ER   R  L   LGI  T   +D
Sbjct  269   ETQCVQSIVSTFNCPFLSFKDDKPVLVFTHGDLLSFSERALVREHLGTLLGIPPTKQIFD  328

Query  468   IACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKR  346
             I    +   PA E       A+   +  SL  +DR H P+R
Sbjct  329   IP---DCDCPATES------AIIGMLRYSLAHADR-HFPQR  359



>ref|XP_006602476.1| PREDICTED: uncharacterized protein LOC100783278 isoform X2 [Glycine 
max]
Length=427

 Score =   119 bits (297),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 91/281 (32%), Positives = 140/281 (50%), Gaps = 23/281 (8%)
 Frame = -1

Query  1158  RHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIP  979
             + K+  Y+ G      GG+K +D D+P    LLLVG  GSGKSSL+N +  V+      P
Sbjct  98    KQKILRYKPGAWIEKAGGLKISDYDVPKTTCLLLVGPRGSGKSSLINRISKVVEDDRFAP  157

Query  978   FAQTSSQPTKF--TTMLLEEHNVLRSKKNGFCVYDTRGL-DCHRMDEGMEDVWSWMSDGV  808
                  S  +     T  L+E+ + R   N  C+YDTR L D    DE +  + SWM+ GV
Sbjct  158   ARAQESYNSLLGDGTSFLQEYMIPRY-SNSICLYDTRSLSDNSEKDENIRMLKSWMTKGV  216

Query  807   RHNQPCCRGSDDDREMMEYSMAGRCANK-YCK---RRVNCVLVVAD---MEEAFKDFSSG  649
              H +   R +D+ R  +  S+ G+   K Y     R+VN V+ V +   + +A ++  + 
Sbjct  217   HHGELVVRKTDNQR--LRKSLKGKAHKKGYLSSKTRKVNFVIYVVNGLLVLKAMENDGAL  274

Query  648   DLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYD  469
             + + V++I   F+ P +   ++KP+L+ THGD+L+  ER   R  L   LGI  T   +D
Sbjct  275   ETQCVQSIVSTFNCPFLSFKDDKPVLVFTHGDLLSFSERALVREHLGTLLGIPPTKQIFD  334

Query  468   IACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKR  346
             I    +   PA E       A+   +  SL  +DR H P+R
Sbjct  335   IP---DCDCPATES------AIIGMLRYSLAHADR-HFPQR  365



>ref|XP_003552104.1| PREDICTED: uncharacterized protein LOC100783278 isoform X1 [Glycine 
max]
Length=429

 Score =   119 bits (297),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 91/281 (32%), Positives = 140/281 (50%), Gaps = 23/281 (8%)
 Frame = -1

Query  1158  RHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIP  979
             + K+  Y+ G      GG+K +D D+P    LLLVG  GSGKSSL+N +  V+      P
Sbjct  100   KQKILRYKPGAWIEKAGGLKISDYDVPKTTCLLLVGPRGSGKSSLINRISKVVEDDRFAP  159

Query  978   FAQTSSQPTKF--TTMLLEEHNVLRSKKNGFCVYDTRGL-DCHRMDEGMEDVWSWMSDGV  808
                  S  +     T  L+E+ + R   N  C+YDTR L D    DE +  + SWM+ GV
Sbjct  160   ARAQESYNSLLGDGTSFLQEYMIPRY-SNSICLYDTRSLSDNSEKDENIRMLKSWMTKGV  218

Query  807   RHNQPCCRGSDDDREMMEYSMAGRCANK-YCK---RRVNCVLVVAD---MEEAFKDFSSG  649
              H +   R +D+ R  +  S+ G+   K Y     R+VN V+ V +   + +A ++  + 
Sbjct  219   HHGELVVRKTDNQR--LRKSLKGKAHKKGYLSSKTRKVNFVIYVVNGLLVLKAMENDGAL  276

Query  648   DLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYD  469
             + + V++I   F+ P +   ++KP+L+ THGD+L+  ER   R  L   LGI  T   +D
Sbjct  277   ETQCVQSIVSTFNCPFLSFKDDKPVLVFTHGDLLSFSERALVREHLGTLLGIPPTKQIFD  336

Query  468   IACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKR  346
             I    +   PA E       A+   +  SL  +DR H P+R
Sbjct  337   IP---DCDCPATES------AIIGMLRYSLAHADR-HFPQR  367



>ref|XP_008372522.1| PREDICTED: uncharacterized protein LOC103435872 isoform X1 [Malus 
domestica]
Length=530

 Score =   120 bits (300),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 94/293 (32%), Positives = 136/293 (46%), Gaps = 23/293 (8%)
 Frame = -1

Query  1185  ISMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYS  1006
             I  + L+  + K+ SY  G     VG +K  D D+P   TLLLVG  GSGKSSLVN +  
Sbjct  123   IRSKDLEEAKSKILSYTPGAWIDRVGAVKPRDYDVPNTTTLLLVGPKGSGKSSLVNRISK  182

Query  1005  VLGRSGLIPFAQTSSQPTKFT-----TMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGM  841
             V        FA   +Q +  +     T  L E+ + R   + FC+YDTR L      E +
Sbjct  183   VFEDDK---FASERAQVSYNSSLGDGTFFLHEYMMPRCS-SSFCLYDTRSL-SDNSPENI  237

Query  840   EDVWSWMSDGVRHNQPCCRGSDDD--REMMEYSMAGRCANKYCKRRVNCVLVVADMEEAF  667
             + +  WM  GVRH +   R SD    R  M Y            + VN V+ V +     
Sbjct  238   KILKHWMEHGVRHGELVVRDSDXPSLRNTMMYKDXDDGYLSSEIKNVNFVIFVVNGLSVL  297

Query  666   KDFSS---GDLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLG  496
             K   S    + ++ E I   F S  +   ++KP+L+ THGD+L+ +ER   R+ L E LG
Sbjct  298   KSMESNEDAETQYTEMIASAFKSRYLAFKDDKPLLVXTHGDLLSLDERAXVRVHLGELLG  357

Query  495   ISETTGAYDIACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFK  337
             I  TT  +D        IP E  D V+   + + +  SL  +++    KRK +
Sbjct  358   IPPTTQIFD--------IPXESSDAVTQLTIVDMIRYSLEHAEKNLPRKRKVE  402



>ref|XP_009348369.1| PREDICTED: uncharacterized protein LOC103940015 isoform X2 [Pyrus 
x bretschneideri]
Length=489

 Score =   119 bits (298),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 93/295 (32%), Positives = 138/295 (47%), Gaps = 28/295 (9%)
 Frame = -1

Query  1185  ISMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYS  1006
             I  + L+  + K+ SY  G     VG +K  D D+P   TLLLVG  GSGKSSLVN +  
Sbjct  89    IRSKDLEEAKSKILSYTPGAWIDRVGAVKPRDYDVPNTTTLLLVGPKGSGKSSLVNRISK  148

Query  1005  VLGRSGLIPFAQTSSQPTKFT-----TMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGM  841
             V        FA   +Q +  +     T  L E+ + R   N FC+YDTR L      E +
Sbjct  149   VFEDDK---FASERAQVSYNSSIGDGTFFLHEYMIPRCS-NSFCLYDTRSL-SDNSPENI  203

Query  840   EDVWSWMSDGVRHNQPCCRGSDDDREMMEYSMAGRCANKYC----KRRVNCVLVVADMEE  673
             + +  WM  GVRH +   R  D D   +  +M  +  +  C     + VN V+ V     
Sbjct  204   KILKHWMEHGVRHGELVVR--DSDSPSLRNTMMYKDRDDGCLFSEIKNVNFVIFVVSGLS  261

Query  672   AFKDFSS---GDLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCES  502
               K   S    + ++ E I   F S  +   ++KP+L++THGD+L+ +ER   R+ L E 
Sbjct  262   VLKSMESDEDAETQYTEMIASAFKSRYLAFKDDKPLLVVTHGDLLSLDERARVRVHLGEL  321

Query  501   LGISETTGAYDIACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFK  337
             LGI  TT  +DI          E  D V+   + + +  SL  +++    KRK +
Sbjct  322   LGIPPTTQIFDI---------PESSDAVTQLTIVDMIRYSLEHAEKNLPRKRKVE  367



>ref|XP_010926161.1| PREDICTED: uncharacterized protein LOC105048535 isoform X1 [Elaeis 
guineensis]
Length=409

 Score =   117 bits (294),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 90/287 (31%), Positives = 133/287 (46%), Gaps = 25/287 (9%)
 Frame = -1

Query  1173  GLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGR  994
              L   ++ +  ++ GD    VGG K +D DIP   TLLLVG  GSGKS+LVN +  V   
Sbjct  94    ALQAAKNIIARHRPGDWIEEVGGTKASDYDIPETTTLLLVGPRGSGKSTLVNRITRVFQD  153

Query  993   SGLIPFAQTSSQPTKFTTM-----LLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVW  829
                 PFA    Q +   ++      L+E+ + R+ K+  CVYDTR L     D   + + 
Sbjct  154   D---PFAPDRGQVSHNVSVTEGSCFLQEYMIPRNSKS-LCVYDTRSLSTLSSD-NFKLLQ  208

Query  828   SWMSDGVRHNQPCCRGSDDDREMMEYSMAGRCAN-KYC---KRRVNCVLVVADMEEAFKD  661
              WM  GV H Q   R SDD   +    + G     ++C   KR VN V+ V D     K 
Sbjct  209   HWMMQGVSHRQMVIRDSDD--VVTRKRIKGTAQQGQFCPCQKRMVNFVIFVVDGISVLKS  266

Query  660   FSSGDLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETT  481
                 D ++ + +   F+ P +   + KP++++THGD L+  +R   R  L E LGI   T
Sbjct  267   MDDKDTQYNDMLAETFNYPFLSFHDNKPVVVVTHGDELSVSDRAHIRTYLGELLGIPPLT  326

Query  480   GAYDIACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKF  340
               +DI   +E           +  A+ + +  S+  SDR    K  F
Sbjct  327   QIFDIPGRNEYD---------TELAIVDMLRYSIEHSDRNLPFKHNF  364



>ref|XP_009372214.1| PREDICTED: uncharacterized protein LOC103961399 isoform X4 [Pyrus 
x bretschneideri]
Length=639

 Score =   120 bits (300),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 93/292 (32%), Positives = 139/292 (48%), Gaps = 31/292 (11%)
 Frame = -1

Query  1170  LDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRS  991
             L+  + K+ SY+ G     VG +K  + D+P   TLLLVG  GSGKSSLVN +  V    
Sbjct  91    LEEAKSKILSYRPGAWIDRVGSVKPRNYDVPKTTTLLLVGPKGSGKSSLVNRISKVFEDD  150

Query  990   GLIPFAQTSSQPTKFT-----TMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVW-  829
                 FA   +Q +  +     T  L  + + R   + FC+YDTR L     D  +E++  
Sbjct  151   E---FASERAQVSYNSSVGEGTFFLHGYMIPRCS-SSFCLYDTRSLS----DNSLENIII  202

Query  828   --SWMSDGVRHNQPCCRGSDDD--REMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKD  661
                WM +GVRH +   R SD    R  M Y            R VN V+ V +     K 
Sbjct  203   LKHWMENGVRHGELVTRDSDSQSLRNTMMYKARDDGYLSSEIRNVNFVIFVVNGLSVLKS  262

Query  660   FSS---GDLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGIS  490
                    + ++ E I   F+S  +   ++KP+L++THGD+L+ +ER   R+ L E LGI 
Sbjct  263   MEGDEDAETRYTEMITSAFNSGYLAFKDDKPLLVVTHGDLLSLDERARVRVHLGELLGIP  322

Query  489   ETTGAYDIACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKD  334
              TT  +DI          E  DPV+   + + +  SL  +++  LP+R+  D
Sbjct  323   PTTQIFDI---------PESSDPVTELTIVDMIRYSLEHAEKN-LPRRRKVD  364



>ref|XP_008458044.1| PREDICTED: uncharacterized protein LOC103497586 isoform X3 [Cucumis 
melo]
Length=467

 Score =   118 bits (295),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 91/315 (29%), Positives = 137/315 (43%), Gaps = 49/315 (16%)
 Frame = -1

Query  1176  EGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLG  997
             E L   + K  SY  G     VGG+K +D DIP  I+L+L+G  GSGKSSL+N +  V  
Sbjct  103   ENLKQAKQKNLSYSPGAWIEQVGGMKLSDYDIPQTISLILIGPKGSGKSSLINRISKVFE  162

Query  996   RSGLIP---------------------------------FAQTSSQPTKFTTMLLEEHNV  916
                  P                                 F    +   +  T  L E+ +
Sbjct  163   EDHFAPERAQVSCISLNTFEVFFLYENSSHLFELKICNIFWAIGNSSGEGGTFFLHEYMI  222

Query  915   LRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSDGVRHNQPCCRGSDDDREMMEYSMAGR  736
             LR  K+ FC+YDTRGL     D  +E +  WMS GVRH +   R SD    +       R
Sbjct  223   LRKSKS-FCLYDTRGLSDDPSD-NIETLKQWMSKGVRHGELVTRKSDASNFINRMKCKAR  280

Query  735   CANKYCK--RRVNCVLVVADMEEAFKDFSSGDLK--HVEAIKMIFHSPSIRRSNEKPMLI  568
              +    +  R +N V+ V D     K     D +  +   I   F+ P +   ++KP+++
Sbjct  281   QSFPRSRVIRIINFVIFVVDGLSVLKSIDGDDKQKDYDRVITTAFNCPYLSYGDDKPVVV  340

Query  567   LTHGDILTAEERVETRLKLCESLGISETTGAYDIACLSESGIPAEEGDPVSAFALTEAVY  388
             LTHGD+L+  +RV  R  L   LGI  T   +DI          +  DPV+   + + ++
Sbjct  341   LTHGDLLSFADRVRVRGHLGNLLGIPSTKQIFDI---------PDRYDPVTELTIIDMLH  391

Query  387   RSLLQSDRTHLPKRK  343
               L  +D+ +LP ++
Sbjct  392   YCLEHADK-NLPHKR  405



>ref|XP_010100781.1| Serine/threonine-protein kinase MHK [Morus notabilis]
 gb|EXB84479.1| Serine/threonine-protein kinase MHK [Morus notabilis]
Length=958

 Score =   120 bits (301),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 97/326 (30%), Positives = 151/326 (46%), Gaps = 36/326 (11%)
 Frame = -1

Query  1281  EFDENGRFKEDISSGGLSPRLKLLREMQRLAFISMEGLDLLRHKLTSYQAGDLWVPVGGI  1102
             EF+ N R ++ +         ++LR    L  I    L+    K+ SY  G     VGG+
Sbjct  589   EFETNQRRRDRVYR-------EILRSFDELR-IRSRRLEEANSKILSYTPGAWIEKVGGM  640

Query  1101  KKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIPFAQTSSQPTKFT-----TM  937
             K +D D+P   +LLL+G  GSGKSSLVN +  V        FA   +Q T  +     T 
Sbjct  641   KLSDYDVPKTTSLLLIGPKGSGKSSLVNRISRVFENDK---FASERAQVTYNSSLGDGTF  697

Query  936   LLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSDGVRHNQPCCRGSDDDREMM  757
              L+E+ + R     FC+YDTR L     D+ ++ +  WM+ GVRH +   R  D D   +
Sbjct  698   FLQEYMIPRG-STSFCLYDTRSL-SEDSDDNIKMLKHWMTRGVRHGELVER--DSDGVSL  753

Query  756   EYSMAGRCANKYCK----RRVNCVLVVADMEEAFKDFSS---GDLKHVEAIKMIFHSPSI  598
                M  +     C     R+V+ V+ V +     K   +    D ++ + I   F+ P +
Sbjct  754   RTRMKCKALKNGCVSSEIRKVHFVIFVVNGVTVLKSMDNDKDADGQYTKLIASAFNCPYV  813

Query  597   RRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYDIACLSESGIPAEEGDPV  418
                ++KP++++THGD L+  +R   R+ L E LGI  T   +DI          E  DP 
Sbjct  814   SFRDDKPIIVVTHGDQLSCSDRARIRIHLGEQLGIPPTKQIFDI---------PEILDPE  864

Query  417   SAFALTEAVYRSLLQSDRTHLPKRKF  340
             +   + + +  SL  +D+   PKR F
Sbjct  865   TELTIVDMLRYSLEHADKNLPPKRLF  890



>ref|XP_002863279.1| hypothetical protein ARALYDRAFT_497092 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39538.1| hypothetical protein ARALYDRAFT_497092 [Arabidopsis lyrata subsp. 
lyrata]
Length=479

 Score =   118 bits (295),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 92/325 (28%), Positives = 148/325 (46%), Gaps = 34/325 (10%)
 Frame = -1

Query  1260  FKEDISS---GGLSPRLKLLREMQRLAFISMEGLDLL-----------RHKLTSYQAGDL  1123
             FK+D+S       S  +  LR  ++     ++  D+L           R+++  Y  G  
Sbjct  33    FKDDVSEDNFANFSNHVTDLRRREKSYQEILQSYDVLLRSSKRKLRQARNEILRYTPGS-  91

Query  1122  WVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIPF-AQTS-SQPTK  949
             W     +K +D D+P   +++LVG  G+GKSSLVN +  V+      P  AQ S    +K
Sbjct  92    W---SDVKLSDYDVPKTTSIMLVGPKGAGKSSLVNKISRVIEDDEFFPARAQESFGTQSK  148

Query  948   FTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSDGVRHNQPCCRGSDDD  769
               T  ++E+ + R     FC+YDTRGL      +    +  WM+ GV H +P    SD  
Sbjct  149   GGTFFVQEYMIPRGGSASFCLYDTRGLSHISSSDNTRMIEQWMTKGVHHGEPVIWTSDSS  208

Query  768   REMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDFSSGDLKHVEAIKMIFHSPSIRRS  589
                ++  +       Y +R+VN V+ V +  E  K     +  +   I   F+ P +   
Sbjct  209   D--LKDRLIRDGGTGYERRKVNSVIFVINAVEILKSMEC-ETSYAHMISTAFNCPLLSFK  265

Query  588   NEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYDIACLSESGIPAEEGDPVSAF  409
             ++KP +++THGD+L+ E+R   R+ L E LGI      +DI          E  D  +A 
Sbjct  266   DDKPAVVMTHGDMLSLEDRARVRVFLGELLGIPPAKQIFDI---------PESRDIATAL  316

Query  408   ALTEAVYRSLLQSDRT--HLPKRKF  340
              +   +  SL  +D+    LPKR F
Sbjct  317   TICNLLCYSLDHADKNFVFLPKRNF  341



>ref|XP_009610772.1| PREDICTED: uncharacterized protein LOC104104405 isoform X1 [Nicotiana 
tomentosiformis]
Length=402

 Score =   117 bits (292),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 80/244 (33%), Positives = 120/244 (49%), Gaps = 8/244 (3%)
 Frame = -1

Query  1158  RHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIP  979
             + K+  Y  G     VGG+KK+D +IP   TLLL+G   SGKSSLVN +  VL      P
Sbjct  102   KSKILRYTPGSWIEEVGGMKKSDYNIPKKTTLLLIGPKASGKSSLVNKISMVLEDDPFTP  161

Query  978   -FAQTSSQPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSDGVRH  802
               A  S       T  L+E+ + R   + FC+YDTR L    + E  + V  WM+ GVRH
Sbjct  162   ERAPVSYSSVGDGTYFLQEYTIPRG-SSSFCLYDTRSL-SDDLTENKKMVKQWMTKGVRH  219

Query  801   NQPCCRGSDDDREMMEYSMAGRCANKYC--KRRVNCVLVVADMEEAFKDFSSGD---LKH  637
              +   R SDD     +     R  + Y    + VN V++V +     +     D    + 
Sbjct  220   GELIKRDSDDVHLKSKMKSKARRNSLYVIEAKMVNFVILVVNAVSILELMDGDDETKRQK  279

Query  636   VEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYDIACL  457
              +A+   F+ P +   ++KP+++LTHGD+L+  +R   R+ L + LGI      +DI   
Sbjct  280   TQAVATTFNDPLLSFEDDKPVVVLTHGDLLSLSDRTRIRMHLGQLLGIHPKKQIFDIPES  339

Query  456   SESG  445
              +SG
Sbjct  340   DDSG  343



>ref|XP_008780970.1| PREDICTED: uncharacterized protein LOC103700848 isoform X3 [Phoenix 
dactylifera]
Length=384

 Score =   116 bits (291),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 81/222 (36%), Positives = 107/222 (48%), Gaps = 7/222 (3%)
 Frame = -1

Query  1113  VGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIPFAQTSSQPTKFTTML  934
             VGG K  D DIP  +TLLLVG  GSGKS+LVN +  V       P     SQ + F    
Sbjct  96    VGGTKARDYDIPETMTLLLVGPRGSGKSTLVNRITRVFQDDQFAPDRAQVSQGSCF----  151

Query  933   LEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSDGVRHNQPCCRGSDDDREMME  754
             L+E+ + R  K   CVYDTR L     D   + +  WM  GV H Q   R SDD      
Sbjct  152   LQEYMIPRDSKK-LCVYDTRSLSTFSSD-NFKLLQDWMMHGVTHRQMVIRDSDDVITTNR  209

Query  753   YSMAGRCANKYCKRR-VNCVLVVADMEEAFKDFSSGDLKHVEAIKMIFHSPSIRRSNEKP  577
                  R     C++R VN V+ V D     K   S D ++ + +   F+ P +   + KP
Sbjct  210   IKDMAREGFGPCQKRMVNFVIFVVDGISVLKSIDSMDTRYNDMLAETFNYPFLSFRDNKP  269

Query  576   MLILTHGDILTAEERVETRLKLCESLGISETTGAYDIACLSE  451
             ++++THGD L+  ER   R  L E LGI   T  +DI   +E
Sbjct  270   VVVVTHGDELSLFERAHIRTYLGELLGIPPLTQIFDIPGTNE  311



>ref|XP_009610773.1| PREDICTED: uncharacterized protein LOC104104405 isoform X2 [Nicotiana 
tomentosiformis]
Length=398

 Score =   116 bits (291),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 80/244 (33%), Positives = 120/244 (49%), Gaps = 8/244 (3%)
 Frame = -1

Query  1158  RHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIP  979
             + K+  Y  G     VGG+KK+D +IP   TLLL+G   SGKSSLVN +  VL      P
Sbjct  102   KSKILRYTPGSWIEEVGGMKKSDYNIPKKTTLLLIGPKASGKSSLVNKISMVLEDDPFTP  161

Query  978   -FAQTSSQPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSDGVRH  802
               A  S       T  L+E+ + R   + FC+YDTR L    + E  + V  WM+ GVRH
Sbjct  162   ERAPVSYSSVGDGTYFLQEYTIPRG-SSSFCLYDTRSL-SDDLTENKKMVKQWMTKGVRH  219

Query  801   NQPCCRGSDDDREMMEYSMAGRCANKYC--KRRVNCVLVVADMEEAFKDFSSGD---LKH  637
              +   R SDD     +     R  + Y    + VN V++V +     +     D    + 
Sbjct  220   GELIKRDSDDVHLKSKMKSKARRNSLYVIEAKMVNFVILVVNAVSILELMDGDDETKRQK  279

Query  636   VEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYDIACL  457
              +A+   F+ P +   ++KP+++LTHGD+L+  +R   R+ L + LGI      +DI   
Sbjct  280   TQAVATTFNDPLLSFEDDKPVVVLTHGDLLSLSDRTRIRMHLGQLLGIHPKKQIFDIPES  339

Query  456   SESG  445
              +SG
Sbjct  340   DDSG  343



>ref|XP_011024603.1| PREDICTED: uncharacterized protein LOC105125731 isoform X2 [Populus 
euphratica]
Length=541

 Score =   118 bits (296),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 85/282 (30%), Positives = 136/282 (48%), Gaps = 25/282 (9%)
 Frame = -1

Query  1158  RHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIP  979
             + K+ SY  G     V G+K +D D+P    LL++G  GSGKSSL+N +  V        
Sbjct  103   KSKILSYTPGGWMENVIGMKLSDFDVPNTTVLLVIGPKGSGKSSLINRISKVFEDDK---  159

Query  978   FAQTSSQPTKFT-----TMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSD  814
             FA   +Q +  +     T  L+E+ + R     FC+YDTRGL     D   + + +W++ 
Sbjct  160   FASERAQVSYNSSAADGTYFLQEYMIPRGS-TSFCLYDTRGLSYDSYDSA-KMLKNWITK  217

Query  813   GVRHNQPCCRGSDDD--REMMEYSMAGRCANKYCKRRVNCVLVVAD---MEEAFKDFSSG  649
             GV H +   R SD+   R  M     G        R VN V+ V D   + ++  +   G
Sbjct  218   GVHHRELIIRPSDNSHLRNKMNCKARGNGCQSKETRMVNFVIFVVDGLAVLKSMDNLVDG  277

Query  648   DLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYD  469
               K+ + I   F  P I  +++KP++++THGD+L+  +R   R+ L E LGI      +D
Sbjct  278   GKKYTQMIAKTFDCPYISFNDDKPVVVVTHGDLLSLNDRARVRVHLGELLGIPPAKQIFD  337

Query  468   IACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRK  343
             I          E  DPV+   +   ++ SL  +D+ +LP ++
Sbjct  338   I---------PESHDPVTELTIVNMLHYSLEHADK-NLPHQR  369



>ref|XP_008780962.1| PREDICTED: uncharacterized protein LOC103700848 isoform X2 [Phoenix 
dactylifera]
Length=387

 Score =   116 bits (290),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 80/224 (36%), Positives = 106/224 (47%), Gaps = 5/224 (2%)
 Frame = -1

Query  1113  VGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIPFAQTSSQPTKFT--T  940
             VGG K  D DIP  +TLLLVG  GSGKS+LVN +  V       P     S     T  +
Sbjct  93    VGGTKARDYDIPETMTLLLVGPRGSGKSTLVNRITRVFQDDQFAPDRAQVSHNVSVTEGS  152

Query  939   MLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSDGVRHNQPCCRGSDDDREM  760
               L+E+ + R  K   CVYDTR L     D   + +  WM  GV H Q   R SDD    
Sbjct  153   CFLQEYMIPRDSKK-LCVYDTRSLSTFSSD-NFKLLQDWMMHGVTHRQMVIRDSDDVITT  210

Query  759   MEYSMAGRCANKYCKRR-VNCVLVVADMEEAFKDFSSGDLKHVEAIKMIFHSPSIRRSNE  583
                    R     C++R VN V+ V D     K   S D ++ + +   F+ P +   + 
Sbjct  211   NRIKDMAREGFGPCQKRMVNFVIFVVDGISVLKSIDSMDTRYNDMLAETFNYPFLSFRDN  270

Query  582   KPMLILTHGDILTAEERVETRLKLCESLGISETTGAYDIACLSE  451
             KP++++THGD L+  ER   R  L E LGI   T  +DI   +E
Sbjct  271   KPVVVVTHGDELSLFERAHIRTYLGELLGIPPLTQIFDIPGTNE  314



>ref|XP_009787336.1| PREDICTED: uncharacterized protein LOC104235302 isoform X2 [Nicotiana 
sylvestris]
Length=450

 Score =   116 bits (290),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 81/246 (33%), Positives = 122/246 (50%), Gaps = 10/246 (4%)
 Frame = -1

Query  1161  LRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLI  982
             ++ K+ SY  G     +GG+KK D +IP  +TLLL+G   SGKSSLVN +  VL      
Sbjct  101   VKSKILSYTPGSWIEELGGMKKGDYNIPKKMTLLLIGPKASGKSSLVNKISMVLEDDPFT  160

Query  981   P-FAQTSSQPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSDGVR  805
             P  A  S       T  L+E+ + R   + FC+YDTR L    + E  + V  WM+ GVR
Sbjct  161   PDRAPVSYSSVGDGTFFLQEYMIPRG-SSSFCLYDTRSL-SDDLAENKKMVKQWMTKGVR  218

Query  804   HNQPCCRGSDDDREMMEYSMAGRCANKYC---KRRVNCVLVVADMEEAFKDFSSGD---L  643
             H +   R SDD     +     R  N +C    + VN V+ V       +   S D    
Sbjct  219   HGELIKRDSDDVHLKSKMKSKAR-RNSFCAIEAKVVNYVIFVVSAVSILELMDSDDEIKR  277

Query  642   KHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYDIA  463
             +  +A+   F+ P +   ++KP+++LTHGD+L+  +R   R+ L + LGI      +DI 
Sbjct  278   RKTQAVATTFNDPLLSFEDDKPVVVLTHGDLLSLSDRTRIRMHLGQLLGIHPKKQIFDIP  337

Query  462   CLSESG  445
                ++G
Sbjct  338   ESDDAG  343



>ref|XP_011024602.1| PREDICTED: uncharacterized protein LOC105125731 isoform X1 [Populus 
euphratica]
Length=609

 Score =   118 bits (295),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 85/282 (30%), Positives = 136/282 (48%), Gaps = 25/282 (9%)
 Frame = -1

Query  1158  RHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIP  979
             + K+ SY  G     V G+K +D D+P    LL++G  GSGKSSL+N +  V        
Sbjct  103   KSKILSYTPGGWMENVIGMKLSDFDVPNTTVLLVIGPKGSGKSSLINRISKVFEDDK---  159

Query  978   FAQTSSQPTKFT-----TMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSD  814
             FA   +Q +  +     T  L+E+ + R     FC+YDTRGL     D   + + +W++ 
Sbjct  160   FASERAQVSYNSSAADGTYFLQEYMIPRGS-TSFCLYDTRGLSYDSYDSA-KMLKNWITK  217

Query  813   GVRHNQPCCRGSDDD--REMMEYSMAGRCANKYCKRRVNCVLVVAD---MEEAFKDFSSG  649
             GV H +   R SD+   R  M     G        R VN V+ V D   + ++  +   G
Sbjct  218   GVHHRELIIRPSDNSHLRNKMNCKARGNGCQSKETRMVNFVIFVVDGLAVLKSMDNLVDG  277

Query  648   DLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYD  469
               K+ + I   F  P I  +++KP++++THGD+L+  +R   R+ L E LGI      +D
Sbjct  278   GKKYTQMIAKTFDCPYISFNDDKPVVVVTHGDLLSLNDRARVRVHLGELLGIPPAKQIFD  337

Query  468   IACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRK  343
             I          E  DPV+   +   ++ SL  +D+ +LP ++
Sbjct  338   I---------PESHDPVTELTIVNMLHYSLEHADK-NLPHQR  369



>ref|XP_008780954.1| PREDICTED: uncharacterized protein LOC103700848 isoform X1 [Phoenix 
dactylifera]
Length=390

 Score =   115 bits (288),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 80/224 (36%), Positives = 106/224 (47%), Gaps = 5/224 (2%)
 Frame = -1

Query  1113  VGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIPFAQTSSQPTKFT--T  940
             VGG K  D DIP  +TLLLVG  GSGKS+LVN +  V       P     S     T  +
Sbjct  96    VGGTKARDYDIPETMTLLLVGPRGSGKSTLVNRITRVFQDDQFAPDRAQVSHNVSVTEGS  155

Query  939   MLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSDGVRHNQPCCRGSDDDREM  760
               L+E+ + R  K   CVYDTR L     D   + +  WM  GV H Q   R SDD    
Sbjct  156   CFLQEYMIPRDSKK-LCVYDTRSLSTFSSD-NFKLLQDWMMHGVTHRQMVIRDSDDVITT  213

Query  759   MEYSMAGRCANKYCKRR-VNCVLVVADMEEAFKDFSSGDLKHVEAIKMIFHSPSIRRSNE  583
                    R     C++R VN V+ V D     K   S D ++ + +   F+ P +   + 
Sbjct  214   NRIKDMAREGFGPCQKRMVNFVIFVVDGISVLKSIDSMDTRYNDMLAETFNYPFLSFRDN  273

Query  582   KPMLILTHGDILTAEERVETRLKLCESLGISETTGAYDIACLSE  451
             KP++++THGD L+  ER   R  L E LGI   T  +DI   +E
Sbjct  274   KPVVVVTHGDELSLFERAHIRTYLGELLGIPPLTQIFDIPGTNE  317



>gb|AES79089.2| ATP-binding protein, putative [Medicago truncatula]
Length=474

 Score =   116 bits (290),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 83/250 (33%), Positives = 124/250 (50%), Gaps = 14/250 (6%)
 Frame = -1

Query  1185  ISMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYS  1006
             I  + L   + K+ SY+ G       G+K  D D+P    LLLVG +GSGKSSL+N +  
Sbjct  93    IDSKNLKEAKEKILSYRPGTWTEKAKGLKLCDYDVPETTCLLLVGPSGSGKSSLINRISK  152

Query  1005  VLGRSGLIPF-AQTSSQPTKFT-TMLLEEHNVLRSKKNGFCVYDTRGL--DCHRMDEGME  838
             V       P  AQ S    +   T  L E+ + R   N  C+YDTR L  D H  ++ ++
Sbjct  153   VFDEDKFAPARAQVSYNSIRGNGTCFLREYMIPRDS-NSICLYDTRSLSDDSHENNKMLK  211

Query  837   DVWSWMSDGVRHNQPCCRGSDDDREMMEYSMAGRCANKYCK--RRVNCVLVVADMEEAFK  664
             +   WM+ GVRH +   RG DD R      + G     +    R+VN V+ V +      
Sbjct  212   N---WMTKGVRHGELVARGMDDKRLSKNLKLKGDKKGFFSSKSRKVNYVICVLNGLSVLN  268

Query  663   --DFSSGDLK--HVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLG  496
               + + G L+  +++ I   F+ P +   ++KP+L+LTHGD+L+  +R   R  L E LG
Sbjct  269   VIENAGGALEEWYIQQIVSTFNCPFLSFKDDKPVLVLTHGDLLSLSDRARVRAYLGELLG  328

Query  495   ISETTGAYDI  466
             I  T   +DI
Sbjct  329   IPPTKQIFDI  338



>gb|AFK38535.1| unknown [Medicago truncatula]
Length=474

 Score =   116 bits (290),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 83/250 (33%), Positives = 124/250 (50%), Gaps = 14/250 (6%)
 Frame = -1

Query  1185  ISMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYS  1006
             I  + L   + K+ SY+ G       G+K  D D+P    LLLVG +GSGKSSL+N +  
Sbjct  93    IDSKNLKEAKEKILSYRPGTWTEKAKGLKLCDYDVPETTCLLLVGPSGSGKSSLINRISK  152

Query  1005  VLGRSGLIPF-AQTSSQPTKFT-TMLLEEHNVLRSKKNGFCVYDTRGL--DCHRMDEGME  838
             V       P  AQ S    +   T  L E+ + R   N  C+YDTR L  D H  ++ ++
Sbjct  153   VFDEDKFAPARAQVSYNSIRGNGTCFLREYMIPRDS-NSICLYDTRSLSDDSHENNKMLK  211

Query  837   DVWSWMSDGVRHNQPCCRGSDDDREMMEYSMAGRCANKYCK--RRVNCVLVVADMEEAFK  664
             +   WM+ GVRH +   RG DD R      + G     +    R+VN V+ V +      
Sbjct  212   N---WMTKGVRHGELVARGMDDKRLSKNLKLKGDKKGFFSSKSRKVNYVICVLNGLSVLN  268

Query  663   --DFSSGDLK--HVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLG  496
               + + G L+  +++ I   F+ P +   ++KP+L+LTHGD+L+  +R   R  L E LG
Sbjct  269   VIENAGGALEEWYIQQIVSTFNCPFLSFKDDKPVLVLTHGDLLSLSDRARVRAYLGELLG  328

Query  495   ISETTGAYDI  466
             I  T   +DI
Sbjct  329   IPPTKQIFDI  338



>ref|XP_010450267.1| PREDICTED: uncharacterized protein LOC104732423 isoform X2 [Camelina 
sativa]
Length=465

 Score =   116 bits (290),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 90/282 (32%), Positives = 132/282 (47%), Gaps = 29/282 (10%)
 Frame = -1

Query  1158  RHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIP  979
             R+ + SY  G  W      K +D D+    +++LVG  G+GKSSLVN +  V+      P
Sbjct  73    RNDILSYTPGS-W---SDGKVSDYDVQKTTSIILVGPKGAGKSSLVNRITRVIEDDEFSP  128

Query  978   -FAQTS-SQPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLD-CHRMDEGMEDVWSWMSDGV  808
               AQ S  + +K  T  LEE+ + R     FC+YDTRGL       +    +  WM+ GV
Sbjct  129   DRAQESFGKQSKGGTYFLEEYEMPRGGSASFCLYDTRGLSHISSSSDNTSMIEQWMTRGV  188

Query  807   RHNQPCCRGSDD----DREMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDFSSGDLK  640
              H +P    SD     DR + +             R+VN V+ V D  E  K   S +  
Sbjct  189   HHGEPVIWASDSSDLKDRLIRDSGTGSEI------RKVNSVIFVVDAVEILKSMES-ETS  241

Query  639   HVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYDIAC  460
             +   +   F+ P +   ++KP +++THGD+L+ EER   R+ L E LGI      +D   
Sbjct  242   YAHMVSTAFNCPLLSFKDDKPAVVMTHGDLLSREERARARVFLGELLGIPPDKQIFD---  298

Query  459   LSESGIPAEEGDPVSAFALTEAVYRSLLQSDRT--HLPKRKF  340
                  IPA   DP +A  +   +  SL  +D+    LPKR F
Sbjct  299   -----IPASR-DPATALTICNLLCYSLDHADKNLVFLPKRNF  334



>ref|XP_008372523.1| PREDICTED: uncharacterized protein LOC103435872 isoform X2 [Malus 
domestica]
Length=529

 Score =   116 bits (291),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 93/293 (32%), Positives = 135/293 (46%), Gaps = 24/293 (8%)
 Frame = -1

Query  1185  ISMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYS  1006
             I  + L+  + K+ SY  G     VG +K  D D+P   TLLLVG  GSGKSSLVN +  
Sbjct  123   IRSKDLEEAKSKILSYTPGAWIDRVGAVKPRDYDVPNTTTLLLVGPKGSGKSSLVNRISK  182

Query  1005  VLGRSGLIPFAQTSSQPTKFT-----TMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGM  841
             V        FA   +Q +  +     T  L E+ + R   + FC+YDTR L      E +
Sbjct  183   VFEDDK---FASERAQVSYNSSLGDGTFFLHEYMMPRCS-SSFCLYDTRSL-SDNSPENI  237

Query  840   EDVWSWMSDGVRHNQPCCRGSDDD--REMMEYSMAGRCANKYCKRRVNCVLVVADMEEAF  667
             + +  WM  GVRH +   R SD    R  M Y            + VN V+ V +     
Sbjct  238   KILKHWMEHGVRHGELVVRDSDXPSLRNTMMYKDXDDGYLSSEIKNVNFVIFVVNGLSVL  297

Query  666   KDFSS---GDLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLG  496
             K   S    + ++ E I   F S  +   ++KP+L+ THGD+L+ +ER   R+ L E LG
Sbjct  298   KSMESNEDAETQYTEMIASAFKSRYLAFKDDKPLLVXTHGDLLSLDERAXVRVHLGELLG  357

Query  495   ISETTGAYDIACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFK  337
             I  TT  +DI          E  D V+   + + +  SL  +++    KRK +
Sbjct  358   IPPTTQIFDI---------PESSDAVTQLTIVDMIRYSLEHAEKNLPRKRKVE  401



>ref|XP_010450266.1| PREDICTED: uncharacterized protein LOC104732423 isoform X1 [Camelina 
sativa]
Length=487

 Score =   116 bits (290),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 90/282 (32%), Positives = 132/282 (47%), Gaps = 29/282 (10%)
 Frame = -1

Query  1158  RHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIP  979
             R+ + SY  G  W      K +D D+    +++LVG  G+GKSSLVN +  V+      P
Sbjct  73    RNDILSYTPGS-W---SDGKVSDYDVQKTTSIILVGPKGAGKSSLVNRITRVIEDDEFSP  128

Query  978   -FAQTS-SQPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLD-CHRMDEGMEDVWSWMSDGV  808
               AQ S  + +K  T  LEE+ + R     FC+YDTRGL       +    +  WM+ GV
Sbjct  129   DRAQESFGKQSKGGTYFLEEYEMPRGGSASFCLYDTRGLSHISSSSDNTSMIEQWMTRGV  188

Query  807   RHNQPCCRGSDD----DREMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDFSSGDLK  640
              H +P    SD     DR + +             R+VN V+ V D  E  K   S +  
Sbjct  189   HHGEPVIWASDSSDLKDRLIRDSGTGSEI------RKVNSVIFVVDAVEILKSMES-ETS  241

Query  639   HVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYDIAC  460
             +   +   F+ P +   ++KP +++THGD+L+ EER   R+ L E LGI      +D   
Sbjct  242   YAHMVSTAFNCPLLSFKDDKPAVVMTHGDLLSREERARARVFLGELLGIPPDKQIFD---  298

Query  459   LSESGIPAEEGDPVSAFALTEAVYRSLLQSDRT--HLPKRKF  340
                  IPA   DP +A  +   +  SL  +D+    LPKR F
Sbjct  299   -----IPASR-DPATALTICNLLCYSLDHADKNLVFLPKRNF  334



>ref|XP_003622871.1| hypothetical protein MTR_7g055720 [Medicago truncatula]
Length=475

 Score =   115 bits (289),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 83/250 (33%), Positives = 124/250 (50%), Gaps = 14/250 (6%)
 Frame = -1

Query  1185  ISMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYS  1006
             I  + L   + K+ SY+ G       G+K  D D+P    LLLVG +GSGKSSL+N +  
Sbjct  93    IDSKNLKEAKEKILSYRPGTWTEKAKGLKLCDYDVPETTCLLLVGPSGSGKSSLINRISK  152

Query  1005  VLGRSGLIPF-AQTSSQPTKFT-TMLLEEHNVLRSKKNGFCVYDTRGL--DCHRMDEGME  838
             V       P  AQ S    +   T  L E+ + R   N  C+YDTR L  D H  ++ ++
Sbjct  153   VFDEDKFAPARAQVSYNSIRGNGTCFLREYMIPRDS-NSICLYDTRSLSDDSHENNKMLK  211

Query  837   DVWSWMSDGVRHNQPCCRGSDDDREMMEYSMAGRCANKYCK--RRVNCVLVVADMEEAFK  664
             +   WM+ GVRH +   RG DD R      + G     +    R+VN V+ V +      
Sbjct  212   N---WMTKGVRHGELVARGMDDKRLSKNLKLKGDKKGFFSSKSRKVNYVICVLNGLSVLN  268

Query  663   --DFSSGDLK--HVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLG  496
               + + G L+  +++ I   F+ P +   ++KP+L+LTHGD+L+  +R   R  L E LG
Sbjct  269   VIENAGGALEEWYIQQIVSTFNCPFLSFKDDKPVLVLTHGDLLSLSDRARVRAYLGELLG  328

Query  495   ISETTGAYDI  466
             I  T   +DI
Sbjct  329   IPPTKQIFDI  338



>ref|XP_009408995.1| PREDICTED: uncharacterized protein LOC103991312 [Musa acuminata 
subsp. malaccensis]
Length=397

 Score =   114 bits (286),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 87/243 (36%), Positives = 119/243 (49%), Gaps = 13/243 (5%)
 Frame = -1

Query  1164  LLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGL  985
             +LRHK      GD    VGG    D ++P  ITLLLVG  GSGKS+LVN +  V      
Sbjct  92    ILRHK-----PGDWIEEVGGTTAGDYEVPDAITLLLVGPRGSGKSTLVNRITRVFDDDFS  146

Query  984   IPFAQTSSQPTKFT--TMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSDG  811
              P     S     T  T  L+E+ + R  K+  CVYDTR L  + +      +  WM+ G
Sbjct  147   APDRAQVSHNLSATGGTCFLQEYMIPRKSKS-LCVYDTRSLSTN-LPHNFRLLQRWMTRG  204

Query  810   VRHNQPCCRGSDD--DREMMEYSMAGRCANKYCKRR-VNCVLVVADMEEAFKDFSSGDLK  640
             V H +   R SDD   R+ ++ SM  +     CKRR VN V+ V D     K   + D +
Sbjct  205   VSHGEMVIRDSDDFVTRKNIK-SMRRQGLLSPCKRRIVNFVIFVVDGLSVLKSMDAKDDQ  263

Query  639   HVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYDIAC  460
             + E +   F+ P +   + KP +++THGD L+  ER   R +L E LGI      +DI  
Sbjct  264   YNEILFETFNYPFLSFKDNKPAVVVTHGDELSLSERAIIRTRLGELLGIPPIKQIFDIPG  323

Query  459   LSE  451
              SE
Sbjct  324   TSE  326



>ref|XP_004290170.1| PREDICTED: uncharacterized protein LOC101307548 [Fragaria vesca 
subsp. vesca]
Length=718

 Score =   116 bits (291),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 87/286 (30%), Positives = 138/286 (48%), Gaps = 30/286 (10%)
 Frame = -1

Query  1158  RHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIP  979
             + K+ SY  G      G +K+ + D+P   TLLLVG  GSGKSSL+N +  VL       
Sbjct  96    KDKILSYTPGAWIGTAGAMKRREYDVPKTTTLLLVGPKGSGKSSLINRISKVLEDDK---  152

Query  978   FAQTSSQPTKFT-----TMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVW---SW  823
             FA   +Q +  +     T+ L E+ + R     FC+YD+R L     D+  E++     W
Sbjct  153   FASERAQVSYNSSVGDGTLFLHEYMMPRGS-TSFCIYDSRSLS----DDSAENIKFLKDW  207

Query  822   MSDGVRHNQPCCRGSDDD--REMMEYSMAGRCANKYCKRRVNCVLVVAD---MEEAFKDF  658
             + +GVRH +   R SD+   R  M              R+VN V+ V +   + EA +  
Sbjct  208   IENGVRHGELAIRDSDNQSLRTAMMCKAHDNVDLSSAIRKVNFVIFVVNGLPVLEALESE  267

Query  657   SSGDLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTG  478
                  ++ + I  +F+ P +   ++KP +++THGD+L+ +ER   RL L E LGI  TT 
Sbjct  268   EDAKTQYTQMIASMFNCPFLAFKDDKPAVVITHGDLLSHDERARVRLFLGELLGIPPTTQ  327

Query  477   AYDIACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKF  340
              +DI          E  DPV+     + +  SL  +++ +  K+K 
Sbjct  328   IFDI---------PESSDPVTESTTIDMLRYSLEHAEKNYTHKKKV  364



>ref|XP_009372211.1| PREDICTED: uncharacterized protein LOC103961399 isoform X1 [Pyrus 
x bretschneideri]
Length=649

 Score =   116 bits (290),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 94/301 (31%), Positives = 140/301 (47%), Gaps = 39/301 (13%)
 Frame = -1

Query  1170  LDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRS  991
             L+  + K+ SY+ G     VG +K  + D+P   TLLLVG  GSGKSSLVN +  V    
Sbjct  91    LEEAKSKILSYRPGAWIDRVGSVKPRNYDVPKTTTLLLVGPKGSGKSSLVNRISKVFEDD  150

Query  990   GLIPFAQTSSQPTKFT-----TMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVW-  829
                 FA   +Q +  +     T  L  + + R   + FC+YDTR L     D  +E++  
Sbjct  151   E---FASERAQVSYNSSVGEGTFFLHGYMIPRC-SSSFCLYDTRSLS----DNSLENIII  202

Query  828   --SWMSDGVRHNQPCCRGSDDD--REMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKD  661
                WM +GVRH +   R SD    R  M Y            R VN V+ V +     K 
Sbjct  203   LKHWMENGVRHGELVTRDSDSQSLRNTMMYKARDDGYLSSEIRNVNFVIFVVNGLSVLKS  262

Query  660   FSS---GDLKHVEAIKMIFHSPSIR---------RSNEKPMLILTHGDILTAEERVETRL  517
                    + ++ E I   F+S  +            ++KP+L++THGD+L+ +ER   R+
Sbjct  263   MEGDEDAETRYTEMITSAFNSGYLAFKVTTSPFFLPDDKPLLVVTHGDLLSLDERARVRV  322

Query  516   KLCESLGISETTGAYDIACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFK  337
              L E LGI  TT  +D        IP E  DPV+   + + +  SL  +++  LP+R+  
Sbjct  323   HLGELLGIPPTTQIFD--------IPVESSDPVTELTIVDMIRYSLEHAEKN-LPRRRKV  373

Query  336   D  334
             D
Sbjct  374   D  374



>ref|XP_004292355.1| PREDICTED: uncharacterized protein LOC101301843 [Fragaria vesca 
subsp. vesca]
Length=353

 Score =   112 bits (281),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 97/320 (30%), Positives = 146/320 (46%), Gaps = 42/320 (13%)
 Frame = -1

Query  1185  ISMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYS  1006
             I  + L+  + K+ SY  G     VG +K  D D+P    LLLVG TGSGKSSLVN +  
Sbjct  54    IRSKSLEEAKKKILSYTPGAWIESVGAMKLMDYDVPKTTCLLLVGPTGSGKSSLVNKISK  113

Query  1005  VLGRSGLIPFAQTSSQPTKFT-----TMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGM  841
             V  R     FA   +Q +  +     T+ L+E+ + R     FC+YDTR L      E +
Sbjct  114   VFDR-----FASQRAQVSYNSSVSNGTLFLQEYMIPRG-STSFCLYDTRSL-SDDPPENI  166

Query  840   EDVWSWMSDGVRHNQPCCRG-------SDDDREMMEYSMAGRCANKYCKRRVNCVLVVAD  682
               +  WM  GV H +   R        +      +EY   G  +++   R+VN V+ V D
Sbjct  167   RTLEDWMRRGVCHGKLVYRSGFLNSLQTIKKFRALEY---GHVSSEI--RKVNFVIFVVD  221

Query  681   MEEAFKDFSSGDLKHVEAIKMI---FHSPSIRRSNEKPMLILTHGDILTAEERVETRLKL  511
                  K   S +       KMI   F+S  +   ++KP++++T GD+L+  +R   R+ L
Sbjct  222   AVSVLKSIESNEDAVTRYSKMIATAFNSQHLAFKDDKPLVVVTQGDLLSQVQRSRVRVHL  281

Query  510   CESLGISETTGAYDIACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKDW  331
              E LGI   T  +DI          E  DPV+   + + +  +L  +D+    KRK +  
Sbjct  282   GELLGIPPVTQIFDI---------PESNDPVTDLTIVDMLCYALEHADKNFPHKRKVQ--  330

Query  330   VLAFASWVLCCFSSFFAMLA  271
                 A+ VL C     A+L 
Sbjct  331   ----AASVLLCMLLSVAVLG  346



>ref|XP_002303066.1| hypothetical protein POPTR_0002s24880g [Populus trichocarpa]
 gb|EEE82339.1| hypothetical protein POPTR_0002s24880g [Populus trichocarpa]
Length=575

 Score =   115 bits (288),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 85/287 (30%), Positives = 135/287 (47%), Gaps = 24/287 (8%)
 Frame = -1

Query  1158  RHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIP  979
             + K+ SY  G     V G+K +D D+P    LL++G  GSGKSSL+N +  V        
Sbjct  127   KSKILSYTPGGWMENVIGMKLSDFDVPNTTVLLVIGPKGSGKSSLINRISKVFEDDK---  183

Query  978   FAQTSSQPTKFT-----TMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSD  814
             FA   +Q +  +     T  L+E+ + RS  + FC+YDTRGL     D     + +W++ 
Sbjct  184   FASERAQVSYNSSAADGTYFLQEYMIPRSS-SSFCLYDTRGLSYDSYDSA-NMLKNWITK  241

Query  813   GVRHNQPCCRGSDDD--REMMEYSMAGRCANKYCKRRVNCVLVVAD---MEEAFKDFSSG  649
             GV H +   R SD+   R  M+    G        R V  V+ V D   + ++  +    
Sbjct  242   GVHHRELIIRPSDNSHLRNQMKCKARGNGCQSKETRMVTFVIFVVDGLAVLKSMDNLVDE  301

Query  648   DLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYD  469
               K+ + I   F  P I  +++KP++++THGD+L+  +R   R+ L E LGI      +D
Sbjct  302   GKKYTQMIAKTFDCPYISFNDDKPVVVVTHGDLLSLNDRARVRVHLGELLGIPPAKQIFD  361

Query  468   IACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKDWV  328
             I          E  DPV+   +   ++ SL  +D+    KR+    V
Sbjct  362   I---------PESHDPVTELTIVNMLHYSLEHADKNLPHKRQIAKKV  399



>ref|XP_009787339.1| PREDICTED: uncharacterized protein LOC104235302 isoform X5 [Nicotiana 
sylvestris]
Length=403

 Score =   113 bits (282),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 80/240 (33%), Positives = 118/240 (49%), Gaps = 10/240 (4%)
 Frame = -1

Query  1143  SYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIP-FAQT  967
             SY  G     +GG+KK D +IP  +TLLL+G   SGKSSLVN +  VL      P  A  
Sbjct  60    SYTPGSWIEELGGMKKGDYNIPKKMTLLLIGPKASGKSSLVNKISMVLEDDPFTPDRAPV  119

Query  966   SSQPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSDGVRHNQPCC  787
             S       T  L+E+ + R   + FC+YDTR L    + E  + V  WM+ GVRH +   
Sbjct  120   SYSSVGDGTFFLQEYMIPRGS-SSFCLYDTRSL-SDDLAENKKMVKQWMTKGVRHGELIK  177

Query  786   RGSDDDREMMEYSMAGRCANKYCK---RRVNCVLVVADMEEAFKDFSSGD---LKHVEAI  625
             R SDD     +     R  N +C    + VN V+ V       +   S D    +  +A+
Sbjct  178   RDSDDVHLKSKMKSKAR-RNSFCAIEAKVVNYVIFVVSAVSILELMDSDDEIKRRKTQAV  236

Query  624   KMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYDIACLSESG  445
                F+ P +   ++KP+++LTHGD+L+  +R   R+ L + LGI      +DI    ++G
Sbjct  237   ATTFNDPLLSFEDDKPVVVLTHGDLLSLSDRTRIRMHLGQLLGIHPKKQIFDIPESDDAG  296



>ref|XP_009787338.1| PREDICTED: uncharacterized protein LOC104235302 isoform X4 [Nicotiana 
sylvestris]
Length=412

 Score =   113 bits (282),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 80/240 (33%), Positives = 118/240 (49%), Gaps = 10/240 (4%)
 Frame = -1

Query  1143  SYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIP-FAQT  967
             SY  G     +GG+KK D +IP  +TLLL+G   SGKSSLVN +  VL      P  A  
Sbjct  115   SYTPGSWIEELGGMKKGDYNIPKKMTLLLIGPKASGKSSLVNKISMVLEDDPFTPDRAPV  174

Query  966   SSQPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSDGVRHNQPCC  787
             S       T  L+E+ + R   + FC+YDTR L    + E  + V  WM+ GVRH +   
Sbjct  175   SYSSVGDGTFFLQEYMIPRGS-SSFCLYDTRSL-SDDLAENKKMVKQWMTKGVRHGELIK  232

Query  786   RGSDDDREMMEYSMAGRCANKYCK---RRVNCVLVVADMEEAFKDFSSGD---LKHVEAI  625
             R SDD     +     R  N +C    + VN V+ V       +   S D    +  +A+
Sbjct  233   RDSDDVHLKSKMKSKAR-RNSFCAIEAKVVNYVIFVVSAVSILELMDSDDEIKRRKTQAV  291

Query  624   KMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYDIACLSESG  445
                F+ P +   ++KP+++LTHGD+L+  +R   R+ L + LGI      +DI    ++G
Sbjct  292   ATTFNDPLLSFEDDKPVVVLTHGDLLSLSDRTRIRMHLGQLLGIHPKKQIFDIPESDDAG  351



>ref|XP_009787337.1| PREDICTED: uncharacterized protein LOC104235302 isoform X3 [Nicotiana 
sylvestris]
Length=443

 Score =   113 bits (282),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 80/240 (33%), Positives = 118/240 (49%), Gaps = 10/240 (4%)
 Frame = -1

Query  1143  SYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIP-FAQT  967
             SY  G     +GG+KK D +IP  +TLLL+G   SGKSSLVN +  VL      P  A  
Sbjct  100   SYTPGSWIEELGGMKKGDYNIPKKMTLLLIGPKASGKSSLVNKISMVLEDDPFTPDRAPV  159

Query  966   SSQPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSDGVRHNQPCC  787
             S       T  L+E+ + R   + FC+YDTR L    + E  + V  WM+ GVRH +   
Sbjct  160   SYSSVGDGTFFLQEYMIPRGS-SSFCLYDTRSL-SDDLAENKKMVKQWMTKGVRHGELIK  217

Query  786   RGSDDDREMMEYSMAGRCANKYCK---RRVNCVLVVADMEEAFKDFSSGD---LKHVEAI  625
             R SDD     +     R  N +C    + VN V+ V       +   S D    +  +A+
Sbjct  218   RDSDDVHLKSKMKSKAR-RNSFCAIEAKVVNYVIFVVSAVSILELMDSDDEIKRRKTQAV  276

Query  624   KMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYDIACLSESG  445
                F+ P +   ++KP+++LTHGD+L+  +R   R+ L + LGI      +DI    ++G
Sbjct  277   ATTFNDPLLSFEDDKPVVVLTHGDLLSLSDRTRIRMHLGQLLGIHPKKQIFDIPESDDAG  336



>ref|XP_008458042.1| PREDICTED: uncharacterized protein LOC103497586 isoform X1 [Cucumis 
melo]
Length=501

 Score =   114 bits (284),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 87/303 (29%), Positives = 132/303 (44%), Gaps = 49/303 (16%)
 Frame = -1

Query  1140  YQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIP------  979
             Y  G     VGG+K +D DIP  I+L+L+G  GSGKSSL+N +  V       P      
Sbjct  149   YSPGAWIEQVGGMKLSDYDIPQTISLILIGPKGSGKSSLINRISKVFEEDHFAPERAQVS  208

Query  978   ---------------------------FAQTSSQPTKFTTMLLEEHNVLRSKKNGFCVYD  880
                                        F    +   +  T  L E+ +LR  K+ FC+YD
Sbjct  209   CISLNTFEVFFLYENSSHLFELKICNIFWAIGNSSGEGGTFFLHEYMILRKSKS-FCLYD  267

Query  879   TRGLDCHRMDEGMEDVWSWMSDGVRHNQPCCRGSDDDREMMEYSMAGRCANKYCK--RRV  706
             TRGL     D  +E +  WMS GVRH +   R SD    +       R +    +  R +
Sbjct  268   TRGLSDDPSD-NIETLKQWMSKGVRHGELVTRKSDASNFINRMKCKARQSFPRSRVIRII  326

Query  705   NCVLVVADMEEAFKDFSSGDLK--HVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEER  532
             N V+ V D     K     D +  +   I   F+ P +   ++KP+++LTHGD+L+  +R
Sbjct  327   NFVIFVVDGLSVLKSIDGDDKQKDYDRVITTAFNCPYLSYGDDKPVVVLTHGDLLSFADR  386

Query  531   VETRLKLCESLGISETTGAYDIACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLP  352
             V  R  L   LGI  T   +DI          +  DPV+   + + ++  L  +D+ +LP
Sbjct  387   VRVRGHLGNLLGIPSTKQIFDI---------PDRYDPVTELTIIDMLHYCLEHADK-NLP  436

Query  351   KRK  343
              ++
Sbjct  437   HKR  439



>ref|XP_009787335.1| PREDICTED: uncharacterized protein LOC104235302 isoform X1 [Nicotiana 
sylvestris]
Length=458

 Score =   112 bits (281),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 80/240 (33%), Positives = 118/240 (49%), Gaps = 10/240 (4%)
 Frame = -1

Query  1143  SYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIP-FAQT  967
             SY  G     +GG+KK D +IP  +TLLL+G   SGKSSLVN +  VL      P  A  
Sbjct  115   SYTPGSWIEELGGMKKGDYNIPKKMTLLLIGPKASGKSSLVNKISMVLEDDPFTPDRAPV  174

Query  966   SSQPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSDGVRHNQPCC  787
             S       T  L+E+ + R   + FC+YDTR L    + E  + V  WM+ GVRH +   
Sbjct  175   SYSSVGDGTFFLQEYMIPRGS-SSFCLYDTRSL-SDDLAENKKMVKQWMTKGVRHGELIK  232

Query  786   RGSDDDREMMEYSMAGRCANKYCK---RRVNCVLVVADMEEAFKDFSSGD---LKHVEAI  625
             R SDD     +     R  N +C    + VN V+ V       +   S D    +  +A+
Sbjct  233   RDSDDVHLKSKMKSKAR-RNSFCAIEAKVVNYVIFVVSAVSILELMDSDDEIKRRKTQAV  291

Query  624   KMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYDIACLSESG  445
                F+ P +   ++KP+++LTHGD+L+  +R   R+ L + LGI      +DI    ++G
Sbjct  292   ATTFNDPLLSFEDDKPVVVLTHGDLLSLSDRTRIRMHLGQLLGIHPKKQIFDIPESDDAG  351



>ref|XP_010435316.1| PREDICTED: uncharacterized protein LOC104719155 isoform X2 [Camelina 
sativa]
Length=461

 Score =   112 bits (280),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 86/282 (30%), Positives = 130/282 (46%), Gaps = 29/282 (10%)
 Frame = -1

Query  1158  RHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIP  979
             R+ + SY  G  W      K +D D+    +++L+G  G+GKSSLVN +  V+      P
Sbjct  69    RNDILSYTPGS-W---SDGKVSDYDVQKTTSIILIGPKGAGKSSLVNRITRVIEDDEFSP  124

Query  978   -FAQTS-SQPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLD-CHRMDEGMEDVWSWMSDGV  808
               AQ S    +K  T  +EE+ + R     FC+YDTRGL       +    +  WM+ GV
Sbjct  125   DRAQESFGTQSKGGTYFVEEYKMPRGDSASFCLYDTRGLSHISSSSDNTSMIEKWMTRGV  184

Query  807   RHNQPCCRGSDD----DREMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDFSSGDLK  640
              H +P    SD     DR + +             R+VN V+ V D  E  K   S +  
Sbjct  185   HHGEPVIWASDSSDLKDRLIRDSGTGSEI------RKVNSVIFVVDAVEILKSMES-ETS  237

Query  639   HVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYDIAC  460
             +   +   F+SP +   ++KP +++THGD+L+ E+R   R+ L E LGI      +DI  
Sbjct  238   YTHMVSTAFNSPLLSYKDDKPAVVMTHGDLLSREDRARVRVFLGELLGIPPEKQIFDI--  295

Query  459   LSESGIPAEEGDPVSAFALTEAVYRSLLQSDRT--HLPKRKF  340
                     E  D  +A  +   +  SL  +D+    LPKR F
Sbjct  296   -------PESRDTATALTICNLLCYSLEHADKNLVFLPKRNF  330



>ref|XP_010435315.1| PREDICTED: uncharacterized protein LOC104719155 isoform X1 [Camelina 
sativa]
Length=464

 Score =   112 bits (280),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 86/282 (30%), Positives = 130/282 (46%), Gaps = 29/282 (10%)
 Frame = -1

Query  1158  RHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIP  979
             R+ + SY  G  W      K +D D+    +++L+G  G+GKSSLVN +  V+      P
Sbjct  72    RNDILSYTPGS-W---SDGKVSDYDVQKTTSIILIGPKGAGKSSLVNRITRVIEDDEFSP  127

Query  978   -FAQTS-SQPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLD-CHRMDEGMEDVWSWMSDGV  808
               AQ S    +K  T  +EE+ + R     FC+YDTRGL       +    +  WM+ GV
Sbjct  128   DRAQESFGTQSKGGTYFVEEYKMPRGDSASFCLYDTRGLSHISSSSDNTSMIEKWMTRGV  187

Query  807   RHNQPCCRGSDD----DREMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDFSSGDLK  640
              H +P    SD     DR + +             R+VN V+ V D  E  K   S +  
Sbjct  188   HHGEPVIWASDSSDLKDRLIRDSGTGSEI------RKVNSVIFVVDAVEILKSMES-ETS  240

Query  639   HVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYDIAC  460
             +   +   F+SP +   ++KP +++THGD+L+ E+R   R+ L E LGI      +DI  
Sbjct  241   YTHMVSTAFNSPLLSYKDDKPAVVMTHGDLLSREDRARVRVFLGELLGIPPEKQIFDI--  298

Query  459   LSESGIPAEEGDPVSAFALTEAVYRSLLQSDRT--HLPKRKF  340
                     E  D  +A  +   +  SL  +D+    LPKR F
Sbjct  299   -------PESRDTATALTICNLLCYSLEHADKNLVFLPKRNF  333



>ref|XP_010440644.1| PREDICTED: uncharacterized protein LOC104723902 isoform X2 [Camelina 
sativa]
Length=460

 Score =   111 bits (277),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 87/279 (31%), Positives = 130/279 (47%), Gaps = 23/279 (8%)
 Frame = -1

Query  1158  RHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIP  979
             R+ + SY  G  W      K +D D+    +++LVG  G+GKSSLVN +  V+      P
Sbjct  72    RNDILSYTPGS-W---SDGKVSDYDVQKTTSIILVGPKGAGKSSLVNRITRVIEDDEFSP  127

Query  978   -FAQTS-SQPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMD--EGMEDVWSWMSDG  811
               AQ S  + +K  T  +EE+ + R     FC+YDTRGL  HR    +    +  WM+ G
Sbjct  128   DRAQESFGKQSKGGTYFVEEYKMPRGGSASFCLYDTRGL-SHRSSSSDNTSMIEKWMTRG  186

Query  810   VRHNQPCCRGSDDDREMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDFSSGDLKHVE  631
             V H  P    SD           G   ++   R+VN V+ V D  E  K   S +  +  
Sbjct  187   VHHGAPVIWASDSSDLKDRLIRDGGTGSEI--RKVNSVIFVVDAVEILKSMES-ETSYAH  243

Query  630   AIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYDIACLSE  451
              +   F+ P +   ++KP +++THGD+L+ E+R   R+ L E LGI      +DI     
Sbjct  244   MVSTAFNCPLLSFKDDKPAVVMTHGDLLSREDRARVRVFLGELLGIPPDKQIFDI-----  298

Query  450   SGIPAEEGDPVSAFALTEAVYRSLLQSDRT--HLPKRKF  340
                  E  D  +A  +   +  SL  +D+    LPKR F
Sbjct  299   ----PESRDTATALTICNLLCYSLEHADKNLVFLPKRNF  333



>ref|XP_009372212.1| PREDICTED: uncharacterized protein LOC103961399 isoform X2 [Pyrus 
x bretschneideri]
Length=648

 Score =   112 bits (281),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 93/301 (31%), Positives = 139/301 (46%), Gaps = 40/301 (13%)
 Frame = -1

Query  1170  LDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRS  991
             L+  + K+ SY+ G     VG +K  + D+P   TLLLVG  GSGKSSLVN +  V    
Sbjct  91    LEEAKSKILSYRPGAWIDRVGSVKPRNYDVPKTTTLLLVGPKGSGKSSLVNRISKVFEDD  150

Query  990   GLIPFAQTSSQPTKFT-----TMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVW-  829
                 FA   +Q +  +     T  L  + + R   + FC+YDTR L     D  +E++  
Sbjct  151   E---FASERAQVSYNSSVGEGTFFLHGYMIPRC-SSSFCLYDTRSLS----DNSLENIII  202

Query  828   --SWMSDGVRHNQPCCRGSDDD--REMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKD  661
                WM +GVRH +   R SD    R  M Y            R VN V+ V +     K 
Sbjct  203   LKHWMENGVRHGELVTRDSDSQSLRNTMMYKARDDGYLSSEIRNVNFVIFVVNGLSVLKS  262

Query  660   FSS---GDLKHVEAIKMIFHSPSIR---------RSNEKPMLILTHGDILTAEERVETRL  517
                    + ++ E I   F+S  +            ++KP+L++THGD+L+ +ER   R+
Sbjct  263   MEGDEDAETRYTEMITSAFNSGYLAFKVTTSPFFLPDDKPLLVVTHGDLLSLDERARVRV  322

Query  516   KLCESLGISETTGAYDIACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFK  337
              L E LGI  TT  +DI          E  DPV+   + + +  SL  +++  LP+R+  
Sbjct  323   HLGELLGIPPTTQIFDI---------PESSDPVTELTIVDMIRYSLEHAEKN-LPRRRKV  372

Query  336   D  334
             D
Sbjct  373   D  373



>gb|AAQ22612.1| At4g13030 [Arabidopsis thaliana]
Length=372

 Score =   110 bits (274),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 76/245 (31%), Positives = 118/245 (48%), Gaps = 16/245 (7%)
 Frame = -1

Query  1062  LLVGLTGSGKSSLVNFMYSVLGRSG-LIPFAQTS-SQPTKFTTMLLEEHNVLRSKKNGFC  889
             +LVG  G+GKSSLVN +  V+     L+  AQ S   P+K  T  ++E+ + R     FC
Sbjct  1     MLVGPKGAGKSSLVNKITRVIEDDAFLLDRAQESFGTPSKGGTYFVQEYMISRGGSASFC  60

Query  888   VYDTRGLDCHRMDEGMEDVWSWMSDGVRHNQPCCRGSDDDREMMEYSMAGRCANKYCKRR  709
             +YDTRGL      +    +  WM+ GV H +P    SD     ++  +       Y +R+
Sbjct  61    LYDTRGLSRISSSDNTSMIEQWMTRGVLHGEPVIWASDSSD--LKDRLIRDGGTGYERRK  118

Query  708   VNCVLVVADMEEAFKDFSSGDLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERV  529
             VN ++ V +  E  K     +  +   I   F+SP +   ++KP +++THGD+L+ EER 
Sbjct  119   VNSIIFVVNAVEILKSMEC-ETSYASMITTAFNSPILLFKDDKPAVVMTHGDMLSREERA  177

Query  528   ETRLKLCESLGISETTGAYDIACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRT--HL  355
               R+ L E LGI      +DI          E  D  +A  +   +  SL  +D+    L
Sbjct  178   RVRVFLGELLGIPPHKQIFDI---------PESRDTATAITICNLLCYSLQHADKNFVFL  228

Query  354   PKRKF  340
             PK+ F
Sbjct  229   PKKNF  233



>ref|XP_010440643.1| PREDICTED: uncharacterized protein LOC104723902 isoform X1 [Camelina 
sativa]
Length=462

 Score =   111 bits (277),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 87/279 (31%), Positives = 130/279 (47%), Gaps = 23/279 (8%)
 Frame = -1

Query  1158  RHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIP  979
             R+ + SY  G  W      K +D D+    +++LVG  G+GKSSLVN +  V+      P
Sbjct  72    RNDILSYTPGS-W---SDGKVSDYDVQKTTSIILVGPKGAGKSSLVNRITRVIEDDEFSP  127

Query  978   -FAQTS-SQPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMD--EGMEDVWSWMSDG  811
               AQ S  + +K  T  +EE+ + R     FC+YDTRGL  HR    +    +  WM+ G
Sbjct  128   DRAQESFGKQSKGGTYFVEEYKMPRGGSASFCLYDTRGL-SHRSSSSDNTSMIEKWMTRG  186

Query  810   VRHNQPCCRGSDDDREMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDFSSGDLKHVE  631
             V H  P    SD           G   ++   R+VN V+ V D  E  K   S +  +  
Sbjct  187   VHHGAPVIWASDSSDLKDRLIRDGGTGSEI--RKVNSVIFVVDAVEILKSMES-ETSYAH  243

Query  630   AIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYDIACLSE  451
              +   F+ P +   ++KP +++THGD+L+ E+R   R+ L E LGI      +DI     
Sbjct  244   MVSTAFNCPLLSFKDDKPAVVMTHGDLLSREDRARVRVFLGELLGIPPDKQIFDI-----  298

Query  450   SGIPAEEGDPVSAFALTEAVYRSLLQSDRT--HLPKRKF  340
                  E  D  +A  +   +  SL  +D+    LPKR F
Sbjct  299   ----PESRDTATALTICNLLCYSLEHADKNLVFLPKRNF  333



>emb|CDY34538.1| BnaA08g04930D [Brassica napus]
Length=457

 Score =   111 bits (277),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 82/282 (29%), Positives = 131/282 (46%), Gaps = 25/282 (9%)
 Frame = -1

Query  1170  LDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRS  991
             L L R ++ SY  G        +  +D  IP   ++L+VG  G+GKSSLVN +  V+   
Sbjct  70    LKLARRQILSYTPGSF----ADVNLSDYHIPKTTSILIVGPKGAGKSSLVNRITRVIQDE  125

Query  990   GLIPF-AQTS-SQPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMS  817
                P  AQ S   P+   T  L+E+ + R     FC+ DTRGL      +    +  W+ 
Sbjct  126   EFAPARAQESYGMPSNGGTFFLQEYMIPRGGSASFCLCDTRGLSQISSSDNTTMIEQWIK  185

Query  816   DGVRHNQPCCRGSDDDREMMEYSMAGRCANKYCK-RRVNCVLVVADMEEAFKDFSSGDLK  640
              GV H +P    SDD  ++ +  +   C    C+ R+VN ++ V +  E  +  SS    
Sbjct  186   KGVHHGEPVIWTSDDS-DLKDRLIRDGCTG--CEIRKVNSIIFVVNAVEMMESESS----  238

Query  639   HVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYDIAC  460
             +   +   F+SP +   ++KP +++THGDIL+ EER   ++ + E LGI      +DI  
Sbjct  239   YAHMVSTAFNSPLLSFKDDKPAVVITHGDILSREERARVQVLVGELLGIPPDKQIFDI--  296

Query  459   LSESGIPAEEGDPVSAFALTEAVYRSLLQSDRT--HLPKRKF  340
                     +  D  +A  +   +   L  +D+     PKR F
Sbjct  297   -------PDSRDAATALTVCNLLRHCLEHADKNLRFCPKRNF  331



>ref|XP_009107671.1| PREDICTED: uncharacterized protein LOC103833338 [Brassica rapa]
Length=457

 Score =   110 bits (276),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 82/282 (29%), Positives = 131/282 (46%), Gaps = 25/282 (9%)
 Frame = -1

Query  1170  LDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRS  991
             L L R ++ SY  G        +  +D  IP   ++L+VG  G+GKSSLVN +  V+   
Sbjct  70    LKLARRQILSYTPGSF----ADVNLSDYHIPKTTSILIVGPKGAGKSSLVNRITRVIQDE  125

Query  990   GLIPF-AQTS-SQPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMS  817
                P  AQ S   P+   T  L+E+ + R     FC+ DTRGL      +    +  W+ 
Sbjct  126   EFAPARAQESYGMPSNGGTFFLQEYMIPRGGSASFCLCDTRGLSQISSSDNTTMIEQWIK  185

Query  816   DGVRHNQPCCRGSDDDREMMEYSMAGRCANKYCK-RRVNCVLVVADMEEAFKDFSSGDLK  640
              GV H +P    SDD  ++ +  +   C    C+ R+VN ++ V +  E  +  SS    
Sbjct  186   KGVHHGEPVIWKSDDS-DLKDRLIRDGCTG--CEIRKVNSIIFVVNAVEMMESESS----  238

Query  639   HVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYDIAC  460
             +   +   F+SP +   ++KP +++THGDIL+ EER   ++ + E LGI      +DI  
Sbjct  239   YAHMVSTAFNSPLLSFKDDKPAVVITHGDILSREERARVQVLVGELLGIPPDKQIFDI--  296

Query  459   LSESGIPAEEGDPVSAFALTEAVYRSLLQSDRT--HLPKRKF  340
                     +  D  +A  +   +   L  +D+     PKR F
Sbjct  297   -------PDSRDAATALTVCNLLRHCLEHADKNLRFCPKRNF  331



>ref|XP_008780979.1| PREDICTED: uncharacterized protein LOC103700848 isoform X4 [Phoenix 
dactylifera]
Length=377

 Score =   109 bits (272),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 78/222 (35%), Positives = 102/222 (46%), Gaps = 14/222 (6%)
 Frame = -1

Query  1113  VGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIPFAQTSSQPTKFTTML  934
             VGG K  D DIP  +TLLLVG  GSGKS+LVN +  V       P     SQ        
Sbjct  96    VGGTKARDYDIPETMTLLLVGPRGSGKSTLVNRITRVFQDDQFAPDRAQVSQ--------  147

Query  933   LEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSDGVRHNQPCCRGSDDDREMME  754
                + + R  K   CVYDTR L     D   + +  WM  GV H Q   R SDD      
Sbjct  148   ---YMIPRDSKK-LCVYDTRSLSTFSSD-NFKLLQDWMMHGVTHRQMVIRDSDDVITTNR  202

Query  753   YSMAGRCANKYCKRR-VNCVLVVADMEEAFKDFSSGDLKHVEAIKMIFHSPSIRRSNEKP  577
                  R     C++R VN V+ V D     K   S D ++ + +   F+ P +   + KP
Sbjct  203   IKDMAREGFGPCQKRMVNFVIFVVDGISVLKSIDSMDTRYNDMLAETFNYPFLSFRDNKP  262

Query  576   MLILTHGDILTAEERVETRLKLCESLGISETTGAYDIACLSE  451
             ++++THGD L+  ER   R  L E LGI   T  +DI   +E
Sbjct  263   VVVVTHGDELSLFERAHIRTYLGELLGIPPLTQIFDIPGTNE  304



>gb|KDP45291.1| hypothetical protein JCGZ_15156 [Jatropha curcas]
Length=426

 Score =   110 bits (274),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 87/290 (30%), Positives = 141/290 (49%), Gaps = 24/290 (8%)
 Frame = -1

Query  1176  EGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLG  997
             +GL+  + K+ SY  G+     GG+  +D ++P   TLLLVG  GSGKSSL+N +  V  
Sbjct  96    KGLEEAKRKILSYTPGEWIEKAGGM--SDYNVPKTTTLLLVGPKGSGKSSLINRISKVFE  153

Query  996   RSGLIP-FAQTSSQPTKFT-TMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSW  823
                  P  AQ S   +    T  L+E+ + R   + FC+YD+RGL      E +E +  W
Sbjct  154   DDKFAPERAQVSYNSSAVEGTYFLQEYMIPRGSAS-FCLYDSRGL-SDDFSENVEMLKQW  211

Query  822   MSDGVRHNQPCCRGSDDD--REMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDFSS-  652
             ++ GVRH +   R SD    +  ++  + G  +     R VN V+ V +     K   S 
Sbjct  212   ITKGVRHGELIIRPSDHSSLKTRIKCKVRGNGSQSSETRMVNFVIFVVNGLAVLKSMESE  271

Query  651   GDLKHV--EAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTG  478
             GD   +  + I   F+ P +   ++KP +++TH D+L+  +R   R+ L   LGI     
Sbjct  272   GDEGSLYWQMIAKTFNCPYLSFKDDKPAVVVTHSDLLSLSDRARIRVWLGNLLGIPPAKQ  331

Query  477   AYDIACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKDWV  328
              +DI          E   PV+   + + +  SL  +++ +LP+   KDW+
Sbjct  332   IFDI---------PESFYPVTELTIVDMLRYSLEHAEK-NLPR---KDWL  368



>ref|XP_006443541.1| hypothetical protein CICLE_v10020463mg [Citrus clementina]
 ref|XP_006479214.1| PREDICTED: uncharacterized protein LOC102623837 isoform X3 [Citrus 
sinensis]
 gb|ESR56781.1| hypothetical protein CICLE_v10020463mg [Citrus clementina]
Length=397

 Score =   109 bits (272),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 89/309 (29%), Positives = 140/309 (45%), Gaps = 29/309 (9%)
 Frame = -1

Query  1158  RHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIP  979
             ++K+ SY  G     VGG+  +D D+P   +LLL+G  GSGKSSLVN +  V        
Sbjct  75    KNKILSYTPGAWIENVGGMTLSDYDVPKTTSLLLIGPKGSGKSSLVNRISKVFEND---K  131

Query  978   FAQTSSQPTKFT-----TMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSD  814
             FA   +Q T  +     T  L+E+ + R   N F +YDTR L     D  +  +  W+ +
Sbjct  132   FASERAQVTYNSSVGDGTYFLQEYTIPRG-SNSFSLYDTRSLSDDASDN-INMIKLWIME  189

Query  813   GVRHNQPCCRGSDDD--REMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDF---SSG  649
             GVRH +   R SD    R  M         +    R+VN V+ V D     K     S  
Sbjct  190   GVRHGELVIRRSDSSSLRNRMRCKARKIGCDPSVIRKVNFVIFVVDGLAVLKSMEGDSDV  249

Query  648   DLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYD  469
             + ++ + +   F+ P +   ++KP++++THGD+L+  +R   R  L E LGI      +D
Sbjct  250   EKQYDQIVATTFNCPYLSFRDDKPVVVVTHGDLLSLTDRARIRTYLGELLGIPPAKQIFD  309

Query  468   IACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPK-----RKFKDWVLAFASWVL  304
             I          E  DP +   + + +   L  +DR    K     + F+  V+AF + +L
Sbjct  310   I---------PESSDPENELIIIDMLRYCLEHADRNLSCKSCARNKGFRVSVMAFLNLLL  360

Query  303   CCFSSFFAM  277
                 +  A 
Sbjct  361   VLGIAIIAF  369



>gb|EYU26986.1| hypothetical protein MIMGU_mgv1a020328mg, partial [Erythranthe 
guttata]
Length=389

 Score =   108 bits (271),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 97/360 (27%), Positives = 155/360 (43%), Gaps = 47/360 (13%)
 Frame = -1

Query  1263  RFKEDISSGG---LSPRLKLLREM---QRLAFIS------------MEGLDLLRHKLTSY  1138
             RF  D  + G   L PR+  + +    QRL   +            ++ LD  + K+ SY
Sbjct  9     RFGNDSPTNGECGLIPRISSINDAVGRQRLKLYAEVSTSYEDLQPRIDRLDEAKTKILSY  68

Query  1137  QAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIPFAQTSSQ  958
             + G        I  +  D+P   ++LLVG   SGKS+LVN +  VL       F    SQ
Sbjct  69    KPGSWAEKAVAIDSSVYDVPNTTSILLVGPKASGKSALVNKISRVLEND---LFTSERSQ  125

Query  957   -----PTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSDGVRHNQP  793
                   T   T  L E+ + R     FC+YDTR L    + E  E V  WM++GVRH + 
Sbjct  126   VSCNSSTGDGTYFLHEYAIPRDS-GSFCLYDTRSLSVD-VSENTEMVNRWMTNGVRHGEL  183

Query  792   CCRGSDDDREMMEYSMAGRCANKYCKRRVNCVLVVA----DMEEAFKDFSSGDLKHVEAI  625
               R SD            R ++   K R    +V       + E+   F     ++   I
Sbjct  184   IERHSDGTDLKARLKCKARKSSASSKLRAVNFVVFVVNGLSVLESMDSFDEKKKEYSRFI  243

Query  624   KMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYDIACLSESG  445
                F++P +   ++KP++++THGD+L+  +RV  R+ L E +G+  TT  +DI       
Sbjct  244   ASNFNNPLLSFKDDKPVVVVTHGDLLSLSDRVRVRVFLGELIGVPSTTQIFDI-------  296

Query  444   IPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKDW------VLAFASWVLCCFSSFF  283
                E  +P +  A+ + +   L ++DR    K K + W      V+    W++   +  F
Sbjct  297   --PENNEPATTLAIVDMLIYCLERADRNIPAKVKSRFWSKVSYVVIYLLVWIILAMAVIF  354



>ref|XP_006443540.1| hypothetical protein CICLE_v10020463mg [Citrus clementina]
 ref|XP_006479212.1| PREDICTED: uncharacterized protein LOC102623837 isoform X1 [Citrus 
sinensis]
 gb|ESR56780.1| hypothetical protein CICLE_v10020463mg [Citrus clementina]
Length=400

 Score =   109 bits (272),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 89/309 (29%), Positives = 140/309 (45%), Gaps = 29/309 (9%)
 Frame = -1

Query  1158  RHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIP  979
             ++K+ SY  G     VGG+  +D D+P   +LLL+G  GSGKSSLVN +  V        
Sbjct  78    KNKILSYTPGAWIENVGGMTLSDYDVPKTTSLLLIGPKGSGKSSLVNRISKVFEND---K  134

Query  978   FAQTSSQPTKFT-----TMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSD  814
             FA   +Q T  +     T  L+E+ + R   N F +YDTR L     D  +  +  W+ +
Sbjct  135   FASERAQVTYNSSVGDGTYFLQEYTIPRG-SNSFSLYDTRSLSDDASDN-INMIKLWIME  192

Query  813   GVRHNQPCCRGSDDD--REMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDF---SSG  649
             GVRH +   R SD    R  M         +    R+VN V+ V D     K     S  
Sbjct  193   GVRHGELVIRRSDSSSLRNRMRCKARKIGCDPSVIRKVNFVIFVVDGLAVLKSMEGDSDV  252

Query  648   DLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYD  469
             + ++ + +   F+ P +   ++KP++++THGD+L+  +R   R  L E LGI      +D
Sbjct  253   EKQYDQIVATTFNCPYLSFRDDKPVVVVTHGDLLSLTDRARIRTYLGELLGIPPAKQIFD  312

Query  468   IACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPK-----RKFKDWVLAFASWVL  304
             I          E  DP +   + + +   L  +DR    K     + F+  V+AF + +L
Sbjct  313   I---------PESSDPENELIIIDMLRYCLEHADRNLSCKSCARNKGFRVSVMAFLNLLL  363

Query  303   CCFSSFFAM  277
                 +  A 
Sbjct  364   VLGIAIIAF  372



>ref|XP_006443543.1| hypothetical protein CICLE_v10020463mg [Citrus clementina]
 ref|XP_006479213.1| PREDICTED: uncharacterized protein LOC102623837 isoform X2 [Citrus 
sinensis]
 gb|ESR56783.1| hypothetical protein CICLE_v10020463mg [Citrus clementina]
Length=399

 Score =   109 bits (272),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 89/309 (29%), Positives = 140/309 (45%), Gaps = 29/309 (9%)
 Frame = -1

Query  1158  RHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIP  979
             ++K+ SY  G     VGG+  +D D+P   +LLL+G  GSGKSSLVN +  V        
Sbjct  77    KNKILSYTPGAWIENVGGMTLSDYDVPKTTSLLLIGPKGSGKSSLVNRISKVFEND---K  133

Query  978   FAQTSSQPTKFT-----TMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSD  814
             FA   +Q T  +     T  L+E+ + R   N F +YDTR L     D  +  +  W+ +
Sbjct  134   FASERAQVTYNSSVGDGTYFLQEYTIPRG-SNSFSLYDTRSLSDDASDN-INMIKLWIME  191

Query  813   GVRHNQPCCRGSDDD--REMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDF---SSG  649
             GVRH +   R SD    R  M         +    R+VN V+ V D     K     S  
Sbjct  192   GVRHGELVIRRSDSSSLRNRMRCKARKIGCDPSVIRKVNFVIFVVDGLAVLKSMEGDSDV  251

Query  648   DLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYD  469
             + ++ + +   F+ P +   ++KP++++THGD+L+  +R   R  L E LGI      +D
Sbjct  252   EKQYDQIVATTFNCPYLSFRDDKPVVVVTHGDLLSLTDRARIRTYLGELLGIPPAKQIFD  311

Query  468   IACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPK-----RKFKDWVLAFASWVL  304
             I          E  DP +   + + +   L  +DR    K     + F+  V+AF + +L
Sbjct  312   I---------PESSDPENELIIIDMLRYCLEHADRNLSCKSCARNKGFRVSVMAFLNLLL  362

Query  303   CCFSSFFAM  277
                 +  A 
Sbjct  363   VLGIAIIAF  371



>ref|XP_006479215.1| PREDICTED: uncharacterized protein LOC102623837 isoform X4 [Citrus 
sinensis]
Length=396

 Score =   109 bits (272),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 89/309 (29%), Positives = 140/309 (45%), Gaps = 29/309 (9%)
 Frame = -1

Query  1158  RHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIP  979
             ++K+ SY  G     VGG+  +D D+P   +LLL+G  GSGKSSLVN +  V        
Sbjct  74    KNKILSYTPGAWIENVGGMTLSDYDVPKTTSLLLIGPKGSGKSSLVNRISKVFEND---K  130

Query  978   FAQTSSQPTKFT-----TMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSD  814
             FA   +Q T  +     T  L+E+ + R   N F +YDTR L     D  +  +  W+ +
Sbjct  131   FASERAQVTYNSSVGDGTYFLQEYTIPRG-SNSFSLYDTRSLSDDASDN-INMIKLWIME  188

Query  813   GVRHNQPCCRGSDDD--REMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDF---SSG  649
             GVRH +   R SD    R  M         +    R+VN V+ V D     K     S  
Sbjct  189   GVRHGELVIRRSDSSSLRNRMRCKARKIGCDPSVIRKVNFVIFVVDGLAVLKSMEGDSDV  248

Query  648   DLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYD  469
             + ++ + +   F+ P +   ++KP++++THGD+L+  +R   R  L E LGI      +D
Sbjct  249   EKQYDQIVATTFNCPYLSFRDDKPVVVVTHGDLLSLTDRARIRTYLGELLGIPPAKQIFD  308

Query  468   IACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPK-----RKFKDWVLAFASWVL  304
             I          E  DP +   + + +   L  +DR    K     + F+  V+AF + +L
Sbjct  309   I---------PESSDPENELIIIDMLRYCLEHADRNLSCKSCARNKGFRVSVMAFLNLLL  359

Query  303   CCFSSFFAM  277
                 +  A 
Sbjct  360   VLGIAIIAF  368



>ref|XP_006443539.1| hypothetical protein CICLE_v10020463mg [Citrus clementina]
 gb|ESR56779.1| hypothetical protein CICLE_v10020463mg [Citrus clementina]
Length=369

 Score =   108 bits (271),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 89/309 (29%), Positives = 140/309 (45%), Gaps = 29/309 (9%)
 Frame = -1

Query  1158  RHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIP  979
             ++K+ SY  G     VGG+  +D D+P   +LLL+G  GSGKSSLVN +  V        
Sbjct  47    KNKILSYTPGAWIENVGGMTLSDYDVPKTTSLLLIGPKGSGKSSLVNRISKVFEND---K  103

Query  978   FAQTSSQPTKFT-----TMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSD  814
             FA   +Q T  +     T  L+E+ + R   N F +YDTR L     D  +  +  W+ +
Sbjct  104   FASERAQVTYNSSVGDGTYFLQEYTIPRG-SNSFSLYDTRSLSDDASDN-INMIKLWIME  161

Query  813   GVRHNQPCCRGSDDD--REMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDF---SSG  649
             GVRH +   R SD    R  M         +    R+VN V+ V D     K     S  
Sbjct  162   GVRHGELVIRRSDSSSLRNRMRCKARKIGCDPSVIRKVNFVIFVVDGLAVLKSMEGDSDV  221

Query  648   DLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYD  469
             + ++ + +   F+ P +   ++KP++++THGD+L+  +R   R  L E LGI      +D
Sbjct  222   EKQYDQIVATTFNCPYLSFRDDKPVVVVTHGDLLSLTDRARIRTYLGELLGIPPAKQIFD  281

Query  468   IACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPK-----RKFKDWVLAFASWVL  304
             I          E  DP +   + + +   L  +DR    K     + F+  V+AF + +L
Sbjct  282   I---------PESSDPENELIIIDMLRYCLEHADRNLSCKSCARNKGFRVSVMAFLNLLL  332

Query  303   CCFSSFFAM  277
                 +  A 
Sbjct  333   VLGIAIIAF  341



>ref|XP_002265228.1| PREDICTED: uncharacterized protein LOC100246086 isoform X1 [Vitis 
vinifera]
 emb|CBI33051.3| unnamed protein product [Vitis vinifera]
Length=384

 Score =   108 bits (271),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 80/249 (32%), Positives = 123/249 (49%), Gaps = 12/249 (5%)
 Frame = -1

Query  1185  ISMEGLDLLRHKLTSYQAGDLWVPV-GGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMY  1009
             I    L+  + ++ SY  G  W+ + GG+K +D ++P   +L+LVG  GSGKSSL+N + 
Sbjct  47    IRTNALEKAKSRILSYTPG-AWIEMSGGMKFSDYNVPETTSLILVGPKGSGKSSLINKIS  105

Query  1008  SVLGRSGLIP-FAQTSSQ-PTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMED  835
              V       P  AQ S        T  L+E+ + R   + FC+YDTRGL     D  M+ 
Sbjct  106   RVFEDDKFAPERAQVSYNLSVGDGTYFLQEYMIPRGSTS-FCLYDTRGLSDVSSDN-MQM  163

Query  834   VWSWMSDGVRHNQPCCRGSDDD--REMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKD  661
             +  W++ GVRH +   R SD    R  M+        N    R VN V+ V +     K 
Sbjct  164   LKHWITKGVRHGELAIRNSDSPSIRARMKCKARQSGYNSSKTRLVNFVIFVVNGLSVLKS  223

Query  660   FSSGD----LKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGI  493
               S D      +++ I  +F  P +   ++ P++++THGD+L+  +R   R+ L E LGI
Sbjct  224   IDSCDDGASQFYIQTIAEMFCCPYLSFRDDMPVVVVTHGDLLSLSDRARVRVHLGEHLGI  283

Query  492   SETTGAYDI  466
             S     +DI
Sbjct  284   SPGKQIFDI  292



>gb|KDO65996.1| hypothetical protein CISIN_1g015952mg [Citrus sinensis]
Length=397

 Score =   108 bits (271),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 89/309 (29%), Positives = 139/309 (45%), Gaps = 29/309 (9%)
 Frame = -1

Query  1158  RHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIP  979
             ++K+ SY  G     VGG+  +D D+P   +LLL+G  GSGKSSLVN +  V        
Sbjct  75    KNKILSYTPGAWIENVGGMTLSDYDVPKTTSLLLIGPKGSGKSSLVNRISKVFEND---K  131

Query  978   FAQTSSQPTKFT-----TMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSD  814
             FA   +Q T  +     T  L+E+ + R   N F +YDTR L     D  +  +  W+ +
Sbjct  132   FASERAQVTYNSSVGDGTYFLQEYTIPRG-SNSFSLYDTRSLSDDASDN-INMIKLWIME  189

Query  813   GVRHNQPCCRGSDDD--REMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDF---SSG  649
             GVRH +   R SD    R  M              R+VN V+ V D     K     S  
Sbjct  190   GVRHGELVIRRSDSSSLRNRMRCKAHKIGCEPSVIRKVNFVIFVVDGLAVLKSMEGDSDV  249

Query  648   DLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYD  469
             + ++ + +   F+ P +   ++KP++++THGD+L+  +R   R  L E LGI      +D
Sbjct  250   EKQYNQIVATTFNCPYLSFRDDKPVVVVTHGDLLSLTDRARIRTYLGELLGIPPAKQIFD  309

Query  468   IACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPK-----RKFKDWVLAFASWVL  304
             I          E  DP +   + + +   L  +DR    K     + F+  V+AF + +L
Sbjct  310   I---------PESSDPENELIIVDMLRYCLEHADRNLSCKSCARNKGFRVSVMAFLNLLL  360

Query  303   CCFSSFFAM  277
                 +  A 
Sbjct  361   VLGIAIIAF  369



>ref|XP_003622872.1| hypothetical protein MTR_7g055730 [Medicago truncatula]
 gb|AES79090.1| 50S ribosome-binding GTPase [Medicago truncatula]
Length=487

 Score =   109 bits (273),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 79/244 (32%), Positives = 120/244 (49%), Gaps = 18/244 (7%)
 Frame = -1

Query  1158  RHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIP  979
             + K+  Y+ G       G+K  D D+P   +L+LVG +GSGKSSL+N +  V       P
Sbjct  96    KEKILRYRPGTWIEKARGLKLRDYDVPETTSLILVGPSGSGKSSLINRISKVFDDDKFAP  155

Query  978   F-AQTSSQPTKFT-TMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSDGVR  805
               AQ S    +   T  L EH + R   N  C+YDTR L  ++  E  E + +WM++GV 
Sbjct  156   TRAQVSYNSLRGDGTYFLREHMIPRDS-NSICLYDTRSL-SNKSHENNEMLKNWMTEGVH  213

Query  804   HNQPCCRGSDDDREMMEYSMAGRCANKYCK--RRVNCVLVVAD-------MEEAFKDFSS  652
             H +   R  D+          G     +    R+VN V+ V +       ME A   F +
Sbjct  214   HGELVIRSKDNQTLTESLKCKGNKKGFFSSKSRKVNFVIYVLNGLSVLNMMENADGAFKA  273

Query  651   GDLKHVEAI--KMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTG  478
                +++E I     F++P +   ++KP+L+LTHGD+L+  +R   R+ L E LGI  T  
Sbjct  274   ---RYIEEIVSTFNFNNPFLSFKDDKPVLVLTHGDLLSLSDRARVRVYLGEVLGIPPTKQ  330

Query  477   AYDI  466
              +DI
Sbjct  331   IFDI  334



>ref|XP_011089056.1| PREDICTED: uncharacterized protein LOC105170127 isoform X2 [Sesamum 
indicum]
Length=425

 Score =   107 bits (267),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 91/311 (29%), Positives = 147/311 (47%), Gaps = 20/311 (6%)
 Frame = -1

Query  1179  MEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVL  1000
             ++ L+  + +L SY  G     +  +  ++ D+P    LLL+G  GSGKSSL+N +  VL
Sbjct  97    IDRLEEAKSRLLSYTPGAWAEKIDVMDLSEYDVPNTTLLLLIGPKGSGKSSLINKISRVL  156

Query  999   GRSGLIPF-AQTSSQPTKFT-TMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWS  826
                 ++   AQ S   +K   T  L E+ + R     FC+YDTR L      E ++ +  
Sbjct  157   ENDIIVSGRAQVSWNSSKEEGTYFLHEYVIPRGS-GSFCLYDTRSL-SDDSSENLKMLQR  214

Query  825   WMSDGVRHNQPCCRGSD-DDREMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDFSSG  649
             WM+ GV H +   R SD +D +      A R  +    R +N V+ V +     +   S 
Sbjct  215   WMTKGVCHGELVKRKSDGEDLKARLKCKARRSRSSSQFREINFVIFVVNGLSVLESMDSV  274

Query  648   DLKHVEAIKMI---FHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTG  478
             D K  E  +MI   F++P +   ++KP++++THGD+L+  +RV  R+ L E LG+     
Sbjct  275   DGKKKEYSQMIATNFNNPLLSFKDDKPIVVITHGDLLSLSDRVRIRVYLGELLGVPPKGQ  334

Query  477   AYDIACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKDWVLAFASWVLCC  298
              +DI          E  D  +  A+ + +   L ++DR   PK  F   V +    +LC 
Sbjct  335   IFDI---------PESNDSATDLAIVDMLIYCLERADRNLPPKNLFVGEVPSLRCMLLCI  385

Query  297   FSSFFAMLANF  265
                  AM+  F
Sbjct  386   ---VLAMVVVF  393



>gb|KDO65997.1| hypothetical protein CISIN_1g015952mg [Citrus sinensis]
Length=346

 Score =   106 bits (264),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 82/276 (30%), Positives = 126/276 (46%), Gaps = 24/276 (9%)
 Frame = -1

Query  1158  RHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIP  979
             ++K+ SY  G     VGG+  +D D+P   +LLL+G  GSGKSSLVN +  V        
Sbjct  74    KNKILSYTPGAWIENVGGMTLSDYDVPKTTSLLLIGPKGSGKSSLVNRISKVFEND---K  130

Query  978   FAQTSSQPTKFT-----TMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSD  814
             FA   +Q T  +     T  L+E+ + R   N F +YDTR L     D  +  +  W+ +
Sbjct  131   FASERAQVTYNSSVGDGTYFLQEYTIPRG-SNSFSLYDTRSLSDDASD-NINMIKLWIME  188

Query  813   GVRHNQPCCRGSDDD--REMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDF---SSG  649
             GVRH +   R SD    R  M              R+VN V+ V D     K     S  
Sbjct  189   GVRHGELVIRRSDSSSLRNRMRCKAHKIGCEPSVIRKVNFVIFVVDGLAVLKSMEGDSDV  248

Query  648   DLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYD  469
             + ++ + +   F+ P +   ++KP++++THGD+L+  +R   R  L E LGI      +D
Sbjct  249   EKQYNQIVATTFNCPYLSFRDDKPVVVVTHGDLLSLTDRARIRTYLGELLGIPPAKQIFD  308

Query  468   IACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRT  361
             I          E  DP +   + + +   L  +DR 
Sbjct  309   I---------PESSDPENELIIVDMLRYCLEHADRN  335



>ref|NP_001150449.1| ATP binding protein [Zea mays]
 gb|ACG39142.1| ATP binding protein [Zea mays]
Length=375

 Score =   106 bits (265),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 73/231 (32%), Positives = 116/231 (50%), Gaps = 10/231 (4%)
 Frame = -1

Query  1140  YQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIPFA----  973
             Y+ GD    VGG K     +P V TLLLVG  GSGKS+LVN +  V  +    PFA    
Sbjct  69    YKPGDWIEGVGGAKAGHFVLPEVTTLLLVGPRGSGKSTLVNRITRVFDKDD-DPFAPDRA  127

Query  972   QTSSQPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSDGVRHNQP  793
             Q S       TM L E+ + R+  +  C+YDTRG   + +++  + +  WM+ G+ H + 
Sbjct  128   QVSCNSKSNGTMFLREYPIPRNS-SAVCIYDTRGW-SNDLEKNFKMLHQWMTKGISHGET  185

Query  792   CCRGSDDDREMMEYSMAGRCAN--KYCKRRVNCVLVVADMEEAFKDFSSGDLKHVEAIKM  619
                  D+  ++      GR  +  +Y  R+VN V+ V D     +     +  + E ++ 
Sbjct  186   TMWDDDEGNKIGNMKPLGRQYSFLRYKIRKVNFVIFVVDGVAVLESMDDSNKGYTEILRQ  245

Query  618   IFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYDI  466
              F  P +   ++KP++++THGD L+ ++RV  + +L E L I      YDI
Sbjct  246   TFMYPFLSIGDDKPVVVVTHGDRLSIQQRVHVQAELAELLDIPAQQ-IYDI  295



>gb|KDO65999.1| hypothetical protein CISIN_1g015952mg [Citrus sinensis]
Length=347

 Score =   106 bits (264),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 82/276 (30%), Positives = 126/276 (46%), Gaps = 24/276 (9%)
 Frame = -1

Query  1158  RHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIP  979
             ++K+ SY  G     VGG+  +D D+P   +LLL+G  GSGKSSLVN +  V        
Sbjct  75    KNKILSYTPGAWIENVGGMTLSDYDVPKTTSLLLIGPKGSGKSSLVNRISKVFEND---K  131

Query  978   FAQTSSQPTKFT-----TMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSD  814
             FA   +Q T  +     T  L+E+ + R   N F +YDTR L     D  +  +  W+ +
Sbjct  132   FASERAQVTYNSSVGDGTYFLQEYTIPRG-SNSFSLYDTRSLSDDASD-NINMIKLWIME  189

Query  813   GVRHNQPCCRGSDDD--REMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDF---SSG  649
             GVRH +   R SD    R  M              R+VN V+ V D     K     S  
Sbjct  190   GVRHGELVIRRSDSSSLRNRMRCKAHKIGCEPSVIRKVNFVIFVVDGLAVLKSMEGDSDV  249

Query  648   DLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYD  469
             + ++ + +   F+ P +   ++KP++++THGD+L+  +R   R  L E LGI      +D
Sbjct  250   EKQYNQIVATTFNCPYLSFRDDKPVVVVTHGDLLSLTDRARIRTYLGELLGIPPAKQIFD  309

Query  468   IACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRT  361
             I          E  DP +   + + +   L  +DR 
Sbjct  310   I---------PESSDPENELIIVDMLRYCLEHADRN  336



>ref|XP_011089055.1| PREDICTED: uncharacterized protein LOC105170127 isoform X1 [Sesamum 
indicum]
Length=437

 Score =   107 bits (267),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 91/311 (29%), Positives = 147/311 (47%), Gaps = 20/311 (6%)
 Frame = -1

Query  1179  MEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVL  1000
             ++ L+  + +L SY  G     +  +  ++ D+P    LLL+G  GSGKSSL+N +  VL
Sbjct  109   IDRLEEAKSRLLSYTPGAWAEKIDVMDLSEYDVPNTTLLLLIGPKGSGKSSLINKISRVL  168

Query  999   GRSGLIPF-AQTSSQPTKFT-TMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWS  826
                 ++   AQ S   +K   T  L E+ + R     FC+YDTR L      E ++ +  
Sbjct  169   ENDIIVSGRAQVSWNSSKEEGTYFLHEYVIPRGS-GSFCLYDTRSL-SDDSSENLKMLQR  226

Query  825   WMSDGVRHNQPCCRGSD-DDREMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDFSSG  649
             WM+ GV H +   R SD +D +      A R  +    R +N V+ V +     +   S 
Sbjct  227   WMTKGVCHGELVKRKSDGEDLKARLKCKARRSRSSSQFREINFVIFVVNGLSVLESMDSV  286

Query  648   DLKHVEAIKMI---FHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTG  478
             D K  E  +MI   F++P +   ++KP++++THGD+L+  +RV  R+ L E LG+     
Sbjct  287   DGKKKEYSQMIATNFNNPLLSFKDDKPIVVITHGDLLSLSDRVRIRVYLGELLGVPPKGQ  346

Query  477   AYDIACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPKRKFKDWVLAFASWVLCC  298
              +DI          E  D  +  A+ + +   L ++DR   PK  F   V +    +LC 
Sbjct  347   IFDI---------PESNDSATDLAIVDMLIYCLERADRNLPPKNLFVGEVPSLRCMLLCI  397

Query  297   FSSFFAMLANF  265
                  AM+  F
Sbjct  398   ---VLAMVVVF  405



>gb|KDO66000.1| hypothetical protein CISIN_1g015952mg [Citrus sinensis]
Length=350

 Score =   106 bits (264),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 82/276 (30%), Positives = 126/276 (46%), Gaps = 24/276 (9%)
 Frame = -1

Query  1158  RHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIP  979
             ++K+ SY  G     VGG+  +D D+P   +LLL+G  GSGKSSLVN +  V        
Sbjct  78    KNKILSYTPGAWIENVGGMTLSDYDVPKTTSLLLIGPKGSGKSSLVNRISKVFEND---K  134

Query  978   FAQTSSQPTKFT-----TMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSD  814
             FA   +Q T  +     T  L+E+ + R   N F +YDTR L     D  +  +  W+ +
Sbjct  135   FASERAQVTYNSSVGDGTYFLQEYTIPRG-SNSFSLYDTRSLSDDASD-NINMIKLWIME  192

Query  813   GVRHNQPCCRGSDDD--REMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDF---SSG  649
             GVRH +   R SD    R  M              R+VN V+ V D     K     S  
Sbjct  193   GVRHGELVIRRSDSSSLRNRMRCKAHKIGCEPSVIRKVNFVIFVVDGLAVLKSMEGDSDV  252

Query  648   DLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYD  469
             + ++ + +   F+ P +   ++KP++++THGD+L+  +R   R  L E LGI      +D
Sbjct  253   EKQYNQIVATTFNCPYLSFRDDKPVVVVTHGDLLSLTDRARIRTYLGELLGIPPAKQIFD  312

Query  468   IACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRT  361
             I          E  DP +   + + +   L  +DR 
Sbjct  313   I---------PESSDPENELIIVDMLRYCLEHADRN  339



>gb|KDO66001.1| hypothetical protein CISIN_1g015952mg [Citrus sinensis]
Length=361

 Score =   106 bits (264),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 82/276 (30%), Positives = 126/276 (46%), Gaps = 24/276 (9%)
 Frame = -1

Query  1158  RHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIP  979
             ++K+ SY  G     VGG+  +D D+P   +LLL+G  GSGKSSLVN +  V        
Sbjct  89    KNKILSYTPGAWIENVGGMTLSDYDVPKTTSLLLIGPKGSGKSSLVNRISKVFEND---K  145

Query  978   FAQTSSQPTKFT-----TMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSD  814
             FA   +Q T  +     T  L+E+ + R   N F +YDTR L     D  +  +  W+ +
Sbjct  146   FASERAQVTYNSSVGDGTYFLQEYTIPRG-SNSFSLYDTRSLSDDASD-NINMIKLWIME  203

Query  813   GVRHNQPCCRGSDDD--REMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDF---SSG  649
             GVRH +   R SD    R  M              R+VN V+ V D     K     S  
Sbjct  204   GVRHGELVIRRSDSSSLRNRMRCKAHKIGCEPSVIRKVNFVIFVVDGLAVLKSMEGDSDV  263

Query  648   DLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYD  469
             + ++ + +   F+ P +   ++KP++++THGD+L+  +R   R  L E LGI      +D
Sbjct  264   EKQYNQIVATTFNCPYLSFRDDKPVVVVTHGDLLSLTDRARIRTYLGELLGIPPAKQIFD  323

Query  468   IACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRT  361
             I          E  DP +   + + +   L  +DR 
Sbjct  324   I---------PESSDPENELIIVDMLRYCLEHADRN  350



>gb|AFW74481.1| ATP binding protein [Zea mays]
Length=419

 Score =   106 bits (264),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 73/231 (32%), Positives = 115/231 (50%), Gaps = 10/231 (4%)
 Frame = -1

Query  1140  YQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIPFA----  973
             Y+ GD    VG  K     +P V TLLLVG  GSGKS+LVN +  V  +    PFA    
Sbjct  113   YKPGDWIEGVGSAKAGHFVLPEVTTLLLVGPRGSGKSTLVNRITRVFDKDD-DPFAPDRA  171

Query  972   QTSSQPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSDGVRHNQP  793
             Q S       TM L E+ + R+  +  C+YDTRG   + +++  + +  WM+ G+ H + 
Sbjct  172   QVSCNSKSNGTMFLREYPIPRNS-SAVCIYDTRGW-SNDLEKNFKMLHQWMTKGISHGET  229

Query  792   CCRGSDDDREMMEYSMAGRCAN--KYCKRRVNCVLVVADMEEAFKDFSSGDLKHVEAIKM  619
                  D+  ++      GR  +  +Y  R+VN VL V D     +     +  + E ++ 
Sbjct  230   TMWDDDEGNKIGNMKPLGRQYSFLRYKIRKVNFVLFVVDGVAVLESMDDSNKGYTEILRQ  289

Query  618   IFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYDI  466
              F  P +   ++KP++++THGD L+ ++RV  + +L E L I      YDI
Sbjct  290   TFMYPFLSIGDDKPVVVVTHGDRLSIQQRVHVQAELAELLDIPAQQ-IYDI  339



>ref|XP_010646542.1| PREDICTED: uncharacterized protein LOC100246086 isoform X2 [Vitis 
vinifera]
Length=315

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 74/223 (33%), Positives = 111/223 (50%), Gaps = 10/223 (4%)
 Frame = -1

Query  1110  GGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIP-FAQTSSQ-PTKFTTM  937
             GG+K +D ++P   +L+LVG  GSGKSSL+N +  V       P  AQ S        T 
Sbjct  3     GGMKFSDYNVPETTSLILVGPKGSGKSSLINKISRVFEDDKFAPERAQVSYNLSVGDGTY  62

Query  936   LLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSDGVRHNQPCCRGSDDD--RE  763
              L+E+ + R   + FC+YDTRGL     D  M+ +  W++ GVRH +   R SD    R 
Sbjct  63    FLQEYMIPRGSTS-FCLYDTRGLSDVSSDN-MQMLKHWITKGVRHGELAIRNSDSPSIRA  120

Query  762   MMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDFSSGD----LKHVEAIKMIFHSPSIR  595
              M+        N    R VN V+ V +     K   S D      +++ I  +F  P + 
Sbjct  121   RMKCKARQSGYNSSKTRLVNFVIFVVNGLSVLKSIDSCDDGASQFYIQTIAEMFCCPYLS  180

Query  594   RSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYDI  466
               ++ P++++THGD+L+  +R   R+ L E LGIS     +DI
Sbjct  181   FRDDMPVVVVTHGDLLSLSDRARVRVHLGEHLGISPGKQIFDI  223



>ref|XP_010926164.1| PREDICTED: uncharacterized protein LOC105048535 isoform X3 [Elaeis 
guineensis]
Length=393

 Score =   105 bits (262),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 74/227 (33%), Positives = 108/227 (48%), Gaps = 10/227 (4%)
 Frame = -1

Query  1173  GLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGR  994
              L   ++ +  ++ GD    VGG K +D DIP   TLLLVG  GSGKS+LVN +  V   
Sbjct  94    ALQAAKNIIARHRPGDWIEEVGGTKASDYDIPETTTLLLVGPRGSGKSTLVNRITRVFQD  153

Query  993   SGLIPFAQTSSQPTKFT--TMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWM  820
                 P     S     T  +  L+E+ + R+ K+  CVYDTR L     D   + +  WM
Sbjct  154   DPFAPDRGQVSHNVSVTEGSCFLQEYMIPRNSKS-LCVYDTRSLSTLSSD-NFKLLQHWM  211

Query  819   SDGVRHNQPCCRGSDDDREMMEYSMAGRCAN-KYC---KRRVNCVLVVADMEEAFKDFSS  652
               GV H Q   R SDD   +    + G     ++C   KR VN V+ V D     K    
Sbjct  212   MQGVSHRQMVIRDSDD--VVTRKRIKGTAQQGQFCPCQKRMVNFVIFVVDGISVLKSMDD  269

Query  651   GDLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKL  511
              D ++ + +   F+ P +   + KP++++THGD L+  +R   R  L
Sbjct  270   KDTQYNDMLAETFNYPFLSFHDNKPVVVVTHGDELSVSDRAHIRTYL  316



>emb|CDP03923.1| unnamed protein product [Coffea canephora]
Length=434

 Score =   104 bits (260),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 82/248 (33%), Positives = 124/248 (50%), Gaps = 9/248 (4%)
 Frame = -1

Query  1170  LDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRS  991
             L+  ++++ SY  G      GG K  D  +P + +LLLVG  GSGKSSL+N +  VL   
Sbjct  104   LEEAKNRILSYTPGSWIRKFGGSKLGDYHVPEITSLLLVGPKGSGKSSLINKISRVLEND  163

Query  990   GLIP-FAQTSSQPTKFT-TMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMS  817
                P  AQ S   +    T  L+E+ + R   N FC+YDTR L      E  +    WM+
Sbjct  164   KFAPERAQVSYNSSAGEGTYFLQEYEIPRGS-NSFCLYDTRCL-SDDSSENTKIFKQWMT  221

Query  816   DGVRHNQPCCRGSDDD-REMMEYSMAGRCANKYCKRRVNCVLVVA----DMEEAFKDFSS  652
              GVR+ +   R SD    +    S A R  N   K RV   +V+      + E+   +  
Sbjct  222   KGVRNGELVKRPSDGAIVKATIKSKARRNGNLSGKARVVNFVVMVVNGLSVLESMDSYDE  281

Query  651   GDLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAY  472
             G   + + I   F++P +   ++KP++++THGD+L   +RV  R+ L E LGI   T  +
Sbjct  282   GKKLYNQMIAKEFNNPYLSFKDDKPVVVVTHGDLLALSDRVRVRVYLGELLGIPPKTQVF  341

Query  471   DIACLSES  448
             DIA  ++S
Sbjct  342   DIADCNDS  349



>tpg|DAA47951.1| TPA: hypothetical protein ZEAMMB73_985826 [Zea mays]
Length=341

 Score =   102 bits (254),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 72/234 (31%), Positives = 116/234 (50%), Gaps = 10/234 (4%)
 Frame = -1

Query  1149  LTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIPFA-  973
             L+ Y+ GD    VGG K     +P V TLLLVG  GS KS+LVN +  V  +    PFA 
Sbjct  32    LSRYKPGDWIEGVGGAKAGHFVLPEVTTLLLVGPRGSVKSTLVNRITRVFDKDD-DPFAP  90

Query  972   ---QTSSQPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSDGVRH  802
                Q S       TM L E+ + R+  +  C+YDTRG   + +++  + +  WM+ G+ H
Sbjct  91    DRAQVSCNSQSNGTMFLREYPIPRNS-SAVCIYDTRGW-SNDLEKNFKMLHQWMTKGISH  148

Query  801   NQPCCRGSDDDREMMEYSMAGRCAN--KYCKRRVNCVLVVADMEEAFKDFSSGDLKHVEA  628
              +      D+  ++      GR  +  +Y   +VN V+ V D     +     +  + E 
Sbjct  149   GETTMWDDDEGNKIGNMKPLGRQYSFLRYKIWKVNFVIFVVDGVAVLESMDDSNKGYTEI  208

Query  627   IKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYDI  466
             ++  F  P +   ++KP++++THGD L+ ++RV  + +L E L I      YDI
Sbjct  209   LRQTFMYPFLSIGDDKPVVVVTHGDRLSIQQRVHVQAELAELLDIP-VQQIYDI  261



>ref|XP_008666477.1| PREDICTED: uncharacterized protein LOC103645140 [Zea mays]
Length=355

 Score =   101 bits (252),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 72/234 (31%), Positives = 116/234 (50%), Gaps = 10/234 (4%)
 Frame = -1

Query  1149  LTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIPFA-  973
             L+ Y+ GD    VGG K     +P V TLLLVG  GS KS+LVN +  V  +    PFA 
Sbjct  46    LSRYKPGDWIEGVGGAKAGHFVLPEVTTLLLVGPRGSVKSTLVNRITRVFDKDD-DPFAP  104

Query  972   ---QTSSQPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSDGVRH  802
                Q S       TM L E+ + R+  +  C+YDTRG   + +++  + +  WM+ G+ H
Sbjct  105   DRAQVSCNSQSNGTMFLREYPIPRNS-SAVCIYDTRGW-SNDLEKNFKMLHQWMTKGISH  162

Query  801   NQPCCRGSDDDREMMEYSMAGRCAN--KYCKRRVNCVLVVADMEEAFKDFSSGDLKHVEA  628
              +      D+  ++      GR  +  +Y   +VN V+ V D     +     +  + E 
Sbjct  163   GETTMWDDDEGNKIGNMKPLGRQYSFLRYKIWKVNFVIFVVDGVAVLESMDDSNKGYTEI  222

Query  627   IKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYDI  466
             ++  F  P +   ++KP++++THGD L+ ++RV  + +L E L I      YDI
Sbjct  223   LRQTFMYPFLSIGDDKPVVVVTHGDRLSIQQRVHVQAELAELLDIP-VQQIYDI  275



>emb|CAB45502.1| putative protein [Arabidopsis thaliana]
 emb|CAB78345.1| putative protein [Arabidopsis thaliana]
Length=360

 Score =   100 bits (249),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 102/204 (50%), Gaps = 5/204 (2%)
 Frame = -1

Query  1062  LLVGLTGSGKSSLVNFMYSVLGRSG-LIPFAQTS-SQPTKFTTMLLEEHNVLRSKKNGFC  889
             +LVG  G+GKSSLVN +  V+     L+  AQ S   P+K  T  ++E+ + R     FC
Sbjct  1     MLVGPKGAGKSSLVNKITRVIEDDAFLLDRAQESFGTPSKGGTYFVQEYMISRGGSASFC  60

Query  888   VYDTRGLDCHRMDEGMEDVWSWMSDGVRHNQPCCRGSDDDREMMEYSMAGRCANKYCKRR  709
             +YDTRGL      +    +  WM+ GV H +P    SD     ++  +       Y +R+
Sbjct  61    LYDTRGLSRISSSDNTSMIEQWMTRGVLHGEPVIWASDSSD--LKDRLIRDGGTGYERRK  118

Query  708   VNCVLVVADMEEAFKDFSSGDLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERV  529
             VN ++ V +  E  K     +  +   I   F+SP +   ++KP +++THGD+L+ EER 
Sbjct  119   VNSIIFVVNAVEILKSMEC-ETSYASMITTAFNSPILLFKDDKPAVVMTHGDMLSREERA  177

Query  528   ETRLKLCESLGISETTGAYDIACL  457
               R+ L E L   +T  A  I  L
Sbjct  178   RVRVFLGELLESRDTATAITICNL  201



>ref|XP_004492277.1| PREDICTED: uncharacterized protein LOC101507360 isoform X2 [Cicer 
arietinum]
Length=446

 Score =   101 bits (251),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 80/254 (31%), Positives = 124/254 (49%), Gaps = 23/254 (9%)
 Frame = -1

Query  1185  ISMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYS  1006
             I  + L   + K+ SY+ G       G+K  D D+P    L+LVG  GSGKSSL+N +  
Sbjct  87    IDSKSLKEAKEKILSYKPGTWIEKARGLKLCDYDVPETTCLILVGPKGSGKSSLINRISK  146

Query  1005  VLGRSGLIPF-AQTSSQP-TKFTTMLLEEHNVLRSKKNGFCVYDTRGL-----DCHRMDE  847
             V       P  AQ S        T  L E+   R   N  C+YDTR L     +C ++  
Sbjct  147   VFEDDKFAPARAQVSYNSLIGDGTYFLCEYMFPRDS-NSICLYDTRSLPDNSRECDKI--  203

Query  846   GMEDVWSWMSDGVRHNQPCCRGSDDDR--EMMEYS--MAGRCANKYCKRRVNCVLVVAD-  682
                 + +WM+ GVR+ +   R  D  R  + +++   M G  +NK   R+VN V+ V + 
Sbjct  204   ----LKNWMTKGVRNGELVVRSIDSQRLRKSLKHKGDMKGFFSNK--SRKVNFVICVINS  257

Query  681   --MEEAFKDFSSGDLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLC  508
               +  A ++  + + K++E I   F+ P +   ++KP+L+ THGD+L+  +R      L 
Sbjct  258   LLVLNAMENAGALEDKYIETIVSTFNCPFLSFKDDKPVLVFTHGDLLSLSDRARVHAYLG  317

Query  507   ESLGISETTGAYDI  466
             E LGI  T   +DI
Sbjct  318   ELLGIPPTKQIFDI  331



>gb|EEC78892.1| hypothetical protein OsI_19263 [Oryza sativa Indica Group]
Length=367

 Score = 99.8 bits (247),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 69/224 (31%), Positives = 110/224 (49%), Gaps = 13/224 (6%)
 Frame = -1

Query  1140  YQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIPF---AQ  970
             Y+ GDL   V G K  D  +P + T LLVG   +GKS+LVN +  V  +         AQ
Sbjct  61    YKPGDLVEGVCGTKSGDYVLPDITTFLLVGPRDAGKSALVNRITRVFDKDDDPDAPDRAQ  120

Query  969   TSSQPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSDGVRHNQPC  790
              S       T  L E+ V R+  N  C+YDTR L  +  +   + +  WM+ G+ H    
Sbjct  121   VSCNSKSTGTSFLREYRVPRNS-NSICIYDTRSLS-NNHENNFKMLQRWMTKGLSHGDII  178

Query  789   CRGSDDDREMMEYSMAGRCANKY----CK-RRVNCVLVVADMEEAFKDFSSGDLKHVEAI  625
                +D+  ++      GR   +Y    CK R+VN V+ V +     +   + +  +++ +
Sbjct  179   TWDNDNYSKIQNIKSMGR---QYSFLRCKTRKVNFVIFVVNGASVLESIENNNKNYIDML  235

Query  624   KMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGI  493
                F  P +   ++KP +++THGD LTA++R+  R +L E LGI
Sbjct  236   HKTFMYPFLSFGDDKPAVVVTHGDRLTAQQRMHVRNELVELLGI  279



>ref|NP_001055071.1| Os05g0274300 [Oryza sativa Japonica Group]
 gb|AAT85121.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF16985.1| Os05g0274300 [Oryza sativa Japonica Group]
 gb|EEE63067.1| hypothetical protein OsJ_17875 [Oryza sativa Japonica Group]
Length=382

 Score = 99.4 bits (246),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 69/224 (31%), Positives = 110/224 (49%), Gaps = 13/224 (6%)
 Frame = -1

Query  1140  YQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIPF---AQ  970
             Y+ GDL   V G K  D  +P + T LLVG   +GKS+LVN +  V  +         AQ
Sbjct  76    YKPGDLVEGVCGTKSGDYVLPDITTFLLVGPRDAGKSALVNRITRVFDKDDDPDAPDRAQ  135

Query  969   TSSQPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSDGVRHNQPC  790
              S       T  L E+ V R+  N  C+YDTR L  +  +   + +  WM+ G+ H    
Sbjct  136   VSCNSKSTGTSFLREYRVPRNS-NSICIYDTRSLS-NNHENNFKMLQRWMTKGLSHGDII  193

Query  789   CRGSDDDREMMEYSMAGRCANKY----CK-RRVNCVLVVADMEEAFKDFSSGDLKHVEAI  625
                +D+  ++      GR   +Y    CK R+VN V+ V +     +   + +  +++ +
Sbjct  194   TWDNDNYSKIQNIKSMGR---QYSFLRCKTRKVNFVIFVVNGASVLESIENNNKNYIDML  250

Query  624   KMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGI  493
                F  P +   ++KP +++THGD LTA++R+  R +L E LGI
Sbjct  251   HKTFMYPFLSFGDDKPAVVVTHGDRLTAQQRMHVRNELVELLGI  294



>ref|XP_006655162.1| PREDICTED: uncharacterized protein LOC102705435 [Oryza brachyantha]
Length=382

 Score = 99.4 bits (246),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 69/227 (30%), Positives = 112/227 (49%), Gaps = 7/227 (3%)
 Frame = -1

Query  1158  RHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRS---G  988
             +  + SY+ GDL   V G K  D  +P + TLLLVG   +GKS+LVN +  V  +     
Sbjct  70    KQLIRSYKPGDLVEGVCGTKAGDYVLPDITTLLLVGPRDAGKSTLVNRITRVFDKDDDPN  129

Query  987   LIPFAQTSSQPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSDGV  808
                 AQ S       T  L E+ V R+  N  C+YDTR L  +  +   + +  WM+ G+
Sbjct  130   APDRAQASCNSKSTGTSFLREYRVPRNS-NSICIYDTRSL-SNNHEINFKTLRRWMTKGL  187

Query  807   RHNQPCCRGSDDDREMMEYSMAGRCANKY-CK-RRVNCVLVVADMEEAFKDFSSGDLKHV  634
              H       +D+  E+      GR  +   CK R+VN V+ V +     +   + +  ++
Sbjct  188   SHGDMVMWDNDNYSEVQNIKSMGRQYSFLRCKTRKVNFVIFVINGATVLESIENSNKNYI  247

Query  633   EAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGI  493
             + +   F  P +   ++KP +++THGD L+ ++R+  R +L E LGI
Sbjct  248   DMLHETFMYPFLSFGDDKPAVVVTHGDRLSLQQRLHVRNELVELLGI  294



>gb|AAS82599.1| hypothetical protein S250_18C08.34 [Sorghum bicolor]
Length=301

 Score = 97.4 bits (241),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 72/248 (29%), Positives = 119/248 (48%), Gaps = 11/248 (4%)
 Frame = -1

Query  1218  KLLREMQRLAFISMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGS  1039
             + LRE +   F     L  ++  +  Y+ GD    VGG K     +P + TLLLVG  GS
Sbjct  42    RQLREAKEFHF--NRQLREVKELIRRYKPGDWVEGVGGAKAGHFLLPEITTLLLVGPRGS  99

Query  1038  GKSSLVNFMYSVLGRSGLIPFA----QTSSQPTKFTTMLLEEHNVLRSKKNGFCVYDTRG  871
             GKS+LVN +  V  +    PFA    Q S   T   T+ L E+ + R+  +  C+YDT G
Sbjct  100   GKSTLVNRITRVFDKDD-DPFAPDRAQVSCNSTSNRTIFLHEYPIPRNS-SAICIYDTCG  157

Query  870   LDCHRMDEGMEDVWSWMSDGVRHNQPCCRGSDDDREMMEYSMAGRCAN--KYCKRRVNCV  697
                +   +  + +  WM+ G+ H +     +D+  +       GR  +  +Y  R+VN V
Sbjct  158   WS-NDPKKNFKMLHQWMTKGISHGETIMWDNDEGNKTGGIKPLGRQYSFLRYITRKVNFV  216

Query  696   LVVADMEEAFKDFSSGDLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRL  517
             + V D     +   S +  + E +   F  P +   ++KP++++THGD L+ ++    + 
Sbjct  217   IFVVDGVAVLESIDSNNKGYTEILHQTFMYPFLSIGDDKPVVVVTHGDRLSIQQCAHVQN  276

Query  516   KLCESLGI  493
             +L E L I
Sbjct  277   ELTELLNI  284



>ref|XP_004958573.1| PREDICTED: uncharacterized protein LOC101768621 isoform X2 [Setaria 
italica]
Length=385

 Score = 97.1 bits (240),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 64/224 (29%), Positives = 111/224 (50%), Gaps = 13/224 (6%)
 Frame = -1

Query  1140  YQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRS---GLIPFAQ  970
             Y+ GD     GG K  D  +P + TLLLVG  G+GKS+LVN +  V  +         AQ
Sbjct  79    YKPGDCIEGAGGAKAGDYILPEITTLLLVGPRGAGKSTLVNRITRVFDKDDDPSAPDRAQ  138

Query  969   TSSQPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSDGVRHNQPC  790
              S       T+ L E+ V R+     C+YDT+ L C+  +   + +  WM+ G+ H +  
Sbjct  139   VSGNSKSNGTVFLREYPVPRNS-TAICIYDTQSLSCNPQN-NFKTLQKWMTKGISHGEIA  196

Query  789   CRGSDDDREMMEYSMAGRCANKY----CK-RRVNCVLVVADMEEAFKDFSSGDLKHVEAI  625
                +++     +    G   N++    CK R+VN V+ V D     +   S    +++ +
Sbjct  197   TGDTNEGNNTKDIKPLG---NQFSYLRCKTRKVNFVIFVVDGVSILQAIESNTEDYIDIL  253

Query  624   KMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGI  493
             +  F  P +   ++KP++++T+G+ L+ ++R   + KL + LGI
Sbjct  254   RQTFMYPCLSIGDDKPVVVVTNGERLSIQQRACVQNKLVDLLGI  297



>ref|XP_002443812.1| hypothetical protein SORBIDRAFT_07g002570 [Sorghum bicolor]
 gb|EES13307.1| hypothetical protein SORBIDRAFT_07g002570 [Sorghum bicolor]
Length=394

 Score = 96.7 bits (239),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 72/246 (29%), Positives = 118/246 (48%), Gaps = 11/246 (4%)
 Frame = -1

Query  1212  LREMQRLAFISMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGK  1033
             LRE +   F     L  ++  +  Y+ GD    VGG K     +P + TLLLVG  GSGK
Sbjct  71    LREAKEFHF--NRQLREVKELIRRYKPGDWVEGVGGAKAGHFLLPEITTLLLVGPRGSGK  128

Query  1032  SSLVNFMYSVLGRSGLIPFA----QTSSQPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLD  865
             S+LVN +  V  +    PFA    Q S   T   T+ L E+ + R+  +  C+YDT G  
Sbjct  129   STLVNRITRVFDKDD-DPFAPDRAQVSCNSTSNRTIFLHEYPIPRNS-SAICIYDTCGWS  186

Query  864   CHRMDEGMEDVWSWMSDGVRHNQPCCRGSDDDREMMEYSMAGRCAN--KYCKRRVNCVLV  691
              +   +  + +  WM+ G+ H +     +D+  +       GR  +  +Y  R+VN V+ 
Sbjct  187   -NDPKKNFKMLHQWMTKGISHGETIMWDNDEGNKTGGIKPLGRQYSFLRYITRKVNFVIF  245

Query  690   VADMEEAFKDFSSGDLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKL  511
             V D     +   S +  + E +   F  P +   ++KP++++THGD L+ ++    + +L
Sbjct  246   VVDGVAVLESIDSNNKGYTEILHQTFMYPFLSIGDDKPVVVVTHGDRLSIQQCAHVQNEL  305

Query  510   CESLGI  493
              E L I
Sbjct  306   TELLNI  311



>ref|XP_004958572.1| PREDICTED: uncharacterized protein LOC101768621 isoform X1 [Setaria 
italica]
Length=386

 Score = 95.5 bits (236),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 65/225 (29%), Positives = 112/225 (50%), Gaps = 14/225 (6%)
 Frame = -1

Query  1140  YQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRS---GLIPFAQ  970
             Y+ GD     GG K  D  +P + TLLLVG  G+GKS+LVN +  V  +         AQ
Sbjct  79    YKPGDCIEGAGGAKAGDYILPEITTLLLVGPRGAGKSTLVNRITRVFDKDDDPSAPDRAQ  138

Query  969   TSSQPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSDGVRHNQPC  790
              S       T+ L E+ V R+     C+YDT+ L C+  +   + +  WM+ G+ H +  
Sbjct  139   VSGNSKSNGTVFLREYPVPRNS-TAICIYDTQSLSCNPQN-NFKTLQKWMTKGISHGEIA  196

Query  789   C-RGSDDDREMMEYSMAGRCANKY----CK-RRVNCVLVVADMEEAFKDFSSGDLKHVEA  628
               R +++     +    G   N++    CK R+VN V+ V D     +   S    +++ 
Sbjct  197   TGRDTNEGNNTKDIKPLG---NQFSYLRCKTRKVNFVIFVVDGVSILQAIESNTEDYIDI  253

Query  627   IKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGI  493
             ++  F  P +   ++KP++++T+G+ L+ ++R   + KL + LGI
Sbjct  254   LRQTFMYPCLSIGDDKPVVVVTNGERLSIQQRACVQNKLVDLLGI  298



>gb|EYU39220.1| hypothetical protein MIMGU_mgv1a026429mg, partial [Erythranthe 
guttata]
Length=288

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 85/294 (29%), Positives = 138/294 (47%), Gaps = 19/294 (6%)
 Frame = -1

Query  1107  GIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGL-IPFAQ-TSSQPTKFTTML  934
             G+  ++  +P   +LLL+G  GSGKSSLVN +  VL +    +  AQ T + PT+  T  
Sbjct  4     GVDLSEYKVPKTTSLLLIGPKGSGKSSLVNKISRVLDKDLFTLERAQVTYNSPTEDGTCF  63

Query  933   LEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSDGVRHNQPCCRGSD--DDREM  760
             L E+ + R K   F +YDTR L    + E  E    WM+ GV   +   R SD  D +  
Sbjct  64    LHEYMIPR-KSGSFSLYDTRSL-SDDLSENRELFNVWMTMGVCDGELVTRNSDSTDFKAR  121

Query  759   MEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDFSSGD---LKHVEAIKMIFHSPSIRRS  589
             ++     R +  Y  R V+ V+ V +     +   S D    ++ + I   F +P +   
Sbjct  122   LKCKSRRRRSTSYKVRAVDFVVFVVNAVSVLESIDSLDENKKRYSQLIAENFKNPLLSYK  181

Query  588   NEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYDIACLSESGIPAEEGDPVSAF  409
             ++KP++ +THGDIL+  +RV  R+ L E LGI  TT  +DI          E  D  +  
Sbjct  182   DDKPVVAVTHGDILSVSDRVRVRIHLGEILGIPPTTQVFDI---------PECDDLATEL  232

Query  408   ALTEAVYRSLLQSDRTHLPKRKFKDWVLAFASWVLCCFSSFFAMLANFFSRFGG  247
              + E +   L ++DR +LP ++  +W +     ++    +   M      +  G
Sbjct  233   TIAEMLTFCLDRADR-NLPTKEPSEWDVRIGGLIVWIVWTVLIMAFLLLKKLSG  285



>gb|EMT26532.1| hypothetical protein F775_07111 [Aegilops tauschii]
Length=412

 Score = 89.7 bits (221),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 73/235 (31%), Positives = 117/235 (50%), Gaps = 15/235 (6%)
 Frame = -1

Query  1176  EGLDLLRHKLTSYQAGDLWVP-VGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVL  1000
             E  DL+R     Y+ G  W+  VG  K  D  +P   TLLLVG  G+GKS+LVN +  V 
Sbjct  100   EAKDLIRR----YKPG-YWIEGVGNTKGGDYLLPETTTLLLVGPRGAGKSTLVNRITRVF  154

Query  999   GRSGLIPFA----QTSSQPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDV  832
              +    PFA    Q S       T  + E+ + R+  NG C+ DTR L     ++  + +
Sbjct  155   DKDD-DPFAPERAQVSYNSKSNGTSFIREYKIPRNS-NGICICDTRSL-SRNPEKDFKML  211

Query  831   WSWMSDGVRHNQPCCRGSDDDREMMEYSMAGRCAN--KYCKRRVNCVLVVADMEEAFKDF  658
               WM+ GV H +     +DDD ++      GR  +   Y  R+VN V+ V D     +  
Sbjct  212   QRWMTKGVSHGEMVTWDTDDDTKIKNLKSMGRQYSFLPYKTRKVNFVIFVVDGVSILRSI  271

Query  657   SSGDLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGI  493
              S    +++  +  F +P +   ++KP +++THGD L+ ++R + + +L E+L I
Sbjct  272   GSDKKGYMDMFRETFMNPFLSFGDDKPAVVVTHGDRLSLQQRSQVQNELAETLAI  326



>ref|XP_004492279.1| PREDICTED: uncharacterized protein LOC101507360 isoform X4 [Cicer 
arietinum]
Length=392

 Score = 88.6 bits (218),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 80/281 (28%), Positives = 124/281 (44%), Gaps = 50/281 (18%)
 Frame = -1

Query  1185  ISMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYS  1006
             I  + L   + K+ SY+ G       G+K  D D+P    L+LVG  GSGKSSL+N +  
Sbjct  87    IDSKSLKEAKEKILSYKPGTWIEKARGLKLCDYDVPETTCLILVGPKGSGKSSLINRISK  146

Query  1005  VLGRSGLIPF-AQTSSQP-TKFTTMLLEEHNVLRSKKNGFCVYDTRGL-----DCHRMDE  847
             V       P  AQ S        T  L E+   R   N  C+YDTR L     +C ++  
Sbjct  147   VFEDDKFAPARAQVSYNSLIGDGTYFLCEYMFPRD-SNSICLYDTRSLPDNSRECDKI--  203

Query  846   GMEDVWSWMSDGVRHNQPCCR-----------------------------GSDDDREMME  754
                 + +WM+ GVR+ +   R                              S   R+ ++
Sbjct  204   ----LKNWMTKGVRNGELVVRFEYLVITFPPIFSNVNIYVKFYQFSIRSIDSQRLRKSLK  259

Query  753   YS--MAGRCANKYCKRRVNCVLVVAD---MEEAFKDFSSGDLKHVEAIKMIFHSPSIRRS  589
             +   M G  +NK   R+VN V+ V +   +  A ++  + + K++E I   F+ P +   
Sbjct  260   HKGDMKGFFSNK--SRKVNFVICVINSLLVLNAMENAGALEDKYIETIVSTFNCPFLSFK  317

Query  588   NEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYDI  466
             ++KP+L+ THGD+L+  +R      L E LGI  T   +DI
Sbjct  318   DDKPVLVFTHGDLLSLSDRARVHAYLGELLGIPPTKQIFDI  358



>ref|XP_004492276.1| PREDICTED: uncharacterized protein LOC101507360 isoform X1 [Cicer 
arietinum]
Length=473

 Score = 88.6 bits (218),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 78/281 (28%), Positives = 123/281 (44%), Gaps = 50/281 (18%)
 Frame = -1

Query  1185  ISMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYS  1006
             I  + L   + K+ SY+ G       G+K  D D+P    L+LVG  GSGKSSL+N +  
Sbjct  87    IDSKSLKEAKEKILSYKPGTWIEKARGLKLCDYDVPETTCLILVGPKGSGKSSLINRISK  146

Query  1005  VLGRSGLIPFAQTSSQPTKF--TTMLLEEHNVLRSKKNGFCVYDTRGL-----DCHRMDE  847
             V       P     S  +     T  L E+   R   N  C+YDTR L     +C ++  
Sbjct  147   VFEDDKFAPARAQVSYNSLIGDGTYFLCEYMFPRD-SNSICLYDTRSLPDNSRECDKI--  203

Query  846   GMEDVWSWMSDGVRHNQPCCR-----------------------------GSDDDREMME  754
                 + +WM+ GVR+ +   R                              S   R+ ++
Sbjct  204   ----LKNWMTKGVRNGELVVRFEYLVITFPPIFSNVNIYVKFYQFSIRSIDSQRLRKSLK  259

Query  753   YS--MAGRCANKYCKRRVNCVLVVAD---MEEAFKDFSSGDLKHVEAIKMIFHSPSIRRS  589
             +   M G  +NK   R+VN V+ V +   +  A ++  + + K++E I   F+ P +   
Sbjct  260   HKGDMKGFFSNK--SRKVNFVICVINSLLVLNAMENAGALEDKYIETIVSTFNCPFLSFK  317

Query  588   NEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYDI  466
             ++KP+L+ THGD+L+  +R      L E LGI  T   +DI
Sbjct  318   DDKPVLVFTHGDLLSLSDRARVHAYLGELLGIPPTKQIFDI  358



>gb|EMS54578.1| hypothetical protein TRIUR3_09023 [Triticum urartu]
Length=400

 Score = 88.2 bits (217),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 75/248 (30%), Positives = 122/248 (49%), Gaps = 23/248 (9%)
 Frame = -1

Query  1215  LLREMQRLAFISMEGLDLLRHKLTSYQAGDLWVP-VGGIKKTDMDIPAVITLLLVGLTGS  1039
             L+R +Q L FI+             Y+ G  W+  VG  K  D  +P   TLLLVG  G+
Sbjct  83    LIRRLQNLRFIN------------PYKPG-YWIEGVGDTKAGDYLLPDTTTLLLVGPRGA  129

Query  1038  GKSSLVNFMYSVLGRSGLIPFA----QTSSQPTKFTTMLLEEHNVLRSKKNGFCVYDTRG  871
             GKS+LVN +  V  +    PFA    Q S       T  + E+ + R+  NG C+ DTR 
Sbjct  130   GKSTLVNRITRVFDKDD-DPFAPERAQVSYNSKSNGTSFIREYKIPRNS-NGICICDTRS  187

Query  870   LDCHRMDEGMEDVWSWMSDGVRHNQPCCRGSDDDREMMEYSMAGRCANKY-CK-RRVNCV  697
             L     ++  + +  WM  G+ H +     +DDD ++      GR  +   CK R+VN V
Sbjct  188   L-SRNPEKDFKMLQRWMMKGISHGEMVTWDTDDDTKIKNLKSMGRQYSFLPCKTRKVNFV  246

Query  696   LVVADMEEAFKDFSSGDLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRL  517
             + V D     +   S    +++ ++  F +P +   ++KP +++THGD L+ ++R + + 
Sbjct  247   IFVVDGVSILRSIGSDKKGYMDMLRGTFMNPFLSFGDDKPAVVVTHGDRLSFQQRSQVQN  306

Query  516   KLCESLGI  493
             +L E+L I
Sbjct  307   ELAETLAI  314



>gb|EPS71715.1| hypothetical protein M569_03045, partial [Genlisea aurea]
Length=233

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 77/245 (31%), Positives = 113/245 (46%), Gaps = 24/245 (10%)
 Frame = -1

Query  1068  TLLLVGLTGSGKSSLVNFMYSVL--GRSG--LIPFAQTSSQPTKFTTMLLEEHNVLRSKK  901
             TLLL+G  GSGKSSLVN +  V   G SG    P +     P +  T  L E+ + R   
Sbjct  1     TLLLIGPKGSGKSSLVNKISRVFETGVSGSSRAPVSCGHKSPPENGTYFLSEYVIPRGS-  59

Query  900   NGFCVYDTRGLDCHRMDEGMEDVWSWMSDGVRHNQPCCRGSDDD--REMMEYSMAGRCAN  727
               FC YDTRGL    + E  + +  WM+ GVRH +   R SD    R  ++       A 
Sbjct  60    GSFCFYDTRGL-SDELIENEKTLERWMTKGVRHGELIERRSDSAELRARLKLKAKRAAAP  118

Query  726   KYCKRRVNCVLVVAD----MEEAFKDFS-SGDLKHVEAIKMIFHSPSIRRSNEKPMLILT  562
                 R V+ V+ V +    ME    D + +G LK +  I   + +  +   +EKP++++T
Sbjct  119   PIESRTVDFVIFVVNAISIMESMNDDGNEAGHLKTI--IVSCYDNALLSFRDEKPVVVVT  176

Query  561   HGDILTAEERVETRLKLCESLGISETTGAYDIACLSESGIPAEEGDPVSAFALTEAVYRS  382
             HGD+L    R   R+ L   LGI      +DI          E  DP +  A+ + +   
Sbjct  177   HGDLLPLRARARIRVFLGNLLGIPPAYQIFDI---------PESHDPATTMAIFDMLVYV  227

Query  381   LLQSD  367
             L ++D
Sbjct  228   LSRAD  232



>ref|XP_004492278.1| PREDICTED: uncharacterized protein LOC101507360 isoform X3 [Cicer 
arietinum]
Length=409

 Score = 86.3 bits (212),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 73/247 (30%), Positives = 108/247 (44%), Gaps = 46/247 (19%)
 Frame = -1

Query  1185  ISMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYS  1006
             I  + L   + K+ SY+ G       G+K  D D+P    L+LVG  GSGKSSL+N +  
Sbjct  87    IDSKSLKEAKEKILSYKPGTWIEKARGLKLCDYDVPETTCLILVGPKGSGKSSLINRISK  146

Query  1005  VLGRSGLIPF-AQTSSQP-TKFTTMLLEEHNVLRSKKNGFCVYDTRGL-----DCHRMDE  847
             V       P  AQ S        T  L E+   R   N  C+YDTR L     +C ++  
Sbjct  147   VFEDDKFAPARAQVSYNSLIGDGTYFLCEYMFPRD-SNSICLYDTRSLPDNSRECDKI--  203

Query  846   GMEDVWSWMSDGVRHNQPCCRGSDDDREMMEYSMAGRCANKYCKRRVNCVLVVADMEEAF  667
                 + +WM+ GVR+ +                             V  +LV+  ME A 
Sbjct  204   ----LKNWMTKGVRNGE----------------------------LVVSLLVLNAMENA-  230

Query  666   KDFSSGDLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISE  487
                 + + K++E I   F+ P +   ++KP+L+ THGD+L+  +R      L E LGI  
Sbjct  231   ---GALEDKYIETIVSTFNCPFLSFKDDKPVLVFTHGDLLSLSDRARVHAYLGELLGIPP  287

Query  486   TTGAYDI  466
             T   +DI
Sbjct  288   TKQIFDI  294



>ref|XP_006443542.1| hypothetical protein CICLE_v10020463mg [Citrus clementina]
 ref|XP_006479216.1| PREDICTED: uncharacterized protein LOC102623837 isoform X5 [Citrus 
sinensis]
 gb|ESR56782.1| hypothetical protein CICLE_v10020463mg [Citrus clementina]
Length=370

 Score = 85.1 bits (209),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 80/309 (26%), Positives = 126/309 (41%), Gaps = 59/309 (19%)
 Frame = -1

Query  1158  RHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIP  979
             ++K+ SY  G     VGG+  +D D+P   +LLL+G  GSGKSSLVN +  V        
Sbjct  78    KNKILSYTPGAWIENVGGMTLSDYDVPKTTSLLLIGPKGSGKSSLVNRISKVFEND---K  134

Query  978   FAQTSSQPTKFT-----TMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSD  814
             FA   +Q T  +     T  L+E+ + R                                
Sbjct  135   FASERAQVTYNSSVGDGTYFLQEYTIPR--------------------------------  162

Query  813   GVRHNQPCCRGSDDD--REMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDF---SSG  649
             GVRH +   R SD    R  M         +    R+VN V+ V D     K     S  
Sbjct  163   GVRHGELVIRRSDSSSLRNRMRCKARKIGCDPSVIRKVNFVIFVVDGLAVLKSMEGDSDV  222

Query  648   DLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYD  469
             + ++ + +   F+ P +   ++KP++++THGD+L+  +R   R  L E LGI      +D
Sbjct  223   EKQYDQIVATTFNCPYLSFRDDKPVVVVTHGDLLSLTDRARIRTYLGELLGIPPAKQIFD  282

Query  468   IACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRTHLPK-----RKFKDWVLAFASWVL  304
             I          E  DP +   + + +   L  +DR    K     + F+  V+AF + +L
Sbjct  283   I---------PESSDPENELIIIDMLRYCLEHADRNLSCKSCARNKGFRVSVMAFLNLLL  333

Query  303   CCFSSFFAM  277
                 +  A 
Sbjct  334   VLGIAIIAF  342



>gb|KDO65998.1| hypothetical protein CISIN_1g015952mg [Citrus sinensis]
Length=317

 Score = 82.0 bits (201),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 73/276 (26%), Positives = 112/276 (41%), Gaps = 54/276 (20%)
 Frame = -1

Query  1158  RHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIP  979
             ++K+ SY  G     VGG+  +D D+P   +LLL+G  GSGKSSLVN +  V        
Sbjct  75    KNKILSYTPGAWIENVGGMTLSDYDVPKTTSLLLIGPKGSGKSSLVNRISKVFEND---K  131

Query  978   FAQTSSQPTKFT-----TMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSD  814
             FA   +Q T  +     T  L+E+ + R                                
Sbjct  132   FASERAQVTYNSSVGDGTYFLQEYTIPR--------------------------------  159

Query  813   GVRHNQPCCRGSDDD--REMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDF---SSG  649
             GVRH +   R SD    R  M              R+VN V+ V D     K     S  
Sbjct  160   GVRHGELVIRRSDSSSLRNRMRCKAHKIGCEPSVIRKVNFVIFVVDGLAVLKSMEGDSDV  219

Query  648   DLKHVEAIKMIFHSPSIRRSNEKPMLILTHGDILTAEERVETRLKLCESLGISETTGAYD  469
             + ++ + +   F+ P +   ++KP++++THGD+L+  +R   R  L E LGI      +D
Sbjct  220   EKQYNQIVATTFNCPYLSFRDDKPVVVVTHGDLLSLTDRARIRTYLGELLGIPPAKQIFD  279

Query  468   IACLSESGIPAEEGDPVSAFALTEAVYRSLLQSDRT  361
             I          E  DP +   + + +   L  +DR 
Sbjct  280   I---------PESSDPENELIIVDMLRYCLEHADRN  306



>ref|XP_009610774.1| PREDICTED: uncharacterized protein LOC104104405 isoform X3 [Nicotiana 
tomentosiformis]
Length=353

 Score = 82.4 bits (202),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 62/191 (32%), Positives = 89/191 (47%), Gaps = 8/191 (4%)
 Frame = -1

Query  1158  RHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIP  979
             + K+  Y  G     VGG+KK+D +IP   TLLL+G   SGKSSLVN +  VL      P
Sbjct  102   KSKILRYTPGSWIEEVGGMKKSDYNIPKKTTLLLIGPKASGKSSLVNKISMVLEDDPFTP  161

Query  978   -FAQTSSQPTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSDGVRH  802
               A  S       T  L+E+ + R   + FC+YDTR L    + E  + V  WM+ GVRH
Sbjct  162   ERAPVSYSSVGDGTYFLQEYTIPRG-SSSFCLYDTRSL-SDDLTENKKMVKQWMTKGVRH  219

Query  801   NQPCCRGSDDDREMMEYSMAGRCANKYC--KRRVNCVLVVADMEEAFKDFSSGD---LKH  637
              +   R SDD     +     R  + Y    + VN V++V +     +     D    + 
Sbjct  220   GELIKRDSDDVHLKSKMKSKARRNSLYVIEAKMVNFVILVVNAVSILELMDGDDETKRQK  279

Query  636   VEAIKMIFHSP  604
              +A+   F+ P
Sbjct  280   TQAVATTFNDP  290



>ref|XP_006284430.1| hypothetical protein CARUB_v10005599mg [Capsella rubella]
 gb|EOA17328.1| hypothetical protein CARUB_v10005599mg [Capsella rubella]
Length=247

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 52/165 (32%), Positives = 76/165 (46%), Gaps = 9/165 (5%)
 Frame = -1

Query  1158  RHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIP  979
             R+K+ SY  G         K  D D+    +++LVG  G+ KSSLVN +  V+     +P
Sbjct  77    RNKILSYTPGSF----SDRKLRDNDVLKTTSIILVGPKGARKSSLVNQITRVIEDDEFLP  132

Query  978   FAQTSSQ---PTKFTTMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDVWSWMSDGV  808
              A+        +K  T  +EE+ + R     FC+YDTRGL      + +  +  WM+ GV
Sbjct  133   PARAQESFGMQSKGGTYFVEEYMIPRGGSGSFCLYDTRGLSHVPSSDNISMIEKWMTRGV  192

Query  807   RHNQPCCRGSDDDREMMEYSMAGRCANKYCKRRVNCVLVVADMEE  673
             R  +P   GSD           G   N+   R+VN V+ V D  E
Sbjct  193   RRGEPVIWGSDSSELKNRLIRDGGTGNEI--RKVNFVIFVVDAVE  235



>ref|XP_006843770.1| hypothetical protein AMTR_s00007p00242150 [Amborella trichopoda]
 gb|ERN05445.1| hypothetical protein AMTR_s00007p00242150 [Amborella trichopoda]
Length=308

 Score = 73.2 bits (178),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 63/201 (31%), Positives = 97/201 (48%), Gaps = 20/201 (10%)
 Frame = -1

Query  1218  KLLREMQRLAFISMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGS  1039
             KL+ + Q+L    +  L+  + K+  Y+ GD  +   G+ K D +IP V TLLL+G  GS
Sbjct  74    KLMLKYQQLQH-RVASLETEKEKILRYKPGDWLIESHGMSKYDYEIPEVTTLLLIGNKGS  132

Query  1038  GKSSLVNFMYSVLGRSGLIP-----FAQTSSQPTKFTTMLLEEHNVLRSKKNGFCVYDTR  874
             GKS+LVN + ++     +       F  +  Q TK+      E+ V  S    FCVYD++
Sbjct  133   GKSTLVNNILNLFEDDRVTSHRAQVFYGSCGQGTKY----FREYMVPNSS---FCVYDSQ  185

Query  873   GLDCHRMDEGMEDVWSWMSDGVRHNQPCCRGSDD-----DREMMEYSMAG-RCANKYCKR  712
             GL      E    +  WM++G++H +   R  D+      R+  E   A  +C ++  KR
Sbjct  186   GLS-GLSSEDCTCLQRWMTEGIQHGELGVRKLDELPNWGFRKKPEGQEAQYKCHSRNEKR  244

Query  711   RVNCVLVVADMEEAFKDFSSG  649
              VN V+ V D     K   SG
Sbjct  245   MVNFVIFVVDALLVLKSMGSG  265



>gb|AFK48527.1| unknown [Lotus japonicus]
Length=210

 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 48/142 (34%), Positives = 72/142 (51%), Gaps = 4/142 (3%)
 Frame = -1

Query  1185  ISMEGLDLLRHKLTSYQAGDLWVPVGGIKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYS  1006
             I  + L   + K+ SY+ G     VGG+K  D D+P    L+LVG +GSGKSSL+N +  
Sbjct  47    IDSKNLKEAKEKILSYRPGAWIEKVGGLKLCDYDVPKTTCLILVGPSGSGKSSLINRISK  106

Query  1005  VLGRSGLIPF-AQTSSQPTKFT-TMLLEEHNVLRSKKNGFCVYDTRGLDCHRMDEGMEDV  832
             V       P  AQ S        T  L E+ + R +K   C+YDTR L    ++E    +
Sbjct  107   VFEDDNFAPARAQVSYNSLNGDGTCFLREYMIPR-EKTSICLYDTRSL-SDDLNENNRML  164

Query  831   WSWMSDGVRHNQPCCRGSDDDR  766
              +WM+ GV + +   R +D+ +
Sbjct  165   KNWMTKGVCNGELVVRNADNQK  186



>ref|WP_035751619.1| daunorubicin resistance protein DrrC [Gordonia alkanivorans]
 gb|ETA06524.1| ABC transporter [Gordonia alkanivorans CGMCC 6845]
Length=803

 Score = 58.9 bits (141),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 63/214 (29%), Positives = 96/214 (45%), Gaps = 29/214 (14%)
 Frame = -1

Query  1104  IKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIPFAQTS------SQPTKFT  943
             ++  D+DIP  + ++L G+ GSGKSSL+N   SV G  G++   QT+      S P  +T
Sbjct  514   LQNVDVDIPLGVLVVLTGVAGSGKSSLIN--SSVAGADGVVSIDQTAIKGSRRSNPATYT  571

Query  942   TMLLEEHNVLRSKKNGF--CVYDTRGLDCHRMDEGMEDVWSWMSDGVRHNQPC--CRGSD  775
               LLE      +K NG    ++            G   V+S ++       PC  C G  
Sbjct  572   G-LLEPIRKAFAKANGVKPALFSANSEGACPNCNGAGVVYSDLAMMAGVAAPCEVCEGRR  630

Query  774   DDREMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDFSSGDLKHVEAIKMIFHSPSIR  595
                E++EY++ GR  ++  +      + VA  EE F D   GD K + A K+      +R
Sbjct  631   FQAEVLEYTLGGRNISEVLE------MSVAQAEEFFAD---GDAKLIAAQKI------LR  675

Query  594   RSNEKPMLILTHGDILTAEERVE-TRLKLCESLG  496
             R  +  +  +  G  LT     E  RLKL   +G
Sbjct  676   RMVDVGLGYIKVGQPLTTLSGGERQRLKLATHMG  709



>ref|WP_006360361.1| ABC transporter [Gordonia alkanivorans]
 dbj|GAA14293.1| putative UvrA-like protein [Gordonia alkanivorans NBRC 16433]
Length=803

 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 63/214 (29%), Positives = 96/214 (45%), Gaps = 29/214 (14%)
 Frame = -1

Query  1104  IKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIPFAQTS------SQPTKFT  943
             ++  D+DIP  + ++L G+ GSGKSSL+N   SV G  G++   QT+      S P  +T
Sbjct  514   LQNVDVDIPLGVLVVLTGVAGSGKSSLIN--SSVAGADGVVSIDQTAIKGSRRSNPATYT  571

Query  942   TMLLEEHNVLRSKKNGF--CVYDTRGLDCHRMDEGMEDVWSWMSDGVRHNQPC--CRGSD  775
               LLE      +K NG    ++            G   V+S ++       PC  C G  
Sbjct  572   G-LLEPIRKAFAKANGVKPALFSANSEGACPNCNGAGVVYSDLAMMAGVAAPCEVCEGKR  630

Query  774   DDREMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDFSSGDLKHVEAIKMIFHSPSIR  595
                E++EY++ GR  ++  +      + VA  EE F D   GD K + A K+      +R
Sbjct  631   FQAEVLEYTLGGRNISEVLE------MSVAQAEEFFAD---GDAKLLAAHKI------LR  675

Query  594   RSNEKPMLILTHGDILTAEERVE-TRLKLCESLG  496
             R  +  +  +  G  LT     E  RLKL   +G
Sbjct  676   RMVDVGLGYIKVGQPLTTLSGGERQRLKLATHMG  709



>gb|EMP12725.1| ABC transporter family protein [Gordonia sp. NB4-1Y]
Length=797

 Score = 57.0 bits (136),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 65/214 (30%), Positives = 94/214 (44%), Gaps = 29/214 (14%)
 Frame = -1

Query  1104  IKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIPFAQTS------SQPTKFT  943
             ++  D+DIP  + ++L G+ GSGKSSL++   SV GR G++   Q +      S P  +T
Sbjct  508   LRDVDVDIPLGVLVVLTGVAGSGKSSLIS--GSVAGRDGVVSIDQGAIKGSRRSNPATYT  565

Query  942   TMLLEEHNVLRSKKNGF--CVYDTRGLDCHRMDEGMEDVWS--WMSDGVRHNQPCCRGSD  775
               LLE      +K NG    ++           +G   V+S   M  GV      C G  
Sbjct  566   G-LLEPIRKAFAKANGVKPALFSANSAGACPNCKGAGVVYSDLAMMGGVSSVCEVCEGRR  624

Query  774   DDREMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDFSSGDLKHVEAIKMIFHSPSIR  595
                E++EY+  GR  ++         + VA  EE F D   GD K   A K+      +R
Sbjct  625   FQAEVLEYTFGGRNIDEV------LTMSVAQAEEFFAD---GDAKVPAAHKI------LR  669

Query  594   RSNEKPMLILTHGDILTAEERVE-TRLKLCESLG  496
             R  +  +  LT G  LT     E  RLKL   +G
Sbjct  670   RLADVGLGYLTIGQPLTTLSGGERQRLKLAVEMG  703



>ref|WP_013863686.1| ABC transporter [Microlunatus phosphovorus]
 ref|YP_004573220.1| UvrA-like protein [Microlunatus phosphovorus NM-1]
 dbj|BAK35817.1| UvrA-like protein [Microlunatus phosphovorus NM-1]
Length=789

 Score = 56.2 bits (134),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 66/222 (30%), Positives = 97/222 (44%), Gaps = 31/222 (14%)
 Frame = -1

Query  1104  IKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIPFAQTS------SQPTKFT  943
             ++  D+DIP  + ++L G+ GSGKSSL+N   SV GR G++   QT       S P  +T
Sbjct  495   LRNVDVDIPLGVLVVLTGVAGSGKSSLIN--GSVAGREGVVTIDQTGIKGSRRSNPATYT  552

Query  942   TMLLEEHNVLRSKKNGF--CVYDTRGLDCHRMDEGMEDVWS--WMSDGVRHNQPCCRGSD  775
               LL+      +K NG    ++            G   +++   M  GV      C G  
Sbjct  553   G-LLDPIRKAFAKANGVKPALFSPNSEGACPNCNGAGVIYTDLAMMAGVATTCEVCEGKR  611

Query  774   DDREMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDFSSGDLKHVEAIKMIFHSPSIR  595
              D  ++EY++ GR  ++         +  AD  EAF  F SGD +   A K+      + 
Sbjct  612   FDASVLEYTLGGRDISEV------LAMSAAD-AEAF--FGSGDARTPAAHKI------LE  656

Query  594   RSNEKPMLILTHGDILTAEERVE-TRLKLCESLGISETTGAY  472
             R  +  +  LT G  LT     E  RLKL   +G  E  G Y
Sbjct  657   RFVDVGLGYLTLGQPLTTLSGGERQRLKLATHMG--EKGGVY  696



>ref|WP_005194993.1| excinuclease ABC subunit A, partial [Gordonia rubripertincta]
 dbj|GAB83958.1| putative UvrA-like protein, partial [Gordonia rubripertincta 
NBRC 101908]
Length=498

 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 61/213 (29%), Positives = 92/213 (43%), Gaps = 27/213 (13%)
 Frame = -1

Query  1104  IKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIPFAQTS------SQPTKFT  943
             ++  D+DIP  + ++L G+ GSGKSSL+N   SV    G++   QT+      S P  +T
Sbjct  209   LRNVDVDIPLGVLVVLTGVAGSGKSSLIN--SSVANAEGVVSIDQTAIKGSRRSNPATYT  266

Query  942   TMLLEEHNVLRSKKNGF--CVYDTRGLDCHRMDEGMEDVWSWMSDGVRHNQPC--CRGSD  775
               LLE      +K NG    ++            G   V+S ++       PC  C G  
Sbjct  267   G-LLEPIRKAFAKANGVKPALFSANSEGACPNCNGAGVVYSDLAMMAGVAAPCEVCEGRR  325

Query  774   DDREMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDFSSGDLKHVEAIKMIFHSPSIR  595
                E++EY++ GR  ++  +  V          EAF  F+ GD K   A K++     + 
Sbjct  326   FQAEVLEYTLGGRNISEVLEMSVA-------QAEAF--FADGDAKLPAAHKILHRMVDVG  376

Query  594   RSNEKPMLILTHGDILTAEERVETRLKLCESLG  496
                 K    LT    L+  ER   RLKL   +G
Sbjct  377   LGYIKVGQPLT---TLSGGER--QRLKLATHMG  404



>ref|WP_006864756.1| ABC transporter [Gordonia namibiensis]
 dbj|GAB98474.1| UvrA-like protein [Gordonia namibiensis NBRC 108229]
Length=803

 Score = 53.1 bits (126),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 62/213 (29%), Positives = 92/213 (43%), Gaps = 27/213 (13%)
 Frame = -1

Query  1104  IKKTDMDIPAVITLLLVGLTGSGKSSLVNFMYSVLGRSGLIPFAQTS------SQPTKFT  943
             ++  D+DIP  + ++L G+ GSGKSSL+N   SV    G++   QT+      S P  +T
Sbjct  514   LQNVDVDIPLGVLVVLTGVAGSGKSSLIN--SSVAKADGVVSIDQTAIKGSRRSNPATYT  571

Query  942   TMLLEEHNVLRSKKNGF--CVYDTRGLDCHRMDEGMEDVWSWMSDGVRHNQPC--CRGSD  775
               LLE      +K NG    ++            G   V+S ++       PC  C G  
Sbjct  572   G-LLEPIRKAFAKANGVKPALFSANSEGACPNCNGAGVVYSDLAMMAGVAAPCEVCEGKR  630

Query  774   DDREMMEYSMAGRCANKYCKRRVNCVLVVADMEEAFKDFSSGDLKHVEAIKMIFHSPSIR  595
                E++EY++ GR  ++  +  V          EAF  FS GD K   A K++     + 
Sbjct  631   FQAEVLEYTLGGRNISEVLEMSVA-------QAEAF--FSDGDAKLPAAHKILHRMVDVG  681

Query  594   RSNEKPMLILTHGDILTAEERVETRLKLCESLG  496
                 K    LT    L+  ER   RLKL   +G
Sbjct  682   LGYIKVGQPLT---TLSGGER--QRLKLATHMG  709



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3756859799544