BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7612_g1_i1 len=1339 path=[1236:0-1128 2365:1129-1153 2390:1154-1233
2365:1234-1258 2390:1259-1338]

Length=1339
                                                                      Score     E

dbj|BAA22072.1|  dihydroflavonol 4-reductase                            824   0.0      Ipomoea nil [qian niu]
gb|ACS87954.1|  dihydroflavonol 4-reductase                             767   0.0      Ipomoea horsfalliae [Kuhio-vine]
dbj|BAF64707.1|  dihydroflavonol 4-reductase                            760   0.0      Ipomoea tricolor [campanilla]
gb|ABL74479.1|  dihydroflavonol 4-reductase                             756   0.0      Ipomoea batatas [batate]
dbj|BAA34637.1|  dihydroflavonol 4-reductase                            756   0.0      Ipomoea batatas [batate]
dbj|BAD05164.1|  dihydroflavonol 4-reductase                            756   0.0      Ipomoea batatas [batate]
dbj|BAA36406.1|  dihydroflavonol 4-reductase                            751   0.0      Ipomoea purpurea
gb|ACB42445.1|  dihydroflavonol 4-reductase                             745   0.0      
gb|ABY25283.1|  dihydroflavonol 4-reductase B                           735   0.0      Turbina oblongata
dbj|BAA74700.1|  dihydroflavonol 4-reductase                            731   0.0      Ipomoea purpurea
gb|ABW69680.1|  dihydroflavonol 4-reductase                             729   0.0      Ipomoea purpurea
gb|AAB84048.1|  dihydroflavonol 4-reductase                             729   0.0      Ipomoea purpurea
gb|ABW69681.1|  dihydroflavonol 4-reductase                             729   0.0      Ipomoea purpurea
gb|ABY61976.1|  dihydroflavonol 4-reductase                             704   0.0      Ipomoea batatas [batate]
gb|AAS46256.1|  dihydroflavonol reductase                               700   0.0      Ipomoea quamoclit
gb|ABY25285.1|  dihydroflavonol 4-reductase B                           685   0.0      Merremia dissecta
gb|ABY25284.1|  dihydroflavonol 4-reductase B                           637   0.0      Convolvulus arvensis
gb|AAB50009.1|  dihydroflavonol 4-reductase                             622   0.0      Ipomoea purpurea
gb|AGI96401.1|  dihydroflavonol 4-reductase                             573   0.0      
ref|NP_001274988.1|  dihydroflavonol 4-reductase                        571   0.0      
gb|AEN83503.1|  dihydroflavonol 4-reductase                             570   0.0      
sp|P14720.2|DFRA_PETHY  RecName: Full=Dihydroflavonol-4-reductase...    570   0.0      Petunia x hybrida [garden petunia]
gb|AFL48186.1|  DFR protein                                             568   0.0      
gb|AAM73809.1|AF449422_1  dihydroflavonol-4-reductase                   568   0.0      Solanum tuberosum [potatoes]
gb|ABY25290.1|  dihydroflavonol 4-reductase                             566   0.0      Evolvulus glomeratus
gb|AGI96400.1|  dihydroflavonol 4-reductase                             566   0.0      
gb|AFQ98276.1|  dihydroflavonol 4-reductase                             566   0.0      
gb|AEX88625.1|  dihydroflavonol 4-reductase                             565   0.0      
gb|AEQ04697.1|  dihydroflavonol 4-reductase                             564   0.0      
gb|ABY25286.1|  dihydroflavonol 4-reductase B                           563   0.0      Petunia x hybrida [garden petunia]
ref|XP_010315879.1|  PREDICTED: dihydroflavonol-4-reductase isofo...    563   0.0      
gb|AAX63400.1|  dihydroflavonol 4-reductase                             563   0.0      Solanum pinnatisectum
gb|ABY25280.1|  dihydroflavonol 4-reductase A                           562   0.0      Merremia dissecta
gb|AAF60298.1|AF233639_1  dihydroflavonol-4-reductase                   563   0.0      Petunia x hybrida [garden petunia]
emb|CAA33544.1|  unnamed protein product                                562   0.0      Petunia x hybrida [garden petunia]
dbj|BAA36405.1|  dihydroflavonol 4-reductase                            561   0.0      Ipomoea purpurea
gb|AFO59585.1|  diihydroflavonol 4-reductase                            561   0.0      
gb|AFO59586.1|  diihydroflavonol 4-reductase                            561   0.0      
gb|AAZ57436.1|  dihydroflavonol reductase                               561   0.0      Solanum tuberosum [potatoes]
dbj|BAA59332.1|  dihydroflavonol 4-reductase                            558   0.0      Ipomoea nil [qian niu]
gb|AFO59587.1|  diihydroflavonol 4-reductase                            559   0.0      
ref|NP_001275409.1|  dihydroflavonol-4-reductase-like                   559   0.0      
dbj|BAC10993.1|  dihydroflavonol 4-reductase                            557   0.0      Nierembergia sp. NB17
gb|ABN80438.1|  dihydroflavonol 4-reductase                             557   0.0      Nicotiana benthamiana
gb|ABY25282.1|  dihydroflavonol 4-reductase A                           555   0.0      Turbina oblongata
gb|AGP50169.1|  dihydroflavonol-4-reductase                             556   0.0      
gb|ADV03181.1|  dihydroflavonol reductase                               556   0.0      
gb|AFD28990.1|  dihydroflavonol 4-reductase                             555   0.0      
gb|AFO59584.1|  diihydroflavonol 4-reductase                            555   0.0      
gb|AFO59589.1|  diihydroflavonol 4-reductase                            555   0.0      
gb|AFO59581.1|  diihydroflavonol 4-reductase                            554   0.0      
gb|AFO59580.1|  diihydroflavonol 4-reductase                            551   0.0      
gb|AFO59579.1|  diihydroflavonol 4-reductase                            551   0.0      
gb|AFO59582.1|  diihydroflavonol 4-reductase                            551   0.0      
ref|NP_001289451.1|  dihydroflavonol-4-reductase                        550   0.0      
gb|ABY25281.1|  dihydroflavonol 4-reductase A                           548   0.0      Convolvulus arvensis
gb|AFO59583.1|  diihydroflavonol 4-reductase                            550   0.0      
gb|ADV03180.1|  dihydroflavonol reductase                               550   0.0      
dbj|BAM37961.1|  dihydroflavonol-4-reductase                            549   0.0      
gb|ACS12835.1|  dihydroflavonol 4-reductase                             549   0.0      Nicotiana langsdorffii [fumo-bravo]
gb|AFO59588.1|  diihydroflavonol 4-reductase                            549   0.0      
gb|ABN80436.1|  dihydroflavonol 4-reductase                             549   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009759956.1|  PREDICTED: dihydroflavonol-4-reductase             546   0.0      
gb|ABN80437.1|  dihydroflavonol 4-reductase                             546   0.0      Nicotiana tabacum [American tobacco]
gb|ACS12834.1|  dihydroflavonol 4-reductase                             545   0.0      Nicotiana alata [flowering tobacco]
emb|CDP01993.1|  unnamed protein product                                541   0.0      
gb|ABK88311.2|  dihydroflavonol 4-reductase                             540   0.0      Chrysanthemum x morifolium [florist's chrysanthemum]
ref|NP_001234408.1|  dihydroflavonol-4-reductase                        537   0.0      
emb|CAC88859.1|  dihydroflavonol reductase                              533   0.0      Rhododendron simsii
dbj|BAA22076.1|  dihydroflavonol 4-reductase                            533   0.0      Ipomoea nil [qian niu]
gb|AHM27144.1|  dihydroflavonol 4-reductase                             535   0.0      
gb|ABY25287.1|  dihydroflavonol 4-reductase C                           531   0.0      Turbina oblongata
gb|AEN69001.1|  dihydroflavonol 4-reductase                             533   0.0      
gb|ADC96612.1|  dihydroflavonol 4-reductase                             532   0.0      Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ACK57789.1|  dihydroflavonol reductase                               530   0.0      Centaurea maculosa
dbj|BAA36407.1|  dihydroflavonol 4-reductase                            531   0.0      Ipomoea purpurea
gb|AIY51701.1|  dihydroflavonol 4-reductase                             531   0.0      
gb|ACB56920.1|  dihydroflavonol-4-reductase                             530   0.0      Pilosella officinarum [mouse-ear hawkweed]
dbj|BAA12736.1|  dihydroflavonol-4-reductase                            530   0.0      Gentiana triflora
dbj|BAA19658.1|  dihydroflavonol 4-reductase                            533   0.0      Perilla frutescens [beefsteak-mint]
sp|P14721.1|DFRA_ANTMA  RecName: Full=Dihydroflavonol-4-reductase...    531   0.0      Antirrhinum majus [garden snapdragon]
gb|AIR09398.1|  dihydroflavonol 4-reductase                             530   0.0      
gb|AIY22763.1|  dihydroflavonol 4-reductase                             527   0.0      
gb|ABY25289.1|  dihydroflavonol 4-reductase C                           526   0.0      Merremia umbellata
emb|CAA70345.1|  dihydroflavonol reductase                              526   0.0      Forsythia x intermedia [cultivated forsythia]
gb|ABK88310.2|  dihydroflavonol 4-reductase                             526   0.0      Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AER40962.1|  dihydroflavonol 4-reductase                             525   0.0      
gb|ABQ97018.1|  dihydroflavonol 4-reductase                             524   0.0      Saussurea medusa
gb|ABS84871.1|  dihydroflavonol-4-reductase                             526   0.0      Linaria sp. JA-2007
gb|AIY51700.1|  dihydroflavonol 4-reductase                             524   0.0      
sp|P51105.1|DFRA_GERHY  RecName: Full=Dihydroflavonol-4-reductase...    523   0.0      Gerbera hybrid cultivar
gb|AHJ80979.1|  dihydroflavanone reductase                              526   0.0      
ref|XP_011083203.1|  PREDICTED: LOW QUALITY PROTEIN: dihydroflavo...    523   0.0      
gb|ACO50430.1|  dihydroflavonol 4-reductase                             521   0.0      
dbj|BAM42669.1|  dihydroflavonol 4-reductase                            521   0.0      
dbj|BAJ17657.1|  dihydroflavonol reductase                              521   0.0      
gb|AHK23093.1|  dihydroflavonol 4-reductase                             521   0.0      
dbj|BAA84939.1|  dihydroflavonol 4-reductase                            519   6e-180   Camellia sinensis [black tea]
gb|AAT84073.1|  dihydroflavonol 4-reductase                             518   1e-179   Camellia sinensis [black tea]
gb|AFC37249.1|  dihydroflavonol4-reductase                              517   3e-179   
gb|EYU31196.1|  hypothetical protein MIMGU_mgv1a006799mg                520   3e-179   
gb|ABU93477.1|  dihydroflavonol 4-reductase                             516   7e-179   Helianthus annuus
gb|AGO64770.1|  dihydroflavonol 4-reductase                             514   1e-178   
gb|AAX12420.1|  dihydroflavonol 4-reductase                             516   1e-178   
gb|AGV53048.1|  dihydroflavonol 4-reductase                             514   3e-178   
gb|AEN69002.1|  dihydroflavonol 4-reductase                             514   3e-178   
gb|ABP57077.1|  dihydroflavonol 4-reductase                             514   5e-178   Solenostemon scutellarioides
gb|AAT66505.1|  dihydroflavonol 4-reductase                             513   1e-177   Camellia sinensis [black tea]
gb|ACV72642.1|  dihydroflavonol 4-reductase                             510   1e-176   Gossypium hirsutum [American cotton]
gb|ABM64800.1|  dihydroflavonol 4-reductase                             510   2e-176   Gossypium hirsutum [American cotton]
dbj|BAJ08043.1|  dihydroflavonol 4-reductase                            508   5e-176   
ref|XP_011007452.1|  PREDICTED: dihydroflavonol-4-reductase             508   2e-175   
sp|P51103.1|DFRA_CALCH  RecName: Full=Dihydroflavonol-4-reductase...    508   2e-175   Callistephus chinensis [Chinese aster]
gb|ACA04005.1|  dihydroflavonol-4-reductase                             510   1e-174   Diplacus aurantiacus
gb|AAR01565.1|  dihydroflavonol/flavonone-4-reductase like protein      506   1e-174   Sinningia cardinalis
gb|ACA04004.1|  dihydroflavonol-4-reductase                             510   1e-174   Diplacus aurantiacus
gb|AAD56578.1|AF184271_1  dihydroflavonol 4-reductase                   506   3e-174   Daucus carota [carrots]
dbj|BAF49318.1|  dihydroflavonol 4-reductase                            503   6e-174   Lobelia erinus
gb|AGJ70142.1|  dihydroflavonol-4-reductase                             503   6e-174   
ref|XP_006383711.1|  hypothetical protein POPTR_0005s25110g             504   1e-173   
dbj|BAB20075.1|  dihydroflavonol 4-reductase                            502   2e-173   Torenia hybrid cultivar
dbj|BAD05177.1|  dihydroflavonol 4-reductase                            498   5e-173   Ipomoea batatas [batate]
ref|XP_002307667.2|  dihydroflavonol reductase family protein           501   6e-173   Populus trichocarpa [western balsam poplar]
gb|AIU98514.1|  dihydroflavonol 4-reductase                             501   1e-172   
gb|AHF58605.1|  dihydroflavonol 4-reductase                             499   4e-172   
gb|AAV71171.1|  dihydroflavonol reductase                               498   7e-172   Lotus corniculatus
gb|AFK35141.1|  unknown                                                 496   3e-171   
ref|XP_007017586.1|  Dihydroflavonol-4-reductase                        496   8e-171   
dbj|BAH24302.1|  dihydroflavonol 4-reductase                            496   8e-171   Rosa hybrid cultivar
gb|AAL89715.1|AF483836_1  dihydroflavonol-4-reductase                   495   1e-170   Vaccinium macrocarpon [American cranberry]
ref|XP_011028872.1|  PREDICTED: dihydroflavonol-4-reductase-like ...    495   1e-170   
gb|AFG28176.1|  putative dihydroflavonol 4-reductase                    494   2e-170   
gb|AIU34714.1|  dihydroflavonol 4-reductase 1                           494   2e-170   
dbj|BAD34461.1|  dihydroflavonol 4-reductase                            494   2e-170   Eustoma exaltatum subsp. russellianum [bluebells]
gb|AEN71545.1|  dihydroflavonol 4-reductase                             495   3e-170   
ref|NP_001268144.1|  dihydroflavonol-4-reductase                        494   3e-170   
dbj|BAA12723.1|  dihydroflavonol 4-reductase                            494   4e-170   Rosa hybrid cultivar
gb|AAX12422.1|  dihydroflavonol 4-reductase                             494   4e-170   
gb|AGO02174.1|  dihydroflavonol 4-reductase                             493   4e-170   
dbj|BAE19953.1|  dihydroflavonol 4-reductase                            493   5e-170   Lotus japonicus
gb|AHK10250.1|  dihydroflavonol 4-reductase                             493   5e-170   
gb|ABY25288.1|  dihydroflavonol 4-reductase C                           493   6e-170   Convolvulus arvensis
ref|XP_007160734.1|  hypothetical protein PHAVU_001G012700g             493   7e-170   
dbj|BAJ08042.1|  dihydroflavonol 4-reductase                            493   9e-170   
gb|KDP38534.1|  hypothetical protein JCGZ_04459                         493   9e-170   
gb|AAN63056.1|  dihydroflavonol reductase                               493   1e-169   Populus tremuloides
gb|AAF23884.2|AF117263_1  dihydroflavanol reductase 3                   492   1e-169   Lotus corniculatus
gb|AHF58604.1|  dihydroflavonol 4-reductase                             492   2e-169   
gb|AFI71899.1|  dihydroflavonol 4-reductase                             491   6e-169   
gb|ACN82380.1|  dihydroflavonol 4-reductase                             490   9e-169   Vitis amurensis
gb|KHN20964.1|  Bifunctional dihydroflavonol 4-reductase/flavanon...    489   2e-168   
dbj|BAJ21535.1|  dihydroflavonol 4-reductase                            489   2e-168   
gb|AII26023.1|  dihydroflavanol 4-reductase                             489   3e-168   
ref|NP_001238612.1|  dihydroflavonol-4-reductase DFR1                   489   3e-168   
ref|XP_002300759.1|  dihydroflavonol reductase family protein           488   4e-168   Populus trichocarpa [western balsam poplar]
ref|XP_003550388.1|  PREDICTED: bifunctional dihydroflavonol 4-re...    488   1e-167   
ref|XP_004499176.1|  PREDICTED: bifunctional dihydroflavonol 4-re...    487   1e-167   
dbj|BAO53727.1|  dihydroflavonol 4-reducatase 2                         488   1e-167   
gb|AAR27015.1|  dihydroflavonal-4-reductase 2                           487   1e-167   Medicago truncatula
ref|XP_007160735.1|  hypothetical protein PHAVU_001G012800g             486   2e-167   
sp|P51110.1|DFRA_VITVI  RecName: Full=Dihydroflavonol-4-reductase...    486   3e-167   Vitis vinifera
ref|XP_009336072.1|  PREDICTED: bifunctional dihydroflavonol 4-re...    486   5e-167   
ref|XP_010523603.1|  PREDICTED: dihydroflavonol-4-reductase             487   5e-167   
gb|AAL89714.1|AF483835_1  dihydroflavonol-4-reductase                   486   5e-167   Vaccinium macrocarpon [American cranberry]
dbj|BAD67186.1|  dihydroflavonol 4-reductase                            485   6e-167   Phytolacca americana [common pokeberry]
gb|ACJ84553.1|  unknown                                                 485   1e-166   Medicago truncatula
gb|AHL45016.1|  dihydroflavonol 4-reductase                             485   1e-166   
dbj|BAF49294.1|  dihydroflavanol 4-reductase                            484   1e-166   Clitoria ternatea
gb|AJA79073.1|  dihydroflavonol 4-reductase                             485   1e-166   
ref|XP_007222317.1|  hypothetical protein PRUPE_ppa008069mg             485   1e-166   
ref|XP_009365091.1|  PREDICTED: bifunctional dihydroflavonol 4-re...    485   1e-166   
gb|ACU28803.1|  dihydroflavonol reductase                               485   1e-166   Rhizophora mangle
dbj|BAO53730.1|  dihydroflavonol 4-reducatase 2                         485   2e-166   
gb|AEF14420.1|  dihydroflavonol 4-reductase                             484   2e-166   
gb|AFF60412.1|  dihydroflavonol reductase                               484   2e-166   
gb|ADZ54784.1|  dihydrokaempferol 4-reductase                           484   2e-166   
gb|AGZ15302.1|  dihydroflavonol 4-reductase                             484   2e-166   
gb|AEO79982.1|  dihydroflavonol 4-reductase                             484   3e-166   
gb|AHL46451.1|  dihydroflavonol 4-reductase                             484   3e-166   
dbj|BAD67185.1|  dihydroflavonol 4-reductase                            483   4e-166   Spinacia oleracea
gb|AAO39818.1|  dihydroflavonol 4-reductase                             483   8e-166   Pyrus communis
gb|AEX07281.1|  DFR                                                     483   1e-165   
gb|AEI59122.1|  dihydroflavonol 4-reductase                             482   1e-165   
ref|XP_004291858.1|  PREDICTED: bifunctional dihydroflavonol 4-re...    483   1e-165   
ref|NP_001280868.1|  bifunctional dihydroflavonol 4-reductase/fla...    482   1e-165   
sp|Q84KP0.1|DFRA_PYRCO  RecName: Full=Bifunctional dihydroflavono...    482   1e-165   Pyrus communis
dbj|BAI78343.1|  dihydroflavonol reductase                              482   1e-165   Pelargonium zonale
gb|AFK35813.1|  unknown                                                 481   2e-165   
gb|AAX16491.1|  dihydroflavonol 4-reductase                             481   2e-165   Crataegus monogyna
gb|AHZ31751.1|  dihydroflavonol 4-reductase                             481   3e-165   
gb|AHZ30596.1|  dihydroflavonol reductase                               481   3e-165   
gb|AAO39816.1|  dihydroflavonol 4-reductase                             481   4e-165   Malus domestica [apple tree]
gb|AGZ15301.1|  dihydroflavonol 4-reductase                             481   4e-165   
gb|ABY89686.1|  dihydroflavonol-4-reductase 2 protein                   480   4e-165   
ref|XP_009114035.1|  PREDICTED: dihydroflavonol-4-reductase             482   8e-165   
gb|AGU42192.1|  dihydroflavonol 4-reductase                             482   8e-165   
gb|ACP30362.1|  dihydroflavonol-4-reductase protein                     480   8e-165   Malus hybrid cultivar
ref|XP_010673251.1|  PREDICTED: dihydroflavonol-4-reductase             480   8e-165   
gb|AAV80210.1|  dihydroflavonol-4-reductase                             482   8e-165   Brassica rapa subsp. pekinensis [bai cai]
gb|AHL46448.1|  dihydroflavonol 4-reductase                             480   1e-164   
gb|AHZ97873.1|  dihydroflavonol 4-reductase                             479   1e-164   
gb|AAX53571.1|  dihydroflavonol 4-reductase                             481   2e-164   Brassica rapa
gb|AAP13055.1|  dihydroflavonol 4-reductase                             479   2e-164   Gypsophila elegans [annual baby's-breath]
gb|ADB45307.1|  dihydroflavonol 4-reductase                             480   3e-164   Brassica juncea var. napiformis [jie cai ge da]
dbj|BAE19950.1|  dihydroflavonol 4-reductase                            478   3e-164   Lotus japonicus
ref|NP_001275860.1|  dihydroflavonol-4-reductase                        478   4e-164   
gb|AIB06741.1|  dihydroflavonol 4-reductase                             478   4e-164   
ref|XP_010494237.1|  PREDICTED: dihydroflavonol-4-reductase-like        479   4e-164   
ref|XP_008377381.1|  PREDICTED: bifunctional dihydroflavonol 4-re...    478   6e-164   
emb|CDX95155.1|  BnaC09g17150D                                          479   6e-164   
ref|XP_003638261.1|  Dihydroflavonol reductase                          477   9e-164   
dbj|BAD95233.1|  dihydroflavonol 4-reductase                            479   9e-164   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006281803.1|  hypothetical protein CARUB_v10027976mg             477   9e-164   
ref|XP_006473894.1|  PREDICTED: dihydroflavonol-4-reductase             477   9e-164   
gb|AHL46445.1|  dihydroflavonol 4-reductase                             477   1e-163   
gb|ACM62744.1|  dihydroflavonol-4-reductase                             476   2e-163   Garcinia mangostana [mangosteen]
ref|XP_002862988.1|  dihydroflavonol reductase                          478   2e-163   
emb|CAP08825.1|  dihydroflavonol reductase                              478   2e-163   Arabidopsis lyrata [lyrate rockcress]
ref|XP_002510417.1|  cinnamoyl-CoA reductase, putative                  476   2e-163   Ricinus communis
ref|NP_199094.1|  dihydroflavonol-4-reductase                           478   3e-163   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010442115.1|  PREDICTED: dihydroflavonol-4-reductase             477   3e-163   
gb|KDO84613.1|  hypothetical protein CISIN_1g040253mg                   475   5e-163   
gb|AAO73442.1|  dihydroflavonol 4-reductase                             477   5e-163   Brassica oleracea
gb|AIM48930.1|  dihydroflavonol 4-reductase                             477   7e-163   
gb|KFK31813.1|  hypothetical protein AALP_AA6G162000                    477   8e-163   
gb|AHL46450.1|  dihydroflavonol 4-reductase                             475   1e-162   
emb|CAP08818.1|  dihydroflavonol reductase                              476   1e-162   Arabidopsis thaliana [mouse-ear cress]
emb|CAP08819.1|  dihydroflavonol reductase                              476   1e-162   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF45153.1|  dihydroflavonol 4-reductase                            474   1e-162   Humulus lupulus [common hop]
ref|XP_010263613.1|  PREDICTED: LOW QUALITY PROTEIN: bifunctional...    474   2e-162   
gb|AAA32783.1|  dihydroflavonol 4-reductase                             476   2e-162   Arabidopsis thaliana [mouse-ear cress]
emb|CAP08805.1|  dihydroflavonol reductase                              475   3e-162   Arabidopsis thaliana [mouse-ear cress]
emb|CAP08813.1|  dihydroflavonol reductase                              475   4e-162   Arabidopsis thaliana [mouse-ear cress]
gb|ABG76202.1|  dihydroflavonol reductase                               474   5e-162   Brassica napus [oilseed rape]
emb|CAP08822.1|  dihydroflavonol reductase                              474   5e-162   Arabidopsis thaliana [mouse-ear cress]
gb|AAR27014.1|  dihydroflavanol-4-reductase 1                           473   6e-162   Medicago truncatula
emb|CBI19727.3|  unnamed protein product                                492   2e-161   
ref|XP_010060970.1|  PREDICTED: dihydroflavonol-4-reductase             471   3e-161   
ref|XP_002863734.1|  dihydroflavonol reductase                          472   4e-161   
dbj|BAB92999.1|  dihydroflavonol reductase                              469   5e-161   Malus domestica [apple tree]
ref|XP_010481941.1|  PREDICTED: dihydroflavonol-4-reductase-like        472   5e-161   
gb|ADY02644.1|  dihydroflavonol 4-reductase                             471   7e-161   
gb|ADY02645.1|  dihydroflavonol 4-reductase                             471   7e-161   
ref|XP_006403345.1|  hypothetical protein EUTSA_v10003227mg             471   1e-160   
gb|AHL46438.1|  dihydroflavonol 4-reductase                             469   2e-160   
gb|AAU12363.1|  dihydroflavonol 4-reductase                             469   2e-160   Fragaria x ananassa
sp|P51104.1|DFRA_DIACA  RecName: Full=Dihydroflavonol-4-reductase...    469   2e-160   Dianthus caryophyllus [carnation]
gb|ACZ48697.1|  dihydroflavonol-4-reductase                             469   2e-160   Fagopyrum tataricum [Kangra buckwheat]
gb|AGI16384.1|  dihydroflavonol 4-reductase                             470   2e-160   
gb|AAU12364.1|  dihydroflavonol 4-reductase                             468   3e-160   Fragaria x ananassa
gb|AHL46440.1|  dihydroflavonol 4-reductase                             468   4e-160   
gb|ADY02643.1|  dihydroflavonol 4-reductase                             469   5e-160   
gb|AAG01030.1|  dihydroflavonol 4-reductase                             468   8e-160   Dianthus gratianopolitanus [cheddar pink]
gb|AAS89833.1|  dihydroflavonol 4-reductase                             467   9e-160   Fragaria x ananassa
gb|AAX12421.1|  dihydroflavonol 4-reductase                             467   1e-159   
gb|ADY02647.1|  dihydroflavonol 4-reductase                             468   2e-159   
gb|AHL46442.1|  dihydroflavonol 4-reductase                             466   2e-159   
gb|AAC25960.1|  dihydroflavonol 4-reductase                             466   3e-159   Fragaria x ananassa
dbj|BAE19948.1|  dihydroflavonol 4-reductase                            466   4e-159   Lotus japonicus
gb|ACZ48698.1|  dihydroflavonol-4-reductase                             465   5e-159   Fagopyrum esculentum
ref|XP_006403346.1|  hypothetical protein EUTSA_v10003227mg             466   7e-159   
ref|XP_010906334.1|  PREDICTED: bifunctional dihydroflavonol 4-re...    465   7e-159   
gb|AFU90827.1|  dihydroflavonol 4-reductase                             466   7e-159   
gb|AET74075.2|  dihydroflavonol 4-reductase                             464   1e-158   
dbj|BAF49325.1|  dihydroflavonol 4-reductase                            464   2e-158   Delphinium belladonna
dbj|BAE17125.1|  dihydroflavonol 4-reductase                            462   8e-158   Fragaria x ananassa
gb|ADY02646.1|  dihydroflavonol 4-reductase                             463   1e-157   
ref|XP_006601319.1|  PREDICTED: bifunctional dihydroflavonol 4-re...    461   2e-157   
gb|ABP57067.1|  dihydroflavonol 4-reductase                             461   3e-157   Fagopyrum cymosum
ref|XP_009398122.1|  PREDICTED: dihydroflavonol-4-reductase-like        459   2e-156   
gb|AFU90826.1|  dihydroflavonol 4-reductase                             458   4e-156   
gb|AHI49023.1|  dihydroflavonol 4-reductase                             454   4e-155   
ref|XP_010110052.1|  Bifunctional dihydroflavonol 4-reductase/fla...    455   4e-155   
ref|XP_009394236.1|  PREDICTED: dihydroflavonol-4-reductase-like        455   8e-155   
ref|XP_006878526.1|  hypothetical protein AMTR_s00011p00221520          454   3e-154   
gb|AGA82783.1|  dihydroflavonol reductase 2                             451   7e-154   
gb|AHB19302.1|  dihydroflavonol-4-reductase                             452   7e-154   
gb|KDP38532.1|  hypothetical protein JCGZ_04457                         451   2e-153   
ref|XP_009396003.1|  PREDICTED: dihydroflavonol-4-reductase-like        451   5e-153   
ref|XP_008797532.1|  PREDICTED: dihydroflavonol-4-reductase             449   1e-152   
ref|XP_010926084.1|  PREDICTED: dihydroflavonol-4-reductase-like        448   4e-152   
gb|AHY35315.1|  dihydroflavonol reductase                               447   4e-152   
ref|NP_001239696.1|  uncharacterized protein LOC100778253               446   2e-151   
gb|AHA36975.1|  dihydroflavonol 4-reductase                             447   4e-151   
emb|CDM83481.1|  unnamed protein product                                446   5e-151   
gb|AAB62873.1|  dihydroflavonol 4-reductase                             444   1e-150   
gb|AIC33029.1|  dihydroflavonol 4-reductase                             445   1e-150   
gb|AIS35914.1|  dihydroflavonol 4-reductase                             445   1e-150   
dbj|BAH36916.1|  dihydroflavonol-4-reductase                            444   1e-150   
gb|AIC33028.1|  dihydroflavonol 4-reductase                             444   2e-150   
gb|AAO53552.1|  dihydroflavonol 4-reductase                             444   2e-150   
gb|AGY46123.1|  dihydroflavonol 4-reductase                             444   2e-150   
dbj|BAD11018.1|  dihydroflavonol-4-reductase                            444   2e-150   
dbj|BAH36906.1|  dihydroflavonol-4-reductase                            443   3e-150   
gb|AEB96144.1|  dihydroflavinol reductase                               443   3e-150   
gb|AAV83983.1|  dihydroflavonol 4-reductase 1                           443   3e-150   
gb|ABC94578.1|  dihydroflavonol 4-reductase                             443   4e-150   
ref|XP_004499177.1|  PREDICTED: bifunctional dihydroflavonol 4-re...    441   5e-150   
ref|XP_003569417.2|  PREDICTED: dihydroflavonol-4-reductase-like ...    443   6e-150   
gb|AAO60212.1|  dihydroflavonol 4-reductase                             442   6e-150   
dbj|BAH36913.1|  dihydroflavonol-4-reductase                            442   7e-150   
gb|AAP20866.1|  putative dihydroflavonol 4-reductase                    442   8e-150   
ref|XP_007145529.1|  hypothetical protein PHAVU_007G246200g             441   9e-150   
gb|ADK62520.1|  dihydroflavonol 4-reductase                             443   9e-150   
gb|AAU93766.1|  putative dihyroflavonol 4-reductase                     442   9e-150   
dbj|BAD11019.1|  dihydroflavonol-4-reductase                            442   1e-149   
emb|CAR64529.1|  dihydroflavonol-4-reductase                            442   1e-149   
emb|CAR64530.1|  dihydroflavonol-4-reductase                            442   1e-149   
gb|AEF58500.1|  dihydroflavonol-4-reductase                             441   1e-149   
emb|CAN61338.1|  hypothetical protein VITISV_011895                     440   2e-149   
gb|EMS68193.1|  Dihydroflavonol-4-reductase                             441   3e-149   
gb|AAV83987.1|  dihydroflavonol 4-reductase 5                           441   3e-149   
dbj|BAH36905.1|  dihydroflavonol-4-reductase                            441   4e-149   
dbj|BAB40789.1|  dihydroflavonol 4-reductase                            441   4e-149   
dbj|BAM28974.1|  dihydroflavonol 4-reductase                            441   5e-149   
gb|AIZ74402.1|  dihydroflavonol 4-reductase                             440   6e-149   
dbj|BAH36901.1|  dihydroflavonol-4-reductase                            440   8e-149   
dbj|BAH36921.1|  dihydroflavonol-4-reductase                            439   1e-148   
dbj|BAM28975.1|  dihydroflavonol 4-reductase                            439   2e-148   
gb|AFS60083.1|  dihydroflavonol 4-reductase                             439   2e-148   
gb|AFO65508.1|  dihydroflavonol 4-reductase                             438   2e-148   
dbj|BAH36914.1|  dihydroflavonol-4-reductase                            439   3e-148   
dbj|BAH36911.1|  dihydroflavonol-4-reductase                            438   3e-148   
gb|AFO65509.1|  dihydroflavonol 4-reductase                             437   3e-148   
gb|AAO50084.1|  dihydroflavonol 4-reductase                             438   4e-148   
gb|AAO60214.1|  dihydroflavonol 4-reductase                             437   7e-148   
gb|AFO65510.1|  dihydroflavonol 4-reductase                             436   7e-148   
gb|AAQ83576.1|  dihydroflavonol 4-reductase                             438   8e-148   
dbj|BAE79202.1|  dihydroflavonol 4-reductase                            438   9e-148   
gb|AFP58815.1|  dihydroflavonol-4-reductase                             437   1e-147   
gb|AAV83985.1|  dihydroflavonol 4-reductase 3                           437   1e-147   
dbj|BAH36912.1|  dihydroflavonol-4-reductase                            437   1e-147   
dbj|BAH36918.1|  dihydroflavonol-4-reductase                            437   1e-147   
gb|ABE01414.1|  dihydroflavonol 4-reductase                             436   2e-147   
dbj|BAH36922.1|  dihydroflavonol-4-reductase                            436   2e-147   
sp|P51106.1|DFRA_HORVU  RecName: Full=Dihydroflavonol-4-reductase...    436   2e-147   
gb|AHH28214.1|  dihydroflavonol 4-reducatse                             436   2e-147   
gb|AAS57870.1|  DFR-2                                                   436   3e-147   
dbj|BAH36909.1|  dihydroflavonol-4-reductase                            436   3e-147   
dbj|BAH36903.1|  dihydroflavonol-4-reductase                            436   3e-147   
dbj|BAH36904.1|  dihydroflavonol-4-reductase                            435   5e-147   
gb|AAD49343.1|AF169801_1  dihydroflavonol-4-reductase                   436   6e-147   
ref|XP_002456015.1|  hypothetical protein SORBIDRAFT_03g028880          434   8e-147   
dbj|BAF96943.1|  dihydroflavonol 4-reductase                            431   8e-147   
dbj|BAH36910.1|  dihydroflavonol-4-reductase                            434   2e-146   
dbj|BAH36920.1|  dihydroflavonol-4-reductase                            434   2e-146   
dbj|BAN62761.1|  dihydroflavonol 4-reductase                            434   2e-146   
prf||1804328A  dihydroflavonol reductase                                434   2e-146
gb|AAO63026.1|  dihydroflavonol 4-reductase                             434   3e-146   
dbj|BAH36899.1|  dihydroflavonol-4-reductase                            433   3e-146   
dbj|BAH36919.1|  dihydroflavonol-4-reductase                            433   4e-146   
dbj|BAD11017.1|  dihydroflavonol-4-reductase                            433   5e-146   
dbj|BAE78769.1|  dihydroflavonol 4-reductase                            433   7e-146   
gb|AHW45701.1|  mutant dihydroflavonol 4-reductase                      433   9e-146   
gb|AHW45698.1|  dihydroflavonol 4-reductase                             433   1e-145   
gb|AHW45697.1|  dihydroflavonol 4-reductase                             432   2e-145   
ref|XP_008220831.1|  PREDICTED: LOW QUALITY PROTEIN: bifunctional...    431   2e-145   
gb|AHW45699.1|  dihydroflavonol 4-reductase                             432   2e-145   
gb|AAV83986.1|  dihydroflavonol 4-reductase 4                           431   2e-145   
dbj|BAH36915.1|  dihydroflavonol-4-reductase                            431   3e-145   
ref|XP_004969260.1|  PREDICTED: dihydroflavonol-4-reductase-like        431   3e-145   
dbj|BAH36900.1|  dihydroflavonol-4-reductase                            431   3e-145   
gb|AHW45706.1|  mutant dihydroflavonol 4-reductase                      430   2e-144   
ref|XP_004499178.1|  PREDICTED: bifunctional dihydroflavonol 4-re...    425   4e-144   
gb|ACN40030.1|  unknown                                                 428   4e-144   
gb|ABR17584.1|  unknown                                                 428   4e-144   
ref|XP_010232065.1|  PREDICTED: dihydroflavonol-4-reductase-like ...    429   5e-144   
gb|AGR34043.1|  dihydroflavonol-4-reductase                             427   6e-144   
ref|XP_010245914.1|  PREDICTED: bifunctional dihydroflavonol 4-re...    427   6e-144   
gb|AHW45705.1|  mutant dihydroflavonol 4-reductase                      428   6e-144   
gb|ABK24604.1|  unknown                                                 429   1e-143   
dbj|BAF93856.1|  dihydroflavonol 4-reductase                            427   1e-143   
gb|AGT17256.1|  dihydroflavonol4-reductase                              429   2e-143   
ref|XP_011028873.1|  PREDICTED: bifunctional dihydroflavonol 4-re...    423   2e-143   
gb|AAQ77347.1|  dihydroflavonol 4-reductase                             427   4e-143   
gb|ABK22120.1|  unknown                                                 425   6e-143   
dbj|BAF93896.1|  dihydroflavonol 4-reductase                            425   7e-143   
ref|XP_010245913.1|  PREDICTED: dihydroflavonol-4-reductase-like ...    422   2e-142   
ref|NP_001140905.1|  anthocyaninless4                                   424   2e-142   
gb|AAY32602.1|  dihydroflavonol 4-reductase                             423   2e-142   
dbj|BAL15045.1|  dihydroflavonol-4-reductase                            423   2e-142   
dbj|BAH36902.1|  dihydroflavonol-4-reductase                            423   2e-142   
ref|XP_004499179.1|  PREDICTED: bifunctional dihydroflavonol 4-re...    421   2e-142   
ref|XP_002440593.1|  hypothetical protein SORBIDRAFT_09g003710          423   5e-142   
gb|AAY32600.1|  dihydroflavonol 4-reductase                             422   5e-142   
emb|CAA75996.1|  dihydroflavonol4-reductase                             422   5e-142   
ref|XP_010247640.1|  PREDICTED: bifunctional dihydroflavonol 4-re...    421   1e-141   
dbj|BAH98155.1|  dihydroflavonol 4-reductase                            424   2e-141   
gb|AHI49022.1|  dihydroflavonol 4-reductase                             418   3e-141   
ref|XP_010245912.1|  PREDICTED: dihydroflavonol-4-reductase-like ...    419   5e-141   
emb|CAA75998.1|  dihydroflavonol4-reductase                             419   7e-141   
gb|AGJ50590.1|  DFR1                                                    421   2e-140   
gb|ABB29303.1|  NADPH-dependent reductase                               418   3e-140   
gb|ACU19265.1|  unknown                                                 414   1e-139   
sp|P51108.1|DFRA_MAIZE  RecName: Full=Dihydroflavonol-4-reductase...    416   1e-139   
gb|AAW66345.1|  NADPH-dependent reductase                               416   1e-139   
ref|NP_001152467.1|  dihydroflavonol-4-reductase                        415   5e-139   
emb|CAA69253.1|  Dihydroflavonol reductase                              415   8e-139   
emb|CAA75997.1|  dihydroflavonol4-reductase                             414   1e-138   
gb|AAF21888.1|AF101045_3  putative NADPH-dependent reductase A1         414   1e-138   
ref|XP_002451586.1|  hypothetical protein SORBIDRAFT_04g004290          414   2e-138   
gb|ABB29305.1|  NADPH-dependent reductase                               411   1e-137   
dbj|BAE19952.1|  dihydroflavonol 4-reductase                            408   2e-137   
gb|ACN60404.1|  dihydroflavonol-4-reductase                             406   4e-137   
dbj|BAE19951.1|  dihydroflavonol 4-reductase                            408   5e-137   
tpg|DAA58432.1|  TPA: anthocyaninless1                                  409   1e-136   
gb|AAL35830.1|AF434703_1  dihydroflavonol-4-reductase                   409   2e-136   
ref|XP_002456016.1|  hypothetical protein SORBIDRAFT_03g028890          410   2e-136   
gb|AAC17843.1|  dihydroflavonol-4-reductase                             408   2e-136   
gb|AAB94015.1|  NADPH-dependent reductase A1-b                          407   2e-135   
gb|AAV83984.1|  dihydroflavonol 4-reductase 2                           399   1e-133   
gb|ABF21084.1|  dihydroflavonol 4-reductase                             395   1e-132   
gb|AAD10522.2|  NADPH-dependent reductase                               387   6e-129   
gb|ADN03368.1|  dihydroflavonol 4-reductase                             385   2e-128   
gb|EAZ12808.1|  hypothetical protein OsJ_02728                          384   4e-127   
gb|ABA86595.1|  putative dihydroflavonol 4-reductase                    381   5e-127   
dbj|BAD68895.1|  putative dihydrokaempferol 4-reductase                 383   2e-126   
gb|AGA82802.1|  dihydroflavonol reductase 1                             375   4e-125   
gb|AGA82775.1|  dihydroflavonol reductase 2                             375   5e-125   
gb|ADP09380.1|  dihydroflavonol reductase                               374   3e-124   
gb|AAY32601.1|  dihydroflavonol 4-reductase                             373   5e-123   
ref|XP_010664947.1|  PREDICTED: dihydroflavonol-4-reductase-like        371   4e-122   
gb|AGA82779.1|  dihydroflavonol reductase 2                             366   1e-121   
gb|AAF81742.1|AF267172_1  dihydroflavonol 4-reductase                   366   3e-121   
gb|AAF78071.1|  dihydroflavonol-4-reductase                             365   3e-121   
gb|AGA82770.1|  dihydroflavonol reductase 2                             364   6e-121   
emb|CBI19728.3|  unnamed protein product                                372   8e-121   
gb|AGA82786.1|  dihydroflavonol reductase 1                             362   4e-120   
gb|KHG12457.1|  Dihydroflavonol-4-reductase                             363   8e-120   
gb|AHW45704.1|  mutant dihydroflavonol 4-reductase                      360   5e-119   
gb|ABK26123.1|  unknown                                                 362   5e-119   
dbj|BAD05176.1|  dihydroflavonol 4-reductase                            355   1e-117   
gb|AAY45747.1|  dihydroflavonol-4-reductase                             347   3e-114   
dbj|BAF03077.1|  dihydroflavonol 4-reductase                            346   4e-114   
dbj|BAC98343.1|  dihydroflavonol reductase                              345   8e-114   
gb|ACV49882.1|  dihydroflavonol 4-reductase                             344   1e-112   
gb|AGO18339.1|  dihydroflavonol reductase                               342   3e-112   
gb|ADO16089.1|  DFRB                                                    335   1e-110   
gb|ABR18365.1|  unknown                                                 341   2e-110   
gb|ADO16083.1|  DFRB                                                    334   2e-110   
gb|ADO16079.1|  DFRB                                                    333   4e-110   
gb|ADO16091.1|  DFRB                                                    333   6e-110   
gb|ADO16074.1|  DFRB                                                    332   1e-109   
gb|ADO16078.1|  DFRB                                                    332   1e-109   
gb|ADO16092.1|  DFRB                                                    332   3e-109   
sp|P51109.1|DFRA_MEDSA  RecName: Full=Dihydroflavonol-4-reductase...    333   3e-109   
gb|ADX68822.1|  dihydroflavonol 4-reductase                             333   3e-109   
gb|ADO16075.1|  DFRB                                                    330   2e-108   
ref|XP_010649291.1|  PREDICTED: LOW QUALITY PROTEIN: dihydroflavo...    332   4e-108   
emb|CAF34418.1|  dihydroflavonol 4-reductase                            331   4e-108   
gb|ADO16086.1|  DFRB                                                    328   7e-108   
gb|ADO16088.1|  DFRB                                                    327   2e-107   
gb|ADO16093.1|  DFRB                                                    326   3e-107   
gb|ADO16087.1|  DFRB                                                    325   6e-107   
gb|ADO16081.1|  DFRB                                                    325   7e-107   
dbj|BAO53728.1|  dihydroflavonol 4-reducatase 2                         327   1e-106   
gb|ADO16090.1|  DFRB                                                    325   1e-106   
gb|ADX68821.1|  dihydroflavonol 4-reductase                             325   2e-106   
gb|ABK24620.1|  unknown                                                 330   3e-106   
gb|AAD56579.1|AF184272_1  dihydroflavonol 4-reductase like              330   3e-106   
gb|ADX68818.1|  dihydroflavonol 4-reductase                             325   4e-106   
ref|XP_007017587.1|  Dihydroflavonol-4-reductase                        327   8e-106   
gb|ADO16076.1|  DFRB                                                    322   9e-106   
gb|ADO16084.1|  DFRB                                                    322   1e-105   
emb|CAB94914.1|  dihydroflavonol 4-reductase                            325   1e-105   
gb|ADO16080.1|  DFRB                                                    322   1e-105   
gb|ADX68820.1|  dihydroflavonol 4-reductase                             322   4e-105   
gb|ADO16082.1|  DFRB                                                    318   8e-104   
gb|ABK27116.1|  unknown                                                 324   1e-103   
gb|AAU95082.1|  anthocyanidin reductase                                 323   4e-103   
gb|AAW66347.1|  NADPH-dependent reductase                               315   1e-101   
dbj|BAI66081.1|  dihydroflavonol 4-reductase                            307   4e-99    
gb|ADE76248.1|  unknown                                                 311   2e-98    
gb|AGA82790.1|  dihydroflavonol reductase 3                             305   4e-98    
gb|ADE77658.1|  unknown                                                 309   7e-98    
ref|XP_009368377.1|  PREDICTED: anthocyanidin reductase-like            308   1e-97    
gb|AEQ61978.1|  dihydroflavonol 4-reductase                             303   1e-97    
ref|XP_010097631.1|  Bifunctional dihydroflavonol 4-reductase/fla...    304   1e-97    
emb|CDP19907.1|  unnamed protein product                                308   2e-97    
gb|AHW45702.1|  mutant dihydroflavonol 4-reductase                      303   1e-96    
gb|AEL79860.1|  anthocyanidin reductase                                 304   6e-96    
ref|NP_001280930.1|  anthocyanidin reductase                            304   6e-96    
gb|ABV71915.1|  DFR                                                     296   8e-95    
gb|KDP38533.1|  hypothetical protein JCGZ_04458                         299   9e-95    
gb|AFZ93012.1|  anthocyanidin reductase                                 301   9e-95    
gb|ADO16077.1|  DFRB                                                    294   9e-95    
gb|AAX12184.1|  putative anthocyanidin reductase                        300   1e-94    
ref|XP_010241022.1|  PREDICTED: anthocyanidin reductase                 300   1e-94    
gb|AAZ17408.1|  anthocyanidin reductase                                 300   2e-94    
ref|XP_009368282.1|  PREDICTED: anthocyanidin reductase-like            300   2e-94    
gb|AFZ93006.1|  anthocyanidin reductase                                 300   2e-94    
gb|AAZ79363.1|  anthocyanidin reductase                                 300   2e-94    
gb|ADY02685.1|  dihydroflavonol 4-reductase                             294   2e-94    
ref|XP_010251431.1|  PREDICTED: anthocyanidin reductase-like            300   2e-94    
gb|AGA82788.1|  dihydroflavonol reductase 3                             294   3e-94    
gb|AGL81352.1|  anthocyanidin reductase                                 299   5e-94    
gb|ADB43599.1|  dihydroflavonol 4-reductase                             292   2e-93    
gb|ABB77695.1|  anthocyanidin reductase                                 297   3e-93    
gb|AGM48591.1|  dihydroflavonol 4-reductase 1                           291   4e-93    
gb|ABG76842.1|  anthocyanidin reductase                                 296   5e-93    



>dbj|BAA22072.1| dihydroflavonol 4-reductase [Ipomoea nil]
 dbj|BAA59333.1| dihydroflavonol 4-reductase [Ipomoea nil]
Length=403

 Score =   824 bits (2129),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/404 (99%), Positives = 401/404 (99%), Gaps = 2/404 (0%)
 Frame = +2

Query  68    MVDGNHPLLPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKAD  247
             MVDGNHPLLPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKAD
Sbjct  1     MVDGNHPLLPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKAD  60

Query  248   TNLTIWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCV  427
             TNLTIWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCV
Sbjct  61    TNLTIWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCV  120

Query  428   KAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAW  607
             KAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAW
Sbjct  121   KAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAW  180

Query  608   KVTKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLC  787
             KVTKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLC
Sbjct  181   KVTKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLC  240

Query  788   EAHIFLYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSK  967
             EAHIFLYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSK
Sbjct  241   EAHIFLYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSK  300

Query  968   KLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEKPTAIEQK  1147
             KLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEKPTAIEQK
Sbjct  301   KLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEKPTAIEQK  360

Query  1148  QEAKTVPLKPSAIEQKQETAVPLKLEEEPTAIEQKQEAKTVPLK  1279
             QEAKTVPLKPSAIEQKQETAVPLKLEEEPTAIEQKQE   VPLK
Sbjct  361   QEAKTVPLKPSAIEQKQETAVPLKLEEEPTAIEQKQE--VVPLK  402



>gb|ACS87954.1| dihydroflavonol 4-reductase [Ipomoea horsfalliae]
Length=414

 Score =   767 bits (1980),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/419 (92%), Positives = 393/419 (94%), Gaps = 14/419 (3%)
 Frame = +2

Query  68    MVDGNHP---LLPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELP  238
             MVDGNHP   L PPKVCVTGAAGFIGSWLV  LLQRGYH+HATVRDPGNTKKV HLLELP
Sbjct  1     MVDGNHPAPALPPPKVCVTGAAGFIGSWLVMKLLQRGYHVHATVRDPGNTKKVNHLLELP  60

Query  239   KADTNLTIWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIIN  418
             KADTNLT+WKGVMEEEGSFDEAIAGCEGVFHVATP DFDSKDPENEVIKPAINGVLNIIN
Sbjct  61    KADTNLTVWKGVMEEEGSFDEAIAGCEGVFHVATPTDFDSKDPENEVIKPAINGVLNIIN  120

Query  419   SCVKAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEK  598
             SCVKAKTVKRLVFTSSAG LNVQPQQKPV DE+CWSDLDFIYAKKMTGWMYFASKILAEK
Sbjct  121   SCVKAKTVKRLVFTSSAGALNVQPQQKPVCDESCWSDLDFIYAKKMTGWMYFASKILAEK  180

Query  599   EAWKVTKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLD  778
             EAWK TKEKKIDFISIIPPLVVGPFI+PTFPPSLITALSLITGNQAHYSIIKQGQYVHLD
Sbjct  181   EAWKATKEKKIDFISIIPPLVVGPFISPTFPPSLITALSLITGNQAHYSIIKQGQYVHLD  240

Query  779   DLCEAHIFLYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYF  958
             DLCEAHIFLYEHPKAEGRFICSSHHTTIHGLA+MI QNWPEYYIPSEFKGIEKDLPVVYF
Sbjct  241   DLCEAHIFLYEHPKAEGRFICSSHHTTIHGLAEMIRQNWPEYYIPSEFKGIEKDLPVVYF  300

Query  959   SSKKLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEKPTAI  1138
             SSKKLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKE AAIEEEQETV LKVE+PTAI
Sbjct  301   SSKKLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEPAAIEEEQETVPLKVEEPTAI  360

Query  1139  EQKQEAKTVPLKPSAIEQKQETAVPLKLEEEPTAIEQKQEAKTVPLK---PSAIEQKQE  1306
             EQKQEA    LKP+AIEQ+QET VPLKL EEPTAIEQKQE  TVPLK   P+AIEQ QE
Sbjct  361   EQKQEA----LKPAAIEQRQET-VPLKL-EEPTAIEQKQE--TVPLKLEEPTAIEQMQE  411



>dbj|BAF64707.1| dihydroflavonol 4-reductase [Ipomoea tricolor]
 dbj|BAF64708.1| dihydroflavonol 4-reductase [Ipomoea tricolor]
 dbj|BAF64709.1| dihydroflavonol 4-reductase [Ipomoea tricolor]
Length=421

 Score =   760 bits (1962),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/425 (92%), Positives = 402/425 (95%), Gaps = 11/425 (3%)
 Frame = +2

Query  68    MVDGNHPLLPP-KVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKA  244
             MVDGNHP LPP KVCVTGAAGFIGSWLV  LLQRGYH+HATVRDPGNTKKVKHLLELPKA
Sbjct  1     MVDGNHPALPPPKVCVTGAAGFIGSWLVMKLLQRGYHVHATVRDPGNTKKVKHLLELPKA  60

Query  245   DTNLTIWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSC  424
             DTNLT+WKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSC
Sbjct  61    DTNLTLWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSC  120

Query  425   VKAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEA  604
              KAKTVKRLVFTSSAGTLNVQPQQKPVY E CWSDLDFIYAKKMTGWMYFASKILAEKEA
Sbjct  121   AKAKTVKRLVFTSSAGTLNVQPQQKPVYHENCWSDLDFIYAKKMTGWMYFASKILAEKEA  180

Query  605   WKVTKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDL  784
             WK TKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGN+AHYSIIKQGQYVHLDDL
Sbjct  181   WKATKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNEAHYSIIKQGQYVHLDDL  240

Query  785   CEAHIFLYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSS  964
             CEAHIFLYEHPKAEGRFICSSHHTTIHGLA+MITQNWPEYYIPS+FKGIEKDL VVYFSS
Sbjct  241   CEAHIFLYEHPKAEGRFICSSHHTTIHGLAEMITQNWPEYYIPSQFKGIEKDLAVVYFSS  300

Query  965   KKLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEKP-TAIE  1141
             KKLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETV LKVE+P +AIE
Sbjct  301   KKLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVPLKVEEPISAIE  360

Query  1142  QKQEAKTVPLKPSAIEQKQETAVPLKLEEEPTAIEQKQEAKTVPLK----PSAIEQKQET  1309
             QKQEAKTVPLKP+AIEQKQET VPLKL EEPTAIEQKQE   VPLK     +AIEQKQE 
Sbjct  361   QKQEAKTVPLKPAAIEQKQET-VPLKL-EEPTAIEQKQE--IVPLKLEEPTTAIEQKQEV  416

Query  1310  AVPLK  1324
              VPLK
Sbjct  417   -VPLK  420



>gb|ABL74479.1| dihydroflavonol 4-reductase [Ipomoea batatas]
Length=394

 Score =   756 bits (1952),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/404 (93%), Positives = 383/404 (95%), Gaps = 11/404 (3%)
 Frame = +2

Query  68    MVDGNHPLLPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKAD  247
             MVDGNHP +   VCVTGAAGFIGSWLV TLLQRGYH+HATVRDPGNTKKVKHLLELPKAD
Sbjct  1     MVDGNHPQV---VCVTGAAGFIGSWLVMTLLQRGYHVHATVRDPGNTKKVKHLLELPKAD  57

Query  248   TNLTIWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCV  427
             TNL +WKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCV
Sbjct  58    TNLRVWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCV  117

Query  428   KAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAW  607
             KAKTVKRLVFTSSAGTLNVQPQQKPVYDE+CWSDLDFIYAKKMTGWMYFASKILAEKEAW
Sbjct  118   KAKTVKRLVFTSSAGTLNVQPQQKPVYDESCWSDLDFIYAKKMTGWMYFASKILAEKEAW  177

Query  608   KVTKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLC  787
             K TKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLC
Sbjct  178   KATKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLC  237

Query  788   EAHIFLYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSK  967
             EAHIFLYEHPKAEGRFICSSHHTTIHGL +MI QNWPEYYIPS+FKGIEKDLPVVYFSSK
Sbjct  238   EAHIFLYEHPKAEGRFICSSHHTTIHGLGEMIRQNWPEYYIPSQFKGIEKDLPVVYFSSK  297

Query  968   KLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEKPTAIEQK  1147
             KLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKE AAIEEEQETV LKV++PT    K
Sbjct  298   KLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEPAAIEEEQETVPLKVQEPT----K  353

Query  1148  QEAKTVPLKPSAIEQKQETAVPLKLEEEPTAIEQKQEAKTVPLK  1279
             QEA TVPLKP+AIEQKQET VPLKL EEPTAIEQKQE   VPLK
Sbjct  354   QEATTVPLKPAAIEQKQET-VPLKL-EEPTAIEQKQE--VVPLK  393



>dbj|BAA34637.1| dihydroflavonol 4-reductase [Ipomoea batatas]
 gb|AEQ92209.1| dihydroflavonol 4-reductase [Ipomoea batatas]
Length=394

 Score =   756 bits (1952),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/404 (93%), Positives = 383/404 (95%), Gaps = 11/404 (3%)
 Frame = +2

Query  68    MVDGNHPLLPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKAD  247
             MVDGNHP +   VCVTGAAGFIGSWLV TLLQRGYH+HATVRDPGNTKKVKHLLELPKAD
Sbjct  1     MVDGNHPKV---VCVTGAAGFIGSWLVMTLLQRGYHVHATVRDPGNTKKVKHLLELPKAD  57

Query  248   TNLTIWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCV  427
             TNL +WKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCV
Sbjct  58    TNLRVWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCV  117

Query  428   KAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAW  607
             KAKTVKRLVFTSSAGTLNVQPQQKPVYDE+CWSDLDFIYAKKMTGWMYFASKILAEKEAW
Sbjct  118   KAKTVKRLVFTSSAGTLNVQPQQKPVYDESCWSDLDFIYAKKMTGWMYFASKILAEKEAW  177

Query  608   KVTKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLC  787
             K TKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLC
Sbjct  178   KATKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLC  237

Query  788   EAHIFLYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSK  967
             EAHIFLYEHPKAEGRFICSSHHTTIHGL +MI QNWPEYYIPS+FKGIEKDLPVVYFSSK
Sbjct  238   EAHIFLYEHPKAEGRFICSSHHTTIHGLGEMIRQNWPEYYIPSQFKGIEKDLPVVYFSSK  297

Query  968   KLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEKPTAIEQK  1147
             KLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKE AAIEEEQETV LKV++PT    K
Sbjct  298   KLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEPAAIEEEQETVPLKVQEPT----K  353

Query  1148  QEAKTVPLKPSAIEQKQETAVPLKLEEEPTAIEQKQEAKTVPLK  1279
             QEA TVPLKP+AIEQKQET VPLKL EEPTAIEQKQ  K VPLK
Sbjct  354   QEATTVPLKPAAIEQKQET-VPLKL-EEPTAIEQKQ--KVVPLK  393



>dbj|BAD05164.1| dihydroflavonol 4-reductase [Ipomoea batatas]
 dbj|BAD05178.1| dihydroflavonol 4-reductase [Ipomoea batatas]
Length=394

 Score =   756 bits (1952),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/404 (93%), Positives = 382/404 (95%), Gaps = 11/404 (3%)
 Frame = +2

Query  68    MVDGNHPLLPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKAD  247
             MVD NHP +   VCVTGAAGFIGSWLV TLLQRGYH+HATVRDPGNTKKVKHLLELPKAD
Sbjct  1     MVDANHPKV---VCVTGAAGFIGSWLVMTLLQRGYHVHATVRDPGNTKKVKHLLELPKAD  57

Query  248   TNLTIWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCV  427
             TNLT+WKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCV
Sbjct  58    TNLTVWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCV  117

Query  428   KAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAW  607
             KAKTVKRLVFTSSAGTLNVQPQQKPVYDE+CWSDLDFIYAKKMTGWMYFASKILAEKEAW
Sbjct  118   KAKTVKRLVFTSSAGTLNVQPQQKPVYDESCWSDLDFIYAKKMTGWMYFASKILAEKEAW  177

Query  608   KVTKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLC  787
             K TKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLC
Sbjct  178   KATKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLC  237

Query  788   EAHIFLYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSK  967
             EAHIFLYEHPKAEGRFICSSHHTTIHGLA+MI QNWPEYYIPSEFKGIEKDLPVVYFSSK
Sbjct  238   EAHIFLYEHPKAEGRFICSSHHTTIHGLAEMIKQNWPEYYIPSEFKGIEKDLPVVYFSSK  297

Query  968   KLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEKPTAIEQK  1147
             KLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKE AAIEEEQET  LKV++PT    K
Sbjct  298   KLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEPAAIEEEQETAPLKVQEPT----K  353

Query  1148  QEAKTVPLKPSAIEQKQETAVPLKLEEEPTAIEQKQEAKTVPLK  1279
             QEA TVPLKP+AIEQKQET VPLK  EEPTAIEQKQE   VPLK
Sbjct  354   QEATTVPLKPAAIEQKQET-VPLKF-EEPTAIEQKQE--VVPLK  393



>dbj|BAA36406.1| dihydroflavonol 4-reductase [Ipomoea purpurea]
 dbj|BAA74699.1| dihydroflavonol 4-reductase [Ipomoea purpurea]
Length=386

 Score =   751 bits (1938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/404 (91%), Positives = 375/404 (93%), Gaps = 19/404 (5%)
 Frame = +2

Query  68    MVDGNHPLLPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKAD  247
             MVDGNHPL  PKVCVTGAAGFIGSWLVKTLLQRGYH+HATVRDPGNTKKVKHL+ELPKAD
Sbjct  1     MVDGNHPLPAPKVCVTGAAGFIGSWLVKTLLQRGYHVHATVRDPGNTKKVKHLVELPKAD  60

Query  248   TNLTIWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCV  427
             TNLT+WKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKP INGVLNIINSCV
Sbjct  61    TNLTVWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPTINGVLNIINSCV  120

Query  428   KAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAW  607
             KAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAW
Sbjct  121   KAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAW  180

Query  608   KVTKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLC  787
             K TKEK+IDFISIIPPLVVGPFITPTFPPSLITALSLITGN+AHYSIIKQGQYVHLDDLC
Sbjct  181   KATKEKQIDFISIIPPLVVGPFITPTFPPSLITALSLITGNEAHYSIIKQGQYVHLDDLC  240

Query  788   EAHIFLYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSK  967
             EAHIFLYEHPKAEGRFICSSHHTTIHGLADMIT NWPEYYIPS+FKGIEK+LPVVYFSSK
Sbjct  241   EAHIFLYEHPKAEGRFICSSHHTTIHGLADMITHNWPEYYIPSQFKGIEKELPVVYFSSK  300

Query  968   KLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEKPTAIEQK  1147
             KLQDMGFQFKYSLEDMYRG+IETLRKKGLLPYSTKE AAIEEEQETV LKVE+PTAIEQK
Sbjct  301   KLQDMGFQFKYSLEDMYRGSIETLRKKGLLPYSTKETAAIEEEQETVPLKVEEPTAIEQK  360

Query  1148  QEAKTVPLKPSAIEQKQETAVPLKLEEEPTAIEQKQEAKTVPLK  1279
             QE                  VPLKLEEEP AIEQKQE   VPLK
Sbjct  361   QE-----------------TVPLKLEEEPIAIEQKQEV--VPLK  385



>gb|ACB42445.1| dihydroflavonol 4-reductase [Ipomoea batatas]
Length=395

 Score =   745 bits (1923),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/405 (92%), Positives = 381/405 (94%), Gaps = 12/405 (3%)
 Frame = +2

Query  68    MVDGNHPLLPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKAD  247
             MVD NHP +   VCVTGAAGFIGSWLV TLLQRGYH+HATVRDPGNTKKVKHLLELPKAD
Sbjct  1     MVDANHPKV---VCVTGAAGFIGSWLVMTLLQRGYHVHATVRDPGNTKKVKHLLELPKAD  57

Query  248   TNLTIWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCV  427
             TNLT+WKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCV
Sbjct  58    TNLTVWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCV  117

Query  428   KAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAW  607
             KAKTVKRLVFTSSAGTLNVQPQQKPVYDE+CWSDLDFIYAKKMTGWMYFASKILAEKEAW
Sbjct  118   KAKTVKRLVFTSSAGTLNVQPQQKPVYDESCWSDLDFIYAKKMTGWMYFASKILAEKEAW  177

Query  608   KVTKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLC  787
             K TKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLC
Sbjct  178   KATKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLC  237

Query  788   EAHIFLYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSK  967
             EAHIFLYEHPKAEGRFICSSHHTTIHGLA+MI QNWPEYYIPSEFKGIEKDLPVVYFSSK
Sbjct  238   EAHIFLYEHPKAEGRFICSSHHTTIHGLAEMIRQNWPEYYIPSEFKGIEKDLPVVYFSSK  297

Query  968   KLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEA-AAIEEEQETVALKVEKPTAIEQ  1144
             KLQ+MGFQFKYSLEDMYRGAIE LRKKGLLPYSTKE  AAIEEEQETV LKV++PT    
Sbjct  298   KLQEMGFQFKYSLEDMYRGAIEILRKKGLLPYSTKELPAAIEEEQETVPLKVQEPT----  353

Query  1145  KQEAKTVPLKPSAIEQKQETAVPLKLEEEPTAIEQKQEAKTVPLK  1279
             KQEA TVPLK +AIE KQET VPLKL EEPTAIEQKQ  K VPLK
Sbjct  354   KQEATTVPLKAAAIEPKQET-VPLKL-EEPTAIEQKQ--KVVPLK  394



>gb|ABY25283.1| dihydroflavonol 4-reductase B [Turbina oblongata]
Length=399

 Score =   735 bits (1897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/394 (91%), Positives = 373/394 (95%), Gaps = 9/394 (2%)
 Frame = +2

Query  68    MVDGNH--PLLPPK-----VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHL  226
             MVDGNH  P LPP      VCVTGAAGFIGSWLV TLL+RGYH+HATVRDPGNTKKVKHL
Sbjct  1     MVDGNHAAPALPPPTKPKVVCVTGAAGFIGSWLVMTLLRRGYHVHATVRDPGNTKKVKHL  60

Query  227   LELPKADTNLTIWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVL  406
             L+LPKADTNLT+WKGVMEEEGSFDEAIAGCEGVFHVATPMDF+SKDPENEVIKPAINGVL
Sbjct  61    LDLPKADTNLTVWKGVMEEEGSFDEAIAGCEGVFHVATPMDFESKDPENEVIKPAINGVL  120

Query  407   NIINSCVKAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKI  586
             NIINSC KAKTVKRLVFTSSAGTLNVQPQQKP+YDE+CWSDLDFIYAKKMTGWMYFASKI
Sbjct  121   NIINSCAKAKTVKRLVFTSSAGTLNVQPQQKPLYDESCWSDLDFIYAKKMTGWMYFASKI  180

Query  587   LAEKEAWKVTKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQY  766
             LAEKEAWK TKEK+IDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQY
Sbjct  181   LAEKEAWKATKEKQIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQY  240

Query  767   VHLDDLCEAHIFLYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLP  946
             VHLDDLCEAHIFLYEHPKAEGRFICSSHHTTIHGLADMI +NWPEYY+PSEF GIEKDLP
Sbjct  241   VHLDDLCEAHIFLYEHPKAEGRFICSSHHTTIHGLADMIRENWPEYYVPSEFXGIEKDLP  300

Query  947   VVYFSSKKLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEK  1126
             VV FSSKKLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKE AAIEE+QETV LKVE+
Sbjct  301   VVIFSSKKLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEPAAIEEKQETVPLKVEE  360

Query  1127  PTAIEQKQEAKTVPLKPSAIEQKQETAVPLKLEE  1228
             P A+EQKQEA  VPLKP++IEQKQET VPLKLEE
Sbjct  361   PAAVEQKQEA-AVPLKPASIEQKQET-VPLKLEE  392



>dbj|BAA74700.1| dihydroflavonol 4-reductase [Ipomoea purpurea]
Length=386

 Score =   731 bits (1887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/404 (91%), Positives = 376/404 (93%), Gaps = 19/404 (5%)
 Frame = +2

Query  68    MVDGNHPLLPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKAD  247
             MVDGNHPL  PKVCVTGAAGFIGSWLVKTLLQRGYH+HATVRDPGNTKKVKHL+ELPKAD
Sbjct  1     MVDGNHPLPAPKVCVTGAAGFIGSWLVKTLLQRGYHVHATVRDPGNTKKVKHLVELPKAD  60

Query  248   TNLTIWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCV  427
             TNLT+WKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKP INGVLNIINSCV
Sbjct  61    TNLTVWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPTINGVLNIINSCV  120

Query  428   KAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAW  607
             KAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAW
Sbjct  121   KAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAW  180

Query  608   KVTKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLC  787
             K TKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLC
Sbjct  181   KATKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLC  240

Query  788   EAHIFLYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSK  967
             EAHIFLYEHPKAEGRFICSSHHTTIHGLA+MITQNWPEYYIPS+FKGIEK+L VVYFSSK
Sbjct  241   EAHIFLYEHPKAEGRFICSSHHTTIHGLAEMITQNWPEYYIPSQFKGIEKELAVVYFSSK  300

Query  968   KLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEKPTAIEQK  1147
             KLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETV LKVE+PTAIEQK
Sbjct  301   KLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVPLKVEEPTAIEQK  360

Query  1148  QEAKTVPLKPSAIEQKQETAVPLKLEEEPTAIEQKQEAKTVPLK  1279
             QE                  VPLKLEEEP AIE+KQE   VPLK
Sbjct  361   QE-----------------TVPLKLEEEPIAIEKKQEV--VPLK  385



>gb|ABW69680.1| dihydroflavonol 4-reductase [Ipomoea purpurea]
Length=386

 Score =   729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/404 (91%), Positives = 375/404 (93%), Gaps = 19/404 (5%)
 Frame = +2

Query  68    MVDGNHPLLPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKAD  247
             MVDGNHPL  PKVCVTGAAGFIGSWLVKTLLQRGYH+HATVRDPGNTKKVKHL+ELPKAD
Sbjct  1     MVDGNHPLPAPKVCVTGAAGFIGSWLVKTLLQRGYHVHATVRDPGNTKKVKHLVELPKAD  60

Query  248   TNLTIWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCV  427
             TNLT+WKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKP INGVLNIINSCV
Sbjct  61    TNLTVWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPTINGVLNIINSCV  120

Query  428   KAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAW  607
             KAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAW
Sbjct  121   KAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAW  180

Query  608   KVTKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLC  787
             K TKEK+IDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLC
Sbjct  181   KATKEKQIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLC  240

Query  788   EAHIFLYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSK  967
             EAHIFLYEHPKAEGRFICSSHHTTIHGLADMIT NWPEYYIPS+FKGIEK+LPVVYFSSK
Sbjct  241   EAHIFLYEHPKAEGRFICSSHHTTIHGLADMITHNWPEYYIPSQFKGIEKELPVVYFSSK  300

Query  968   KLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEKPTAIEQK  1147
             KLQDMGFQFKYSLEDMYRG+IETLRKKGLL YSTKEAAAIEEEQETV LKVE+PTAIEQK
Sbjct  301   KLQDMGFQFKYSLEDMYRGSIETLRKKGLLLYSTKEAAAIEEEQETVPLKVEEPTAIEQK  360

Query  1148  QEAKTVPLKPSAIEQKQETAVPLKLEEEPTAIEQKQEAKTVPLK  1279
             QE                  VPLKLEEEP AIEQKQE   VPLK
Sbjct  361   QE-----------------TVPLKLEEEPIAIEQKQEV--VPLK  385



>gb|AAB84048.1| dihydroflavonol 4-reductase [Ipomoea purpurea]
Length=386

 Score =   729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/404 (91%), Positives = 376/404 (93%), Gaps = 19/404 (5%)
 Frame = +2

Query  68    MVDGNHPLLPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKAD  247
             MVDGNHPL  PKVCVTGAAGFIGSWLVKTLLQRGYH+HATVRDPGNTKKVKHL+ELPKAD
Sbjct  1     MVDGNHPLPAPKVCVTGAAGFIGSWLVKTLLQRGYHVHATVRDPGNTKKVKHLVELPKAD  60

Query  248   TNLTIWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCV  427
             TNLT+WKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKP INGVLNIINSCV
Sbjct  61    TNLTVWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPTINGVLNIINSCV  120

Query  428   KAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAW  607
             KAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAW
Sbjct  121   KAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAW  180

Query  608   KVTKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLC  787
             K TKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGN+AHYSIIKQGQYVHLDDLC
Sbjct  181   KATKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNEAHYSIIKQGQYVHLDDLC  240

Query  788   EAHIFLYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSK  967
             EAHIFLYEHPKAEGRFICSSHHTTIHGLA+MITQNWPEYYIPS+FKGIEK+L VVYFSSK
Sbjct  241   EAHIFLYEHPKAEGRFICSSHHTTIHGLAEMITQNWPEYYIPSQFKGIEKELAVVYFSSK  300

Query  968   KLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEKPTAIEQK  1147
             KLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETV LKVE+PTAIEQK
Sbjct  301   KLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVPLKVEEPTAIEQK  360

Query  1148  QEAKTVPLKPSAIEQKQETAVPLKLEEEPTAIEQKQEAKTVPLK  1279
             QE                  VPLKLEEEP AIE+KQE   VPLK
Sbjct  361   QE-----------------TVPLKLEEEPIAIEKKQEV--VPLK  385



>gb|ABW69681.1| dihydroflavonol 4-reductase [Ipomoea purpurea]
Length=386

 Score =   729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/404 (91%), Positives = 375/404 (93%), Gaps = 19/404 (5%)
 Frame = +2

Query  68    MVDGNHPLLPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKAD  247
             MVDGNHPL  PKVCVTGAAGFIGSWLVKTLLQRGYH+HATVRDPGNTKKVKHL+ELPKAD
Sbjct  1     MVDGNHPLPAPKVCVTGAAGFIGSWLVKTLLQRGYHVHATVRDPGNTKKVKHLVELPKAD  60

Query  248   TNLTIWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCV  427
             TNLT+WKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKP INGVLNIINSCV
Sbjct  61    TNLTVWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPTINGVLNIINSCV  120

Query  428   KAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAW  607
             KAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAW
Sbjct  121   KAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAW  180

Query  608   KVTKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLC  787
             K TKEK+IDFISIIPPLVVGPFITPTFPPSLITALSLITGN+AHYSIIKQGQYVHLDDLC
Sbjct  181   KATKEKQIDFISIIPPLVVGPFITPTFPPSLITALSLITGNEAHYSIIKQGQYVHLDDLC  240

Query  788   EAHIFLYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSK  967
             EAHIFLYEHPKAEGRFICSSHHTTIHGLADMIT NWPEYYIPS+FKGIEK+L VVYFSSK
Sbjct  241   EAHIFLYEHPKAEGRFICSSHHTTIHGLADMITHNWPEYYIPSQFKGIEKELAVVYFSSK  300

Query  968   KLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEKPTAIEQK  1147
             KLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETV LKVE+PTAIEQK
Sbjct  301   KLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVPLKVEEPTAIEQK  360

Query  1148  QEAKTVPLKPSAIEQKQETAVPLKLEEEPTAIEQKQEAKTVPLK  1279
             QE                  VPLKLEEEP AIEQKQE   VPLK
Sbjct  361   QE-----------------TVPLKLEEEPIAIEQKQEV--VPLK  385



>gb|ABY61976.1| dihydroflavonol 4-reductase [Ipomoea batatas]
Length=398

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/405 (87%), Positives = 362/405 (89%), Gaps = 9/405 (2%)
 Frame = +2

Query  68    MVDGNHPLLPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKAD  247
             MVDGNHPLLPPKVCVTG AGFIGSWLV TLLQRGYH+HATVRDPGNTKKVKHLLELPKAD
Sbjct  1     MVDGNHPLLPPKVCVTGPAGFIGSWLVMTLLQRGYHVHATVRDPGNTKKVKHLLELPKAD  60

Query  248   TNLTIWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCV  427
             TNLT+WKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCV
Sbjct  61    TNLTVWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCV  120

Query  428   KAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAW  607
             KAKTVKRLVFTSSAGTLNVQPQQKPVYDE+CWSDLDFIYAKKMTGWMYFASKILAEKEAW
Sbjct  121   KAKTVKRLVFTSSAGTLNVQPQQKPVYDESCWSDLDFIYAKKMTGWMYFASKILAEKEAW  180

Query  608   KVTKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLC  787
             K TKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLC
Sbjct  181   KATKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLC  240

Query  788   EAHIFLYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSK  967
             EAHIFLYEHPKAEGRFICSSHHTTIHGL +MI QNWPEYY  SEFKG EKDLPVVYFSSK
Sbjct  241   EAHIFLYEHPKAEGRFICSSHHTTIHGLCEMIRQNWPEYYFLSEFKGSEKDLPVVYFSSK  300

Query  968   KLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKE-AAAIEEEQETVALKVEKPTAIEQ  1144
             KLQ+MGF+ KY  ED YRG I T R KGL+PY  KE   AI+EE  T  LKV++ T    
Sbjct  301   KLQEMGFRLKYCFEDNYRGEIVTSRMKGLIPYCNKEWPGAIDEEHATTPLKVQEHT----  356

Query  1145  KQEAKTVPLKPSAIEQKQETAVPLKLEEEPTAIEQKQEAKTVPLK  1279
              QEA TVPLK  AIE KQ T VPLKL EEP A EQK+  K VPLK
Sbjct  357   NQEATTVPLKAGAIEPKQGT-VPLKL-EEPNASEQKR--KVVPLK  397



>gb|AAS46256.1| dihydroflavonol reductase [Ipomoea quamoclit]
Length=408

 Score =   700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/424 (85%), Positives = 379/424 (89%), Gaps = 26/424 (6%)
 Frame = +2

Query  68    MVDGNHPLLPP-----KVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLE  232
             MVDGNHP   P     KVCVTG AGFIGSWLV  LLQ+GYH+HATVRDPGNTKK+KHLLE
Sbjct  1     MVDGNHPAPAPALTPPKVCVTGTAGFIGSWLVMKLLQQGYHVHATVRDPGNTKKLKHLLE  60

Query  233   LPKADTNLTIWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNI  412
             LP ADTNLT+WKGVMEEEGSFDEAIAGCEGV HVATPMDF SKDP+NE+IKPAINGVLNI
Sbjct  61    LPMADTNLTVWKGVMEEEGSFDEAIAGCEGVSHVATPMDFHSKDPDNELIKPAINGVLNI  120

Query  413   INSCVKAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILA  592
             I SCVKAKTVKRLVFTSSAGTLNV PQQKPV DETCWSDLDFIYAKKMTGWMYFASKILA
Sbjct  121   IKSCVKAKTVKRLVFTSSAGTLNVHPQQKPVCDETCWSDLDFIYAKKMTGWMYFASKILA  180

Query  593   EKEAWKVTKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVH  772
             +KEAWK TKEK+IDFISIIPPLVVGPFITPTFPPSLITALSLITGN+AHYSIIKQGQYVH
Sbjct  181   DKEAWKATKEKQIDFISIIPPLVVGPFITPTFPPSLITALSLITGNEAHYSIIKQGQYVH  240

Query  773   LDDLCEAHIFLYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVV  952
             LDDLCEAHIFLYEHPKAEGR ICSSHHTTIHGLA+MITQNWPEYYIPS+FKGIEKDLPVV
Sbjct  241   LDDLCEAHIFLYEHPKAEGRLICSSHHTTIHGLAEMITQNWPEYYIPSQFKGIEKDLPVV  300

Query  953   YFSSKKLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTK-EAAAIEEEQETVALKVEKP  1129
             YFSSKKLQDMGFQFKYSLEDM++GAIETLRKKGLLPYSTK  AAAIEEE+ETV LKVE+P
Sbjct  301   YFSSKKLQDMGFQFKYSLEDMFKGAIETLRKKGLLPYSTKEPAAAIEEEEETVPLKVEEP  360

Query  1130  -TAI-EQKQEAKTVPLKPSAIEQKQETAVPLKLEEEPTAIEQKQEAKTVPLKPSAIEQKQ  1303
              TAI EQKQEA TVPLKP+AIE                  EQKQEA TVPLKP+AIEQKQ
Sbjct  361   STAIEEQKQEATTVPLKPAAIE------------------EQKQEATTVPLKPAAIEQKQ  402

Query  1304  ETAV  1315
             ET +
Sbjct  403   ETVL  406



>gb|ABY25285.1| dihydroflavonol 4-reductase B [Merremia dissecta]
Length=388

 Score =   685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/387 (87%), Positives = 359/387 (93%), Gaps = 8/387 (2%)
 Frame = +2

Query  110   VTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEEEG  289
             VTGAAGF+GSWLV  LLQRGYH+HATVRDPGNTKKVKHLLELPKADTNLT+WKGVMEEEG
Sbjct  1     VTGAAGFVGSWLVMRLLQRGYHVHATVRDPGNTKKVKHLLELPKADTNLTVWKGVMEEEG  60

Query  290   SFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTSSA  469
             SFDEA+AGCEGVFHVATPMDF+SKDPENEVIKPAINGVLNIINSC KAKTVKRLVFTSSA
Sbjct  61    SFDEAVAGCEGVFHVATPMDFESKDPENEVIKPAINGVLNIINSCAKAKTVKRLVFTSSA  120

Query  470   GTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFISII  649
             GTLNVQP+QKPVYDE+ WSDLDFIYAKKMTGWMYFASKILAEKEAWK TKEK+IDFISII
Sbjct  121   GTLNVQPEQKPVYDESSWSDLDFIYAKKMTGWMYFASKILAEKEAWKATKEKQIDFISII  180

Query  650   PPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKAEG  829
             PPLVVGPFITPTFPPSLITALSLITGN+ HYSIIKQGQYVHLDDLCEAHIFLYEHPKAEG
Sbjct  181   PPLVVGPFITPTFPPSLITALSLITGNELHYSIIKQGQYVHLDDLCEAHIFLYEHPKAEG  240

Query  830   RFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYSLE  1009
             RFICSSHHTTIH LA MITQNWPEYY+PSEFKGIEKDLPVVYFSSKKLQDMGFQF YSLE
Sbjct  241   RFICSSHHTTIHDLAKMITQNWPEYYVPSEFKGIEKDLPVVYFSSKKLQDMGFQFNYSLE  300

Query  1010  DMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEKPT-AIEQKQEAKTVPL---KP  1177
             +MYRGAIETLRKKGLLPYS KE AAIEE +E V LK+E+P  AIEQ++EA  VPL   +P
Sbjct  301   EMYRGAIETLRKKGLLPYSIKEHAAIEEGKEAVPLKLEEPNIAIEQRKEA--VPLILEEP  358

Query  1178  S-AIEQKQETAVPLKLEEEPTAIEQKQ  1255
             + AIEQK+E AVPL LEE   A EQ++
Sbjct  359   NIAIEQKKE-AVPLILEEPNIAXEQRK  384



>gb|ABY25284.1| dihydroflavonol 4-reductase B [Convolvulus arvensis]
Length=398

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/377 (84%), Positives = 337/377 (89%), Gaps = 10/377 (3%)
 Frame = +2

Query  68    MVDGNHPLLPPK------VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLL  229
             MVDG+H   P        VCVTGAAGFIGSWLV  LL+RGY +HATVRDPGNTKKVKHLL
Sbjct  1     MVDGDHHTTPADLPARKVVCVTGAAGFIGSWLVMRLLERGYDVHATVRDPGNTKKVKHLL  60

Query  230   ELPKADTNLTIWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLN  409
             ELPKA+TNL ++KGVMEEEGSFDEAIAGCEGVFHVATPMDF+SKDPENEVIKPAINGVLN
Sbjct  61    ELPKAETNLKLYKGVMEEEGSFDEAIAGCEGVFHVATPMDFESKDPENEVIKPAINGVLN  120

Query  410   IINSCVKAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKIL  589
             IINSC KA TVKRLVFTSSAGTLNVQ  QKPVYDET WSDLDFIY+KKMTGWMYFASKI 
Sbjct  121   IINSCAKANTVKRLVFTSSAGTLNVQQIQKPVYDETSWSDLDFIYSKKMTGWMYFASKIQ  180

Query  590   AEKEAWKVTKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYV  769
             AEKEAWK TKEK+IDFISIIPPLVVGPFITPTFPPSLITALSLITGN+ HYSIIKQ QYV
Sbjct  181   AEKEAWKATKEKQIDFISIIPPLVVGPFITPTFPPSLITALSLITGNEPHYSIIKQVQYV  240

Query  770   HLDDLCEAHIFLYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPV  949
             HLDDLC+AHIFLYEHPKAEGR+ICSS+ TTI+ LA MI QNWPEYY+PSEFKGIEKDL V
Sbjct  241   HLDDLCQAHIFLYEHPKAEGRYICSSYDTTIYDLAKMIRQNWPEYYVPSEFKGIEKDLGV  300

Query  950   VYFSSKKLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQE-TVALKVEK  1126
             V FSSKKLQDMGF+FKY+LEDMYRGAIETLRKKGLLPYS K+  AIEE+QE +V LK+E+
Sbjct  301   VSFSSKKLQDMGFEFKYTLEDMYRGAIETLRKKGLLPYSIKDPCAIEEKQEVSVPLKLEE  360

Query  1127  PTA-IEQKQEAKTVPLK  1174
               A IEQKQE  TVPLK
Sbjct  361   NAAIIEQKQE--TVPLK  375



>gb|AAB50009.1| dihydroflavonol 4-reductase [Ipomoea purpurea]
Length=333

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/335 (94%), Positives = 323/335 (96%), Gaps = 6/335 (2%)
 Frame = +2

Query  224   LLELPKADTNLTIWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGV  403
             +LELPKADTNLT+WKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKP INGV
Sbjct  1     MLELPKADTNLTVWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPTINGV  60

Query  404   LNIINSCVKAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASK  583
             LNIINSCVKAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASK
Sbjct  61    LNIINSCVKAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASK  120

Query  584   ILAEKEAWKVTKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQ  763
             ILAEKEAWK TKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGN+AHYSIIKQGQ
Sbjct  121   ILAEKEAWKATKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNEAHYSIIKQGQ  180

Query  764   YVHLDDLCEAHIFLYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDL  943
             YVHLDDLCEAHIFLYEHPKAEGRFICSSHHTTIHGLADMIT NWPEYYIPS+FKGIEK+L
Sbjct  181   YVHLDDLCEAHIFLYEHPKAEGRFICSSHHTTIHGLADMITHNWPEYYIPSQFKGIEKEL  240

Query  944   PVVYFSSKKLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVE  1123
              VVYFSSKKLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETV LKVE
Sbjct  241   AVVYFSSKKLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVPLKVE  300

Query  1124  KPTAIEQKQEAKTVPLK---PSAIEQKQETAVPLK  1219
             +PTAIEQKQE  TVPLK   P+AIEQKQE  VPLK
Sbjct  301   EPTAIEQKQE--TVPLKFEEPTAIEQKQE-VVPLK  332



>gb|AGI96401.1| dihydroflavonol 4-reductase [Petunia x hybrida]
Length=380

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/347 (77%), Positives = 300/347 (86%), Gaps = 0/347 (0%)
 Frame = +2

Query  86    PLLPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIW  265
             P+  P VCVTGAAGFIGSWLV  LL+RGY++HATVRDP N KKVKHLLELPKADTNLT+W
Sbjct  12    PVAVPTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPKADTNLTLW  71

Query  266   KGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVK  445
             K  +  EGSFDEAI GC+GVFHVATPMDF+SKDPENEVIKP + G+L+II SC KA TVK
Sbjct  72    KADLTVEGSFDEAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGMLSIIESCAKANTVK  131

Query  446   RLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEK  625
             RLVFTSSAGTL+VQ QQK  YD+T WSDLDFIYAKKMTGWMYF SKILAEK A + TK+K
Sbjct  132   RLVFTSSAGTLDVQEQQKLFYDQTSWSDLDFIYAKKMTGWMYFVSKILAEKSAMEETKKK  191

Query  626   KIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFL  805
              IDFISIIPPLVVGPFITPTFPPSLITALSLITGN+AHY IIKQGQYVHLDDLCEAHIFL
Sbjct  192   NIDFISIIPPLVVGPFITPTFPPSLITALSLITGNEAHYCIIKQGQYVHLDDLCEAHIFL  251

Query  806   YEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMG  985
             YEHPKA+GRFICSSHH  I+ +A M+ + WPEYY+P+EFKGI+KDLPVV FSSKKL DMG
Sbjct  252   YEHPKADGRFICSSHHAIIYDVAKMVREKWPEYYVPTEFKGIDKDLPVVSFSSKKLTDMG  311

Query  986   FQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEK  1126
             FQFKY+LEDMY+GAIET R+K LLP+ST+ AA     +E +A+  + 
Sbjct  312   FQFKYTLEDMYKGAIETCRQKQLLPFSTRSAADNGHNREAIAISAQN  358



>ref|NP_001274988.1| dihydroflavonol 4-reductase [Solanum tuberosum]
 gb|AAQ54579.1| dihydroflavonol 4-reductase [Solanum tuberosum]
 gb|AAQ54581.1| dihydroflavonol 4-reductase [Solanum tuberosum]
Length=382

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/353 (76%), Positives = 301/353 (85%), Gaps = 0/353 (0%)
 Frame = +2

Query  68    MVDGNHPLLPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKAD  247
             +VD + P   P VCVTGAAGFIGSWLV  LL+RGY++HATVRDP N KKVKHLLELPKAD
Sbjct  8     VVDAHSPPKTPTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENQKKVKHLLELPKAD  67

Query  248   TNLTIWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCV  427
             TNLT+WK  +  EGSFDEAI GC+GVFHVATPMDF+SKDPENEVIKP + G+L+II SC 
Sbjct  68    TNLTLWKADLAVEGSFDEAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGMLSIIESCA  127

Query  428   KAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAW  607
             KA TVKRLVFTSSAGTL+VQ  QK  YDET WSDLDFIYAKKMTGWMYF SKILAEK A 
Sbjct  128   KANTVKRLVFTSSAGTLDVQEDQKLFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAM  187

Query  608   KVTKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLC  787
             K  K+  I+FISIIPPLVVGPFITPTFPPSLITALSLITGN+AHY IIKQGQYVHLDDLC
Sbjct  188   KEAKKNNINFISIIPPLVVGPFITPTFPPSLITALSLITGNEAHYGIIKQGQYVHLDDLC  247

Query  788   EAHIFLYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSK  967
             EAHIFLYEHPKAEGRFICSSHH  I+ +A M+ Q WPEYY+P+EFKGI+KDLP+V FSSK
Sbjct  248   EAHIFLYEHPKAEGRFICSSHHAIIYDVAKMVRQKWPEYYVPTEFKGIDKDLPIVSFSSK  307

Query  968   KLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEK  1126
             KL DMGFQFKY+LEDMY+GAIET R+K LLP+ST+ +A   +++E + +  E 
Sbjct  308   KLMDMGFQFKYTLEDMYKGAIETCRQKQLLPFSTRSSADNGKDKEAIPISTEN  360



>gb|AEN83503.1| dihydroflavonol 4-reductase [Solanum tuberosum]
Length=382

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/353 (76%), Positives = 301/353 (85%), Gaps = 0/353 (0%)
 Frame = +2

Query  68    MVDGNHPLLPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKAD  247
             +VD + P   P VCVTGAAGFIGSWLV  LL+RGY++HATVRDP N KKVKHLLELPKAD
Sbjct  8     VVDAHSPPKTPTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENQKKVKHLLELPKAD  67

Query  248   TNLTIWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCV  427
             TNLT+WK  +  EGSFDEAI GC+GVFHVATPMDF+SKDPENEVIKP + G+L+II SC 
Sbjct  68    TNLTLWKADLAVEGSFDEAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGMLSIIESCA  127

Query  428   KAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAW  607
             KAKTVKRLVFTSSAGTL+VQ  QK  YDET WSDLDFIYAKKMTGWMYF SKILAEK A 
Sbjct  128   KAKTVKRLVFTSSAGTLDVQEDQKLFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAM  187

Query  608   KVTKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLC  787
             +  K+  I+FISIIPPLVVGPFITPTFPPSLITALSLITGN+AHY IIKQGQYVHLDDLC
Sbjct  188   EEAKKNNINFISIIPPLVVGPFITPTFPPSLITALSLITGNEAHYGIIKQGQYVHLDDLC  247

Query  788   EAHIFLYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSK  967
             EAHIFLYEHPKAEGRFICSSHH  I+ +A M+ Q WPEYY+P+EFKGI+KDLP+V FSSK
Sbjct  248   EAHIFLYEHPKAEGRFICSSHHAIIYDVAKMVRQKWPEYYVPTEFKGIDKDLPIVSFSSK  307

Query  968   KLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEK  1126
             KL DMGFQFKY+LEDMY+GAIET R+K LLP+ST+  A   +++E + +  E 
Sbjct  308   KLMDMGFQFKYTLEDMYKGAIETCRQKQLLPFSTRSTADNGKDKEAIPISTEN  360



>sp|P14720.2|DFRA_PETHY RecName: Full=Dihydroflavonol-4-reductase; Short=DFR; AltName: 
Full=Dihydrokaempferol 4-reductase [Petunia x hybrida]
 emb|CAA56160.1| dfrA [Petunia x hybrida]
 gb|AGI96402.1| dihydroflavonol 4-reductase [Petunia x hybrida]
 gb|AGP50170.1| dihydroflavonol-4-reductase [Petunia x hybrida]
Length=380

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/347 (76%), Positives = 299/347 (86%), Gaps = 0/347 (0%)
 Frame = +2

Query  86    PLLPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIW  265
             P+  P VCVTGAAGFIGSWLV  LL+RGY++HATVRDP N KKVKHLLELPKADTNLT+W
Sbjct  12    PVAVPTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPKADTNLTLW  71

Query  266   KGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVK  445
             K  +  EGSFDEAI GC+GVFHVATPMDF+SKDPENEVIKP + G+L+II SC KA TVK
Sbjct  72    KADLTVEGSFDEAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGMLSIIESCAKANTVK  131

Query  446   RLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEK  625
             RLVFTSSAGTL+VQ QQK  YD+T WSDLDFIYAKKMTGWMYFASKILAEK A +  K+K
Sbjct  132   RLVFTSSAGTLDVQEQQKLFYDQTSWSDLDFIYAKKMTGWMYFASKILAEKAAMEEAKKK  191

Query  626   KIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFL  805
              IDFISIIPPLVVGPFITPTFPPSLITALSLITGN+AHY IIKQGQYVHLDDLCEAHIFL
Sbjct  192   NIDFISIIPPLVVGPFITPTFPPSLITALSLITGNEAHYCIIKQGQYVHLDDLCEAHIFL  251

Query  806   YEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMG  985
             YEHPKA+GRFICSSHH  I+ +A M+ + WPEYY+P+EFKGI+KDLPVV FSSKKL DMG
Sbjct  252   YEHPKADGRFICSSHHAIIYDVAKMVREKWPEYYVPTEFKGIDKDLPVVSFSSKKLTDMG  311

Query  986   FQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEK  1126
             FQFKY+LEDMY+GAI+T R+K LLP+ST+ A      +E +A+  + 
Sbjct  312   FQFKYTLEDMYKGAIDTCRQKQLLPFSTRSAEDNGHNREAIAISAQN  358



>gb|AFL48186.1| DFR protein [Capsicum annuum]
Length=382

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/353 (76%), Positives = 299/353 (85%), Gaps = 0/353 (0%)
 Frame = +2

Query  68    MVDGNHPLLPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKAD  247
             +VD   P + P VCVTGAAGFIGSWLV  LL+RGY++HATVRDP N KKVKHLLELP+AD
Sbjct  8     VVDAPSPPVAPTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPEAD  67

Query  248   TNLTIWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCV  427
             TNLT+WK  +  EGSFDEAI GC+GVFHVATPMDF+SKDPENEVIKP + G+L+II SC 
Sbjct  68    TNLTLWKADLTVEGSFDEAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGMLSIIESCA  127

Query  428   KAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAW  607
             KA TVKRLVFTSSAGTL+VQ  QK  YDET WSDLDFIYAKKMTGWMYF SKILAEK A 
Sbjct  128   KANTVKRLVFTSSAGTLDVQEHQKIFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAM  187

Query  608   KVTKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLC  787
             +  K+  IDFISIIPPLVVGPFITPTFPPSLITALSLITGN+AHY IIKQGQYVHLDDLC
Sbjct  188   EEAKKNNIDFISIIPPLVVGPFITPTFPPSLITALSLITGNEAHYCIIKQGQYVHLDDLC  247

Query  788   EAHIFLYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSK  967
             EAHIFLYEHPKAEGRFICSSHH  I+ +A M+ Q WPEY +P+EFKGI+KDLP+V FSSK
Sbjct  248   EAHIFLYEHPKAEGRFICSSHHAIIYDVAKMVRQKWPEYNVPTEFKGIDKDLPIVSFSSK  307

Query  968   KLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEK  1126
             KL DMGFQFKYSLEDMY+GAIET R+K LLP+ST+  A    ++ET+ +  E 
Sbjct  308   KLMDMGFQFKYSLEDMYKGAIETCRQKQLLPFSTRSTADKGHDKETIPISAEN  360



>gb|AAM73809.1|AF449422_1 dihydroflavonol-4-reductase [Solanum tuberosum]
Length=382

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/353 (75%), Positives = 301/353 (85%), Gaps = 0/353 (0%)
 Frame = +2

Query  68    MVDGNHPLLPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKAD  247
             +VD + P   P VCVTGAAGFIGSWLV  LL+RGY++HATVRDP N KKVKHLLELPKAD
Sbjct  8     VVDAHSPPKTPTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENQKKVKHLLELPKAD  67

Query  248   TNLTIWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCV  427
             TNLT+WK  +  EGSFDEAI GC+GVFHVATPMDF+SKDPENEVI+P + G+L+II SC 
Sbjct  68    TNLTLWKADLAVEGSFDEAIKGCQGVFHVATPMDFESKDPENEVIQPTVRGMLSIIESCA  127

Query  428   KAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAW  607
             KAKTVKRLVFTSSAGTL+VQ  QK  YDET WSDLDFIYAKKMTGWMYF SKILAEK A 
Sbjct  128   KAKTVKRLVFTSSAGTLDVQEDQKLFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAM  187

Query  608   KVTKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLC  787
             +  K+  I+FISIIPPLVVGPFITPTFPPSLITALSLITGN+AHY IIKQGQYVHLDDLC
Sbjct  188   EEAKKNNINFISIIPPLVVGPFITPTFPPSLITALSLITGNEAHYGIIKQGQYVHLDDLC  247

Query  788   EAHIFLYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSK  967
             EAHIFLYEHPKAEGRFICSSHH  I+ +A M+ Q WPEYY+P+EFKGI+KDLP+V FSSK
Sbjct  248   EAHIFLYEHPKAEGRFICSSHHAIIYDVAKMVRQKWPEYYVPTEFKGIDKDLPIVSFSSK  307

Query  968   KLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEK  1126
             KL DMGFQFKY+LEDMY+GAIET R+K LLP+ T+  AA  +++E + +  E 
Sbjct  308   KLMDMGFQFKYTLEDMYKGAIETCRQKQLLPFHTRSTAANGKDKEAIPIFTEN  360



>gb|ABY25290.1| dihydroflavonol 4-reductase [Evolvulus glomeratus]
Length=350

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/337 (78%), Positives = 297/337 (88%), Gaps = 1/337 (0%)
 Frame = +2

Query  74    DGNHPLLPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTN  253
             D  H ++  KVCVTGA GFIGSWLV  LL+R Y +HATVRDPGN +KVKHLLELPKAD N
Sbjct  5     DDQHNVVS-KVCVTGATGFIGSWLVMRLLERDYIVHATVRDPGNMEKVKHLLELPKADKN  63

Query  254   LTIWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKA  433
             L +W+GV+EEEGSFDEAI GCEGVFHVATPMDFDS+DPENEVIKP + G+L II+SC K+
Sbjct  64    LRLWRGVLEEEGSFDEAIEGCEGVFHVATPMDFDSEDPENEVIKPTVKGILGIIDSCAKS  123

Query  434   KTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKV  613
             K+VKR+VFTSSAGT+++Q  QK +YDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWK 
Sbjct  124   KSVKRIVFTSSAGTVDIQENQKSLYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKS  183

Query  614   TKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEA  793
             TKEK+IDFISIIPP+VVGPFITPTFPPSLITALS I GN++H   IKQGQ+VH+DDLCEA
Sbjct  184   TKEKQIDFISIIPPVVVGPFITPTFPPSLITALSPIMGNESHCRHIKQGQFVHIDDLCEA  243

Query  794   HIFLYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKL  973
              +FLYEHPKA+GRFICSSHHTTIH +A MI  NWPEY +P+EFKGIEKD+ VV FSSKKL
Sbjct  244   LMFLYEHPKAQGRFICSSHHTTIHDIAKMIRHNWPEYNVPNEFKGIEKDIEVVSFSSKKL  303

Query  974   QDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAA  1084
              DMGFQFKY+LEDMYRGAIET R KGLLPYS K+ AA
Sbjct  304   LDMGFQFKYTLEDMYRGAIETSRNKGLLPYSIKDPAA  340



>gb|AGI96400.1| dihydroflavonol 4-reductase [Petunia x hybrida]
Length=380

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/347 (76%), Positives = 298/347 (86%), Gaps = 0/347 (0%)
 Frame = +2

Query  86    PLLPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIW  265
             P+  P VCVTGAAGFIGSWLV  LL+RGY++HATVRDP N KKVKHLLELPKADTNLT+W
Sbjct  12    PVAVPTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPKADTNLTLW  71

Query  266   KGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVK  445
             K  +  EGSFDEAI GC+GVFHVATPMDF+SKDPENEVIKP + G+L+II SC KA TVK
Sbjct  72    KADLTVEGSFDEAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGMLSIIESCAKANTVK  131

Query  446   RLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEK  625
             RLVFTSSAGTL+VQ QQK  YD+T WSDLDFIYAKKMTGWMYFASKI AEK A +  K+K
Sbjct  132   RLVFTSSAGTLDVQEQQKLFYDQTSWSDLDFIYAKKMTGWMYFASKIPAEKAAMEEAKKK  191

Query  626   KIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFL  805
              IDFISIIPPLVVGPFITPTFPPSLITALSLITGN+AHY IIKQGQYVHLDDLCEAHIFL
Sbjct  192   NIDFISIIPPLVVGPFITPTFPPSLITALSLITGNEAHYCIIKQGQYVHLDDLCEAHIFL  251

Query  806   YEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMG  985
             YEHPKA+GRFICSSHH  I+ +A M+ + WPEYY+P+EFKGI+KDLPVV FSSKKL DMG
Sbjct  252   YEHPKADGRFICSSHHAIIYDVAKMVREKWPEYYVPTEFKGIDKDLPVVSFSSKKLTDMG  311

Query  986   FQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEK  1126
             FQFKY+LEDMY+GAI+T R+K LLP+ST+ A      +E +A+  + 
Sbjct  312   FQFKYTLEDMYKGAIDTCRQKQLLPFSTRSAEDNGHNREAIAISAQN  358



>gb|AFQ98276.1| dihydroflavonol 4-reductase [Solanum tuberosum]
Length=382

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/353 (75%), Positives = 300/353 (85%), Gaps = 0/353 (0%)
 Frame = +2

Query  68    MVDGNHPLLPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKAD  247
             +VD + P   P VCVTGAAGFIGSWLV  LL+RGY++HATVRDP N KKVKHLLELPKAD
Sbjct  8     VVDAHSPPKTPTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENQKKVKHLLELPKAD  67

Query  248   TNLTIWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCV  427
             TNLT+WK  +  EGSFDEAI GC+GVFHVATPMDF+SKDPENEVIKP + G+L+II SC 
Sbjct  68    TNLTLWKADLAVEGSFDEAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGMLSIIESCA  127

Query  428   KAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAW  607
             KAKTVKRLVFTSSAGTL+VQ  QK  YDET WSDLDFIYAKKMTGWMYF SKILAEK A 
Sbjct  128   KAKTVKRLVFTSSAGTLDVQEDQKLFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAM  187

Query  608   KVTKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLC  787
             +  K+  I+FISIIPPLVVGPFITPTFPPSLITALSLITGN+AHY IIKQGQYVHLDDLC
Sbjct  188   EEAKKNNINFISIIPPLVVGPFITPTFPPSLITALSLITGNEAHYGIIKQGQYVHLDDLC  247

Query  788   EAHIFLYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSK  967
             EAHIFLYEHPKAEGRFICSSHH  I+ +A M+ Q WPEYY+P+EFKGI+KDLP+V FSSK
Sbjct  248   EAHIFLYEHPKAEGRFICSSHHAIIYDVAKMVRQKWPEYYVPTEFKGIDKDLPIVSFSSK  307

Query  968   KLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEK  1126
             KL  MGFQFKY+LEDMY+GAIET R+K LLP+ST+  A   +++E + +  + 
Sbjct  308   KLMGMGFQFKYTLEDMYKGAIETCRQKQLLPFSTRSTADNGKDKEAIPISTDN  360



>gb|AEX88625.1| dihydroflavonol 4-reductase [Lycium ruthenicum]
Length=379

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/343 (76%), Positives = 296/343 (86%), Gaps = 0/343 (0%)
 Frame = +2

Query  98    PKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVM  277
             P VCVTGAAGFIGSWLV  LL+RGY++HATVRDP N KKVKHLLELPKADTNLT+WK  +
Sbjct  15    PTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPKADTNLTLWKADL  74

Query  278   EEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVF  457
             + EGSFDEAI GC+GVFHVATPMDF+SKDPENEVIKP + GVL+II SCVKA TV+RLVF
Sbjct  75    KVEGSFDEAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGVLSIIESCVKANTVRRLVF  134

Query  458   TSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDF  637
             TSSAGTL+VQ  QK  YDET WSDLDFIYAKKMTGWMYF SKILAEK A +  K+  IDF
Sbjct  135   TSSAGTLDVQEHQKLFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAMEEAKKNNIDF  194

Query  638   ISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHP  817
             ISIIPPLVVGPFITPTFPPSLITALSLITGN+AHY IIKQGQYVHLDDLCEAHIFLYEHP
Sbjct  195   ISIIPPLVVGPFITPTFPPSLITALSLITGNEAHYCIIKQGQYVHLDDLCEAHIFLYEHP  254

Query  818   KAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFK  997
             KAEGR+ICSSHH  I+ +A ++ Q WPEYY+P+EFKGI+KDLP++ FSSKKL DMGFQFK
Sbjct  255   KAEGRYICSSHHAIIYDVAKIVRQKWPEYYVPTEFKGIDKDLPIISFSSKKLMDMGFQFK  314

Query  998   YSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEK  1126
             Y+LEDMY+GAIET R+K LLP ST+  A   +++E + +  E 
Sbjct  315   YTLEDMYKGAIETCRQKQLLPLSTRSTADNGQDKEAIPISAEN  357



>gb|AEQ04697.1| dihydroflavonol 4-reductase [Lycium barbarum]
Length=372

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/343 (76%), Positives = 295/343 (86%), Gaps = 0/343 (0%)
 Frame = +2

Query  98    PKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVM  277
             P VCVTGA+GFIGSWLV  LL+RGY++HATVRDP N KKVKHLLELPKADTNLT+WK  +
Sbjct  15    PTVCVTGASGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPKADTNLTLWKADL  74

Query  278   EEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVF  457
               EGSFDEAI GC+GVFHVATPMDF+SKDPENEVIKP + G+L+II SCVKA TV+RLVF
Sbjct  75    TVEGSFDEAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGMLSIIESCVKANTVRRLVF  134

Query  458   TSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDF  637
             TSSAGTL+VQ  QK  YDET WSDLDFIYAKKMTGWMYF SKILAEK A +  K+  IDF
Sbjct  135   TSSAGTLDVQEHQKLFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAMEEAKKNNIDF  194

Query  638   ISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHP  817
             ISIIPPLVVGPFITPTFPPSLITALSLITGN+AHY IIKQGQYVHLDDLCEAHIFLYEHP
Sbjct  195   ISIIPPLVVGPFITPTFPPSLITALSLITGNEAHYCIIKQGQYVHLDDLCEAHIFLYEHP  254

Query  818   KAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFK  997
             KAEGR+ICSSHH  I+ +A M+ Q WPEYY+P+EFKGI+KDLP++ FSSKKL DMGFQFK
Sbjct  255   KAEGRYICSSHHAIIYDVAKMVRQKWPEYYVPTEFKGIDKDLPIISFSSKKLMDMGFQFK  314

Query  998   YSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEK  1126
             Y+LEDMY+GAIET R+K LLP ST+  A   +++E + +  E 
Sbjct  315   YTLEDMYKGAIETCRQKQLLPLSTRSTADNGQDKEAIPISAEN  357



>gb|ABY25286.1| dihydroflavonol 4-reductase B [Petunia x hybrida]
Length=361

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/339 (78%), Positives = 295/339 (87%), Gaps = 0/339 (0%)
 Frame = +2

Query  110   VTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEEEG  289
             VTGAAGFIGSWLV  LL+RGY++HATVRDP N KKVKHLLELPKADTNLT+WK  +  EG
Sbjct  1     VTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPKADTNLTLWKADLTVEG  60

Query  290   SFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTSSA  469
             SFDEAI GC+GVFHVATPMDF+SKDPENEVIKP + G+L+II SC KA TVKRLVFTSSA
Sbjct  61    SFDEAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGMLSIIESCAKANTVKRLVFTSSA  120

Query  470   GTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFISII  649
             GTL+VQ QQK  YD+T WSDLDFIYAKKMTGWMYFASKILAEK A +  K+K IDFISII
Sbjct  121   GTLDVQEQQKLFYDQTSWSDLDFIYAKKMTGWMYFASKILAEKAAMEEAKKKNIDFISII  180

Query  650   PPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKAEG  829
             PPLVVGPFITPTFPPSLITALSLITGN+AHY IIKQGQYVHLDDLCEAHIFLYEHPKAEG
Sbjct  181   PPLVVGPFITPTFPPSLITALSLITGNEAHYCIIKQGQYVHLDDLCEAHIFLYEHPKAEG  240

Query  830   RFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYSLE  1009
             RFICSSHH  I+ +A M+ + WPEYY+P+EFKGI+KDLPVV FSSKKL DMGFQFKY+LE
Sbjct  241   RFICSSHHAIIYDVAKMVREKWPEYYVPTEFKGIDKDLPVVSFSSKKLTDMGFQFKYTLE  300

Query  1010  DMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEK  1126
             DMY+GAIET R+K LLP+ST+ AA  E  ++ V +  + 
Sbjct  301   DMYKGAIETCRQKQLLPFSTRSAADNEHNRDDVPISAQN  339



>ref|XP_010315879.1| PREDICTED: dihydroflavonol-4-reductase isoform X1 [Solanum lycopersicum]
Length=382

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/353 (75%), Positives = 298/353 (84%), Gaps = 0/353 (0%)
 Frame = +2

Query  68    MVDGNHPLLPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKAD  247
             +VD + P     VCVTGAAGFIGSWLV  LL+RGY++HATVRDP N KKVKHLLELPKAD
Sbjct  8     VVDAHSPPKTTTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENQKKVKHLLELPKAD  67

Query  248   TNLTIWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCV  427
             TNLT+WK  +  EGSFDEAI GC+GVFHVATPMDF+SKDPENEVIKP + G+L+II SC 
Sbjct  68    TNLTLWKADLAVEGSFDEAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGMLSIIESCA  127

Query  428   KAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAW  607
             KA TVKRLVFTSSAGTL+VQ  QK  YDET WSDLDFIYAKKMTGWMYF SKILAEK A 
Sbjct  128   KANTVKRLVFTSSAGTLDVQEDQKLFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAM  187

Query  608   KVTKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLC  787
             +  ++  IDFISIIPPLVVGPFIT TFPPSLITALSLITGN+AHY IIKQGQYVHLDDLC
Sbjct  188   EEARKNNIDFISIIPPLVVGPFITSTFPPSLITALSLITGNEAHYGIIKQGQYVHLDDLC  247

Query  788   EAHIFLYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSK  967
             EAHIFLYEHPKAEGRFICSSHH  I+ +A M+ Q WPEYY+P+EFKGI+KDLPVV FSSK
Sbjct  248   EAHIFLYEHPKAEGRFICSSHHAIIYDVAKMVRQKWPEYYVPTEFKGIDKDLPVVSFSSK  307

Query  968   KLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEK  1126
             KL DMGFQFK++LEDMY+GAIET R+K LLP+ST+  A   +++E + +  E 
Sbjct  308   KLMDMGFQFKHTLEDMYKGAIETCRQKQLLPFSTRSTADNGKDKEAIPISTEN  360



>gb|AAX63400.1| dihydroflavonol 4-reductase [Solanum pinnatisectum]
 gb|AAX63404.1| dihydroflavonol 4-reductase [Solanum pinnatisectum]
Length=382

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/343 (76%), Positives = 296/343 (86%), Gaps = 0/343 (0%)
 Frame = +2

Query  98    PKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVM  277
             P VCVTGAAGFIGSWLV  LL+RGY++HATVRDP N KKVKHLLELPKADTNLT+WK  +
Sbjct  18    PTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENQKKVKHLLELPKADTNLTLWKADL  77

Query  278   EEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVF  457
               EGSFDEAI GC+GVFHVATPMDF+SKDPENEVIKP + G+L+II SC KA TVKRLVF
Sbjct  78    AVEGSFDEAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGMLSIIESCAKANTVKRLVF  137

Query  458   TSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDF  637
             TSSAGTL+VQ  QK  YDET WSDLDFIYAKKMTGWMYF SKILAEK A +  K+  IDF
Sbjct  138   TSSAGTLDVQEDQKLFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAMEEAKKNNIDF  197

Query  638   ISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHP  817
             ISIIPPLVVGPFITPTFPPSLITALSLITGN+AHY IIKQGQYVHLDDLCEAHIFLYE+P
Sbjct  198   ISIIPPLVVGPFITPTFPPSLITALSLITGNEAHYGIIKQGQYVHLDDLCEAHIFLYEYP  257

Query  818   KAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFK  997
             KAEGRFICSSHH  I+ +A ++ Q WPEYY+P+EFKGI+KDLP+V+FSSKKL DMGFQFK
Sbjct  258   KAEGRFICSSHHAIIYDVAKIVRQKWPEYYVPTEFKGIDKDLPIVFFSSKKLMDMGFQFK  317

Query  998   YSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEK  1126
             Y+LEDMY+GAIET R+K LLP+ST+  A   +++E + +  E 
Sbjct  318   YTLEDMYKGAIETCRQKQLLPFSTRSTADNGKDKEAIPISTEN  360



>gb|ABY25280.1| dihydroflavonol 4-reductase A [Merremia dissecta]
Length=356

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/334 (78%), Positives = 296/334 (89%), Gaps = 3/334 (1%)
 Frame = +2

Query  110   VTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEEEG  289
             VTGAAGF+GSWLV  LLQRGYH+HATVRDP N +KVKHLL+LPKADTN+T+WKGVMEEEG
Sbjct  1     VTGAAGFVGSWLVMKLLQRGYHVHATVRDPSNAEKVKHLLQLPKADTNMTVWKGVMEEEG  60

Query  290   SFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTSSA  469
             SFDEAIAGCEGVFHVATP++F SKDPENEVIKPA+ G+L+IINSC KAKTVKRLVFTSSA
Sbjct  61    SFDEAIAGCEGVFHVATPVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKRLVFTSSA  120

Query  470   GTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFISII  649
               + ++  QK VYDE+ WSDLDFIYAKKM GWMY ASK LAEKEAWK  KEK+IDFISII
Sbjct  121   AAVQIEENQKLVYDESSWSDLDFIYAKKMAGWMYLASKTLAEKEAWKAAKEKQIDFISII  180

Query  650   PPLVVGPFITPTFPPSLITALSLIT---GNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPK  820
             PPLV+GPFITPTFP SL+TALS I    GN  H++IIKQG +VH+DDLCEA IFLYE+PK
Sbjct  181   PPLVIGPFITPTFPLSLVTALSPIMDPIGNGLHHNIIKQGNFVHVDDLCEAQIFLYENPK  240

Query  821   AEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKY  1000
             A+GRFICSSH  TIH +A MI +NWPEYY+PSEFKGIEK+LPVV  SSKKLQ+MGFQFKY
Sbjct  241   AQGRFICSSHDNTIHDVAKMIRENWPEYYVPSEFKGIEKELPVVSLSSKKLQEMGFQFKY  300

Query  1001  SLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQE  1102
             +L DMYRGAIETLR+KGLLP+STKE AAIE+EQ+
Sbjct  301   TLVDMYRGAIETLREKGLLPFSTKEPAAIEQEQQ  334



>gb|AAF60298.1|AF233639_1 dihydroflavonol-4-reductase [Petunia x hybrida]
Length=373

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/348 (76%), Positives = 296/348 (85%), Gaps = 0/348 (0%)
 Frame = +2

Query  83    HPLLPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTI  262
             H      VCVTGAAGFIGSWLV  LL+RGY++HATVRDP N KKVKHLLELPKADTNLT+
Sbjct  4     HLRCSATVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPKADTNLTL  63

Query  263   WKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTV  442
             WK  +  EGSFDEAI GC+GVFHVATPMDF+SKDPENEVIKP + G+L+II SC KA TV
Sbjct  64    WKADLTVEGSFDEAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGMLSIIESCAKANTV  123

Query  443   KRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKE  622
             KRLVFTSSAGTL+VQ QQK  YD+T WSDLDFIYAKKMTGWMYFASKILAEK A +  K+
Sbjct  124   KRLVFTSSAGTLDVQEQQKLFYDQTSWSDLDFIYAKKMTGWMYFASKILAEKAAMEEAKK  183

Query  623   KKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIF  802
             K IDFISIIPPLVVGPFITPTFPPSLITALSLITGN+AHY IIKQGQYVHLDDLCEAHIF
Sbjct  184   KNIDFISIIPPLVVGPFITPTFPPSLITALSLITGNEAHYCIIKQGQYVHLDDLCEAHIF  243

Query  803   LYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDM  982
             LYEHPKA+GRFICSSHH  I+ +A M+ + WPEYY+P+EFKGI+KDLPVV FSSKKL DM
Sbjct  244   LYEHPKADGRFICSSHHAIIYDVAKMVREKWPEYYVPTEFKGIDKDLPVVSFSSKKLTDM  303

Query  983   GFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEK  1126
             GFQFKY+LEDMY+GAI+T R+K LLP+S + A      +E +A+  + 
Sbjct  304   GFQFKYTLEDMYKGAIDTCRQKQLLPFSPRSAEDNGHNREAIAISAQN  351



>emb|CAA33544.1| unnamed protein product [Petunia x hybrida]
Length=373

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/348 (76%), Positives = 296/348 (85%), Gaps = 0/348 (0%)
 Frame = +2

Query  83    HPLLPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTI  262
             H      VCVTGAAGFIGSWLV  LL+RGY++HATVRDP N KKVKHLLELPKADTNLT+
Sbjct  4     HLRCSATVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPKADTNLTL  63

Query  263   WKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTV  442
              K  +  EGSFDEAI GC+GVFHVATPMDF+SKDPENEVIKP + G+L+II SC KA TV
Sbjct  64    LKADLTVEGSFDEAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGMLSIIESCAKANTV  123

Query  443   KRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKE  622
             KRLVFTSSAGTL+VQ QQK  YD+T WSDLDFIYAKKMTGWMYFASKILAEK A +  K+
Sbjct  124   KRLVFTSSAGTLDVQEQQKLFYDQTSWSDLDFIYAKKMTGWMYFASKILAEKAAMEEAKK  183

Query  623   KKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIF  802
             K IDFISIIPPLVVGPFITPTFPPSLITALSLITGN+AHY IIKQGQYVHLDDLCEAHIF
Sbjct  184   KNIDFISIIPPLVVGPFITPTFPPSLITALSLITGNEAHYCIIKQGQYVHLDDLCEAHIF  243

Query  803   LYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDM  982
             LYEHPKA+GRFICSSHH  I+ +A M+ + WPEYY+P+EFKGI+KDLPVV FSSKKL DM
Sbjct  244   LYEHPKADGRFICSSHHAIIYDVAKMVREKWPEYYVPTEFKGIDKDLPVVSFSSKKLTDM  303

Query  983   GFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEK  1126
             GFQFKY+LEDMY+GAI+T R+K LLP+ST+ A      +E +A+  + 
Sbjct  304   GFQFKYTLEDMYKGAIDTCRQKQLLPFSTRSAEDNGHNREAIAISAQN  351



>dbj|BAA36405.1| dihydroflavonol 4-reductase [Ipomoea purpurea]
Length=348

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/345 (76%), Positives = 300/345 (87%), Gaps = 2/345 (1%)
 Frame = +2

Query  68    MVDGNH-PLLP-PKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPK  241
             MV GNH P  P P VCVTGAAGF+GSWLV  LLQRGY +HATVRDPGNT+KVKHLLELPK
Sbjct  1     MVGGNHTPASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNTQKVKHLLELPK  60

Query  242   ADTNLTIWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINS  421
             A+  L +WKGV+EEEGSFDEAIAGCEGVFHVA  ++F SKDPENEVIKPA+ G+L+IINS
Sbjct  61    AEGKLKVWKGVLEEEGSFDEAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINS  120

Query  422   CVKAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKE  601
             C KAKTVK+LVFTSS   ++++  Q+ VYDE+ WSDLDFIYA KM GWMYFASK LAEKE
Sbjct  121   CAKAKTVKKLVFTSSTAAVHIKETQQLVYDESSWSDLDFIYANKMGGWMYFASKTLAEKE  180

Query  602   AWKVTKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDD  781
             AWK  KEK+I+FISIIPPLV+GPF+ PTFP SL+TALS I GN  H++IIKQG++VHLDD
Sbjct  181   AWKAAKEKQIEFISIIPPLVIGPFLIPTFPLSLVTALSPIMGNGLHHNIIKQGKFVHLDD  240

Query  782   LCEAHIFLYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFS  961
             LCEA IFLY+HP+A GRFICSSHH TIH +A MI  NWPEYY+PSEFKGIEK+LP+V FS
Sbjct  241   LCEAQIFLYQHPEAGGRFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFS  300

Query  962   SKKLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEE  1096
             SKKLQ+MGFQFKY+LEDMY+GAIETLRKKGLLPYSTKE A IE+E
Sbjct  301   SKKLQEMGFQFKYTLEDMYKGAIETLRKKGLLPYSTKEPAGIEQE  345



>gb|AFO59585.1| diihydroflavonol 4-reductase [Iochroma parvifolium]
Length=381

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/353 (75%), Positives = 298/353 (84%), Gaps = 1/353 (0%)
 Frame = +2

Query  68    MVDGNHPLLPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKAD  247
             +VD   P+    VCVTGAAGFIGSWLV  LL+RGY++HATVRDP N KKVKHLLELPKAD
Sbjct  8     VVDAPSPV-ARTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPKAD  66

Query  248   TNLTIWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCV  427
             TNLT+WK  +  EGSFDEAI GC+GVFHVATPMDF+SKDPENEVIKP + G+L+II SC 
Sbjct  67    TNLTLWKADLTVEGSFDEAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGMLSIIESCA  126

Query  428   KAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAW  607
             KA TVKRLVFTSSAGTL+VQ  QK  YDET WSDLDFIYAKKMTGWMYF SKILAEK A 
Sbjct  127   KANTVKRLVFTSSAGTLDVQEHQKLFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAM  186

Query  608   KVTKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLC  787
             +  K+  IDFISIIPPLVVGPFITPTFPPSLITALS+ITGN+AHY IIKQGQYVHLDDLC
Sbjct  187   EEAKKNNIDFISIIPPLVVGPFITPTFPPSLITALSIITGNEAHYCIIKQGQYVHLDDLC  246

Query  788   EAHIFLYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSK  967
             EAHIFLYEHPKAEGRFICSSHH  I+ +A M+ + WPEYY+P+EFKGI+KDLP+V FSSK
Sbjct  247   EAHIFLYEHPKAEGRFICSSHHAIIYDVAKMVREKWPEYYVPTEFKGIDKDLPIVSFSSK  306

Query  968   KLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEK  1126
             KL DMGFQFKY+LEDMY+GAIET R+K LLP+ST+  A   + +E + +  E 
Sbjct  307   KLMDMGFQFKYTLEDMYKGAIETCRQKQLLPFSTRSTADNGQNKEAIPISTEN  359



>gb|AFO59586.1| diihydroflavonol 4-reductase [Dunalia brachyacantha]
Length=381

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/353 (75%), Positives = 297/353 (84%), Gaps = 1/353 (0%)
 Frame = +2

Query  68    MVDGNHPLLPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKAD  247
             +VD   P+    VCVTGAAGFIGSWLV  LL+RGY++HATVRDP N KKVKHLLELP AD
Sbjct  8     VVDAPSPV-ARTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPNAD  66

Query  248   TNLTIWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCV  427
             TNLT+WK  +  EGSFDEAI GC+GVFHVATPMDF+SKDPENEVIKP + G+L+II SC 
Sbjct  67    TNLTLWKADLTVEGSFDEAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGMLSIIESCA  126

Query  428   KAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAW  607
             KA TVKRLVFTSSAGTL+VQ  QK  YDET WSDLDFIYAKKMTGWMYF SKILAEK A 
Sbjct  127   KANTVKRLVFTSSAGTLDVQEHQKLFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAM  186

Query  608   KVTKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLC  787
             +  K+  IDFISIIPPLVVGPFITPTFPPSLITALS+ITGN+AHY IIKQGQYVHLDDLC
Sbjct  187   EEAKKNNIDFISIIPPLVVGPFITPTFPPSLITALSIITGNEAHYCIIKQGQYVHLDDLC  246

Query  788   EAHIFLYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSK  967
             EAHIFLYEHPKAEGRFICSSHH  I+ +A M+ + WPEYY+P+EFKGI+KDLP+V FSSK
Sbjct  247   EAHIFLYEHPKAEGRFICSSHHAIIYDVAKMVREKWPEYYVPTEFKGIDKDLPIVSFSSK  306

Query  968   KLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEK  1126
             KL DMGFQFKY+LEDMY+GAIET R+K LLP+ST+  A   + +E + +  E 
Sbjct  307   KLMDMGFQFKYTLEDMYKGAIETCRQKQLLPFSTRSTADNGQNKEAIPISTEN  359



>gb|AAZ57436.1| dihydroflavonol reductase [Solanum tuberosum]
Length=382

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/353 (74%), Positives = 297/353 (84%), Gaps = 0/353 (0%)
 Frame = +2

Query  68    MVDGNHPLLPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKAD  247
             +VD + P   P VCVTGAAGFIGSWLV  LL+RGY++HATVRDP N KKVKHLLELPKAD
Sbjct  8     VVDAHSPPRTPTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENQKKVKHLLELPKAD  67

Query  248   TNLTIWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCV  427
             TNLT+WK  +  EGSFDEAI GC+GVFHVATPMDF+SKDPENEVIKP + G+L+II SC 
Sbjct  68    TNLTLWKADLAVEGSFDEAIKGCQGVFHVATPMDFESKDPENEVIKPTVRGMLSIIESCA  127

Query  428   KAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAW  607
             KA TVKRLVFTSSAGTL+VQ  QK  Y+ET WSDLDFIYAKKMTGWMYF SKILAEK A 
Sbjct  128   KANTVKRLVFTSSAGTLDVQEDQKLFYNETSWSDLDFIYAKKMTGWMYFVSKILAEKAAM  187

Query  608   KVTKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLC  787
             +  K+  I+FISIIPPL VGPFITPTFPPSLITALSLITGN+ HY IIKQGQYVHLDDLC
Sbjct  188   EEAKKNNINFISIIPPLAVGPFITPTFPPSLITALSLITGNEDHYGIIKQGQYVHLDDLC  247

Query  788   EAHIFLYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSK  967
             EAHIFLYEHPKAEGRFICSSHH  I+ +A M+ Q WPEYY+P+E KGI+KDLP+V FSSK
Sbjct  248   EAHIFLYEHPKAEGRFICSSHHAIIYDVAKMVRQKWPEYYVPTELKGIDKDLPIVSFSSK  307

Query  968   KLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEK  1126
             KL DMGFQFKY+LEDMY+GAIET R+K LLP+ST+  A   +++E + +  E 
Sbjct  308   KLMDMGFQFKYTLEDMYKGAIETCRQKQLLPFSTRSTADNGKDKEAIPISTEN  360



>dbj|BAA59332.1| dihydroflavonol 4-reductase [Ipomoea nil]
Length=354

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/348 (75%), Positives = 299/348 (86%), Gaps = 2/348 (1%)
 Frame = +2

Query  68    MVDGNH-PLLP-PKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPK  241
             MV GNH P  P P VCVTGAAGF+GSWLV  LLQRGY +HATVRDPGN +KVKHLLELPK
Sbjct  1     MVGGNHTPASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPK  60

Query  242   ADTNLTIWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINS  421
              +  L +WKGV+EEEGSFDEAIAGCEGVFHVA  ++F SKDPENEVIKPA+ G+L+IINS
Sbjct  61    GEGKLKVWKGVLEEEGSFDEAIAGCEGVFHVAAAVNFASKDPENEVIKPAVKGILSIINS  120

Query  422   CVKAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKE  601
             C KAKTVK+LVFTSS   ++++  Q+  YDE+ WSDLDFIYA KM GWMYFASK LAEKE
Sbjct  121   CAKAKTVKKLVFTSSTAAVHIKETQQLEYDESSWSDLDFIYANKMGGWMYFASKTLAEKE  180

Query  602   AWKVTKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDD  781
             AWK  KEK+I+FISIIPPLV+GPF+ PTFP SL+TALS I GN  H++IIKQG++VHLDD
Sbjct  181   AWKAAKEKQIEFISIIPPLVIGPFLIPTFPLSLVTALSPIMGNGLHHNIIKQGKFVHLDD  240

Query  782   LCEAHIFLYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFS  961
             LCEA IFLY+HPKA GRFICSSHH TIH +A MI  NWPEYY+PSEFKGIEK+LP+V FS
Sbjct  241   LCEAQIFLYQHPKAGGRFICSSHHATIHDVAKMIRHNWPEYYVPSEFKGIEKELPIVSFS  300

Query  962   SKKLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQET  1105
             SKKLQ+MGFQFKY+LEDMY+GAIETLRKKGLLPYSTKE A IE+EQ +
Sbjct  301   SKKLQEMGFQFKYTLEDMYKGAIETLRKKGLLPYSTKEPADIEQEQHS  348



>gb|AFO59587.1| diihydroflavonol 4-reductase [Dunalia solanacea]
Length=381

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/353 (74%), Positives = 298/353 (84%), Gaps = 1/353 (0%)
 Frame = +2

Query  68    MVDGNHPLLPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKAD  247
             +VD   P+    VCVTGAAGFIGSWLV  LL+RG+++HATVRDP N KKVKHLLELPKAD
Sbjct  8     VVDAPSPV-AQTVCVTGAAGFIGSWLVMRLLERGFNVHATVRDPENKKKVKHLLELPKAD  66

Query  248   TNLTIWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCV  427
             TNLT+WK  +  EGSFDEAI GC+GVFHVATPMDF+SKDPENEVIKP + G+L+II SC 
Sbjct  67    TNLTLWKADLTVEGSFDEAIQGCQGVFHVATPMDFESKDPENEVIKPTVGGMLSIIESCA  126

Query  428   KAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAW  607
             KA TVKRLVFTSSAGTL+VQ  QK  YDET WSDLDFIYAKKMTGWMYF SKILAEK A 
Sbjct  127   KANTVKRLVFTSSAGTLDVQEHQKLFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAM  186

Query  608   KVTKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLC  787
             +  K+  IDFISIIPPLVVGPFITPTFPPSLITALS+ITGN+AHY IIKQGQYVHLDDLC
Sbjct  187   EEAKKNNIDFISIIPPLVVGPFITPTFPPSLITALSIITGNEAHYCIIKQGQYVHLDDLC  246

Query  788   EAHIFLYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSK  967
             EAHIFLYEHPKAEGRFICSSHH  I+ +A ++ + WPEYY+P+EFKGI+KDLP+V FSSK
Sbjct  247   EAHIFLYEHPKAEGRFICSSHHAIIYDVAKLVREKWPEYYVPTEFKGIDKDLPIVSFSSK  306

Query  968   KLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEK  1126
             KL DMGFQFKY+LEDMY+GAIET R+K LLP+ST+  A   + +E + +  E 
Sbjct  307   KLMDMGFQFKYTLEDMYKGAIETCRQKQLLPFSTRSTADKGQNKEAIPISTEN  359



>ref|NP_001275409.1| dihydroflavonol-4-reductase-like [Solanum tuberosum]
 gb|AAQ54578.1| dihydroflavonol 4-reductase [Solanum tuberosum]
 gb|AAQ54580.1| dihydroflavonol 4-reductase [Solanum tuberosum]
 gb|AEG64707.1| dihydroflavonol 4-reductase [Solanum tuberosum]
Length=382

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/353 (75%), Positives = 295/353 (84%), Gaps = 0/353 (0%)
 Frame = +2

Query  68    MVDGNHPLLPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKAD  247
             +VD + P   P VCVTGAAGFIGSWLV  LL+RGY++HATVRDP N KKVKHLLELPKAD
Sbjct  8     VVDAHSPPKTPTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENQKKVKHLLELPKAD  67

Query  248   TNLTIWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCV  427
             TNLT+WK  +  EGSFDEAI GC+GVFHVATPMDF+SKDPENEVIKP + GVL+II SC 
Sbjct  68    TNLTLWKADLAVEGSFDEAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGVLSIIESCA  127

Query  428   KAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAW  607
             KA TVKRLVFTSSAG L+VQ  QK   DET WSDLDFIYAKKMTGWMYF SKILAEK A 
Sbjct  128   KANTVKRLVFTSSAGALDVQEDQKLFCDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAM  187

Query  608   KVTKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLC  787
             +  K+  ID ISIIPPLVVGPFITPTFPPSLITALSLITGN+AHY IIKQGQYVHLDDLC
Sbjct  188   EEAKKNNIDLISIIPPLVVGPFITPTFPPSLITALSLITGNEAHYGIIKQGQYVHLDDLC  247

Query  788   EAHIFLYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSK  967
             EAHIFLYEHPKAEGRFICSSHH  I+ +A M+ Q WPEYY+P+EFKGI+KDLP+V FSSK
Sbjct  248   EAHIFLYEHPKAEGRFICSSHHAIIYDVAKMVRQKWPEYYVPTEFKGIDKDLPIVSFSSK  307

Query  968   KLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEK  1126
             KL DMGF FKY+LEDMY+GAIET R+K LLP+ST+  A    ++E + +  E 
Sbjct  308   KLMDMGFLFKYTLEDMYKGAIETCRQKQLLPFSTQSTADNGRDKEAIPIPTEN  360



>dbj|BAC10993.1| dihydroflavonol 4-reductase [Nierembergia sp. NB17]
Length=374

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/343 (76%), Positives = 293/343 (85%), Gaps = 0/343 (0%)
 Frame = +2

Query  98    PKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVM  277
             P VCVTGAAGFIGSWLV  LL+RGY++HATVRDP N KKVKHL ELPKADTNLT+WK  +
Sbjct  10    PTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLQELPKADTNLTLWKADL  69

Query  278   EEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVF  457
               EGSFDEAI GC+GVFHVATPMDF+SKDPENEVIKP + G+L+II SCVKA TVKRLVF
Sbjct  70    AVEGSFDEAIKGCQGVFHVATPMDFESKDPENEVIKPTVQGMLSIIESCVKANTVKRLVF  129

Query  458   TSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDF  637
             TSSAGTL+VQ QQK  YDET WSDLDFI AKKMTGWMYF SKILAEK A +  K+  IDF
Sbjct  130   TSSAGTLDVQEQQKLFYDETSWSDLDFINAKKMTGWMYFVSKILAEKAAMEEAKKNNIDF  189

Query  638   ISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHP  817
             ISIIPPLVVGPFITP+FPPSLITALSLITGN+AHY IIKQGQYVHLDDLCEA+IFLYEHP
Sbjct  190   ISIIPPLVVGPFITPSFPPSLITALSLITGNEAHYCIIKQGQYVHLDDLCEAYIFLYEHP  249

Query  818   KAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFK  997
             KAEGRFICSSHH  I+ +A MI + WPEYY+P+EFKGI KDLPVV FSSKKL DMGFQFK
Sbjct  250   KAEGRFICSSHHAIIYDVAKMIREKWPEYYVPTEFKGIAKDLPVVAFSSKKLTDMGFQFK  309

Query  998   YSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEK  1126
             Y+LEDMY+GAIET R+K LLP+ST   +    ++E +++  E 
Sbjct  310   YTLEDMYKGAIETCRQKQLLPFSTNRPSENGLDKEAISISSEN  352



>gb|ABN80438.1| dihydroflavonol 4-reductase [Nicotiana benthamiana]
Length=382

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/352 (75%), Positives = 297/352 (84%), Gaps = 0/352 (0%)
 Frame = +2

Query  71    VDGNHPLLPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADT  250
             V  + P   P VCVTGAAGFIGSWLV  L++RGY++HATVRDP N KKVKHLLELPKADT
Sbjct  9     VHTSSPPATPTVCVTGAAGFIGSWLVMRLIERGYNVHATVRDPENNKKVKHLLELPKADT  68

Query  251   NLTIWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVK  430
             NLT+WK  +  EGSFDEAI GC+GVFHVATPMDF+SKDPENEVIKP + G+L+II SC K
Sbjct  69    NLTLWKADLSVEGSFDEAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGMLSIIESCAK  128

Query  431   AKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWK  610
             A TVKRLVFTSSAGTL+VQ  QK  YDET WSDLDFIYAKKMTGWMYF SKILAEK A +
Sbjct  129   ANTVKRLVFTSSAGTLDVQEHQKLFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAME  188

Query  611   VTKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCE  790
               K+  IDFISIIPPLVVGPF+TPTFPPSLITALSLITGN+ HY IIKQGQYVHLDDLCE
Sbjct  189   AAKQNNIDFISIIPPLVVGPFLTPTFPPSLITALSLITGNETHYCIIKQGQYVHLDDLCE  248

Query  791   AHIFLYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKK  970
             AHIFLYEHPKAEGRFIC+SHH  I+ +A M+ + WPEYYIP+EFKGI+KDLPVVYFSSKK
Sbjct  249   AHIFLYEHPKAEGRFICASHHAIIYDVAKMVREKWPEYYIPTEFKGIDKDLPVVYFSSKK  308

Query  971   LQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEK  1126
             L DMGFQFKY+LEDMY+GAIET R+K LLP+ST+   A   ++E + L  E 
Sbjct  309   LMDMGFQFKYTLEDMYKGAIETCRQKQLLPFSTQSTTANGRDKEAIPLSAEN  360



>gb|ABY25282.1| dihydroflavonol 4-reductase A [Turbina oblongata]
Length=341

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/335 (78%), Positives = 296/335 (88%), Gaps = 3/335 (1%)
 Frame = +2

Query  110   VTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEEEG  289
             VTGAAGF+GSWLV  LLQRGY +HATVRDPGNTKKVKHLLELPKA+ NL +WKGV+EEEG
Sbjct  1     VTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNTKKVKHLLELPKAEENLRLWKGVLEEEG  60

Query  290   SFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTSSA  469
             SFD+AIAGCEGVFHVA  ++F SKDPENEVIKPA+ G+L+IINSC KAKTVK+LVFTSS 
Sbjct  61    SFDDAIAGCEGVFHVAAVVNFASKDPENEVIKPAVKGILSIINSCAKAKTVKKLVFTSST  120

Query  470   GTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFISII  649
               ++++  Q+  YDE+ WSDLDFIYAKKM GWMYFASK LAEKEAWK  KEK+I+FISII
Sbjct  121   AAVHIKETQELAYDESSWSDLDFIYAKKMGGWMYFASKTLAEKEAWKAAKEKQIEFISII  180

Query  650   PPLVVGPFITPTFPPSLITALSLI---TGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPK  820
             PPLV+GPF+ PTFP SL+TALS I    GN  H++IIKQG++VHLDDLCEA IFLYEHPK
Sbjct  181   PPLVIGPFLIPTFPLSLVTALSPIMDPVGNGLHHNIIKQGKFVHLDDLCEAQIFLYEHPK  240

Query  821   AEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKY  1000
             A+GRFICSSHHTTIH +A MI QNWPEYY+PSEFKGIEKDLPVV FSSKKL++MGF FKY
Sbjct  241   AQGRFICSSHHTTIHDVAKMIRQNWPEYYVPSEFKGIEKDLPVVSFSSKKLEEMGFHFKY  300

Query  1001  SLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQET  1105
             +LEDMYRGAIETLRKKGLLPYSTK+ AAIE+EQ +
Sbjct  301   TLEDMYRGAIETLRKKGLLPYSTKQPAAIEQEQHS  335



>gb|AGP50169.1| dihydroflavonol-4-reductase [Calibrachoa sp. YC-2013]
Length=383

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/332 (80%), Positives = 293/332 (88%), Gaps = 0/332 (0%)
 Frame = +2

Query  86    PLLPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIW  265
             P+  P VCVTGAAGFIGSWLV  LL+RGY++HATVRDP N KKV HLLELPKADTNLT+W
Sbjct  15    PVAMPTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVNHLLELPKADTNLTLW  74

Query  266   KGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVK  445
             K  +  EGSFDEAI GC+GVFHVATPMDF+SKDPENEVIKP +NG+L+II SC KAKTVK
Sbjct  75    KADLTVEGSFDEAIQGCQGVFHVATPMDFESKDPENEVIKPTVNGMLSIIESCAKAKTVK  134

Query  446   RLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEK  625
             RLVFTSSAGTL+VQ QQK  Y+ET WSDLDFIYAKKMTGWMYF SKILAEK A +  K+ 
Sbjct  135   RLVFTSSAGTLDVQEQQKLFYEETTWSDLDFIYAKKMTGWMYFVSKILAEKAAMEAAKKN  194

Query  626   KIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFL  805
              IDFISIIPP+VVGPFITPTFPPSLITALSLITGN+AHY IIKQGQYVHLDDLCEAHIFL
Sbjct  195   NIDFISIIPPVVVGPFITPTFPPSLITALSLITGNEAHYCIIKQGQYVHLDDLCEAHIFL  254

Query  806   YEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMG  985
             YEHPKAEGRFICSSHH  I+ +A M+ + WPEYY+P+EFKGI+KDLPVV FSSKKL DMG
Sbjct  255   YEHPKAEGRFICSSHHAIIYDVAKMVREKWPEYYVPTEFKGIDKDLPVVSFSSKKLTDMG  314

Query  986   FQFKYSLEDMYRGAIETLRKKGLLPYSTKEAA  1081
             FQFKYSLEDMY+GAIET R+K LLP+ST+ AA
Sbjct  315   FQFKYSLEDMYKGAIETCRQKQLLPFSTQSAA  346



>gb|ADV03181.1| dihydroflavonol reductase [Iochroma cyaneum]
Length=381

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/341 (76%), Positives = 291/341 (85%), Gaps = 0/341 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGAAGFIGSWLV  LL+RGY++HATVRDP N KKVKHLLEL KADTNLT+WK  +  
Sbjct  19    VCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELAKADTNLTLWKADLTV  78

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC+GVFHVATPMDF+S DPENEVIKP + G+L+II SC KA TVKRLVFTS
Sbjct  79    EGSFDEAIQGCQGVFHVATPMDFESNDPENEVIKPTLRGMLSIIESCAKANTVKRLVFTS  138

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGTL+VQ  QK  YDET WSDLDFIYAKKMTGWMYF SKILAEK A +  K+  IDFIS
Sbjct  139   SAGTLDVQEHQKLFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAMEEAKKNNIDFIS  198

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIPPLVVGPF+TPTFPPSLITALS+ITGN+AHY IIKQGQYVHLDDLCEAHIFLYEHPKA
Sbjct  199   IIPPLVVGPFVTPTFPPSLITALSIITGNEAHYCIIKQGQYVHLDDLCEAHIFLYEHPKA  258

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGRFICSSHH  I+ +A M+ + WPEYY+P+EFKGI+KDLP+V FSSKKL DMGFQFKY+
Sbjct  259   EGRFICSSHHAIIYDVAKMVREKWPEYYVPTEFKGIDKDLPIVSFSSKKLMDMGFQFKYT  318

Query  1004  LEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEK  1126
             LEDMY+GAIET R+K LLP+ST+  A   + +E + +  E 
Sbjct  319   LEDMYKGAIETCRQKQLLPFSTRSTADNGQNKEAIPISTEN  359



>gb|AFD28990.1| dihydroflavonol 4-reductase, partial [Nicotiana attenuata]
Length=396

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/341 (77%), Positives = 294/341 (86%), Gaps = 0/341 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGAAGFIGSWLV  LL+RGY++HATVRDP N KKVKHLLELPKADTNLT+WK  +  
Sbjct  34    VCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENNKKVKHLLELPKADTNLTLWKADLSV  93

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC+GVFHVATPMDF+SKDPENEVIKP + G+L+II SC KA TVKRLVFTS
Sbjct  94    EGSFDEAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGMLSIIESCAKANTVKRLVFTS  153

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGTL+VQ  QK  YDET WSDLDFIYAKKMTGWMYF SKILAEK A +  K+  IDFIS
Sbjct  154   SAGTLDVQEHQKLFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAMEAAKKNNIDFIS  213

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIPPLVVGPF+TP FPPSLITALSLITGN+AHY IIKQGQYVHLDDLCEAHIFLYEHPKA
Sbjct  214   IIPPLVVGPFLTPAFPPSLITALSLITGNEAHYCIIKQGQYVHLDDLCEAHIFLYEHPKA  273

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGRFIC+SHH  I+ +A M+ + WPEYY+P+EFKGI+KDLPVVYFSSKKL DMGFQFKY+
Sbjct  274   EGRFICASHHAIIYDVAKMVREKWPEYYVPTEFKGIDKDLPVVYFSSKKLTDMGFQFKYT  333

Query  1004  LEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEK  1126
             LEDMY+GAIET R+K LLP+ST+  A  E ++E + L  E 
Sbjct  334   LEDMYKGAIETCRQKQLLPFSTRSTADNERDKEAIPLSAEN  374



>gb|AFO59584.1| diihydroflavonol 4-reductase [Iochroma baumii]
Length=381

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/353 (74%), Positives = 295/353 (84%), Gaps = 1/353 (0%)
 Frame = +2

Query  68    MVDGNHPLLPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKAD  247
             +VD   P+    VCVTGAAGFIGSWLV  LL+RGY++HATVRDP N KKVKHLLELPKAD
Sbjct  8     VVDAPSPV-ARTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPKAD  66

Query  248   TNLTIWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCV  427
             TNLT+WK  +  EGSFDEAI GC+GVFHVATPMDF+S DPENEVIKP + G+L+II SC 
Sbjct  67    TNLTLWKADLTVEGSFDEAIQGCQGVFHVATPMDFESYDPENEVIKPTVRGMLSIIESCA  126

Query  428   KAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAW  607
             KA TVKRLVFTSSAGTL+VQ  QK  YDET WSDLDFIYAKKMTGWMYF SKILAEK A 
Sbjct  127   KANTVKRLVFTSSAGTLDVQEHQKLFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAM  186

Query  608   KVTKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLC  787
             +  K+  IDFISIIPPLVVGPFITPTFPPSLITALS+ITGN+AHY IIKQGQYVHLDDLC
Sbjct  187   EEAKKNNIDFISIIPPLVVGPFITPTFPPSLITALSIITGNEAHYCIIKQGQYVHLDDLC  246

Query  788   EAHIFLYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSK  967
             EAHIFLYEH KAEGRFICSSHH  I+ +A M+ + WPEYY+P+EFKGI+KDLP+V FSSK
Sbjct  247   EAHIFLYEHTKAEGRFICSSHHAIIYDVAKMVREKWPEYYVPTEFKGIDKDLPIVSFSSK  306

Query  968   KLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEK  1126
             KL DMGFQFKY+LEDMY+GAIET R+K LLP+ST   A   + +E + +  E 
Sbjct  307   KLMDMGFQFKYTLEDMYKGAIETCRQKQLLPFSTGSTADNGQNKEAIPISTEN  359



>gb|AFO59589.1| diihydroflavonol 4-reductase [Iochroma umbellatum]
Length=381

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/353 (74%), Positives = 296/353 (84%), Gaps = 1/353 (0%)
 Frame = +2

Query  68    MVDGNHPLLPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKAD  247
             +VD   P+    VCVTGAAGFIGSWLV  LL+RGY++HATVRDP N KKVKHLLELPKAD
Sbjct  8     VVDAPSPV-ARTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPKAD  66

Query  248   TNLTIWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCV  427
             TNLT+WK  +  EGSFDEAI GC+GVFHVATPMDF+S DPENEVIKP + G+L+II SC 
Sbjct  67    TNLTLWKADLTVEGSFDEAIQGCQGVFHVATPMDFESNDPENEVIKPTVRGMLSIIESCA  126

Query  428   KAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAW  607
             KA TVKRLVFTSSAGTL+VQ  QK  YDET WSDLDFIYAKKMTGWMYF SKILAEK A 
Sbjct  127   KANTVKRLVFTSSAGTLDVQEHQKLFYDETSWSDLDFIYAKKMTGWMYFGSKILAEKAAM  186

Query  608   KVTKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLC  787
             +  K+  IDFISIIPPLVVGPFITPTFPPSLITALS+ITGN+AHY IIKQGQYVHLDDL 
Sbjct  187   EEAKKNNIDFISIIPPLVVGPFITPTFPPSLITALSIITGNEAHYCIIKQGQYVHLDDLS  246

Query  788   EAHIFLYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSK  967
             +AHIFLYEHPKAEGRFICSSHH  I+ +A M+ + WPEYY+P+EFKGI+KDLP+V FSSK
Sbjct  247   KAHIFLYEHPKAEGRFICSSHHAIIYDVAKMVREKWPEYYVPTEFKGIDKDLPIVSFSSK  306

Query  968   KLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEK  1126
             KL DMGFQFKY+LEDMY+GAIET R+K L+P+ST+  A   + +E + +  E 
Sbjct  307   KLMDMGFQFKYTLEDMYKGAIETCRQKQLIPFSTRSTADNGQNKEAIPISTEN  359



>gb|AFO59581.1| diihydroflavonol 4-reductase [Iochroma calycinum]
Length=381

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/341 (76%), Positives = 290/341 (85%), Gaps = 0/341 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGAAGFIGSWLV  LL+RGY++HATVRDP N KKVKHLLELPKADTNLT+WK  +  
Sbjct  19    VCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPKADTNLTLWKADLTV  78

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC+GVFHVATPMDF+S DPENEVIKP + G+L+II SC KA TVKRLVFTS
Sbjct  79    EGSFDEAIQGCQGVFHVATPMDFESNDPENEVIKPTVRGMLSIIESCAKANTVKRLVFTS  138

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT++VQ  QK  YDET WSDLDFIYAKKMTGWMYF SKILAEK A +  K+  IDFIS
Sbjct  139   SAGTVDVQEHQKLFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAMEEAKKNNIDFIS  198

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIPPLVVGPFITPTFPPSLITALS+ITGN+AHY IIKQGQYVHLDDLCEAHIFLYEH KA
Sbjct  199   IIPPLVVGPFITPTFPPSLITALSIITGNEAHYCIIKQGQYVHLDDLCEAHIFLYEHTKA  258

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGRFICSSHH  I+ +A M+ + WPEYY+P+EFKGI+KDLP+V FSSKKL DMGFQFKY+
Sbjct  259   EGRFICSSHHAIIYDVAKMVREKWPEYYVPTEFKGIDKDLPIVSFSSKKLMDMGFQFKYT  318

Query  1004  LEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEK  1126
             LEDMY+GAIET R+K LLP+ST   A   + +E + +  E 
Sbjct  319   LEDMYKGAIETCRQKQLLPFSTGSTADNGQNKEAIPISTEN  359



>gb|AFO59580.1| diihydroflavonol 4-reductase [Iochroma loxense]
Length=381

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/341 (75%), Positives = 289/341 (85%), Gaps = 0/341 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGAAGFIGSWLV  LL+RGY++HATVRDP N KKVKHLLEL KADTNLT+WK  +  
Sbjct  19    VCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELTKADTNLTLWKADLTV  78

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC+GVFHVATPMDF+S DPENEVIKP + G+L+II SC KA TVKRLVFTS
Sbjct  79    EGSFDEAIHGCQGVFHVATPMDFESNDPENEVIKPTVRGMLSIIESCAKANTVKRLVFTS  138

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT++VQ  QK  YDET WSDLDFIYAKKMTGWMYF SKILAEK A +  K+  IDFIS
Sbjct  139   SAGTVDVQEHQKLFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAMEEAKKNNIDFIS  198

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIPPLVVGPFITPTFPPSLITALS+ITGN+AHY IIKQGQYVHLDDLCEAHIFLYEH KA
Sbjct  199   IIPPLVVGPFITPTFPPSLITALSIITGNEAHYCIIKQGQYVHLDDLCEAHIFLYEHTKA  258

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGRFICSSHH  I+ +A M+ + WPEYY+P+EFKGI+KDLP+V FSSKKL DMGFQFKY+
Sbjct  259   EGRFICSSHHAIIYDVAKMVREKWPEYYVPTEFKGIDKDLPIVSFSSKKLMDMGFQFKYT  318

Query  1004  LEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEK  1126
             LEDMY+GAIET R+K LLP+ST+      + +E + +  E 
Sbjct  319   LEDMYKGAIETSRQKQLLPFSTRSTTDNGQNKEAIPISTEN  359



>gb|AFO59579.1| diihydroflavonol 4-reductase [Iochroma loxense]
Length=381

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/341 (75%), Positives = 289/341 (85%), Gaps = 0/341 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGAAGFIGSWLV  LL+RGY++HATVRDP N KKVKHLLEL KADTNLT+WK  +  
Sbjct  19    VCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELTKADTNLTLWKADLTV  78

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC+GVFHVATPMDF+S DPENEVIKP + G+L+II SC KA TVKRLVFTS
Sbjct  79    EGSFDEAIQGCQGVFHVATPMDFESNDPENEVIKPTVRGMLSIIESCAKANTVKRLVFTS  138

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT++VQ  QK  YDET WSDLDFIYAKKMTGWMYF SKILAEK A +  ++  IDFIS
Sbjct  139   SAGTVDVQEHQKLFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAMEEARKNNIDFIS  198

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIPPLVVGPFITPTFPPSLITALS+ITGN+AHY IIKQGQYVHLDDLCEAHIFLYEH KA
Sbjct  199   IIPPLVVGPFITPTFPPSLITALSIITGNEAHYCIIKQGQYVHLDDLCEAHIFLYEHTKA  258

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGRFICSSHH  I+ +A M+ + WPEYY+P+EFKGI+KDLP+V FSSKKL DMGFQFKY+
Sbjct  259   EGRFICSSHHAIIYDVAKMVREKWPEYYVPTEFKGIDKDLPIVSFSSKKLMDMGFQFKYT  318

Query  1004  LEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEK  1126
             LEDMY+GAIET R+K LLP+ST+      + +E + +  E 
Sbjct  319   LEDMYKGAIETSRQKQLLPFSTRSTTDNGQNKEAIPISTEN  359



>gb|AFO59582.1| diihydroflavonol 4-reductase [Iochroma fuchsioides]
Length=381

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/353 (73%), Positives = 294/353 (83%), Gaps = 1/353 (0%)
 Frame = +2

Query  68    MVDGNHPLLPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKAD  247
             +VD   P+    VCVTGAAGFIGSWLV  LL+RGY++HATVRDP N KKVKHLLELPKAD
Sbjct  8     VVDAPSPV-ARTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPKAD  66

Query  248   TNLTIWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCV  427
             TNLT+WK  +  EGSFDEAI GC+GVFHVATPMDF+S DPENEVIKP + G+L+II SC 
Sbjct  67    TNLTLWKADLTVEGSFDEAIQGCQGVFHVATPMDFESNDPENEVIKPTVRGMLSIIESCA  126

Query  428   KAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAW  607
             KA TVKRLVFTSSAGTL+VQ  QK  YDET WSDLDFIYAKKMTGWMYF SKILAEK A 
Sbjct  127   KANTVKRLVFTSSAGTLDVQEHQKLFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAM  186

Query  608   KVTKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLC  787
             +  K+  IDFISIIPPLVVGPFITPTFPPS ITALS+ITGN+AHY IIKQG+YVHLDDLC
Sbjct  187   EEAKKNNIDFISIIPPLVVGPFITPTFPPSFITALSIITGNEAHYCIIKQGKYVHLDDLC  246

Query  788   EAHIFLYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSK  967
             EAHIFLYEH KAEGRFICSSH+  I+ +A M+ + WPEYY+P+EFKGI+KDLP+V FSSK
Sbjct  247   EAHIFLYEHTKAEGRFICSSHYAIIYDVAKMVREKWPEYYVPTEFKGIDKDLPIVSFSSK  306

Query  968   KLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEK  1126
             KL DMGFQFKY+LEDMY+GAIET R+K LLP+ST   A   + +E + +  E 
Sbjct  307   KLMDMGFQFKYTLEDMYKGAIETCRQKQLLPFSTGSTADNGQNKEAIPISTEN  359



>ref|NP_001289451.1| dihydroflavonol-4-reductase [Nicotiana tomentosiformis]
 gb|ACS12833.1| dihydroflavonol 4-reductase [Nicotiana tomentosiformis]
Length=382

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/347 (76%), Positives = 297/347 (86%), Gaps = 0/347 (0%)
 Frame = +2

Query  86    PLLPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIW  265
             P   P VCVTGAAGFIGSWLV  LL+RGY++HATVRDP N KKVKHLLELPKADTNLT+W
Sbjct  14    PPAAPTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPKADTNLTLW  73

Query  266   KGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVK  445
             K  +  EGSFDEAI GC+GVFHVATPMDF+S+DPENEVIKP + G+L+II SC KA TVK
Sbjct  74    KADLSVEGSFDEAIQGCQGVFHVATPMDFESEDPENEVIKPTVRGMLSIIESCAKANTVK  133

Query  446   RLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEK  625
             RLVFTSSAGT++VQ  QK +YDET WSDLDFIYAKKMTGWMYF SKILAEK A +  K+K
Sbjct  134   RLVFTSSAGTVDVQEHQKLLYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAMEAAKKK  193

Query  626   KIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFL  805
              IDFISIIPPLVVGPF+ PTFPPSLITALSLITGN+AHYSIIKQG+YVHLDDLCEAHIFL
Sbjct  194   NIDFISIIPPLVVGPFLAPTFPPSLITALSLITGNEAHYSIIKQGKYVHLDDLCEAHIFL  253

Query  806   YEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMG  985
             YEHPKAEGRFIC+SHH  I+ +A M+ + WPEYY+P+EFKGI+KDL VVYFSSKKL DMG
Sbjct  254   YEHPKAEGRFICASHHAIIYDVAKMVQEKWPEYYVPTEFKGIDKDLSVVYFSSKKLTDMG  313

Query  986   FQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEK  1126
             FQFKY+LEDMY+GAIET R+K LLP+ST+  A    ++E + L  E 
Sbjct  314   FQFKYTLEDMYKGAIETCRQKQLLPFSTRSTADNVRDKEAIPLSTEN  360



>gb|ABY25281.1| dihydroflavonol 4-reductase A [Convolvulus arvensis]
Length=344

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/347 (76%), Positives = 295/347 (85%), Gaps = 8/347 (2%)
 Frame = +2

Query  68    MVDGNHPLLPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKAD  247
             M+  +H    PKVCVTGAAGF+ SWLV  LL+RGYH+HAT RDPGNT+KV+HLLELPKAD
Sbjct  1     MIGDDHK---PKVCVTGAAGFVASWLVMRLLERGYHVHATSRDPGNTEKVRHLLELPKAD  57

Query  248   TNLTIWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCV  427
             TNL  +K VMEEEGSFDEAIAGCEGVFHVATP+D  SKDPENEVIKPA++G+L+IINSC 
Sbjct  58    TNLKFYKAVMEEEGSFDEAIAGCEGVFHVATPVDLASKDPENEVIKPAVDGILSIINSCA  117

Query  428   KAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKK--MTGWMYFASKILAEKE  601
             KAKTVKRLVFTSS  T++ Q  +K VYDE+CWSDLDFIYA K  M GW YFASK LAEKE
Sbjct  118   KAKTVKRLVFTSSTATIDFQENKKLVYDESCWSDLDFIYANKIIMPGWAYFASKTLAEKE  177

Query  602   AWKVTKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLIT---GNQAHYSIIKQGQYVH  772
             AWK  KEK+IDFIS+IPP++VGPF+ PTFPPSL TALS I    G   H++IIKQG +VH
Sbjct  178   AWKAAKEKQIDFISVIPPVIVGPFLIPTFPPSLFTALSPILDPEGKGFHHNIIKQGHFVH  237

Query  773   LDDLCEAHIFLYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVV  952
             LDDLC+AHIFLYEHPKAEGR++CSSH TTI  LA MI QNWPEYY+PSEFKGIEK+L VV
Sbjct  238   LDDLCQAHIFLYEHPKAEGRYLCSSHDTTIQDLAKMIRQNWPEYYVPSEFKGIEKELSVV  297

Query  953   YFSSKKLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEE  1093
              FSSKKLQDMGF+FKY+LEDMYRGAIETLRKKGLLPYS K+   IEE
Sbjct  298   PFSSKKLQDMGFEFKYTLEDMYRGAIETLRKKGLLPYSIKDPCDIEE  344



>gb|AFO59583.1| diihydroflavonol 4-reductase [Iochroma fuchsioides]
Length=381

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/353 (73%), Positives = 294/353 (83%), Gaps = 1/353 (0%)
 Frame = +2

Query  68    MVDGNHPLLPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKAD  247
             +VD   P+    VCVTGAAGFIGSWLV  LL+RGY++HATVRDP N KKVKHLLELPKAD
Sbjct  8     VVDAPSPV-ARTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPKAD  66

Query  248   TNLTIWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCV  427
             TNLT+WK  +  EGSFDEAI GC+GVFHVATPMDF+S DPENEVIKP + G+L+II SC 
Sbjct  67    TNLTLWKADLTMEGSFDEAIQGCQGVFHVATPMDFESNDPENEVIKPTVRGMLSIIESCA  126

Query  428   KAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAW  607
             KA TVKRLVFTSSAGTL+VQ  QK  YDET WSDLDFIYAKKMTGWMYF SKILAEK A 
Sbjct  127   KANTVKRLVFTSSAGTLDVQEHQKLFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAM  186

Query  608   KVTKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLC  787
             +  K+  IDFISIIPPLVVGPFITPTFPPS ITALS+ITGN+AHY IIKQG+YVHLDDLC
Sbjct  187   EEAKKNNIDFISIIPPLVVGPFITPTFPPSFITALSIITGNEAHYCIIKQGKYVHLDDLC  246

Query  788   EAHIFLYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSK  967
             EAHIFLYEH KAEGRFICSSH+  I+ +A M+ + WPEYY+P+EFKGI+KDLP+V FSSK
Sbjct  247   EAHIFLYEHTKAEGRFICSSHYAIIYDVAKMVREKWPEYYVPTEFKGIDKDLPIVSFSSK  306

Query  968   KLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEK  1126
             KL DMGFQFKY+LEDMY+GAIET R+K LLP+ST   A   + +E + +  E 
Sbjct  307   KLVDMGFQFKYTLEDMYKGAIETCRQKQLLPFSTGSTADNGQNKEDIPISTEN  359



>gb|ADV03180.1| dihydroflavonol reductase [Iochroma gesnerioides]
Length=381

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/353 (73%), Positives = 294/353 (83%), Gaps = 1/353 (0%)
 Frame = +2

Query  68    MVDGNHPLLPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKAD  247
             +VD   P+    VCVTGAAGFIGSWLV  LL+RGY++HATVRDP N KKVKHLLELPKAD
Sbjct  8     VVDAPSPV-ARTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPKAD  66

Query  248   TNLTIWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCV  427
             TNLT+WK  +  EGSFDEAI GC+GVFHVATPMDF+S DPENEVIKP + G+L+II SC 
Sbjct  67    TNLTLWKADLTVEGSFDEAIQGCQGVFHVATPMDFESNDPENEVIKPTVRGMLSIIESCA  126

Query  428   KAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAW  607
             KA TVKRLVFTSSAGTL++Q  QK  YDET WSDLDFIYAKKMTGWMYF SKILAEK A 
Sbjct  127   KANTVKRLVFTSSAGTLDIQEHQKLFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAM  186

Query  608   KVTKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLC  787
             +  K+  IDFISIIPPLVVGPFITPTFPPS ITALS+ITGN+AHY IIKQG+YVHLDDLC
Sbjct  187   EEAKKNNIDFISIIPPLVVGPFITPTFPPSFITALSIITGNEAHYCIIKQGKYVHLDDLC  246

Query  788   EAHIFLYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSK  967
             EAHIFLYEH KAEGRFICSSH+  I+ +A M+ + WPEYY+P+EFKGI+KDLP+V FSSK
Sbjct  247   EAHIFLYEHTKAEGRFICSSHYAIIYDVAKMVREKWPEYYVPTEFKGIDKDLPIVSFSSK  306

Query  968   KLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEK  1126
             KL DMGFQFKY+LEDMY+GAIET R+K LLP+ST   A   + +E + +  E 
Sbjct  307   KLMDMGFQFKYTLEDMYKGAIETCRQKQLLPFSTGSTADNGQNKEEIPISTEN  359



>dbj|BAM37961.1| dihydroflavonol-4-reductase [Nicotiana tabacum]
 dbj|BAM37966.1| dihydroflavonol 4-reductase [Nicotiana tomentosiformis]
Length=382

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/347 (76%), Positives = 297/347 (86%), Gaps = 0/347 (0%)
 Frame = +2

Query  86    PLLPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIW  265
             P   P VCVTGAAGFIGSWLV  LL+RGY++HATVRDP N KKVKHLLELPKADTNLT+W
Sbjct  14    PPAAPTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPKADTNLTLW  73

Query  266   KGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVK  445
             K  +  EGSFDEAI GC+GVFHVATPMDF+S+DPENEVIKP + G+L+II SC KA TVK
Sbjct  74    KADLSVEGSFDEAIQGCQGVFHVATPMDFESEDPENEVIKPTVRGMLSIIESCAKANTVK  133

Query  446   RLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEK  625
             RLVFTSSAGT++VQ  QK +YDET WSDLDFIYAKKMTGWMYF SKILAEK A +  K+K
Sbjct  134   RLVFTSSAGTVDVQEHQKLLYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAMEAAKKK  193

Query  626   KIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFL  805
              IDFISIIPPLVVGPF+ PTFPPSLITALSLITGN+AHYSIIKQG+YVHLDDLCEAHIFL
Sbjct  194   NIDFISIIPPLVVGPFLAPTFPPSLITALSLITGNEAHYSIIKQGKYVHLDDLCEAHIFL  253

Query  806   YEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMG  985
             YEHPKAEGRFIC+SHH  I+ +A M+ + WPEYY+P+EFKGI+KDL VVYFSSKKL DMG
Sbjct  254   YEHPKAEGRFICASHHAIIYDVAKMVQEKWPEYYVPTEFKGIDKDLSVVYFSSKKLTDMG  313

Query  986   FQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEK  1126
             FQFKY+LEDMY+GAIET R+K LLP+ST+  A    ++E + L  E 
Sbjct  314   FQFKYTLEDMYKGAIETCRQKQLLPFSTRSTADNVRDKEAIPLSTEN  360



>gb|ACS12835.1| dihydroflavonol 4-reductase [Nicotiana langsdorffii]
Length=382

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/352 (75%), Positives = 296/352 (84%), Gaps = 0/352 (0%)
 Frame = +2

Query  71    VDGNHPLLPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADT  250
             V  + P   P VCVTGAAGFIGSWLV  LL+RGY++HATVRDP N KKVKHLLELPKADT
Sbjct  9     VHTSSPPATPTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENNKKVKHLLELPKADT  68

Query  251   NLTIWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVK  430
             NLT+WK  +  EGSFDEAI GC+GVFHVATPMDF+SKDPENEVIKP + G+L+II SC K
Sbjct  69    NLTLWKADLSVEGSFDEAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGMLSIIESCAK  128

Query  431   AKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWK  610
             A TVKRLVFTSSAGTL+VQ  QK  YDET WSDLDFIYAKKMTGWMYF SKILAEK A +
Sbjct  129   ANTVKRLVFTSSAGTLDVQEHQKLFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAME  188

Query  611   VTKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCE  790
               K+  IDFISIIPPLVVGPF+TPTFPPSLITALSLITGN+AHY IIKQGQYVHLDDLCE
Sbjct  189   AAKKNNIDFISIIPPLVVGPFLTPTFPPSLITALSLITGNEAHYCIIKQGQYVHLDDLCE  248

Query  791   AHIFLYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKK  970
             AHIFLYE PKAEGRFIC+SHH  I+ +A M+ + WPEY +P+EFKGI+KDLPVVYFSSKK
Sbjct  249   AHIFLYEQPKAEGRFICASHHAIIYDVAKMVREKWPEYCVPTEFKGIDKDLPVVYFSSKK  308

Query  971   LQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEK  1126
             L D+GFQFKY+LEDMY+GAIET R+K LLP+ST+  A    ++E + L  E 
Sbjct  309   LTDIGFQFKYTLEDMYKGAIETCRQKQLLPFSTRSTADNGSDKEAIPLSAEN  360



>gb|AFO59588.1| diihydroflavonol 4-reductase [Iochroma umbellatum]
Length=381

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/341 (75%), Positives = 289/341 (85%), Gaps = 0/341 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGAAGFIGSWLV  LL+RGY++HATVRDP N KKVKHLLELPKADTNLT+WK  +  
Sbjct  19    VCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPKADTNLTLWKADLTV  78

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC+GVFHVATPMDF+S DPENE+IKP + G+L+II SC KA TVKRLVFTS
Sbjct  79    EGSFDEAIQGCQGVFHVATPMDFESNDPENEIIKPTVRGMLSIIESCAKANTVKRLVFTS  138

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGTL+VQ  QK  YDET WSDLDFI AKKMTGWMYF SKILAEK A +  K+  IDFIS
Sbjct  139   SAGTLDVQEHQKLFYDETSWSDLDFIXAKKMTGWMYFGSKILAEKAAMEEAKKNNIDFIS  198

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIPPLVVGPFITPTFPPSLITALS+ITGN+AHY IIKQGQYVHLDDL EAHIFLYEHPKA
Sbjct  199   IIPPLVVGPFITPTFPPSLITALSIITGNEAHYCIIKQGQYVHLDDLSEAHIFLYEHPKA  258

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGRFICSSHH  I+ +A M+ + WPEYY+P+EFKGI+KDLP+V FSSKKL DMGFQFKY+
Sbjct  259   EGRFICSSHHAIIYDVAKMVREKWPEYYVPTEFKGIDKDLPIVSFSSKKLMDMGFQFKYT  318

Query  1004  LEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEK  1126
             LEDMY+GAIET R+K L+P+ T+  A   + +E + +  E 
Sbjct  319   LEDMYKGAIETCRQKQLIPFPTRSTADNGQNKEAIPISTEN  359



>gb|ABN80436.1| dihydroflavonol 4-reductase [Nicotiana tabacum]
Length=382

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/347 (75%), Positives = 297/347 (86%), Gaps = 0/347 (0%)
 Frame = +2

Query  86    PLLPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIW  265
             P   P VCVTGAAGFIGSWLV  LL+RGY++HATVRDP N KKVKHLLELPKADTNLT+W
Sbjct  14    PPAAPTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPKADTNLTLW  73

Query  266   KGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVK  445
             K  +  EGSFDEAI GC+GVFHVATPMDF+S+DPENEVIKP + G+L+II SC KA TVK
Sbjct  74    KADLSVEGSFDEAIQGCQGVFHVATPMDFESEDPENEVIKPTVRGMLSIIESCAKANTVK  133

Query  446   RLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEK  625
             RLVFTSSAGT++VQ  QK +YDET WSDLDFIYAKKMTGWMYF S+ILAEK A +  K+K
Sbjct  134   RLVFTSSAGTVDVQEHQKLLYDETSWSDLDFIYAKKMTGWMYFVSQILAEKAAMEAAKKK  193

Query  626   KIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFL  805
              IDFISIIPPLVVGPF+ PTFPPSLITALSLITGN+AHYSIIKQG+YVHLDDLCEAHIFL
Sbjct  194   NIDFISIIPPLVVGPFLAPTFPPSLITALSLITGNEAHYSIIKQGKYVHLDDLCEAHIFL  253

Query  806   YEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMG  985
             YEHPKAEGRFIC+SHH  I+ +A M+ + WPEYY+P+EFKGI+KDL VVYFSSKKL DMG
Sbjct  254   YEHPKAEGRFICASHHAIIYDVAKMVQEKWPEYYVPTEFKGIDKDLSVVYFSSKKLTDMG  313

Query  986   FQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEK  1126
             FQFKY+LEDMY+GAIET R+K LLP+ST+  A    ++E + L  E 
Sbjct  314   FQFKYTLEDMYKGAIETCRQKQLLPFSTRSTADNVRDKEAIPLSTEN  360



>ref|XP_009759956.1| PREDICTED: dihydroflavonol-4-reductase [Nicotiana sylvestris]
 dbj|BAM37967.1| dihydroflavonol 4-reductase [Nicotiana sylvestris]
Length=381

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/347 (75%), Positives = 294/347 (85%), Gaps = 0/347 (0%)
 Frame = +2

Query  86    PLLPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIW  265
             P + P VCVTGAAGFIGSWLV  LL+RGY++HATVRDP N KKVKHL ELPKADTNLT+W
Sbjct  13    PPVAPTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLFELPKADTNLTLW  72

Query  266   KGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVK  445
             K  +  EGSFDEAI GC+GVFHVATPMDF+S+DPENEVIKP + G+L+II SC KA TVK
Sbjct  73    KADLSVEGSFDEAIQGCQGVFHVATPMDFESEDPENEVIKPTVRGMLSIIESCAKANTVK  132

Query  446   RLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEK  625
             RLVFTSSAGTL+ Q  QK  YDET WSDLDFIYAKKMTGWMYF SKILAEK A +  K+K
Sbjct  133   RLVFTSSAGTLDAQEHQKLFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAMEAAKKK  192

Query  626   KIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFL  805
               DFISIIPPLVVGPF+TPTFPPSLITALSLITGN+AHY IIKQGQYVHLDDLCEAHIFL
Sbjct  193   NFDFISIIPPLVVGPFLTPTFPPSLITALSLITGNEAHYCIIKQGQYVHLDDLCEAHIFL  252

Query  806   YEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMG  985
             YE PKAEGRFIC+SHH  I+ +A M+ + WPEYY+P+EFKGI+KDLPVVYFS KKL DMG
Sbjct  253   YEQPKAEGRFICASHHAIIYDVAKMVREKWPEYYVPTEFKGIDKDLPVVYFSPKKLTDMG  312

Query  986   FQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEK  1126
             FQFKY+LEDMY+GAIET R+K LLP+ST+  A    ++ET+ L  E 
Sbjct  313   FQFKYTLEDMYKGAIETCRQKQLLPFSTQSTADNGRDKETIPLSAEN  359



>gb|ABN80437.1| dihydroflavonol 4-reductase [Nicotiana tabacum]
 dbj|BAF96936.1| dihydroflavonol 4-reductase [Nicotiana tabacum]
Length=381

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/347 (75%), Positives = 294/347 (85%), Gaps = 0/347 (0%)
 Frame = +2

Query  86    PLLPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIW  265
             P + P VCVTGAAGFIGSWLV  LL+RGY++HATVRDP N KKVKHL ELPKADTNLT+W
Sbjct  13    PPVAPTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLFELPKADTNLTLW  72

Query  266   KGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVK  445
             K  +  EGSFDEAI GC+GVFHVATPMDF+S+DPENEVIKP + G+L+II SC KA TVK
Sbjct  73    KADLSVEGSFDEAIQGCQGVFHVATPMDFESEDPENEVIKPTVRGMLSIIESCAKANTVK  132

Query  446   RLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEK  625
             RLVFTSSAGTL+ Q  QK  YDET WSDLDFIYAKKMTGWMYF SKILAEK A +  K+K
Sbjct  133   RLVFTSSAGTLDAQEHQKLFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAMEAAKKK  192

Query  626   KIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFL  805
               DFISIIPPLVVGPF+TPTFPPSLITALSLITGN+AHY IIKQGQYVHLDDLCEAHIFL
Sbjct  193   NFDFISIIPPLVVGPFLTPTFPPSLITALSLITGNEAHYCIIKQGQYVHLDDLCEAHIFL  252

Query  806   YEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMG  985
             YE PKAEGRFIC+SHH  I+ +A M+ + WPEYY+P+EFKGI+KDLPVVYFS KKL DMG
Sbjct  253   YEQPKAEGRFICASHHAIIYDVAKMVREKWPEYYVPTEFKGIDKDLPVVYFSPKKLTDMG  312

Query  986   FQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEK  1126
             FQFKY+LEDMY+GAIET R+K LLP+ST+  A    ++ET+ L  E 
Sbjct  313   FQFKYTLEDMYKGAIETCRQKQLLPFSTQSTADNGRDKETIPLSAEN  359



>gb|ACS12834.1| dihydroflavonol 4-reductase [Nicotiana alata]
Length=382

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/341 (77%), Positives = 292/341 (86%), Gaps = 0/341 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGAAGFIGSWLV  LL+RGY++HATVRDP N KKVKHLLELPKADTNLT+WK  +  
Sbjct  20    VCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPKADTNLTLWKADLSV  79

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC+GVFHVATPMDF+SKDPENEVIKP + G+L+II SC KA TVKRLVFTS
Sbjct  80    EGSFDEAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGMLSIIESCAKANTVKRLVFTS  139

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGTL+VQ  QK  YDET WSDLDFIYAKKMTGWMYF SKILAEK A +  K+K IDFIS
Sbjct  140   SAGTLDVQEHQKLFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAMEAAKKKNIDFIS  199

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIPPLVVGPF+TPTFPPSLITALSLITGN+AHY IIKQGQYVHLDDLCEAHIFLYE P A
Sbjct  200   IIPPLVVGPFLTPTFPPSLITALSLITGNEAHYCIIKQGQYVHLDDLCEAHIFLYEQPTA  259

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGRFIC+SHH  I+ +A M+ + WPEY +P+EFKGI+KDLPVVYFSSKKL DMGFQFKY+
Sbjct  260   EGRFICASHHAIIYDVAKMVREKWPEYCVPTEFKGIDKDLPVVYFSSKKLTDMGFQFKYT  319

Query  1004  LEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEK  1126
             LEDMY+GAIET R+K LLP+ST+  A    ++E + L  E 
Sbjct  320   LEDMYKGAIETCRQKQLLPFSTRSTADNGSDKEAIPLSAEN  360



>emb|CDP01993.1| unnamed protein product [Coffea canephora]
Length=369

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/323 (78%), Positives = 282/323 (87%), Gaps = 1/323 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGAAGFIGSWLV  LL+R Y + ATVRDPGN KKVKHLL+LPKA T+LT+WK  M E
Sbjct  15    VCVTGAAGFIGSWLVMRLLERDYVVRATVRDPGNMKKVKHLLDLPKASTHLTLWKADMTE  74

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEA  GCEGVFHVATPMDFDSKDPENE+IKP ING LNII SCVKAKTVKRLV+TS
Sbjct  75    EGSFDEATQGCEGVFHVATPMDFDSKDPENEIIKPTINGALNIIRSCVKAKTVKRLVYTS  134

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NVQ  Q+PVYDET WSDLDFIY+ KMTGWMYF SK+LAEKEAW+V+K+  IDFIS
Sbjct  135   SAGTVNVQEHQQPVYDETNWSDLDFIYSTKMTGWMYFVSKLLAEKEAWEVSKQSNIDFIS  194

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LVVGPFI PTFPPSLITALSLITGN+AHYSII+QGQ+VH+DDLCEAHIFLYE P A
Sbjct  195   IIPTLVVGPFIMPTFPPSLITALSLITGNEAHYSIIRQGQFVHVDDLCEAHIFLYEDPTA  254

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSSH  TIH LA +I + WPEY IP E KG++KD+PVV FSSKKL   GFQ+KY+
Sbjct  255   EGRYICSSHDATIHDLAKLIAEKWPEYSIP-ELKGVDKDIPVVSFSSKKLVGKGFQYKYT  313

Query  1004  LEDMYRGAIETLRKKGLLPYSTK  1072
             LEDM+R AI+T R+KGLLPYST+
Sbjct  314   LEDMFRAAIDTCREKGLLPYSTQ  336



>gb|ABK88311.2| dihydroflavonol 4-reductase [Chrysanthemum x morifolium]
Length=374

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/367 (70%), Positives = 304/367 (83%), Gaps = 8/367 (2%)
 Frame = +2

Query  95    PPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGV  274
             P  VCVTGAAGFIGSWLV  LL+RGY + ATVR+PG+ KKVKHLLELPKA+TNLT+WK  
Sbjct  6     PAIVCVTGAAGFIGSWLVMRLLERGYIVRATVREPGDMKKVKHLLELPKAETNLTLWKAD  65

Query  275   MEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLV  454
             + +EGSFDEAI GC+GVFHVATPMDF+SKDPENE+IKP I GVL+II SCVKAKTVK+LV
Sbjct  66    LAQEGSFDEAIEGCQGVFHVATPMDFESKDPENEIIKPTIEGVLSIIRSCVKAKTVKKLV  125

Query  455   FTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKID  634
             FTSSAGT+NVQ QQ PVYDE+ WSDLDFIY+KKMT WMYF SKILAEK AWK TKE  ID
Sbjct  126   FTSSAGTVNVQKQQAPVYDESHWSDLDFIYSKKMTAWMYFVSKILAEKAAWKATKENNID  185

Query  635   FISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEH  814
             F+SI+P LVVGPFI+P+FPPSL+TALSLITG ++HYSIIKQ QYVHLDDLCE+HI+LYE+
Sbjct  186   FVSIVPTLVVGPFISPSFPPSLLTALSLITGAESHYSIIKQCQYVHLDDLCESHIYLYEN  245

Query  815   PKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQF  994
             PKAEGR+ICSSH  TIH LA MI + WPEY IP++F+GI+ ++P+V FSSKKL DMGF+F
Sbjct  246   PKAEGRYICSSHDATIHQLAKMIKEKWPEYQIPTKFEGIDDEIPIVSFSSKKLTDMGFKF  305

Query  995   KYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEKPTAIEQK----QEAKT  1162
             KY LE+M+RGAI++ ++KGLLPYST E     +E    +L  +  T  E+K     +A T
Sbjct  306   KYDLEEMFRGAIKSCKEKGLLPYSTNEM----KEGLVSSLVTKADTHEEEKLQIIHKAAT  361

Query  1163  VPLKPSA  1183
              PL P A
Sbjct  362   YPLAPLA  368



>ref|NP_001234408.1| dihydroflavonol-4-reductase [Solanum lycopersicum]
 sp|P51107.1|DFRA_SOLLC RecName: Full=Dihydroflavonol-4-reductase; Short=DFR; AltName: 
Full=Dihydrokaempferol 4-reductase [Solanum lycopersicum]
 emb|CAA79154.1| dihydroflavonol 4-reductase [Solanum lycopersicum]
 prf||2006279A dihydroflavonol 4-reductase
Length=379

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/353 (73%), Positives = 291/353 (82%), Gaps = 3/353 (1%)
 Frame = +2

Query  68    MVDGNHPLLPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKAD  247
             +VD + P     V VTG AGFIGSWLV  LL+RGY++HATVRDP N KKVKHLLELPKAD
Sbjct  8     VVDAHSPPKTTTVWVTGGAGFIGSWLVMRLLERGYNVHATVRDPENQKKVKHLLELPKAD  67

Query  248   TNLTIWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCV  427
             TNLT+WK  +  EGSFDEAI GC+GVFHVATPMDF+SKDPENEVIKP + G+L+II SC 
Sbjct  68    TNLTLWKADLAVEGSFDEAIQGCQGVFHVATPMDFESKDPENEVIKPTVRGMLSIIESCA  127

Query  428   KAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAW  607
             KA TVKRLVFTSSAGTL+VQ  QK  YDET WSDLDFIYAKKMTGWMYF SKILAEK A 
Sbjct  128   KANTVKRLVFTSSAGTLDVQEDQKLFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAM  187

Query  608   KVTKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLC  787
             +  ++  IDFISIIPPLVVGPFIT TFPPSLITALSLIT   AHY IIKQGQYVHLDDLC
Sbjct  188   EEARKNNIDFISIIPPLVVGPFITSTFPPSLITALSLIT---AHYGIIKQGQYVHLDDLC  244

Query  788   EAHIFLYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSK  967
             EAHIFLYEHPKAEGRFICSSHH  I+ +A M+ Q WPEYY+P+EFKGI+KDL +V FSSK
Sbjct  245   EAHIFLYEHPKAEGRFICSSHHAIIYDVAKMVRQKWPEYYVPTEFKGIDKDLALVSFSSK  304

Query  968   KLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEK  1126
             KL D+ FQFK++LEDMY+GAIET R+K LLP+ST+  A   +++E + +  E 
Sbjct  305   KLMDIKFQFKHTLEDMYKGAIETCRQKQLLPFSTRSTADNGKDKEAIPISTEN  357



>emb|CAC88859.1| dihydroflavonol reductase [Rhododendron simsii]
Length=344

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/326 (77%), Positives = 278/326 (85%), Gaps = 0/326 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGAAGFIGSWLV  LL+RGY + ATVRDP N KKVKHLLELPKAD+NLT+WK  + E
Sbjct  12    VCVTGAAGFIGSWLVMRLLERGYVVRATVRDPANIKKVKHLLELPKADSNLTLWKADLNE  71

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDPENEVIKP INGVL+II SC KAKTVKRLVFTS
Sbjct  72    EGSFDEAIEGCFGVFHVATPMDFESKDPENEVIKPTINGVLSIIKSCTKAKTVKRLVFTS  131

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NVQ  Q+PVYDE  WSDLDFI  KKMTGWMYF SK LAEK AW   KE  IDFIS
Sbjct  132   SAGTVNVQEHQQPVYDENNWSDLDFINEKKMTGWMYFVSKTLAEKAAWDAAKENNIDFIS  191

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LVVGPFI PTFPPSL+TALS ITGN+ HYSIIKQGQ+VHLDDLCE+HIFL+EHP+A
Sbjct  192   IIPVLVVGPFIMPTFPPSLVTALSPITGNEPHYSIIKQGQFVHLDDLCESHIFLFEHPEA  251

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSSH  TI+ LA M+ + WPEY +P+EFKGI+KD+P V FSS+KL  MGF+FKYS
Sbjct  252   EGRYICSSHDATIYDLAKMMREKWPEYNVPTEFKGIDKDIPKVSFSSEKLIGMGFKFKYS  311

Query  1004  LEDMYRGAIETLRKKGLLPYSTKEAA  1081
             LEDM+RGAI+T R+KGLLPYS    A
Sbjct  312   LEDMFRGAIDTCREKGLLPYSNATTA  337



>dbj|BAA22076.1| dihydroflavonol 4-reductase [Ipomoea nil]
Length=356

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/334 (78%), Positives = 282/334 (84%), Gaps = 3/334 (1%)
 Frame = +2

Query  80    NHPLLP-PKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKA-DTN  253
             N P LP PKVCVTGAAG++GSWLV  LLQRGY +HATVRDPGNTKKVK LLELPKA +  
Sbjct  7     NAPTLPAPKVCVTGAAGYVGSWLVMKLLQRGYVVHATVRDPGNTKKVKRLLELPKAAEGK  66

Query  254   LTIWKGVMEEEGSFDEAIAGCEGVFHVA-TPMDFDSKDPENEVIKPAINGVLNIINSCVK  430
             L +WKGV+EEEGSFD+AIAGCEGVFHVA TP+DF S DPENE+I+PA+ G+L+IINSC K
Sbjct  67    LRLWKGVLEEEGSFDDAIAGCEGVFHVAATPVDFVSDDPENEIIRPAVKGILSIINSCAK  126

Query  431   AKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWK  610
             AKTVKRLVFTSSA TL VQ   KPVYDE+ WSDLD IYAKKM GWMYFASK  AEKEAWK
Sbjct  127   AKTVKRLVFTSSAVTLIVQENPKPVYDESSWSDLDLIYAKKMPGWMYFASKTQAEKEAWK  186

Query  611   VTKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCE  790
               KEK+IDFISIIPPLV+G  I PT P S   ALS +TGN+AHY +IKQGQYVHLDDLCE
Sbjct  187   AAKEKQIDFISIIPPLVIGASIVPTVPLSFTIALSPVTGNEAHYFVIKQGQYVHLDDLCE  246

Query  791   AHIFLYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKK  970
             A IFL+EHPKAEGRFICSSH  TIH LA MI QNWPEYY+PSEFKGIEKDLPVV  SSKK
Sbjct  247   AQIFLFEHPKAEGRFICSSHDATIHDLAKMIRQNWPEYYVPSEFKGIEKDLPVVSLSSKK  306

Query  971   LQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTK  1072
             L DMGFQFKY+LEDMYR  IETLR K +LPYS K
Sbjct  307   LLDMGFQFKYTLEDMYREVIETLRNKCVLPYSIK  340



>gb|AHM27144.1| dihydroflavonol 4-reductase [Angelonia angustifolia]
Length=437

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/380 (66%), Positives = 310/380 (82%), Gaps = 2/380 (1%)
 Frame = +2

Query  92    LPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKG  271
             +P  VCVTGAAGFIGSWLV  LLQRGY++ ATVRDPGN KK+KHL +LPKADTNLT+WK 
Sbjct  17    VPATVCVTGAAGFIGSWLVMKLLQRGYNVRATVRDPGNLKKIKHLTQLPKADTNLTLWKA  76

Query  272   VMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRL  451
              + EE SFDEAI GC+GVFH+ATPM+FDSKDPENEVIKP I G+++II SC KAKTV+++
Sbjct  77    DLMEEASFDEAIEGCQGVFHLATPMEFDSKDPENEVIKPTIEGMMSIIRSCAKAKTVEKV  136

Query  452   VFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKI  631
             +FT+SAGTLNV+  QKP YDET WSDLDFIY+KKMTGWMYF SK LAEK+A +  K   I
Sbjct  137   IFTTSAGTLNVEEHQKPFYDETSWSDLDFIYSKKMTGWMYFVSKYLAEKQAVEAAKLNNI  196

Query  632   DFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYE  811
             +FISIIPP+VVGPFI P FPPSL+TALS ITGN+AHY+I+KQGQ+VHLDD+CEAHIFL+E
Sbjct  197   EFISIIPPVVVGPFINPAFPPSLVTALSPITGNEAHYTIMKQGQFVHLDDICEAHIFLFE  256

Query  812   HPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQ  991
             HPKA+GR+ICSSH  TI+ +A +I   WPEY +P EFKGI+KD+PVV FSSKKL  MGF+
Sbjct  257   HPKADGRYICSSHDATIYDIARLIRDKWPEYNVPMEFKGIDKDIPVVRFSSKKLTSMGFK  316

Query  992   FKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEKPTAIEQKQEAKTVPL  1171
             FKYSLEDMYRGAIET R+KGLLPYST   +  E+++ T+   +EK +  ++K   K V  
Sbjct  317   FKYSLEDMYRGAIETCREKGLLPYSTHNQSNGEKKESTLQ-SLEKHSDDQEKVLEKRVNG  375

Query  1172  K-PSAIEQKQETAVPLKLEE  1228
             +     E++++  +P++ E+
Sbjct  376   RLDKQFEEQKKELLPIREEK  395



>gb|ABY25287.1| dihydroflavonol 4-reductase C [Turbina oblongata]
Length=338

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/324 (79%), Positives = 277/324 (85%), Gaps = 1/324 (0%)
 Frame = +2

Query  110   VTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEEEG  289
             VTGAAG++GSWLV  LLQRGY +HATVRDPGNTKKVKHLLELPKA  NL +WKGV+EEEG
Sbjct  1     VTGAAGYVGSWLVMKLLQRGYVVHATVRDPGNTKKVKHLLELPKAKGNLRLWKGVLEEEG  60

Query  290   SFDEAIAGCEGVFHVA-TPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTSS  466
             SFD AIAGCEGVFHVA TP+DF S DPENE+I+PA+ G+ +IINSC KAKTVKRLVFTSS
Sbjct  61    SFDNAIAGCEGVFHVAGTPVDFVSNDPENEIIRPAVKGIQSIINSCAKAKTVKRLVFTSS  120

Query  467   AGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFISI  646
             A TL VQ   KPVYDE+ WSDLD IYA KM GWMYFASK  AEKEAWK  KEK+IDFISI
Sbjct  121   AVTLIVQEYPKPVYDESSWSDLDLIYANKMPGWMYFASKTQAEKEAWKAAKEKQIDFISI  180

Query  647   IPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKAE  826
             IPPL++GP I PT P SL  ALS +TGN+AHY +IKQGQYVHLDDLCEA IFL+EHPKAE
Sbjct  181   IPPLIIGPSILPTVPLSLSIALSPVTGNEAHYFVIKQGQYVHLDDLCEAQIFLFEHPKAE  240

Query  827   GRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYSL  1006
             GRFICSSH  TIH LA MI QNWPEYY+PSEFKGIEKDLPVV  SSKKL DMGFQFKY+L
Sbjct  241   GRFICSSHDATIHDLAKMIRQNWPEYYVPSEFKGIEKDLPVVSLSSKKLLDMGFQFKYTL  300

Query  1007  EDMYRGAIETLRKKGLLPYSTKEA  1078
             EDMYR  IETLRKK +LPYSTK A
Sbjct  301   EDMYRETIETLRKKRVLPYSTKPA  324



>gb|AEN69001.1| dihydroflavonol 4-reductase [Chrysanthemum x morifolium]
Length=374

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 244/327 (75%), Positives = 285/327 (87%), Gaps = 0/327 (0%)
 Frame = +2

Query  95    PPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGV  274
             P  VCVTGA+GFIGSWLV  LL+RGY + ATVRDPG+ KKVKHLLELPKA+TNLT+WK  
Sbjct  6     PAIVCVTGASGFIGSWLVMRLLERGYIVRATVRDPGDMKKVKHLLELPKAETNLTLWKAD  65

Query  275   MEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLV  454
             + +EGSFDEAI GC GVFHVATPMDF+SKDPENE+IKP I+GVL+II SC KAKTVK+LV
Sbjct  66    LAQEGSFDEAIEGCHGVFHVATPMDFESKDPENEIIKPTIDGVLSIIRSCAKAKTVKKLV  125

Query  455   FTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKID  634
             FTSSAGT+NVQ QQ PVYDE+ WSDLDFIY+KKMT WMYF SK LAEK AWK TKE  ID
Sbjct  126   FTSSAGTVNVQKQQVPVYDESHWSDLDFIYSKKMTAWMYFVSKTLAEKAAWKATKENNID  185

Query  635   FISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEH  814
             FISIIP LVVGPFI+P+FPPSL+TALSLITG ++HYSIIKQ QYVHLDDLCE+HI+LYE+
Sbjct  186   FISIIPTLVVGPFISPSFPPSLMTALSLITGAESHYSIIKQCQYVHLDDLCESHIYLYEN  245

Query  815   PKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQF  994
             PKA GR+ICSSH  TIH LA MI + WPEY +P++F+GI+ ++P+V FSSKKL DMGF+F
Sbjct  246   PKAAGRYICSSHDATIHQLAKMIKEKWPEYQVPTKFEGIDDEIPIVSFSSKKLTDMGFKF  305

Query  995   KYSLEDMYRGAIETLRKKGLLPYSTKE  1075
             KY LE+M+RGAI++ ++KGLLPYST E
Sbjct  306   KYDLEEMFRGAIKSCKEKGLLPYSTNE  332



>gb|ADC96612.1| dihydroflavonol 4-reductase [Chrysanthemum x morifolium]
Length=374

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/327 (75%), Positives = 284/327 (87%), Gaps = 0/327 (0%)
 Frame = +2

Query  95    PPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGV  274
             P  VCVTGA+GFIGSWLV  LL+RGY + ATVRDPG+ KKVKHLLELPKA+TNLT+WK  
Sbjct  6     PAIVCVTGASGFIGSWLVMRLLERGYIVRATVRDPGDMKKVKHLLELPKAETNLTLWKAD  65

Query  275   MEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLV  454
             +  EGSFDEAI GC GVFHVATPMDF+SKDPENE+IKP I+GVL+II SCVKAKTVK+LV
Sbjct  66    LALEGSFDEAIEGCHGVFHVATPMDFESKDPENEIIKPTIDGVLSIIRSCVKAKTVKKLV  125

Query  455   FTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKID  634
             FTSSAGT+NVQ QQ PVYDE+ WSDLDFIY+KKMT WMYF SK LAEK AWK TKE  ID
Sbjct  126   FTSSAGTVNVQKQQVPVYDESHWSDLDFIYSKKMTAWMYFVSKTLAEKAAWKATKENNID  185

Query  635   FISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEH  814
             FISIIP LVVGPFI+P+FPPSL+TALSLITG ++HYSI KQ QYVHLDDLCE+HI+LYE 
Sbjct  186   FISIIPTLVVGPFISPSFPPSLMTALSLITGAESHYSITKQCQYVHLDDLCESHIYLYEQ  245

Query  815   PKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQF  994
             PKAEGR+ICSSH  TIH LA MI + WPEY +P++F+GI+ ++P+V FSSKKL DMGF+F
Sbjct  246   PKAEGRYICSSHDATIHQLAKMIKEKWPEYQVPAKFEGIDDEIPIVSFSSKKLTDMGFKF  305

Query  995   KYSLEDMYRGAIETLRKKGLLPYSTKE  1075
             KY LE+M+RGAI++ ++KGLLPYST E
Sbjct  306   KYDLEEMFRGAIKSCKEKGLLPYSTNE  332



>gb|ACK57789.1| dihydroflavonol reductase [Centaurea maculosa]
Length=344

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 243/325 (75%), Positives = 283/325 (87%), Gaps = 0/325 (0%)
 Frame = +2

Query  95    PPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGV  274
             P  VCVTGAAGFIGSWLV  LL+RGY + ATVRDPGN KKVKHL++LPKA+TNLT+WK  
Sbjct  6     PTTVCVTGAAGFIGSWLVMRLLERGYIVRATVRDPGNMKKVKHLIQLPKAETNLTLWKAD  65

Query  275   MEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLV  454
             + +EGSFDEA+ GC GVFHVATPMDF+SKDPENE+IKP I GVL+II SCVKAKTVK+LV
Sbjct  66    LTQEGSFDEAVEGCHGVFHVATPMDFESKDPENEIIKPTIQGVLSIIRSCVKAKTVKKLV  125

Query  455   FTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKID  634
             +TSSAGT+NV+  Q PVYDE+ WSDLDFIY+KKMT WMYF SK LAEK AWK T E  ID
Sbjct  126   YTSSAGTVNVEEHQLPVYDESNWSDLDFIYSKKMTAWMYFVSKTLAEKAAWKATTENNID  185

Query  635   FISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEH  814
             FISIIP LVVGPFITP+FPPSLITALSLI G ++HYSIIKQGQYVHLDDLCE+HI+LYEH
Sbjct  186   FISIIPTLVVGPFITPSFPPSLITALSLINGAESHYSIIKQGQYVHLDDLCESHIYLYEH  245

Query  815   PKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQF  994
             PKA GR+ICSSH  TIH LA M+ + WPEY+IP++F GI+K+ P+V FSSKKL +MGF+F
Sbjct  246   PKATGRYICSSHDATIHQLAKMLKEKWPEYHIPNQFPGIDKEPPIVSFSSKKLTEMGFEF  305

Query  995   KYSLEDMYRGAIETLRKKGLLPYST  1069
             KY+LEDM++GAI++ R+KGLLPYST
Sbjct  306   KYNLEDMFKGAIDSCREKGLLPYST  330



>dbj|BAA36407.1| dihydroflavonol 4-reductase [Ipomoea purpurea]
Length=356

 Score =   531 bits (1367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/335 (77%), Positives = 283/335 (84%), Gaps = 3/335 (1%)
 Frame = +2

Query  77    GNHPLLP-PKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKA-DT  250
             G+ P LP PKVCVTGAAG++GSWLV  LLQRGY +HATVRDPGNTKKVKHLLELPKA + 
Sbjct  6     GHAPTLPAPKVCVTGAAGYVGSWLVMKLLQRGYVVHATVRDPGNTKKVKHLLELPKAAEG  65

Query  251   NLTIWKGVMEEEGSFDEAIAGCEGVFHVA-TPMDFDSKDPENEVIKPAINGVLNIINSCV  427
              L +WKGV+EEEGSFD+AIAGCEGVFHVA TP+DF S DP+NE+I+PA+ G+L+IINSC 
Sbjct  66    KLRLWKGVLEEEGSFDDAIAGCEGVFHVAATPVDFVSDDPQNEIIRPAVKGILSIINSCA  125

Query  428   KAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAW  607
             KAKTVKRLVFTSSA TL VQ   KPVYDE+ WSDLD IYAKKM GWMYFASK  AEKEAW
Sbjct  126   KAKTVKRLVFTSSAVTLIVQGNPKPVYDESSWSDLDLIYAKKMPGWMYFASKTQAEKEAW  185

Query  608   KVTKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLC  787
             K  KEK+IDFISIIPPLV+G  I PT P S   ALS +TGN+AHY +IKQGQYVHLDDLC
Sbjct  186   KAAKEKQIDFISIIPPLVIGTSIVPTVPLSFTIALSPVTGNEAHYFVIKQGQYVHLDDLC  245

Query  788   EAHIFLYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSK  967
             EA IFL+EHPKAEGRFICSSH  TIH LA MI QNWPEYY+PSEFKGIEKDL VV  SSK
Sbjct  246   EAQIFLFEHPKAEGRFICSSHDATIHDLAKMIRQNWPEYYVPSEFKGIEKDLQVVSLSSK  305

Query  968   KLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTK  1072
             KL DMGFQFKY+LEDMYR  IETLR K +LPYS K
Sbjct  306   KLLDMGFQFKYTLEDMYREVIETLRNKCVLPYSIK  340



>gb|AIY51701.1| dihydroflavonol 4-reductase [Penstemon barbatus]
Length=383

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/376 (68%), Positives = 310/376 (82%), Gaps = 5/376 (1%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGAAGFIGSWLV  LL+RGY + ATVRDP N KKVKHL+ELPKADTNLT+WK  +  
Sbjct  12    VCVTGAAGFIGSWLVMRLLERGYIVRATVRDPENLKKVKHLIELPKADTNLTLWKADLTV  71

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             +GSFDEAI GCEGVFH+ATPM+FDS DPENEVIKP I+G+L+II SCVKAKTVKRL+FT+
Sbjct  72    DGSFDEAIQGCEGVFHLATPMEFDSPDPENEVIKPTIDGMLSIIRSCVKAKTVKRLIFTT  131

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGTLNV+  QKP YDET WSDLDF+Y+KKMTGWMYF SKILAEK A    KE  I+FIS
Sbjct  132   SAGTLNVEEHQKPEYDETSWSDLDFMYSKKMTGWMYFVSKILAEKAALGPAKENNIEFIS  191

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIPP+VVGP ITPTFPPSLITALS ITGN+AHYSIIKQGQ+VHLDD+ EAHIFL+E+PKA
Sbjct  192   IIPPVVVGPSITPTFPPSLITALSPITGNEAHYSIIKQGQFVHLDDISEAHIFLFEYPKA  251

Query  824   E-GRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKY  1000
             E GR+ICSSH  TI+ +A++I + WPEYYIP+EF+GI+KD+PVV FSSKKL DMGF+FKY
Sbjct  252   EGGRYICSSHDATIYDIANLIKEKWPEYYIPTEFEGIDKDIPVVRFSSKKLMDMGFKFKY  311

Query  1001  SLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEKPTAIEQKQEAKTVPLKPS  1180
             +LEDM+R AIE+ R+KGL PYST+  +   EE+ET +  +EK + ++ K+ +     K +
Sbjct  312   TLEDMFREAIESCREKGLFPYSTQNRSN-GEEKETDSKSLEKHSDVQDKKLSAITNEKHA  370

Query  1181  AIEQKQETAVPLKLEE  1228
              +   QE A+ L + +
Sbjct  371   NV---QENALLLDIAQ  383



>gb|ACB56920.1| dihydroflavonol-4-reductase [Pilosella officinarum]
Length=354

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/339 (75%), Positives = 286/339 (84%), Gaps = 1/339 (0%)
 Frame = +2

Query  95    PPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGV  274
             P  VCVTGAAGFIGSWLV  LL+RGY +HATVRDP N KKVKHLLELPKA+TNLT+WKG 
Sbjct  7     PATVCVTGAAGFIGSWLVMRLLERGYIVHATVRDPDNIKKVKHLLELPKAETNLTLWKGD  66

Query  275   MEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLV  454
             + EEGSFDEAI GCEGVFHVATPMDF+SKDPENE+IKP I GVL+II SC KAKTVKRLV
Sbjct  67    LTEEGSFDEAIEGCEGVFHVATPMDFESKDPENEIIKPTIEGVLSIIRSCAKAKTVKRLV  126

Query  455   FTSSAGTLNVQP-QQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKI  631
             FTSSAGT+NV    Q PVYDE+ WSDLDFI +KKMT WMYF SKILAEKEAWK TKE  I
Sbjct  127   FTSSAGTVNVHDGSQLPVYDESHWSDLDFINSKKMTAWMYFVSKILAEKEAWKATKENNI  186

Query  632   DFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYE  811
             DFISIIP LVVGPFI P FPPSLITALSLI G ++HYSIIKQGQYVHLDDLCE+HI+LYE
Sbjct  187   DFISIIPTLVVGPFINPAFPPSLITALSLIIGEESHYSIIKQGQYVHLDDLCESHIYLYE  246

Query  812   HPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQ  991
             +P+A GR+ICSSH  TIH LA+MI + WPEY IP++F GI+ +LP V FSSKKL DMGF+
Sbjct  247   NPEANGRYICSSHDATIHQLANMIKEKWPEYDIPTKFPGIDDELPTVSFSSKKLIDMGFK  306

Query  992   FKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETV  1108
             FKY+LE+M++GAI++ R+KGLLPYST +   I    E V
Sbjct  307   FKYNLEEMFKGAIDSCREKGLLPYSTIKKKLITLNDEHV  345



>dbj|BAA12736.1| dihydroflavonol-4-reductase [Gentiana triflora]
Length=359

 Score =   530 bits (1365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/321 (77%), Positives = 280/321 (87%), Gaps = 0/321 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+G+IGSWL   LL+RGY + ATVRDPGN KKV+HLLELPKA TNLT+ K  + E
Sbjct  12    VCVTGASGYIGSWLAMRLLERGYTVRATVRDPGNLKKVQHLLELPKASTNLTLLKADLTE  71

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDP+NEVIKP I+G L+II SCVKAKTVK+LVFTS
Sbjct  72    EGSFDEAIHGCHGVFHVATPMDFESKDPKNEVIKPTIDGFLSIIRSCVKAKTVKKLVFTS  131

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT++VQ QQKPVYDE  WSDLDFI + KMTGWMYF SKILAEK AW+VTK   I FIS
Sbjct  132   SAGTVDVQEQQKPVYDENDWSDLDFINSTKMTGWMYFVSKILAEKAAWEVTKANDIGFIS  191

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LVVGPFIT TFPPSLITALSLITGN+AHY IIKQGQ+VHLDDLCEAHIFLYEHP+A
Sbjct  192   IIPTLVVGPFITTTFPPSLITALSLITGNEAHYGIIKQGQFVHLDDLCEAHIFLYEHPEA  251

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSSH TTIH LA MI QNWPEYYIP++ KGI++D+PVV FSS KL D+GFQ+KY+
Sbjct  252   EGRYICSSHDTTIHDLAKMIRQNWPEYYIPTKLKGIDEDIPVVSFSSNKLIDLGFQYKYT  311

Query  1004  LEDMYRGAIETLRKKGLLPYS  1066
             LEDM+RGAI+T ++K +LP S
Sbjct  312   LEDMFRGAIDTCKEKRMLPLS  332



>dbj|BAA19658.1| dihydroflavonol 4-reductase [Perilla frutescens]
Length=456

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/357 (69%), Positives = 297/357 (83%), Gaps = 3/357 (1%)
 Frame = +2

Query  95    PPK--VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWK  268
             PP   VCVTGA+GFIGSW++  LL+RGY + ATVRDPG++KKVKHL+ELP ADTNLT+W+
Sbjct  10    PPATTVCVTGASGFIGSWIIMRLLERGYVVRATVRDPGDSKKVKHLIELPGADTNLTLWR  69

Query  269   GVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKR  448
               M  EGS+DEA+ GCE VFH+ATPMDF+S DPENEVIKP ++G+L+I+ SC KAKTVK+
Sbjct  70    ADMNIEGSYDEAVQGCECVFHMATPMDFESDDPENEVIKPTVDGMLSIMRSCTKAKTVKK  129

Query  449   LVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKK  628
             L+FT+SAGTLNV+  QKPVY+E  WSDLDFIY+KKMTGWMYF SKILAEKEA K  KE  
Sbjct  130   LIFTNSAGTLNVEEHQKPVYNEANWSDLDFIYSKKMTGWMYFVSKILAEKEAMKAAKESN  189

Query  629   IDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLY  808
             I+FISIIPP+VVGPF  PTFPPSLITALS ITGN+AHYSIIKQGQ+VH+DDLCEAHIFL+
Sbjct  190   INFISIIPPVVVGPFFMPTFPPSLITALSPITGNEAHYSIIKQGQFVHVDDLCEAHIFLF  249

Query  809   EHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGF  988
             EHP AEGR+ICSSH  TI+ +A MI +NWPEY++P+EF+GI KD+ VV FSSKKL DMGF
Sbjct  250   EHPAAEGRYICSSHDATIYDIAKMIGENWPEYHVPTEFEGIHKDIAVVSFSSKKLVDMGF  309

Query  989   QFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEKPTAIEQKQEAK  1159
              FKY+LEDMYRGAIE+ R+KG+LP+ST +     E +E+++   EK + I    E K
Sbjct  310   SFKYTLEDMYRGAIESCREKGMLPFST-QIHTNGENKESLSNSQEKHSQINTNGENK  365



>sp|P14721.1|DFRA_ANTMA RecName: Full=Dihydroflavonol-4-reductase; Short=DFR; AltName: 
Full=Dihydrokaempferol 4-reductase [Antirrhinum majus]
 emb|CAA33543.1| unnamed protein product [Antirrhinum majus]
Length=446

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/349 (72%), Positives = 290/349 (83%), Gaps = 2/349 (1%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGAAGFIGSWLV  LL+RGY + ATVRDPGN KKVKHL+ELPKADTNLT+WK  M  
Sbjct  20    VCVTGAAGFIGSWLVMRLLERGYTVRATVRDPGNMKKVKHLIELPKADTNLTLWKADMTV  79

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GCEGVFH+AT M+FDS DPENEVIKP I+G+LNII SCV+AKTVK+ +FT+
Sbjct  80    EGSFDEAIQGCEGVFHLATSMEFDSVDPENEVIKPTIDGMLNIIKSCVQAKTVKKFIFTT  139

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             S GT+NV+  QKPVYDET  SD+DFI +KKMTGWMYF SKILAEK   +  KE  IDFIS
Sbjct  140   SGGTVNVEEHQKPVYDETDSSDMDFINSKKMTGWMYFVSKILAEKAGMEAAKENNIDFIS  199

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIPPLVVGPFI PTFPPSLITALS ITGN+AHYSIIKQ QYVHLDDLCE HIFL+E+PKA
Sbjct  200   IIPPLVVGPFIMPTFPPSLITALSPITGNEAHYSIIKQCQYVHLDDLCEGHIFLFEYPKA  259

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSSH  TI+ +A +IT+NWPEY+IP EF+GI+KD+PVV FSSKK+  MGF FKY+
Sbjct  260   EGRYICSSHDATIYDIAKLITENWPEYHIPDEFEGIDKDIPVVSFSSKKMIGMGFIFKYT  319

Query  1004  LEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEKPTAIEQKQ  1150
             LEDM RGAI+T R+KG+LPYSTK      +E+E +   +E    I+ K+
Sbjct  320   LEDMVRGAIDTCREKGMLPYSTKNNKG--DEKEPILNSLENNYNIQDKE  366



>gb|AIR09398.1| dihydroflavonol 4-reductase [Angelonia angustifolia]
Length=438

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/376 (66%), Positives = 307/376 (82%), Gaps = 2/376 (1%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVT AAGFIGSWLV  LLQRGY++ ATVRDPGN KK+KHL +LPKADTNLT+WK  + E
Sbjct  22    VCVTRAAGFIGSWLVMKLLQRGYNVRATVRDPGNLKKIKHLTQLPKADTNLTLWKADLME  81

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             E SFDEAI GC+GVFH+ATPM+FDSKDPENEVIKP I G+++II SC KAKTV++++FT+
Sbjct  82    EASFDEAIEGCQGVFHLATPMEFDSKDPENEVIKPTIEGMMSIIRSCAKAKTVEKVIFTT  141

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGTLNV+  QKP YDET WSDLDFIY+KKMTGWMYF SK LAEK+A +  K   I+FIS
Sbjct  142   SAGTLNVEEHQKPFYDETSWSDLDFIYSKKMTGWMYFVSKYLAEKQAVEAAKLNNIEFIS  201

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIPP+VVGPFI P FPPSL+TALS ITGN+AHY+I+KQGQ+VHLDD+CEAHIFL+EHPKA
Sbjct  202   IIPPVVVGPFINPAFPPSLVTALSPITGNEAHYTIMKQGQFVHLDDICEAHIFLFEHPKA  261

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             +GR+ICSSH  TI+ +A +I   WPEY +P EFKGI+KD+PVV FSSKKL  MGF+FKYS
Sbjct  262   DGRYICSSHDATIYDIARLIRDKWPEYNVPMEFKGIDKDIPVVRFSSKKLTSMGFKFKYS  321

Query  1004  LEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEKPTAIEQKQEAKTVPLK-PS  1180
             LEDMYRGAIET R+KGLLPYST   +  E+++ T+   +EK +  ++K   K V  +   
Sbjct  322   LEDMYRGAIETCREKGLLPYSTHNQSNGEKKESTLQ-SLEKHSDDQEKVLEKRVNGRLDK  380

Query  1181  AIEQKQETAVPLKLEE  1228
               E++++  +P++ E+
Sbjct  381   QFEEQKKELLPIREEK  396



>gb|AIY22763.1| dihydroflavonol 4-reductase [Iochroma calycinum]
Length=370

 Score =   527 bits (1358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/341 (73%), Positives = 280/341 (82%), Gaps = 11/341 (3%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGAAGFIGSWLV  LL+RGY++HATVRDP N KKVKHLLELPKADTNLT+WK  +  
Sbjct  19    VCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPKADTNLTLWKADLTV  78

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC+GVFHVATPMDF+S DPENEVIKP + G+L+II SC KA TVKRLVFTS
Sbjct  79    EGSFDEAIQGCQGVFHVATPMDFESNDPENEVIKPTVRGMLSIIESCAKANTVKRLVFTS  138

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGTL+VQ  QK  YDET WSDLDFIYAKKMTGWMYF SKILAEK A +  K+  IDFIS
Sbjct  139   SAGTLDVQEHQKLFYDETSWSDLDFIYAKKMTGWMYFVSKILAEKAAMEEAKKNNIDFIS  198

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIPPLVVGPFITPTFPPSLITALS+IT           GQYVHLDDLCEAHIFLYEH KA
Sbjct  199   IIPPLVVGPFITPTFPPSLITALSIIT-----------GQYVHLDDLCEAHIFLYEHTKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGRFICSSHH  I+ +A M+ + WPEYY+P+EFKGI+KDLP+V FSSKKL DMGFQFKY+
Sbjct  248   EGRFICSSHHAIIYDVAKMVREKWPEYYVPTEFKGIDKDLPIVSFSSKKLMDMGFQFKYT  307

Query  1004  LEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEK  1126
             LEDMY+GAIET R+K LLP+ST   A   + +E + +  E 
Sbjct  308   LEDMYKGAIETCRQKQLLPFSTGSTADNGQNKEAIPISTEN  348



>gb|ABY25289.1| dihydroflavonol 4-reductase C [Merremia umbellata]
Length=344

 Score =   526 bits (1355),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/325 (78%), Positives = 280/325 (86%), Gaps = 1/325 (0%)
 Frame = +2

Query  110   VTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEEEG  289
             VTGAAG++GSWLV  LLQRGY +HATVRDPGNT KVKHLLELPKADTNL +WKGV+EEEG
Sbjct  1     VTGAAGYVGSWLVMKLLQRGYIVHATVRDPGNTSKVKHLLELPKADTNLRLWKGVLEEEG  60

Query  290   SFDEAIAGCEGVFHVA-TPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTSS  466
             SFDEAIAGCEGVFHVA T +D  S DPENE+I+PAI GVLNIINSC KAKTVKRLV+TSS
Sbjct  61    SFDEAIAGCEGVFHVAATGVDIVSDDPENELIRPAIKGVLNIINSCAKAKTVKRLVYTSS  120

Query  467   AGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFISI  646
             A TL VQ   KPVYDE+ WSDLD +YA KM GW+YFASK LAEKEAWK  KEKKIDFISI
Sbjct  121   AVTLIVQGNPKPVYDESSWSDLDLMYAVKMPGWIYFASKTLAEKEAWKAAKEKKIDFISI  180

Query  647   IPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKAE  826
             +PPLV+GP I PTFP SL  ALSL+TGN+ +Y  IKQGQ+VHLDDLCEA IFL EHP+AE
Sbjct  181   LPPLVIGPSIMPTFPLSLNMALSLVTGNEDYYFSIKQGQFVHLDDLCEAQIFLLEHPQAE  240

Query  827   GRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYSL  1006
             GRFICSSH  TIH LA +I +NWPEYY+PSEFKGI+KDLP+V  SSKK+Q +GFQFKY+L
Sbjct  241   GRFICSSHDATIHDLAKIIRENWPEYYVPSEFKGIDKDLPIVSLSSKKIQGLGFQFKYTL  300

Query  1007  EDMYRGAIETLRKKGLLPYSTKEAA  1081
             EDMYR AIETLRKK LLPYSTK A+
Sbjct  301   EDMYRDAIETLRKKRLLPYSTKPAS  325



>emb|CAA70345.1| dihydroflavonol reductase [Forsythia x intermedia]
Length=371

 Score =   526 bits (1356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/332 (76%), Positives = 279/332 (84%), Gaps = 0/332 (0%)
 Frame = +2

Query  86    PLLPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIW  265
             PL    VCVTGA+GFIGSWLV  LL+RGY + AT RDP N +KVKHLLELP+ADTNLT+W
Sbjct  7     PLPATTVCVTGASGFIGSWLVMRLLERGYFVRATARDPENKQKVKHLLELPRADTNLTLW  66

Query  266   KGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVK  445
             K  M  EGSFDEAI GCEGVFHVATPMDF+SKDPENEVIKP I G L++I SC KAKTVK
Sbjct  67    KADMTVEGSFDEAIQGCEGVFHVATPMDFESKDPENEVIKPTIEGFLSLIRSCTKAKTVK  126

Query  446   RLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEK  625
             R+VFTSSAGT+NV+  QK VYDET +SDL+FIY+KKMTGWMYFASKILAEK AW+  KE 
Sbjct  127   RIVFTSSAGTVNVEEHQKSVYDETDYSDLNFIYSKKMTGWMYFASKILAEKVAWEAAKEN  186

Query  626   KIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFL  805
              I FISIIP LVVGPFI PTFPPSLITALS ITGN+AHYSII Q QYVHLDDLCEAHIFL
Sbjct  187   SIGFISIIPTLVVGPFIMPTFPPSLITALSPITGNEAHYSIIDQCQYVHLDDLCEAHIFL  246

Query  806   YEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMG  985
             YE+P AEGR+ICSSH  TI+ +A MI   WP+Y IP+EF+GI KD+PVV FSSKKL  MG
Sbjct  247   YEYPNAEGRYICSSHDATIYDVAKMIRDKWPKYDIPTEFEGIGKDIPVVSFSSKKLIGMG  306

Query  986   FQFKYSLEDMYRGAIETLRKKGLLPYSTKEAA  1081
             F FKY+LEDMYRGAIET R+KGLLPYST+  A
Sbjct  307   FTFKYTLEDMYRGAIETCREKGLLPYSTRNQA  338



>gb|ABK88310.2| dihydroflavonol 4-reductase [Chrysanthemum x morifolium]
Length=374

 Score =   526 bits (1356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 243/327 (74%), Positives = 283/327 (87%), Gaps = 0/327 (0%)
 Frame = +2

Query  95    PPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGV  274
             P  VCVTGA+GFIGSWLV  LL+RGY + ATVRDPG+ KKVKHLLELPKA+TNLT+WK  
Sbjct  6     PAIVCVTGASGFIGSWLVMRLLERGYIVRATVRDPGDMKKVKHLLELPKAETNLTLWKAD  65

Query  275   MEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLV  454
             +  EGSFDEAI GC GVFHVATPMDF+SKDPENE+IKP I GVL+II SCVKAKTVK+LV
Sbjct  66    LALEGSFDEAIEGCHGVFHVATPMDFESKDPENEIIKPTIEGVLSIIRSCVKAKTVKKLV  125

Query  455   FTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKID  634
             FTSSAGT+NVQ QQ PVYDE+ WSDLDFIY+KKMT WMYF S+ LAEK AWK TKE  ID
Sbjct  126   FTSSAGTVNVQKQQVPVYDESHWSDLDFIYSKKMTAWMYFVSETLAEKAAWKATKENNID  185

Query  635   FISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEH  814
             FISIIP LVVGPFI+P+FPPSL+TALSLITG ++HYSIIKQ Q VHLDDLCE+HI+LYE+
Sbjct  186   FISIIPTLVVGPFISPSFPPSLMTALSLITGAESHYSIIKQCQCVHLDDLCESHIYLYEN  245

Query  815   PKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQF  994
             PKA GR+ICSSH  TIH LA MI + WPEY +P++F+GI+ ++P+V FSSKKL DMGF+F
Sbjct  246   PKAAGRYICSSHDATIHQLAKMIKEKWPEYQVPAKFEGIDDEIPIVSFSSKKLTDMGFKF  305

Query  995   KYSLEDMYRGAIETLRKKGLLPYSTKE  1075
             KY LE+M+RGAI++ ++KGLLPYST E
Sbjct  306   KYDLEEMFRGAIKSCKEKGLLPYSTNE  332



>gb|AER40962.1| dihydroflavonol 4-reductase [Saussurea involucrata]
Length=342

 Score =   525 bits (1352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 240/325 (74%), Positives = 282/325 (87%), Gaps = 0/325 (0%)
 Frame = +2

Query  95    PPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGV  274
             P  VCVTGAAGFIGSWLV  LLQRGY + ATVRDPGN KKV HL++LPKA+TNLT+WK  
Sbjct  6     PTTVCVTGAAGFIGSWLVMRLLQRGYTVRATVRDPGNMKKVNHLIQLPKAETNLTLWKAD  65

Query  275   MEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLV  454
             + +EGSFDEA+ GC GVFHVATPMDF+SKDPENE+IKP I GVL+II SCVKAKTVK+LV
Sbjct  66    LTQEGSFDEAVEGCHGVFHVATPMDFESKDPENEIIKPTIQGVLSIIRSCVKAKTVKKLV  125

Query  455   FTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKID  634
             FTSSAGT+NVQ  Q PVY+E+ WSDLDFIY+KKMT WMYF SK LAEK AW+ TKE  I+
Sbjct  126   FTSSAGTVNVQEHQLPVYNESDWSDLDFIYSKKMTAWMYFVSKTLAEKAAWEATKENNIE  185

Query  635   FISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEH  814
             FISIIP LVVGPFITP+FPPSLITALSLI G ++HYSIIKQGQYVHLDDLCE HI+LYE+
Sbjct  186   FISIIPTLVVGPFITPSFPPSLITALSLINGAESHYSIIKQGQYVHLDDLCECHIYLYEN  245

Query  815   PKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQF  994
             P+A+GR+ICSSH  TIH LA M+ + WPEY++P++F GI+K+ P+V FSSKKL +MGF+F
Sbjct  246   PRAKGRYICSSHDATIHQLARMMKKKWPEYHVPNQFPGIDKEPPIVSFSSKKLTEMGFEF  305

Query  995   KYSLEDMYRGAIETLRKKGLLPYST  1069
             KY LEDM++GAI++ R+KGLLPYST
Sbjct  306   KYDLEDMFKGAIDSCREKGLLPYST  330



>gb|ABQ97018.1| dihydroflavonol 4-reductase [Saussurea medusa]
 gb|ABS11263.1| dihydroflavonol 4-reductase [Saussurea medusa]
Length=342

 Score =   524 bits (1349),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 242/325 (74%), Positives = 280/325 (86%), Gaps = 0/325 (0%)
 Frame = +2

Query  95    PPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGV  274
             P  VCVTGAAGFIGSWLV  LLQRGY + ATVRDPGN KKV HL++LPKA TNLT+WK  
Sbjct  6     PTTVCVTGAAGFIGSWLVMKLLQRGYTVRATVRDPGNMKKVNHLIQLPKAKTNLTLWKAD  65

Query  275   MEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLV  454
             + +EGSFDEAI GC GVFHVATPMDF+SKDPENE+IKP I GVL+II SCVKAKTVK+LV
Sbjct  66    LTQEGSFDEAIEGCHGVFHVATPMDFESKDPENEIIKPTIEGVLSIIRSCVKAKTVKKLV  125

Query  455   FTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKID  634
             FTSSAGT+NVQ  Q PVY+E  WSDLDFIY+KKMT WMYF SK LAEK AW+ TKE  I+
Sbjct  126   FTSSAGTVNVQEHQLPVYNELDWSDLDFIYSKKMTAWMYFVSKTLAEKAAWEATKENNIE  185

Query  635   FISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEH  814
             FISIIP LVVGPFITP+FPPSLITALSLI G ++HYSIIKQGQYVHLDDLCE HI+LYE+
Sbjct  186   FISIIPTLVVGPFITPSFPPSLITALSLINGAESHYSIIKQGQYVHLDDLCECHIYLYEN  245

Query  815   PKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQF  994
             PKA+GR+ICSSH  TIH LA M+ + WPEY++P++F GI+K+ P+V FSSKKL +MGF+F
Sbjct  246   PKAKGRYICSSHDATIHQLARMMKKKWPEYHVPNQFPGIDKEPPIVSFSSKKLTEMGFEF  305

Query  995   KYSLEDMYRGAIETLRKKGLLPYST  1069
             KY LEDM++GAI++ R+KGLLPYST
Sbjct  306   KYDLEDMFKGAIDSCREKGLLPYST  330



>gb|ABS84871.1| dihydroflavonol-4-reductase [Linaria sp. JA-2007]
Length=413

 Score =   526 bits (1356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/389 (67%), Positives = 310/389 (80%), Gaps = 14/389 (4%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA GFIGSWLV  LL+RGY I ATVRDPGN  KVKHL ELPKADTNLT+WK  M  
Sbjct  32    VCVTGANGFIGSWLVMRLLERGYTIRATVRDPGNEGKVKHLKELPKADTNLTLWKADMTV  91

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GCEGVFH+AT M+F+S DPENEVIKP I G+LNII SCVKAKTVK+ +FT+
Sbjct  92    EGSFDEAIQGCEGVFHLATSMEFESLDPENEVIKPTIEGMLNIIRSCVKAKTVKKFIFTT  151

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             S GT+NV+  QKPVYDET  SDLDFIY+KKMTGWMYF SKILAEK+  +  K   IDFIS
Sbjct  152   SGGTVNVEEHQKPVYDETDSSDLDFIYSKKMTGWMYFVSKILAEKDGMEAAKASNIDFIS  211

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIPPLVVGPFI PTFPPSLITALS ITGN+AHYSIIKQGQ+VHLDDLCE HIFL+E+PKA
Sbjct  212   IIPPLVVGPFIMPTFPPSLITALSPITGNEAHYSIIKQGQFVHLDDLCEGHIFLFEYPKA  271

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSSH  TI+ LA +I +NWPEY IP EF+GI+K++PVV FSSKK+  MGF+FKY+
Sbjct  272   EGRYICSSHDATIYDLARLIRENWPEYQIPDEFEGIDKNIPVVSFSSKKMLGMGFKFKYT  331

Query  1004  LEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEKPTAIEQKQEAKTVPLKPSA  1183
             L DM++GAI+T R+KGLLPYSTK  + + EE+E +   +E  T  + K++     L+PS 
Sbjct  332   LLDMFKGAIDTCREKGLLPYSTK--SNMGEEKEPILSSLENNTNTKDKEQ-----LQPS-  383

Query  1184  IEQK----QETAVPLKLEEEPTAIEQKQE  1258
              E+K    QE A+   +E++  ++ QK E
Sbjct  384   -EEKHANGQENALLSDIEKD-HSLSQKIE  410



>gb|AIY51700.1| dihydroflavonol 4-reductase [Penstemon neomexicanus]
Length=383

 Score =   524 bits (1350),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/350 (71%), Positives = 297/350 (85%), Gaps = 2/350 (1%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGAAGFIGSWLV  LL+RGY + ATVRDP N KKVKHL+ELPKADTNLT+WK  +  
Sbjct  12    VCVTGAAGFIGSWLVMRLLERGYIVRATVRDPENLKKVKHLIELPKADTNLTLWKADLTV  71

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             +GSFDEAI GCEGVFH+ATPM+FDS DPENEVIKP I+G+L+II SCVKAKTVK+L+FT+
Sbjct  72    DGSFDEAIQGCEGVFHLATPMEFDSLDPENEVIKPTIDGMLSIIRSCVKAKTVKKLIFTT  131

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGTLNV+  +KP YDET WSDLDFIY+KKMTGWMYF SK LAEK A    KE  I+FIS
Sbjct  132   SAGTLNVEEHKKPEYDETSWSDLDFIYSKKMTGWMYFVSKFLAEKAASGPAKENNIEFIS  191

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIPP+VVGP IT TFPPSLITALS ITGN+AHYSIIKQGQ+VHLDD+ EAHIFL+E+PKA
Sbjct  192   IIPPVVVGPSITQTFPPSLITALSPITGNEAHYSIIKQGQFVHLDDISEAHIFLFEYPKA  251

Query  824   E-GRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKY  1000
             E GR+ICSSH  TI+ +A +I + WPEYYIP+EF+GI+KD+PVV FSSKKL DMGF+FKY
Sbjct  252   EGGRYICSSHDATIYDIAKLIKEKWPEYYIPTEFEGIDKDIPVVRFSSKKLMDMGFKFKY  311

Query  1001  SLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEKPTAIEQKQ  1150
             +LEDM+R AIE+ R+KGLLPYST+  +   EE+ET +  +EK + ++ K+
Sbjct  312   TLEDMFREAIESCREKGLLPYSTQNRSN-GEEKETDSKSLEKHSDVQDKK  360



>sp|P51105.1|DFRA_GERHY RecName: Full=Dihydroflavonol-4-reductase; Short=DFR; AltName: 
Full=Dihydrokaempferol 4-reductase [Gerbera hybrid cultivar]
 emb|CAA78930.1| dihydroflavonol-4-reductase [Gerbera hybrid cultivar]
Length=366

 Score =   523 bits (1348),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/325 (75%), Positives = 279/325 (86%), Gaps = 0/325 (0%)
 Frame = +2

Query  95    PPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGV  274
             P  VCVTGAAGFIGSWLV  LL+RGY +HATVRDPG+ KKVKHLLELPKA TNL +WK  
Sbjct  6     PATVCVTGAAGFIGSWLVMRLLERGYVVHATVRDPGDLKKVKHLLELPKAQTNLKLWKAD  65

Query  275   MEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLV  454
             + +EGSFDEAI GC GVFH+ATPMDF+SKDPENE+IKP I GVL+II SCVKAKTVK+LV
Sbjct  66    LTQEGSFDEAIQGCHGVFHLATPMDFESKDPENEIIKPTIEGVLSIIRSCVKAKTVKKLV  125

Query  455   FTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKID  634
             FTSSAGT+N Q +Q  VYDE+ WSDLDFIY+KKMT WMYF SK LAEK AW  TK   I 
Sbjct  126   FTSSAGTVNGQEKQLHVYDESHWSDLDFIYSKKMTAWMYFVSKTLAEKAAWDATKGNNIS  185

Query  635   FISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEH  814
             FISIIP LVVGPFIT TFPPSL+TALSLITGN+AHYSIIKQGQYVHLDDLCE HI+LYE+
Sbjct  186   FISIIPTLVVGPFITSTFPPSLVTALSLITGNEAHYSIIKQGQYVHLDDLCECHIYLYEN  245

Query  815   PKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQF  994
             PKA+GR+ICSSH  TIH LA +I   WPEYYIP++F GI+++LP+V FSSKKL D GF+F
Sbjct  246   PKAKGRYICSSHDATIHQLAKIIKDKWPEYYIPTKFPGIDEELPIVSFSSKKLIDTGFEF  305

Query  995   KYSLEDMYRGAIETLRKKGLLPYST  1069
             KY+LEDM++GAI+T R+KGLLPYST
Sbjct  306   KYNLEDMFKGAIDTCREKGLLPYST  330



>gb|AHJ80979.1| dihydroflavanone reductase [Erythranthe lewisii]
Length=463

 Score =   526 bits (1354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/369 (69%), Positives = 297/369 (80%), Gaps = 4/369 (1%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGAAGFIGSW+V  LL+RGY + ATVRDP N  KVKHL+ LPKADTNLT+WK  M  
Sbjct  15    VCVTGAAGFIGSWIVMRLLERGYIVRATVRDPENMSKVKHLVGLPKADTNLTLWKADMNI  74

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGS+DEA+ GCE VFH+ATPMDF+S+DPENEVIKP I G+++II SC KAKTVK+L+FT+
Sbjct  75    EGSYDEAVQGCECVFHMATPMDFESEDPENEVIKPTIEGMMSIIRSCAKAKTVKKLIFTN  134

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGTLNV+P QKPVYDET WSDLDFI + KMTGWMYF SKILAEKEA K  KE  I+FIS
Sbjct  135   SAGTLNVEPNQKPVYDETNWSDLDFILSTKMTGWMYFVSKILAEKEAMKAAKESNINFIS  194

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIPP+VVGPFI PT PPSLITALS ITGN+AHYSIIKQGQ+VH+DDLCEAHIFL+E P A
Sbjct  195   IIPPVVVGPFIMPTMPPSLITALSPITGNEAHYSIIKQGQFVHVDDLCEAHIFLFEDPTA  254

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             +GR+ICSSH  TI+ +A+MI   WPEY IP+EF+GI+KD+PVV FSSKKL +MGF FKY+
Sbjct  255   QGRYICSSHDATIYDIANMIRDKWPEYSIPTEFEGIDKDIPVVSFSSKKLTEMGFSFKYT  314

Query  1004  LEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEKPTAIEQKQEAKTVPLKPSA  1183
             LEDM+R AIET R+KGLLPYST +     EE+E+    VEK T   + QE + +P     
Sbjct  315   LEDMFREAIETCREKGLLPYST-QIHINGEEKESRLNPVEKHT---ETQEKELLPASKEK  370

Query  1184  IEQKQETAV  1210
               Q QE  +
Sbjct  371   HAQGQENGL  379



>ref|XP_011083203.1| PREDICTED: LOW QUALITY PROTEIN: dihydroflavonol-4-reductase-like 
[Sesamum indicum]
Length=381

 Score =   523 bits (1346),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/368 (69%), Positives = 299/368 (81%), Gaps = 7/368 (2%)
 Frame = +2

Query  107   CVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEEE  286
             CVTGAAGFIGSWLV  LL+RGY I ATVRDPGN KKVKHL ELPKADTNLT+WK  M  E
Sbjct  16    CVTGAAGFIGSWLVMRLLERGYTIRATVRDPGNMKKVKHLTELPKADTNLTLWKADMNIE  75

Query  287   GSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTSS  466
             GSFDEAI GCEGVFH+ATPMDF+S DPENEVIKP + G+L+II SC KAKTVK+L+FT+S
Sbjct  76    GSFDEAIQGCEGVFHLATPMDFESNDPENEVIKPTVEGMLSIIRSCAKAKTVKKLIFTNS  135

Query  467   AGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFISI  646
             AGTLNV+  QKPVY E+ WSDLDFI +KKMTGWMYF SKILAEK A +  KE  I+FISI
Sbjct  136   AGTLNVEEHQKPVYYESNWSDLDFINSKKMTGWMYFVSKILAEKAAIEAAKENNINFISI  195

Query  647   IPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKAE  826
             IPP+VVGPF  PTFPPSLITALS ITGN+AHYSIIKQGQ+VH+DDLCEAHIFL+EHP AE
Sbjct  196   IPPVVVGPFTMPTFPPSLITALSPITGNEAHYSIIKQGQFVHVDDLCEAHIFLFEHPTAE  255

Query  827   GRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYSL  1006
             GR+ICSSH  TI+GLA+MI + WPEY+IP+EF+GI+KD+PVV FSSKKL +MGF FKY+L
Sbjct  256   GRYICSSHDATIYGLANMIREKWPEYHIPTEFEGIDKDIPVVSFSSKKLMEMGFMFKYTL  315

Query  1007  EDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEKPTAIEQKQEAKTVPLKPSAI  1186
             EDM+R AIET R+KGLLPYST+     EE++  +        ++ + QE  T+P      
Sbjct  316   EDMFREAIETCREKGLLPYSTQIHKNGEEKEPXL-------NSLTKNQEKDTLPTSKEEH  368

Query  1187  EQKQETAV  1210
              ++QE  +
Sbjct  369   AEEQENGL  376



>gb|ACO50430.1| dihydroflavonol 4-reductase [Dahlia pinnata]
Length=359

 Score =   521 bits (1343),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 239/327 (73%), Positives = 279/327 (85%), Gaps = 0/327 (0%)
 Frame = +2

Query  95    PPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGV  274
             P  VCVTGA+GFIGSWLV  LL+RGY + ATVRDPG+ KKVKHL+ELPKA+TNLT+WK  
Sbjct  6     PATVCVTGASGFIGSWLVMRLLERGYIVRATVRDPGDMKKVKHLIELPKAETNLTLWKAD  65

Query  275   MEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLV  454
             + +EGSFDEAI GC GVFHVATPMDF+SKDPENE+IKP I G+L I+ SC KAKTVK+LV
Sbjct  66    LTQEGSFDEAIEGCHGVFHVATPMDFESKDPENEIIKPTIEGILGIVRSCAKAKTVKKLV  125

Query  455   FTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKID  634
             FTSSAGT+N Q +Q PVYDE+ WSDLDFIY+ KMT WMYF SK LAEK AWK T E  ID
Sbjct  126   FTSSAGTVNAQEKQLPVYDESHWSDLDFIYSIKMTAWMYFVSKTLAEKAAWKATTEDNID  185

Query  635   FISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEH  814
             FISIIP LVVGPFITP+FPPSLITALSLI G ++HYSIIKQ QYVHLDDLCE HIFLYE+
Sbjct  186   FISIIPTLVVGPFITPSFPPSLITALSLINGMESHYSIIKQCQYVHLDDLCECHIFLYEN  245

Query  815   PKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQF  994
             P+A+GR+ICSSH  TIH LA MI + WPEY++P++F GI++DL VV FSSKKL DMGF+F
Sbjct  246   PEAKGRYICSSHDATIHQLARMIKEKWPEYHVPTQFVGIDEDLSVVSFSSKKLTDMGFEF  305

Query  995   KYSLEDMYRGAIETLRKKGLLPYSTKE  1075
             KY LE+M++GAI++ R+KGLLPYST +
Sbjct  306   KYDLEEMFKGAIDSCREKGLLPYSTDD  332



>dbj|BAM42669.1| dihydroflavonol 4-reductase [Vaccinium ashei]
Length=345

 Score =   521 bits (1341),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/338 (76%), Positives = 284/338 (84%), Gaps = 1/338 (0%)
 Frame = +2

Query  68    MVDGNHPLLPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKAD  247
             M D N  L    VCVTGAAGFIGSWL+  LL+RGY + ATVRDPGN KKVKHLLELPKAD
Sbjct  1     MKDANSGL-GTTVCVTGAAGFIGSWLIMRLLERGYVVRATVRDPGNLKKVKHLLELPKAD  59

Query  248   TNLTIWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCV  427
             TNLT+WK  + EEGSFDEAI GC GVFHVATPMDF+SKDPENEVIKP INGVL+II SC 
Sbjct  60    TNLTLWKADLNEEGSFDEAIEGCVGVFHVATPMDFESKDPENEVIKPTINGVLSIIKSCT  119

Query  428   KAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAW  607
             KAKTVKRLVFTSSAGT+NVQ  Q+PVYDE  WSDLDF+Y  KMTGWMYF SK LAEK AW
Sbjct  120   KAKTVKRLVFTSSAGTVNVQEHQQPVYDENNWSDLDFVYKIKMTGWMYFVSKTLAEKAAW  179

Query  608   KVTKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLC  787
             +  KE  IDFISIIP LVVGPFI PTFPPSLITALS ITGN+ HYSIIKQGQ+VHLDDLC
Sbjct  180   EAAKENNIDFISIIPTLVVGPFIMPTFPPSLITALSPITGNEPHYSIIKQGQFVHLDDLC  239

Query  788   EAHIFLYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSK  967
             E+HI+L+EHP+AEGR+ICSSH  TI+ LA M+ + WPEY +P+EFKGI KDLP V FSSK
Sbjct  240   ESHIYLFEHPEAEGRYICSSHDATIYDLAKMMREKWPEYNVPTEFKGIPKDLPNVSFSSK  299

Query  968   KLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAA  1081
             KL  MGFQFKYSLEDM+RGAI+T R+KGLLPYS +  A
Sbjct  300   KLIGMGFQFKYSLEDMFRGAIDTCREKGLLPYSNETTA  337



>dbj|BAJ17657.1| dihydroflavonol reductase [Gynura bicolor]
Length=351

 Score =   521 bits (1342),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 243/349 (70%), Positives = 295/349 (85%), Gaps = 6/349 (2%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGAAGFIGSWLV  LL+RGY +HATVRDP + KKVKHL+ELPKA+TNLT+WK  + +
Sbjct  9     VCVTGAAGFIGSWLVMRLLERGYIVHATVRDPDDKKKVKHLIELPKAETNLTLWKADLTK  68

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF++KDPENE+IKP I GVL+II SCVKAKTVK+LVFTS
Sbjct  69    EGSFDEAIKGCHGVFHVATPMDFETKDPENEMIKPTIEGVLSIIRSCVKAKTVKKLVFTS  128

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NVQ  Q PVYDE+ WSDLDFIY+KKMT WMYF SK LAE+ AW+ TKE  IDFIS
Sbjct  129   SAGTVNVQETQLPVYDESHWSDLDFIYSKKMTAWMYFVSKTLAERAAWEATKENNIDFIS  188

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP  VVGPFI+P+FPPSLITALSLI   ++HYSIIKQGQYVHLDDLCE+HI+LYE+PKA
Sbjct  189   IIPTFVVGPFISPSFPPSLITALSLINEMESHYSIIKQGQYVHLDDLCESHIYLYENPKA  248

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSSH  TIH LA MI + WPEY++P++F GI++++P+V FSSKKL D GF+FKY 
Sbjct  249   EGRYICSSHDATIHQLAKMINEKWPEYHVPTQFVGIDEEVPIVSFSSKKLTDTGFKFKYD  308

Query  1004  LEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEKPTAIEQKQ  1150
             LE+M++GAI++ ++KG LPYST +   +++E  TV++      A+EQK+
Sbjct  309   LEEMFKGAIDSCKEKGFLPYSTNK---VKKELFTVSI---DDHAVEQKK  351



>gb|AHK23093.1| dihydroflavonol 4-reductase [Vaccinium corymbosum]
Length=345

 Score =   521 bits (1341),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/330 (77%), Positives = 281/330 (85%), Gaps = 0/330 (0%)
 Frame = +2

Query  92    LPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKG  271
             L   VCVTGAAGFIGSWL+  LL+RGY + ATVRDPGN KKVKHLLELPKADTNLT+WK 
Sbjct  8     LGTTVCVTGAAGFIGSWLIMRLLERGYVVRATVRDPGNLKKVKHLLELPKADTNLTLWKA  67

Query  272   VMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRL  451
              + EEGSFDEAI GC GVFHVATPMDF+SKDPENEVIKP INGVL+II SC KAKTVKRL
Sbjct  68    DLNEEGSFDEAIEGCVGVFHVATPMDFESKDPENEVIKPTINGVLSIIKSCTKAKTVKRL  127

Query  452   VFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKI  631
             VFTSSAGT+NVQ  Q+PVYDE  WSDLDF+Y  KMTGWMYF SK LAEK AW+  KE  I
Sbjct  128   VFTSSAGTVNVQEHQQPVYDENNWSDLDFVYKIKMTGWMYFVSKTLAEKAAWEAAKENNI  187

Query  632   DFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYE  811
             DFISIIP LVVGPFI PTFPPSLITALS ITGN+ HYSIIKQGQ+VHLDDLCE+HI+L+E
Sbjct  188   DFISIIPTLVVGPFIMPTFPPSLITALSPITGNEPHYSIIKQGQFVHLDDLCESHIYLFE  247

Query  812   HPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQ  991
             HP+AEGR+ICSSH  TI+ LA M+ + WPEY +P+EFKGI KDLP V FSSKKL  MGFQ
Sbjct  248   HPEAEGRYICSSHDATIYDLAKMMREKWPEYNVPTEFKGIPKDLPNVSFSSKKLIGMGFQ  307

Query  992   FKYSLEDMYRGAIETLRKKGLLPYSTKEAA  1081
             FKYSLEDM+RGAI+T R+KGLLPYS +  A
Sbjct  308   FKYSLEDMFRGAIDTCREKGLLPYSNETTA  337



>dbj|BAA84939.1| dihydroflavonol 4-reductase [Camellia sinensis]
 dbj|BAA84940.1| dihydroflavonol 4-reductase [Camellia sinensis]
Length=347

 Score =   519 bits (1336),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 252/327 (77%), Positives = 279/327 (85%), Gaps = 0/327 (0%)
 Frame = +2

Query  95    PPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGV  274
             P  VCVTGAAGFIGSWLV  LL+RGY + ATVRDP N KKVKHLL+LPKADTNLT+WK  
Sbjct  13    PGTVCVTGAAGFIGSWLVMRLLERGYIVRATVRDPANLKKVKHLLDLPKADTNLTLWKAD  72

Query  275   MEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLV  454
             + EEGSFDEAI GC GVFHVATPMDF+SKDPENEVIKP INGVL+II SC KAKTVKRLV
Sbjct  73    LNEEGSFDEAIEGCSGVFHVATPMDFESKDPENEVIKPTINGVLSIIRSCTKAKTVKRLV  132

Query  455   FTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKID  634
             FTSSAGT+NVQ  Q+PV+DE  WSDLDFI  KKMTGWMYF SK LAEK AW+  KE  ID
Sbjct  133   FTSSAGTVNVQEHQQPVFDENNWSDLDFINKKKMTGWMYFVSKTLAEKAAWEAAKENNID  192

Query  635   FISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEH  814
             FISIIP LVVGPFI PTFPPSLITALS IT N+ HYSIIKQGQ+VHLDDLCE+HIFLYE 
Sbjct  193   FISIIPTLVVGPFIMPTFPPSLITALSPITRNEGHYSIIKQGQFVHLDDLCESHIFLYER  252

Query  815   PKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQF  994
             P+AEGR+ICSSH  TIH LA ++ + WPEY +P+EFKGI+KDLPVV FSSKKL  MGF+F
Sbjct  253   PQAEGRYICSSHDATIHDLAKLMREKWPEYNVPTEFKGIDKDLPVVSFSSKKLIGMGFEF  312

Query  995   KYSLEDMYRGAIETLRKKGLLPYSTKE  1075
             KYSLEDM+RGAI+T R+KGLLP+S  E
Sbjct  313   KYSLEDMFRGAIDTCREKGLLPHSFAE  339



>gb|AAT84073.1| dihydroflavonol 4-reductase [Camellia sinensis]
Length=347

 Score =   518 bits (1334),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 252/327 (77%), Positives = 278/327 (85%), Gaps = 0/327 (0%)
 Frame = +2

Query  95    PPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGV  274
             P  VCVTGAAGFIGSWLV  LL+RGY + ATVRDP N KKVKHLL+LPKADTNLT+WK  
Sbjct  13    PGTVCVTGAAGFIGSWLVMRLLERGYIVRATVRDPANLKKVKHLLDLPKADTNLTLWKAD  72

Query  275   MEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLV  454
             + EEGSFDEAI GC GVFHVATPMDF SKDPENEVIKP INGVL+II SC KAKTVKRLV
Sbjct  73    LNEEGSFDEAIEGCSGVFHVATPMDFKSKDPENEVIKPTINGVLSIIRSCTKAKTVKRLV  132

Query  455   FTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKID  634
             FTSSAGT+NVQ  Q+PV+DE  WSDLDFI  KKMTGWMYF SK LAEK AW+  KE  ID
Sbjct  133   FTSSAGTVNVQEHQQPVFDENNWSDLDFINKKKMTGWMYFVSKTLAEKAAWEAAKENNID  192

Query  635   FISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEH  814
             FISIIP LVVGPFI PTFPPSLITALS IT N+ HYSIIKQGQ+VHLDDLCE+HIFLYE 
Sbjct  193   FISIIPTLVVGPFIMPTFPPSLITALSPITRNEGHYSIIKQGQFVHLDDLCESHIFLYER  252

Query  815   PKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQF  994
             P+AEGR+ICSSH  TIH LA ++ + WPEY +P+EFKGI+KDLPVV FSSKKL  MGF+F
Sbjct  253   PQAEGRYICSSHDATIHDLAKLMREKWPEYNVPTEFKGIDKDLPVVSFSSKKLIGMGFEF  312

Query  995   KYSLEDMYRGAIETLRKKGLLPYSTKE  1075
             KYSLEDM+RGAI+T R+KGLLP+S  E
Sbjct  313   KYSLEDMFRGAIDTCREKGLLPHSFAE  339



>gb|AFC37249.1| dihydroflavonol4-reductase [Camellia chekiangoleosa]
Length=347

 Score =   517 bits (1331),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 251/328 (77%), Positives = 279/328 (85%), Gaps = 0/328 (0%)
 Frame = +2

Query  95    PPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGV  274
             P  VCVTGAAGFIGSWLV  LL+RGY + ATVRDP N KKVKHLL+LPKADTNLT+WK  
Sbjct  13    PGTVCVTGAAGFIGSWLVMRLLERGYIVRATVRDPANLKKVKHLLDLPKADTNLTLWKAD  72

Query  275   MEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLV  454
             + EEGSFDEAI GC GVFHVATPMDF+SKDPENEVIKP INGVL+II SC KAKTVKRLV
Sbjct  73    LNEEGSFDEAIEGCSGVFHVATPMDFESKDPENEVIKPTINGVLSIIRSCTKAKTVKRLV  132

Query  455   FTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKID  634
             FTSSAGT+NVQ  Q+P++DE  WSDLDFI  KKMTGWMYF SK LAEK AW+  KE  ID
Sbjct  133   FTSSAGTVNVQEHQQPIFDENNWSDLDFINEKKMTGWMYFVSKTLAEKAAWEAAKENNID  192

Query  635   FISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEH  814
             FISIIP LVVGPFI PTFPPSLITALS IT N+ HYSIIKQGQ+VHLDDLCE+HIFLYEH
Sbjct  193   FISIIPTLVVGPFIMPTFPPSLITALSPITRNEGHYSIIKQGQFVHLDDLCESHIFLYEH  252

Query  815   PKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQF  994
             P+AEGR+ICSSH  TIH LA ++ + WPEY +P+EFKGI+KDLPVV FSSKKL  MGF+F
Sbjct  253   PQAEGRYICSSHDATIHDLAKLMREKWPEYNVPTEFKGIDKDLPVVSFSSKKLIGMGFEF  312

Query  995   KYSLEDMYRGAIETLRKKGLLPYSTKEA  1078
             KYSLEDM+R AI+T R+KGLLP S  E+
Sbjct  313   KYSLEDMFREAIDTCREKGLLPQSFAES  340



>gb|EYU31196.1| hypothetical protein MIMGU_mgv1a006799mg [Erythranthe guttata]
Length=431

 Score =   520 bits (1340),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 241/365 (66%), Positives = 300/365 (82%), Gaps = 7/365 (2%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGAAGFIGSW+V  LL+RGY + ATVRDP N  KVKHL+ELPKADTNLT+WK  M  
Sbjct  16    VCVTGAAGFIGSWIVMRLLERGYVVRATVRDPENKSKVKHLVELPKADTNLTLWKADMNI  75

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             +GS+DEA+ GC+ VFH+ATPMDF+S+DPENEVIKP I G+++II SC +AKTVK+L+FT+
Sbjct  76    KGSYDEAVQGCQCVFHMATPMDFESEDPENEVIKPTIEGMMSIIESCARAKTVKKLIFTN  135

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGTLNV+P QKPVYDET WSDLDFI + KMTGWMYF SKILAEKEA +  KE  I+FIS
Sbjct  136   SAGTLNVEPHQKPVYDETNWSDLDFILSTKMTGWMYFVSKILAEKEAMEAAKESNINFIS  195

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIPP+VVGPFI PT PPSLITALS ITGN+ HYSIIKQGQ+VH+DDLCEAHIFL+E+P A
Sbjct  196   IIPPVVVGPFIMPTMPPSLITALSPITGNEPHYSIIKQGQFVHVDDLCEAHIFLFENPNA  255

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
              GR++CSSH  TI+ +A+MI  NWPEY+IP+EF+GI+K++PVV F SKKL  MGF FKY+
Sbjct  256   HGRYVCSSHDATIYDIANMIRDNWPEYHIPTEFEGIDKNIPVVRFLSKKLTGMGFSFKYT  315

Query  1004  LEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEKPTAIEQKQEAKTVPLKPSA  1183
             LEDM+R AIET R+KGLLPYST+     +E++ T+        ++E++ + +   L P++
Sbjct  316   LEDMFREAIETCREKGLLPYSTQIHINGDEKEYTL-------NSLEKQSDTREKELLPAS  368

Query  1184  IEQKQ  1198
             +E++Q
Sbjct  369   MEKQQ  373



>gb|ABU93477.1| dihydroflavonol 4-reductase [Helianthus annuus]
Length=355

 Score =   516 bits (1329),  Expect = 7e-179, Method: Compositional matrix adjust.
 Identities = 237/327 (72%), Positives = 279/327 (85%), Gaps = 0/327 (0%)
 Frame = +2

Query  95    PPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGV  274
             P  VCVTGA+GFIGSWLV  LL+RGY + ATVRDPG+ KKVKHL ELP A+TNLT++K  
Sbjct  6     PATVCVTGASGFIGSWLVMRLLERGYIVRATVRDPGDMKKVKHLKELPGAETNLTLYKAD  65

Query  275   MEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLV  454
             M +EGSFDEAI GC GVFHVATPMDF+SKDPENE+IKP + GVL+I+ SC KAKTVK+LV
Sbjct  66    MTQEGSFDEAIEGCHGVFHVATPMDFESKDPENEIIKPTVQGVLSIVRSCAKAKTVKKLV  125

Query  455   FTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKID  634
             FTSSAGT+NVQ +Q PVYDE+ WSDLDFI ++KMT WMYF SK LAE+ AWK   E  ID
Sbjct  126   FTSSAGTVNVQEKQLPVYDESHWSDLDFINSQKMTAWMYFVSKTLAERAAWKAAIENNID  185

Query  635   FISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEH  814
             FISIIP LVVGPFITP FPPSLITALSLI G ++HYSIIKQGQ+VHLDDLCE HIFLYE+
Sbjct  186   FISIIPTLVVGPFITPIFPPSLITALSLINGMESHYSIIKQGQFVHLDDLCECHIFLYEN  245

Query  815   PKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQF  994
             P+A+GR+ICSSH  TIH LA MI + WPEY++P++F GI++D+PVV FSSKKL DMGF+F
Sbjct  246   PEAKGRYICSSHDATIHQLARMIKEKWPEYHVPTQFVGIDEDIPVVSFSSKKLTDMGFEF  305

Query  995   KYSLEDMYRGAIETLRKKGLLPYSTKE  1075
             KY+LE+M++GAI+  R+KGLLPYST E
Sbjct  306   KYNLEEMFKGAIDCCREKGLLPYSTNE  332



>gb|AGO64770.1| dihydroflavonol 4-reductase, partial [Lycium barbarum]
Length=298

 Score =   514 bits (1323),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 237/298 (80%), Positives = 264/298 (89%), Gaps = 0/298 (0%)
 Frame = +2

Query  134   GSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEEEGSFDEAIAG  313
             GSWLV  LL+RGY++HATVRDP N KKVKHLLELPKADTNLT+WK  +  EGSFDEAI G
Sbjct  1     GSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPKADTNLTLWKADLTVEGSFDEAIQG  60

Query  314   CEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTSSAGTLNVQPQ  493
             C+GVFHVATPMDF+SKDPENEVIKP + G+L+II SCVKA TV+RLVFTSSAGTL+VQ  
Sbjct  61    CQGVFHVATPMDFESKDPENEVIKPTVRGMLSIIESCVKANTVRRLVFTSSAGTLDVQEH  120

Query  494   QKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFISIIPPLVVGPF  673
             QK  YDE+ WSDLDFIYAKKMTGWMYF SKILAEK A +  K+  IDFISIIPPLVVGPF
Sbjct  121   QKLFYDESSWSDLDFIYAKKMTGWMYFVSKILAEKAAMEEAKKNNIDFISIIPPLVVGPF  180

Query  674   ITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKAEGRFICSSHH  853
             ITPTFPPSLITALSLITGN+AHY IIKQGQYVHLDDLCEAHIFLYEHPKAEGR+ICSSHH
Sbjct  181   ITPTFPPSLITALSLITGNEAHYCIIKQGQYVHLDDLCEAHIFLYEHPKAEGRYICSSHH  240

Query  854   TTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYSLEDMYRGA  1027
               I+ +A M+ Q WPEYY+P+EFKGI+KDLP++ FSSKKL DMGFQFKY+LEDMY+GA
Sbjct  241   AIIYDVAKMVRQKWPEYYVPTEFKGIDKDLPIISFSSKKLMDMGFQFKYTLEDMYKGA  298



>gb|AAX12420.1| dihydroflavonol 4-reductase [Vaccinium macrocarpon]
Length=353

 Score =   516 bits (1328),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 252/330 (76%), Positives = 280/330 (85%), Gaps = 0/330 (0%)
 Frame = +2

Query  92    LPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKG  271
             L   VCVTGAAGFIGSWL+  LL+RGY + ATVRDPGN KKVKHLLELPKADTNLT+WK 
Sbjct  8     LGTTVCVTGAAGFIGSWLIMRLLERGYVVRATVRDPGNLKKVKHLLELPKADTNLTLWKA  67

Query  272   VMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRL  451
              + EEGSFDEAI GC GVFHVATPMDF+SKDPENEVIKP INGVL+II SC KAKTVKRL
Sbjct  68    DLNEEGSFDEAIEGCVGVFHVATPMDFESKDPENEVIKPTINGVLSIIKSCTKAKTVKRL  127

Query  452   VFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKI  631
             VFTSSAGT+NVQ  Q+P +DE  WSDLDFIY  KMTGWMYF SK LAEK AW+  KE  I
Sbjct  128   VFTSSAGTVNVQEHQQPTFDENNWSDLDFIYKIKMTGWMYFVSKTLAEKAAWEAAKENNI  187

Query  632   DFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYE  811
             DFISIIP LVVGPFI PTFPPSLITALS ITGN+ HYSIIKQGQ+VHLDDLCE+HI+L+E
Sbjct  188   DFISIIPTLVVGPFIMPTFPPSLITALSPITGNEPHYSIIKQGQFVHLDDLCESHIYLFE  247

Query  812   HPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQ  991
             HP+AEGR+ICSSH  TI+ LA ++ + WPEY +P+EFKGI KDLP V FSSKKL  MGFQ
Sbjct  248   HPEAEGRYICSSHDATIYDLAKIMREKWPEYNVPTEFKGIPKDLPNVSFSSKKLIGMGFQ  307

Query  992   FKYSLEDMYRGAIETLRKKGLLPYSTKEAA  1081
             FKYSLEDM+RGAI+T R+KGLLPYS +  A
Sbjct  308   FKYSLEDMFRGAIDTCREKGLLPYSNETTA  337



>gb|AGV53048.1| dihydroflavonol 4-reductase [Actinidia chinensis]
Length=345

 Score =   514 bits (1324),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 250/323 (77%), Positives = 278/323 (86%), Gaps = 0/323 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGAAGFIGSWLV  LL+RGY + ATVRDPGN KKVKHLL+LPKA+ NLT+WK  + E
Sbjct  12    VCVTGAAGFIGSWLVMRLLERGYIVRATVRDPGNMKKVKHLLDLPKAEANLTLWKADLGE  71

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDPENEVIKP INGVL+II SC KAKTVKRLVFTS
Sbjct  72    EGSFDEAIQGCSGVFHVATPMDFESKDPENEVIKPTINGVLSIIRSCTKAKTVKRLVFTS  131

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NVQ  Q+P YDE  WSDLDFIYAKKMTGWMYF SK LAEK AW+  KE  IDFIS
Sbjct  132   SAGTVNVQEHQQPRYDENNWSDLDFIYAKKMTGWMYFVSKTLAEKAAWEAAKENNIDFIS  191

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LVVGPFI PTFPPSLITALS ITGN+ HYSIIKQGQ+VHLDDLCE+HIFLYE+PKA
Sbjct  192   IIPTLVVGPFIMPTFPPSLITALSPITGNEPHYSIIKQGQFVHLDDLCESHIFLYENPKA  251

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSSH  TI  LA M+ + WPEY +PSEFKG +++LP V FSS+KL  MGF+FKYS
Sbjct  252   EGRYICSSHDATIFDLAKMMREKWPEYNVPSEFKGFDENLPNVSFSSEKLIGMGFKFKYS  311

Query  1004  LEDMYRGAIETLRKKGLLPYSTK  1072
             LEDM+RGAI+T R+KGLLPYS +
Sbjct  312   LEDMFRGAIDTCREKGLLPYSNE  334



>gb|AEN69002.1| dihydroflavonol 4-reductase [Chrysanthemum x morifolium]
Length=357

 Score =   514 bits (1325),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 238/321 (74%), Positives = 277/321 (86%), Gaps = 0/321 (0%)
 Frame = +2

Query  95    PPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGV  274
             P  VCVTGA+GFIGSWLV  LL+RGY + ATVRDPG+ KKVKHLLELPKA+TNL +WK  
Sbjct  6     PAIVCVTGASGFIGSWLVMRLLERGYSVRATVRDPGDMKKVKHLLELPKAETNLALWKAD  65

Query  275   MEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLV  454
             +  EGSFDEAI GC GVFHVATPMDF+SKDPENE+IKP I GVL+II SCVKAKTVK+LV
Sbjct  66    LALEGSFDEAIEGCHGVFHVATPMDFESKDPENEIIKPTIEGVLSIIRSCVKAKTVKKLV  125

Query  455   FTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKID  634
             FTSSAGT+NVQ QQ PVYDE+ WSDLDFIY+KKMT WMYF SK LAEK AWK TKE  ID
Sbjct  126   FTSSAGTVNVQKQQVPVYDESHWSDLDFIYSKKMTAWMYFVSKTLAEKAAWKATKENNID  185

Query  635   FISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEH  814
             FISIIP LVVGPFI+P+FPPSL+TALSLITG ++HYSIIKQ QYVHLDDLCE+HI+LYE+
Sbjct  186   FISIIPTLVVGPFISPSFPPSLMTALSLITGAESHYSIIKQCQYVHLDDLCESHIYLYEN  245

Query  815   PKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQF  994
             PKA GR+ICSSH  TIH LA MI + WPEY +P++F+ I+ ++P+V FSSKKL DMGF+F
Sbjct  246   PKAAGRYICSSHDATIHQLAKMIKEKWPEYQVPTKFEVIDDEIPIVSFSSKKLTDMGFKF  305

Query  995   KYSLEDMYRGAIETLRKKGLL  1057
             KY LE+M+RGAI++ ++KGLL
Sbjct  306   KYDLEEMFRGAIKSCKEKGLL  326



>gb|ABP57077.1| dihydroflavonol 4-reductase [Solenostemon scutellarioides]
 gb|ABP57078.1| dihydroflavonol 4-reductase [Solenostemon scutellarioides]
Length=366

 Score =   514 bits (1325),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 246/363 (68%), Positives = 297/363 (82%), Gaps = 3/363 (1%)
 Frame = +2

Query  86    PLLPPK--VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLT  259
             P  PP   VCVTGA+GFIGSWLV  LL+RGY + ATVRDP N KKVKHL ELP+ADTNLT
Sbjct  3     PAPPPATTVCVTGASGFIGSWLVMRLLERGYIVRATVRDPENLKKVKHLTELPRADTNLT  62

Query  260   IWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKT  439
             +WK  M  EGS+DEA+ GC GVFH+ATPMDF+S DPENEVIKP ++G+++I+ SC KAKT
Sbjct  63    LWKADMNTEGSYDEAVQGCIGVFHMATPMDFESDDPENEVIKPTVDGMMSIMRSCAKAKT  122

Query  440   VKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTK  619
             VK+L+FT+SAGTLNV+  QKPVYDET WSDLDFIY+KKMTGWMYF SKILAEK A +  K
Sbjct  123   VKKLIFTNSAGTLNVEEHQKPVYDETNWSDLDFIYSKKMTGWMYFVSKILAEKAAMEAAK  182

Query  620   EKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHI  799
             +  I+FISIIPP+VVGPF  PTFPPSLITALS ITGN AHYSIIKQGQ+VH+DDLCEAHI
Sbjct  183   QDNINFISIIPPVVVGPFFMPTFPPSLITALSPITGNDAHYSIIKQGQFVHVDDLCEAHI  242

Query  800   FLYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQD  979
             FL+EHPKAEGR+ICSSH  TI+ +ADM+ + WPEY+IP++F+GI+KD+PVV FSSKKL +
Sbjct  243   FLFEHPKAEGRYICSSHDATIYDIADMLREKWPEYHIPTQFEGIDKDIPVVRFSSKKLVE  302

Query  980   MGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEKPTAIEQKQEAK  1159
             MGF FKYSLEDM+R AI++ R+KG LP+ T +     E +E++    EK + I   QE +
Sbjct  303   MGFSFKYSLEDMFREAIDSCREKGFLPFDT-QIHNNGENKESILSSQEKHSNITDNQEKE  361

Query  1160  TVP  1168
              +P
Sbjct  362   LLP  364



>gb|AAT66505.1| dihydroflavonol 4-reductase [Camellia sinensis]
Length=347

 Score =   513 bits (1320),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 250/327 (76%), Positives = 277/327 (85%), Gaps = 0/327 (0%)
 Frame = +2

Query  95    PPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGV  274
             P  VCVTGAAGFIGSWLV  LL+RGY + ATVRDP N KKVKHLL+LPKADTNLT+WK  
Sbjct  13    PGTVCVTGAAGFIGSWLVMRLLERGYIVRATVRDPANLKKVKHLLDLPKADTNLTLWKAD  72

Query  275   MEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLV  454
             + EEGSFDEAI GC GVFHVATPMDF+SKDPENEVIKP INGVL+II SC KAKTVKRLV
Sbjct  73    LNEEGSFDEAIEGCSGVFHVATPMDFESKDPENEVIKPTINGVLSIIRSCTKAKTVKRLV  132

Query  455   FTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKID  634
             FTSSAGT+NVQ  Q+PV+DE  WSDL FI  KKMTGWMYF SK LAEK AW+  KE  ID
Sbjct  133   FTSSAGTVNVQEHQQPVFDENNWSDLHFINKKKMTGWMYFVSKTLAEKAAWEAAKENNID  192

Query  635   FISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEH  814
             FISIIP LV GPFI PTFPPSLITALS IT N+ HYSIIKQGQ+VHLDDLCE+HIFLYE 
Sbjct  193   FISIIPTLVGGPFIMPTFPPSLITALSPITRNEGHYSIIKQGQFVHLDDLCESHIFLYER  252

Query  815   PKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQF  994
             P+AEGR+ICSSH  TIH LA ++ + WPEY +P+EFKGI+KDLPVV FSSKKL  MGF+F
Sbjct  253   PQAEGRYICSSHDATIHDLAKLMREKWPEYNVPTEFKGIDKDLPVVSFSSKKLIGMGFEF  312

Query  995   KYSLEDMYRGAIETLRKKGLLPYSTKE  1075
             KYSLEDM+RGAI+T R+KGLLP+S  E
Sbjct  313   KYSLEDMFRGAIDTCREKGLLPHSFAE  339



>gb|ACV72642.1| dihydroflavonol 4-reductase [Gossypium hirsutum]
Length=340

 Score =   510 bits (1314),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 232/324 (72%), Positives = 279/324 (86%), Gaps = 0/324 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTG +GFIGSWL+K LL+RGY + ATVRDPGN+KKVKHLLELPKA+T+LT+WK  + E
Sbjct  11    VCVTGGSGFIGSWLIKLLLERGYVVRATVRDPGNSKKVKHLLELPKAETHLTLWKADLAE  70

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFD+AI  C GVFHVATPMDF+S+DPENEVIKP INGVL+I+ +C KAKTV+RLVFTS
Sbjct  71    EGSFDDAIQACTGVFHVATPMDFESEDPENEVIKPTINGVLSIMKACAKAKTVRRLVFTS  130

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT++V  QQKP YDETCWSDL+FI AKKMTGWMYF SK +AE+ AWK  KE  IDF+S
Sbjct  131   SAGTIDVAEQQKPCYDETCWSDLEFIQAKKMTGWMYFVSKTMAEQAAWKFAKENNIDFVS  190

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIPPLVVGPFI  + PPSLITALS ITGN+AHYSIIKQGQ++HLDDLC AHIFL+E+PKA
Sbjct  191   IIPPLVVGPFIMQSMPPSLITALSPITGNEAHYSIIKQGQFIHLDDLCRAHIFLFENPKA  250

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR IC+SHH TI  LA M+++ +PEY +P++FK ++++L  V FSSKKL D+GF+FKYS
Sbjct  251   EGRHICASHHATIIDLAKMLSEKYPEYNVPTKFKDVDENLKSVEFSSKKLLDLGFEFKYS  310

Query  1004  LEDMYRGAIETLRKKGLLPYSTKE  1075
             LEDM+ GA+ET R+KGLLP S ++
Sbjct  311   LEDMFVGAVETCREKGLLPLSNEK  334



>gb|ABM64800.1| dihydroflavonol 4-reductase [Gossypium hirsutum]
 gb|AHG97389.1| dihydroflavonol 4-reductase [Gossypium hirsutum]
Length=355

 Score =   510 bits (1314),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 232/324 (72%), Positives = 279/324 (86%), Gaps = 0/324 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTG +GFIGSWL+K LL+RGY + ATVRDPGN+KKVKHLLELPKA+T+LT+WK  + E
Sbjct  26    VCVTGGSGFIGSWLIKLLLERGYVVRATVRDPGNSKKVKHLLELPKAETHLTLWKADLAE  85

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFD+AI  C GVFHVATPMDF+S+DPENEVIKP INGVL+I+ +C KAKTV+RLVFTS
Sbjct  86    EGSFDDAIQACTGVFHVATPMDFESEDPENEVIKPTINGVLSIMKACAKAKTVRRLVFTS  145

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT++V  QQKP YDETCWSDL+FI AKKMTGWMYF SK +AE+ AWK  KE  IDF+S
Sbjct  146   SAGTIDVAEQQKPCYDETCWSDLEFIQAKKMTGWMYFVSKTMAEQAAWKFAKENNIDFVS  205

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIPPLVVGPFI  + PPSLITALS ITGN+AHYSIIKQGQ++HLDDLC AHIFL+E+PKA
Sbjct  206   IIPPLVVGPFIMQSMPPSLITALSPITGNEAHYSIIKQGQFIHLDDLCRAHIFLFENPKA  265

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR IC+SHH TI  LA M+++ +PEY +P++FK ++++L  V FSSKKL D+GF+FKYS
Sbjct  266   EGRHICASHHATIIDLAKMLSEKYPEYNVPTKFKDVDENLKSVEFSSKKLLDLGFEFKYS  325

Query  1004  LEDMYRGAIETLRKKGLLPYSTKE  1075
             LEDM+ GA+ET R+KGLLP S ++
Sbjct  326   LEDMFVGAVETCREKGLLPLSNEK  349



>dbj|BAJ08043.1| dihydroflavonol 4-reductase [Cyclamen graecum]
Length=331

 Score =   508 bits (1308),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 244/325 (75%), Positives = 274/325 (84%), Gaps = 0/325 (0%)
 Frame = +2

Query  95    PPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGV  274
             P  VCVTGAAGFIGSWLV  LL+RGY + ATVRDP N KKVKHLL+LPKA TNLT+WK  
Sbjct  7     PGTVCVTGAAGFIGSWLVMRLLERGYTVRATVRDPENMKKVKHLLDLPKAGTNLTLWKAD  66

Query  275   MEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLV  454
             + EEGSFDEAI GC GVFHVATPMDF+S+DPE EVIKP I+GVL+II SC KAKTVK+LV
Sbjct  67    LTEEGSFDEAIQGCSGVFHVATPMDFESQDPEKEVIKPTIDGVLSIIKSCAKAKTVKKLV  126

Query  455   FTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKID  634
             FTSSAGT+NVQ  QK VYDE+ WSDLDFI AKKMT WMYF SK LAE  A +  KE  I+
Sbjct  127   FTSSAGTVNVQATQKSVYDESDWSDLDFIVAKKMTAWMYFVSKTLAELAAVEAAKENNIN  186

Query  635   FISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEH  814
             FISIIP LVVGPFI PTFPPSLITALS ITGN+AHYSIIKQGQ+VHLDDLCEAHIFLYEH
Sbjct  187   FISIIPTLVVGPFIMPTFPPSLITALSPITGNEAHYSIIKQGQFVHLDDLCEAHIFLYEH  246

Query  815   PKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQF  994
             P  EGR+ICSSH TTI+GLA+M+ + WPEY +P+EF+GI+KDL  V FSS KL  +GF+F
Sbjct  247   PMGEGRYICSSHDTTIYGLANMMREKWPEYNVPTEFEGIDKDLKSVCFSSNKLTGLGFEF  306

Query  995   KYSLEDMYRGAIETLRKKGLLPYST  1069
             K SLEDM+RGAI+T R+KGLLPYS 
Sbjct  307   KNSLEDMFRGAIDTCREKGLLPYSN  331



>ref|XP_011007452.1| PREDICTED: dihydroflavonol-4-reductase [Populus euphratica]
Length=373

 Score =   508 bits (1309),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 238/367 (65%), Positives = 293/367 (80%), Gaps = 9/367 (2%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL++GY + ATVRDP NT+KV HLLELPKADT+LT+WK  +  
Sbjct  8     VCVTGASGFIGSWLVMRLLEKGYTVRATVRDPDNTRKVNHLLELPKADTHLTLWKADLSV  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEA+ GC GVFHVATPMDF+SKDPENEVIKP INGVL+I+ +C KAKTV+R+VFTS
Sbjct  68    EGSFDEAVQGCTGVFHVATPMDFESKDPENEVIKPTINGVLDIMKACAKAKTVRRVVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT++V+  +K VYDETCWSDL+F+   KMTGWMYF SK LAE+ AWK  KE  +DFIS
Sbjct  128   SAGTVDVEEHKKTVYDETCWSDLEFVQTVKMTGWMYFVSKTLAEQAAWKYAKENNLDFIS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             +IPPLVVGPFI P+ PPSLITALSLITGN+AHY IIKQG YVHLDDLC AHI L+E+PKA
Sbjct  188   VIPPLVVGPFIMPSMPPSLITALSLITGNEAHYGIIKQGNYVHLDDLCRAHIVLFENPKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSSH  TIH LA ++ + +PEY +P++FK I++DL  V FSSKKL D+GF+FKYS
Sbjct  248   EGRYICSSHEATIHDLAKLLREKYPEYNVPAKFKDIDEDLASVVFSSKKLMDLGFEFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEKPT-------AIEQKQEAKT  1162
             LE+M+ GA+ET R+KGL+P S ++ AA  E++   A++  +P        A+E+ +E   
Sbjct  308   LEEMFAGAVETCREKGLIPLSHEKQAA--EDKLVGAVETCRPIPLSHEKQAVEESKEKGG  365

Query  1163  VPLKPSA  1183
             VP    A
Sbjct  366   VPADSEA  372



>sp|P51103.1|DFRA_CALCH RecName: Full=Dihydroflavonol-4-reductase; Short=DFR; AltName: 
Full=Dihydrokaempferol 4-reductase [Callistephus chinensis]
 emb|CAA91922.1| dihydroflavonol 4-reductase [Callistephus chinensis]
Length=364

 Score =   508 bits (1307),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 240/328 (73%), Positives = 279/328 (85%), Gaps = 0/328 (0%)
 Frame = +2

Query  95    PPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGV  274
             PP VCVTGAAGFIGSWLV  LL+RGY + ATVR+PG+ KKVKHLLELPKA+TNLT+WK  
Sbjct  6     PPTVCVTGAAGFIGSWLVMRLLERGYIVRATVRNPGDMKKVKHLLELPKAETNLTLWKAD  65

Query  275   MEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLV  454
             + +EGSFDEAI GC GVFHVATPMDF+SKDPENE+IKP I G+L+II SC KAKTVK+LV
Sbjct  66    LTQEGSFDEAIEGCHGVFHVATPMDFESKDPENEIIKPTIEGILSIIRSCAKAKTVKKLV  125

Query  455   FTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKID  634
             +TSSAGT+NVQ  Q PVYDE+ WSDLDFIY+KKMT WMYF SK LAEK A +  KE  ID
Sbjct  126   YTSSAGTVNVQETQLPVYDESHWSDLDFIYSKKMTAWMYFVSKTLAEKAAMEAAKENNID  185

Query  635   FISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEH  814
             F+SIIPPLVVGPFI PTFPPSLITALSLI G ++HYSIIKQGQYVHLDDLCE HIFLYE+
Sbjct  186   FVSIIPPLVVGPFINPTFPPSLITALSLINGAESHYSIIKQGQYVHLDDLCECHIFLYEN  245

Query  815   PKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQF  994
             P+A+GR+ICS    TIH LA MI Q WPEY++P++F GI+++LP V FSSKKL DMGF+F
Sbjct  246   PEAKGRYICSKQDATIHQLARMIKQKWPEYHVPTQFAGIDEELPTVSFSSKKLIDMGFKF  305

Query  995   KYSLEDMYRGAIETLRKKGLLPYSTKEA  1078
             KY LEDM++GAI++ ++KG LPYST E 
Sbjct  306   KYDLEDMFKGAIDSCKEKGFLPYSTNEV  333



>gb|ACA04005.1| dihydroflavonol-4-reductase [Diplacus aurantiacus]
Length=470

 Score =   510 bits (1314),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 255/380 (67%), Positives = 300/380 (79%), Gaps = 9/380 (2%)
 Frame = +2

Query  71    VDGNHPLLPPK--VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKA  244
             VD      PP   VCVTGA GFIGSW+V  LL+RGY +HATVRDP N +KVK L+ELP+A
Sbjct  3     VDQTTVAAPPATTVCVTGATGFIGSWIVMRLLERGYVVHATVRDPENMEKVKDLIELPRA  62

Query  245   DTNLTIWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSC  424
             DTNL +WK  M  EGS+DEA+ GCEGVFH+ATPMDF+S DPENEVIKP I G+++II SC
Sbjct  63    DTNLKLWKADMNVEGSYDEAVKGCEGVFHMATPMDFESDDPENEVIKPTIEGMMSIIRSC  122

Query  425   VKAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEA  604
              KAKTVK+L+FT+SAGTLNV+  QKPVYDET WSDLDFI + KMTGWMYF SKILAEK A
Sbjct  123   AKAKTVKKLIFTNSAGTLNVEQHQKPVYDETNWSDLDFILSTKMTGWMYFVSKILAEKAA  182

Query  605   WKVTKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDL  784
              +  KE  I+FISIIPP+VVGPFI PTFPPSLITALS ITGN+AHYSII+QGQYVH+DDL
Sbjct  183   IEAAKENNINFISIIPPVVVGPFIMPTFPPSLITALSPITGNEAHYSIIRQGQYVHVDDL  242

Query  785   CEAHIFLYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSS  964
             CEAHIFL+E P AEGR+ICSSH  TI+G+A+MI + WPEY IP+EF+GI+KD+PVV FSS
Sbjct  243   CEAHIFLFEDPTAEGRYICSSHDETIYGIANMIREKWPEYQIPTEFEGIDKDIPVVRFSS  302

Query  965   KKLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALK-VEKPTAIE  1141
             KKL  MGF +KY+LEDM+ GAIET R KGLLPYSTK     E E     L  +EK T I+
Sbjct  303   KKLIGMGFSYKYTLEDMFTGAIETCRAKGLLPYSTKIHTNGELETRGRPLNPLEKHTDIQ  362

Query  1142  QKQEAKTVPLKPSAIEQKQE  1201
             +K+      L P++ E+  E
Sbjct  363   EKE------LHPASEEKHAE  376



>gb|AAR01565.1| dihydroflavonol/flavonone-4-reductase like protein [Sinningia 
cardinalis]
Length=358

 Score =   506 bits (1302),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 248/345 (72%), Positives = 285/345 (83%), Gaps = 1/345 (0%)
 Frame = +2

Query  86    PLLPPK-VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTI  262
             PL P   VCVTGAAG++GSWLV  LL+RGY +HATVRDPGN KKVKHLLELP A TNLT+
Sbjct  6     PLAPATTVCVTGAAGYVGSWLVMKLLERGYIVHATVRDPGNIKKVKHLLELPGAKTNLTL  65

Query  263   WKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTV  442
             WK  M   GSFDEAI GC+GVFHVATPMDF  KDPEN+VIKP I GVL+II +C KAKTV
Sbjct  66    WKADMTVNGSFDEAIQGCQGVFHVATPMDFQCKDPENDVIKPTIEGVLSIIRTCAKAKTV  125

Query  443   KRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKE  622
             +RLVFTS+AG LNV  Q+K VYDE  WSDLDFIY+KKMTGWMYFASK+LAEK AW+  KE
Sbjct  126   RRLVFTSTAGALNVAEQRKSVYDENNWSDLDFIYSKKMTGWMYFASKVLAEKAAWEAAKE  185

Query  623   KKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIF  802
               ID +SIIP LVVG F TPTFPPSLITAL+ ITGN++HY IIKQGQYVHLDDLCEAHIF
Sbjct  186   YNIDLVSIIPTLVVGQFNTPTFPPSLITALAPITGNESHYWIIKQGQYVHLDDLCEAHIF  245

Query  803   LYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDM  982
             L+E PKAEGR+ICSSH  TI+ LA+MI   WPEY IP+EF+GI+KD+P+V FSSKKL +M
Sbjct  246   LFEEPKAEGRYICSSHDATIYDLANMIRDKWPEYNIPTEFEGIDKDIPLVRFSSKKLVEM  305

Query  983   GFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALK  1117
             GF FKY+ EDMYRGAIET R+KG+LPYST+  +  ++E + V  K
Sbjct  306   GFTFKYTFEDMYRGAIETCREKGMLPYSTQICSNGDQEIDLVPSK  350



>gb|ACA04004.1| dihydroflavonol-4-reductase [Diplacus aurantiacus]
Length=470

 Score =   510 bits (1313),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 255/380 (67%), Positives = 300/380 (79%), Gaps = 9/380 (2%)
 Frame = +2

Query  71    VDGNHPLLPPK--VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKA  244
             VD      PP   VCVTGA GFIGSW+V  LL+RGY +HATVRDP N +KVK L+ELP+A
Sbjct  3     VDQTTVAAPPATTVCVTGATGFIGSWIVMRLLERGYIVHATVRDPENMEKVKDLIELPRA  62

Query  245   DTNLTIWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSC  424
             DTNL +WK  M  EGS+DEA+ GCEGVFH+ATPMDF+S DPENEVIKP I G+++II SC
Sbjct  63    DTNLKLWKADMNVEGSYDEAVKGCEGVFHMATPMDFESDDPENEVIKPTIEGMMSIIRSC  122

Query  425   VKAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEA  604
              KAKTVK+L+FT+SAGTLNV+  QKPVYDET WSDLDFI + KMTGWMYF SKILAEK A
Sbjct  123   AKAKTVKKLIFTNSAGTLNVEQHQKPVYDETNWSDLDFILSTKMTGWMYFVSKILAEKAA  182

Query  605   WKVTKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDL  784
              +  KE  I+FISIIPP+VVGPFI P+FPPSLITALS ITGN+AHYSIIKQGQYVH+DDL
Sbjct  183   IEAAKENNINFISIIPPVVVGPFIMPSFPPSLITALSPITGNEAHYSIIKQGQYVHVDDL  242

Query  785   CEAHIFLYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSS  964
             CEAHIFL+E P AEGR+ICSSH  TI+G+A+MI + WPEY IP+EF+GI+KD+PVV FSS
Sbjct  243   CEAHIFLFEDPTAEGRYICSSHDETIYGIANMIREKWPEYQIPTEFEGIDKDIPVVRFSS  302

Query  965   KKLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALK-VEKPTAIE  1141
             KKL  MGF +KY+LEDM+ GAIET R KGLLPYSTK     E E     L  +EK T I+
Sbjct  303   KKLIGMGFSYKYTLEDMFTGAIETCRAKGLLPYSTKIHTNGELETRGRPLNPLEKHTDIQ  362

Query  1142  QKQEAKTVPLKPSAIEQKQE  1201
             +K+      L P++ E+  E
Sbjct  363   EKE------LHPASEEKHAE  376



>gb|AAD56578.1|AF184271_1 dihydroflavonol 4-reductase [Daucus carota]
Length=380

 Score =   506 bits (1302),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 230/322 (71%), Positives = 272/322 (84%), Gaps = 0/322 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LLQRGY + ATVRDPGN +KVKHLL+LPKA+TNL + +  + E
Sbjct  8     VCVTGASGFIGSWLVLRLLQRGYTVRATVRDPGNPQKVKHLLQLPKAETNLILCRADLNE  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFD+A+ GC  VFH+ATPMD +S+DPENEVIKP + GVL+II +C KAKTVK+L++TS
Sbjct  68    EGSFDDAVKGCHAVFHMATPMDIESQDPENEVIKPTVQGVLDIITACAKAKTVKKLIYTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NV+  Q PVYDE+ WSD+DFIY+ KMT WMYF SK LAEK AW+  +E  I FIS
Sbjct  128   SAGTVNVREHQLPVYDESNWSDMDFIYSTKMTAWMYFVSKSLAEKAAWQAAEENNIQFIS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LVVGPFI+PTFPPSLITALS +TGN+AHYSIIKQ QYVHLDDLCE+ IFLYEHP A
Sbjct  188   IIPTLVVGPFISPTFPPSLITALSPLTGNEAHYSIIKQCQYVHLDDLCESQIFLYEHPTA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             +GR+ICSSH  TIH +  +I + WPEY +P+EFKGIEKDLPV+ FSSKKL DMGF FKY+
Sbjct  248   QGRYICSSHDATIHDVVKLIREKWPEYNVPTEFKGIEKDLPVISFSSKKLTDMGFTFKYN  307

Query  1004  LEDMYRGAIETLRKKGLLPYST  1069
             LEDM++GAIET R+KGLLP ST
Sbjct  308   LEDMFKGAIETCREKGLLPNST  329



>dbj|BAF49318.1| dihydroflavonol 4-reductase [Lobelia erinus]
Length=330

 Score =   503 bits (1295),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 243/318 (76%), Positives = 272/318 (86%), Gaps = 0/318 (0%)
 Frame = +2

Query  116   GAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEEEGSF  295
             GAAGFIGSWLV  LL+RGY + ATVRDPGN KKVKHLLELPKADTNLT+W+  + EEGSF
Sbjct  12    GAAGFIGSWLVMRLLERGYVVRATVRDPGNLKKVKHLLELPKADTNLTLWRADLTEEGSF  71

Query  296   DEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTSSAGT  475
             DEAI GC GVFHVATPMDF+SKDPENE+IKP + GVL II SC KA TVKRL+FTSSAGT
Sbjct  72    DEAIEGCHGVFHVATPMDFESKDPENEIIKPTVAGVLGIIKSCAKANTVKRLIFTSSAGT  131

Query  476   LNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFISIIPP  655
             +NVQ  Q PVYDE+ WSDLDFIY+KKMT WMYF SK LAEK AW+  KE  IDFISIIP 
Sbjct  132   VNVQENQLPVYDESNWSDLDFIYSKKMTAWMYFVSKTLAEKAAWEAAKENNIDFISIIPT  191

Query  656   LVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKAEGRF  835
             LVVGPFI PTFPPSLITALSLI G +AHYSII+QGQ+VH+DDLCE+HIFLYE PKAEGR+
Sbjct  192   LVVGPFINPTFPPSLITALSLILGKEAHYSIIEQGQFVHIDDLCESHIFLYEDPKAEGRY  251

Query  836   ICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYSLEDM  1015
             ICSSH  TI+ LA MI + WPEY IP+E KGI+K+LPV+ FSSKKL  +GF+FKYSLEDM
Sbjct  252   ICSSHDATIYQLAKMIKEKWPEYNIPTELKGIDKELPVICFSSKKLMGLGFKFKYSLEDM  311

Query  1016  YRGAIETLRKKGLLPYST  1069
             +RGAIET R+KGLLP ST
Sbjct  312   FRGAIETCREKGLLPLST  329



>gb|AGJ70142.1| dihydroflavonol-4-reductase [Vitis rotundifolia]
Length=337

 Score =   503 bits (1295),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 231/319 (72%), Positives = 271/319 (85%), Gaps = 0/319 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGAAGFIGSWLV  LL+RGY + ATVRDP N KKVKHLL+LPKA+T+LT+WK  + E
Sbjct  8     VCVTGAAGFIGSWLVMRLLERGYTVRATVRDPTNMKKVKHLLDLPKAETHLTLWKADLAE  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDPENEVIKP I G+L I+ SC  AKTV+RLVFTS
Sbjct  68    EGSFDEAIKGCNGVFHVATPMDFESKDPENEVIKPTIEGLLGIMKSCAAAKTVRRLVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+N+Q  Q PVYDE+CWSD++F  AKKMTGWMYF SK LAE+ AWK  KE  IDFIS
Sbjct  128   SAGTVNIQEHQLPVYDESCWSDMEFCRAKKMTGWMYFVSKTLAEQAAWKYAKENNIDFIS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIPPLVVGPFI  + PPSLITALS ITGN+AHYSII+QGQ++HLDDLC+AHIFL+E+PKA
Sbjct  188   IIPPLVVGPFIMSSMPPSLITALSPITGNEAHYSIIRQGQFIHLDDLCKAHIFLFENPKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSS+  TI  LA M+ + +PEY IP+EFKG++++L  V FSSKKL D+GF+FKYS
Sbjct  248   EGRYICSSNDCTILDLAKMLREKYPEYNIPTEFKGVDENLKSVCFSSKKLTDLGFEFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLP  1060
             LEDM+ GA++T R KGLLP
Sbjct  308   LEDMFTGAVDTCRAKGLLP  326



>ref|XP_006383711.1| hypothetical protein POPTR_0005s25110g [Populus trichocarpa]
 gb|ERP61508.1| hypothetical protein POPTR_0005s25110g [Populus trichocarpa]
Length=376

 Score =   504 bits (1297),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 237/370 (64%), Positives = 294/370 (79%), Gaps = 10/370 (3%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL++GY + ATVRDP N +KVKHLLELPKADT+LT+WK  +  
Sbjct  8     VCVTGASGFIGSWLVMRLLEKGYTVRATVRDPDNIRKVKHLLELPKADTHLTLWKADLSV  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEA+ GC GVFHVATPMDF+SKDPENEVIKP INGVL+I+ +C KAKTV+R+VFTS
Sbjct  68    EGSFDEAVQGCTGVFHVATPMDFESKDPENEVIKPTINGVLDIMKACAKAKTVRRIVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT++V+  +KPVYDE+CWSDL+F+   KMTGWMYF SK LAE+ AWK  KE  +DFIS
Sbjct  128   SAGTVDVEEHKKPVYDESCWSDLEFVQTVKMTGWMYFVSKTLAEQAAWKYAKENNLDFIS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             +IPPLVVGPFI  + PPSLITALSLITGN+AHY IIKQG YVHLDDLC AHI L+E+PKA
Sbjct  188   VIPPLVVGPFIMHSMPPSLITALSLITGNEAHYGIIKQGNYVHLDDLCRAHIVLFENPKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSSH  TIH LA ++ + +P+Y +P++FK I++DL  V FSSKKL D+GF+FKYS
Sbjct  248   EGRYICSSHEATIHDLAKLLREKYPKYNVPAKFKDIDEDLASVVFSSKKLLDLGFEFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYSTKEAAAIEE---------EQETVALKVEKPTAIEQKQEA  1156
             LE+M+ GA+ET R+KGL+P S ++ AA ++         E+  + L  EK  A+E+ +E 
Sbjct  308   LEEMFAGAVETCREKGLIPLSHEKQAAEDKLVGAVETCREKGPIPLSHEK-QAVEESKEN  366

Query  1157  KTVPLKPSAI  1186
               VP    A+
Sbjct  367   GRVPADSEAL  376



>dbj|BAB20075.1| dihydroflavonol 4-reductase [Torenia hybrid cultivar]
Length=349

 Score =   502 bits (1293),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 235/326 (72%), Positives = 273/326 (84%), Gaps = 1/326 (0%)
 Frame = +2

Query  95    PPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKAD-TNLTIWKG  271
             P  VCVTGA+GFIGSWLV  LL RGY +HATVRDP N KKVKHLLELP+AD  +L ++K 
Sbjct  12    PITVCVTGASGFIGSWLVMKLLNRGYTVHATVRDPENMKKVKHLLELPRADDASLRLFKA  71

Query  272   VMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRL  451
              M  EGSFDEA+  CE VFH+ATPMDF+S DPENEVIKP ++G+L+II SC KA+TVKRL
Sbjct  72    DMNVEGSFDEAVGSCECVFHMATPMDFESDDPENEVIKPTVDGMLSIIRSCAKAQTVKRL  131

Query  452   VFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKI  631
             +FT+SAGTLNV+  QKPVYDE+ WSDLDFIY+ KMTGWMYF SK+LAEK A K  KE  I
Sbjct  132   IFTNSAGTLNVEEHQKPVYDESNWSDLDFIYSTKMTGWMYFVSKVLAEKAAIKACKENNI  191

Query  632   DFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYE  811
             DFISIIPP+VVGPFI   +PPSLITALS ITGN+AHYSIIKQGQ+VH+DDLCEAHIFL E
Sbjct  192   DFISIIPPVVVGPFIIDNWPPSLITALSPITGNEAHYSIIKQGQFVHVDDLCEAHIFLSE  251

Query  812   HPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQ  991
             HPK E R+ICSSH  TI+ +A+MI + WPEY +P+EF+GI+KD+PVV FSSKKL  MGF 
Sbjct  252   HPKTEERYICSSHDATIYDIANMIREKWPEYDVPTEFEGIDKDIPVVRFSSKKLMGMGFT  311

Query  992   FKYSLEDMYRGAIETLRKKGLLPYST  1069
             FKY+LEDM+R AIET R KGLLPYS+
Sbjct  312   FKYTLEDMFREAIETCRDKGLLPYSS  337



>dbj|BAD05177.1| dihydroflavonol 4-reductase [Ipomoea batatas]
Length=273

 Score =   498 bits (1283),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 254/280 (91%), Positives = 261/280 (93%), Gaps = 9/280 (3%)
 Frame = +2

Query  443   KRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKE  622
             K+LVFTSSAGTLNVQPQQKPVYDE+CWSDLDFIYAKKMTGWMYFASKILAEKEAWK TKE
Sbjct  1     KKLVFTSSAGTLNVQPQQKPVYDESCWSDLDFIYAKKMTGWMYFASKILAEKEAWKATKE  60

Query  623   KKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIF  802
             KKIDFISIIPPLVVGPFITPTFPPSLITALSLIT NQAHYSIIKQGQYVHLDDLCEAHIF
Sbjct  61    KKIDFISIIPPLVVGPFITPTFPPSLITALSLITENQAHYSIIKQGQYVHLDDLCEAHIF  120

Query  803   LYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDM  982
             LYEHPKAEGRFICSSHHTTIHGL +MI QNWPEYYIPS+FKGIEKDLPVVYFSSKKLQDM
Sbjct  121   LYEHPKAEGRFICSSHHTTIHGLGEMIRQNWPEYYIPSQFKGIEKDLPVVYFSSKKLQDM  180

Query  983   GFQFKYSLEDMYRGAIETLRKKGLLPYSTKEA-AAIEEEQETVALKVEKPTAIEQKQEAK  1159
             GFQFKYSLEDMYRGAIETLRKKGLLPYSTKE  AAIEEEQETV LKV++PT    KQEA 
Sbjct  181   GFQFKYSLEDMYRGAIETLRKKGLLPYSTKELPAAIEEEQETVPLKVQEPT----KQEAT  236

Query  1160  TVPLKPSAIEQKQETAVPLKLEEEPTAIEQKQEAKTVPLK  1279
             TVPLK +AIE KQET VPLKL EEPTAIEQKQ  K VPLK
Sbjct  237   TVPLKAAAIEPKQET-VPLKL-EEPTAIEQKQ--KVVPLK  272



>ref|XP_002307667.2| dihydroflavonol reductase family protein [Populus trichocarpa]
 gb|EEE94663.2| dihydroflavonol reductase family protein [Populus trichocarpa]
Length=350

 Score =   501 bits (1290),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 229/334 (69%), Positives = 280/334 (84%), Gaps = 1/334 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL++GY + ATVRDP N +KVKHLLELPKADT+LT+WK  +  
Sbjct  8     VCVTGASGFIGSWLVMRLLEKGYTVRATVRDPDNIRKVKHLLELPKADTHLTLWKADLSV  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEA+ GC GVFHVATPMDF+SKDPENEVIKP INGVL+I+ +C KAKTV+R+VFTS
Sbjct  68    EGSFDEAVQGCTGVFHVATPMDFESKDPENEVIKPTINGVLDIMKACAKAKTVRRIVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT++V+  +KPVYDE+CWSDL+F+   KMTGWMYF SK LAE+ AWK  KE  +DFIS
Sbjct  128   SAGTVDVEEHKKPVYDESCWSDLEFVQTVKMTGWMYFVSKTLAEQAAWKYAKENNLDFIS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             +IPPLVVGPFI  + PPSLITALSLITGN+AHY IIKQG YVHLDDLC AHI L+E+PKA
Sbjct  188   VIPPLVVGPFIMHSMPPSLITALSLITGNEAHYGIIKQGNYVHLDDLCRAHIVLFENPKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSSH  TIH LA ++ + +P+Y +P++FK I++DL  V FSSKKL D+GF+FKYS
Sbjct  248   EGRYICSSHEATIHDLAKLLREKYPKYNVPAKFKDIDEDLASVVFSSKKLLDLGFEFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQET  1105
             LE+M+ GA+ET R+KGL+P S ++ AA E+ +E 
Sbjct  308   LEEMFAGAVETCREKGLIPLSHEKQAA-EDNKEN  340



>gb|AIU98514.1| dihydroflavonol 4-reductase [Paeonia suffruticosa]
Length=364

 Score =   501 bits (1289),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 229/319 (72%), Positives = 268/319 (84%), Gaps = 0/319 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGAAGFIGSWLV  LL+ GY + ATVRDP N +KVKHLL+LPKADT+LT+WK  +  
Sbjct  12    VCVTGAAGFIGSWLVMRLLEHGYVVRATVRDPENMRKVKHLLDLPKADTHLTLWKADLLV  71

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             +GSFDE I GC GVFHVATPMDFDSKDPENEVIKP ING+L+I+ +C KAKTV+R+VFTS
Sbjct  72    DGSFDETIKGCTGVFHVATPMDFDSKDPENEVIKPTINGMLSIMRACAKAKTVRRVVFTS  131

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NV+  Q+ VYDETCWSD++FI  KKMTGWMYF SKILAE+ AWK  KE  IDFIS
Sbjct  132   SAGTINVEEHQQSVYDETCWSDMEFIQTKKMTGWMYFVSKILAEQAAWKFAKENSIDFIS  191

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LVVGPF+ P+ PPSL+TALSLITGN+AHYSIIKQGQ+VHLDDLC AHI+L+EHPK 
Sbjct  192   IIPTLVVGPFLMPSMPPSLVTALSLITGNEAHYSIIKQGQFVHLDDLCNAHIYLFEHPKV  251

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSSH  TI  LA M+   +PEY +P+EFK +++ L  V FSSKKL D GF+FKY+
Sbjct  252   EGRYICSSHDATILSLAKMLRDKYPEYNVPTEFKDVDESLKSVSFSSKKLMDSGFEFKYN  311

Query  1004  LEDMYRGAIETLRKKGLLP  1060
             LEDM+ GAIET R+KGLLP
Sbjct  312   LEDMFVGAIETCREKGLLP  330



>gb|AHF58605.1| dihydroflavonol 4-reductase [Gerbera jamesonii]
Length=366

 Score =   499 bits (1286),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 243/325 (75%), Positives = 277/325 (85%), Gaps = 0/325 (0%)
 Frame = +2

Query  95    PPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGV  274
             P  VCVTGAAGFIGSWLV  LL+RGY +HATVR PG+ KKVKHLL LPKA TNL +WK  
Sbjct  6     PATVCVTGAAGFIGSWLVMRLLERGYVVHATVRVPGDLKKVKHLLXLPKAQTNLKLWKAD  65

Query  275   MEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLV  454
             + +EGSFDEAI GC GVFHVATPMDF+SKDPENE+IKP I GVL+II SCVKAKTVK+LV
Sbjct  66    LTQEGSFDEAIQGCHGVFHVATPMDFESKDPENEIIKPTIEGVLSIIRSCVKAKTVKKLV  125

Query  455   FTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKID  634
             FTSSA T+NVQ +Q  VYDE+ WSDLDFIY+KKMT WMYF SK LAEK AW  TKE  I 
Sbjct  126   FTSSAXTVNVQEKQLHVYDESHWSDLDFIYSKKMTAWMYFVSKTLAEKAAWDATKENNIS  185

Query  635   FISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEH  814
             F+SIIP LVVGPFIT TFPPSL+TALSLITGN+AHYSIIKQGQYVHLDDLCE HI+LYE+
Sbjct  186   FLSIIPTLVVGPFITSTFPPSLVTALSLITGNEAHYSIIKQGQYVHLDDLCECHIYLYEN  245

Query  815   PKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQF  994
             PKA+GR+ICSSH  TIH LA +I   WPEYYIP++F GI++++P+V FSSKKL D GF+F
Sbjct  246   PKAKGRYICSSHDATIHQLAKIIKDKWPEYYIPTKFPGIDEEVPIVSFSSKKLIDTGFEF  305

Query  995   KYSLEDMYRGAIETLRKKGLLPYST  1069
             KY+LEDM +GAI+T R+KGLLPYST
Sbjct  306   KYNLEDMXKGAIDTCREKGLLPYST  330



>gb|AAV71171.1| dihydroflavonol reductase [Lotus corniculatus]
 dbj|BAE19949.1| dihydroflavonol 4-reductase [Lotus japonicus]
Length=336

 Score =   498 bits (1281),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 231/323 (72%), Positives = 270/323 (84%), Gaps = 0/323 (0%)
 Frame = +2

Query  92    LPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKG  271
             +P  VCVTGAAGFIGSWLV  L++RGY + ATVRDP N KKVKHLLELP+A T LT+WK 
Sbjct  4     VPETVCVTGAAGFIGSWLVMRLMERGYMVRATVRDPANMKKVKHLLELPEAKTKLTLWKA  63

Query  272   VMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRL  451
              + EEGSFDEAI GC GVFHVATPMDF+SKDPENEVIKP INGVL+I+ +C KAKTV+RL
Sbjct  64    DLAEEGSFDEAIKGCTGVFHVATPMDFESKDPENEVIKPTINGVLDIMKACQKAKTVRRL  123

Query  452   VFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKI  631
             VFTSSAGTLNV   QK ++DE+CWSD++F    KMTGWMYF SK LAE+EAWK  KE  I
Sbjct  124   VFTSSAGTLNVIEHQKQMFDESCWSDVEFCRRVKMTGWMYFVSKTLAEQEAWKFAKEHGI  183

Query  632   DFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYE  811
             DFI+IIPPLVVG F+ PT PPSLITALS ITGN+AHYSIIKQGQYVHLDDLC AHIFL+E
Sbjct  184   DFITIIPPLVVGSFLMPTMPPSLITALSPITGNEAHYSIIKQGQYVHLDDLCLAHIFLFE  243

Query  812   HPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQ  991
             HP++EGR+ICS+   TIH +A +I   +PEY IP++FK I  +L +V FSSKK++DMGF+
Sbjct  244   HPESEGRYICSASEATIHDIAKLINSKYPEYNIPTKFKNIPDELELVRFSSKKIKDMGFE  303

Query  992   FKYSLEDMYRGAIETLRKKGLLP  1060
             FKYSLEDMY GAI+T ++KGLLP
Sbjct  304   FKYSLEDMYTGAIDTCKEKGLLP  326



>gb|AFK35141.1| unknown [Lotus japonicus]
Length=336

 Score =   496 bits (1277),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 230/323 (71%), Positives = 270/323 (84%), Gaps = 0/323 (0%)
 Frame = +2

Query  92    LPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKG  271
             +P  VCVTGAAGFIGSWLV  L++RGY + ATVRDP N KKVKHLLELP+A T LT+WK 
Sbjct  4     VPETVCVTGAAGFIGSWLVMRLMERGYMVRATVRDPANMKKVKHLLELPEAKTKLTLWKA  63

Query  272   VMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRL  451
              + EEGSFDEAI GC GVFHVATPMDF+SKDPENEVIKP INGVL+I+ +C KAKTV+RL
Sbjct  64    DLAEEGSFDEAIKGCTGVFHVATPMDFESKDPENEVIKPTINGVLDIMKACQKAKTVRRL  123

Query  452   VFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKI  631
             VFTSSAGTLNV   QK ++DE+CWSD++F    KMTGWMYF SK LAE+EAWK  KE  I
Sbjct  124   VFTSSAGTLNVIEHQKQMFDESCWSDVEFCRRVKMTGWMYFVSKTLAEQEAWKFAKEHGI  183

Query  632   DFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYE  811
             DFI+IIPPLVVG F+ PT PPSLITALS ITGN+AHYSIIKQGQYVHLDDLC AHIFL+E
Sbjct  184   DFITIIPPLVVGSFLMPTMPPSLITALSPITGNEAHYSIIKQGQYVHLDDLCLAHIFLFE  243

Query  812   HPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQ  991
             HP++EGR+ICS+   TIH +A +I   +PEY IP++FK I  +L +V FSSKK++D+GF+
Sbjct  244   HPESEGRYICSASEATIHDIAKLINSKYPEYNIPTKFKNIPDELELVRFSSKKIKDIGFE  303

Query  992   FKYSLEDMYRGAIETLRKKGLLP  1060
             FKYSLEDMY GAI+T ++KGLLP
Sbjct  304   FKYSLEDMYTGAIDTCKEKGLLP  326



>ref|XP_007017586.1| Dihydroflavonol-4-reductase [Theobroma cacao]
 gb|EOY14811.1| Dihydroflavonol-4-reductase [Theobroma cacao]
Length=345

 Score =   496 bits (1276),  Expect = 8e-171, Method: Compositional matrix adjust.
 Identities = 229/329 (70%), Positives = 275/329 (84%), Gaps = 0/329 (0%)
 Frame = +2

Query  95    PPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGV  274
             P  VCVTGA+GFIGSWLV  LL+ GY + ATVRDP N KKVKHLLELPKAD++LT+WK  
Sbjct  5     PQSVCVTGASGFIGSWLVMRLLENGYAVRATVRDPDNVKKVKHLLELPKADSHLTLWKAD  64

Query  275   MEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLV  454
             + EEGSFD AI GC GVFHVATPMDF+SKDPENEVIKP INGVL+I+ +CVKAKTVK+LV
Sbjct  65    LSEEGSFDAAIQGCTGVFHVATPMDFESKDPENEVIKPTINGVLDIMKACVKAKTVKKLV  124

Query  455   FTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKID  634
             FTSSAGT+NV+ +QKPVYDE+ WSDL+F+YAKKMTGWMYF SK LAE+ AWK  KE  +D
Sbjct  125   FTSSAGTVNVEERQKPVYDESNWSDLEFVYAKKMTGWMYFVSKTLAEQAAWKFAKENNLD  184

Query  635   FISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEH  814
             FI+IIP LV+GPF+  + PPSLIT LS ITGN+AHY+II+QGQ+VHLDDLC AHIFL+E+
Sbjct  185   FITIIPTLVIGPFLMSSMPPSLITGLSPITGNEAHYTIIRQGQFVHLDDLCMAHIFLFEN  244

Query  815   PKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQF  994
             PKAEGR+ICSSH  TI  LA M+ + +P+Y IP++FK  +++L  V FSSKKL D+GFQF
Sbjct  245   PKAEGRYICSSHEATIVELAKMLREKYPDYNIPTKFKDADENLANVVFSSKKLLDLGFQF  304

Query  995   KYSLEDMYRGAIETLRKKGLLPYSTKEAA  1081
             KYSLEDM+  A+ET R+KGL+P   K+ A
Sbjct  305   KYSLEDMFTEAVETCREKGLIPAPIKKDA  333



>dbj|BAH24302.1| dihydroflavonol 4-reductase [Rosa hybrid cultivar]
Length=349

 Score =   496 bits (1276),  Expect = 8e-171, Method: Compositional matrix adjust.
 Identities = 228/340 (67%), Positives = 280/340 (82%), Gaps = 1/340 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL RGY + ATVRDP N KKV HLL+LPKA T+LT+WK  + E
Sbjct  8     VCVTGASGFIGSWLVMRLLDRGYTVRATVRDPANKKKVNHLLDLPKAATHLTLWKADLAE  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDPENEVIKP INGVL+I+ +C+KAKTV+RLVFTS
Sbjct  68    EGSFDEAIKGCTGVFHVATPMDFESKDPENEVIKPTINGVLDIMQACLKAKTVRRLVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAG++NV+  QKPVY+E+ WSD++F    KMTGWMYFASK LAE+EAWK  KE  IDFI+
Sbjct  128   SAGSVNVEETQKPVYNESNWSDVEFCRRVKMTGWMYFASKTLAEQEAWKFAKENNIDFIT  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LV+GPF+ P+ PPSLIT LS +TGN++HYSIIKQGQ++HLDDLC++HI+LYEHPKA
Sbjct  188   IIPTLVIGPFLMPSMPPSLITGLSPVTGNESHYSIIKQGQFIHLDDLCQSHIYLYEHPKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSSH  TIH +A ++ + +PEY +P+ FKGIE++LP V+FSSKKL + GF+FKYS
Sbjct  248   EGRYICSSHDATIHEIAKLLKEKYPEYNVPTTFKGIEENLPKVHFSSKKLLETGFEFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYSTKEAAAIE-EEQETVALKV  1120
             LEDM+ GA++  + KGLLP  T+     E +E   V +KV
Sbjct  308   LEDMFVGAVDACKAKGLLPPPTERVEKQEVDESSVVRVKV  347



>gb|AAL89715.1|AF483836_1 dihydroflavonol-4-reductase [Vaccinium macrocarpon]
Length=354

 Score =   495 bits (1275),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 240/331 (73%), Positives = 270/331 (82%), Gaps = 1/331 (0%)
 Frame = +2

Query  92    LPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKG  271
             L   VCVTGAAGFIGSWL+  LL+RGY + ATVRDPGN KKVKHLLELPKADTNLT+WK 
Sbjct  8     LGTTVCVTGAAGFIGSWLIMRLLERGYVVRATVRDPGNLKKVKHLLELPKADTNLTLWKA  67

Query  272   VMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRL  451
              + EEGSFDEAI GC GVFHVATPMDF+SKDPENEVIKP INGVL+II SC KAKTVKRL
Sbjct  68    DLNEEGSFDEAIEGCVGVFHVATPMDFESKDPENEVIKPTINGVLSIIKSCTKAKTVKRL  127

Query  452   VFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKI  631
             VFTSSAG +  Q  Q  V+DE  WSD+DF+Y KKMTGW YF SK LAE+ A +  KE  I
Sbjct  128   VFTSSAGAVVDQEHQPLVFDENNWSDVDFLYDKKMTGWTYFVSKTLAERAAMEAAKEISI  187

Query  632   DFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYE  811
             DFISIIP LVVGPFI+PTFPPSLIT LS ITGN  HYSIIKQGQ+VHLDDLCE+HI+L+E
Sbjct  188   DFISIIPTLVVGPFISPTFPPSLITVLSPITGNDPHYSIIKQGQFVHLDDLCESHIYLFE  247

Query  812   HPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQ  991
             HP+AEGR+ICSSH  TI+ LA ++ +N P    P+EFKGI KDLP V F SKKL  MGFQ
Sbjct  248   HPEAEGRYICSSHDATIYDLAKIMRRNAPSTMSPTEFKGIPKDLPNVSFPSKKLIGMGFQ  307

Query  992   FKYSLEDMYRGAIETLRK-KGLLPYSTKEAA  1081
             FKYSLEDM+RGAI+T ++ KGLLPYS +  A
Sbjct  308   FKYSLEDMFRGAIDTCQETKGLLPYSNETTA  338



>ref|XP_011028872.1| PREDICTED: dihydroflavonol-4-reductase-like isoform X1 [Populus 
euphratica]
Length=346

 Score =   495 bits (1274),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 227/334 (68%), Positives = 277/334 (83%), Gaps = 1/334 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWL+  LL+RGY + ATVRDP N KKVKHLLELPKA T+LT+WK  +  
Sbjct  8     VCVTGASGFIGSWLIMRLLERGYAVRATVRDPDNMKKVKHLLELPKASTHLTLWKADLSV  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGS+DEAI GC GVFHVATPMDF+SKDPENEVIKP INGVL+I+ +C K+KTV++++FTS
Sbjct  68    EGSYDEAIQGCTGVFHVATPMDFESKDPENEVIKPTINGVLDIMRACAKSKTVRKIIFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT++V+ ++KPVYDE+CWSDLDF+   KMTGWMYF SK LAE+ AWK  KE  +DFIS
Sbjct  128   SAGTVDVEEKRKPVYDESCWSDLDFVQRIKMTGWMYFVSKTLAEQAAWKFAKENNLDFIS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LVVGPFI  + PPSL+TALSLITGN+AHY IIKQG YVHLDDLC +HIFLYE+PKA
Sbjct  188   IIPTLVVGPFIMQSMPPSLLTALSLITGNEAHYGIIKQGHYVHLDDLCMSHIFLYENPKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+IC+S    IH LA ++ + +PEY +P+ FK I+++LP V FSSKKL D+GF+FKYS
Sbjct  248   EGRYICNSDDANIHDLAKLLREKYPEYNVPAMFKDIDENLPCVAFSSKKLTDLGFEFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQET  1105
             LEDM  GA+ET R+KGL+P S K+  A+EE +E 
Sbjct  308   LEDMVVGAVETCREKGLIPLSHKK-QAVEECKEN  340



>gb|AFG28176.1| putative dihydroflavonol 4-reductase [Vitis bellula]
Length=337

 Score =   494 bits (1273),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 227/319 (71%), Positives = 268/319 (84%), Gaps = 0/319 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+RGY + ATVRDP N KKVKHLL+LPKA+T+LT+WK  + +
Sbjct  8     VCVTGASGFIGSWLVMRLLERGYTVRATVRDPTNVKKVKHLLDLPKAETHLTLWKADLAD  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDPENEVIKP I G+L I+ SC  AKTV+RLVFTS
Sbjct  68    EGSFDEAIKGCTGVFHVATPMDFESKDPENEVIKPTIEGMLGIMKSCAAAKTVRRLVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+N+Q  Q PVYDE+CWSD++F  AKKMTGWMYF SK LAE+ AWK  KE  IDFIS
Sbjct  128   SAGTVNIQEHQLPVYDESCWSDMEFCRAKKMTGWMYFVSKTLAEQAAWKYAKENNIDFIS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LVVGPFI  + PPSLITALS ITGN+AHYSII+QGQ+VHLDDLC AHI+L+E+PKA
Sbjct  188   IIPTLVVGPFIMSSMPPSLITALSPITGNEAHYSIIRQGQFVHLDDLCNAHIYLFENPKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSS+   I  LA M+ + +PEY IP+EFKG++++L  V FSSKKL D+GF+FKYS
Sbjct  248   EGRYICSSNDCIILDLAKMLREKYPEYNIPTEFKGVDENLKSVCFSSKKLTDLGFEFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLP  1060
             LEDM+ GA++T R KGLLP
Sbjct  308   LEDMFTGAVDTCRAKGLLP  326



>gb|AIU34714.1| dihydroflavonol 4-reductase 1 [Rosa rugosa]
Length=349

 Score =   494 bits (1273),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 226/340 (66%), Positives = 281/340 (83%), Gaps = 1/340 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GF+GSWLV  LL+RGY + ATVRDP N+KKVKHLL+LPKA T+LT+WK  + E
Sbjct  8     VCVTGASGFVGSWLVMRLLERGYTVRATVRDPANSKKVKHLLDLPKAATHLTLWKADLAE  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDPENEVIKP INGVL+I+ +C+KAKTV+RLVFT+
Sbjct  68    EGSFDEAIKGCTGVFHVATPMDFESKDPENEVIKPTINGVLDIMKACLKAKTVRRLVFTA  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAG++NV+  QKPVY+E+ WSD++F    KMTGWMYF SK LAE+EAWK  KE  IDFI+
Sbjct  128   SAGSVNVEETQKPVYNESNWSDVEFCRRVKMTGWMYFVSKTLAEQEAWKFAKENNIDFIT  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LV+GPF+ P  PPSLIT LS +TGN++HYSIIKQGQ++HLDDLC++HI+LYEHPKA
Sbjct  188   IIPTLVIGPFLMPAMPPSLITGLSPLTGNESHYSIIKQGQFIHLDDLCQSHIYLYEHPKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSSH  TIH +A ++ + +PEY +P+ FKGIE++LP V+FSSKKL + GF+FKYS
Sbjct  248   EGRYICSSHDATIHEIAKLLREKYPEYNVPTTFKGIEENLPKVHFSSKKLLETGFEFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYSTKEAAAIE-EEQETVALKV  1120
             LEDM+ GA++  + KGLLP  T+     E +E   V +KV
Sbjct  308   LEDMFVGAVDACKAKGLLPPPTERVEKQEVDESSVVRVKV  347



>dbj|BAD34461.1| dihydroflavonol 4-reductase [Eustoma grandiflorum]
Length=347

 Score =   494 bits (1273),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 237/332 (71%), Positives = 280/332 (84%), Gaps = 0/332 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGAAG+IGSWLV  LL+RGY + ATVRDPG+ KKVKHL ELPKA TNLT+ K  + E
Sbjct  11    VCVTGAAGYIGSWLVMRLLERGYTVRATVRDPGDVKKVKHLFELPKASTNLTVLKADLIE  70

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFH+ATPM+F+SK+PENEVIKP I+GVL++I S VKAKTVK++VFTS
Sbjct  71    EGSFDEAIQGCHGVFHMATPMEFESKNPENEVIKPTIDGVLSVIRSSVKAKTVKKIVFTS  130

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT++VQ +QK VYDE   SDLDFIY+KKMTGWMYF SKILAEK AW+  K   I FIS
Sbjct  131   SAGTVDVQKEQKSVYDENDQSDLDFIYSKKMTGWMYFVSKILAEKAAWEAAKANNIGFIS  190

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP +VVGPFIT TFPPSLITALSL+TGN+AHYSIIKQGQ+VHLDDLCEAHIFLYEHP+A
Sbjct  191   IIPTVVVGPFITCTFPPSLITALSLLTGNEAHYSIIKQGQFVHLDDLCEAHIFLYEHPEA  250

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSSH TTI+ LA MI   WPEY +P+  KGI++D+P+  FS KKL  MGFQ+KY+
Sbjct  251   EGRYICSSHDTTINDLAKMIRHRWPEYNVPTNLKGIDEDIPLASFSFKKLTGMGFQYKYT  310

Query  1004  LEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQ  1099
             LEDM+RGAIET R+KGLLP+S +    +++ +
Sbjct  311   LEDMFRGAIETCREKGLLPHSNENHVIMQQTE  342



>gb|AEN71545.1| dihydroflavonol 4-reductase [Paeonia suffruticosa]
Length=364

 Score =   495 bits (1274),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 228/319 (71%), Positives = 268/319 (84%), Gaps = 0/319 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGAAGFIGSWLV  LL+ GY + ATVRDP N +KVKHLL+LPKADT+LT+WK  +  
Sbjct  12    VCVTGAAGFIGSWLVMRLLEHGYVVRATVRDPENMRKVKHLLDLPKADTHLTLWKADLLV  71

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             +GSFDEAI GC GVFHVATPMDF+SKDPENEVIKP I+G+L+I+ +  KAKTV+R+VFTS
Sbjct  72    DGSFDEAIKGCTGVFHVATPMDFESKDPENEVIKPTIDGMLSIMRAWAKAKTVRRVVFTS  131

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NVQ  Q+ VYDETCWSD++FI  KKMTGWMYF SKILAE+ AWK  KE  IDFIS
Sbjct  132   SAGTVNVQQHQQSVYDETCWSDMEFIQTKKMTGWMYFVSKILAEQAAWKFAKENSIDFIS  191

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LVVGPF+ P+ PPSL+TALSLITGN+AHYSIIKQGQ+VHLDDLC AHI+L+EHPK 
Sbjct  192   IIPTLVVGPFLMPSMPPSLVTALSLITGNEAHYSIIKQGQFVHLDDLCNAHIYLFEHPKV  251

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSSH  TI  LA M+   +PEY +P+EFK +++ L  V FSSKKL D GF+FKY+
Sbjct  252   EGRYICSSHDATIFSLAKMLRDKYPEYNVPTEFKDVDESLKSVSFSSKKLMDSGFEFKYN  311

Query  1004  LEDMYRGAIETLRKKGLLP  1060
             LEDM+ GAIET R+KGLLP
Sbjct  312   LEDMFVGAIETCREKGLLP  330



>ref|NP_001268144.1| dihydroflavonol-4-reductase [Vitis vinifera]
 pdb|2C29|D Chain D, Structure Of Dihydroflavonol Reductase From Vitis Vinifera 
At 1.8 A.
 pdb|2C29|F Chain F, Structure Of Dihydroflavonol Reductase From Vitis Vinifera 
At 1.8 A.
 pdb|2IOD|A Chain A, Binding Of Two Substrate Analogue Molecules To Dihydroflavonol-4-Reductase 
Alters The Functional Geometry Of The 
Catalytic Site
 pdb|2IOD|B Chain B, Binding Of Two Substrate Analogue Molecules To Dihydroflavonol-4-Reductase 
Alters The Functional Geometry Of The 
Catalytic Site
 pdb|2IOD|C Chain C, Binding Of Two Substrate Analogue Molecules To Dihydroflavonol-4-Reductase 
Alters The Functional Geometry Of The 
Catalytic Site
 pdb|2IOD|D Chain D, Binding Of Two Substrate Analogue Molecules To Dihydroflavonol-4-Reductase 
Alters The Functional Geometry Of The 
Catalytic Site
 pdb|2NNL|D Chain D, Binding Of Two Substrate Analogue Molecules To Dihydroflavonol-4-Reductase 
Alters The Functional Geometry Of The 
Catalytic Site
 pdb|2NNL|F Chain F, Binding Of Two Substrate Analogue Molecules To Dihydroflavonol-4-Reductase 
Alters The Functional Geometry Of The 
Catalytic Site
 pdb|3C1T|A Chain A, Binding Of Two Substrate Analogue Molecules To Dihydroflavonol 
4-Reductase Alters The Functional Geometry Of The 
Catalytic Site
 pdb|3C1T|B Chain B, Binding Of Two Substrate Analogue Molecules To Dihydroflavonol 
4-Reductase Alters The Functional Geometry Of The 
Catalytic Site
 pdb|3C1T|C Chain C, Binding Of Two Substrate Analogue Molecules To Dihydroflavonol 
4-Reductase Alters The Functional Geometry Of The 
Catalytic Site
 pdb|3C1T|D Chain D, Binding Of Two Substrate Analogue Molecules To Dihydroflavonol 
4-Reductase Alters The Functional Geometry Of The 
Catalytic Site
 pdb|3BXX|A Chain A, Binding Of Two Substrate Analogue Molecules To Dihydroflavonol 
4-Reductase Alters The Functional Geometry Of The 
Catalytic Site
 pdb|3BXX|B Chain B, Binding Of Two Substrate Analogue Molecules To Dihydroflavonol 
4-Reductase Alters The Functional Geometry Of The 
Catalytic Site
 pdb|3BXX|C Chain C, Binding Of Two Substrate Analogue Molecules To Dihydroflavonol 
4-Reductase Alters The Functional Geometry Of The 
Catalytic Site
 pdb|3BXX|D Chain D, Binding Of Two Substrate Analogue Molecules To Dihydroflavonol 
4-Reductase Alters The Functional Geometry Of The 
Catalytic Site
 pdb|3BXX|E Chain E, Binding Of Two Substrate Analogue Molecules To Dihydroflavonol 
4-Reductase Alters The Functional Geometry Of The 
Catalytic Site
 pdb|3BXX|F Chain F, Binding Of Two Substrate Analogue Molecules To Dihydroflavonol 
4-Reductase Alters The Functional Geometry Of The 
Catalytic Site
 emb|CAA72420.1| dihydroflavonol 4-reductase [Vitis vinifera]
 gb|AAX12423.1| dihydroflavonol 4-reductase [Vitis vinifera]
Length=337

 Score =   494 bits (1271),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 226/319 (71%), Positives = 267/319 (84%), Gaps = 0/319 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+RGY + ATVRDP N KKVKHLL+LPKA+T+LT+WK  + +
Sbjct  8     VCVTGASGFIGSWLVMRLLERGYTVRATVRDPTNVKKVKHLLDLPKAETHLTLWKADLAD  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDPENEVIKP I G+L I+ SC  AKTV+RLVFTS
Sbjct  68    EGSFDEAIKGCTGVFHVATPMDFESKDPENEVIKPTIEGMLGIMKSCAAAKTVRRLVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+N+Q  Q PVYDE+CWSD++F  AKKMT WMYF SK LAE+ AWK  KE  IDFI+
Sbjct  128   SAGTVNIQEHQLPVYDESCWSDMEFCRAKKMTAWMYFVSKTLAEQAAWKYAKENNIDFIT  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LVVGPFI  + PPSLITALS ITGN+AHYSII+QGQ+VHLDDLC AHI+L+E+PKA
Sbjct  188   IIPTLVVGPFIMSSMPPSLITALSPITGNEAHYSIIRQGQFVHLDDLCNAHIYLFENPKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSSH   I  LA M+ + +PEY IP+EFKG++++L  V FSSKKL D+GF+FKYS
Sbjct  248   EGRYICSSHDCIILDLAKMLREKYPEYNIPTEFKGVDENLKSVCFSSKKLTDLGFEFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLP  1060
             LEDM+ GA++T R KGLLP
Sbjct  308   LEDMFTGAVDTCRAKGLLP  326



>dbj|BAA12723.1| dihydroflavonol 4-reductase [Rosa hybrid cultivar]
Length=349

 Score =   494 bits (1271),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 228/340 (67%), Positives = 280/340 (82%), Gaps = 1/340 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL RGY + ATVRDP N KKV HLL+LPKA T+LT+WK  + E
Sbjct  8     VCVTGASGFIGSWLVMRLLDRGYTVRATVRDPANKKKVNHLLDLPKAATHLTLWKADLAE  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDPENEVIKP INGVL+I+ +C+KAKTV+RLVFTS
Sbjct  68    EGSFDEAIKGCTGVFHVATPMDFESKDPENEVIKPTINGVLDIMQACLKAKTVRRLVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAG++NV+  QKPVY+E+ WSD++F    KMTGWMYFASK LAE+EAWK  KE  IDFI+
Sbjct  128   SAGSVNVEETQKPVYNESNWSDVEFCRRVKMTGWMYFASKTLAEQEAWKFAKENNIDFIT  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LV+GPF+ P+ PPSLIT LS +TGN++HYSIIKQGQ++HLDDLC++HI+LYEHPKA
Sbjct  188   IIPTLVIGPFLMPSMPPSLITGLSPLTGNESHYSIIKQGQFIHLDDLCQSHIYLYEHPKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSSH  TIH +A ++   +PEY +P+ FKGIE++LP V+FSSKKL + GF+FKYS
Sbjct  248   EGRYICSSHDATIHEIAKLLKGKYPEYNVPTTFKGIEENLPKVHFSSKKLLETGFEFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYSTKEAAAIE-EEQETVALKV  1120
             LEDM+ GA++  ++KGLLP  T+     E +E   V +KV
Sbjct  308   LEDMFVGAVDACKEKGLLPPPTERVEKQEVDESSVVRVKV  347



>gb|AAX12422.1| dihydroflavonol 4-reductase [Rosa hybrid cultivar]
Length=349

 Score =   494 bits (1271),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 228/340 (67%), Positives = 278/340 (82%), Gaps = 1/340 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL RGY + AT RDP N KKVKHLL+LPKA T+LT+WK  + E
Sbjct  8     VCVTGASGFIGSWLVMRLLDRGYTVRATARDPANKKKVKHLLDLPKAATHLTLWKADLAE  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDPENEVIKPAINGVL+I+ +C+KAKTV+RLVFTS
Sbjct  68    EGSFDEAIKGCTGVFHVATPMDFESKDPENEVIKPAINGVLDIMQACLKAKTVRRLVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAG++NV+  QKPVY+E+ WSD++F    KMTGWMYF SK LAE+EAWK  KE  IDFI+
Sbjct  128   SAGSVNVEETQKPVYNESNWSDIEFCRRVKMTGWMYFVSKTLAEQEAWKFAKENNIDFIT  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LVVGPF+ P  PPSLIT LS +TGN++HYSIIKQGQ++HLDDLC++HI+LYEHPKA
Sbjct  188   IIPTLVVGPFLMPAMPPSLITGLSPLTGNESHYSIIKQGQFIHLDDLCQSHIYLYEHPKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSSH  TIH +A ++ + +PEY +P+ FKGIE++LP V+FSS KL + GF+FKYS
Sbjct  248   EGRYICSSHDATIHEIAKLLREKYPEYNVPTTFKGIEENLPKVHFSSNKLLETGFEFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYSTKEAAAIE-EEQETVALKV  1120
             LEDM+ GA++  + KGLLP  T+     E +E   V +KV
Sbjct  308   LEDMFVGAVDACKAKGLLPPPTERVEKQEVDESSVVRVKV  347



>gb|AGO02174.1| dihydroflavonol 4-reductase [Ampelopsis grossedentata]
Length=337

 Score =   493 bits (1270),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 227/319 (71%), Positives = 267/319 (84%), Gaps = 0/319 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGAAGFIGSW+V  LL+RGY + ATVRDP N KKVKHLL+LPKA+T+LT+WK  + E
Sbjct  8     VCVTGAAGFIGSWMVMRLLERGYIVRATVRDPTNMKKVKHLLDLPKAETHLTLWKADLAE  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSF+EAI GC GVFHVATPMDF+SKDPENEVIKP I G+L I+ SC  AKTV+RLVFTS
Sbjct  68    EGSFNEAIKGCTGVFHVATPMDFESKDPENEVIKPTIEGMLGIMKSCAAAKTVRRLVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+N+Q +Q+PVYDE CWSD++F  AKKMTGWMYF SK LAE+ AWK  KE  IDFIS
Sbjct  128   SAGTVNIQERQQPVYDENCWSDMEFCRAKKMTGWMYFVSKTLAEQAAWKYAKENNIDFIS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LVVGPFI  + PPSLITA S ITGN+AHYSII+QGQ+VHLDDLC AHI+L+E+PKA
Sbjct  188   IIPTLVVGPFIMSSMPPSLITAPSPITGNEAHYSIIRQGQFVHLDDLCNAHIYLFENPKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSSH   I  LA M+ + +PEY IP+EFKG++++L  V F SKKL D+GF+FKYS
Sbjct  248   EGRYICSSHDCIILDLAKMLKEKYPEYNIPTEFKGVDENLKSVRFCSKKLTDLGFEFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLP  1060
             LEDM+ GA+ET R KGLLP
Sbjct  308   LEDMFTGAVETCRAKGLLP  326



>dbj|BAE19953.1| dihydroflavonol 4-reductase [Lotus japonicus]
Length=340

 Score =   493 bits (1270),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 225/326 (69%), Positives = 271/326 (83%), Gaps = 0/326 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGAAGFIGSWLV  L++RGY + AT+RDP N KKVKHLLELP A T L++WK  + E
Sbjct  8     VCVTGAAGFIGSWLVMRLIERGYTVRATIRDPANMKKVKHLLELPDAKTKLSLWKADLAE  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDPENEVIKP ING+L+I+ +C KAKTV+RLVFTS
Sbjct  68    EGSFDEAIRGCTGVFHVATPMDFESKDPENEVIKPTINGLLDILKACEKAKTVRRLVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT++V    KPV DETCWSD++F    KMTGWMYF SK  AE+EAWK  KE  IDF+S
Sbjct  128   SAGTVDVTEHPKPVIDETCWSDIEFCLRVKMTGWMYFVSKTRAEQEAWKYAKEHNIDFVS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             +IPPLVVGPF+ PT PPSLITALSLITGN+AHYSIIKQGQYVHLDDLC AHIFL+E+PKA
Sbjct  188   VIPPLVVGPFLMPTMPPSLITALSLITGNEAHYSIIKQGQYVHLDDLCLAHIFLFENPKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             +GR++CS++  TIH +A MI + +PE+ +P++FK I  +L ++ FSSKK+ D+GF+FKYS
Sbjct  248   QGRYMCSAYEATIHEVARMINKKYPEFNVPTKFKDIPDELDIIKFSSKKITDLGFKFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYSTKEAA  1081
             LEDMY GA+ET R+KGLLP + +  A
Sbjct  308   LEDMYTGAVETCREKGLLPKTAETPA  333



>gb|AHK10250.1| dihydroflavonol 4-reductase [Vitis davidii]
Length=337

 Score =   493 bits (1269),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 227/319 (71%), Positives = 267/319 (84%), Gaps = 0/319 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+RGY + ATVRDP N KKVKHLL+LPKA+T+LT+WK  + +
Sbjct  8     VCVTGASGFIGSWLVMRLLERGYTVRATVRDPTNVKKVKHLLDLPKAETHLTLWKADLAD  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDPENEVIKP I G+L I+ SC  AKTV+RLVFTS
Sbjct  68    EGSFDEAIKGCTGVFHVATPMDFESKDPENEVIKPTIEGMLGIMKSCAAAKTVRRLVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+N+Q  Q PVYDE+CWSDL+F  AKKMT WMYF SK LAE+ AWK  KE  IDFIS
Sbjct  128   SAGTVNIQEHQLPVYDESCWSDLEFCRAKKMTAWMYFVSKTLAEQAAWKYAKENNIDFIS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LVVGPFI  + PPSLITALS ITGN+AHYSII+QGQ+VHLDDLC AHI+L+E+PKA
Sbjct  188   IIPTLVVGPFIMSSMPPSLITALSPITGNEAHYSIIRQGQFVHLDDLCNAHIYLFENPKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSS+   I  LA M+ + +PEY IP+EFKG++++L  V FSSKKL D+GF+FKYS
Sbjct  248   EGRYICSSNDCIILDLAKMLREKYPEYNIPTEFKGVDENLKSVCFSSKKLTDLGFEFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLP  1060
             LEDM+ GA++T R KGLLP
Sbjct  308   LEDMFTGAVDTCRAKGLLP  326



>gb|ABY25288.1| dihydroflavonol 4-reductase C [Convolvulus arvensis]
Length=354

 Score =   493 bits (1270),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 261/349 (75%), Positives = 286/349 (82%), Gaps = 4/349 (1%)
 Frame = +2

Query  68    MVDGNHP--LLPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPK  241
             M  G H   L  PKVCVTGA+G+IGSWLV  LLQRGY +HATVRDPGNTK+VKHLL+LPK
Sbjct  1     MSAGGHASTLPAPKVCVTGASGYIGSWLVMKLLQRGYIVHATVRDPGNTKRVKHLLQLPK  60

Query  242   ADTNLTIWKGVMEEEGSFDEAIAGCEGVFHVA-TPMDFDSKDPENEVIKPAINGVLNIIN  418
             AD NL  +KGV+EEEGSFDEAIAGCEGVFHVA T +D  S DPENE+I+PA+ G+L+IIN
Sbjct  61    ADRNLKFYKGVLEEEGSFDEAIAGCEGVFHVAATAVDVVSDDPENEIIRPAVKGILSIIN  120

Query  419   SCVKAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEK  598
             SC KAKTVKRLV+TSSA TL  Q  QKPVYDE+ WSDLD IYA KM GWMYFASK LAEK
Sbjct  121   SCAKAKTVKRLVYTSSAVTLIFQENQKPVYDESNWSDLDLIYAVKMPGWMYFASKTLAEK  180

Query  599   EAWKVTKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLD  778
             EAWK  K K+IDFISIIPPLV+GP I PT P SL  ALS ITGN+A Y  IKQGQ+VHLD
Sbjct  181   EAWKAAKAKQIDFISIIPPLVIGPSIIPTLPLSLSLALSPITGNEAQYFPIKQGQFVHLD  240

Query  779   DLCEAHIFLYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYF  958
             DLCEA IFL EHPKAEGRFICSSH  TIH LA MI QNWPEY +PSEFKGIEKDLPVV  
Sbjct  241   DLCEAQIFLLEHPKAEGRFICSSHDATIHDLAKMIRQNWPEYNVPSEFKGIEKDLPVVSL  300

Query  959   SSKKLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQET  1105
             SSKKLQDMGFQFKY+LEDMYR +IETLR+KGL PYS K +   E+E E 
Sbjct  301   SSKKLQDMGFQFKYTLEDMYRESIETLREKGLPPYSIK-STPTEQEWEN  348



>ref|XP_007160734.1| hypothetical protein PHAVU_001G012700g [Phaseolus vulgaris]
 gb|ESW32728.1| hypothetical protein PHAVU_001G012700g [Phaseolus vulgaris]
Length=354

 Score =   493 bits (1270),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 228/319 (71%), Positives = 266/319 (83%), Gaps = 0/319 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+RGY + ATVRDPGN KKVKHL+ELP A T L++WK  + E
Sbjct  8     VCVTGASGFIGSWLVMRLLERGYTVRATVRDPGNMKKVKHLVELPGAKTKLSLWKADLGE  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDPENEVI P +NG+L+I+ +C+K KTV+RL+FTS
Sbjct  68    EGSFDEAIKGCTGVFHVATPMDFESKDPENEVINPTVNGILDIMKACMKTKTVRRLIFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGTLNV   QKPV DETCWSD+DF    KMTGWMYF SK LAEKEAWK  KE  +DFI+
Sbjct  128   SAGTLNVFEHQKPVMDETCWSDVDFCRRVKMTGWMYFVSKTLAEKEAWKFAKEHGMDFIT  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIPPLVVGPF+ PT PPSLITALS ITGN+ HYSIIKQGQ+VHLDDLC AHIFL+E PK 
Sbjct  188   IIPPLVVGPFLMPTMPPSLITALSPITGNEGHYSIIKQGQFVHLDDLCLAHIFLFEEPKV  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICS+  TTIH +A +I + +P+Y IP++FK I  +L +V FSSKK++D+GFQFKYS
Sbjct  248   EGRYICSACDTTIHHIAKLINEKYPDYNIPTKFKNIPDELELVRFSSKKIRDLGFQFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLP  1060
             LEDMY GAI+T R KGLLP
Sbjct  308   LEDMYCGAIDTCRDKGLLP  326



>dbj|BAJ08042.1| dihydroflavonol 4-reductase [Cyclamen graecum]
Length=344

 Score =   493 bits (1268),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 241/328 (73%), Positives = 279/328 (85%), Gaps = 0/328 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGAAGFIGSWLV  LL+RGY + ATVRDP N KKVKHLL+LPKA+TNLT+WK  + E
Sbjct  10    VCVTGAAGFIGSWLVMRLLERGYAVRATVRDPANMKKVKHLLDLPKAETNLTLWKADLTE  69

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDPENEVIKP INGVL+II+SCVKAK VK+LVFTS
Sbjct  70    EGSFDEAIQGCSGVFHVATPMDFESKDPENEVIKPTINGVLSIISSCVKAKIVKKLVFTS  129

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT++V    KP Y+E+ WSDL+FI   KMTGWMYF SK LAEK AW+  KE  I+FIS
Sbjct  130   SAGTVDVCEHGKPEYNESDWSDLEFINKIKMTGWMYFVSKTLAEKAAWEAAKENNIEFIS  189

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LVVGPFI  +FPPSLITALS ITGN+ HY IIKQGQ+VHLDDLCE+HI+LYEHPKA
Sbjct  190   IIPTLVVGPFIMQSFPPSLITALSPITGNEGHYGIIKQGQFVHLDDLCESHIYLYEHPKA  249

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSSH  TI+ LA M+ + WPEY IP+EFKGI+++LP V FSS+KL+ MGF+FKYS
Sbjct  250   EGRYICSSHEATIYELAKMLKEKWPEYNIPTEFKGIDENLPNVRFSSEKLKGMGFEFKYS  309

Query  1004  LEDMYRGAIETLRKKGLLPYSTKEAAAI  1087
             LEDM+RGAI+T R+KGLLP S++  AAI
Sbjct  310   LEDMFRGAIDTCREKGLLPCSSETPAAI  337



>gb|KDP38534.1| hypothetical protein JCGZ_04459 [Jatropha curcas]
Length=357

 Score =   493 bits (1270),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 233/332 (70%), Positives = 271/332 (82%), Gaps = 1/332 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWL+  LL+RGY + ATVRDP N KKV+HLLELPKA T+L+ WK  +  
Sbjct  8     VCVTGASGFIGSWLIMRLLERGYTVRATVRDPDNRKKVQHLLELPKAKTHLSFWKADLSL  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDFDSKDPENEVIKP INGVL+I+ +C KAKTVKR+VFTS
Sbjct  68    EGSFDEAIQGCTGVFHVATPMDFDSKDPENEVIKPTINGVLDIMRACAKAKTVKRIVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT++V+  +K VYDE CWSDL FI  KKMTGWMYF SK LAEK AW   KE  +DFIS
Sbjct  128   SAGTVDVEEHRKEVYDENCWSDLKFIQTKKMTGWMYFVSKSLAEKAAWDYAKENGLDFIS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LVVGPFI P+ PPSLITALSLITGN+AHYSI+KQG YVHLDDLC +HIFL+E+PKA
Sbjct  188   IIPTLVVGPFIMPSMPPSLITALSLITGNEAHYSILKQGHYVHLDDLCNSHIFLFENPKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSS   TI+ +A ++ Q +PEY IP++FK IE+++    FSSKKL D+GFQFKY+
Sbjct  248   EGRYICSSDDATIYEIAGLLKQKYPEYNIPTKFKDIEEEIKNPTFSSKKLLDLGFQFKYN  307

Query  1004  LEDMYRGAIETLRKKGLLPYST-KEAAAIEEE  1096
             LEDM+ GA+ET R KGLLP S  KEA    EE
Sbjct  308   LEDMFTGAVETCRSKGLLPVSDGKEAMKKSEE  339



>gb|AAN63056.1| dihydroflavonol reductase [Populus tremuloides]
Length=346

 Score =   493 bits (1268),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 223/337 (66%), Positives = 279/337 (83%), Gaps = 1/337 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWL+  LL++GY + ATVRDP N KKVKHLLELPKA T+LT+WK  + E
Sbjct  8     VCVTGASGFIGSWLIMRLLEKGYAVRATVRDPDNMKKVKHLLELPKASTHLTLWKADLSE  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGS+DEAI GC GVFHVATPMDF+SKDPENEVIKP INGVL+I+ +C K+KT+++++FTS
Sbjct  68    EGSYDEAIQGCTGVFHVATPMDFESKDPENEVIKPTINGVLDIMRACAKSKTIRKIIFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT++V+ ++KPVYDE+CWSDLDF+   KMTGWMYF SK LAE+ AWK  ++  +DFIS
Sbjct  128   SAGTVDVEEKRKPVYDESCWSDLDFVQGIKMTGWMYFVSKTLAEQAAWKFAEDNNLDFIS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LVVGPFI  + PPSL+TALSLITGN+AHY I+KQG YVHLDDLC +HIFLYE+PKA
Sbjct  188   IIPTLVVGPFIMQSMPPSLLTALSLITGNEAHYGILKQGHYVHLDDLCMSHIFLYENPKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+IC+S    IH LA ++ + +PEY +P +FK I+++L  V FSSKKL D+GF+FKYS
Sbjct  248   EGRYICNSDDANIHDLAQLLREKYPEYNVPDKFKDIDENLACVAFSSKKLTDLGFEFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVAL  1114
             LEDM+ GA+ET R+KGL+P S K+  A+EE +E   L
Sbjct  308   LEDMFAGAVETCREKGLIPLSHKK-QAVEECKENEVL  343



>gb|AAF23884.2|AF117263_1 dihydroflavanol reductase 3 [Lotus corniculatus]
Length=336

 Score =   492 bits (1267),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 229/323 (71%), Positives = 269/323 (83%), Gaps = 0/323 (0%)
 Frame = +2

Query  92    LPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKG  271
             +P  VCVTGAAGFIGSWLV  L++RGY + ATVRDP N KKVKHLLELP+A T  T+WK 
Sbjct  4     VPETVCVTGAAGFIGSWLVMRLMERGYMVRATVRDPANMKKVKHLLELPEAKTKPTLWKA  63

Query  272   VMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRL  451
              + EEGSFDEAI GC GVFHVATPMDF+SK+PENEVIKP INGVL+I+ +C KAKTV+RL
Sbjct  64    DLAEEGSFDEAIKGCTGVFHVATPMDFESKNPENEVIKPTINGVLDIMKACQKAKTVRRL  123

Query  452   VFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKI  631
             VFTSSAGTLNV   QK ++DE+CWSD++F    KMTGWMYF SK LAE+EAWK  KE  I
Sbjct  124   VFTSSAGTLNVIEHQKQMFDESCWSDVEFCRRVKMTGWMYFVSKTLAEQEAWKFAKEHGI  183

Query  632   DFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYE  811
             DFI+IIPPLVVG F+ PT PPSLITALS ITGN+AHYSIIKQGQYVHLDDLC AHIFL+E
Sbjct  184   DFITIIPPLVVGSFLMPTMPPSLITALSPITGNEAHYSIIKQGQYVHLDDLCLAHIFLFE  243

Query  812   HPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQ  991
             HP++EGR+ICS+   TIH +A +I   +PEY IP++FK I  +L +V FSSKK++DMGF+
Sbjct  244   HPESEGRYICSASEATIHDIAKLINSKYPEYNIPTKFKNIPDELELVRFSSKKIKDMGFE  303

Query  992   FKYSLEDMYRGAIETLRKKGLLP  1060
             FKYSLEDMY GAI+T ++KGLLP
Sbjct  304   FKYSLEDMYTGAIDTCKEKGLLP  326



>gb|AHF58604.1| dihydroflavonol 4-reductase [Rosa chinensis]
Length=349

 Score =   492 bits (1267),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 225/340 (66%), Positives = 278/340 (82%), Gaps = 1/340 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GF+GSWL+  LL RGY + ATVRDP N KKVKHLL+LPKA T+LT+WK  + E
Sbjct  8     VCVTGASGFVGSWLIMRLLDRGYTVRATVRDPANKKKVKHLLDLPKAATHLTLWKADLAE  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDPENEV KP ING+L+I+ +C+KAKTV+RLVFTS
Sbjct  68    EGSFDEAIKGCTGVFHVATPMDFESKDPENEVTKPTINGLLDIVKACLKAKTVRRLVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NV+  QKPVY+E+ WSD++F    KMTGWMYF SK LAE+EAWK  KE  IDFI+
Sbjct  128   SAGTVNVEETQKPVYNESNWSDVEFCRRVKMTGWMYFVSKTLAEQEAWKFAKENNIDFIT  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LV+GPF+ P+ PPSLIT LS +TGN+ HYSIIKQGQ++HLDDLC++HI+LYEHPKA
Sbjct  188   IIPTLVIGPFLMPSMPPSLITGLSPLTGNEGHYSIIKQGQFIHLDDLCQSHIYLYEHPKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSSH  TIH +A ++ + +PEY +P+ FKGIE++LP V+FSSKKL + GF+FKYS
Sbjct  248   EGRYICSSHDATIHEIAKLLREKYPEYNVPTTFKGIEENLPKVHFSSKKLLETGFEFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYSTKEAAAIE-EEQETVALKV  1120
             LEDM+ GA++  + KGLLP  T+     E +E   V +KV
Sbjct  308   LEDMFVGAVDACKAKGLLPPPTERVEKQEVDESSVVRVKV  347



>gb|AFI71899.1| dihydroflavonol 4-reductase [Paeonia lactiflora]
Length=364

 Score =   491 bits (1265),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 227/319 (71%), Positives = 269/319 (84%), Gaps = 0/319 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGAAGFIGSWLV  LL+ GY + ATVRDP N KKVKHLL+LPKADT+LT+WK  +  
Sbjct  12    VCVTGAAGFIGSWLVMRLLEHGYVVRATVRDPENMKKVKHLLDLPKADTHLTLWKADLLV  71

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             +GSFDEAI GC GVFHVATPMDF+SKDPENEVIKP I+G+L+I+ +C KAKTV+R+VFTS
Sbjct  72    DGSFDEAIKGCTGVFHVATPMDFESKDPENEVIKPTIDGMLSIMRACAKAKTVRRVVFTS  131

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NV+  Q+ VYDETC SD++FI  KKMTGWMYF SKILAE+ AWK  KE  IDFIS
Sbjct  132   SAGTINVEEHQQSVYDETCSSDMEFIQTKKMTGWMYFVSKILAEQAAWKFAKENNIDFIS  191

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LVVGPF+ P+ PPSL+TALS ITGN+AHYSIIKQGQ+VHLDDLC AHI+L+EHPKA
Sbjct  192   IIPTLVVGPFLMPSMPPSLVTALSPITGNEAHYSIIKQGQFVHLDDLCNAHIYLFEHPKA  251

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSS   TI  LA M+ + +PEY +P+EFKG+++ L +V FSSKKL D GF+FKY+
Sbjct  252   EGRYICSSRDATIISLAKMLREKYPEYNVPTEFKGVDESLKIVSFSSKKLMDSGFEFKYN  311

Query  1004  LEDMYRGAIETLRKKGLLP  1060
             LEDM+  AIET R+KGLLP
Sbjct  312   LEDMFVEAIETCREKGLLP  330



>gb|ACN82380.1| dihydroflavonol 4-reductase [Vitis amurensis]
Length=337

 Score =   490 bits (1261),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 225/319 (71%), Positives = 267/319 (84%), Gaps = 0/319 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+RGY + ATVRDP N KKVKHLL+LPKA+T+LT+WK  + +
Sbjct  8     VCVTGASGFIGSWLVMRLLERGYTVRATVRDPTNVKKVKHLLDLPKAETHLTLWKADLAD  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDP NEVIKP I G+L I+ SC  AKTV++LVFTS
Sbjct  68    EGSFDEAIKGCTGVFHVATPMDFESKDPGNEVIKPTIEGMLGIMKSCAAAKTVRKLVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+N+Q  Q PVYDE+CWSD++F  AKKMTGWMYF SK LAE+ AWK  KE  IDFIS
Sbjct  128   SAGTVNIQEHQLPVYDESCWSDMEFCRAKKMTGWMYFVSKTLAEQAAWKYAKENNIDFIS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LVVGPFI  + PPSLITALS ITGN+AHYSII+QGQ+VHLDDLC AHI+L+E+PKA
Sbjct  188   IIPTLVVGPFIMSSMPPSLITALSPITGNEAHYSIIRQGQFVHLDDLCNAHIYLFENPKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSS+   I  LA M+ + +PEY IP+EFKG++++L  V FSSKKL D+GF+FKYS
Sbjct  248   EGRYICSSNDCIILDLAKMLREKYPEYNIPTEFKGVDENLKSVCFSSKKLTDLGFEFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLP  1060
             LEDM+ GA++T R KGLLP
Sbjct  308   LEDMFTGAVDTCRAKGLLP  326



>gb|KHN20964.1| Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase 
[Glycine soja]
Length=343

 Score =   489 bits (1259),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 225/319 (71%), Positives = 267/319 (84%), Gaps = 0/319 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  L++RGY + ATVRDP N KKVKHL+ELP A + L++WK  + E
Sbjct  8     VCVTGASGFIGSWLVMRLIERGYTVRATVRDPVNMKKVKHLVELPGAKSKLSLWKADLAE  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDPENEVIKP INGVL+I+ +C+KAKTV+RL+FTS
Sbjct  68    EGSFDEAIKGCTGVFHVATPMDFESKDPENEVIKPTINGVLDIMKACLKAKTVRRLIFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGTLNV  +QKPV+D+TCWSD++F    KMTGWMYF SK LAEKEAWK  KE+ +DFI+
Sbjct  128   SAGTLNVIERQKPVFDDTCWSDVEFCRRVKMTGWMYFVSKTLAEKEAWKFAKEQGLDFIT  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIPPLVVGPF+ PT PPSLITALS ITGN+ HYSIIKQGQ+VHLDDLC AHIFL+E P+ 
Sbjct  188   IIPPLVVGPFLMPTMPPSLITALSPITGNEDHYSIIKQGQFVHLDDLCLAHIFLFEEPEV  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICS+   TIH +A +I Q +PEY +P++FK I   L +V FSSKK+ D+GF+FKYS
Sbjct  248   EGRYICSACDATIHDIAKLINQKYPEYKVPTKFKNIPDQLELVRFSSKKITDLGFKFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLP  1060
             LEDMY GAI+T R KGLLP
Sbjct  308   LEDMYTGAIDTCRDKGLLP  326



>dbj|BAJ21535.1| dihydroflavonol 4-reductase [Dahlia pinnata]
Length=336

 Score =   489 bits (1258),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 224/307 (73%), Positives = 263/307 (86%), Gaps = 0/307 (0%)
 Frame = +2

Query  155   LLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEEEGSFDEAIAGCEGVFHV  334
             LL+RGY + ATVRDPG+ KKVKHL+ELPKA+TNLT+WK  + +EGSFDEAI GC GVFHV
Sbjct  3     LLERGYIVRATVRDPGDMKKVKHLIELPKAETNLTLWKADLTQEGSFDEAIEGCHGVFHV  62

Query  335   ATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTSSAGTLNVQPQQKPVYDE  514
             ATPMDF+SKDPENE+IKP I G+L I+ SC KAKTVK+LVFTSSAGT+N Q +Q PVYDE
Sbjct  63    ATPMDFESKDPENEIIKPTIEGILGIVRSCAKAKTVKKLVFTSSAGTVNAQEKQLPVYDE  122

Query  515   TCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFISIIPPLVVGPFITPTFPP  694
             + WSDLDFIY+ KMT WMYF SK LAEK AWK T E  IDFISIIP LVVGPFITP+FPP
Sbjct  123   SHWSDLDFIYSIKMTAWMYFVSKTLAEKAAWKATTEDNIDFISIIPTLVVGPFITPSFPP  182

Query  695   SLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKAEGRFICSSHHTTIHGLA  874
             SLITALSLI G ++HYSIIKQ QYVHLDDLCE HIFLYE+P+A+GR+ICSSH  TIH LA
Sbjct  183   SLITALSLINGMESHYSIIKQCQYVHLDDLCECHIFLYENPEAKGRYICSSHDATIHQLA  242

Query  875   DMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYSLEDMYRGAIETLRKKGL  1054
              MI + WPEY++P++F GI++DL VV FSSKKL DMGF+FKY LE+M++GAI++ R+KGL
Sbjct  243   RMIKEKWPEYHVPTQFVGIDEDLSVVSFSSKKLTDMGFEFKYDLEEMFKGAIDSCREKGL  302

Query  1055  LPYSTKE  1075
             LPYST +
Sbjct  303   LPYSTDD  309



>gb|AII26023.1| dihydroflavanol 4-reductase [Pisum sativum]
Length=342

 Score =   489 bits (1259),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 223/319 (70%), Positives = 267/319 (84%), Gaps = 0/319 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  L++ GY + ATVRDP N KKVKHLLELP A + L++WK  + E
Sbjct  8     VCVTGASGFIGSWLVMRLIEHGYTVRATVRDPDNVKKVKHLLELPDAKSKLSLWKADLAE  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDPENEVIKP ING+L+I+ +C KAKTV+RLVFTS
Sbjct  68    EGSFDEAIKGCVGVFHVATPMDFESKDPENEVIKPTINGLLDIMKACEKAKTVRRLVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT++V    KPV DETCWSD+DF     MTGWMYF SK LAE+EAWK +KE KIDF+S
Sbjct  128   SAGTVDVTENPKPVIDETCWSDVDFCRRVNMTGWMYFVSKTLAEQEAWKYSKEHKIDFVS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIPPLVVGPF+ P+ PPSLITALSLITGN+AHY+IIKQGQYVHLDDLC AHIFL+E+PKA
Sbjct  188   IIPPLVVGPFLMPSMPPSLITALSLITGNEAHYTIIKQGQYVHLDDLCLAHIFLFENPKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             +GR+IC SH  TIH +A +I Q +PE+ +P++FK I  +L ++ F SKK+ D+GF+FKYS
Sbjct  248   QGRYICCSHEATIHEVATLIKQKYPEFNVPTKFKDIPDELEIIKFCSKKITDLGFKFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLP  1060
             LEDM+ GA+ET R+KGLLP
Sbjct  308   LEDMFTGAVETCREKGLLP  326



>ref|NP_001238612.1| dihydroflavonol-4-reductase DFR1 [Glycine max]
 gb|AAD54273.1|AF167556_1 dihydroflavonol-4-reductase DFR1 [Glycine max]
Length=347

 Score =   489 bits (1258),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 225/319 (71%), Positives = 267/319 (84%), Gaps = 0/319 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  L++RGY + ATVRDP N KKVKHL+ELP A + L++WK  + E
Sbjct  8     VCVTGASGFIGSWLVMRLIERGYTVRATVRDPVNMKKVKHLVELPGAKSKLSLWKADLAE  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDPENEVIKP INGVL+I+ +C+KAKTV+RL+FTS
Sbjct  68    EGSFDEAIKGCTGVFHVATPMDFESKDPENEVIKPTINGVLDIMKACLKAKTVRRLIFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGTLNV  +QKPV+D+TCWSD++F    KMTGWMYF SK LAEKEAWK  KE+ +DFI+
Sbjct  128   SAGTLNVIERQKPVFDDTCWSDVEFCRRVKMTGWMYFVSKTLAEKEAWKFAKEQGLDFIT  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIPPLVVGPF+ PT PPSLITALS ITGN+ HYSIIKQGQ+VHLDDLC AHIFL+E P+ 
Sbjct  188   IIPPLVVGPFLMPTMPPSLITALSPITGNEDHYSIIKQGQFVHLDDLCLAHIFLFEEPEV  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICS+   TIH +A +I Q +PEY +P++FK I   L +V FSSKK+ D+GF+FKYS
Sbjct  248   EGRYICSACDATIHDIAKLINQKYPEYKVPTKFKNIPDQLELVRFSSKKITDLGFKFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLP  1060
             LEDMY GAI+T R KGLLP
Sbjct  308   LEDMYTGAIDTCRDKGLLP  326



>ref|XP_002300759.1| dihydroflavonol reductase family protein [Populus trichocarpa]
 gb|EEE80032.1| dihydroflavonol reductase family protein [Populus trichocarpa]
Length=346

 Score =   488 bits (1257),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 221/334 (66%), Positives = 276/334 (83%), Gaps = 1/334 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWL+  LL++GY + ATVRDP N KKV HLLELPKA T+LT+WK  +  
Sbjct  8     VCVTGASGFIGSWLIMRLLEKGYAVRATVRDPDNMKKVTHLLELPKASTHLTLWKADLSV  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGS+DEAI GC GVFHVATPMDF+SKDPENEVIKP INGVL+I+ +C  +KTV+++VFTS
Sbjct  68    EGSYDEAIQGCTGVFHVATPMDFESKDPENEVIKPTINGVLDIMRACANSKTVRKIVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT++V+ ++KPVYDE+CWSDLDF+ + KMTGWMYF SK LAE+ AWK  KE  +DFIS
Sbjct  128   SAGTVDVEEKRKPVYDESCWSDLDFVQSIKMTGWMYFVSKTLAEQAAWKFAKENNLDFIS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LVVGPFI  + PPSL+TALSLITGN+AHY I+KQG YVHLDDLC +HIFLYE+PKA
Sbjct  188   IIPTLVVGPFIMQSMPPSLLTALSLITGNEAHYGILKQGHYVHLDDLCMSHIFLYENPKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+IC+S    IH LA ++ + +PEY +P++FK I+++L  V FSSKKL D+GF+FKYS
Sbjct  248   EGRYICNSDDANIHDLAKLLREKYPEYNVPAKFKDIDENLACVAFSSKKLTDLGFEFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQET  1105
             LEDM+ GA+ET R+KGL+P S ++   +EE +E 
Sbjct  308   LEDMFAGAVETCREKGLIPLSHRK-QVVEECKEN  340



>ref|XP_003550388.1| PREDICTED: bifunctional dihydroflavonol 4-reductase/flavanone 
4-reductase isoformX1 [Glycine max]
 gb|ABM64803.1| dihydroflavonol-4-reductase 2 [Glycine max]
 dbj|BAO53731.1| dihydroflavonol 4-reducatase 2 [Glycine max]
 dbj|BAO53732.1| dihydroflavonol 4-reducatase 2 [Glycine soja]
 gb|KHN12695.1| Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase 
[Glycine soja]
Length=354

 Score =   488 bits (1256),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 221/319 (69%), Positives = 264/319 (83%), Gaps = 0/319 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  L++RGY + ATVRDP N KKVKHL+ELP A T L++WK  + +
Sbjct  10    VCVTGASGFIGSWLVMRLIERGYTVRATVRDPANMKKVKHLVELPGAKTKLSLWKADLAQ  69

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDFDSKDPENEVIKP ING+L+I+ +CVKAKTV+RLVFTS
Sbjct  70    EGSFDEAIKGCTGVFHVATPMDFDSKDPENEVIKPTINGLLDIMKACVKAKTVRRLVFTS  129

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT++V     PV DE CWSD+DF    KMTGWMYF SK LAE+EAWK  KE  IDFIS
Sbjct  130   SAGTVDVTEHPNPVIDENCWSDVDFCTRVKMTGWMYFVSKTLAEQEAWKYAKEHNIDFIS  189

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             +IPPLVVGPF+ PT PPSLITALSLITGN++HY IIKQGQ+VHLDDLC  HIF++E+PKA
Sbjct  190   VIPPLVVGPFLMPTMPPSLITALSLITGNESHYHIIKQGQFVHLDDLCLGHIFVFENPKA  249

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+IC SH  TIH +A ++ Q +PEY + ++FK I  +L ++ FSSKK+ D+GF+FKYS
Sbjct  250   EGRYICCSHEATIHDIAKLLNQKYPEYNVLTKFKNIPDELDIIKFSSKKITDLGFKFKYS  309

Query  1004  LEDMYRGAIETLRKKGLLP  1060
             LEDM+ GA+ET R+KGLLP
Sbjct  310   LEDMFTGAVETCREKGLLP  328



>ref|XP_004499176.1| PREDICTED: bifunctional dihydroflavonol 4-reductase/flavanone 
4-reductase-like isoform X1 [Cicer arietinum]
Length=341

 Score =   487 bits (1254),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 220/319 (69%), Positives = 264/319 (83%), Gaps = 0/319 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWL+  L++RGY + ATVRDP N KKV HLLELP A TNLT+WK  + E
Sbjct  8     VCVTGASGFIGSWLIMRLMERGYTVRATVRDPDNMKKVNHLLELPGAKTNLTLWKADLAE  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSF E I GC GVFHVATPMDFDSKDPENEVIKP ING+L+I+ +C KAKTV+RLVFTS
Sbjct  68    EGSFHEPIKGCTGVFHVATPMDFDSKDPENEVIKPTINGLLDILKACEKAKTVRRLVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT++V    K ++DETCWSD+DF    KMTGWMYF SK LAE+EAWK  K+  IDF+S
Sbjct  128   SAGTVDVTENSKSIFDETCWSDVDFCRRVKMTGWMYFVSKTLAEQEAWKFAKQNNIDFVS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIPPLVVGPF+ PT PPSLITALSLITGN+AHY+IIKQGQYVHLDDLC AHIFL+E+PKA
Sbjct  188   IIPPLVVGPFLMPTMPPSLITALSLITGNEAHYAIIKQGQYVHLDDLCLAHIFLFENPKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+IC SH  TIH +A +I + +P + +P++FK I   L ++ FSSKK+ ++GF+FKYS
Sbjct  248   EGRYICCSHEATIHDVATLINKKYPHFNVPTKFKDIPDQLEIIKFSSKKITELGFKFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLP  1060
             LEDM+ GA+ET R+KG+LP
Sbjct  308   LEDMFTGAVETCREKGILP  326



>dbj|BAO53727.1| dihydroflavonol 4-reducatase 2 [Glycine max]
Length=354

 Score =   488 bits (1255),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 221/319 (69%), Positives = 264/319 (83%), Gaps = 0/319 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  L++RGY + ATVRDP N KKVKHL+ELP A T L++WK  + +
Sbjct  10    VCVTGASGFIGSWLVMRLIERGYTVRATVRDPANMKKVKHLVELPGAKTKLSLWKADLAQ  69

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDFDSKDPENEVIKP ING+L+I+ +CVKAKTV+RLVFTS
Sbjct  70    EGSFDEAIKGCTGVFHVATPMDFDSKDPENEVIKPTINGLLDIMKACVKAKTVRRLVFTS  129

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT++V     PV DE CWSD+DF    KMTGWMYF SK LAE+EAWK  KE  IDFIS
Sbjct  130   SAGTVDVTEHPNPVIDENCWSDVDFCTRVKMTGWMYFVSKTLAEQEAWKYAKEHNIDFIS  189

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             +IPPLVVGPF+ PT PPSLITALSLITGN++HY IIKQGQ+VHLDDLC  HIF++E+PKA
Sbjct  190   VIPPLVVGPFLMPTMPPSLITALSLITGNESHYHIIKQGQFVHLDDLCLGHIFVFENPKA  249

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+IC SH  TIH +A ++ Q +PEY + ++FK I  +L ++ FSSKK+ D+GF+FKYS
Sbjct  250   EGRYICCSHEATIHDIAKLLNQKYPEYNVLTKFKNIPDELDIIKFSSKKITDLGFKFKYS  309

Query  1004  LEDMYRGAIETLRKKGLLP  1060
             LEDM+ GA+ET R+KGLLP
Sbjct  310   LEDMFTGAVETCREKGLLP  328



>gb|AAR27015.1| dihydroflavonal-4-reductase 2 [Medicago truncatula]
 gb|KEH40172.1| dihydroflavonol 4-reductase-like protein [Medicago truncatula]
Length=339

 Score =   487 bits (1253),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 225/323 (70%), Positives = 267/323 (83%), Gaps = 0/323 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  L++RGY + ATVRDP N KKVKHLLELP A++ L++WK  + E
Sbjct  8     VCVTGASGFIGSWLVMRLMERGYTVRATVRDPDNMKKVKHLLELPGANSKLSLWKADLGE  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDPE EVI P ING+L+I+ +C KAKTV+RLVFTS
Sbjct  68    EGSFDEAIKGCTGVFHVATPMDFESKDPEKEVINPTINGLLDIMKACKKAKTVRRLVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGTL+V  QQ  V DETCWSD++F    KMTGWMYF SK LAE+EAWK +KE  IDF+S
Sbjct  128   SAGTLDVTEQQNSVIDETCWSDVEFCRRVKMTGWMYFVSKTLAEQEAWKFSKEHNIDFVS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIPPLVVGPFI P+ PPSLITALSLITG +AHYSIIKQGQY+HLDDLC AHIFL+E+PKA
Sbjct  188   IIPPLVVGPFIMPSMPPSLITALSLITGYEAHYSIIKQGQYIHLDDLCLAHIFLFENPKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
              GR+IC SH  TIH +A +I + +PE+ +P++FK I  DL ++ FSSKK+ D+GF FKYS
Sbjct  248   HGRYICCSHEATIHEVAKLINKKYPEFNVPTKFKDIPDDLEIIKFSSKKITDLGFIFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYSTK  1072
             LEDM+ GAIET R+KGLLP  T+
Sbjct  308   LEDMFTGAIETCREKGLLPKVTE  330



>ref|XP_007160735.1| hypothetical protein PHAVU_001G012800g [Phaseolus vulgaris]
 gb|ESW32729.1| hypothetical protein PHAVU_001G012800g [Phaseolus vulgaris]
Length=339

 Score =   486 bits (1252),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 221/319 (69%), Positives = 265/319 (83%), Gaps = 0/319 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  L++RGY + ATVRDP N KKVKHL+ELP A T L++WK  + E
Sbjct  8     VCVTGASGFIGSWLVMRLMERGYTVRATVRDPENMKKVKHLVELPGAKTKLSLWKADLAE  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDPENEVIKP I G+++I+ +CVKAK+V+R+VFTS
Sbjct  68    EGSFDEAIKGCTGVFHVATPMDFESKDPENEVIKPTIKGLVDIMKACVKAKSVRRIVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT++V  + KP YDE CWSD++F    KMTGWMYF SK LAEKEAWK  KE  IDF+S
Sbjct  128   SAGTVDVAEKSKPFYDENCWSDVEFCRRVKMTGWMYFVSKTLAEKEAWKFAKEHNIDFVS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIPPLVVGPF+ PT PPSLITALSLITGN+ HY IIKQGQ+VHLDDLC AHIFL+E+PKA
Sbjct  188   IIPPLVVGPFLMPTMPPSLITALSLITGNEGHYHIIKQGQFVHLDDLCLAHIFLFENPKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+IC SH  TIH +A ++ Q +P Y IP++FK I  +L ++ FSSKK+ DMGF+F+YS
Sbjct  248   EGRYICCSHEATIHDIAKLLNQKYPHYNIPTKFKDIPDELEIIRFSSKKITDMGFKFEYS  307

Query  1004  LEDMYRGAIETLRKKGLLP  1060
             LEDM+ GA+ET R+KGLLP
Sbjct  308   LEDMFAGAVETCREKGLLP  326



>sp|P51110.1|DFRA_VITVI RecName: Full=Dihydroflavonol-4-reductase; Short=DFR; AltName: 
Full=Dihydrokaempferol 4-reductase [Vitis vinifera]
 emb|CAA53578.1| dihydroflavonol reductase [Vitis vinifera]
Length=337

 Score =   486 bits (1251),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 223/318 (70%), Positives = 264/318 (83%), Gaps = 0/318 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+R   + ATVRDP N KKVKHLL+LPKA+T+LT+WK  + +
Sbjct  8     VCVTGASGFIGSWLVMRLLERRLTVRATVRDPTNVKKVKHLLDLPKAETHLTLWKADLAD  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDPENEVIKP I G+L I+ SC  AKTV+RLVFTS
Sbjct  68    EGSFDEAIKGCTGVFHVATPMDFESKDPENEVIKPTIEGMLGIMKSCAAAKTVRRLVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+N+Q  Q PVYDE+CWSD++F  AKKMT WMYF SK LAE+ AWK  KE  IDFI+
Sbjct  128   SAGTVNIQEHQLPVYDESCWSDMEFCRAKKMTAWMYFVSKTLAEQAAWKYAKENNIDFIT  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LVVGPFI  + PPSLITALS ITGN+AHYSII+QGQ+VHLDDLC AHI+L+E+PKA
Sbjct  188   IIPTLVVGPFIMSSMPPSLITALSPITGNEAHYSIIRQGQFVHLDDLCNAHIYLFENPKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSSH   I  LA M+ + +PEY IP+EFKG++++L  V FSSKKL D+GF+FKYS
Sbjct  248   EGRYICSSHDCIILDLAKMLREKYPEYNIPTEFKGVDENLKSVCFSSKKLTDLGFEFKYS  307

Query  1004  LEDMYRGAIETLRKKGLL  1057
             LEDM+ GA++T R KGLL
Sbjct  308   LEDMFTGAVDTCRAKGLL  325



>ref|XP_009336072.1| PREDICTED: bifunctional dihydroflavonol 4-reductase/flavanone 
4-reductase-like [Pyrus x bretschneideri]
Length=347

 Score =   486 bits (1251),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 223/332 (67%), Positives = 273/332 (82%), Gaps = 0/332 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+ GY + ATVRDP N KKVKHLL+LPKA+T+LT+WK  + +
Sbjct  8     VCVTGASGFIGSWLVMRLLEHGYTVRATVRDPTNQKKVKHLLDLPKAETHLTLWKADLAD  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDPENEVIKP ING+L+I+ +C KAKTV++LVFTS
Sbjct  68    EGSFDEAIQGCSGVFHVATPMDFESKDPENEVIKPTINGLLDILKACQKAKTVRQLVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NV+  QKPVYDE+ WSD++F  + KMTGWMYF SK LAE+ AWK  KE  IDFI+
Sbjct  128   SAGTVNVEEHQKPVYDESNWSDVEFCRSVKMTGWMYFVSKTLAEQAAWKYAKENNIDFIT  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LV+GPF+ P+ PPSLIT LS I  N++HY IIKQGQYVHLDDLC +HI+LYEHPKA
Sbjct  188   IIPTLVIGPFLMPSMPPSLITGLSPILRNESHYGIIKQGQYVHLDDLCLSHIYLYEHPKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSSH TTIH L  M+ + +PEY IP++FKGI+ +L  V+FSSKKL+++GF+FKYS
Sbjct  248   EGRYICSSHDTTIHELVKMLREKYPEYNIPTKFKGIDDNLEPVHFSSKKLREIGFEFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQ  1099
             LEDM+ GA++  R KGL+P   ++  A EE  
Sbjct  308   LEDMFVGAVDACRAKGLIPIPAEKTEAAEESN  339



>ref|XP_010523603.1| PREDICTED: dihydroflavonol-4-reductase [Tarenaya hassleriana]
Length=378

 Score =   487 bits (1254),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 222/321 (69%), Positives = 270/321 (84%), Gaps = 0/321 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+ GY + ATVRDPGN KKV+HLL+LP A T+LT+WK  +  
Sbjct  8     VCVTGASGFIGSWLVMRLLEHGYFVRATVRDPGNVKKVQHLLDLPNAKTHLTLWKADLSV  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGS+DE I GC+GVFHVATPMDF+SKDPENEVIKP +NGVL I+ +CV AKTV+R+VFTS
Sbjct  68    EGSYDEPIQGCDGVFHVATPMDFESKDPENEVIKPTVNGVLGIMKACVTAKTVRRIVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGTLNV+  Q+  YDET WSDL+F+ +KKMTGWMYF SK LAEK AW+ +KE +ID I+
Sbjct  128   SAGTLNVEEHQRAQYDETNWSDLEFVKSKKMTGWMYFVSKALAEKAAWEYSKENRIDLIT  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIPPLVVGPFIT + PPSLITALS IT N+AHYSI++QGQYVHL+DLC AHIFL+EHPKA
Sbjct  188   IIPPLVVGPFITSSMPPSLITALSPITRNEAHYSIVRQGQYVHLEDLCNAHIFLFEHPKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             +GR+ICSSH  TI  LA ++ Q +PEY +PS F+G++++L  V FSSKKL ++GF+FK+S
Sbjct  248   KGRYICSSHDATILTLAGLLGQKYPEYNVPSVFEGVDENLKSVAFSSKKLLELGFEFKFS  307

Query  1004  LEDMYRGAIETLRKKGLLPYS  1066
             LEDM+ GAIET R KGLLP+S
Sbjct  308   LEDMFSGAIETCRAKGLLPHS  328



>gb|AAL89714.1|AF483835_1 dihydroflavonol-4-reductase [Vaccinium macrocarpon]
Length=342

 Score =   486 bits (1250),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 235/327 (72%), Positives = 269/327 (82%), Gaps = 1/327 (0%)
 Frame = +2

Query  92    LPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKG  271
             L   VCVTGAAGFIGSWL+  LL+RGY + ATVRDPGN KKVKHLLELPKADTNLT+WK 
Sbjct  8     LGTTVCVTGAAGFIGSWLIMRLLERGYVVRATVRDPGNLKKVKHLLELPKADTNLTLWKA  67

Query  272   VMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRL  451
              + EEGSFDEAI GC GVFHVATPMDF+SKDPENEVIKP INGVL+II SC KAKTVKRL
Sbjct  68    DLNEEGSFDEAIEGCVGVFHVATPMDFESKDPENEVIKPTINGVLSIIKSCTKAKTVKRL  127

Query  452   VFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKI  631
             VFTSSAG +  Q  Q  V+DE  WSD+DF+Y KKMTGW YF SK LAE+ A +  KE  I
Sbjct  128   VFTSSAGAVVDQEHQPLVFDENNWSDVDFLYDKKMTGWTYFVSKTLAERAAMEAAKEISI  187

Query  632   DFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYE  811
             DFISIIP LVVGPFI+PTFPPSLIT LS ITGN+AHYSIIKQ QYVHLDDLC+  +FL E
Sbjct  188   DFISIIPTLVVGPFISPTFPPSLITVLSPITGNEAHYSIIKQCQYVHLDDLCKYLMFLLE  247

Query  812   HPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQ  991
             HP+AEGR+ICSSH  TI+ LA M+ +N P    P+EFKGI+K+LP++ FSSKKL  +GF+
Sbjct  248   HPEAEGRYICSSHDATIYDLAKMMRRNGPGTMSPNEFKGIDKELPIMSFSSKKLLVIGFK  307

Query  992   FKYSLEDMYRGAIETLRK-KGLLPYST  1069
             FKY+LEDM+RGAI+T ++ KGLLPYS 
Sbjct  308   FKYNLEDMFRGAIDTWQETKGLLPYSN  334



>dbj|BAD67186.1| dihydroflavonol 4-reductase [Phytolacca americana]
Length=340

 Score =   485 bits (1249),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 221/318 (69%), Positives = 267/318 (84%), Gaps = 1/318 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGAAGFIGSWL+KTLL RGY + ATVRDP NTKKV+HLL+LP A T LT+WK  + E
Sbjct  8     VCVTGAAGFIGSWLIKTLLDRGYVVRATVRDPDNTKKVQHLLDLPNAKTYLTLWKADLNE  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFD+AI GC GVFHVATPMDFDSKDPENEVIKP ING+L+I+ SCVKAK ++RLVFTS
Sbjct  68    EGSFDDAINGCTGVFHVATPMDFDSKDPENEVIKPTINGLLDIMRSCVKAK-IRRLVFTS  126

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NV+  QKPVYDE+CWSD++F  +K+MTGWMYF SK LAE+ AWK   E K+DF++
Sbjct  127   SAGTVNVEEVQKPVYDESCWSDMEFCRSKRMTGWMYFVSKTLAEQAAWKFAAENKLDFVT  186

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             +IPPLVVGPFITPT PPSLITALS IT N+AHYSIIKQGQ+VHLDDLC AHIFLYEHP A
Sbjct  187   VIPPLVVGPFITPTMPPSLITALSPITRNEAHYSIIKQGQFVHLDDLCMAHIFLYEHPNA  246

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             +GR+I S+   TI  +  M+ + +PEY +P++FK  ++D+  V+FSSKKL D+GF+FKY 
Sbjct  247   QGRYIASACDATIFNIGKMLREEYPEYNVPTKFKDFKEDMERVHFSSKKLTDLGFEFKYG  306

Query  1004  LEDMYRGAIETLRKKGLL  1057
             L++MY GA+E+ R KGLL
Sbjct  307   LKEMYTGAVESCRAKGLL  324



>gb|ACJ84553.1| unknown [Medicago truncatula]
Length=339

 Score =   485 bits (1248),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 224/323 (69%), Positives = 266/323 (82%), Gaps = 0/323 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  L++RGY + ATVRDP N KKVKHLLELP A++ L++WK  + E
Sbjct  8     VCVTGASGFIGSWLVMRLMERGYTVRATVRDPDNMKKVKHLLELPGANSKLSLWKADLGE  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDPE EVI P ING+L+I+ +C KAKTV+RLVFTS
Sbjct  68    EGSFDEAIKGCTGVFHVATPMDFESKDPEKEVINPTINGLLDIMKACKKAKTVRRLVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGTL+V  QQ  V DETCWSD++F    KMTGWMYF SK LAE+EAWK +KE  ID +S
Sbjct  128   SAGTLDVTEQQNSVIDETCWSDVEFCRRVKMTGWMYFVSKTLAEQEAWKFSKEHNIDLVS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIPPLVVGPFI P+ PPSLITALSLITG +AHYSIIKQGQY+HLDDLC AHIFL+E+PKA
Sbjct  188   IIPPLVVGPFIMPSMPPSLITALSLITGYEAHYSIIKQGQYIHLDDLCLAHIFLFENPKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
              GR+IC SH  TIH +A +I + +PE+ +P++FK I  DL ++ FSSKK+ D+GF FKYS
Sbjct  248   HGRYICCSHEATIHEVAKLINKKYPEFNVPTKFKDIPDDLEIIKFSSKKITDLGFIFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYSTK  1072
             LEDM+ GAIET R+KGLLP  T+
Sbjct  308   LEDMFTGAIETCREKGLLPKVTE  330



>gb|AHL45016.1| dihydroflavonol 4-reductase [Prunus avium]
Length=346

 Score =   485 bits (1248),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 219/319 (69%), Positives = 268/319 (84%), Gaps = 0/319 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+RGY + ATVRDP N KKVKHLL+LPKA+T+LT+WK  + +
Sbjct  8     VCVTGASGFIGSWLVMRLLERGYTVRATVRDPANQKKVKHLLDLPKAETHLTLWKADLAD  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDPENEVIKP INGVL+I+ +C+KAKTV+RLVFTS
Sbjct  68    EGSFDEAIQGCTGVFHVATPMDFESKDPENEVIKPTINGVLDIMKACLKAKTVRRLVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NV+  Q+P YDET WSD++F  + KMTGWMYF SK LAE+ AWK  KE  IDFI+
Sbjct  128   SAGTVNVEEHQRPSYDETNWSDVEFCRSVKMTGWMYFVSKTLAEQAAWKFAKENNIDFIT  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LV+GPF+  + PPSLIT LS +TGN +HYSIIK+GQ+VHLDDLC +HI+LYEHPKA
Sbjct  188   IIPTLVIGPFLMSSMPPSLITGLSPLTGNTSHYSIIKRGQFVHLDDLCLSHIYLYEHPKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSSH  TI+ +A ++ + +PEY IP++F  IE++L  V+FSSKKL D GF+FKYS
Sbjct  248   EGRYICSSHDATIYDIAKLLREKYPEYNIPTKFDNIEENLTKVHFSSKKLTDQGFEFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLP  1060
             LEDM+ GA++T R KGL+P
Sbjct  308   LEDMFVGAVDTCRAKGLIP  326



>dbj|BAF49294.1| dihydroflavanol 4-reductase [Clitoria ternatea]
Length=339

 Score =   484 bits (1247),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 216/319 (68%), Positives = 266/319 (83%), Gaps = 0/319 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+RGY + ATVRDPGN KKVKHLL+LP A   L++WK  + +
Sbjct  8     VCVTGASGFIGSWLVMRLLERGYTVRATVRDPGNMKKVKHLLDLPNAKNKLSLWKADLGQ  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDPE EVIKP I+G+L+I+ +C KAK+V+RLVFTS
Sbjct  68    EGSFDEAIKGCNGVFHVATPMDFESKDPEKEVIKPTIDGLLDIMRACKKAKSVRRLVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT++V    K V+DE CWSD+DF    +MTGWMYF SK LAE+EAW   KE+ IDFIS
Sbjct  128   SAGTVDVSENSKDVFDENCWSDVDFCRRVQMTGWMYFVSKTLAEQEAWNFAKEQNIDFIS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             +IPPLVVGPF+ PT PPSLITALSLITGN+AHY IIKQGQ+VHLDDLC AHIFL++HP+A
Sbjct  188   VIPPLVVGPFLLPTMPPSLITALSLITGNEAHYPIIKQGQFVHLDDLCLAHIFLFQHPQA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             +GR+IC SH  TIH +A ++ Q +P+Y++P++FK I  +L ++ FSSKK+ DMGF+FKYS
Sbjct  248   QGRYICCSHEATIHDIAKLLNQIYPDYHVPTKFKNIPVELEIIRFSSKKIMDMGFKFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLP  1060
             LEDM+ GA+ET R+KGL+P
Sbjct  308   LEDMFTGAVETCREKGLIP  326



>gb|AJA79073.1| dihydroflavonol 4-reductase [Prunus persica]
 gb|AJA79078.1| dihydroflavonol 4-reductase [Prunus persica]
Length=346

 Score =   485 bits (1248),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 220/319 (69%), Positives = 269/319 (84%), Gaps = 0/319 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+RGY + ATVRDP N KKVKHLLELPKA+T+LT+WK  + +
Sbjct  8     VCVTGASGFIGSWLVMRLLERGYTVRATVRDPTNQKKVKHLLELPKAETHLTLWKADLAD  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDPENEVIKP INGVL+I+ +C+KAKTV+RLVFTS
Sbjct  68    EGSFDEAIQGCTGVFHVATPMDFESKDPENEVIKPTINGVLDILKACLKAKTVRRLVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NV+  QK  YDET WSD++F  + KMTGWMYFASK LAE+ AWK  KE  IDFI+
Sbjct  128   SAGTVNVEEHQKSYYDETDWSDVEFCRSVKMTGWMYFASKTLAEQAAWKFAKENNIDFIT  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LV+GPF+ P+ PPSLIT LS +TGN +HYSIIK+GQ+VHLDDLC +HI+LYEHPKA
Sbjct  188   IIPTLVIGPFLMPSMPPSLITGLSPLTGNTSHYSIIKRGQFVHLDDLCLSHIYLYEHPKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSSH  TI+ +A ++ + +PEY IP++F  IE++L  ++FSSKKL D GF+FKYS
Sbjct  248   EGRYICSSHDATIYDIAKLLREKYPEYNIPTKFDNIEENLTNIHFSSKKLTDHGFEFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLP  1060
             LEDM+ GA++T R +GL+P
Sbjct  308   LEDMFVGAVDTCRARGLIP  326



>ref|XP_007222317.1| hypothetical protein PRUPE_ppa008069mg [Prunus persica]
 gb|AEJ88220.1| dihydroflavonol 4-reductase [Prunus persica]
 gb|EMJ23516.1| hypothetical protein PRUPE_ppa008069mg [Prunus persica]
Length=346

 Score =   485 bits (1248),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 220/319 (69%), Positives = 269/319 (84%), Gaps = 0/319 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+RGY + ATVRDP N KKVKHLLELPKA+T+LT+WK  + +
Sbjct  8     VCVTGASGFIGSWLVMRLLERGYTVRATVRDPTNQKKVKHLLELPKAETHLTLWKADLAD  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDPENEVIKP INGVL+I+ +C+KAKTV+RLVFTS
Sbjct  68    EGSFDEAIQGCTGVFHVATPMDFESKDPENEVIKPTINGVLDILKACLKAKTVRRLVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NV+  QK  YDET WSD++F  + KMTGWMYFASK LAE+ AWK  KE  IDFI+
Sbjct  128   SAGTVNVEEHQKSYYDETDWSDVEFCRSVKMTGWMYFASKTLAEQAAWKFAKENNIDFIT  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LV+GPF+ P+ PPSLIT LS +TGN +HYSIIK+GQ+VHLDDLC +HI+LYEHPKA
Sbjct  188   IIPTLVIGPFLMPSMPPSLITGLSPLTGNTSHYSIIKRGQFVHLDDLCLSHIYLYEHPKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSSH  TI+ +A ++ + +PEY IP++F  IE++L  ++FSSKKL D GF+FKYS
Sbjct  248   EGRYICSSHDATIYDIAKLLREKYPEYNIPTKFDNIEENLTNIHFSSKKLTDHGFEFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLP  1060
             LEDM+ GA++T R +GL+P
Sbjct  308   LEDMFVGAVDTCRARGLIP  326



>ref|XP_009365091.1| PREDICTED: bifunctional dihydroflavonol 4-reductase/flavanone 
4-reductase [Pyrus x bretschneideri]
Length=347

 Score =   485 bits (1248),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 222/332 (67%), Positives = 272/332 (82%), Gaps = 0/332 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+ GY + ATVRDP N KKVKHLL+LPKA+T+LT+WK  + +
Sbjct  8     VCVTGASGFIGSWLVMRLLEHGYTVRATVRDPTNQKKVKHLLDLPKAETHLTLWKADLAD  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDPENEVIKP ING+L+I+ +C KAKTV++LVFTS
Sbjct  68    EGSFDEAIQGCSGVFHVATPMDFESKDPENEVIKPTINGLLDILKACQKAKTVRKLVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NV+  QKPVYDE+ WSD++F  + KMTGWMYF SK LAE+ AWK  KE  IDFI+
Sbjct  128   SAGTVNVEEHQKPVYDESNWSDVEFCRSVKMTGWMYFVSKTLAEQAAWKYAKENNIDFIT  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LV+GPF+ P+ PPSLIT LS I  N++HY IIKQGQYVHLDDLC +HI+LYEHPKA
Sbjct  188   IIPTLVIGPFLMPSMPPSLITGLSPILRNESHYGIIKQGQYVHLDDLCLSHIYLYEHPKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSSH  TIH L  M+ + +PEY IP++FKGI+ +L  V+FSSKKL+++GF+FKYS
Sbjct  248   EGRYICSSHDATIHELVKMLREKYPEYNIPTKFKGIDDNLEPVHFSSKKLREIGFEFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQ  1099
             LEDM+ GA++  R KGL+P   ++  A EE  
Sbjct  308   LEDMFVGAVDACRAKGLIPIPAQKTEAAEESN  339



>gb|ACU28803.1| dihydroflavonol reductase [Rhizophora mangle]
Length=352

 Score =   485 bits (1248),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 221/325 (68%), Positives = 267/325 (82%), Gaps = 0/325 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWL+  LL+R Y + ATVRDP N KKVKHLLELPKA TNLT+WK  +  
Sbjct  8     VCVTGASGFIGSWLIMRLLERDYTVRATVRDPDNIKKVKHLLELPKAKTNLTLWKADLSV  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+S DPENEVIKP INGVL+I+ +C KA TV+R+VFTS
Sbjct  68    EGSFDEAIKGCAGVFHVATPMDFESSDPENEVIKPTINGVLDIMKACAKAGTVRRIVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT++V+  +K  YDE+CWSDLDF+ +KKMTGWMYF SK LAEK AWK  +E  IDFI+
Sbjct  128   SAGTVDVEEHKKTFYDESCWSDLDFVQSKKMTGWMYFVSKTLAEKAAWKFAEENNIDFIT  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LVVGPFI P+ PPSLITALSL+TGN++HY IIKQG YVHLDDLC AHIFL+E PKA
Sbjct  188   IIPTLVVGPFIMPSMPPSLITALSLLTGNESHYGIIKQGNYVHLDDLCIAHIFLFELPKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSSH  +I+ +A ++ +N+PEY +P++FK I+++L  V FSSKKL D GF+F+Y+
Sbjct  248   EGRYICSSHDASIYDIAKLLRENYPEYNVPAKFKDIDENLMRVVFSSKKLLDSGFEFRYT  307

Query  1004  LEDMYRGAIETLRKKGLLPYSTKEA  1078
             LEDM+ GA+ET R K LLP    +A
Sbjct  308   LEDMFVGAVETCRAKELLPSVDNKA  332



>dbj|BAO53730.1| dihydroflavonol 4-reducatase 2 [Glycine max]
Length=354

 Score =   485 bits (1248),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 220/319 (69%), Positives = 263/319 (82%), Gaps = 0/319 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  L++RGY + ATV DP N KKVKHL+ELP A T L++WK  + +
Sbjct  10    VCVTGASGFIGSWLVMRLIERGYTVRATVHDPANMKKVKHLVELPGAKTKLSLWKADLAQ  69

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDFDSKDPENEVIKP ING+L+I+ +CVKAKTV+RLVFTS
Sbjct  70    EGSFDEAIKGCTGVFHVATPMDFDSKDPENEVIKPTINGLLDIMKACVKAKTVRRLVFTS  129

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT++V     PV DE CWSD+DF    KMTGWMYF SK LAE+EAWK  KE  IDFIS
Sbjct  130   SAGTVDVTEHPNPVIDENCWSDVDFCTRVKMTGWMYFVSKTLAEQEAWKYAKEHNIDFIS  189

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             +IPPLVVGPF+ PT PPSLITALSLITGN++HY IIKQGQ+VHLDDLC  HIF++E+PKA
Sbjct  190   VIPPLVVGPFLMPTMPPSLITALSLITGNESHYHIIKQGQFVHLDDLCLGHIFVFENPKA  249

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+IC SH  TIH +A ++ Q +PEY + ++FK I  +L ++ FSSKK+ D+GF+FKYS
Sbjct  250   EGRYICCSHEATIHDIAKLLNQKYPEYNVLTKFKNIPDELDIIKFSSKKITDLGFKFKYS  309

Query  1004  LEDMYRGAIETLRKKGLLP  1060
             LEDM+ GA+ET R+KGLLP
Sbjct  310   LEDMFTGAVETCREKGLLP  328



>gb|AEF14420.1| dihydroflavonol 4-reductase [Onobrychis viciifolia]
Length=341

 Score =   484 bits (1246),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 222/329 (67%), Positives = 266/329 (81%), Gaps = 0/329 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGAAGF+GSWLV  L++RGY + ATVRDP N KKVKHLL+LP A T L++WK  +  
Sbjct  8     VCVTGAAGFVGSWLVMRLIERGYTVRATVRDPANMKKVKHLLDLPDAKTKLSLWKADLAH  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDFDSKDPENEVIKP ING+L+I+ +C KAKTV+RLVFTS
Sbjct  68    EGSFDEAIKGCTGVFHVATPMDFDSKDPENEVIKPTINGLLDIMKACEKAKTVRRLVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT++V    KPV DETCWSD++F    KMTGWMYF SK LAE+EAWK  KE  IDFIS
Sbjct  128   SAGTVDVTEHPKPVIDETCWSDIEFCRRVKMTGWMYFVSKTLAEQEAWKYAKEHNIDFIS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             +IPPLVVGPF+ PT PPSLITALSLITGN++HY IIKQGQYVHLDDLC  HIFL+EHPK 
Sbjct  188   VIPPLVVGPFLMPTMPPSLITALSLITGNESHYHIIKQGQYVHLDDLCLGHIFLFEHPKP  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+IC S   TIH +A +I + +PE+ +P++FK I  +L ++ FSSKK+ D+GF+FKY+
Sbjct  248   EGRYICCSDEATIHDVAKLINKIYPEFNVPTKFKDIPDELEIIKFSSKKITDLGFKFKYT  307

Query  1004  LEDMYRGAIETLRKKGLLPYSTKEAAAIE  1090
             LEDM  GA+ET R+KGLLP + +E   + 
Sbjct  308   LEDMLTGAVETCREKGLLPKAVEETTPVN  336



>gb|AFF60412.1| dihydroflavonol reductase [Pyrus pyrifolia]
Length=347

 Score =   484 bits (1247),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 222/332 (67%), Positives = 272/332 (82%), Gaps = 0/332 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+ GY + ATVRDP N KKVKHLL+LPKA+T+LT+WK  + +
Sbjct  8     VCVTGASGFIGSWLVMRLLEHGYTVRATVRDPTNQKKVKHLLDLPKAETHLTLWKADLAD  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDPENEVIKP ING+L+I+ +C KAKTV++LVFTS
Sbjct  68    EGSFDEAIQGCSGVFHVATPMDFESKDPENEVIKPTINGLLDILKACQKAKTVRKLVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NV+  QKPVYDE+ WSD++F  + KMTGWMYF SK LAE+ AWK  KE  IDFI+
Sbjct  128   SAGTVNVEEHQKPVYDESNWSDVEFCRSVKMTGWMYFVSKTLAEQAAWKYAKENNIDFIT  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LV+GPF+ P+ PPSLIT LS I  N++HY IIKQGQYVHLDDLC +HI+LYEHPKA
Sbjct  188   IIPTLVIGPFLMPSMPPSLITGLSPILRNESHYGIIKQGQYVHLDDLCLSHIYLYEHPKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSSH  TIH L  M+ + +PEY IP++FKGI+ +L  V+FSSKKL+++GF+FKYS
Sbjct  248   EGRYICSSHDATIHELVKMLREKYPEYNIPTKFKGIDDNLEPVHFSSKKLREIGFEFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQ  1099
             LEDM+ GA++  R KGL+P   ++  A EE  
Sbjct  308   LEDMFVGAVDACRAKGLIPIPAEKTEAAEESN  339



>gb|ADZ54784.1| dihydrokaempferol 4-reductase [Prunus avium]
Length=346

 Score =   484 bits (1247),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 219/319 (69%), Positives = 267/319 (84%), Gaps = 0/319 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+RGY + ATVRDP N KKVKHLL+LPKA+T+LT+WK  + +
Sbjct  8     VCVTGASGFIGSWLVMRLLERGYTVRATVRDPANQKKVKHLLDLPKAETHLTLWKADLAD  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDPENEVIKP INGVL+I+ +C+KAKTV+RLVFTS
Sbjct  68    EGSFDEAIQGCTGVFHVATPMDFESKDPENEVIKPTINGVLDIMKACLKAKTVRRLVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NV+  Q+P YDET WSD++F  + KMTGWMYF SK LAE+ AWK  KE  IDFI+
Sbjct  128   SAGTVNVEEHQRPSYDETNWSDVEFCRSVKMTGWMYFVSKTLAEQAAWKFAKENNIDFIT  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LV+GPF+  + PPSLIT LS +TGN +HYSIIK+GQ+VHLDDLC +HI+LYEHPKA
Sbjct  188   IIPTLVIGPFLMSSMPPSLITGLSPLTGNTSHYSIIKRGQFVHLDDLCLSHIYLYEHPKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSSH  TI+ +A ++ + +PEY IP++F  IE +L  V+FSSKKL D GF+FKYS
Sbjct  248   EGRYICSSHDATIYDIAKLLXEKYPEYNIPTKFDNIEXNLTKVHFSSKKLTDQGFEFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLP  1060
             LEDM+ GA++T R KGL+P
Sbjct  308   LEDMFVGAVDTCRAKGLIP  326



>gb|AGZ15302.1| dihydroflavonol 4-reductase [Pyrus x bretschneideri]
Length=347

 Score =   484 bits (1247),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 222/332 (67%), Positives = 272/332 (82%), Gaps = 0/332 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+ GY + ATVRDP N KKVKHLL+LPKA+T+LT+WK  + +
Sbjct  8     VCVTGASGFIGSWLVMRLLEHGYTVRATVRDPTNQKKVKHLLDLPKAETHLTLWKADLAD  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDPENEVIKP ING+L+I+ +C KAKTV++LVFTS
Sbjct  68    EGSFDEAIQGCSGVFHVATPMDFESKDPENEVIKPTINGLLDILKACQKAKTVRKLVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NV+  QKPVYDE+ WSD++F  + KMTGWMYF SK LAE+ AWK  KE  IDFI+
Sbjct  128   SAGTVNVEEHQKPVYDESNWSDVEFCRSVKMTGWMYFVSKTLAEQAAWKYAKENNIDFIT  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LV+GPF+ P+ PPSLIT LS I  N++HY IIKQGQYVHLDDLC +HI+LYEHPKA
Sbjct  188   IIPTLVIGPFLMPSMPPSLITGLSPILRNESHYGIIKQGQYVHLDDLCLSHIYLYEHPKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSSH  TIH L  M+ + +PEY IP++FKGI+ +L  V+FSSKKL+++GF+FKYS
Sbjct  248   EGRYICSSHDATIHELVKMLREKYPEYNIPTKFKGIDDNLEPVHFSSKKLREIGFEFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQ  1099
             LEDM+ GA++  R KGL+P   ++  A EE  
Sbjct  308   LEDMFVGAVDACRAKGLIPIPAEKTEAAEESN  339



>gb|AEO79982.1| dihydroflavonol 4-reductase [Prunus avium]
Length=346

 Score =   484 bits (1245),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 218/319 (68%), Positives = 268/319 (84%), Gaps = 0/319 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+RGY +  TVRDP N KKVKHLL+LPKA+T+LT+WK  + +
Sbjct  8     VCVTGASGFIGSWLVMRLLERGYTVRTTVRDPANQKKVKHLLDLPKAETHLTLWKADLAD  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDPENEVIKP INGVL+I+ +C+KAKTV+RLVFTS
Sbjct  68    EGSFDEAIQGCTGVFHVATPMDFESKDPENEVIKPTINGVLDIMKACLKAKTVRRLVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NV+  Q+P YDET WSD++F  + KMTGWMYF SK LAE+ AWK+ KE  IDFI+
Sbjct  128   SAGTVNVEEHQRPSYDETNWSDVEFCRSVKMTGWMYFVSKTLAEQAAWKLAKENNIDFIT  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LV+GPF+  + PPSLIT LS +TGN +HYSIIK+GQ+VHLDDLC +HI+LYEHPKA
Sbjct  188   IIPTLVIGPFLMSSMPPSLITGLSPLTGNTSHYSIIKRGQFVHLDDLCLSHIYLYEHPKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSSH  TI+ +A ++ + +PEY IP++F  IE++L  V+FSSKKL D GF+FKYS
Sbjct  248   EGRYICSSHDATIYDIAKLLREKYPEYNIPTKFDNIEENLTKVHFSSKKLTDQGFEFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLP  1060
             LEDM+ GA++T R KGL+P
Sbjct  308   LEDMFVGAVDTCRAKGLIP  326



>gb|AHL46451.1| dihydroflavonol 4-reductase [Fragaria x ananassa]
Length=349

 Score =   484 bits (1245),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 218/319 (68%), Positives = 268/319 (84%), Gaps = 0/319 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GF+GSWLV  LL+RGY + ATVRDP N KKVKHLL+LPKA T+LT+WK  + +
Sbjct  8     VCVTGASGFVGSWLVMRLLERGYTVRATVRDPTNAKKVKHLLDLPKAATHLTLWKADLAD  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDPENEVIKP INGVL+I+ +C+KAKTV+RLVFT+
Sbjct  68    EGSFDEAIKGCSGVFHVATPMDFESKDPENEVIKPTINGVLDIMKACLKAKTVRRLVFTA  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAG++NV+  QKPVY+E+ WSD++F    KMTGWMYF SK LAE+EAWK  KE  IDFI+
Sbjct  128   SAGSVNVEETQKPVYNESNWSDVEFCRRVKMTGWMYFVSKTLAEQEAWKFAKENNIDFIT  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LV+GPF+ P  PPSLIT LS + GN+ HYSIIKQGQ+VHLDDLC++HI+LYEHPKA
Sbjct  188   IIPTLVIGPFLMPAMPPSLITGLSPLFGNEGHYSIIKQGQFVHLDDLCQSHIYLYEHPKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSSH  TIH +A ++ + +PEY +P++FKGIE +L  V+FSSKKL + GF+FKYS
Sbjct  248   EGRYICSSHDATIHEIAKLLREKYPEYNVPTKFKGIEDNLTKVHFSSKKLLETGFEFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLP  1060
             LEDM+ GA++  + KGLLP
Sbjct  308   LEDMFVGAVDACKAKGLLP  326



>dbj|BAD67185.1| dihydroflavonol 4-reductase [Spinacia oleracea]
Length=342

 Score =   483 bits (1244),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 223/319 (70%), Positives = 267/319 (84%), Gaps = 1/319 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGAAGFIGSWLVK LL+ GY + ATVRDPGN KKV+HLL+LP A+T+LT+WK  + E
Sbjct  8     VCVTGAAGFIGSWLVKRLLEHGYIVRATVRDPGNVKKVQHLLDLPNANTHLTLWKADLNE  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             +GSFDEAI+GC GVFHVATPMDFDS DPENEVIKP ING+L+I+ SC KAK ++RLVFTS
Sbjct  68    QGSFDEAISGCAGVFHVATPMDFDSNDPENEVIKPTINGMLDIMRSCAKAK-IRRLVFTS  126

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NV+  QKPVYDETCWSD++F  +KKMTGWMYF SK LAEK AWK   E  +DFIS
Sbjct  127   SAGTVNVEEIQKPVYDETCWSDMEFCSSKKMTGWMYFVSKTLAEKAAWKFAAENNLDFIS  186

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIPPLVVGPFITPT PPSLITALS IT N+AHYSIIKQGQ+VHLDDLC AHI+LYEHP A
Sbjct  187   IIPPLVVGPFITPTMPPSLITALSPITRNEAHYSIIKQGQFVHLDDLCMAHIYLYEHPNA  246

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             +GR+I S+   TI+ +  M+ + +PEY IP++FK  E+D+  V+FSS+KL  + F+FKY 
Sbjct  247   KGRYIASACDATIYDIGKMLREEYPEYNIPTKFKDFEEDMEHVHFSSEKLMGLNFKFKYE  306

Query  1004  LEDMYRGAIETLRKKGLLP  1060
             L+DMY+GA++T R KGLLP
Sbjct  307   LKDMYKGAVDTCRTKGLLP  325



>gb|AAO39818.1| dihydroflavonol 4-reductase [Pyrus communis]
 gb|AAO39819.1| dihydroflavonol 4-reductase [Pyrus communis]
 gb|AGL50917.1| dihydroflavonol 4-reductase [Pyrus communis]
 gb|AGL81349.1| dihydroflavonol 4-reductase 1 [Pyrus communis]
 gb|AGL81350.1| dihydroflavonol 4-reductase 2 [Pyrus communis]
Length=347

 Score =   483 bits (1243),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 221/332 (67%), Positives = 272/332 (82%), Gaps = 0/332 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+ GY + ATVRDP N KKVKHLL+LPKA+T+LT+WK  + +
Sbjct  8     VCVTGASGFIGSWLVMRLLEHGYTVRATVRDPTNQKKVKHLLDLPKAETHLTLWKADLAD  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDPENEVIKP ING+L+I+ +C KAKTV++LVFTS
Sbjct  68    EGSFDEAIQGCSGVFHVATPMDFESKDPENEVIKPTINGLLDILKACQKAKTVRKLVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NV+  QKPVYDE+ WSD++F  + KMTGWMYF SK LAE+ AWK  KE  IDFI+
Sbjct  128   SAGTVNVEEHQKPVYDESNWSDVEFCRSVKMTGWMYFVSKTLAEQAAWKYAKENNIDFIT  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LV+GPF+ P+ PPSLIT LS I  N++HY IIKQGQYVHLDDLC +HI+LY+HPKA
Sbjct  188   IIPTLVIGPFLMPSMPPSLITGLSPILRNESHYGIIKQGQYVHLDDLCLSHIYLYKHPKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSSH  TIH L  M+ + +PEY IP++FKGI+ +L  V+FSSKKL+++GF+FKYS
Sbjct  248   EGRYICSSHDATIHELVKMLREKYPEYNIPTKFKGIDDNLEPVHFSSKKLREIGFEFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQ  1099
             LEDM+ GA++  R KGL+P   ++  A EE  
Sbjct  308   LEDMFVGAVDACRAKGLIPIPAEKTEAAEESN  339



>gb|AEX07281.1| DFR [Arachis hypogaea]
Length=345

 Score =   483 bits (1242),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 221/338 (65%), Positives = 270/338 (80%), Gaps = 0/338 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+ GY + ATVRDP N KKVKHLLELP A   L++WK  + E
Sbjct  8     VCVTGASGFIGSWLVMRLLEHGYTVRATVRDPANMKKVKHLLELPGAKAKLSLWKAELGE  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDPENEVIKP INGV++I+ +C+KAKTV+RL+FTS
Sbjct  68    EGSFDEAINGCTGVFHVATPMDFESKDPENEVIKPTINGVIDIMKACLKAKTVRRLIFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NV   +K +YDETCWSD+DF    KMTGWMYF SK LAE+EAWK +KE  +DFI+
Sbjct  128   SAGTVNVSEPKKDLYDETCWSDVDFCRRVKMTGWMYFVSKTLAEQEAWKFSKEHNMDFIT  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIPPLVVGPFI PT PPSLITALS ITGN+AHYSIIKQGQ+ HLDD C AHIFL+E PK 
Sbjct  188   IIPPLVVGPFIMPTMPPSLITALSPITGNEAHYSIIKQGQFAHLDDFCRAHIFLFERPKV  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICS+   TIH +A  + + +PEY +P+ FK I  +L ++ FSS K++D+GFQFKY+
Sbjct  248   EGRYICSACDATIHQIAKFLNKKYPEYDVPTTFKNIPDELELIRFSSNKIKDLGFQFKYT  307

Query  1004  LEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALK  1117
             LE+MY GA++T R+KGLLP + K A    +++    +K
Sbjct  308   LENMYTGAVDTCREKGLLPNNNKLATPENDDEACKDIK  345



>gb|AEI59122.1| dihydroflavonol 4-reductase [Medicago sativa]
Length=339

 Score =   482 bits (1241),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 221/319 (69%), Positives = 266/319 (83%), Gaps = 0/319 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  L++ GY + ATVRDP N KKVKHLLELP A++ L++WK  + E
Sbjct  8     VCVTGASGFIGSWLVMRLIEHGYTVRATVRDPDNIKKVKHLLELPGANSKLSLWKADLGE  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDPE EVI P ING+L+I+ +C KAKTV+RLVFTS
Sbjct  68    EGSFDEAIKGCTGVFHVATPMDFESKDPEKEVINPTINGLLDIMKACEKAKTVRRLVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGTL+V   QK V DETCWSD++F    KMTGWMYF SK LAE+EAWK +KE  IDF+S
Sbjct  128   SAGTLDVTEHQKSVIDETCWSDVEFCRRVKMTGWMYFVSKTLAEQEAWKFSKEHNIDFVS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIPPLVVGPFI P+ PPSLITALSLITGN+AHYSIIKQGQY+HL DLC AHIFL+E+PKA
Sbjct  188   IIPPLVVGPFIMPSMPPSLITALSLITGNEAHYSIIKQGQYIHLHDLCLAHIFLFENPKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             +GR+IC SH  TIH +A +I + +PE+ +P++FK I  +L ++ FSSKK+ D+GF+F+YS
Sbjct  248   QGRYICCSHEATIHEVAKLINKKYPEFNVPTKFKDIPDELEIIKFSSKKITDLGFKFEYS  307

Query  1004  LEDMYRGAIETLRKKGLLP  1060
             LEDM+ GAIET R+KGLLP
Sbjct  308   LEDMFTGAIETCREKGLLP  326



>ref|XP_004291858.1| PREDICTED: bifunctional dihydroflavonol 4-reductase/flavanone 
4-reductase-like [Fragaria vesca subsp. vesca]
 gb|AHL46446.1| dihydroflavonol 4-reductase [Fragaria vesca]
 gb|AHL46447.1| dihydroflavonol 4-reductase [Fragaria vesca]
Length=349

 Score =   483 bits (1242),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 220/335 (66%), Positives = 272/335 (81%), Gaps = 0/335 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GF+GSWLV  LL+RGY + ATVRDP N KKVKHLL+LPKA T+LT+WK  + +
Sbjct  8     VCVTGASGFVGSWLVMRLLERGYTVRATVRDPTNAKKVKHLLDLPKAATHLTLWKADLAD  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDPENEVIKP INGVL+I+ +C+KAKTV+RLVFT+
Sbjct  68    EGSFDEAIKGCTGVFHVATPMDFESKDPENEVIKPTINGVLDIMKACLKAKTVRRLVFTA  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAG++NV+  QKPVY+E+ WSD++F    KMTGWMYF SK LAE+EAWK  KE  IDFI+
Sbjct  128   SAGSVNVEETQKPVYNESNWSDVEFCRRVKMTGWMYFVSKTLAEQEAWKFAKENNIDFIT  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LV+GPF+ P  PPSLIT LS + GN+ HYSIIKQGQ+VHLDDLC++HI+LYEHPKA
Sbjct  188   IIPTLVIGPFLMPAMPPSLITGLSPLFGNEGHYSIIKQGQFVHLDDLCQSHIYLYEHPKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSSH  TIH +  ++ + +PEY +P++FKGIE +L  V+FSSKKL + GF+FKYS
Sbjct  248   EGRYICSSHDATIHEIGKLLREKYPEYNVPTKFKGIEDNLTKVHFSSKKLLETGFEFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETV  1108
             LEDM+ GA++  + KGLLP  T+     E    +V
Sbjct  308   LEDMFVGAVDACKAKGLLPPPTERVEKQENGDSSV  342



>ref|NP_001280868.1| bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase 
[Malus domestica]
 sp|Q9XES5.1|DFRA_MALDO RecName: Full=Bifunctional dihydroflavonol 4-reductase/flavanone 
4-reductase; AltName: Full=Dihydroflavonol 4-reductase; 
Short=DFR; AltName: Full=Dihydrokaempferol 4-reductase; AltName: 
Full=Flavanone 4-reductase; Short=FNR [Malus domestica]
 gb|AAD26204.1|AF117268_1 dihydroflavonol reductase [Malus domestica]
 gb|AAO39817.1| dihydroflavonol 4-reductase [Malus domestica]
Length=348

 Score =   482 bits (1241),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 225/340 (66%), Positives = 274/340 (81%), Gaps = 1/340 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+ GY + ATVRDP N KKVKHLL+LPKA+T+LT+WK  + +
Sbjct  8     VCVTGASGFIGSWLVMRLLEHGYTVRATVRDPTNQKKVKHLLDLPKAETHLTLWKADLAD  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDPENEVIKP ING+L+I+ +C KAKTV++LVFTS
Sbjct  68    EGSFDEAIQGCSGVFHVATPMDFESKDPENEVIKPTINGLLDILKACQKAKTVRKLVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NV+  QKPVYDE+ WSD++F  + KMTGWMYF SK LAE+ AWK  KE  IDFI+
Sbjct  128   SAGTVNVEEHQKPVYDESNWSDVEFCRSVKMTGWMYFVSKTLAEQAAWKYAKENNIDFIT  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LV+GPF+ P+ PPSLIT LS I  N++HY IIKQGQYVHLDDLC +HI+LYEHPKA
Sbjct  188   IIPTLVIGPFLMPSMPPSLITGLSPILRNESHYGIIKQGQYVHLDDLCLSHIYLYEHPKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSSH  TIH L  M+ + +PEY IP++FKGI+ +L  V+FSSKKL+++GF+FKYS
Sbjct  248   EGRYICSSHDATIHELVKMLREKYPEYNIPTKFKGIDDNLEPVHFSSKKLREIGFEFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYST-KEAAAIEEEQETVALKV  1120
             LEDM+ GA++  R KGL+P     E     EE   V +KV
Sbjct  308   LEDMFVGAVDACRAKGLIPIPIPAEKTEAAEESNLVDVKV  347



>sp|Q84KP0.1|DFRA_PYRCO RecName: Full=Bifunctional dihydroflavonol 4-reductase/flavanone 
4-reductase; AltName: Full=Dihydroflavonol 4-reductase; 
Short=DFR; AltName: Full=Flavanone 4-reductase; Short=FNR [Pyrus 
communis]
 gb|AAO39820.1| putative dihydroflavonol 4-reductase [Pyrus communis]
Length=347

 Score =   482 bits (1241),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 220/332 (66%), Positives = 272/332 (82%), Gaps = 0/332 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+ GY + ATVRDP N KKVKHLL+LPKA+T+LT+WK  + +
Sbjct  8     VCVTGASGFIGSWLVMRLLEHGYTVRATVRDPTNQKKVKHLLDLPKAETHLTLWKADLAD  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+S+DPENEVIKP ING+L+I+ +C KAKTV++LVFTS
Sbjct  68    EGSFDEAIQGCSGVFHVATPMDFESRDPENEVIKPTINGLLDILKACQKAKTVRKLVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NV+  QKPVYDE+ WSD++F  + KMTGWMYF SK LAE+ AWK  KE  IDFI+
Sbjct  128   SAGTVNVEEHQKPVYDESNWSDVEFCRSVKMTGWMYFVSKTLAEQAAWKYAKENNIDFIT  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LV+GPF+ P+ PPSLIT LS I  N++HY IIKQGQYVHLDDLC +HI+LY+HPKA
Sbjct  188   IIPTLVIGPFLMPSMPPSLITGLSPILRNESHYGIIKQGQYVHLDDLCLSHIYLYKHPKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSSH  TIH L  M+ + +PEY IP++FKGI+ +L  V+FSSKKL+++GF+FKYS
Sbjct  248   EGRYICSSHDATIHELVKMLREKYPEYNIPTKFKGIDDNLEPVHFSSKKLREIGFEFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQ  1099
             LEDM+ GA++  R KGL+P   ++  A EE  
Sbjct  308   LEDMFVGAVDACRAKGLIPIPAEKTEAAEESN  339



>dbj|BAI78343.1| dihydroflavonol reductase [Pelargonium zonale]
Length=340

 Score =   482 bits (1240),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 222/324 (69%), Positives = 272/324 (84%), Gaps = 1/324 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWL+  LL+RGY + ATVRDP N KKVKHLLELPKA+TNLT+WK  +  
Sbjct  11    VCVTGASGFIGSWLIMRLLERGYMVRATVRDPANMKKVKHLLELPKAETNLTLWKADLAV  70

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             +GSFDE I GC GVFHVATPMDF+SKDPENEVIKP I+G+L+I+ +C KAK V+RLVFTS
Sbjct  71    QGSFDEPIQGCTGVFHVATPMDFESKDPENEVIKPTIDGMLSIMKACEKAK-VRRLVFTS  129

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT++V+ QQ   YDE CWSDL+F+ +KKMTGWMYF SK LAE+EAWK  KE  I+FIS
Sbjct  130   SAGTVDVREQQMSEYDEECWSDLEFMLSKKMTGWMYFVSKTLAEQEAWKYAKENNIEFIS  189

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LVVGPF+ P+ PPSLITALS ITGN++HYSIIKQG +VHLDDLC AHI+L+E+PKA
Sbjct  190   IIPTLVVGPFLMPSMPPSLITALSPITGNESHYSIIKQGHFVHLDDLCIAHIYLFENPKA  249

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             +GR+ICSSH  TI  LA ++ Q +PEY +P+EFK ++++L  V FSSKKL+++GF+FKYS
Sbjct  250   QGRYICSSHDATILELAKLLRQKFPEYNVPTEFKDVDENLKSVSFSSKKLKELGFEFKYS  309

Query  1004  LEDMYRGAIETLRKKGLLPYSTKE  1075
             LEDM+ GA+ET R+KGLLP S  +
Sbjct  310   LEDMFAGAVETCREKGLLPLSNGD  333



>gb|AFK35813.1| unknown [Medicago truncatula]
Length=339

 Score =   481 bits (1239),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 223/323 (69%), Positives = 265/323 (82%), Gaps = 0/323 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  L++RGY + ATVRDP N KKVKHLLELP A++ L++WK  + E
Sbjct  8     VCVTGASGFIGSWLVMRLMERGYTVRATVRDPDNMKKVKHLLELPGANSKLSLWKADLGE  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDPE EVI P ING+L+I+ +C KAKTV+RLVFTS
Sbjct  68    EGSFDEAIKGCTGVFHVATPMDFESKDPEKEVINPTINGLLDIMKACKKAKTVRRLVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGTL+V  QQ  V DETCWSD++F    KMTGWMYF SK LAE+EAWK +KE  ID +S
Sbjct  128   SAGTLDVTEQQNSVIDETCWSDVEFCRRVKMTGWMYFVSKTLAEQEAWKFSKEHNIDLVS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIPPLVVGPFI P+ PPSLITALSLITG +AHYSIIKQG Y+HLDDLC AHIFL+E+PKA
Sbjct  188   IIPPLVVGPFIMPSMPPSLITALSLITGYEAHYSIIKQGPYIHLDDLCLAHIFLFENPKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
              GR+IC SH  TIH +A +I + +PE+ +P++FK I  DL ++ FSSKK+ D+GF FKYS
Sbjct  248   HGRYICCSHEATIHEVAKLINKKYPEFNVPTKFKDIPDDLEIIKFSSKKITDLGFIFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYSTK  1072
             LEDM+ GAIET R+KGLLP  T+
Sbjct  308   LEDMFTGAIETCREKGLLPKVTE  330



>gb|AAX16491.1| dihydroflavonol 4-reductase [Crataegus monogyna]
Length=347

 Score =   481 bits (1239),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 220/332 (66%), Positives = 272/332 (82%), Gaps = 0/332 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+ GY + ATVRDP N KKVKHLL+LPKA+T+LT+WK  + +
Sbjct  8     VCVTGASGFIGSWLVMRLLEHGYTVRATVRDPTNQKKVKHLLDLPKAETHLTLWKADLAD  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDPENEVIKP ING+L+I+ +C KAKTV++LVFTS
Sbjct  68    EGSFDEAIQGCSGVFHVATPMDFESKDPENEVIKPTINGLLDILKACQKAKTVRKLVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NV+  QKPVYDE+ WSD++F  + KMTGWMYF SK LAE+ AWK  KE  IDFI+
Sbjct  128   SAGTVNVEEHQKPVYDESNWSDVEFCRSVKMTGWMYFVSKTLAEQAAWKYAKENNIDFIT  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LV+GPF+ P+ PPSLIT LS I  N++HY IIKQGQYVHLDDLC +HI+LY+HPKA
Sbjct  188   IIPTLVIGPFLMPSMPPSLITGLSPILRNESHYGIIKQGQYVHLDDLCLSHIYLYKHPKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSSH  TIH L  M+ + +PEY IP++FKGI+ +L  V+FSSKKL+++GF+FKYS
Sbjct  248   EGRYICSSHDATIHELVKMLREKYPEYNIPTKFKGIDDNLEPVHFSSKKLREIGFEFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQ  1099
             LEDM+ GA++  R KGL+P   ++  A E+  
Sbjct  308   LEDMFVGAVDACRAKGLIPIPAEKTEAAEDSN  339



>gb|AHZ31751.1| dihydroflavonol 4-reductase [Viola x wittrockiana]
Length=347

 Score =   481 bits (1239),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 223/319 (70%), Positives = 265/319 (83%), Gaps = 1/319 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWL+  +L++GY + ATVRDP N KKVKHLLELPKA T+LT+WK  +  
Sbjct  12    VCVTGASGFIGSWLIMRVLEQGYTVRATVRDPDNVKKVKHLLELPKASTHLTLWKADLSV  71

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDFDSKDPENEVIKP + GVL+I+ +CVKAKTV+R+VFTS
Sbjct  72    EGSFDEAIQGCNGVFHVATPMDFDSKDPENEVIKPTVYGVLDIMKACVKAKTVQRVVFTS  131

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT++V+  +KPVYDE+  SDL+F+ + KMTGWMYF SK LAE+ AWK   E KIDFIS
Sbjct  132   SAGTVDVEEHKKPVYDESNRSDLEFVRSVKMTGWMYFVSKTLAERAAWKFAAENKIDFIS  191

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIPPLVVGPFI P  PPSLITALSLITGN+AHY IIK G YVHLDDLC+AHIFL+EHPK+
Sbjct  192   IIPPLVVGPFIMPLMPPSLITALSLITGNEAHYGIIKLGNYVHLDDLCQAHIFLFEHPKS  251

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICS+   TIH LA M+ Q +PEY IP  + G +++L    FSSKK+ D+GFQFKY+
Sbjct  252   EGRYICSAEAATIHDLAKMLRQKYPEYNIPESY-GTDENLSKCVFSSKKVTDLGFQFKYN  310

Query  1004  LEDMYRGAIETLRKKGLLP  1060
             LEDM+ GA+ET R+KGLLP
Sbjct  311   LEDMFVGAVETCREKGLLP  329



>gb|AHZ30596.1| dihydroflavonol reductase, partial [Prunus domestica]
Length=340

 Score =   481 bits (1238),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 220/339 (65%), Positives = 276/339 (81%), Gaps = 2/339 (1%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCV GA+GF GSWLV  LL+RGY + ATVRDP N KKVKHLLELPKA+T+LT+WK  + +
Sbjct  2     VCVXGASGFXGSWLVMRLLERGYTVRATVRDPTNQKKVKHLLELPKAETHLTLWKADLAD  61

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDPENEVIKP INGVL+I+ +C+KAKTV+RLVFTS
Sbjct  62    EGSFDEAIQGCTGVFHVATPMDFESKDPENEVIKPTINGVLDILKACLKAKTVRRLVFTS  121

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+N++  QK  YDET WSD++F  + KMTGWMYF SK LAE+ AWK  KE  IDFI+
Sbjct  122   SAGTVNIEENQKSFYDETNWSDVEFCRSVKMTGWMYFVSKTLAEQAAWKFAKENNIDFIT  181

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LV+GPF+ P+ PPSLIT LS +TGN +HYSIIK+GQ+VHLDDLC +HI+LYEHPKA
Sbjct  182   IIPTLVIGPFLMPSMPPSLITGLSPLTGNTSHYSIIKRGQFVHLDDLCLSHIYLYEHPKA  241

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSSH  TI+ +A ++ + +PEY IP++F  IE++L  ++FSSKKL D GF+FKY+
Sbjct  242   EGRYICSSHDATIYDIAKLLREKYPEYNIPTKFDNIEENLTNIHFSSKKLTDQGFEFKYN  301

Query  1004  LEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKV  1120
             L+DM+ GA++T R KGL+P S ++  A  ++   V +KV
Sbjct  302   LDDMFVGAVDTCRAKGLIPISAEKHEA--DDNTVVDVKV  338



>gb|AAO39816.1| dihydroflavonol 4-reductase [Malus domestica]
Length=348

 Score =   481 bits (1238),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 219/319 (69%), Positives = 267/319 (84%), Gaps = 0/319 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+ GY + ATVRDP N KKVKHLL+LPKA+T+LT+WK  + +
Sbjct  8     VCVTGASGFIGSWLVMRLLEHGYTVRATVRDPTNQKKVKHLLDLPKAETHLTLWKADLAD  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDPENEVIKP ING+L+I+ +C KAKTV++LVFTS
Sbjct  68    EGSFDEAIQGCSGVFHVATPMDFESKDPENEVIKPTINGLLDILKACQKAKTVRKLVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NV+  QKPVYDE+ WSD++F  + KMTGWMYF SK LAE+ AWK  KE  IDFI+
Sbjct  128   SAGTVNVEEHQKPVYDESNWSDVEFCRSVKMTGWMYFVSKTLAEQAAWKYAKENNIDFIT  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LV+GPF+ P+ PPSLIT LS I  N++HY IIKQGQYVHLDDLC +HI+LYEHPKA
Sbjct  188   IIPTLVIGPFLMPSMPPSLITGLSPILRNESHYGIIKQGQYVHLDDLCLSHIYLYEHPKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSSH  TIH L  M+ + +PEY IP++FKGI+ +L  V+FSSKKL+++GF+FKYS
Sbjct  248   EGRYICSSHDATIHELVKMLREKYPEYNIPTKFKGIDDNLEPVHFSSKKLREIGFEFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLP  1060
             LEDM+ GA++  R KGL+P
Sbjct  308   LEDMFVGAVDACRAKGLIP  326



>gb|AGZ15301.1| dihydroflavonol 4-reductase [Pyrus x bretschneideri]
Length=347

 Score =   481 bits (1238),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 220/332 (66%), Positives = 271/332 (82%), Gaps = 0/332 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+ GY + AT RDP N KKVKHLL+LPKA+T+LT+WK  + +
Sbjct  8     VCVTGASGFIGSWLVMRLLEHGYTVRATARDPTNQKKVKHLLDLPKAETHLTLWKADLAD  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDPENEVIKP ING+L+I+ +C KAKTV++LVFTS
Sbjct  68    EGSFDEAIQGCSGVFHVATPMDFESKDPENEVIKPTINGLLDILKACQKAKTVRKLVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NV+  QKPVYDE+ WSD++F  + KMTGWMYF SK LAE+ AWK  KE  IDFI+
Sbjct  128   SAGTVNVEEHQKPVYDESNWSDVEFCRSVKMTGWMYFVSKTLAEQAAWKYAKENNIDFIT  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LV+GPF+ P+ PPSLIT LS I  N++HY IIKQGQYVHLDDLC +HI+LY+HPKA
Sbjct  188   IIPTLVIGPFLMPSMPPSLITGLSPILRNESHYGIIKQGQYVHLDDLCLSHIYLYKHPKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSSH  TIH L  M+ + +PEY IP++FKGI+ +L  V+FSSKKL+++GF+FKYS
Sbjct  248   EGRYICSSHDATIHELVKMLREKYPEYNIPTKFKGIDDNLEPVHFSSKKLREIGFEFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQ  1099
             LEDM+ GA++  R KGL+P   ++  A EE  
Sbjct  308   LEDMFVGAVDACRAKGLIPIPAEKTEAAEESN  339



>gb|ABY89686.1| dihydroflavonol-4-reductase 2 protein [Brassica rapa subsp. oleifera]
Length=332

 Score =   480 bits (1236),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 220/319 (69%), Positives = 262/319 (82%), Gaps = 0/319 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+RGY + ATVRDPGN KKV+HLL+LP A T LT+WK  + +
Sbjct  8     VCVTGASGFIGSWLVMRLLERGYFVRATVRDPGNLKKVQHLLDLPNAKTQLTLWKADLSD  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGS+D+AI GC+GVFH+ATPMDF+SKDPENEVIKP +NGVL I+ +C KAKTV+R+VFTS
Sbjct  68    EGSYDDAINGCDGVFHIATPMDFESKDPENEVIKPTVNGVLGIMKACDKAKTVRRIVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NV+  QK VYDE  WSDLDFI +KKMTGWMYF SK LAEK AW   KEK IDFIS
Sbjct  128   SAGTVNVEEHQKNVYDENDWSDLDFIMSKKMTGWMYFMSKTLAEKAAWDYAKEKGIDFIS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LV+GPFIT + PPSLITALS IT N+AHYSII+QGQYVHLDDLC AHIFLYE   A
Sbjct  188   IIPTLVIGPFITTSMPPSLITALSPITRNEAHYSIIRQGQYVHLDDLCNAHIFLYEQAGA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             +GR++CSSH  TI  +++ + Q +PEY +PS F+G++++L  + FSSKKL DMGF FKYS
Sbjct  248   KGRYVCSSHDATILTISEFLRQKYPEYNVPSTFEGVDENLKSIMFSSKKLIDMGFNFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLP  1060
             LEDM   +IET R+KG LP
Sbjct  308   LEDMLVESIETCRQKGFLP  326



>ref|XP_009114035.1| PREDICTED: dihydroflavonol-4-reductase [Brassica rapa]
 gb|ABL86389.1| dihydroflavonol 4-reductase [Brassica juncea]
 gb|ABL86390.1| dihydroflavonol 4-reductase [Brassica juncea]
 emb|CDY52372.1| BnaA09g15710D [Brassica napus]
Length=385

 Score =   482 bits (1240),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 221/324 (68%), Positives = 264/324 (81%), Gaps = 0/324 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+RGY + ATVRDPGN KKV+HLL+LP A T LT+WK  + +
Sbjct  8     VCVTGASGFIGSWLVMRLLERGYFVRATVRDPGNLKKVQHLLDLPNAKTQLTLWKADLSD  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGS+D+AI GC+GVFH+ATPMDF+SKDPENEVIKP +NGVL I+ +C KAKTV+R+VFTS
Sbjct  68    EGSYDDAINGCDGVFHIATPMDFESKDPENEVIKPTVNGVLGIMKACDKAKTVRRIVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NV+  QK VYDE  WSDLDFI +KKMTGWMYF SK LAEK AW   KEK IDFIS
Sbjct  128   SAGTVNVEEHQKNVYDENDWSDLDFIMSKKMTGWMYFMSKTLAEKAAWDYAKEKGIDFIS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LV+GPFIT + PPSLITALS IT N+AHYSII+QGQYVHLDDLC AHIFLYE   A
Sbjct  188   IIPTLVIGPFITTSMPPSLITALSPITRNEAHYSIIRQGQYVHLDDLCNAHIFLYEQAAA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             +GR++CSSH  TI  +++ + Q +PEY +PS F+G++++L  + FSSKKL DMGF FKYS
Sbjct  248   KGRYVCSSHDATILTISEFLRQKYPEYNVPSTFEGVDENLKSIMFSSKKLIDMGFNFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYSTKE  1075
             LEDM   +IET R+KG LP +  E
Sbjct  308   LEDMLVESIETCRQKGFLPVTLPE  331



>gb|AGU42192.1| dihydroflavonol 4-reductase [Raphanus sativus]
Length=387

 Score =   482 bits (1240),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 221/321 (69%), Positives = 262/321 (82%), Gaps = 0/321 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+RGY + ATVRDPGN KKV+HLL+LP A T LT+WK  + +
Sbjct  9     VCVTGASGFIGSWLVMRLLERGYFVRATVRDPGNLKKVQHLLDLPNAKTQLTLWKADLSD  68

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGS+D+AI GC+GVFH+ATPMDF+SKDPENEVIKP +NGVL I+ +C KAKTV+R+VFTS
Sbjct  69    EGSYDDAINGCDGVFHIATPMDFESKDPENEVIKPTVNGVLGIMKACDKAKTVRRIVFTS  128

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NV+  QK VYDE  WSDLDFI +KKMTGWMYF SK LAEK AW   KEK IDFIS
Sbjct  129   SAGTVNVEEHQKNVYDENDWSDLDFIMSKKMTGWMYFMSKTLAEKAAWDYAKEKGIDFIS  188

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LV+GPFIT + PPSLITALS IT N+AHYSII+QGQYVHLDDLC AHIFLYE   A
Sbjct  189   IIPTLVIGPFITTSMPPSLITALSPITRNEAHYSIIRQGQYVHLDDLCNAHIFLYEQAVA  248

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             +GR++CSSH  TI  +++   Q +PEY +PS F+G++++L  + FSSKKL DMGF FKYS
Sbjct  249   KGRYVCSSHDATILTISEFFRQKYPEYNVPSSFEGVDENLKSIVFSSKKLIDMGFNFKYS  308

Query  1004  LEDMYRGAIETLRKKGLLPYS  1066
             LEDM   +IET R+KG LP S
Sbjct  309   LEDMLVESIETCRQKGFLPVS  329



>gb|ACP30362.1| dihydroflavonol-4-reductase protein [Malus hybrid cultivar]
Length=348

 Score =   480 bits (1236),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 224/340 (66%), Positives = 273/340 (80%), Gaps = 1/340 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+ GY + ATVRDP N KKVKHLL+LPKA+T+LT+WK  + +
Sbjct  8     VCVTGASGFIGSWLVMRLLEHGYTVRATVRDPTNQKKVKHLLDLPKAETHLTLWKADLAD  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDPENEVIKP ING+L+I+ +C KAKTV++LVFTS
Sbjct  68    EGSFDEAIQGCSGVFHVATPMDFESKDPENEVIKPTINGLLDILKACQKAKTVRKLVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NV+  QKPVYDE+ WSD++F  + KMTGWMYF SK LAE+ AWK  KE  IDFI+
Sbjct  128   SAGTVNVEEHQKPVYDESNWSDVEFCRSVKMTGWMYFVSKTLAEQAAWKYAKENNIDFIT  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LV+GPF+ P+ PPSLIT LS I  N++HY IIKQGQYVHLDDLC +H +LYEHPKA
Sbjct  188   IIPTLVIGPFLMPSMPPSLITGLSPILRNESHYGIIKQGQYVHLDDLCLSHTYLYEHPKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSSH  TIH L  M+ + +PEY IP++FKGI+ +L  V+FSSKKL+++GF+FKYS
Sbjct  248   EGRYICSSHDATIHELVKMLREKYPEYNIPTKFKGIDDNLEPVHFSSKKLREIGFEFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYST-KEAAAIEEEQETVALKV  1120
             LEDM+ GA++  R KGL+P     E     EE   V +KV
Sbjct  308   LEDMFVGAVDACRAKGLIPIPIPAEKTEAAEESNLVDVKV  347



>ref|XP_010673251.1| PREDICTED: dihydroflavonol-4-reductase [Beta vulgaris subsp. 
vulgaris]
Length=338

 Score =   480 bits (1235),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 223/321 (69%), Positives = 265/321 (83%), Gaps = 1/321 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGAAGFIGSWL+K LL+ GY + ATVRDPGN KKV+HLL+LP A+T+LT+WK  + E
Sbjct  8     VCVTGAAGFIGSWLIKRLLEHGYVVRATVRDPGNMKKVQHLLDLPNANTHLTLWKADLNE  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSF EAI GC GVFHVATPMDF+SKDPENEVIKP ING+L+I+ SCV AK ++RLVFTS
Sbjct  68    EGSFKEAINGCTGVFHVATPMDFESKDPENEVIKPTINGMLDIMKSCVNAK-IRRLVFTS  126

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NV+  QKP YDETCWSD+DF  +  MTGWMYF SK LAE+ AWK   E  +DFIS
Sbjct  127   SAGTVNVEEIQKPEYDETCWSDMDFCRSSNMTGWMYFVSKTLAEQVAWKFAAENNLDFIS  186

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIPPLVVGPF+TPT PPSLITALS IT N+AHYSIIKQGQ+VHLDDLC AHIFLYEHP A
Sbjct  187   IIPPLVVGPFLTPTMPPSLITALSPITKNEAHYSIIKQGQFVHLDDLCMAHIFLYEHPNA  246

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             +GR+I S+   TI+ +  M+ + +PEY IP +FK IE+D+ +V+FSS+KL  + F+FKY 
Sbjct  247   KGRYIASACDATIYDIGKMLREEYPEYNIPIKFKDIEEDIELVHFSSEKLMSLSFKFKYG  306

Query  1004  LEDMYRGAIETLRKKGLLPYS  1066
             L+DMY+GAIET R KGLLP S
Sbjct  307   LKDMYKGAIETCRAKGLLPLS  327



>gb|AAV80210.1| dihydroflavonol-4-reductase [Brassica rapa subsp. pekinensis]
 gb|ABY89685.1| dihydroflavonol-4-reductase 1 protein [Brassica rapa subsp. oleifera]
Length=385

 Score =   482 bits (1240),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 222/331 (67%), Positives = 267/331 (81%), Gaps = 0/331 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+RGY + ATVRDPGN KKV+HLL+LP A T LT+WK  + +
Sbjct  8     VCVTGASGFIGSWLVMRLLERGYFVRATVRDPGNLKKVQHLLDLPNAKTQLTLWKADLSD  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGS+D+AI GC+GVFH+ATPMDF+SKDPENEVIKP +NGVL I+ +C KAKTV+R+VFTS
Sbjct  68    EGSYDDAINGCDGVFHIATPMDFESKDPENEVIKPTVNGVLGIMKACDKAKTVRRIVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NV+  QK VYDE  WSDLDFI +KKMTGWMYF SK LAEK AW   KEK IDFIS
Sbjct  128   SAGTVNVEEHQKNVYDENDWSDLDFIMSKKMTGWMYFMSKTLAEKAAWDYAKEKGIDFIS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LV+GPFIT + PPSLITALS IT N+AHYSII+QGQYVHLDDLC AHIFLYE   A
Sbjct  188   IIPTLVIGPFITTSMPPSLITALSPITRNEAHYSIIRQGQYVHLDDLCNAHIFLYEQAGA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             +GR++CSSH  TI  +++ + Q +PEY +PS F+G++++L  + FSSKKL DMGF FKYS
Sbjct  248   KGRYVCSSHDATILTISEFLRQKYPEYNVPSTFEGVDENLKSIMFSSKKLIDMGFNFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYSTKEAAAIEEE  1096
             LEDM   +IET R+KG LP +  E    E++
Sbjct  308   LEDMLVESIETCRQKGFLPVTLPEHLKSEDK  338



>gb|AHL46448.1| dihydroflavonol 4-reductase [Fragaria vesca]
Length=349

 Score =   480 bits (1235),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 216/319 (68%), Positives = 266/319 (83%), Gaps = 0/319 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GF+GSWLV  LL+RGY + ATVRDP N KKVKHLL+LPKA T+LT+WK  + +
Sbjct  8     VCVTGASGFVGSWLVMRLLERGYTVRATVRDPTNAKKVKHLLDLPKAATHLTLWKADLAD  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDPENEVIKP INGVL+I+ +C+KAKTV+RLVFT+
Sbjct  68    EGSFDEAIKGCSGVFHVATPMDFESKDPENEVIKPTINGVLDIMKACLKAKTVRRLVFTA  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAG++NV+  QKPVY+E+ WSD++F    KMTGWMYF SK LAE+EAWK  KE  IDFI+
Sbjct  128   SAGSVNVEENQKPVYNESNWSDVEFCRRVKMTGWMYFVSKTLAEQEAWKFAKENNIDFIT  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LV+GPF+ P  PPSLIT LS + GN+ HYSIIKQGQ+VHLDDLC++HI+LYEHPKA
Sbjct  188   IIPTLVIGPFLMPAMPPSLITGLSPLFGNEGHYSIIKQGQFVHLDDLCQSHIYLYEHPKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSSH  TIH +A ++ + +PEY +P++FKGIE +L  V+FSS KL + GF+FKYS
Sbjct  248   EGRYICSSHDATIHEIAKLLREKYPEYNVPTKFKGIEDNLTKVHFSSNKLLETGFEFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLP  1060
             LE M+ GA++  + KGLLP
Sbjct  308   LEGMFVGAVDACKAKGLLP  326



>gb|AHZ97873.1| dihydroflavonol 4-reductase [Punica granatum]
Length=341

 Score =   479 bits (1234),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 218/321 (68%), Positives = 269/321 (84%), Gaps = 1/321 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGAAGFIGSWLV  LL+RGY + ATVRDP N KKVKHLL+LP A T+L++W+  + E
Sbjct  8     VCVTGAAGFIGSWLVMRLLERGYTVRATVRDPNNMKKVKHLLDLPNAKTHLSLWRADLNE  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
              GSFDE I GC GVFHVATPMDF+SKDPENEVIKP I G+L+I+ SCVKAK V+RLVFTS
Sbjct  68    AGSFDEPIQGCTGVFHVATPMDFESKDPENEVIKPTIEGMLSIMKSCVKAK-VRRLVFTS  126

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NVQP Q+PV+DET WSDLDF++A KMTGWMYF SK +AE+ AWK  +E  +DFIS
Sbjct  127   SAGTVNVQPVQRPVHDETSWSDLDFVWATKMTGWMYFVSKTMAERAAWKFAEENNLDFIS  186

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LVVGPF+ P+FPPSLITALS IT N+AHY II+QGQ+VHLDDLC +HIFLYEHP+A
Sbjct  187   IIPTLVVGPFLMPSFPPSLITALSPITRNEAHYGIIRQGQFVHLDDLCMSHIFLYEHPEA  246

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             +GR+ICSSH   I G+A ++ + +PEY IP++F+G++++   V FSSKKL+D+G +FK++
Sbjct  247   KGRYICSSHDENITGIAKLLREKYPEYDIPTKFEGVDENTEKVSFSSKKLRDLGLEFKHN  306

Query  1004  LEDMYRGAIETLRKKGLLPYS  1066
             LEDM+ GA+E  R+KGLLP S
Sbjct  307   LEDMFVGAVECCREKGLLPLS  327



>gb|AAX53571.1| dihydroflavonol 4-reductase [Brassica rapa subsp. oleifera]
 gb|AAX53572.1| dihydroflavonol 4-reductase [Brassica rapa subsp. oleifera]
Length=385

 Score =   481 bits (1237),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 221/324 (68%), Positives = 263/324 (81%), Gaps = 0/324 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+RGY + ATVRDPGN KKV+HLL+LP A T LT+WK  + +
Sbjct  8     VCVTGASGFIGSWLVMRLLERGYFVRATVRDPGNLKKVQHLLDLPNAKTQLTLWKADLSD  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGS+D+AI GC+GVFH+ATPMDF+SKDPENEVIKP +NGVL I  +C KAKTV+R+VFTS
Sbjct  68    EGSYDDAINGCDGVFHIATPMDFESKDPENEVIKPTVNGVLGITKACDKAKTVRRIVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NV+  QK VYDE  WSDLDFI +KKMTGWMYF SK LAEK AW   KEK IDFIS
Sbjct  128   SAGTVNVEEHQKNVYDENDWSDLDFIMSKKMTGWMYFMSKTLAEKAAWDYAKEKGIDFIS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LV+GPFIT + PPSLITALS IT N+AHYSII+QGQYVHLDDLC AHIFLYE   A
Sbjct  188   IIPTLVIGPFITTSMPPSLITALSPITRNEAHYSIIRQGQYVHLDDLCNAHIFLYEQAAA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             +GR++CSSH  TI  +++ + Q +PEY +PS F+G++++L  + FSSKKL DMGF FKYS
Sbjct  248   KGRYVCSSHDATILTISEFLRQKYPEYNVPSTFEGVDENLKSIMFSSKKLIDMGFNFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYSTKE  1075
             LEDM   +IET R+KG LP +  E
Sbjct  308   LEDMLVESIETCRQKGFLPVTLPE  331



>gb|AAP13055.1| dihydroflavonol 4-reductase [Gypsophila elegans]
Length=353

 Score =   479 bits (1234),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 221/335 (66%), Positives = 273/335 (81%), Gaps = 4/335 (1%)
 Frame = +2

Query  71    VDGNH---PLLPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPK  241
             +DG H   P+    VCVTGA+GFIGSWL+  LL+RGY +  TVRDP NTKKV+HLL+LP+
Sbjct  11    LDGKHDTKPVQGETVCVTGASGFIGSWLIMRLLERGYTVRGTVRDPDNTKKVQHLLDLPQ  70

Query  242   ADTNLTIWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINS  421
             A TNLT+WK  + EEGSFD+A+ GC GVFH+ATPMDF+SKDPENE+IKP ING+L+I+ S
Sbjct  71    AKTNLTLWKADLNEEGSFDKAVDGCSGVFHIATPMDFESKDPENEMIKPTINGMLDIMKS  130

Query  422   CVKAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKE  601
             C KAK VKR+VFTSS GT+NV+  QK  YDETCWSDLDFI + KMTGWMYF SKILAE+ 
Sbjct  131   CAKAK-VKRVVFTSSGGTVNVEETQKAEYDETCWSDLDFIRSVKMTGWMYFVSKILAEQA  189

Query  602   AWKVTKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDD  781
             AWK   E  +DFISIIPPLVVGPFI P+ PPSLITALS IT  ++HY+IIKQGQ+VHLDD
Sbjct  190   AWKYAAENNLDFISIIPPLVVGPFIMPSMPPSLITALSPITRTESHYTIIKQGQFVHLDD  249

Query  782   LCEAHIFLYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFS  961
             LC AHIFLYE+PKA+GR+I S+   TI+ +A M+ + +PEY +P++FK  ++D+ +V+FS
Sbjct  250   LCMAHIFLYENPKAQGRYIASACDATIYDIAKMLREEYPEYNVPTKFKDYKEDMDLVHFS  309

Query  962   SKKLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYS  1066
             SKKL ++GF+FKY L+DMY GA+ET R KGLLP S
Sbjct  310   SKKLTELGFEFKYGLKDMYTGAVETCRAKGLLPLS  344



>gb|ADB45307.1| dihydroflavonol 4-reductase [Brassica juncea var. napiformis]
Length=385

 Score =   480 bits (1236),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 220/324 (68%), Positives = 264/324 (81%), Gaps = 0/324 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+RGY + ATVRDPGN KKV+HLL+LP A T LT+WK  + +
Sbjct  8     VCVTGASGFIGSWLVMRLLERGYFVRATVRDPGNLKKVQHLLDLPNAKTQLTLWKADLSD  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGS+D+AI GC+GVFH+ATPMDF+SKDPENEVIKP +NGVL I+ +C KAKTV+R+VFTS
Sbjct  68    EGSYDDAINGCDGVFHIATPMDFESKDPENEVIKPTVNGVLGIMKACDKAKTVRRIVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT++V+  QK VYDE  WSDLDFI +KKMTGWMYF SK LAEK AW   KEK IDFIS
Sbjct  128   SAGTVSVEEHQKNVYDENDWSDLDFIMSKKMTGWMYFMSKTLAEKAAWDYAKEKGIDFIS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LV+GPFIT + PPSLITALS IT N+AHYSII+QGQYVHLDDLC AHIFLYE   A
Sbjct  188   IIPTLVIGPFITTSMPPSLITALSPITRNEAHYSIIRQGQYVHLDDLCNAHIFLYEQAAA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             +GR++CSSH  TI  +++ + Q +PEY +PS F+G++++L  + FSSKKL DMGF FKYS
Sbjct  248   KGRYVCSSHDATILTISEFLRQKYPEYNVPSTFEGVDENLKSIMFSSKKLIDMGFNFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYSTKE  1075
             LEDM   +IET R+KG LP +  E
Sbjct  308   LEDMLVESIETCRQKGFLPVTLPE  331



>dbj|BAE19950.1| dihydroflavonol 4-reductase [Lotus japonicus]
Length=340

 Score =   478 bits (1231),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 223/320 (70%), Positives = 262/320 (82%), Gaps = 1/320 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATV-RDPGNTKKVKHLLELPKADTNLTIWKGVME  280
             VCVTG+ GFIGSWLV  L++ GY + ATV RDP N KKVKHLLELP A TNLTIW   + 
Sbjct  8     VCVTGSTGFIGSWLVMRLMEGGYTVRATVQRDPDNMKKVKHLLELPGAKTNLTIWNADLT  67

Query  281   EEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFT  460
             EEGSFDEAI GC GVFHVA+PMDF+SKDPENEVIKP+INGVL+I+ +C KAKTV+RLVFT
Sbjct  68    EEGSFDEAINGCSGVFHVASPMDFNSKDPENEVIKPSINGVLDIMKACQKAKTVRRLVFT  127

Query  461   SSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFI  640
             SSAGTLN    QK + DE+CWSD++F    KMTGWMYF SK LAE+EAWK  +E  IDFI
Sbjct  128   SSAGTLNAVEHQKQMCDESCWSDVEFCRRVKMTGWMYFVSKTLAEQEAWKFAQEHDIDFI  187

Query  641   SIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPK  820
             +IIP LVVG F+ PT PPSL TALS ITGN+AHYSIIKQGQYVHLDDLC AHIFL+EHPK
Sbjct  188   TIIPSLVVGSFLMPTLPPSLTTALSPITGNEAHYSIIKQGQYVHLDDLCLAHIFLFEHPK  247

Query  821   AEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKY  1000
             +EGR+ICS+   TIH +A +I   +PEY +P++FK I  +L +V FSSKK++DMGF+FKY
Sbjct  248   SEGRYICSASEATIHDIAKLINSKYPEYNVPTKFKNIPDELELVRFSSKKIKDMGFEFKY  307

Query  1001  SLEDMYRGAIETLRKKGLLP  1060
             SLEDMY GAI+T ++KGLLP
Sbjct  308   SLEDMYTGAIDTCKEKGLLP  327



>ref|NP_001275860.1| dihydroflavonol-4-reductase [Citrus sinensis]
 ref|XP_006435032.1| hypothetical protein CICLE_v10001757mg [Citrus clementina]
 gb|AAS00611.1| dihydroflavonol-4-reductase [Citrus sinensis]
 gb|AAY87035.1| dihydroflavonol 4-reductase [Citrus sinensis]
 gb|AAY87036.1| dihydroflavonol 4-reductase [Citrus sinensis]
 gb|ESR48272.1| hypothetical protein CICLE_v10001757mg [Citrus clementina]
Length=338

 Score =   478 bits (1230),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 216/319 (68%), Positives = 266/319 (83%), Gaps = 0/319 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWL+  LL+RGY + ATVRDP N KKVKHLLELPKA T+LT+WK  + E
Sbjct  8     VCVTGASGFIGSWLIMRLLERGYAVRATVRDPDNKKKVKHLLELPKASTHLTLWKADLAE  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EG+FDEAI GC GVFH+ATPMDF+SKDPENEVI+P ING+++I+ +C  AKTV+RLVFTS
Sbjct  68    EGNFDEAIRGCTGVFHLATPMDFESKDPENEVIRPTINGMVSIMRACKNAKTVRRLVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGTL+V+  +KPVYDET WSDLDF+ + KMTGWMYF SK LAE+ AWK  +E  IDFIS
Sbjct  128   SAGTLDVEEHRKPVYDETSWSDLDFVRSVKMTGWMYFVSKTLAEQAAWKFAEENNIDFIS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LVVGPF+T + PPSLITALS IT N+AHY IIKQGQ+VHLDDLC AHIFL+EHP A
Sbjct  188   IIPSLVVGPFLTSSMPPSLITALSPITRNEAHYPIIKQGQFVHLDDLCSAHIFLFEHPNA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             +GR+ICSSH  TI  LA  + + +PE+ +P+EF+ +++++  + FSSKKL D+GF+FKYS
Sbjct  248   KGRYICSSHPATILELAKFLREKYPEFNVPTEFEDVDENMKNMLFSSKKLTDLGFKFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLP  1060
             L+DM+ GA++T R KGLLP
Sbjct  308   LDDMFTGAVDTCRAKGLLP  326



>gb|AIB06741.1| dihydroflavonol 4-reductase [Mangifera indica]
Length=333

 Score =   478 bits (1230),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 218/321 (68%), Positives = 264/321 (82%), Gaps = 0/321 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWL+  LL+RGY + ATVRDP N  KVKHLLELP A T+LT+WK  M E
Sbjct  6     VCVTGASGFIGSWLIMRLLERGYSVRATVRDPNNMNKVKHLLELPNAKTHLTLWKADMTE  65

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPM FD+KDPENE+IKP ING+L+I+ +C  AKTV+RLVFTS
Sbjct  66    EGSFDEAIKGCTGVFHVATPMFFDAKDPENEMIKPTINGMLDIMKACKNAKTVRRLVFTS  125

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGTL+V+  +KPVYDE+ WSDL+F+ A KMTGWMYF SK LAE+ AWK  +E  +DFIS
Sbjct  126   SAGTLDVEEHKKPVYDESSWSDLEFVLATKMTGWMYFVSKTLAEQAAWKFAEENNLDFIS  185

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LVVGPF+ P+ PPSLI+ALS ITGN+ HYSIIKQGQ+VHLDDLC +HIFLYE P+A
Sbjct  186   IIPSLVVGPFLMPSMPPSLISALSPITGNEDHYSIIKQGQFVHLDDLCNSHIFLYEKPEA  245

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             +GR+ICSS   TI  +A ++ + +PEY IP++FKG++ +L    FSSKKL D+GF+FKY+
Sbjct  246   KGRYICSSDSATILEVAKLLREKYPEYNIPTKFKGVDDNLENYKFSSKKLTDLGFKFKYN  305

Query  1004  LEDMYRGAIETLRKKGLLPYS  1066
             LEDMY GA+ET R KGL+P S
Sbjct  306   LEDMYTGAVETCRAKGLIPLS  326



>ref|XP_010494237.1| PREDICTED: dihydroflavonol-4-reductase-like [Camelina sativa]
Length=377

 Score =   479 bits (1234),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 219/335 (65%), Positives = 268/335 (80%), Gaps = 0/335 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+RGY + ATVRDPGN+KKVKHLL+LP A + LT+WK  + +
Sbjct  8     VCVTGASGFIGSWLVMRLLERGYFVRATVRDPGNSKKVKHLLDLPNAKSKLTLWKADLSD  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGS+D+AI GC+GVFHVATPMDF+SKDPENEVIKP +NG+L I+ +CVKAKTV+R VFTS
Sbjct  68    EGSYDDAIKGCDGVFHVATPMDFESKDPENEVIKPTVNGMLGILKACVKAKTVRRFVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NV+  QK VYDE  WSDL+FI +KKMTGWMYF SK LAEK AW   KE  +DFIS
Sbjct  128   SAGTVNVEENQKSVYDEKDWSDLEFIMSKKMTGWMYFVSKTLAEKAAWDFAKENGLDFIS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LV+GPFIT + PPSLITALS IT  +AHYSII+QGQYVHLDDLC AHIFLYE   A
Sbjct  188   IIPTLVIGPFITTSMPPSLITALSPITRKEAHYSIIRQGQYVHLDDLCNAHIFLYEKTAA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR++CSSH  TI  ++  + Q +PEY +PS F+G++++L  V FSSKKL +MGF FKYS
Sbjct  248   EGRYVCSSHDATILTMSKFLRQKYPEYNVPSTFEGVDENLKGVVFSSKKLTEMGFSFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETV  1108
             LE+M+  +IET R+KG LP S  +  + ++  E +
Sbjct  308   LEEMFVESIETCRQKGFLPVSLNKVPSKDDNIELI  342



>ref|XP_008377381.1| PREDICTED: bifunctional dihydroflavonol 4-reductase/flavanone 
4-reductase-like [Malus domestica]
Length=347

 Score =   478 bits (1230),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 217/332 (65%), Positives = 269/332 (81%), Gaps = 0/332 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+RGY + ATVRDP N KKVKHLL+LPKA+T+LT+WK  + +
Sbjct  8     VCVTGASGFIGSWLVMRLLERGYTVRATVRDPTNQKKVKHLLDLPKAETHLTLWKADLAD  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDPENEVIKP ING+L+I+ +C K KTV+RLVFTS
Sbjct  68    EGSFDEAIQGCTGVFHVATPMDFESKDPENEVIKPTINGLLDILKACQKVKTVRRLVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+ ++  +KPVYDE+ WSD++F  + KMTGWMYF SK LAE+ AWK  KE  IDFI+
Sbjct  128   SAGTVIMEEHKKPVYDESNWSDVEFCLSVKMTGWMYFVSKTLAEQAAWKYAKENNIDFIT  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LV+GPF+ P+ PPSLIT LS IT  ++HY IIKQGQYVHLDDLC +HI+LYEHPKA
Sbjct  188   IIPTLVIGPFLMPSMPPSLITGLSPITRTKSHYGIIKQGQYVHLDDLCXSHIYLYEHPKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSSH  TIH L  M+ + +P Y IP++F+GI+ +L  ++FSSKKL+D+GF+FKYS
Sbjct  248   EGRYICSSHDATIHDLVKMLREKYPAYNIPTKFEGIDDNLDTIHFSSKKLRDIGFEFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQ  1099
              EDM+ GA +T R KGL+P   ++  A +E  
Sbjct  308   FEDMFVGAXDTCRAKGLIPIPAEKTEAADESN  339



>emb|CDX95155.1| BnaC09g17150D [Brassica napus]
Length=385

 Score =   479 bits (1234),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 221/324 (68%), Positives = 263/324 (81%), Gaps = 0/324 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+RGY + ATVRDPGN KKV+HLL+LP A T LT+WK  + +
Sbjct  8     VCVTGASGFIGSWLVMRLLERGYFVRATVRDPGNLKKVQHLLDLPNAKTQLTLWKADLSD  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGS+D+AI GC+GVFH+ATPMDF+SKDPENEVIKP +NGVL I  +C KAKTV+R+VFTS
Sbjct  68    EGSYDDAINGCDGVFHIATPMDFESKDPENEVIKPTVNGVLGITKACDKAKTVRRIVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NV+  QK VYDE  WSDLDFI +KKMTGWMYF SK LAEK AW   KEK IDFIS
Sbjct  128   SAGTVNVEEHQKNVYDENDWSDLDFIMSKKMTGWMYFMSKTLAEKAAWDYAKEKGIDFIS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LV+GPFIT + PPSLITALS IT N+AHYSII+QGQYVHLDDLC AHIFLYE   A
Sbjct  188   IIPTLVIGPFITTSMPPSLITALSPITRNEAHYSIIRQGQYVHLDDLCNAHIFLYEQAAA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             +GR+ICSSH  TI  +++ + Q +PEY +PS F+G++++L  + FSSKKL DMGF FKYS
Sbjct  248   KGRYICSSHDATILTISEFLRQKYPEYNVPSTFEGVDENLKSIMFSSKKLIDMGFNFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYSTKE  1075
             LE+M   +IET R+KG LP +  E
Sbjct  308   LENMLVESIETCRQKGFLPVTLPE  331



>ref|XP_003638261.1| Dihydroflavonol reductase [Medicago truncatula]
Length=334

 Score =   477 bits (1228),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 218/319 (68%), Positives = 264/319 (83%), Gaps = 0/319 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  L++RGY + ATVRDP N KKVKHLLELP A++ L++WK  + E
Sbjct  8     VCVTGASGFIGSWLVMRLMERGYTVRATVRDPDNMKKVKHLLELPGANSKLSLWKADLGE  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDPENE+IKP I GVL+I+ +C+KAKTV+R +FTS
Sbjct  68    EGSFDEAIKGCTGVFHVATPMDFESKDPENEMIKPTIKGVLDIMKACLKAKTVRRFIFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGTLNV   QKP++DE+CWSD++F    KMTGWMYF SK LAE+EAWK  KE  +DFI+
Sbjct  128   SAGTLNVTEDQKPLWDESCWSDVEFCRRVKMTGWMYFVSKTLAEQEAWKFAKEHNMDFIT  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIPPLVVGPF+ PT PPSLITALS ITGN+AHYSIIKQGQ+VHLDDLCEAHIFL+EH + 
Sbjct  188   IIPPLVVGPFLIPTMPPSLITALSPITGNEAHYSIIKQGQFVHLDDLCEAHIFLFEHMEV  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR++CS+    IH +A +I   +PEY IP++F  I  +L +V FSSKK++D+GF+FKYS
Sbjct  248   EGRYLCSACEANIHDIAKLINTKYPEYNIPTKFNNIPDELELVRFSSKKIKDLGFEFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLP  1060
             LEDMY  AI+T  +KGLLP
Sbjct  308   LEDMYTEAIDTCIEKGLLP  326



>dbj|BAD95233.1| dihydroflavonol 4-reductase [Arabidopsis thaliana]
Length=382

 Score =   479 bits (1233),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 223/340 (66%), Positives = 271/340 (80%), Gaps = 2/340 (1%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+RGY + ATVRDPGN KKV+HLL+LP A T LT+WK  + E
Sbjct  8     VCVTGASGFIGSWLVMRLLERGYFVRATVRDPGNLKKVQHLLDLPNAKTQLTLWKADLSE  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGS+D+AI GC+GVFHVATPMDF+SKDPENEVIKP +NG+L I+ +CVKAKTV+R VFTS
Sbjct  68    EGSYDDAINGCDGVFHVATPMDFESKDPENEVIKPTVNGMLGIMKACVKAKTVRRFVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NV+  QK VYDE  WSDL+FI +KKMTGWMYF SK LAEK AW   +EK +DFIS
Sbjct  128   SAGTVNVEEHQKNVYDENDWSDLEFIMSKKMTGWMYFVSKTLAEKAAWDFAEEKGLDFIS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LVVGPFIT + PPSLITALS IT N+AHYSII+QGQYVHLDDLC AHIFLYE   A
Sbjct  188   IIPTLVVGPFITTSMPPSLITALSPITRNEAHYSIIRQGQYVHLDDLCNAHIFLYEQAAA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             +GR+ICSSH  TI  ++  +   +PEY +PS F+G++++L  + FSSKKL DMGF FKYS
Sbjct  248   KGRYICSSHDATILTISKFLRPKYPEYNVPSTFEGVDENLKSIEFSSKKLTDMGFNFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYST--KEAAAIEEEQETVALK  1117
             LE+M+  +IET R+KG LP S   +  + I+ + E + +K
Sbjct  308   LEEMFIESIETCRQKGFLPVSLSYQSISEIKTKNENIDVK  347



>ref|XP_006281803.1| hypothetical protein CARUB_v10027976mg, partial [Capsella rubella]
 gb|EOA14701.1| hypothetical protein CARUB_v10027976mg, partial [Capsella rubella]
Length=326

 Score =   477 bits (1227),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 219/319 (69%), Positives = 261/319 (82%), Gaps = 0/319 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+RGY + ATVRDPGN KKV HLL+LP A T LT+WK  + E
Sbjct  8     VCVTGASGFIGSWLVMKLLERGYFVRATVRDPGNLKKVNHLLDLPNAKTQLTLWKADLSE  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGS+D+AI GC+GVFHVATPMDF+SKDPENEVIKP +NG+L I+ +CVKAKTV+R VFTS
Sbjct  68    EGSYDDAIKGCDGVFHVATPMDFESKDPENEVIKPTVNGMLGILKACVKAKTVRRFVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NV+  +K VYDE  WSDL+FI +KKMTGWMYF SK LAEK AW   +EK +DFIS
Sbjct  128   SAGTVNVEEHKKSVYDEQDWSDLEFIMSKKMTGWMYFVSKTLAEKAAWDYAEEKGLDFIS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LVVGPFIT + PPSLITALS IT N+AHYSII+QGQYVHLDDLC AHIFLYEH  A
Sbjct  188   IIPTLVVGPFITTSMPPSLITALSPITRNEAHYSIIRQGQYVHLDDLCNAHIFLYEHNAA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             +GR+ICSSH  TI  ++  + Q +PEY +PS F+G++++L  + FSSKKL +MGF FKYS
Sbjct  248   KGRYICSSHDATILTISKFLRQKYPEYNVPSTFEGVDENLKSIKFSSKKLTEMGFNFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLP  1060
             LE+M   +IET R+KG LP
Sbjct  308   LEEMMVESIETCRQKGFLP  326



>ref|XP_006473894.1| PREDICTED: dihydroflavonol-4-reductase [Citrus sinensis]
Length=340

 Score =   477 bits (1228),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 217/321 (68%), Positives = 266/321 (83%), Gaps = 0/321 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWL+  LL+RGY + ATVRDP N KKVKHLLELPKA T+LT+WK  + E
Sbjct  8     VCVTGASGFIGSWLIMRLLERGYAVRATVRDPDNKKKVKHLLELPKASTHLTLWKADLAE  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EG+FDE I GC GVFH+ATPMDF+SKDPENEVI+P ING+L+I+ +C  AKTV+RLVFTS
Sbjct  68    EGNFDEPIRGCTGVFHLATPMDFESKDPENEVIRPTINGMLSIMRACKNAKTVRRLVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGTL+V+  +KPVYDET WSDLDF+ + KMTGWMYF SK LAE+ AWK  +E  IDFIS
Sbjct  128   SAGTLDVEEHRKPVYDETSWSDLDFVRSVKMTGWMYFVSKTLAEQAAWKFAEENNIDFIS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LVVGPF+T + PPSLITALS IT N+AHY IIKQGQ+VHLDDLC AHIFL+EHP A
Sbjct  188   IIPSLVVGPFLTSSMPPSLITALSPITRNEAHYPIIKQGQFVHLDDLCSAHIFLFEHPNA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             +GR+ICSSH  TI  LA ++ + + E+ +P+EF+ +++++  + FSSKKL D+GF+FKYS
Sbjct  248   KGRYICSSHPATILELAKLLREKYTEFTVPTEFEDVDENMKNMLFSSKKLTDLGFKFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYS  1066
             LEDM+ GA++T R KGLLP S
Sbjct  308   LEDMFTGAVDTCRTKGLLPLS  328



>gb|AHL46445.1| dihydroflavonol 4-reductase [Fragaria vesca]
 gb|AHL46449.1| dihydroflavonol 4-reductase [Fragaria vesca]
Length=349

 Score =   477 bits (1228),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 218/335 (65%), Positives = 270/335 (81%), Gaps = 0/335 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCV GA+GF+GSWLV  LL+RGY + ATVRDP N KKVKHLL+LPKA T+LT+WK  + +
Sbjct  8     VCVHGASGFVGSWLVMRLLERGYTVRATVRDPTNAKKVKHLLDLPKAATHLTLWKADLAD  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDPENEVIKP INGVL+I+ +C+KAKTV+RLVFT+
Sbjct  68    EGSFDEAIKGCTGVFHVATPMDFESKDPENEVIKPTINGVLDIMKACLKAKTVRRLVFTA  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAG++NV+  QKPVY+E+ WSD++F    KMTGWMYF SK LAE+EAWK  KE  IDFI+
Sbjct  128   SAGSVNVEETQKPVYNESNWSDVEFCRRVKMTGWMYFVSKTLAEQEAWKFAKENNIDFIT  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LV+GPF+ P  PPSLIT L  + GN+ HYSIIKQGQ+VHLDDLC++HI+LYEHPKA
Sbjct  188   IIPTLVIGPFLMPAMPPSLITGLLPLFGNEGHYSIIKQGQFVHLDDLCQSHIYLYEHPKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSSH  TIH +  ++ + +PEY +P++FKGIE +L  V+FSSKKL + GF+FKYS
Sbjct  248   EGRYICSSHDATIHEIGKLLREKYPEYNVPTKFKGIEDNLTKVHFSSKKLLETGFEFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETV  1108
             LEDM+ GA++  + KGLLP  T+     E    +V
Sbjct  308   LEDMFVGAVDACKAKGLLPPPTERVEKQENGDSSV  342



>gb|ACM62744.1| dihydroflavonol-4-reductase [Garcinia mangostana]
Length=334

 Score =   476 bits (1226),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 218/321 (68%), Positives = 268/321 (83%), Gaps = 1/321 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+RGY + ATVRDP N KKV+HLLELPKA T+LT+WK  +  
Sbjct  8     VCVTGASGFIGSWLVMRLLERGYTVRATVRDPDNAKKVQHLLELPKAKTHLTLWKAELGI  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDPENEVIKP I+G+++I+ SC KAK V+R+VFT+
Sbjct  68    EGSFDEAIQGCSGVFHVATPMDFESKDPENEVIKPTIDGMIDILKSCAKAK-VRRIVFTA  126

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAG L+V+  ++PVYDE CWSDL+FI + KMTGWMYF SK  AE+ AWK  KE  +DFIS
Sbjct  127   SAGALDVEEHRRPVYDENCWSDLEFINSVKMTGWMYFVSKTKAERAAWKFAKENNLDFIS  186

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LVVGPFI  + PPSLI+AL+LITGN+ HY+I+KQG YVHLDDL E+HI+LYE+PKA
Sbjct  187   IIPSLVVGPFIMQSMPPSLISALALITGNEGHYTILKQGHYVHLDDLVESHIYLYENPKA  246

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICS++   I  LA+M+ + +PEY IP+ FKGIE++LP V FSSKKL D GF+FKY+
Sbjct  247   EGRYICSNYDVNIFELANMLNKKYPEYNIPTTFKGIEENLPSVIFSSKKLLDHGFEFKYT  306

Query  1004  LEDMYRGAIETLRKKGLLPYS  1066
             L+DM++GA+ET RKKGL+P S
Sbjct  307   LDDMFQGAVETCRKKGLIPLS  327



>ref|XP_002862988.1| dihydroflavonol reductase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39247.1| dihydroflavonol reductase [Arabidopsis lyrata subsp. lyrata]
Length=384

 Score =   478 bits (1230),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 218/321 (68%), Positives = 264/321 (82%), Gaps = 0/321 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+RGY + ATVRDPGN KKV+HLL+LP A T LT+WK  + E
Sbjct  8     VCVTGASGFIGSWLVMRLLERGYFVRATVRDPGNLKKVQHLLDLPNAKTQLTLWKADLSE  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGS+D AI GC+GVFHVATPMDF+SKDPENEVIKP +NG+L I+ +CVKAKTV+R +FTS
Sbjct  68    EGSYDGAITGCDGVFHVATPMDFESKDPENEVIKPTVNGMLGIMKACVKAKTVRRFIFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NV+  QK VYDE  WSDL+FI +KKMTGWMYF SK LAEK AW   +EK +DFIS
Sbjct  128   SAGTVNVEEHQKSVYDENDWSDLEFIMSKKMTGWMYFVSKTLAEKAAWDYAEEKGLDFIS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LVVGPFIT + PPSLITALS IT N+AHYSII+QGQYVHLDDLC +HIFLYE   A
Sbjct  188   IIPTLVVGPFITTSMPPSLITALSPITRNEAHYSIIRQGQYVHLDDLCNSHIFLYEQETA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             +GR+ICSSH  TI  ++ ++ Q +PEY +PS ++G++++L  + FSSKKL DMGF FKYS
Sbjct  248   KGRYICSSHDATILTISKLLRQKYPEYNVPSTYEGVDENLKSIEFSSKKLTDMGFNFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYS  1066
             LE+M+  +IET R+KG LP+S
Sbjct  308   LEEMFIESIETCRQKGFLPFS  328



>emb|CAP08825.1| dihydroflavonol reductase [Arabidopsis lyrata]
Length=384

 Score =   478 bits (1230),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 218/321 (68%), Positives = 263/321 (82%), Gaps = 0/321 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+RGY + ATVRDPGN KKV+HLL+LP A T LT+WK  + E
Sbjct  8     VCVTGASGFIGSWLVMRLLERGYFVRATVRDPGNLKKVQHLLDLPNAKTQLTLWKADLSE  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGS+D+AI GC+GVFHVATPMDF+SKDPENEVIKP +NG+L I+ +CVKAKTV+R +FTS
Sbjct  68    EGSYDDAITGCDGVFHVATPMDFESKDPENEVIKPTVNGMLGIMKACVKAKTVRRFIFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NV+  QK VYDE  WSDL+FI +KKMTGWMYF SK LAEK AW   +EK +DFIS
Sbjct  128   SAGTVNVEEHQKSVYDENDWSDLEFIMSKKMTGWMYFVSKTLAEKAAWDYAEEKGLDFIS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LVVGPFIT + PPSLITALS IT N+AHYSII+QGQYVHLDDLC +HIFLYE   A
Sbjct  188   IIPTLVVGPFITTSMPPSLITALSPITRNEAHYSIIRQGQYVHLDDLCNSHIFLYEQETA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             +GR+ICSSH  TI  ++  + Q + EY +PS F+G++++L  + FSSKKL DMGF FKYS
Sbjct  248   KGRYICSSHDATILTISKFLRQKYSEYNVPSTFEGVDENLKSIEFSSKKLTDMGFNFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYS  1066
             LE+M+  +IET R+KG LP+S
Sbjct  308   LEEMFIESIETCRQKGFLPFS  328



>ref|XP_002510417.1| cinnamoyl-CoA reductase, putative [Ricinus communis]
 gb|EEF52604.1| cinnamoyl-CoA reductase, putative [Ricinus communis]
Length=347

 Score =   476 bits (1226),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 216/319 (68%), Positives = 262/319 (82%), Gaps = 0/319 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+RG+ + ATVRD  N KKVKHLLELP A T++T+WK  + +
Sbjct  8     VCVTGASGFIGSWLVMRLLERGFMVRATVRDADNMKKVKHLLELPNAKTHMTLWKADLAQ  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFD+AI GC GVFHVATPMDF+ KDPENEVI+P +NGVL+I+ +C KAKTV+R+VFTS
Sbjct  68    EGSFDDAIRGCSGVFHVATPMDFEPKDPENEVIRPTVNGVLDIMKACAKAKTVRRIVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT++V+  +K +YDE CWSDLDFI  KKMTGW+YF SK LAEK AWK  ++  +DFIS
Sbjct  128   SAGTVDVEEHRKEMYDEHCWSDLDFILTKKMTGWVYFVSKSLAEKAAWKFAEKNNLDFIS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LVVGPF+   FPPSLITAL+ ITGN+AHYSIIKQG +VHLDDLC AHIFL+EHPKA
Sbjct  188   IIPTLVVGPFLGSFFPPSLITALAPITGNEAHYSIIKQGHFVHLDDLCNAHIFLFEHPKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSSH  TIH +A ++ + +PEY IP++  G+E+D+    FSSKKL DMGFQFKYS
Sbjct  248   EGRYICSSHDATIHEVAKLLREKYPEYNIPAKINGVEEDIKNFIFSSKKLTDMGFQFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLP  1060
             LEDM  G +E+ R KG+LP
Sbjct  308   LEDMLVGGVESCRAKGVLP  326



>ref|NP_199094.1| dihydroflavonol-4-reductase [Arabidopsis thaliana]
 sp|P51102.2|DFRA_ARATH RecName: Full=Dihydroflavonol-4-reductase; Short=DFR; AltName: 
Full=Dihydrokaempferol 4-reductase; AltName: Full=Protein 
TRANSPARENT TESTA 3 [Arabidopsis thaliana]
 dbj|BAB10636.1| dihydroflavonol 4-reductase [Arabidopsis thaliana]
 emb|CAC10525.1| dihydroflavonol 4-reductase [Arabidopsis thaliana]
 emb|CAP08806.1| dihydroflavonol reductase [Arabidopsis thaliana]
 emb|CAP08808.1| dihydroflavonol reductase [Arabidopsis thaliana]
 emb|CAP08812.1| dihydroflavonol reductase [Arabidopsis thaliana]
 emb|CAP08814.1| dihydroflavonol reductase [Arabidopsis thaliana]
 emb|CAP08815.1| dihydroflavonol reductase [Arabidopsis thaliana]
 emb|CAP08821.1| dihydroflavonol reductase [Arabidopsis thaliana]
 gb|AED94866.1| dihydroflavonol-4-reductase [Arabidopsis thaliana]
Length=382

 Score =   478 bits (1229),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 223/340 (66%), Positives = 271/340 (80%), Gaps = 2/340 (1%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+RGY + ATVRDPGN KKV+HLL+LP A T LT+WK  + E
Sbjct  8     VCVTGASGFIGSWLVMRLLERGYFVRATVRDPGNLKKVQHLLDLPNAKTLLTLWKADLSE  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGS+D+AI GC+GVFHVATPMDF+SKDPENEVIKP +NG+L I+ +CVKAKTV+R VFTS
Sbjct  68    EGSYDDAINGCDGVFHVATPMDFESKDPENEVIKPTVNGMLGIMKACVKAKTVRRFVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NV+  QK VYDE  WSDL+FI +KKMTGWMYF SK LAEK AW   +EK +DFIS
Sbjct  128   SAGTVNVEEHQKNVYDENDWSDLEFIMSKKMTGWMYFVSKTLAEKAAWDFAEEKGLDFIS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LVVGPFIT + PPSLITALS IT N+AHYSII+QGQYVHLDDLC AHIFLYE   A
Sbjct  188   IIPTLVVGPFITTSMPPSLITALSPITRNEAHYSIIRQGQYVHLDDLCNAHIFLYEQAAA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             +GR+ICSSH  TI  ++  +   +PEY +PS F+G++++L  + FSSKKL DMGF FKYS
Sbjct  248   KGRYICSSHDATILTISKFLRPKYPEYNVPSTFEGVDENLKSIEFSSKKLTDMGFNFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYST--KEAAAIEEEQETVALK  1117
             LE+M+  +IET R+KG LP S   +  + I+ + E + +K
Sbjct  308   LEEMFIESIETCRQKGFLPVSLSYQSISEIKTKNENIDVK  347



>ref|XP_010442115.1| PREDICTED: dihydroflavonol-4-reductase [Camelina sativa]
Length=377

 Score =   477 bits (1228),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 218/321 (68%), Positives = 263/321 (82%), Gaps = 0/321 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+RGY + ATVRDPGN KKVKHLL+LP A + LT+WK  + +
Sbjct  8     VCVTGASGFIGSWLVMRLLERGYFVRATVRDPGNLKKVKHLLDLPNAKSKLTLWKADLSD  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGS+D+AI GC+GVFHVATPMDF+SKDPENEVIKP +NG+L I+ +CV+AKTV+R VFTS
Sbjct  68    EGSYDDAIKGCDGVFHVATPMDFESKDPENEVIKPTVNGILGILKACVEAKTVRRFVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NV+  QK VYDE  WSDL+FI +KKMTGWMYF SK LAEK AW   +EK +DFIS
Sbjct  128   SAGTVNVEENQKSVYDEQDWSDLEFIMSKKMTGWMYFVSKTLAEKAAWDYAEEKGLDFIS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LVVGPFIT + PPSLITALS IT N+AHYSII+QGQYVHLDDLC AHIFLYE   A
Sbjct  188   IIPTLVVGPFITTSMPPSLITALSPITRNEAHYSIIRQGQYVHLDDLCNAHIFLYEKTAA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             +GR+ICSSH  TI  ++  + Q +PEY +PS F+G++++L  + FSSKKL +MGF FKYS
Sbjct  248   KGRYICSSHDATILTMSKFLRQKYPEYNVPSTFEGVDENLKGIVFSSKKLTEMGFNFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYS  1066
             LE+M+  +IET R+KG LP S
Sbjct  308   LEEMFIESIETCRQKGFLPVS  328



>gb|KDO84613.1| hypothetical protein CISIN_1g040253mg [Citrus sinensis]
Length=338

 Score =   475 bits (1223),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 215/319 (67%), Positives = 265/319 (83%), Gaps = 0/319 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWL+  LL+RGY + ATVRDP N KKVKHLLELPKA T+LT+WK  + E
Sbjct  8     VCVTGASGFIGSWLIMRLLERGYAVRATVRDPDNKKKVKHLLELPKASTHLTLWKADLAE  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EG+FDE I GC GVFH+ATPMDF+SKDPENEVI+P ING+++I+ +C  AKTV+RLVFTS
Sbjct  68    EGNFDEPIRGCTGVFHLATPMDFESKDPENEVIRPTINGMVSIMRACKNAKTVRRLVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGTL+V+  +KPVYDET WSDLDF+ + KMTGWMYF SK LAE+ AWK  +E  IDFIS
Sbjct  128   SAGTLDVEEHRKPVYDETSWSDLDFVRSVKMTGWMYFVSKTLAEQAAWKFAEENNIDFIS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LVVGPF+T + PPSLITALS IT N+AHY IIKQGQ+VHLDDLC AHIFL+EHP A
Sbjct  188   IIPSLVVGPFLTSSMPPSLITALSPITRNEAHYPIIKQGQFVHLDDLCSAHIFLFEHPNA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             +GR+ICSSH  TI  LA  + + +PE+ +P+EF+ +++++  + FSSKKL D+GF+FKYS
Sbjct  248   KGRYICSSHPATILELAKFLREKYPEFNVPTEFEDVDENMKNMLFSSKKLTDLGFKFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLP  1060
             L+DM+ GA++T R KGLLP
Sbjct  308   LDDMFTGAVDTCRAKGLLP  326



>gb|AAO73442.1| dihydroflavonol 4-reductase [Brassica oleracea var. capitata]
Length=385

 Score =   477 bits (1228),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 221/324 (68%), Positives = 262/324 (81%), Gaps = 0/324 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+RGY + ATVRDPGN KKV+HLL+LP A T LT+WK  + +
Sbjct  8     VCVTGASGFIGSWLVMRLLERGYFVRATVRDPGNLKKVQHLLDLPNAKTQLTLWKADLSD  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGS+D+AI GC+GVFH+ATPMDF+SKDPENEVIKP +NGVL I  +C KAKTV+R+VFTS
Sbjct  68    EGSYDDAINGCDGVFHIATPMDFESKDPENEVIKPTVNGVLGITKACDKAKTVRRIVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NV+  QK VYDE  WSDLDFI +KKMTGWMYF SK LAEK AW   KEK IDFIS
Sbjct  128   SAGTVNVEEHQKNVYDENDWSDLDFIMSKKMTGWMYFMSKTLAEKAAWDYAKEKGIDFIS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LV+GPFIT + PPSLITALS IT N+AHYSII+QGQYVHLDDLC AHIFLYE   A
Sbjct  188   IIPTLVIGPFITTSMPPSLITALSPITRNEAHYSIIRQGQYVHLDDLCHAHIFLYEQAAA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             +GR+ICSSH  TI  +++ + Q +PEY +PS F+G++++L  + FSSKKL DMGF FKYS
Sbjct  248   KGRYICSSHDATILTISEFLRQKYPEYNVPSTFEGVDENLKSIMFSSKKLIDMGFNFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYSTKE  1075
             LE+M   +IET R KG LP +  E
Sbjct  308   LENMLVESIETCRPKGFLPVTLPE  331



>gb|AIM48930.1| dihydroflavonol 4-reductase [Raphanus sativus]
Length=389

 Score =   477 bits (1227),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 221/323 (68%), Positives = 262/323 (81%), Gaps = 2/323 (1%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPG--NTKKVKHLLELPKADTNLTIWKGVM  277
             VCVTGA+GFIGSWLV  LL+RGY + ATVRDPG  N KKV+HLL+LP A T LT+WK  +
Sbjct  9     VCVTGASGFIGSWLVMRLLERGYFVRATVRDPGKGNLKKVQHLLDLPNAKTQLTLWKADL  68

Query  278   EEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVF  457
              +EGS+D+AI GC+GVFH+ATPMDF+SKDPENEVIKP +NGVL I+ +C KAKTV+R+VF
Sbjct  69    SDEGSYDDAINGCDGVFHIATPMDFESKDPENEVIKPTVNGVLGIMKACDKAKTVRRIVF  128

Query  458   TSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDF  637
             TSSAGT+NV+  QK VYDE  WSDLDFI +KKMTGWMYF SK LAEK AW   KEK IDF
Sbjct  129   TSSAGTVNVEEHQKNVYDENDWSDLDFIMSKKMTGWMYFMSKTLAEKAAWDYAKEKGIDF  188

Query  638   ISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHP  817
             ISIIP LV+GPFIT + PPSLITALS IT N+A YSII+QGQYVHLDDLC AHIFLYE  
Sbjct  189   ISIIPTLVIGPFITTSMPPSLITALSPITRNEAQYSIIRQGQYVHLDDLCNAHIFLYEQT  248

Query  818   KAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFK  997
              A+GR++CSSH  TI  +++ I Q +PEY +PS F+G++++L  + FSSKKL DMGF FK
Sbjct  249   VAKGRYVCSSHDATILSISEFIRQKYPEYNVPSSFEGVDENLKSIAFSSKKLIDMGFNFK  308

Query  998   YSLEDMYRGAIETLRKKGLLPYS  1066
             YSLEDM   +IET R+KG LP S
Sbjct  309   YSLEDMLVESIETCRQKGFLPVS  331



>gb|KFK31813.1| hypothetical protein AALP_AA6G162000 [Arabis alpina]
Length=384

 Score =   477 bits (1227),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 217/334 (65%), Positives = 268/334 (80%), Gaps = 0/334 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+RGY + ATVRDPGN KKV+HLL+LP A T LT+WK  + +
Sbjct  8     VCVTGASGFIGSWLVMRLLERGYDVRATVRDPGNLKKVQHLLDLPNAKTQLTLWKADLSD  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGS+D+AI GC+GVFHVATPMDF+SKDPENEVIKP +NG+L I+ +C KAKTV+R++FTS
Sbjct  68    EGSYDDAINGCDGVFHVATPMDFESKDPENEVIKPTVNGILGIMKACAKAKTVRRIIFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NV+  QK VYDE  WSDLDF+ +KKMTGWMYF SK LAEK AW   KE+ +DFIS
Sbjct  128   SAGTVNVEEHQKNVYDENDWSDLDFVISKKMTGWMYFLSKTLAEKAAWDYAKEQGLDFIS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LV+GPFIT + PPSLITALS +T N+AHYSII+QGQYVHLDDLC AHIFLYE   A
Sbjct  188   IIPTLVIGPFITTSMPPSLITALSPVTRNEAHYSIIRQGQYVHLDDLCNAHIFLYEQALA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             +GR++CSSH  TI  +++++ Q +PEY +PS ++G+++ L  + FSSKKL DMGF FKYS
Sbjct  248   KGRYVCSSHDATILTISELMRQKYPEYNVPSTYEGVDESLKGIVFSSKKLIDMGFSFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQET  1105
             LE+M   +IET R KG LP S  E+ + E +  T
Sbjct  308   LEEMVVESIETCRVKGFLPVSLPESKSDENKDAT  341



>gb|AHL46450.1| dihydroflavonol 4-reductase [Fragaria x ananassa]
Length=349

 Score =   475 bits (1222),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 217/335 (65%), Positives = 269/335 (80%), Gaps = 0/335 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GF+ SWLV  LL+RGY + ATVRDP N KKVKHLL+LPKA T+LT+WK  + +
Sbjct  8     VCVTGASGFVASWLVMRLLERGYTLRATVRDPTNAKKVKHLLDLPKAATHLTLWKADLAD  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDPENEVIKP INGVL+I+ +C+KAKTV+RLVFT+
Sbjct  68    EGSFDEAIKGCTGVFHVATPMDFESKDPENEVIKPTINGVLDIMKACLKAKTVRRLVFTA  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAG++NV+  QKPVY+E+ WSD++F    KMTGWMYF SK LAE+EAWK  K   ID I+
Sbjct  128   SAGSVNVEETQKPVYNESNWSDVEFCRRVKMTGWMYFVSKTLAEQEAWKFAKGNNIDLIT  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LV+GPF+ P  PPSLIT LS + GN+ HYSIIKQGQ+VHLDDLC++HI+LYEHPKA
Sbjct  188   IIPTLVIGPFLMPAMPPSLITGLSPLFGNEGHYSIIKQGQFVHLDDLCQSHIYLYEHPKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSSH  TIH +  ++ + +PEY +P++FKGIE +L  V+FSSKKL + GF+FKYS
Sbjct  248   EGRYICSSHDATIHEIGKLLREKYPEYNVPTKFKGIEDNLTKVHFSSKKLLETGFEFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETV  1108
             LEDM+ GA++  + KGLLP  T+     E    +V
Sbjct  308   LEDMFVGAVDACKAKGLLPPPTERVEKQENGDSSV  342



>emb|CAP08818.1| dihydroflavonol reductase [Arabidopsis thaliana]
 emb|CAP08820.1| dihydroflavonol reductase [Arabidopsis thaliana]
 emb|CAP08824.1| dihydroflavonol reductase [Arabidopsis thaliana]
Length=384

 Score =   476 bits (1225),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 219/321 (68%), Positives = 262/321 (82%), Gaps = 0/321 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+RGY + ATVRDPGN KKV+HLL+LP A T LT+WK  + E
Sbjct  8     VCVTGASGFIGSWLVMRLLERGYFVRATVRDPGNLKKVQHLLDLPNAKTQLTLWKADLSE  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGS+D+AI GC+GVFHVATPMDF+SKDPENEVIKP +NG+L I+ +CVKAKTV+R VFTS
Sbjct  68    EGSYDDAINGCDGVFHVATPMDFESKDPENEVIKPTVNGMLGIMKACVKAKTVRRFVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NV+  QK VYDE  WSDL+FI +KKMTGWMYF SK LAEK AW   +EK +DFIS
Sbjct  128   SAGTVNVEEHQKNVYDENDWSDLEFIMSKKMTGWMYFVSKTLAEKAAWDFAEEKGLDFIS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LVVGPFIT + PPSLITALS IT N+AHYSII+QGQYVHLDDLC AHIFLYE   A
Sbjct  188   IIPTLVVGPFITTSMPPSLITALSPITRNEAHYSIIRQGQYVHLDDLCNAHIFLYEQAAA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             +GR+ICSSH  TI  ++  +   +PEY +PS F+G++++L  + FSSKKL +MGF FKYS
Sbjct  248   KGRYICSSHDATILTISKFLRPKYPEYNVPSTFEGVDENLKSIEFSSKKLTEMGFNFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYS  1066
             LE+M+  +IET R+KG LP S
Sbjct  308   LEEMFIESIETCRQKGFLPVS  328



>emb|CAP08819.1| dihydroflavonol reductase [Arabidopsis thaliana]
 emb|CAP08823.1| dihydroflavonol reductase [Arabidopsis thaliana]
Length=384

 Score =   476 bits (1225),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 232/382 (61%), Positives = 282/382 (74%), Gaps = 8/382 (2%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+RGY + ATVRDPGN KKV+HLL+LP A T LT+WK  + E
Sbjct  8     VCVTGASGFIGSWLVMRLLERGYFVRATVRDPGNLKKVQHLLDLPNAKTQLTLWKADLSE  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGS+D+AI GC+GVFHVATPMDF+SKDPENEVIKP +NG+L I+ +CVKAKTV+R VFTS
Sbjct  68    EGSYDDAINGCDGVFHVATPMDFESKDPENEVIKPTVNGMLGIMKACVKAKTVRRFVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NV+  QK VYDE  WSDL+FI +KKMTGWMYF SK LAEK AW   +EK +DFIS
Sbjct  128   SAGTVNVEEHQKNVYDENDWSDLEFIMSKKMTGWMYFVSKTLAEKAAWDFAEEKGLDFIS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LVVGPFIT + PPSLITALS IT N+AHYSII+QGQYVHLDDLC AHIFLYE   A
Sbjct  188   IIPTLVVGPFITTSMPPSLITALSPITRNEAHYSIIRQGQYVHLDDLCNAHIFLYEQAAA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             +GR+ICSSH  TI  ++  +   +PEY +PS F+G++++L  + FSSKKL  MGF FKYS
Sbjct  248   KGRYICSSHDATILTISKFLRPKYPEYNVPSTFEGVDENLKSIEFSSKKLTKMGFNFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEKPTAIEQKQEAKTVPLKPSA  1183
             LE+M+  +IET R+KG LP S    +  E +  T    +E  T      +  T  +KP  
Sbjct  308   LEEMFIESIETCRQKGFLPVSLSYQSISEIKVPTKNENIEVKTG-----DGLTDGMKPC-  361

Query  1184  IEQKQETAVPLKLEEEPTAIEQ  1249
                K ET V  +  + P   +Q
Sbjct  362   --NKTETGVTGERTDAPMLAQQ  381



>dbj|BAF45153.1| dihydroflavonol 4-reductase [Humulus lupulus]
Length=350

 Score =   474 bits (1221),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 217/321 (68%), Positives = 267/321 (83%), Gaps = 0/321 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+ GY + ATVRDP N KKVKHL+ELPKA+T LT+WK  + E
Sbjct  8     VCVTGASGFIGSWLVMRLLELGYTVRATVRDPTNLKKVKHLVELPKAETRLTLWKADLSE  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSF EAI GC GVFHVATPMDF+SKDPENEVIKP I+G+L+I+ +CV+AKTVK LVFTS
Sbjct  68    EGSFHEAIKGCNGVFHVATPMDFESKDPENEVIKPTISGMLDIMKACVEAKTVKXLVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NV+P QKP YDE+ WSD+DF    KMTGWMYF SK LAE+ AW+  ++  ++FI+
Sbjct  128   SAGTVNVEPIQKPTYDESNWSDIDFCRKVKMTGWMYFTSKTLAEQAAWEYARKHNLNFIT  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LV+GPF+ P+ PPSLIT LSLITGN++HY IIKQGQ+VHLDDLC AHIFLYE+PKA
Sbjct  188   IIPTLVIGPFLMPSMPPSLITGLSLITGNESHYFIIKQGQFVHLDDLCNAHIFLYENPKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+I SSH  TI+ LA ++   +PEY IP++ K +E+++P V+FSSKKL D+GF+FKYS
Sbjct  248   EGRYIASSHDATIYELAKLLKDKYPEYNIPTKIKDMEENIPNVHFSSKKLTDLGFEFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYS  1066
             LEDM+ GA++T R KGLLP +
Sbjct  308   LEDMFTGAVDTCRAKGLLPLT  328



>ref|XP_010263613.1| PREDICTED: LOW QUALITY PROTEIN: bifunctional dihydroflavonol 
4-reductase/flavanone 4-reductase-like [Nelumbo nucifera]
Length=342

 Score =   474 bits (1220),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 214/319 (67%), Positives = 266/319 (83%), Gaps = 0/319 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGAAGF+GSWLV  LL+ GY + ATVRDPGN KKVKHLL+LPKA T+LT+WK  + +
Sbjct  8     VCVTGAAGFVGSWLVMRLLEEGYTVRATVRDPGNPKKVKHLLDLPKASTHLTLWKADLVD  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             +GSFDEAI GC GVFHVATPMDF+SKDPENEVIKP I GVLNI+ SC KAKTV+R+VFTS
Sbjct  68    DGSFDEAIQGCSGVFHVATPMDFESKDPENEVIKPCIEGVLNIMRSCAKAKTVRRVVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NVQ  Q+P YDE+ WSD+DF    KMTGWMYF SK LAEK AW+  ++  IDFIS
Sbjct  128   SAGTVNVQEHQQPEYDESSWSDVDFCRRTKMTGWMYFVSKSLAEKAAWEFAEQNNIDFIS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LVVGPFI  + PPS+ITAL+LITG ++HYSI+KQ Q+VHLDDLC AHI+L+EHP+A
Sbjct  188   IIPTLVVGPFIMSSMPPSMITALALITGTESHYSILKQVQFVHLDDLCNAHIYLFEHPEA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             +GR+ICSS   TI+ LA+M+ + +PEY IP++F+GI++ L  V FSS+K++ +GF+FKYS
Sbjct  248   KGRYICSSDQATIYSLANMLKEKFPEYNIPTKFEGIDESLEAVRFSSEKIRSLGFEFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLP  1060
             +EDMY GA++  R+KGL+P
Sbjct  308   VEDMYVGAVKCAREKGLIP  326



>gb|AAA32783.1| dihydroflavonol 4-reductase [Arabidopsis thaliana]
 dbj|BAA85261.1| dihydroflavonol 4-reductase [Arabidopsis thaliana]
 emb|CAP08807.1| dihydroflavonol reductase [Arabidopsis thaliana]
 emb|CAP08809.1| dihydroflavonol reductase [Arabidopsis thaliana]
 emb|CAP08811.1| dihydroflavonol reductase [Arabidopsis thaliana]
 emb|CAP08816.1| dihydroflavonol reductase [Arabidopsis thaliana]
 emb|CAP08817.1| dihydroflavonol reductase [Arabidopsis thaliana]
Length=384

 Score =   476 bits (1224),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 219/321 (68%), Positives = 262/321 (82%), Gaps = 0/321 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+RGY + ATVRDPGN KKV+HLL+LP A T LT+WK  + E
Sbjct  8     VCVTGASGFIGSWLVMRLLERGYFVRATVRDPGNLKKVQHLLDLPNAKTQLTLWKADLSE  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGS+D+AI GC+GVFHVATPMDF+SKDPENEVIKP +NG+L I+ +CVKAKTV+R VFTS
Sbjct  68    EGSYDDAINGCDGVFHVATPMDFESKDPENEVIKPTVNGMLGIMKACVKAKTVRRFVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NV+  QK VYDE  WSDL+FI +KKMTGWMYF SK LAEK AW   +EK +DFIS
Sbjct  128   SAGTVNVEEHQKNVYDENDWSDLEFIMSKKMTGWMYFVSKSLAEKAAWDFAEEKGLDFIS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LVVGPFIT + PPSLITALS IT N+AHYSII+QGQYVHLDDLC AHIFLYE   A
Sbjct  188   IIPTLVVGPFITTSMPPSLITALSPITRNEAHYSIIRQGQYVHLDDLCNAHIFLYEQAAA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             +GR+ICSSH  TI  ++  +   +PEY +PS F+G++++L  + FSSKKL +MGF FKYS
Sbjct  248   KGRYICSSHDATILTISKFLRPKYPEYNVPSTFEGVDENLKSIEFSSKKLTEMGFNFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYS  1066
             LE+M+  +IET R+KG LP S
Sbjct  308   LEEMFIESIETCRQKGFLPVS  328



>emb|CAP08805.1| dihydroflavonol reductase [Arabidopsis thaliana]
 emb|CAP08810.1| dihydroflavonol reductase [Arabidopsis thaliana]
 emb|CAP08826.1| dihydroflavonol reductase [Arabidopsis thaliana]
Length=384

 Score =   475 bits (1222),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 219/321 (68%), Positives = 262/321 (82%), Gaps = 0/321 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+RGY + ATVRDPGN KKV+HLL+LP A T LT+WK  + E
Sbjct  8     VCVTGASGFIGSWLVMRLLERGYFVRATVRDPGNLKKVQHLLDLPNAKTLLTLWKADLSE  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGS+D+AI GC+GVFHVATPMDF+SKDPENEVIKP +NG+L I+ +CVKAKTV+R VFTS
Sbjct  68    EGSYDDAINGCDGVFHVATPMDFESKDPENEVIKPTVNGMLGIMKACVKAKTVRRFVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NV+  QK VYDE  WSDL+FI +KKMTGWMYF SK LAEK AW   +EK +DFIS
Sbjct  128   SAGTVNVEEHQKNVYDENDWSDLEFIMSKKMTGWMYFVSKTLAEKAAWDFAEEKGLDFIS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LVVGPFIT + PPSLITALS IT N+AHYSII+QGQYVHLDDLC AHIFLYE   A
Sbjct  188   IIPTLVVGPFITTSMPPSLITALSPITRNEAHYSIIRQGQYVHLDDLCNAHIFLYEQAAA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             +GR+ICSSH  TI  ++  +   +PEY +PS F+G++++L  + FSSKKL +MGF FKYS
Sbjct  248   KGRYICSSHDATILTISKFLRPKYPEYNVPSTFEGVDENLKSIEFSSKKLTEMGFNFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYS  1066
             LE+M+  +IET R+KG LP S
Sbjct  308   LEEMFIESIETCRQKGFLPVS  328



>emb|CAP08813.1| dihydroflavonol reductase [Arabidopsis thaliana]
Length=384

 Score =   475 bits (1222),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 232/382 (61%), Positives = 282/382 (74%), Gaps = 8/382 (2%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+RGY + ATVRDPGN KKV+HLL+LP A T LT+WK  + E
Sbjct  8     VCVTGASGFIGSWLVMRLLERGYFVRATVRDPGNLKKVQHLLDLPNAKTLLTLWKADLSE  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGS+D+AI GC+GVFHVATPMDF+SKDPENEVIKP +NG+L I+ +CVKAKTV+R VFTS
Sbjct  68    EGSYDDAINGCDGVFHVATPMDFESKDPENEVIKPTVNGMLGIMKACVKAKTVRRFVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NV+  QK VYDE  WSDL+FI +KKMTGWMYF SK LAEK AW   +EK +DFIS
Sbjct  128   SAGTVNVEEHQKNVYDENDWSDLEFIMSKKMTGWMYFVSKTLAEKAAWDFAEEKGLDFIS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LVVGPFIT + PPSLITALS IT N+AHYSII+QGQYVHLDDLC AHIFLYE   A
Sbjct  188   IIPTLVVGPFITTSMPPSLITALSPITRNEAHYSIIRQGQYVHLDDLCNAHIFLYEQAAA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             +GR+ICSSH  TI  ++  +   +PEY +PS F+G++++L  + FSSKKL  MGF FKYS
Sbjct  248   KGRYICSSHDATILTISKFLRPKYPEYNVPSTFEGVDENLKSIEFSSKKLTKMGFNFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVEKPTAIEQKQEAKTVPLKPSA  1183
             LE+M+  +IET R+KG LP S    +  E +  T    +E  T      +  T  +KP  
Sbjct  308   LEEMFIESIETCRQKGFLPVSLSYQSISEIKVPTKNENIEVKTG-----DGLTDGMKPC-  361

Query  1184  IEQKQETAVPLKLEEEPTAIEQ  1249
                K ET V  +  + P   +Q
Sbjct  362   --NKTETGVTGERTDAPMLAQQ  381



>gb|ABG76202.1| dihydroflavonol reductase [Brassica napus]
Length=385

 Score =   474 bits (1221),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 220/331 (66%), Positives = 264/331 (80%), Gaps = 0/331 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+ FIGSWLV   L+RGY + ATVRDPGN KKV+HLL+LP A T LT+WK  + +
Sbjct  8     VCVTGASRFIGSWLVMRRLERGYFVRATVRDPGNLKKVQHLLDLPNAKTQLTLWKADLSD  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGS D+AI GC+GVFH+ATPMDF+SKDPENEVIKP +NGVL I+ +C KAKTV+R+VFTS
Sbjct  68    EGSHDDAINGCDGVFHIATPMDFESKDPENEVIKPTVNGVLGIMKACDKAKTVRRIVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NV+  QK VYDE  WSDLDFI +KKMTGWMYF SK LAEK AW   KEK IDFIS
Sbjct  128   SAGTVNVEEHQKNVYDENDWSDLDFIMSKKMTGWMYFMSKTLAEKAAWDYAKEKGIDFIS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LV+GPFIT + PPSLITALS IT N+AHYSII+QGQYVHLDDLC AHIFLYE   A
Sbjct  188   IIPTLVIGPFITTSMPPSLITALSPITRNEAHYSIIRQGQYVHLDDLCNAHIFLYEQAAA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             +GR++CSSH  TI  +++ + Q +PEY +PS F+G++++L  + FSSKKL DMGF FKYS
Sbjct  248   KGRYVCSSHDATILTISEFLRQKYPEYNVPSTFEGVDENLKSIMFSSKKLIDMGFNFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYSTKEAAAIEEE  1096
             LEDM   +IET R+KG LP +  E    E++
Sbjct  308   LEDMLVESIETCRQKGFLPVTLPEHLKSEDK  338



>emb|CAP08822.1| dihydroflavonol reductase [Arabidopsis thaliana]
Length=382

 Score =   474 bits (1221),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 222/340 (65%), Positives = 270/340 (79%), Gaps = 2/340 (1%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+RGY + ATVRDP N KKV+HLL+LP A T LT+WK  + E
Sbjct  8     VCVTGASGFIGSWLVMRLLERGYFVRATVRDPDNLKKVQHLLDLPNAKTLLTLWKADLSE  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGS+D+AI GC+GVFHVATPMDF+SKDPENEVIKP +NG+L I+ +CVKAKTV+R VFTS
Sbjct  68    EGSYDDAINGCDGVFHVATPMDFESKDPENEVIKPTVNGMLGIMKACVKAKTVRRFVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NV+  QK VYDE  WSDL+FI +KKMTGWMYF SK LAEK AW   +EK +DFIS
Sbjct  128   SAGTVNVEEHQKNVYDENDWSDLEFIMSKKMTGWMYFVSKTLAEKAAWDFAEEKGLDFIS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LVVGPFIT + PPSLITALS IT N+AHYSII+QGQYVHLDDLC AHIFLYE   A
Sbjct  188   IIPTLVVGPFITTSMPPSLITALSPITRNEAHYSIIRQGQYVHLDDLCNAHIFLYEQAAA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             +GR+ICSSH  TI  ++  +   +PEY +PS F+G++++L  + FSSKKL DMGF FKYS
Sbjct  248   KGRYICSSHDATILTISKFLRPKYPEYNVPSTFEGVDENLKSIEFSSKKLTDMGFNFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYST--KEAAAIEEEQETVALK  1117
             LE+M+  +IET R+KG LP S   +  + I+ + E + +K
Sbjct  308   LEEMFIESIETCRQKGFLPVSLSYQSISEIKTKNENIDVK  347



>gb|AAR27014.1| dihydroflavanol-4-reductase 1 [Medicago truncatula]
 gb|KEH40173.1| dihydroflavonol 4-reductase [Medicago truncatula]
Length=334

 Score =   473 bits (1216),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 217/319 (68%), Positives = 261/319 (82%), Gaps = 0/319 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  L++RGY + ATVRDP N KKV HLLELP A   L++WK  + E
Sbjct  8     VCVTGASGFIGSWLVMRLMERGYMVRATVRDPENLKKVSHLLELPGAKGKLSLWKADLGE  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDPENE+IKP I GVL+I+ +C+KAKTV+R +FTS
Sbjct  68    EGSFDEAIKGCTGVFHVATPMDFESKDPENEMIKPTIKGVLDIMKACLKAKTVRRFIFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGTLNV   QKP++DE+CWSD++F    KMTGWMYF SK LAE+EAWK  KE  +DFI+
Sbjct  128   SAGTLNVTEDQKPLWDESCWSDVEFCRRVKMTGWMYFVSKTLAEQEAWKFAKEHNMDFIT  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIPPLVVGPF+ PT PPSLITALS ITGN+AHYSIIKQGQ+VHLDDLCEAHIFL+EH + 
Sbjct  188   IIPPLVVGPFLIPTMPPSLITALSPITGNEAHYSIIKQGQFVHLDDLCEAHIFLFEHMEV  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR++CS+    IH +A +I   +PEY IP++F  I  +L +V FSSKK++D+GF+FKYS
Sbjct  248   EGRYLCSACEANIHDIAKLINTKYPEYNIPTKFNNIPDELELVRFSSKKIKDLGFEFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLP  1060
             LEDMY  AI+T  +KGLLP
Sbjct  308   LEDMYTEAIDTCIEKGLLP  326



>emb|CBI19727.3| unnamed protein product [Vitis vinifera]
Length=931

 Score =   492 bits (1266),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 226/319 (71%), Positives = 267/319 (84%), Gaps = 0/319 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+RGY + ATVRDP N KKVKHLL+LPKA+T+LT+WK  + +
Sbjct  602   VCVTGASGFIGSWLVMRLLERGYTVRATVRDPTNVKKVKHLLDLPKAETHLTLWKADLAD  661

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDPENEVIKP I G+L I+ SC  AKTV+RLVFTS
Sbjct  662   EGSFDEAIKGCTGVFHVATPMDFESKDPENEVIKPTIEGMLGIMKSCAAAKTVRRLVFTS  721

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+N+Q  Q PVYDE+CWSD++F  AKKMT WMYF SK LAE+ AWK  KE  IDFI+
Sbjct  722   SAGTVNIQEHQLPVYDESCWSDMEFCRAKKMTAWMYFVSKTLAEQAAWKYAKENNIDFIT  781

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LVVGPFI  + PPSLITALS ITGN+AHYSII+QGQ+VHLDDLC AHI+L+E+PKA
Sbjct  782   IIPTLVVGPFIMSSMPPSLITALSPITGNEAHYSIIRQGQFVHLDDLCNAHIYLFENPKA  841

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSSH   I  LA M+ + +PEY IP+EFKG++++L  V FSSKKL D+GF+FKYS
Sbjct  842   EGRYICSSHDCIILDLAKMLREKYPEYNIPTEFKGVDENLKSVCFSSKKLTDLGFEFKYS  901

Query  1004  LEDMYRGAIETLRKKGLLP  1060
             LEDM+ GA++T R KGLLP
Sbjct  902   LEDMFTGAVDTCRAKGLLP  920


 Score =   400 bits (1028),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 180/325 (55%), Positives = 254/325 (78%), Gaps = 6/325 (2%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LLQRGY++HATVRDPGN +KVKHLLELPKA T+L++W+  ++E
Sbjct  9     VCVTGASGFIGSWLVMKLLQRGYYVHATVRDPGNVEKVKHLLELPKASTHLSLWRADLKE  68

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFD+AI GC GVFHVA+PMD  ++D +NEVI P +NGVL+I+ +C KAKTVKR ++TS
Sbjct  69    EGSFDDAIQGCIGVFHVASPMDISTQDAQNEVIDPTVNGVLDIMRACTKAKTVKRFIYTS  128

Query  464   SAGTLNVQPQQKPV-YDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFI  640
             + GT+ V P+  P+ YDE+ W+D+D+  A+KMT WMYF +K  AEK AW+  KEK +D +
Sbjct  129   TTGTITVGPEPLPLEYDESFWTDVDYCKAQKMTAWMYFIAKTTAEKAAWEFAKEKGLDVV  188

Query  641   SIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPK  820
             +I PP+VVGPF+TP+ PPS    L+++TG +A  +++ +G+ VH+DDLC+AHI+L+EHP+
Sbjct  189   TIQPPVVVGPFVTPSLPPSAKLVLAVLTGEEAGCNLLARGRAVHVDDLCDAHIYLFEHPE  248

Query  821   AEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKY  1000
             A+GR+ICSSH   I  LA  ++  + EY IP++F+G+++ L  +  SS+KL D+G++FKY
Sbjct  249   AKGRYICSSHCFNIIELARSLSLKYSEYNIPTKFEGVDESLKSIPCSSRKLLDLGYKFKY  308

Query  1001  SLE-----DMYRGAIETLRKKGLLP  1060
             + E     D+  GAIE+ ++KGL+P
Sbjct  309   NSEEYDIGDLCSGAIESCKEKGLMP  333



>ref|XP_010060970.1| PREDICTED: dihydroflavonol-4-reductase [Eucalyptus grandis]
 gb|KCW67873.1| hypothetical protein EUGRSUZ_F01589 [Eucalyptus grandis]
Length=337

 Score =   471 bits (1212),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 214/321 (67%), Positives = 264/321 (82%), Gaps = 0/321 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGAAGFIGSWLV  LL+RGY + ATVRDP N KKVKHLL+LP+A T+LT+WK  + E
Sbjct  8     VCVTGAAGFIGSWLVMRLLERGYTVRATVRDPNNMKKVKHLLDLPQAKTHLTLWKADLNE  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
              GSFDEAI GC GVFHVATPMDF+SKDPENEVIKP + GVL I+ +C KAKTV+RLVFTS
Sbjct  68    AGSFDEAINGCTGVFHVATPMDFESKDPENEVIKPTVEGVLGIMRACAKAKTVRRLVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT++VQ  +KPVY E  WSD+DF+ A KMTGWMYF SK LAEK AWK  +E  ID IS
Sbjct  128   SAGTVDVQEHRKPVYSEEDWSDMDFVLATKMTGWMYFVSKTLAEKAAWKFAEENNIDLIS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LVVGPFI  + PPSLIT LS IT N+AHYSI+KQG +VH DDLCE+HIFL+EHP+A
Sbjct  188   IIPSLVVGPFIMSSMPPSLITGLSPITRNEAHYSIMKQGHFVHTDDLCESHIFLFEHPEA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             +GR+ICSSH  +I  +A+++ + +PEY IP+EF+G+++++  V F +KKL D+GF++KY+
Sbjct  248   KGRYICSSHDASILEVANLLRKKYPEYDIPTEFEGVDENMQSVTFCTKKLLDLGFKYKYT  307

Query  1004  LEDMYRGAIETLRKKGLLPYS  1066
             LED++ GA+ET R+KGLLP S
Sbjct  308   LEDIFVGAVETCREKGLLPLS  328



>ref|XP_002863734.1| dihydroflavonol reductase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39993.1| dihydroflavonol reductase [Arabidopsis lyrata subsp. lyrata]
Length=384

 Score =   472 bits (1215),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 216/321 (67%), Positives = 260/321 (81%), Gaps = 0/321 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+RGY + ATVRDPGN KKV+HLL+LP A T LT+WK  + E
Sbjct  8     VCVTGASGFIGSWLVMRLLERGYFVRATVRDPGNLKKVQHLLDLPNAKTQLTLWKADLSE  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGS+D+AI GC+GVFHVATPMDF+SKDPENEVIKP +NG+L I+ +CVKAKTV+R +FTS
Sbjct  68    EGSYDDAITGCDGVFHVATPMDFESKDPENEVIKPTVNGMLGIMKACVKAKTVRRFIFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NV+  QK VYDE  WSDL+FI +KKMTGWMYF SK LAEK AW   +EK +DF+S
Sbjct  128   SAGTVNVEEHQKSVYDENDWSDLEFIMSKKMTGWMYFVSKTLAEKAAWDYAEEKGLDFVS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LVVGPFIT + PPSLITALS IT N+AHYSII+QGQYVHLDDLC +HIFLYE   A
Sbjct  188   IIPTLVVGPFITTSMPPSLITALSPITRNEAHYSIIRQGQYVHLDDLCNSHIFLYEQEAA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             +GR+ICSSH  TI  ++  + Q + EY +PS F+G++++L  + FSSKKL DMGF FKYS
Sbjct  248   KGRYICSSHDATILTISKFLRQKYSEYNVPSTFEGVDENLKSIEFSSKKLTDMGFNFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYS  1066
             LE+M   +IET R+KG L  S
Sbjct  308   LEEMLIESIETCRQKGFLSVS  328



>dbj|BAB92999.1| dihydroflavonol reductase [Malus domestica]
Length=314

 Score =   469 bits (1208),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 214/310 (69%), Positives = 261/310 (84%), Gaps = 0/310 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+ GY + ATVRDP N KKVKHLL+LPKA+T+LT+WK  + +
Sbjct  5     VCVTGASGFIGSWLVMRLLEHGYTVRATVRDPTNQKKVKHLLDLPKAETHLTLWKADLAD  64

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDPENEVIKP ING+L+I+ +C KAKTV++LVFTS
Sbjct  65    EGSFDEAIQGCSGVFHVATPMDFESKDPENEVIKPTINGLLDILKACQKAKTVRKLVFTS  124

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NV+  QKPVYDE+ WSD++F  + KMTGWMYF SK LAE+ AWK  KE  IDFI+
Sbjct  125   SAGTVNVEEHQKPVYDESNWSDVEFCRSVKMTGWMYFVSKTLAEQAAWKYAKENNIDFIT  184

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LV+GPF+ P+ PPSLIT LS I  N++HY IIKQGQYVHLDDLC +HI+LYEHPKA
Sbjct  185   IIPTLVIGPFLMPSMPPSLITGLSPILRNESHYGIIKQGQYVHLDDLCLSHIYLYEHPKA  244

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSSH  TIH L  M+ + +PEY IP++FKGI+ +L  V+FSSKKL+++GF+FKYS
Sbjct  245   EGRYICSSHDATIHELVKMLREKYPEYNIPTKFKGIDDNLEPVHFSSKKLREIGFEFKYS  304

Query  1004  LEDMYRGAIE  1033
             LEDM+ GA++
Sbjct  305   LEDMFVGAVD  314



>ref|XP_010481941.1| PREDICTED: dihydroflavonol-4-reductase-like [Camelina sativa]
Length=377

 Score =   472 bits (1214),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 216/333 (65%), Positives = 267/333 (80%), Gaps = 0/333 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+RGY + ATVRDPGN KKVKHLL+LP A + LT+W   + +
Sbjct  8     VCVTGASGFIGSWLVMRLLERGYFVRATVRDPGNLKKVKHLLDLPNAKSKLTLWMADLSD  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGS+D+AI GC+GVFHVATPMDF+SKDPENEVIKP +NG+L I+ +CV+AKTV+R VFTS
Sbjct  68    EGSYDDAIKGCDGVFHVATPMDFESKDPENEVIKPTVNGMLGILKACVEAKTVRRFVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NV+  QK VYDE  WSDL+FI +KKMTGWMYF SK LAEK AW   +EK +DFIS
Sbjct  128   SAGTVNVEENQKSVYDEQDWSDLEFIMSKKMTGWMYFVSKTLAEKAAWDYAEEKGLDFIS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LVVGPFIT + PPSLITALS IT N+AHYSIIKQGQY+HLDDLC AHIFLYE   A
Sbjct  188   IIPTLVVGPFITTSMPPSLITALSPITRNEAHYSIIKQGQYMHLDDLCNAHIFLYEKTAA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             +GR++CSSH  TI  ++  + Q +PEY +PS F+G++++L  + FSSKKL ++GF FKYS
Sbjct  248   KGRYVCSSHDATILTMSKFLRQKYPEYNVPSTFEGVDENLKGIVFSSKKLTEVGFNFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQE  1102
             LE+M+  +IET R+KG LP S  +  + ++  E
Sbjct  308   LEEMFVESIETCRQKGFLPVSMNKVPSKDDNIE  340



>gb|ADY02644.1| dihydroflavonol 4-reductase [Parrya nudicaulis]
Length=375

 Score =   471 bits (1213),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 216/321 (67%), Positives = 261/321 (81%), Gaps = 0/321 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWL   LL+RGY +HATVR+PGN KKV+HLL+LP A T LT+WK  +  
Sbjct  8     VCVTGASGFIGSWLXMRLLERGYFVHATVREPGNLKKVQHLLDLPNAKTQLTLWKADLSG  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             E S+D+AI GC+GVFHVATPMDF+SKDPENEVIKP +NG+L I+ +C+K KTV+R+VFTS
Sbjct  68    EESYDDAINGCDGVFHVATPMDFESKDPENEVIKPTVNGMLGIMKACIKTKTVRRVVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NV+  QK VYDE  WSDL+FI +KKMTGWMYF SK LAEK AW   KEK IDFIS
Sbjct  128   SAGTINVEEHQKNVYDENNWSDLEFIISKKMTGWMYFLSKTLAEKAAWDYAKEKGIDFIS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LV+GPFIT + PPSLITALS IT N+AHYSIIKQGQY+HLDDLC AHIFLYE   A
Sbjct  188   IIPTLVIGPFITTSMPPSLITALSPITRNEAHYSIIKQGQYIHLDDLCNAHIFLYEQAVA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             +GR++CSSH  TI  +++ + + +PEY +PS F+G  ++L  V FSSKKL +MGF FKYS
Sbjct  248   KGRYVCSSHDATIVTISEFLRRKYPEYNVPSTFEGANENLKSVVFSSKKLIEMGFNFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYS  1066
             LEDM+  +IET R+KG LP+S
Sbjct  308   LEDMFVESIETCRRKGFLPFS  328



>gb|ADY02645.1| dihydroflavonol 4-reductase [Parrya nudicaulis]
Length=375

 Score =   471 bits (1213),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 217/321 (68%), Positives = 261/321 (81%), Gaps = 0/321 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+RGY +HATVR+PGN KKV+HLL+LP A T LT+WK  +  
Sbjct  8     VCVTGASGFIGSWLVMRLLERGYFVHATVREPGNLKKVQHLLDLPNAKTQLTLWKADLSG  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             E S+D+AI GC+GVFHVATPMDF+SKDPENEVIKP +NG+L I+ +C+K KTV+R+VFTS
Sbjct  68    EESYDDAINGCDGVFHVATPMDFESKDPENEVIKPTVNGMLGIMKACIKTKTVRRVVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NV+  QK VYDE  WSDL+FI +KKMTGWMYF SK LAEK AW   KEK IDFIS
Sbjct  128   SAGTINVEEHQKNVYDENNWSDLEFIISKKMTGWMYFLSKTLAEKAAWDYAKEKGIDFIS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LV+GPFIT + PPSLITALS IT N+AHYSIIKQGQY+HLDDLC AHIFLYE   A
Sbjct  188   IIPTLVIGPFITTSMPPSLITALSPITRNEAHYSIIKQGQYIHLDDLCNAHIFLYEQAVA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             +GR++CSSH  TI  +++ + + +PEY  PS F+G  ++L  V FSSKKL +MGF FKYS
Sbjct  248   KGRYVCSSHDATIVTISEFLRRKYPEYNXPSXFEGANENLKSVVFSSKKLIEMGFNFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYS  1066
             LEDM+  +IET R+KG LP+S
Sbjct  308   LEDMFVESIETCRRKGFLPFS  328



>ref|XP_006403345.1| hypothetical protein EUTSA_v10003227mg [Eutrema salsugineum]
 gb|ESQ44798.1| hypothetical protein EUTSA_v10003227mg [Eutrema salsugineum]
Length=382

 Score =   471 bits (1212),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 220/340 (65%), Positives = 269/340 (79%), Gaps = 0/340 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GFIGSWLV  LL+RGY +  TVRDPGN KKV+HLL+LP A T LT+WK  + +
Sbjct  8     VCVTGASGFIGSWLVMRLLERGYFVRGTVRDPGNLKKVQHLLDLPNAKTQLTLWKADLSD  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGS+DEAI GC+G+FHVATPMDF+S DPENEVIKP +NGVL I+ +CVKAKTV+R+VFTS
Sbjct  68    EGSYDEAINGCDGIFHVATPMDFESTDPENEVIKPTVNGVLGIMKACVKAKTVRRIVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NV+   K VYDE+ WSDL+FI +KKMTGWMYF SK+LAEK AW   KE  IDFIS
Sbjct  128   SAGTVNVEEHMKDVYDESDWSDLNFIMSKKMTGWMYFLSKMLAEKAAWDYAKENGIDFIS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LV+GPFIT + PPSLITALS IT N+AHYSII+QGQYVHLDDLC AHIFL+E   A
Sbjct  188   IIPTLVIGPFITTSMPPSLITALSPITRNEAHYSIIRQGQYVHLDDLCNAHIFLFEEAVA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             +GR+ICSSH  TI  ++  + + +PEY +P+ F+G++++L  + FSSKKL DMGF FKYS
Sbjct  248   KGRYICSSHDATILSISGFLRKKYPEYNVPATFEGVDENLKSIMFSSKKLIDMGFSFKYS  307

Query  1004  LEDMYRGAIETLRKKGLLPYSTKEAAAIEEEQETVALKVE  1123
             LE+M   +IET R+KG LP S  + +  EE+  T   K E
Sbjct  308   LEEMLVESIETCREKGFLPVSFPKPSKSEEKVPTSDDKSE  347



>gb|AHL46438.1| dihydroflavonol 4-reductase [Fragaria vesca]
 gb|AHL46439.1| dihydroflavonol 4-reductase [Fragaria vesca]
 gb|AHL46441.1| dihydroflavonol 4-reductase [Fragaria vesca]
Length=333

 Score =   469 bits (1206),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 211/324 (65%), Positives = 265/324 (82%), Gaps = 0/324 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GF+GSWLV  LL+RGY + ATVRDP N KKV+HLLELP+A T LT+WK  ++ 
Sbjct  10    VCVTGASGFVGSWLVMRLLERGYTVRATVRDPANLKKVRHLLELPQAATLLTLWKADLDI  69

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+S+DPENEVIKP ING+L+I+ +C+KAKTV+R+VFTS
Sbjct  70    EGSFDEAIKGCTGVFHVATPMDFESEDPENEVIKPTINGMLDIMKACLKAKTVRRVVFTS  129

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAG + ++  +K VY E  WSD+ F    KMTGWMYF SK LAE+ AWK  KE  IDFI+
Sbjct  130   SAGAVAIEEHRKEVYSENNWSDVVFCRKVKMTGWMYFVSKTLAEQAAWKFAKENNIDFIT  189

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LV+GPF+ P+ PPSLI+ LS +TGN+AHY IIKQ QYVHLDDLC++HIFLYEHPKA
Sbjct  190   IIPTLVIGPFLAPSMPPSLISGLSPLTGNEAHYGIIKQCQYVHLDDLCQSHIFLYEHPKA  249

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSSH  TIH +A ++ + +P+Y +P +FKGIE++L  ++FSSKKL++MGF+FK+S
Sbjct  250   EGRYICSSHDATIHDIAKLLNERYPKYNVPKKFKGIEENLTNIHFSSKKLKEMGFEFKHS  309

Query  1004  LEDMYRGAIETLRKKGLLPYSTKE  1075
             LEDM+ GA++  R KGLLP   +E
Sbjct  310   LEDMFTGAVDACRAKGLLPLPQEE  333



>gb|AAU12363.1| dihydroflavonol 4-reductase [Fragaria x ananassa]
 gb|AFP99286.1| dihydroflavonol 4-reductase [Fragaria x ananassa]
 gb|AHL46443.1| dihydroflavonol 4-reductase [Fragaria x ananassa]
 gb|AHL46444.1| dihydroflavonol 4-reductase [Fragaria x ananassa]
Length=341

 Score =   469 bits (1207),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 210/324 (65%), Positives = 265/324 (82%), Gaps = 0/324 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GF+GSWLV  LL+ GY + ATVRDP N KKV+HLLELP+A T LT+WK  ++ 
Sbjct  10    VCVTGASGFVGSWLVMRLLEHGYTVRATVRDPANLKKVRHLLELPQAATRLTLWKADLDV  69

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+S+DPENEVIKP ING+L+I+ +C+KAKTV+R+VFTS
Sbjct  70    EGSFDEAIKGCTGVFHVATPMDFESEDPENEVIKPTINGMLDIMKACLKAKTVRRVVFTS  129

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAG + ++  +K VY E  WSD+ F    KMTGWMYF SK LAE+ AWK  KE  IDFI+
Sbjct  130   SAGAVAIEEHRKEVYSENNWSDVVFCRKVKMTGWMYFVSKTLAEQAAWKFAKENNIDFIT  189

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LV+GPF+ P+ PPSLI+ LS +TGN+AHY IIKQ QYVHLDDLC++HIFLYEHPKA
Sbjct  190   IIPTLVIGPFLAPSMPPSLISGLSPLTGNEAHYGIIKQCQYVHLDDLCQSHIFLYEHPKA  249

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR+ICSSH  TIH +A ++ + +P+Y +P +FKGIE++L  ++FSSKKL++MGF+FK+S
Sbjct  250   EGRYICSSHDATIHDIAKLLNEKYPKYNVPKKFKGIEENLTNIHFSSKKLKEMGFEFKHS  309

Query  1004  LEDMYRGAIETLRKKGLLPYSTKE  1075
             LEDM+ GA++  R+KGLLP   +E
Sbjct  310   LEDMFTGAVDACREKGLLPLPQEE  333



>sp|P51104.1|DFRA_DIACA RecName: Full=Dihydroflavonol-4-reductase; Short=DFR; AltName: 
Full=Dihydrokaempferol 4-reductase [Dianthus caryophyllus]
 emb|CAA91924.1| dihydroflavonol 4-reductase [Dianthus caryophyllus]
Length=360

 Score =   469 bits (1208),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 218/336 (65%), Positives = 269/336 (80%), Gaps = 5/336 (1%)
 Frame = +2

Query  71    VDGNHPL----LPPKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELP  238
             +DG H +        VCVTGA+GFIGSWL+  LL+RGY + ATVRDP NTKKV+HLL+LP
Sbjct  10    LDGKHDINKVGQGETVCVTGASGFIGSWLIMRLLERGYTVRATVRDPDNTKKVQHLLDLP  69

Query  239   KADTNLTIWKGVMEEEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIIN  418
              A TNLT+WK  + EEGSFD A+ GC GVFH+ATPMDF+SKDPENE+IKP ING+L+I+ 
Sbjct  70    NAKTNLTLWKADLHEEGSFDAAVDGCTGVFHIATPMDFESKDPENEMIKPTINGMLDILK  129

Query  419   SCVKAKTVKRLVFTSSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEK  598
             SCVKAK ++R+VFTSS GT+NV+  QKPVYDETCWS LDFI + KMTGWMYF SKILAE+
Sbjct  130   SCVKAK-LRRVVFTSSGGTVNVEATQKPVYDETCWSALDFIRSVKMTGWMYFVSKILAEQ  188

Query  599   EAWKVTKEKKIDFISIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLD  778
              AWK   E  ++FISIIPPLVVGPFI P+ PPSLITALS IT  ++HY+IIKQGQ+VHLD
Sbjct  189   AAWKYAAENNLEFISIIPPLVVGPFIMPSMPPSLITALSPITRTESHYTIIKQGQFVHLD  248

Query  779   DLCEAHIFLYEHPKAEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYF  958
             DLC +HIFLYE+PKA GR+I S+   TI+ +A M+ + +PEY +P++FK  ++D+  V F
Sbjct  249   DLCMSHIFLYENPKANGRYIASACAATIYDIAKMLREEYPEYNVPTKFKDYKEDMGQVQF  308

Query  959   SSKKLQDMGFQFKYSLEDMYRGAIETLRKKGLLPYS  1066
             SSKKL D+GF+FKY L+DMY  A+E+ R KGLLP S
Sbjct  309   SSKKLTDLGFEFKYGLKDMYTAAVESCRAKGLLPLS  344



>gb|ACZ48697.1| dihydroflavonol-4-reductase [Fagopyrum tataricum]
Length=341

 Score =   469 bits (1206),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 214/324 (66%), Positives = 265/324 (82%), Gaps = 1/324 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGA+GF+GSWLV  LL+ GY + ATVRDP N KKVKHLL+LPK+ TNL++WK  + E
Sbjct  8     VCVTGASGFVGSWLVMRLLEHGYVVRATVRDPSNMKKVKHLLDLPKSKTNLSLWKADLSE  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDPENEVIKP ING+L+I+ +C+KA  V++LVFTS
Sbjct  68    EGSFDEAIQGCAGVFHVATPMDFESKDPENEVIKPTINGMLDIMKACLKA-NVRKLVFTS  126

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT+NV+ +QKPVYDETCWSD+DF    KMTGWMYF SK LAE+ AWK  +E  +DFIS
Sbjct  127   SAGTVNVEEKQKPVYDETCWSDVDFCRRVKMTGWMYFVSKTLAEQAAWKFAEENNMDFIS  186

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             IIP LVVGPFI P+FPPSLITALS IT  + HY+IIKQ QYVHLDDLC +HI+LYE   +
Sbjct  187   IIPTLVVGPFIMPSFPPSLITALSPITRTEGHYTIIKQCQYVHLDDLCMSHIYLYEKAGS  246

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             +GR++CSSH+ TI+ L  M+   +PEY +P++F+  ++++  V FSSKKL D GF+FKYS
Sbjct  247   KGRYVCSSHNATIYDLGKMLRNKYPEYNVPTKFRDFDENMEAVSFSSKKLTDEGFEFKYS  306

Query  1004  LEDMYRGAIETLRKKGLLPYSTKE  1075
             LEDM+ GA+ET R+KGLLP + +E
Sbjct  307   LEDMFVGAVETCREKGLLPKTFEE  330



>gb|AGI16384.1| dihydroflavonol 4-reductase [Ribes nigrum]
Length=366

 Score =   470 bits (1209),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 213/321 (66%), Positives = 260/321 (81%), Gaps = 0/321 (0%)
 Frame = +2

Query  104   VCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVMEE  283
             VCVTGAAGFIGSWL+  LL+RGY + ATVRDP N KKVKHLL+LP A TNLT+WK  + E
Sbjct  8     VCVTGAAGFIGSWLIMRLLERGYIVRATVRDPKNMKKVKHLLDLPTAKTNLTLWKADLSE  67

Query  284   EGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFTS  463
             EGSFDEAI GC GVFHVATPMDF+SKDPENEVIKP I G+L+I+ SC KAKTV+R+VFTS
Sbjct  68    EGSFDEAINGCTGVFHVATPMDFESKDPENEVIKPTIEGMLSIMKSCAKAKTVRRIVFTS  127

Query  464   SAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFIS  643
             SAGT++V   QKPVYDETCWSD++F  AKKMTGWMYF SK +AE+ AW   KE  ID +S
Sbjct  128   SAGTIDVSEHQKPVYDETCWSDVEFCRAKKMTGWMYFVSKTMAEQAAWDFAKENNIDLVS  187

Query  644   IIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPKA  823
             +IPPLVVGPF+  T PPSLIT LS IT  ++HY IIKQGQ+VHLDDLC AHI+++E+PKA
Sbjct  188   VIPPLVVGPFLMSTMPPSLITGLSPITRTESHYGIIKQGQFVHLDDLCNAHIYVFENPKA  247

Query  824   EGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKYS  1003
             EGR++CS+   TI  LA ++   +PEY +P++F  I+++L  V+FSS KL+ +GF+FKY+
Sbjct  248   EGRYMCSACDATIIELAKLLNLKYPEYNVPTKFNNIDENLENVHFSSDKLKSLGFEFKYT  307

Query  1004  LEDMYRGAIETLRKKGLLPYS  1066
             LEDM+  A+ET R KGLLP S
Sbjct  308   LEDMFTDAVETCRAKGLLPLS  328



>gb|AAU12364.1| dihydroflavonol 4-reductase [Fragaria x ananassa]
Length=342

 Score =   468 bits (1205),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 212/325 (65%), Positives = 266/325 (82%), Gaps = 1/325 (0%)
 Frame = +2

Query  104   VCVTGAAGF-IGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPKADTNLTIWKGVME  280
             VCVTGA+GF IGSWLV  LL+RGY + ATVRDP N KKV+HLLELP+A T LT+WK  ++
Sbjct  10    VCVTGASGFVIGSWLVMRLLERGYTVRATVRDPANLKKVRHLLELPQAATRLTLWKADLD  69

Query  281   EEGSFDEAIAGCEGVFHVATPMDFDSKDPENEVIKPAINGVLNIINSCVKAKTVKRLVFT  460
              EGSFDEAI GC GVFHVATPMDF+S+DPENEVIKP ING+L+I+ +C+KAKTV+R+VFT
Sbjct  70    IEGSFDEAIKGCTGVFHVATPMDFESEDPENEVIKPTINGMLDIMKACLKAKTVRRVVFT  129

Query  461   SSAGTLNVQPQQKPVYDETCWSDLDFIYAKKMTGWMYFASKILAEKEAWKVTKEKKIDFI  640
             SSAG + ++  +K VY E  WSD+ F    KMTGWMYF SK LAE+ AWK  KE  IDFI
Sbjct  130   SSAGAVAIEEHRKEVYSENNWSDVVFCRKVKMTGWMYFVSKTLAEQAAWKFAKENNIDFI  189

Query  641   SIIPPLVVGPFITPTFPPSLITALSLITGNQAHYSIIKQGQYVHLDDLCEAHIFLYEHPK  820
             +IIP LV+GPF+ P+ PPSLI+ LS +TGN+AHY IIKQ QYVHLDDLC++HIFLYEHPK
Sbjct  190   TIIPTLVIGPFLAPSMPPSLISGLSPLTGNEAHYGIIKQCQYVHLDDLCQSHIFLYEHPK  249

Query  821   AEGRFICSSHHTTIHGLADMITQNWPEYYIPSEFKGIEKDLPVVYFSSKKLQDMGFQFKY  1000
             AEGR+ICSSH  TIH +  ++ +N+P+Y +P +FKGIE++L  ++FSSKKL++MGF+FK+
Sbjct  250   AEGRYICSSHDATIHDIVKLLNENYPKYNVPKKFKGIEENLTNIHFSSKKLKEMGFEFKH  309

Query  1001  SLEDMYRGAIETLRKKGLLPYSTKE  1075
             SLEDM+ GA++  R+KGLLP   +E
Sbjct  310   SLEDMFTGAVDACREKGLLPLPQEE  334



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3512314477896