BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c760_g2_i1 len=596 path=[15:0-595]

Length=596
                                                                      Score     E

emb|CDP04103.1|  unnamed protein product                                307   7e-103   
ref|XP_009593251.1|  PREDICTED: uncharacterized protein LOC104089939    312   7e-101   
ref|XP_009757234.1|  PREDICTED: uncharacterized protein LOC104210124    311   1e-100   
ref|XP_004248407.1|  PREDICTED: uncharacterized protein LOC101259294    309   6e-100   
ref|XP_006352613.1|  PREDICTED: uncharacterized protein LOC102598072    307   7e-99    
ref|XP_009604702.1|  PREDICTED: uncharacterized protein LOC104099425    306   1e-98    
ref|XP_010260816.1|  PREDICTED: uncharacterized protein LOC104599797    306   2e-98    
ref|XP_009788642.1|  PREDICTED: uncharacterized protein LOC104236423    304   8e-98    
ref|XP_004232603.1|  PREDICTED: uncharacterized protein LOC101245716    304   1e-97    
ref|XP_007211819.1|  hypothetical protein PRUPE_ppa004238mg             303   3e-97    
ref|XP_006364820.1|  PREDICTED: uncharacterized protein LOC102595515    303   6e-97    
gb|KHN26585.1|  hypothetical protein glysoja_019824                     291   2e-96    
emb|CBI27377.3|  unnamed protein product                                289   8e-96    
ref|XP_008356149.1|  PREDICTED: uncharacterized protein LOC103419837    290   1e-95    
ref|XP_008225942.1|  PREDICTED: uncharacterized protein LOC103325540    299   2e-95    
gb|ABK94817.1|  unknown                                                 290   4e-95    Populus trichocarpa [western balsam poplar]
ref|XP_007138875.1|  hypothetical protein PHAVU_009G244900g             297   8e-95    
ref|XP_004293801.1|  PREDICTED: uncharacterized protein LOC101301656    296   2e-94    
gb|AGV54873.1|  hypothetical protein                                    296   2e-94    
ref|XP_002303721.1|  hypothetical protein POPTR_0003s15530g             290   2e-93    Populus trichocarpa [western balsam poplar]
ref|XP_009368565.1|  PREDICTED: uncharacterized protein LOC103958069    293   2e-93    
gb|EYU43615.1|  hypothetical protein MIMGU_mgv1a004537mg                293   2e-93    
ref|XP_008383246.1|  PREDICTED: uncharacterized protein LOC103445969    293   4e-93    
ref|XP_011096871.1|  PREDICTED: uncharacterized protein LOC105175921    290   2e-92    
ref|XP_002263686.1|  PREDICTED: uncharacterized protein LOC100251363    290   7e-92    Vitis vinifera
ref|XP_008364236.1|  PREDICTED: uncharacterized protein LOC103427929    289   1e-91    
ref|XP_003534854.1|  PREDICTED: uncharacterized protein LOC100795606    289   1e-91    
ref|XP_007040980.1|  Domain of Uncharacterized protein function (...    289   1e-91    
ref|XP_010094640.1|  hypothetical protein L484_009885                   289   1e-91    
ref|XP_003546382.1|  PREDICTED: uncharacterized protein LOC100787815    288   2e-91    
ref|XP_011008216.1|  PREDICTED: uncharacterized protein LOC105113657    286   2e-90    
ref|XP_002299381.2|  hypothetical protein POPTR_0001s12330g             285   5e-90    Populus trichocarpa [western balsam poplar]
ref|XP_009363281.1|  PREDICTED: uncharacterized protein LOC103953269    285   6e-90    
ref|XP_010058074.1|  PREDICTED: uncharacterized protein LOC104445843    283   1e-89    
gb|KCW75585.1|  hypothetical protein EUGRSUZ_E04328                     283   3e-89    
gb|KDP35088.1|  hypothetical protein JCGZ_10997                         282   6e-89    
ref|XP_008439419.1|  PREDICTED: uncharacterized protein LOC103484233    281   8e-89    
ref|XP_004488232.1|  PREDICTED: uncharacterized protein LOC101489232    280   3e-88    
ref|XP_011022744.1|  PREDICTED: uncharacterized protein LOC105124421    280   7e-88    
ref|XP_002533995.1|  conserved hypothetical protein                     278   3e-87    Ricinus communis
ref|XP_003547803.1|  PREDICTED: uncharacterized protein LOC100816...    277   3e-87    
ref|XP_008798470.1|  PREDICTED: uncharacterized protein LOC103713353    277   4e-87    
gb|KHN25040.1|  hypothetical protein glysoja_049162                     277   4e-87    
ref|XP_004134511.1|  PREDICTED: uncharacterized protein LOC101220016    276   6e-87    
ref|XP_007156305.1|  hypothetical protein PHAVU_003G275200g             273   1e-85    
ref|XP_010928822.1|  PREDICTED: uncharacterized protein LOC105050478    273   1e-85    
ref|XP_004509608.1|  PREDICTED: uncharacterized protein LOC101490982    272   2e-85    
gb|KEH37330.1|  glycosyltransferase family 92 protein                   271   2e-84    
ref|XP_003628971.1|  hypothetical protein MTR_8g070700                  268   1e-83    
ref|XP_006448575.1|  hypothetical protein CICLE_v10014882mg             264   5e-82    
ref|XP_010910220.1|  PREDICTED: uncharacterized protein LOC105036167    261   3e-81    
ref|XP_006468595.1|  PREDICTED: uncharacterized protein LOC102614492    262   4e-81    
gb|KDO77183.1|  hypothetical protein CISIN_1g009350mg                   262   5e-81    
ref|XP_009406517.1|  PREDICTED: uncharacterized protein LOC103989411    254   2e-78    
ref|XP_010441840.1|  PREDICTED: uncharacterized protein LOC104724...    250   6e-77    
ref|XP_010481723.1|  PREDICTED: uncharacterized protein LOC104760496    250   8e-77    
ref|XP_010441841.1|  PREDICTED: uncharacterized protein LOC104724...    251   8e-77    
ref|XP_006398091.1|  hypothetical protein EUTSA_v10000855mg             251   1e-76    
ref|XP_010494514.1|  PREDICTED: uncharacterized protein LOC104771647    250   1e-76    
ref|XP_006280340.1|  hypothetical protein CARUB_v10026267mg             249   1e-76    
emb|CDY71149.1|  BnaCnng71560D                                          236   3e-75    
ref|NP_199280.1|  uncharacterized protein                               246   4e-75    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002863553.1|  hypothetical protein ARALYDRAFT_494517             246   5e-75    
ref|XP_010529310.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    246   7e-75    
emb|CDY69573.1|  BnaAnng30860D                                          244   1e-74    
ref|XP_010449215.1|  PREDICTED: uncharacterized protein LOC104731515    244   1e-74    
gb|KFK31618.1|  hypothetical protein AALP_AA6G136500                    244   2e-74    
ref|XP_006283465.1|  hypothetical protein CARUB_v10004512mg             246   2e-74    
emb|CDX78979.1|  BnaA01g10460D                                          244   2e-74    
emb|CDY31450.1|  BnaC03g63740D                                          244   2e-74    
ref|XP_010434312.1|  PREDICTED: uncharacterized protein LOC104718293    244   2e-74    
ref|XP_009133537.1|  PREDICTED: uncharacterized protein LOC103858...    243   3e-74    
ref|XP_009133544.1|  PREDICTED: uncharacterized protein LOC103858...    243   4e-74    
ref|XP_006413894.1|  hypothetical protein EUTSA_v10024965mg             243   5e-74    
ref|XP_010439609.1|  PREDICTED: uncharacterized protein LOC104723016    243   6e-74    
ref|XP_006855865.1|  hypothetical protein AMTR_s00037p00116470          242   1e-73    
ref|XP_009108462.1|  PREDICTED: uncharacterized protein LOC103834153    241   2e-73    
emb|CDY50064.1|  BnaCnng18710D                                          241   2e-73    
emb|CDY49028.1|  BnaAnng10220D                                          239   3e-72    
ref|XP_009101686.1|  PREDICTED: uncharacterized protein LOC103827882    239   4e-72    
ref|XP_002869945.1|  hypothetical protein ARALYDRAFT_492851             237   6e-72    
gb|AAL24253.1|  AT4g20170/F1C12_90                                      234   8e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009388895.1|  PREDICTED: uncharacterized protein LOC103975...    233   5e-71    
ref|NP_193750.1|  uncharacterized protein                               234   8e-71    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010684202.1|  PREDICTED: uncharacterized protein LOC104898791    234   1e-70    
ref|XP_009388894.1|  PREDICTED: uncharacterized protein LOC103975...    233   2e-70    
ref|XP_003530546.1|  PREDICTED: uncharacterized protein LOC100795928    228   4e-68    
ref|XP_010684201.1|  PREDICTED: uncharacterized protein LOC104898790    219   6e-65    
gb|AFK35556.1|  unknown                                                 198   4e-61    
gb|ACF84457.1|  unknown                                                 194   5e-57    Zea mays [maize]
ref|XP_003560772.1|  PREDICTED: uncharacterized protein LOC100838543    197   1e-56    
ref|NP_001047907.2|  Os02g0712500                                       197   2e-56    Oryza sativa Japonica Group [Japonica rice]
gb|EEC73881.1|  hypothetical protein OsI_08667                          197   2e-56    Oryza sativa Indica Group [Indian rice]
ref|XP_002436975.1|  hypothetical protein SORBIDRAFT_10g013010          197   2e-56    Sorghum bicolor [broomcorn]
gb|EMS62496.1|  hypothetical protein TRIUR3_23927                       188   2e-56    
ref|XP_010555291.1|  PREDICTED: uncharacterized protein LOC104824814    196   2e-56    
gb|EEC80517.1|  hypothetical protein OsI_22786                          192   3e-56    Oryza sativa Indica Group [Indian rice]
ref|XP_006647788.1|  PREDICTED: uncharacterized protein LOC102718338    197   3e-56    
gb|EMS60568.1|  hypothetical protein TRIUR3_26687                       189   9e-56    
gb|EMT03263.1|  hypothetical protein F775_13698                         188   1e-55    
ref|XP_008796313.1|  PREDICTED: uncharacterized protein LOC103711805    194   2e-55    
gb|KHG02318.1|  hypothetical protein F383_24787                         194   2e-55    
ref|NP_001057533.1|  Os06g0328800                                       194   2e-55    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001143123.1|  uncharacterized protein LOC100275601               194   2e-55    Zea mays [maize]
ref|NP_001145321.1|  uncharacterized protein LOC100278639               194   4e-55    Zea mays [maize]
gb|EMT20191.1|  hypothetical protein F775_11280                         186   5e-55    
ref|XP_010927291.1|  PREDICTED: uncharacterized protein LOC105049368    192   2e-54    
gb|ACN33511.1|  unknown                                                 191   3e-54    Zea mays [maize]
dbj|BAK07794.1|  predicted protein                                      191   3e-54    
ref|XP_006656994.1|  PREDICTED: uncharacterized protein LOC102714566    190   5e-54    
ref|XP_010266306.1|  PREDICTED: uncharacterized protein LOC104603843    190   6e-54    
ref|XP_008782820.1|  PREDICTED: uncharacterized protein LOC103702263    190   6e-54    
ref|XP_004966964.1|  PREDICTED: uncharacterized protein LOC101757183    190   8e-54    
ref|XP_009417284.1|  PREDICTED: uncharacterized protein LOC103997703    190   1e-53    
gb|KHG18440.1|  hypothetical protein F383_21802                         189   1e-53    
ref|XP_008776506.1|  PREDICTED: uncharacterized protein LOC103696604    188   2e-53    
ref|XP_002452656.1|  hypothetical protein SORBIDRAFT_04g030080          189   3e-53    Sorghum bicolor [broomcorn]
ref|XP_010270611.1|  PREDICTED: uncharacterized protein LOC104606894    187   3e-53    
ref|XP_007028812.1|  Domain of Uncharacterized protein function (...    188   3e-53    
ref|XP_007208842.1|  hypothetical protein PRUPE_ppa025548mg             187   7e-53    
gb|EPS59182.1|  hypothetical protein M569_15627                         187   9e-53    
ref|XP_008237881.1|  PREDICTED: uncharacterized protein LOC103336601    187   1e-52    
dbj|BAJ98571.1|  predicted protein                                      188   2e-52    
ref|XP_010910409.1|  PREDICTED: uncharacterized protein LOC105036334    187   2e-52    
ref|XP_006294085.1|  hypothetical protein CARUB_v10023079mg             186   3e-52    
emb|CBI40790.3|  unnamed protein product                                184   6e-52    
ref|XP_010509864.1|  PREDICTED: uncharacterized protein LOC104786207    185   6e-52    
ref|XP_002273918.1|  PREDICTED: uncharacterized protein LOC100247851    184   1e-51    Vitis vinifera
ref|XP_002879458.1|  hypothetical protein ARALYDRAFT_902431             184   1e-51    
ref|XP_004301605.1|  PREDICTED: uncharacterized protein LOC101298030    184   1e-51    
gb|KDP36721.1|  hypothetical protein JCGZ_08012                         184   2e-51    
ref|XP_010469454.1|  PREDICTED: uncharacterized protein LOC104749510    184   2e-51    
ref|XP_010413841.1|  PREDICTED: uncharacterized protein LOC104700087    184   2e-51    
ref|XP_011041123.1|  PREDICTED: uncharacterized protein LOC105137176    183   2e-51    
emb|CAN76802.1|  hypothetical protein VITISV_000632                     184   3e-51    Vitis vinifera
emb|CDX84681.1|  BnaA03g15490D                                          182   3e-51    
ref|XP_002510749.1|  conserved hypothetical protein                     182   4e-51    Ricinus communis
emb|CDY27956.1|  BnaCnng05410D                                          180   4e-51    
ref|XP_010094491.1|  hypothetical protein L484_024782                   182   4e-51    
ref|XP_002307008.1|  hypothetical protein POPTR_0005s28030g             182   5e-51    Populus trichocarpa [western balsam poplar]
ref|XP_010666271.1|  PREDICTED: uncharacterized protein LOC104883439    182   8e-51    
emb|CDY17187.1|  BnaA05g10010D                                          181   1e-50    
ref|XP_009143843.1|  PREDICTED: uncharacterized protein LOC103867522    181   1e-50    
ref|XP_009415437.1|  PREDICTED: uncharacterized protein LOC103996273    181   1e-50    
ref|NP_565768.1|  galactan synthase 1                                   181   2e-50    Arabidopsis thaliana [mouse-ear cress]
emb|CDX79534.1|  BnaC03g18700D                                          181   2e-50    
ref|XP_009132936.1|  PREDICTED: uncharacterized protein LOC103857495    181   2e-50    
gb|EMS66628.1|  hypothetical protein TRIUR3_12773                       174   2e-50    
gb|KFK31016.1|  hypothetical protein AALP_AA6G057400                    180   4e-50    
ref|XP_010063184.1|  PREDICTED: uncharacterized protein LOC104450362    179   8e-50    
ref|XP_008799144.1|  PREDICTED: uncharacterized protein LOC103713874    179   1e-49    
ref|NP_001130404.1|  uncharacterized protein LOC100191500               179   1e-49    Zea mays [maize]
ref|XP_010932160.1|  PREDICTED: uncharacterized protein LOC105052881    179   1e-49    
ref|XP_011083362.1|  PREDICTED: uncharacterized protein LOC105165907    179   1e-49    
gb|EYU41216.1|  hypothetical protein MIMGU_mgv1a005071mg                178   3e-49    
ref|XP_003570222.1|  PREDICTED: uncharacterized protein LOC100831738    178   3e-49    
ref|XP_002437304.1|  hypothetical protein SORBIDRAFT_10g024570          177   8e-49    Sorghum bicolor [broomcorn]
ref|XP_010539085.1|  PREDICTED: uncharacterized protein LOC104813216    176   1e-48    
ref|XP_006657150.1|  PREDICTED: uncharacterized protein LOC102701737    170   4e-48    
ref|XP_006410501.1|  hypothetical protein EUTSA_v10016550mg             174   5e-48    
gb|EMT15330.1|  hypothetical protein F775_17170                         175   6e-48    
ref|XP_003563598.1|  PREDICTED: uncharacterized protein LOC100821285    174   9e-48    
ref|XP_010556045.1|  PREDICTED: uncharacterized protein LOC104825419    174   1e-47    
ref|XP_004965848.1|  PREDICTED: uncharacterized protein LOC101759875    173   1e-47    
dbj|BAK07243.1|  predicted protein                                      172   5e-47    
ref|NP_001058107.1|  Os06g0624700                                       171   5e-47    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ37686.1|  hypothetical protein OsJ_22025                          172   7e-47    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ01730.1|  hypothetical protein OsI_23756                          171   8e-47    Oryza sativa Indica Group [Indian rice]
ref|XP_009778585.1|  PREDICTED: uncharacterized protein LOC104227908    169   3e-46    
ref|XP_009595951.1|  PREDICTED: uncharacterized protein LOC104092135    168   5e-46    
ref|XP_006342202.1|  PREDICTED: uncharacterized protein LOC102591298    162   1e-43    
ref|XP_004238474.1|  PREDICTED: uncharacterized protein LOC101247215    161   1e-43    
ref|XP_002964794.1|  hypothetical protein SELMODRAFT_82649              150   2e-39    
ref|XP_002961724.1|  hypothetical protein SELMODRAFT_77156              150   3e-39    
ref|NP_191658.1|  uncharacterized protein                               140   7e-39    Arabidopsis thaliana [mouse-ear cress]
ref|NP_187394.1|  uncharacterized protein                               138   6e-38    Arabidopsis thaliana [mouse-ear cress]
ref|XP_001775945.1|  predicted protein                                  138   4e-35    
ref|XP_001777796.1|  predicted protein                                  131   1e-32    
ref|XP_001758982.1|  predicted protein                                  130   2e-32    
ref|XP_001758423.1|  predicted protein                                  115   7e-27    
ref|XP_001769268.1|  predicted protein                                  114   2e-26    
ref|XP_001759086.1|  predicted protein                                  112   6e-26    
gb|AFG70562.1|  hypothetical protein 0_12697_01                         100   2e-23    
ref|XP_001757048.1|  predicted protein                                  103   2e-22    
ref|XP_008346109.1|  PREDICTED: uncharacterized protein LOC103409067  96.7    3e-20    
ref|XP_007040981.1|  Domain of Uncharacterized protein function i...  89.7    1e-17    
gb|KHN06995.1|  hypothetical protein glysoja_042235                   87.4    3e-17    
ref|XP_001778370.1|  predicted protein                                85.9    1e-16    
ref|XP_001767951.1|  predicted protein                                81.3    5e-15    
gb|AFG56179.1|  hypothetical protein 0_17802_01                       75.1    3e-14    
ref|XP_001785941.1|  predicted protein                                77.0    3e-13    
gb|AEW08052.1|  hypothetical protein 0_17802_01                       70.5    1e-12    
ref|XP_006435485.1|  hypothetical protein CICLE_v10003494mg           72.0    2e-12    
ref|XP_001777720.1|  predicted protein                                67.0    1e-09    



>emb|CDP04103.1| unnamed protein product [Coffea canephora]
Length=208

 Score =   307 bits (787),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 143/170 (84%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            AKWMFFFDVDEF+FVPKKSTLK+V+DS S Y+QFTIEQMPMSNKLCL ED GK++RKWGF
Sbjct  39   AKWMFFFDVDEFLFVPKKSTLKTVMDSFSEYTQFTIEQMPMSNKLCLAEDAGKSYRKWGF  98

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLVYKDVKRGIRRDRKY VQPRNVFATGVHMSQNTVGKTTHKTEG+IMYFHYHGTIA+R
Sbjct  99   EKLVYKDVKRGIRRDRKYVVQPRNVFATGVHMSQNTVGKTTHKTEGRIMYFHYHGTIADR  158

Query  232  REPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            REPCR+ VNTT +T+DGIPY LDT+MR  AG VKRFELK IG  LQ+TRQ
Sbjct  159  REPCRRSVNTTDITIDGIPYSLDTSMRIVAGFVKRFELKMIGSVLQRTRQ  208



>ref|XP_009593251.1| PREDICTED: uncharacterized protein LOC104089939 [Nicotiana tomentosiformis]
Length=499

 Score =   312 bits (800),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 158/171 (92%), Gaps = 0/171 (0%)
 Frame = -2

Query  595  QAKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWG  416
            QAKWMFFFDVDEFIFVPKKST+KSV+DSL+ Y+QFTIEQMPMSNKLCL ED GK++RKWG
Sbjct  329  QAKWMFFFDVDEFIFVPKKSTIKSVVDSLADYTQFTIEQMPMSNKLCLSEDRGKSYRKWG  388

Query  415  FEKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAE  236
            FEKLVYKDVKRGIRRDRKYAVQPRNV ATGVHMSQNTVGKTTHKTEG+I YFHYHGTIAE
Sbjct  389  FEKLVYKDVKRGIRRDRKYAVQPRNVIATGVHMSQNTVGKTTHKTEGRIKYFHYHGTIAE  448

Query  235  RREPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            RREPCR+LVN TS+TVDG PY++DTTMRD A  VKRFELK IG  LQ+TRQ
Sbjct  449  RREPCRQLVNATSITVDGTPYIVDTTMRDIAATVKRFELKMIGSTLQRTRQ  499



>ref|XP_009757234.1| PREDICTED: uncharacterized protein LOC104210124 [Nicotiana sylvestris]
Length=499

 Score =   311 bits (798),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 158/171 (92%), Gaps = 0/171 (0%)
 Frame = -2

Query  595  QAKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWG  416
            QAKWMFFFDVDEFIFVPKKST+KSV+DSLS Y+QFTIEQMPMSNKLCL ED GK++RKWG
Sbjct  329  QAKWMFFFDVDEFIFVPKKSTIKSVVDSLSDYTQFTIEQMPMSNKLCLSEDRGKSYRKWG  388

Query  415  FEKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAE  236
            FEKLVYKDVKRGIRRDRKYAVQPRNV ATGVHMSQNTVGKTTHKTEG+I YFHYHGTIAE
Sbjct  389  FEKLVYKDVKRGIRRDRKYAVQPRNVIATGVHMSQNTVGKTTHKTEGRIKYFHYHGTIAE  448

Query  235  RREPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            RREPCR+LVN TS+TV+G PY++DTTMRD A  VKRFELK IG  LQ+TRQ
Sbjct  449  RREPCRQLVNATSITVEGTPYIVDTTMRDIAATVKRFELKMIGSTLQRTRQ  499



>ref|XP_004248407.1| PREDICTED: uncharacterized protein LOC101259294 [Solanum lycopersicum]
Length=480

 Score =   309 bits (792),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 157/171 (92%), Gaps = 0/171 (0%)
 Frame = -2

Query  595  QAKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWG  416
            QAKWMFFFDVDEFIFVPKKST+KSV+DSLS Y+QFTIEQMPMSNKLCL ED GK++RKWG
Sbjct  310  QAKWMFFFDVDEFIFVPKKSTIKSVVDSLSDYTQFTIEQMPMSNKLCLEEDRGKSYRKWG  369

Query  415  FEKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAE  236
            FEKLVYKDVKRGIRRDRKYAVQPRNV ATGVHMSQNTVGKTTHKTEG+I YFHYHGTIAE
Sbjct  370  FEKLVYKDVKRGIRRDRKYAVQPRNVIATGVHMSQNTVGKTTHKTEGRIKYFHYHGTIAE  429

Query  235  RREPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
             REPCR+LVN T++TVD IPY +D+TMRD AG VKRFELK IG  LQKTRQ
Sbjct  430  HREPCRQLVNATTITVDQIPYEVDSTMRDIAGTVKRFELKMIGSTLQKTRQ  480



>ref|XP_006352613.1| PREDICTED: uncharacterized protein LOC102598072 [Solanum tuberosum]
Length=503

 Score =   307 bits (787),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 145/171 (85%), Positives = 156/171 (91%), Gaps = 0/171 (0%)
 Frame = -2

Query  595  QAKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWG  416
            QAKWMFFFDVDEFIFVPKKST+KSV++SLS Y+QFTIEQMPMSNKLCL ED GK++RKWG
Sbjct  333  QAKWMFFFDVDEFIFVPKKSTIKSVVNSLSDYTQFTIEQMPMSNKLCLEEDRGKSYRKWG  392

Query  415  FEKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAE  236
            FEKLVYKDVKRGIRRDRKYAVQPRNV ATGVHMSQNTVGKTTHKTEG+I YFHYHGTIAE
Sbjct  393  FEKLVYKDVKRGIRRDRKYAVQPRNVIATGVHMSQNTVGKTTHKTEGRIKYFHYHGTIAE  452

Query  235  RREPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
             REPCR+LVN T++TVD  PY +DTTMRD AG VKRFELK IG  LQKTRQ
Sbjct  453  HREPCRQLVNATTITVDQTPYEVDTTMRDIAGTVKRFELKMIGSTLQKTRQ  503



>ref|XP_009604702.1| PREDICTED: uncharacterized protein LOC104099425 [Nicotiana tomentosiformis]
 ref|XP_009604703.1| PREDICTED: uncharacterized protein LOC104099425 [Nicotiana tomentosiformis]
Length=498

 Score =   306 bits (785),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 143/171 (84%), Positives = 156/171 (91%), Gaps = 0/171 (0%)
 Frame = -2

Query  595  QAKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWG  416
            QAKWMFFFDVDEFIFVPKKST+K+V+DSLS ++QFTIEQMPMSNKLCL ED GK++RKWG
Sbjct  328  QAKWMFFFDVDEFIFVPKKSTIKTVVDSLSDFTQFTIEQMPMSNKLCLEEDRGKSYRKWG  387

Query  415  FEKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAE  236
            FEKLVYKD+KRGIRRDRKYAVQPRNV ATGVHMSQN VGKTTHKTEG I YFHYHGTIAE
Sbjct  388  FEKLVYKDIKRGIRRDRKYAVQPRNVIATGVHMSQNIVGKTTHKTEGLIKYFHYHGTIAE  447

Query  235  RREPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            RREPCR+LVN T++TVD  PY +DTTMRD AG VKRFELK IGP LQ+TRQ
Sbjct  448  RREPCRQLVNATAITVDRTPYAVDTTMRDIAGIVKRFELKMIGPVLQRTRQ  498



>ref|XP_010260816.1| PREDICTED: uncharacterized protein LOC104599797 [Nelumbo nucifera]
Length=495

 Score =   306 bits (783),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 142/170 (84%), Positives = 158/170 (93%), Gaps = 0/170 (0%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            AKWMFFFDVDE+++VP KST+KSVLDSLS Y+QFTIEQMPMSNKLCL ED GKT+RKWGF
Sbjct  326  AKWMFFFDVDEYVYVPPKSTIKSVLDSLSDYTQFTIEQMPMSNKLCLAEDAGKTYRKWGF  385

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLV+KDVK+GIRRDRKYAVQPRNVFATGVHMSQN  GKTTHKTEG+I YFHYHGTIA+R
Sbjct  386  EKLVFKDVKKGIRRDRKYAVQPRNVFATGVHMSQNVAGKTTHKTEGRIKYFHYHGTIADR  445

Query  232  REPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            REPCR+LVN T LTV+GIPY LD+T+RDAA +VKRFELKTIG RLQ+TRQ
Sbjct  446  REPCRQLVNVTHLTVEGIPYELDSTLRDAAQSVKRFELKTIGSRLQRTRQ  495



>ref|XP_009788642.1| PREDICTED: uncharacterized protein LOC104236423 [Nicotiana sylvestris]
Length=496

 Score =   304 bits (779),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 155/171 (91%), Gaps = 0/171 (0%)
 Frame = -2

Query  595  QAKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWG  416
            QAKWMFFFDVDEFIFVPKKST+KSV+DSLS ++QFTIEQMPMSNKLCL ED GK++RKWG
Sbjct  326  QAKWMFFFDVDEFIFVPKKSTIKSVVDSLSDFTQFTIEQMPMSNKLCLEEDRGKSYRKWG  385

Query  415  FEKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAE  236
            FEKLVYKD+KRGIRRDRKYAVQPRNV ATGVHMSQN VGKTTHKTEG+I YFHYHGTIAE
Sbjct  386  FEKLVYKDIKRGIRRDRKYAVQPRNVIATGVHMSQNIVGKTTHKTEGRIKYFHYHGTIAE  445

Query  235  RREPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            RREPCR+LVN T++TVD  PY +D TMRD AG VKRFELK IG  LQ+TRQ
Sbjct  446  RREPCRQLVNATAITVDRTPYAVDATMRDIAGTVKRFELKMIGSVLQRTRQ  496



>ref|XP_004232603.1| PREDICTED: uncharacterized protein LOC101245716 [Solanum lycopersicum]
Length=510

 Score =   304 bits (778),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 156/171 (91%), Gaps = 0/171 (0%)
 Frame = -2

Query  595  QAKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWG  416
            QAKWMFFFDVDE+I+VPKKST+KSV++SLS Y+QFTIEQMPMSNKLCL ED GK++RKWG
Sbjct  340  QAKWMFFFDVDEYIYVPKKSTIKSVVNSLSDYTQFTIEQMPMSNKLCLEEDRGKSYRKWG  399

Query  415  FEKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAE  236
            FEKLVYKDVK GIRRDRKYAVQPRNV A GVHMSQNTVGKTTHKTEG+I YFHYHGTIAE
Sbjct  400  FEKLVYKDVKTGIRRDRKYAVQPRNVIANGVHMSQNTVGKTTHKTEGRIKYFHYHGTIAE  459

Query  235  RREPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
             REPCR+LVNTT++TVDGIPY +DTTMRD A  VKRFELK IG  LQ+TRQ
Sbjct  460  HREPCRQLVNTTAITVDGIPYNVDTTMRDVAATVKRFELKMIGTTLQRTRQ  510



>ref|XP_007211819.1| hypothetical protein PRUPE_ppa004238mg [Prunus persica]
 gb|EMJ13018.1| hypothetical protein PRUPE_ppa004238mg [Prunus persica]
Length=521

 Score =   303 bits (777),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            AKWMFFFDVDE+I++P KS +KSVLDSLS Y+QFTIEQMPMSNKLCL  D+GKT+RKWGF
Sbjct  352  AKWMFFFDVDEYIYMPPKSNIKSVLDSLSDYTQFTIEQMPMSNKLCLSSDYGKTYRKWGF  411

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLVYKDVKRGIRRDRKYAVQPRNV+ATGVHMSQN  GKTTHKTE +I YFHYHGTIA R
Sbjct  412  EKLVYKDVKRGIRRDRKYAVQPRNVYATGVHMSQNVAGKTTHKTENRIKYFHYHGTIANR  471

Query  232  REPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            REPCR+LVN+T   VD IPYV+DTTMRD AG+VKRFEL+ IG RLQKTRQ
Sbjct  472  REPCRQLVNSTETNVDKIPYVMDTTMRDVAGSVKRFELRMIGNRLQKTRQ  521



>ref|XP_006364820.1| PREDICTED: uncharacterized protein LOC102595515 [Solanum tuberosum]
Length=512

 Score =   303 bits (775),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 155/171 (91%), Gaps = 0/171 (0%)
 Frame = -2

Query  595  QAKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWG  416
            QAKWMFFFDVDE+IFVPKKST+KSV+ SLS ++QFTIEQMPMSNKLCL ED GK++RKWG
Sbjct  342  QAKWMFFFDVDEYIFVPKKSTIKSVVKSLSDFTQFTIEQMPMSNKLCLEEDRGKSYRKWG  401

Query  415  FEKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAE  236
            FEKLVYKDVK GIRRDRKYAVQPRNV A GVHMSQNTVGKTTHKTEG+I YFHYHGTIAE
Sbjct  402  FEKLVYKDVKTGIRRDRKYAVQPRNVIANGVHMSQNTVGKTTHKTEGRIKYFHYHGTIAE  461

Query  235  RREPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
             REPCR+LVNTT++TVDGIPY +DTTMRD A  VKRFELK IG  LQ+TRQ
Sbjct  462  HREPCRQLVNTTAITVDGIPYNVDTTMRDVAATVKRFELKMIGTTLQRTRQ  512



>gb|KHN26585.1| hypothetical protein glysoja_019824 [Glycine soja]
Length=209

 Score =   291 bits (744),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 134/171 (78%), Positives = 153/171 (89%), Gaps = 1/171 (1%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            AKWMFFFDVDE+I+VP KST+KSVLDSLS YSQFTIEQMPMS+KLCL  D+GKT+RKWGF
Sbjct  39   AKWMFFFDVDEYIYVPPKSTIKSVLDSLSEYSQFTIEQMPMSSKLCLTSDYGKTYRKWGF  98

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLVYKD K+GIRRDRKYAVQPR+++ATGVHMSQN  GKTTHKTEG+IMY+HYHGTIAE+
Sbjct  99   EKLVYKDSKKGIRRDRKYAVQPRSLYATGVHMSQNLAGKTTHKTEGKIMYYHYHGTIAEK  158

Query  232  REPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQ-KTRQ  83
            RE C+ L+N+T +T D  PYVLDTTMRD AG +K+FELK IG RLQ KTRQ
Sbjct  159  RESCKMLINSTEITYDKTPYVLDTTMRDIAGVIKKFELKMIGDRLQHKTRQ  209



>emb|CBI27377.3| unnamed protein product [Vitis vinifera]
Length=208

 Score =   289 bits (740),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            AKWMFFFDVDE+I+VP K+T+KSVL+SLSGY+QFTIEQMP+SNKLCL  D GK  RKWGF
Sbjct  39   AKWMFFFDVDEYIYVPPKNTIKSVLNSLSGYTQFTIEQMPISNKLCLSSDAGKAPRKWGF  98

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLVY+DVKRGIRRDRKYAVQPRNVFATGVH+SQN  GKTTHKT+  + YFHYHGT+AER
Sbjct  99   EKLVYRDVKRGIRRDRKYAVQPRNVFATGVHLSQNLAGKTTHKTDHLVKYFHYHGTVAER  158

Query  232  REPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            REPCRK+VNTT LT DG PYV+DTTMR  AG+VK FELK IG RLQ+T Q
Sbjct  159  REPCRKMVNTTELTFDGTPYVMDTTMRAVAGSVKIFELKAIGSRLQRTPQ  208



>ref|XP_008356149.1| PREDICTED: uncharacterized protein LOC103419837, partial [Malus 
domestica]
Length=222

 Score =   290 bits (741),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            AKWMFFFDVDE+I++P KS LKSVLDSLS Y+QFTIEQMPMS+KLCL ED+ KT+RKWGF
Sbjct  53   AKWMFFFDVDEYIYMPPKSNLKSVLDSLSDYTQFTIEQMPMSSKLCLLEDYHKTYRKWGF  112

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLVYKDVKRGIRRDRKYAVQPRNV+ATGVHMSQN  GKTTHKTE +I YFHYHGTIA R
Sbjct  113  EKLVYKDVKRGIRRDRKYAVQPRNVYATGVHMSQNVAGKTTHKTESRIQYFHYHGTIATR  172

Query  232  REPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
             EPCR+L+NTT + VD +PY +DTT+R  AG+VK+FEL+ IG RLQ TRQ
Sbjct  173  GEPCRRLINTTEIYVDKVPYAVDTTLRSVAGSVKKFELRMIGSRLQNTRQ  222



>ref|XP_008225942.1| PREDICTED: uncharacterized protein LOC103325540 [Prunus mume]
Length=520

 Score =   299 bits (765),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/170 (81%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            AKWMFFFDVDE+I++P KS +KSVLDSLS Y+QFTIEQMPMSNKLCL  D+ KT+RKWGF
Sbjct  351  AKWMFFFDVDEYIYMPPKSNIKSVLDSLSDYTQFTIEQMPMSNKLCLSADYRKTYRKWGF  410

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLVYKDVKRGIRRDRKYAVQPRNV+ATGVHMSQN  GKTTHKTE +I YFHYHGTIA R
Sbjct  411  EKLVYKDVKRGIRRDRKYAVQPRNVYATGVHMSQNVAGKTTHKTENRIKYFHYHGTIANR  470

Query  232  REPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            REPCR+LVN T   VD IPYV+DTTMRD AG+VKRFEL+ IG RLQKTRQ
Sbjct  471  REPCRQLVNATETNVDKIPYVMDTTMRDVAGSVKRFELRMIGNRLQKTRQ  520



>gb|ABK94817.1| unknown [Populus trichocarpa]
Length=272

 Score =   290 bits (742),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 152/170 (89%), Gaps = 0/170 (0%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            AKWMFFFDVDE+I++P K+T+KSVLDSLSGY+QFT EQMPMS+KLCL  D+G+ +RKWG 
Sbjct  103  AKWMFFFDVDEYIYLPPKNTIKSVLDSLSGYTQFTFEQMPMSSKLCLSADYGRYYRKWGI  162

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLVY+DVKRGIRRDRKYA+QPRNVFATGVHMSQN  GKTT+KTEG+I YFHYHGTIA+R
Sbjct  163  EKLVYRDVKRGIRRDRKYAIQPRNVFATGVHMSQNFAGKTTYKTEGKIKYFHYHGTIAQR  222

Query  232  REPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            REPCR L+N T +  + +PYVLDTTMRD A +VK+FELKTIGP+LQ TRQ
Sbjct  223  REPCRNLLNVTEINFENVPYVLDTTMRDLAWSVKKFELKTIGPKLQNTRQ  272



>ref|XP_007138875.1| hypothetical protein PHAVU_009G244900g [Phaseolus vulgaris]
 gb|ESW10869.1| hypothetical protein PHAVU_009G244900g [Phaseolus vulgaris]
Length=514

 Score =   297 bits (760),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 152/169 (90%), Gaps = 0/169 (0%)
 Frame = -2

Query  589  KWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGFE  410
            KWMFFFDVDE+IFVP KST+KSVLDSLS YSQFTIEQMPMS+KLCL  D+GKT+RKWGFE
Sbjct  346  KWMFFFDVDEYIFVPPKSTIKSVLDSLSEYSQFTIEQMPMSSKLCLTSDYGKTYRKWGFE  405

Query  409  KLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAERR  230
            KLVYKD K+GIRRDRKYAVQPR++FATGVHMSQN  GKTTHKTEG+IMY+HYHGTIAERR
Sbjct  406  KLVYKDSKKGIRRDRKYAVQPRSLFATGVHMSQNLAGKTTHKTEGKIMYYHYHGTIAERR  465

Query  229  EPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            E C+ L+N+T +T D  PYVLDTTMRD AG +K+FELK IG RLQKTRQ
Sbjct  466  ESCKMLINSTEITYDKTPYVLDTTMRDIAGVIKKFELKMIGNRLQKTRQ  514



>ref|XP_004293801.1| PREDICTED: uncharacterized protein LOC101301656 [Fragaria vesca 
subsp. vesca]
Length=512

 Score =   296 bits (758),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            AKWMFFFDVDE+I++P KST+K+VLDSL+ YSQFTIEQMPMSNKLCL ED+ KT RKWGF
Sbjct  343  AKWMFFFDVDEYIYMPPKSTIKTVLDSLAEYSQFTIEQMPMSNKLCLLEDYHKTNRKWGF  402

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLVYKDVKRGIRRDRKYAVQPRNV+ TGVHMSQN  GKTTHKTE +I YFHYHGTIA+R
Sbjct  403  EKLVYKDVKRGIRRDRKYAVQPRNVYGTGVHMSQNIAGKTTHKTENRIKYFHYHGTIADR  462

Query  232  REPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            REPC+KL+N T + +D +PYV+DTTMRD AGAVKRFEL+ IG RLQ+TRQ
Sbjct  463  REPCKKLINDTQIYLDKVPYVIDTTMRDVAGAVKRFELRMIGSRLQQTRQ  512



>gb|AGV54873.1| hypothetical protein [Phaseolus vulgaris]
Length=514

 Score =   296 bits (758),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 152/169 (90%), Gaps = 0/169 (0%)
 Frame = -2

Query  589  KWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGFE  410
            KWMFFFDVDE+IFVP KST+KSVLDSLS YSQFTIEQMPMS+KLCL  D+GKT+RKWGFE
Sbjct  346  KWMFFFDVDEYIFVPPKSTIKSVLDSLSEYSQFTIEQMPMSSKLCLTSDYGKTYRKWGFE  405

Query  409  KLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAERR  230
            KLVYKD K+GIRRDRKYAVQPR++FATGVHMSQN  GKTTHKTEG+IMY+HYHGTIAERR
Sbjct  406  KLVYKDSKKGIRRDRKYAVQPRSLFATGVHMSQNLAGKTTHKTEGKIMYYHYHGTIAERR  465

Query  229  EPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            E C+ L+N+T +T D  PYVLDTTMRD AG +K+FELK IG RLQKTRQ
Sbjct  466  ESCKMLINSTEITYDKTPYVLDTTMRDIAGVIKKFELKMIGNRLQKTRQ  514



>ref|XP_002303721.1| hypothetical protein POPTR_0003s15530g [Populus trichocarpa]
 gb|EEE78700.1| hypothetical protein POPTR_0003s15530g [Populus trichocarpa]
Length=387

 Score =   290 bits (741),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 152/170 (89%), Gaps = 0/170 (0%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            AKWMFFFDVDE+I++P K+T+KSVLDSLSGY+QFT EQMPMS+KLCL  D+G+ +RKWG 
Sbjct  218  AKWMFFFDVDEYIYLPPKNTIKSVLDSLSGYTQFTFEQMPMSSKLCLSADYGRYYRKWGI  277

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLVY+DVKRGIRRDRKYA+QPRNVFATGVHMSQN  GKTT+KTEG+I YFHYHGTIA+R
Sbjct  278  EKLVYRDVKRGIRRDRKYAIQPRNVFATGVHMSQNFAGKTTYKTEGKIKYFHYHGTIAQR  337

Query  232  REPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            REPCR L+N T +  + +PYVLDTTMRD A +VK+FELKTIGP+LQ TRQ
Sbjct  338  REPCRNLLNVTEINFENVPYVLDTTMRDLAWSVKKFELKTIGPKLQNTRQ  387



>ref|XP_009368565.1| PREDICTED: uncharacterized protein LOC103958069 [Pyrus x bretschneideri]
Length=520

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 152/170 (89%), Gaps = 0/170 (0%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            AKWMFFFDVDE+I++P KS +KSVLDSLS Y+QFTIEQMPMSNKLCL ED+ KT+RKWGF
Sbjct  351  AKWMFFFDVDEYIYMPPKSNIKSVLDSLSDYTQFTIEQMPMSNKLCLFEDYRKTYRKWGF  410

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLVYKDVKRGIRRDRKYAVQPRNV+ATGVHMSQN  GKTTHKTE +I YFHYHGTIA R
Sbjct  411  EKLVYKDVKRGIRRDRKYAVQPRNVYATGVHMSQNVAGKTTHKTERRIKYFHYHGTIATR  470

Query  232  REPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            REPCR+L+NTT   VD IPYV+DTTMR  AG+VK+FEL+ IG RLQKTRQ
Sbjct  471  REPCRQLINTTETNVDQIPYVVDTTMRMVAGSVKKFELRMIGDRLQKTRQ  520



>gb|EYU43615.1| hypothetical protein MIMGU_mgv1a004537mg [Erythranthe guttata]
Length=522

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            AKW+FFFDVDEFIFVPKKS + S+LDSLS ++QFT EQMPMSNKLCL +D    FRKWGF
Sbjct  353  AKWLFFFDVDEFIFVPKKSNINSILDSLSSFTQFTFEQMPMSNKLCLSQDAPTAFRKWGF  412

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLVYKDVKRGIR+DRKYAVQPR+VFATGVHMSQN VGKTTH T+G+I YFHYHGTIAER
Sbjct  413  EKLVYKDVKRGIRKDRKYAVQPRSVFATGVHMSQNIVGKTTHNTDGRIKYFHYHGTIAER  472

Query  232  REPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            REPCR+ +N+T +TVD IPYV+DTTMRD AGAVKRFELK IG  LQ+TRQ
Sbjct  473  REPCRQFINSTEITVDTIPYVMDTTMRDIAGAVKRFELKMIGSALQRTRQ  522



>ref|XP_008383246.1| PREDICTED: uncharacterized protein LOC103445969 [Malus domestica]
Length=525

 Score =   293 bits (750),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            AKWMFFFDVDE+I++P KS +KSVLDSLS Y+QFTIEQMPMSNKLCL ED+ KT+RKWGF
Sbjct  356  AKWMFFFDVDEYIYMPPKSNIKSVLDSLSDYTQFTIEQMPMSNKLCLFEDYRKTYRKWGF  415

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLVYKDVKRGIRRDRKYAVQPRNV+ATGVHMSQN  GKTTHKTE +I YFHYHGTIA R
Sbjct  416  EKLVYKDVKRGIRRDRKYAVQPRNVYATGVHMSQNVAGKTTHKTERRIKYFHYHGTIATR  475

Query  232  REPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            REPCR+L+N T   VD IPYV+DTTMR  AG+VK+FEL+ IG RLQKTRQ
Sbjct  476  REPCRQLINATQTNVDQIPYVVDTTMRTVAGSVKKFELRMIGDRLQKTRQ  525



>ref|XP_011096871.1| PREDICTED: uncharacterized protein LOC105175921 [Sesamum indicum]
Length=481

 Score =   290 bits (742),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            AKW+FFFDVDEFIFVPKK+T+ S+LDSL+ ++QFTIEQMPMSNKLC  +D    FRKWGF
Sbjct  312  AKWIFFFDVDEFIFVPKKTTINSILDSLTEFTQFTIEQMPMSNKLCFSQDAPTAFRKWGF  371

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLVYKDVKRGIRRDRKYAVQP +VFATGVHMSQN VGKTTHKTEG+I YFHYHGTIA R
Sbjct  372  EKLVYKDVKRGIRRDRKYAVQPLSVFATGVHMSQNIVGKTTHKTEGRIKYFHYHGTIAMR  431

Query  232  REPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            REPC++ +N+T  TVDG PY++DTTMRD AGAVKRFELK IG RLQ+TRQ
Sbjct  432  REPCQQFLNSTETTVDGTPYIVDTTMRDIAGAVKRFELKMIGSRLQRTRQ  481



>ref|XP_002263686.1| PREDICTED: uncharacterized protein LOC100251363 [Vitis vinifera]
Length=526

 Score =   290 bits (742),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            AKWMFFFDVDE+I+VP K+T+KSVL+SLSGY+QFTIEQMP+SNKLCL  D GK  RKWGF
Sbjct  357  AKWMFFFDVDEYIYVPPKNTIKSVLNSLSGYTQFTIEQMPISNKLCLSSDAGKAPRKWGF  416

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLVY+DVKRGIRRDRKYAVQPRNVFATGVH+SQN  GKTTHKT+  + YFHYHGT+AER
Sbjct  417  EKLVYRDVKRGIRRDRKYAVQPRNVFATGVHLSQNLAGKTTHKTDHLVKYFHYHGTVAER  476

Query  232  REPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            REPCRK+VNTT LT DG PYV+DTTMR  AG+VK FELK IG RLQ+T Q
Sbjct  477  REPCRKMVNTTELTFDGTPYVMDTTMRAVAGSVKIFELKAIGSRLQRTPQ  526



>ref|XP_008364236.1| PREDICTED: uncharacterized protein LOC103427929 [Malus domestica]
Length=522

 Score =   289 bits (740),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            AKWMFFFDVDE+I++P KS LKSVLDSLS Y+QFTIEQMPMS+KLCL ED+ KT+RKWGF
Sbjct  353  AKWMFFFDVDEYIYMPPKSNLKSVLDSLSDYTQFTIEQMPMSSKLCLLEDYHKTYRKWGF  412

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLVYKDVKRGIRRDRKYAVQPRNV+ATGVHMSQN  GKTTHKTE +I YFHYHGTIA R
Sbjct  413  EKLVYKDVKRGIRRDRKYAVQPRNVYATGVHMSQNVAGKTTHKTESRIQYFHYHGTIATR  472

Query  232  REPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
             EPCR+L+NTT + VD +PY +DTT+R  AG+VK+FEL+ IG RLQ TRQ
Sbjct  473  GEPCRRLINTTEIYVDKVPYAVDTTLRSVAGSVKKFELRMIGSRLQNTRQ  522



>ref|XP_003534854.1| PREDICTED: uncharacterized protein LOC100795606 [Glycine max]
Length=527

 Score =   289 bits (740),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 134/171 (78%), Positives = 153/171 (89%), Gaps = 1/171 (1%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            AKWMFFFDVDE+I+VP KST+KSVLDSLS YSQFTIEQMPMS+KLCL  D+GKT+RKWGF
Sbjct  357  AKWMFFFDVDEYIYVPPKSTIKSVLDSLSEYSQFTIEQMPMSSKLCLTSDYGKTYRKWGF  416

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLVYKD K+GIRRDRKYAVQPR+++ATGVHMSQN  GKTTHKTEG+IMY+HYHGTIAE+
Sbjct  417  EKLVYKDSKKGIRRDRKYAVQPRSLYATGVHMSQNLAGKTTHKTEGKIMYYHYHGTIAEK  476

Query  232  REPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQ-KTRQ  83
            RE C+ L+N+T +T D  PYVLDTTMRD AG +K+FELK IG RLQ KTRQ
Sbjct  477  RESCKMLINSTEITYDKTPYVLDTTMRDIAGVIKKFELKMIGDRLQHKTRQ  527



>ref|XP_007040980.1| Domain of Uncharacterized protein function (DUF23) isoform 1 
[Theobroma cacao]
 gb|EOX96811.1| Domain of Uncharacterized protein function (DUF23) isoform 1 
[Theobroma cacao]
Length=516

 Score =   289 bits (739),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 149/170 (88%), Gaps = 0/170 (0%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            AKW+FFFDVDEFI+VP KST++SVLDSLS YSQFTIEQMPMS+KLC   D  K  RKWGF
Sbjct  347  AKWIFFFDVDEFIYVPPKSTIRSVLDSLSDYSQFTIEQMPMSSKLCHTVDAAKRNRKWGF  406

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLVY+DVK+GIRRDRKYA+QPRNVFATGVHMSQN  GKTTHKTEG+I YFHYHGTIAER
Sbjct  407  EKLVYRDVKKGIRRDRKYAIQPRNVFATGVHMSQNLAGKTTHKTEGRIKYFHYHGTIAER  466

Query  232  REPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            REPCR L+N+T +  +  PYVLDTT+RD AGAVK+FELK IGPRLQ TRQ
Sbjct  467  REPCRYLINSTEINYEKTPYVLDTTLRDVAGAVKKFELKMIGPRLQNTRQ  516



>ref|XP_010094640.1| hypothetical protein L484_009885 [Morus notabilis]
 gb|EXB56459.1| hypothetical protein L484_009885 [Morus notabilis]
Length=524

 Score =   289 bits (739),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            AKWMFFFDVDEFI+VP+K+T+KSVLDSLS YSQFTIEQMPMS KLCL +D GKT+RKWGF
Sbjct  355  AKWMFFFDVDEFIYVPRKNTIKSVLDSLSEYSQFTIEQMPMSCKLCLSDDAGKTYRKWGF  414

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLVY+DVKRGIRRDRKY VQPR+V+A GVHMSQN  GKTTHKTEG+IMYFHYHGTIA+R
Sbjct  415  EKLVYRDVKRGIRRDRKYVVQPRSVYAAGVHMSQNLAGKTTHKTEGRIMYFHYHGTIAQR  474

Query  232  REPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            REPCR L N T  T +  PYVLDTTMR+ AG VK+FELK IG RLQKTRQ
Sbjct  475  REPCRNLGNWTETTFENNPYVLDTTMRNIAGFVKKFELKMIGSRLQKTRQ  524



>ref|XP_003546382.1| PREDICTED: uncharacterized protein LOC100787815 [Glycine max]
Length=515

 Score =   288 bits (738),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 153/171 (89%), Gaps = 1/171 (1%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            AKWMFFFDVDE+I+VP KST+KSVLDSLS YSQFTIEQMPMS+KLCL  D+GKT+RKWGF
Sbjct  345  AKWMFFFDVDEYIYVPPKSTIKSVLDSLSEYSQFTIEQMPMSSKLCLTADYGKTYRKWGF  404

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLVYKD K+GIRRDRKYAVQPR+++ATGVHMSQN  GKTTHKTEG+IMY+HYHGTIAE+
Sbjct  405  EKLVYKDSKKGIRRDRKYAVQPRSLYATGVHMSQNLAGKTTHKTEGKIMYYHYHGTIAEK  464

Query  232  REPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRL-QKTRQ  83
            RE C+ L+N+T +T D  PYVLDTTMRD AG +K+FELK IG R+ QKTRQ
Sbjct  465  RESCKMLINSTEITYDKTPYVLDTTMRDIAGVIKKFELKMIGDRVQQKTRQ  515



>ref|XP_011008216.1| PREDICTED: uncharacterized protein LOC105113657 [Populus euphratica]
Length=515

 Score =   286 bits (731),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = -2

Query  589  KWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGFE  410
            KWMFFFDVDE+I VP+K+T+KSVLDSLS Y+QFTIEQMPM+NKLCL  D+G+ +RKWGFE
Sbjct  347  KWMFFFDVDEYIHVPQKNTIKSVLDSLSDYTQFTIEQMPMNNKLCLSADYGRYYRKWGFE  406

Query  409  KLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAERR  230
            KLVYKDVKRGIRRDRKYA+QPRNVFATGVHMSQN  GKTTHKTEG I YFHYHGTIA+RR
Sbjct  407  KLVYKDVKRGIRRDRKYAIQPRNVFATGVHMSQNVAGKTTHKTEGMIRYFHYHGTIAQRR  466

Query  229  EPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            EPCR L+N T +  +  PYVLDTTMRD A +VK+FE + IGP+L+ TRQ
Sbjct  467  EPCRNLLNVTEINFENNPYVLDTTMRDLAWSVKKFENQMIGPKLKNTRQ  515



>ref|XP_002299381.2| hypothetical protein POPTR_0001s12330g [Populus trichocarpa]
 gb|EEE84186.2| hypothetical protein POPTR_0001s12330g [Populus trichocarpa]
Length=515

 Score =   285 bits (728),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 129/170 (76%), Positives = 148/170 (87%), Gaps = 0/170 (0%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            AKWMFFFDVDE+I VP+K+T+KSVLDSLS Y+QFTIEQMPM+NKLCL  D+G+ +RKWGF
Sbjct  346  AKWMFFFDVDEYIHVPQKNTIKSVLDSLSDYTQFTIEQMPMNNKLCLSADYGRYYRKWGF  405

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLVYKDVKRGIRRDRKYA+QPRNVFATGVHMSQN  GKTTHKTEG I YFHYHGT A+R
Sbjct  406  EKLVYKDVKRGIRRDRKYAIQPRNVFATGVHMSQNVAGKTTHKTEGMIRYFHYHGTAAQR  465

Query  232  REPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            REPCR L+N T +  +  PYVLDTTMRD A +VK+FE + IGP+L+ TRQ
Sbjct  466  REPCRNLLNVTEINFENNPYVLDTTMRDLAWSVKKFENQMIGPKLKNTRQ  515



>ref|XP_009363281.1| PREDICTED: uncharacterized protein LOC103953269 [Pyrus x bretschneideri]
Length=526

 Score =   285 bits (729),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 148/170 (87%), Gaps = 0/170 (0%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            AKWMFFFDVDE+I++P KS LKSVLDSLS Y+QFTIEQMPMS+KLCL ED+ KT+RKWGF
Sbjct  357  AKWMFFFDVDEYIYMPPKSNLKSVLDSLSDYTQFTIEQMPMSSKLCLLEDYHKTYRKWGF  416

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLVYKDVKRGIRRDRKYAVQPRNV+ATGVHMSQN  GKTTHKTE +I YFHYHGTIA R
Sbjct  417  EKLVYKDVKRGIRRDRKYAVQPRNVYATGVHMSQNVAGKTTHKTESRIQYFHYHGTIATR  476

Query  232  REPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
              PCR+L+N T + VD +PY +DTT+R  AG+VK+FEL+ IG RLQ TRQ
Sbjct  477  GGPCRRLINATEIYVDKVPYAVDTTLRSVAGSVKKFELRMIGSRLQNTRQ  526



>ref|XP_010058074.1| PREDICTED: uncharacterized protein LOC104445843 [Eucalyptus grandis]
Length=508

 Score =   283 bits (725),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/171 (79%), Positives = 149/171 (87%), Gaps = 2/171 (1%)
 Frame = -2

Query  589  KWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFG--KTFRKWG  416
            KWMFFFDVDEFI+VP K+TL+SVLDSLS YSQ TIEQMPMSNKLC  ++ G  +T+RKWG
Sbjct  338  KWMFFFDVDEFIYVPPKNTLRSVLDSLSEYSQITIEQMPMSNKLCFVDEAGAGRTYRKWG  397

Query  415  FEKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAE  236
            FEKLVYKDVKRGIRRDRKYAVQPR V+ATGVHMSQN  G+T HKTE +I YFHYHGTIAE
Sbjct  398  FEKLVYKDVKRGIRRDRKYAVQPRAVYATGVHMSQNLKGRTNHKTERRIKYFHYHGTIAE  457

Query  235  RREPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            RREPCR LVN+T +T D +PYVLDTTMRDA GAVKRFE K IG RLQ+TRQ
Sbjct  458  RREPCRNLVNSTEITFDKVPYVLDTTMRDAGGAVKRFEFKMIGDRLQRTRQ  508



>gb|KCW75585.1| hypothetical protein EUGRSUZ_E04328 [Eucalyptus grandis]
Length=532

 Score =   283 bits (724),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 135/171 (79%), Positives = 149/171 (87%), Gaps = 2/171 (1%)
 Frame = -2

Query  589  KWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFG--KTFRKWG  416
            KWMFFFDVDEFI+VP K+TL+SVLDSLS YSQ TIEQMPMSNKLC  ++ G  +T+RKWG
Sbjct  362  KWMFFFDVDEFIYVPPKNTLRSVLDSLSEYSQITIEQMPMSNKLCFVDEAGAGRTYRKWG  421

Query  415  FEKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAE  236
            FEKLVYKDVKRGIRRDRKYAVQPR V+ATGVHMSQN  G+T HKTE +I YFHYHGTIAE
Sbjct  422  FEKLVYKDVKRGIRRDRKYAVQPRAVYATGVHMSQNLKGRTNHKTERRIKYFHYHGTIAE  481

Query  235  RREPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            RREPCR LVN+T +T D +PYVLDTTMRDA GAVKRFE K IG RLQ+TRQ
Sbjct  482  RREPCRNLVNSTEITFDKVPYVLDTTMRDAGGAVKRFEFKMIGDRLQRTRQ  532



>gb|KDP35088.1| hypothetical protein JCGZ_10997 [Jatropha curcas]
Length=526

 Score =   282 bits (722),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 148/170 (87%), Gaps = 0/170 (0%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            AKW+FFFDVDE+I+VP K+T+KSVLDSLS Y+QFTIEQMPMSNKLCL  D+G+ +RKWGF
Sbjct  357  AKWIFFFDVDEYIYVPPKNTIKSVLDSLSDYTQFTIEQMPMSNKLCLSADYGRYYRKWGF  416

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLVY+D+KRGIRRDRKYA+QPRNVFATGVHMSQN  GKTTHKT+ ++ YFHYHGTIA+R
Sbjct  417  EKLVYRDIKRGIRRDRKYAIQPRNVFATGVHMSQNLAGKTTHKTDSKVKYFHYHGTIAQR  476

Query  232  REPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            REPCR L+N T +  +  PYVLDTTMRD A +VK+FE K IG RLQ TRQ
Sbjct  477  REPCRNLLNVTEINYENNPYVLDTTMRDIAWSVKKFEQKMIGTRLQNTRQ  526



>ref|XP_008439419.1| PREDICTED: uncharacterized protein LOC103484233 [Cucumis melo]
Length=497

 Score =   281 bits (719),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 146/170 (86%), Gaps = 0/170 (0%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            AKWMFFFD+DEFI+VP KST+KSVLDSLS YSQFTIEQMPM++K CL ED G+T+RKWGF
Sbjct  328  AKWMFFFDIDEFIYVPPKSTIKSVLDSLSEYSQFTIEQMPMNSKTCLTEDAGRTYRKWGF  387

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLVYKDVKRGIRRDRKYAVQPR V+ATGVHMS+N  GKTTHKTEG I YFHYHGTIA+R
Sbjct  388  EKLVYKDVKRGIRRDRKYAVQPRRVYATGVHMSENVDGKTTHKTEGIIKYFHYHGTIAQR  447

Query  232  REPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            REPCR L N T  T +  P++LDTTMR  A AVKRFELK IG RLQ TRQ
Sbjct  448  REPCRTLSNLTQFTAEDTPFLLDTTMRLVAPAVKRFELKMIGTRLQSTRQ  497



>ref|XP_004488232.1| PREDICTED: uncharacterized protein LOC101489232 [Cicer arietinum]
Length=517

 Score =   280 bits (717),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 147/170 (86%), Gaps = 0/170 (0%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            AKWMFFFDVDE+I+VP KST+KSVLDSLS YSQFTIEQMPMS+KLCL  D+GKT+RKWG 
Sbjct  347  AKWMFFFDVDEYIYVPPKSTIKSVLDSLSEYSQFTIEQMPMSSKLCLSADYGKTYRKWGM  406

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLVYKDVK+GIRRDRKYAVQPR++FATGVHMSQN  GKTTHKTEG+I Y+HYHGTIAER
Sbjct  407  EKLVYKDVKKGIRRDRKYAVQPRSLFATGVHMSQNLDGKTTHKTEGKIKYYHYHGTIAER  466

Query  232  REPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            RE C+   N+T  T D  PY+LDTTMRD AG +K+FE K IG R+QKT Q
Sbjct  467  RESCKMFTNSTETTFDKTPYMLDTTMRDIAGVIKKFEQKMIGNRVQKTTQ  516



>ref|XP_011022744.1| PREDICTED: uncharacterized protein LOC105124421 [Populus euphratica]
Length=545

 Score =   280 bits (716),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 148/165 (90%), Gaps = 0/165 (0%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            AKWMFFFD+DE+I++P K+T+KSVLDSLSGY+QFT EQMPMS+KLCL  D+G+ +RKWGF
Sbjct  348  AKWMFFFDLDEYIYLPPKNTIKSVLDSLSGYTQFTFEQMPMSSKLCLSADYGRYYRKWGF  407

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLVY+DVKRGIRRDRKYA+QPRNVFATGVHMSQN  GKTT+KTEG+I YFHYHGTIA+R
Sbjct  408  EKLVYRDVKRGIRRDRKYAIQPRNVFATGVHMSQNFAGKTTYKTEGKIKYFHYHGTIAQR  467

Query  232  REPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRL  98
            REPCR L+N T +  + +PYVLDTTMRD A +VK+FELK IGP++
Sbjct  468  REPCRNLLNVTEINFENVPYVLDTTMRDLAWSVKKFELKMIGPKV  512



>ref|XP_002533995.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28392.1| conserved hypothetical protein [Ricinus communis]
Length=520

 Score =   278 bits (710),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 146/170 (86%), Gaps = 0/170 (0%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            AKW+FFFDVDE+I++P K+T+KSVLDSLS Y+QFT EQMPMS+KLCL  D+G+ +RKWGF
Sbjct  351  AKWIFFFDVDEYIYIPPKNTIKSVLDSLSDYNQFTFEQMPMSSKLCLSADYGRYYRKWGF  410

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLVY+D+KRGIRRDRKYA+QPRNVFATGVHMSQN  GKT HKTE +I YFHYHGTIA+R
Sbjct  411  EKLVYRDIKRGIRRDRKYAIQPRNVFATGVHMSQNLAGKTNHKTESKIKYFHYHGTIAQR  470

Query  232  REPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            REPCR L+N T +  +  PYVLDTTMRD A +VK+FE K IG RLQ TRQ
Sbjct  471  REPCRNLLNVTEINFENNPYVLDTTMRDIAWSVKKFEQKMIGSRLQSTRQ  520



>ref|XP_003547803.1| PREDICTED: uncharacterized protein LOC100816013 isoform 1 [Glycine 
max]
Length=505

 Score =   277 bits (708),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 149/170 (88%), Gaps = 0/170 (0%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            AKWMFFFDVDE+I+VP K+T+KSVL SLS Y QFTIEQMPMS+K+CL ED+GKT+RKWGF
Sbjct  336  AKWMFFFDVDEYIYVPPKTTIKSVLHSLSEYDQFTIEQMPMSSKICLSEDYGKTYRKWGF  395

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLVY+D   GIRRDRKYAVQPR+++ATGVHMS +  GKTTHKTEG+I YFHYHGTI+ER
Sbjct  396  EKLVYRDSITGIRRDRKYAVQPRSLYATGVHMSMDLSGKTTHKTEGRIKYFHYHGTISER  455

Query  232  REPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            RE C+ LVNTT +T + IPYV+DTTMRD AG +K+FELK IG RLQKTRQ
Sbjct  456  RETCKILVNTTQVTQNKIPYVMDTTMRDTAGVIKKFELKMIGTRLQKTRQ  505



>ref|XP_008798470.1| PREDICTED: uncharacterized protein LOC103713353 [Phoenix dactylifera]
Length=505

 Score =   277 bits (708),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 146/170 (86%), Gaps = 0/170 (0%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            AKWMFFFDVDEFI+V  K+TL+SVL SLSGY+QFTIEQMPMS+KLC   D GKT R WGF
Sbjct  336  AKWMFFFDVDEFIYVQPKTTLESVLASLSGYTQFTIEQMPMSSKLCRSSDAGKTTRMWGF  395

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLVY+DVKRG+RRDRKYA+QPRNVFATGVHMSQN VG+  HKTEG+I YFHYHGTIA+R
Sbjct  396  EKLVYRDVKRGVRRDRKYAIQPRNVFATGVHMSQNMVGRNLHKTEGRIRYFHYHGTIADR  455

Query  232  REPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            R PC+  +N T+LTVDG PYV D T+R  AG+VKRFELK +G RLQ+TRQ
Sbjct  456  RYPCKVFINDTTLTVDGTPYVFDPTLRQLAGSVKRFELKALGSRLQRTRQ  505



>gb|KHN25040.1| hypothetical protein glysoja_049162 [Glycine soja]
Length=505

 Score =   277 bits (708),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 149/170 (88%), Gaps = 0/170 (0%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            AKWMFFFDVDE+I+VP K+T+KSVL SLS Y QFTIEQMPMS+K+CL ED+GKT+RKWGF
Sbjct  336  AKWMFFFDVDEYIYVPPKTTIKSVLHSLSEYDQFTIEQMPMSSKICLSEDYGKTYRKWGF  395

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLVY+D   GIRRDRKYAVQPR+++ATGVHMS +  GKTTHKTEG+I YFHYHGTI+ER
Sbjct  396  EKLVYRDSITGIRRDRKYAVQPRSLYATGVHMSMDLSGKTTHKTEGRIKYFHYHGTISER  455

Query  232  REPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            RE C+ LVNTT +T + IPYV+DTTMRD AG +K+FELK IG RLQKTRQ
Sbjct  456  RETCKILVNTTQVTQNKIPYVMDTTMRDTAGVIKKFELKMIGTRLQKTRQ  505



>ref|XP_004134511.1| PREDICTED: uncharacterized protein LOC101220016 [Cucumis sativus]
 ref|XP_004164831.1| PREDICTED: uncharacterized LOC101220016 [Cucumis sativus]
 gb|KGN49546.1| hypothetical protein Csa_6G538750 [Cucumis sativus]
Length=499

 Score =   276 bits (707),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 129/170 (76%), Positives = 146/170 (86%), Gaps = 0/170 (0%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A+WMFFFD+DEFI+VP K+T+KSVLDSLS YSQFTIEQMPM++K CL ED G+T+RKWGF
Sbjct  330  ARWMFFFDIDEFIYVPPKNTIKSVLDSLSEYSQFTIEQMPMNSKTCLTEDAGRTYRKWGF  389

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLVYKDVKRGIRRDRKYAVQPR V+ATGVHMS+N  GKTTHKTEG I YFHYHGTIA+R
Sbjct  390  EKLVYKDVKRGIRRDRKYAVQPRRVYATGVHMSENVDGKTTHKTEGIIKYFHYHGTIAQR  449

Query  232  REPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            REPCR L N T   ++  P+++DTTMR  A AVKRFELK IG RLQ TRQ
Sbjct  450  REPCRTLSNLTQFNLEDTPFLMDTTMRLVAPAVKRFELKMIGTRLQSTRQ  499



>ref|XP_007156305.1| hypothetical protein PHAVU_003G275200g [Phaseolus vulgaris]
 gb|ESW28299.1| hypothetical protein PHAVU_003G275200g [Phaseolus vulgaris]
Length=500

 Score =   273 bits (698),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 147/170 (86%), Gaps = 0/170 (0%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            AKWMFFFDVDE+I+VP K+T+K+VLDSLS Y QFTIEQMPMS+K+CL +D+GKT RKWGF
Sbjct  331  AKWMFFFDVDEYIYVPPKTTIKTVLDSLSEYDQFTIEQMPMSSKICLSQDYGKTHRKWGF  390

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLVY+D   GIRRDRKYAVQPR+++ATGVHMSQ+  GKTTHKTEG+I YFHYHGTI+ER
Sbjct  391  EKLVYRDSISGIRRDRKYAVQPRSLYATGVHMSQDLSGKTTHKTEGRIKYFHYHGTISER  450

Query  232  REPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            RE C+ LVNTT +T D IPYVLDTT+RD AG +K+FE K IG RL  T+Q
Sbjct  451  RESCKILVNTTQVTNDKIPYVLDTTLRDIAGVIKKFEHKMIGSRLHNTKQ  500



>ref|XP_010928822.1| PREDICTED: uncharacterized protein LOC105050478 [Elaeis guineensis]
Length=505

 Score =   273 bits (698),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 143/170 (84%), Gaps = 0/170 (0%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            AKWMFFFDVDEFI+V  K+TL+SVL   S Y+QFTIEQMPMSNKLCL  D GKT R WGF
Sbjct  336  AKWMFFFDVDEFIYVQPKTTLQSVLALFSSYTQFTIEQMPMSNKLCLSSDAGKTPRMWGF  395

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLVY+DVKRG+RRDRKYA+QPRNVFATGVHMSQN  G++ HKTEG+I YFHYHGTIA+R
Sbjct  396  EKLVYRDVKRGVRRDRKYAIQPRNVFATGVHMSQNIAGRSLHKTEGRIKYFHYHGTIADR  455

Query  232  REPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            R PC+  VN T+LT +G PYV D T+R  AG VKRFELKTIG RLQ+TRQ
Sbjct  456  RYPCKVFVNDTTLTFEGTPYVFDPTLRQLAGLVKRFELKTIGSRLQRTRQ  505



>ref|XP_004509608.1| PREDICTED: uncharacterized protein LOC101490982 [Cicer arietinum]
Length=486

 Score =   272 bits (695),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 148/170 (87%), Gaps = 0/170 (0%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            AKWMFFFDVDE+I+VP KST+K+VL SLS YSQFTIEQMPMS+K+CL +D+GKT+RKWGF
Sbjct  317  AKWMFFFDVDEYIYVPPKSTIKTVLHSLSEYSQFTIEQMPMSSKICLSDDYGKTYRKWGF  376

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLVY+D  +GIRRDRKYAVQPRN++ATGVHMS+N  GKTTHKTEG+I YFHYHGTIA+R
Sbjct  377  EKLVYRDAIKGIRRDRKYAVQPRNLYATGVHMSENLDGKTTHKTEGRIKYFHYHGTIAQR  436

Query  232  REPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            +E C+ LVN+T++  +  PYVLDTT+RD A  +K+FELK IG RLQ T Q
Sbjct  437  KETCKLLVNSTNVNYEKTPYVLDTTLRDIAAVIKKFELKMIGSRLQNTTQ  486



>gb|KEH37330.1| glycosyltransferase family 92 protein [Medicago truncatula]
Length=524

 Score =   271 bits (692),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            AKWMFFFDVDE+I+VP KST+KSVLDSLS Y+QFTIEQMPM+ KLC   D+GKT+RKWG 
Sbjct  355  AKWMFFFDVDEYIYVPPKSTIKSVLDSLSEYNQFTIEQMPMNAKLCHSADYGKTYRKWGI  414

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLVYKDVK+GIRRDRKYAVQPR++FATGVHMSQN  GKTTHKTEG+I YFHYHGTIA+R
Sbjct  415  EKLVYKDVKKGIRRDRKYAVQPRSLFATGVHMSQNLDGKTTHKTEGRIKYFHYHGTIAQR  474

Query  232  REPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTR  86
            RE C+  +N+T+ T D  PY LDTT+RD AG +K+FE K IG ++QKTR
Sbjct  475  RESCKMFLNSTATTYDKTPYELDTTLRDLAGVIKKFEQKMIGNKVQKTR  523



>ref|XP_003628971.1| hypothetical protein MTR_8g070700 [Medicago truncatula]
 gb|AET03447.1| glycosyltransferase family 92 protein [Medicago truncatula]
Length=502

 Score =   268 bits (684),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 145/170 (85%), Gaps = 0/170 (0%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            AKWMFFFDVDE+I+VP KST+K+VLDSLS YSQFTIEQM MS K+CL  D+GKT+RKWGF
Sbjct  333  AKWMFFFDVDEYIYVPPKSTIKTVLDSLSEYSQFTIEQMAMSVKVCLSHDYGKTYRKWGF  392

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLVY+D   GIRRDRKYAVQPR++FA G+HMS+N  GKTTH TEG+I YFHYHG I++R
Sbjct  393  EKLVYRDAITGIRRDRKYAVQPRSLFANGIHMSENLDGKTTHNTEGRIKYFHYHGAISQR  452

Query  232  REPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            RE C+ LVN+T +T +  PYV+DTT+RD AG++K+FELK IG RLQ TRQ
Sbjct  453  RETCKLLVNSTKITYEKTPYVMDTTLRDIAGSIKKFELKMIGTRLQNTRQ  502



>ref|XP_006448575.1| hypothetical protein CICLE_v10014882mg [Citrus clementina]
 gb|ESR61815.1| hypothetical protein CICLE_v10014882mg [Citrus clementina]
Length=529

 Score =   264 bits (675),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 139/170 (82%), Gaps = 0/170 (0%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            AKWMFFFDVDE+IFVP K+T+KSVLDSL GY+QFTIEQM M+++LC   D GK  RKWGF
Sbjct  360  AKWMFFFDVDEYIFVPPKNTIKSVLDSLMGYNQFTIEQMHMNSQLCFAGDSGKAHRKWGF  419

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLVYKDVKRGIRRDRKYAVQPRNV+A GVHMSQN  G+TTHKTEG+I Y+HYHGTIA+R
Sbjct  420  EKLVYKDVKRGIRRDRKYAVQPRNVYAAGVHMSQNLYGRTTHKTEGKIKYYHYHGTIAQR  479

Query  232  REPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
             EPC   +N T    +  PYVLD TMR  AGAVK+FEL  IG RL+ TRQ
Sbjct  480  TEPCTTFINWTRYNFENTPYVLDITMRAVAGAVKKFELAKIGDRLKHTRQ  529



>ref|XP_010910220.1| PREDICTED: uncharacterized protein LOC105036167 [Elaeis guineensis]
Length=489

 Score =   261 bits (668),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 140/170 (82%), Gaps = 0/170 (0%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            AKWMFFFD DEFI+V  K+TLKSVLDSLSGY+Q T EQMPMS KLC  +D G T R W F
Sbjct  320  AKWMFFFDCDEFIYVQPKTTLKSVLDSLSGYTQITFEQMPMSGKLCRSQDAGDTPRMWVF  379

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLVY+DVKRG+RRDRKYA+QPRN FATGVH+SQN  G++  K E +I YFHYHGTIAER
Sbjct  380  EKLVYRDVKRGVRRDRKYAIQPRNAFATGVHLSQNIAGRSLRKAESRITYFHYHGTIAER  439

Query  232  REPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
             +PC+  VN T+LT +G PYVLDTT++  AG+VKRFELKTIG RLQ+TRQ
Sbjct  440  SDPCKVFVNDTTLTFEGTPYVLDTTLQQLAGSVKRFELKTIGSRLQRTRQ  489



>ref|XP_006468595.1| PREDICTED: uncharacterized protein LOC102614492 [Citrus sinensis]
Length=535

 Score =   262 bits (670),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/170 (72%), Positives = 138/170 (81%), Gaps = 0/170 (0%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            AKWMFFFDVDE+IFVP K+T+KSVLDSL GY+QFTIEQM M+++LC   D GK  RKWGF
Sbjct  366  AKWMFFFDVDEYIFVPPKNTIKSVLDSLMGYNQFTIEQMHMNSQLCFAGDSGKAHRKWGF  425

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLVYKDVKRGIRRDRKYAVQPRNV+A GVHMSQN  G+ THKTEG+I Y+HYHGTIA+R
Sbjct  426  EKLVYKDVKRGIRRDRKYAVQPRNVYAAGVHMSQNLYGQITHKTEGKIKYYHYHGTIAQR  485

Query  232  REPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
             EPC   +N T    +  PYVLD TMR  AGAVK+FEL  IG RL+ TRQ
Sbjct  486  TEPCTTFINWTRYNFENTPYVLDITMRAVAGAVKKFELAKIGDRLKHTRQ  535



>gb|KDO77183.1| hypothetical protein CISIN_1g009350mg [Citrus sinensis]
Length=537

 Score =   262 bits (670),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 122/170 (72%), Positives = 138/170 (81%), Gaps = 0/170 (0%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            AKWMFFFDVDE+IFVP K+T+KSVLDSL GY+QFTIEQM M+++LC   D GK  RKWGF
Sbjct  368  AKWMFFFDVDEYIFVPPKNTIKSVLDSLMGYNQFTIEQMHMNSQLCFAGDSGKAHRKWGF  427

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLVYKDVKRGIRRDRKYAVQPRNV+A GVHMSQN  G+ THKTEG+I Y+HYHGTIA+R
Sbjct  428  EKLVYKDVKRGIRRDRKYAVQPRNVYAAGVHMSQNLYGQITHKTEGKIKYYHYHGTIAQR  487

Query  232  REPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
             EPC   +N T    +  PYVLD TMR  AGAVK+FEL  IG RL+ TRQ
Sbjct  488  TEPCTTFINWTRYNFENTPYVLDITMRAVAGAVKKFELAKIGDRLKHTRQ  537



>ref|XP_009406517.1| PREDICTED: uncharacterized protein LOC103989411 [Musa acuminata 
subsp. malaccensis]
Length=493

 Score =   254 bits (650),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/170 (68%), Positives = 138/170 (81%), Gaps = 0/170 (0%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            AKW+FFFDVDEFI++  K+ L S+L SLS Y+QFTIEQMPMS KLC   D GKT R WG 
Sbjct  324  AKWIFFFDVDEFIYLAPKTNLDSLLASLSPYTQFTIEQMPMSGKLCRSIDHGKTARMWGI  383

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLVY+DVKRG+RRDRKYA+QPR+ FATGVHMSQN  G++ HKT+G+I Y+HYHGTIA R
Sbjct  384  EKLVYRDVKRGVRRDRKYAIQPRSAFATGVHMSQNVAGRSLHKTDGRIKYYHYHGTIAAR  443

Query  232  REPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            R+PC + VN T++T DG PYVLD T+R  AGAV+RFE K IG RL +TRQ
Sbjct  444  RDPCEEFVNATAVTYDGTPYVLDETLRRVAGAVRRFEHKMIGSRLARTRQ  493



>ref|XP_010441840.1| PREDICTED: uncharacterized protein LOC104724962 isoform X1 [Camelina 
sativa]
Length=493

 Score =   250 bits (639),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 138/171 (81%), Gaps = 1/171 (1%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDF-GKTFRKWG  416
            AKW+FFFDVDEF++VP K T+ SV++SL GYSQFTIEQMPMS++LC   D   +T+RKWG
Sbjct  323  AKWVFFFDVDEFVYVPAKETISSVMESLKGYSQFTIEQMPMSSQLCYDGDGPARTYRKWG  382

Query  415  FEKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAE  236
            FEKL Y+DVK+  RRDRKYAVQPRNVFATGVHMSQN  GKT H+ E QI YFHYHG+I++
Sbjct  383  FEKLAYRDVKKVPRRDRKYAVQPRNVFATGVHMSQNLQGKTYHRAEKQIRYFHYHGSISQ  442

Query  235  RREPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            RREPCR L N T +  D  PYVLDTTMRD   AVK FE++TIG RL +TRQ
Sbjct  443  RREPCRHLYNGTRIVHDNNPYVLDTTMRDIGLAVKTFEIRTIGDRLLRTRQ  493



>ref|XP_010481723.1| PREDICTED: uncharacterized protein LOC104760496 [Camelina sativa]
Length=502

 Score =   250 bits (639),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 138/171 (81%), Gaps = 1/171 (1%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDF-GKTFRKWG  416
            AKW+FFFDVDEF++VP K T+ SV++SL GYSQFTIEQMPMS++LC   D   +T+RKWG
Sbjct  332  AKWVFFFDVDEFVYVPAKETISSVMESLKGYSQFTIEQMPMSSQLCYGGDGPARTYRKWG  391

Query  415  FEKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAE  236
            FEKL Y+DVK+  RRDRKYAVQPRNVFATGVHMSQN  GKT H+ E QI YFHYHG+I++
Sbjct  392  FEKLAYRDVKKVPRRDRKYAVQPRNVFATGVHMSQNLQGKTYHRAEKQIRYFHYHGSISQ  451

Query  235  RREPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            RREPCR L N T +  D  PYVLDTTMRD   AVK FE++TIG RL +TRQ
Sbjct  452  RREPCRHLYNGTRIVHDNNPYVLDTTMRDIGLAVKTFEIRTIGDRLLRTRQ  502



>ref|XP_010441841.1| PREDICTED: uncharacterized protein LOC104724962 isoform X2 [Camelina 
sativa]
Length=519

 Score =   251 bits (640),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 138/171 (81%), Gaps = 1/171 (1%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDF-GKTFRKWG  416
            AKW+FFFDVDEF++VP K T+ SV++SL GYSQFTIEQMPMS++LC   D   +T+RKWG
Sbjct  349  AKWVFFFDVDEFVYVPAKETISSVMESLKGYSQFTIEQMPMSSQLCYDGDGPARTYRKWG  408

Query  415  FEKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAE  236
            FEKL Y+DVK+  RRDRKYAVQPRNVFATGVHMSQN  GKT H+ E QI YFHYHG+I++
Sbjct  409  FEKLAYRDVKKVPRRDRKYAVQPRNVFATGVHMSQNLQGKTYHRAEKQIRYFHYHGSISQ  468

Query  235  RREPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            RREPCR L N T +  D  PYVLDTTMRD   AVK FE++TIG RL +TRQ
Sbjct  469  RREPCRHLYNGTRIVHDNNPYVLDTTMRDIGLAVKTFEIRTIGDRLLRTRQ  519



>ref|XP_006398091.1| hypothetical protein EUTSA_v10000855mg [Eutrema salsugineum]
 gb|ESQ39544.1| hypothetical protein EUTSA_v10000855mg [Eutrema salsugineum]
Length=524

 Score =   251 bits (640),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 140/172 (81%), Gaps = 1/172 (1%)
 Frame = -2

Query  595  QAKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDF-GKTFRKW  419
            +AKW+FFFDVDEFI++P K+T+ SV++SL  YSQFTIEQMPMS++LC   D   +T+RKW
Sbjct  353  EAKWIFFFDVDEFIYIPPKNTISSVMESLEEYSQFTIEQMPMSSQLCFSGDGPARTYRKW  412

Query  418  GFEKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIA  239
            GFEKL Y+DVK+  RRDRKYAVQPRNV+ATGVHMSQN  GKT H+ EG+I YFHYHG+I+
Sbjct  413  GFEKLAYRDVKKVPRRDRKYAVQPRNVYATGVHMSQNLQGKTYHRAEGKIRYFHYHGSIS  472

Query  238  ERREPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            +RREPCR L N T +  D  PYVLDTTMRD   AVK FE++TIG RL +TRQ
Sbjct  473  QRREPCRHLFNGTRIVFDNNPYVLDTTMRDIGLAVKTFEIRTIGDRLLRTRQ  524



>ref|XP_010494514.1| PREDICTED: uncharacterized protein LOC104771647 [Camelina sativa]
Length=502

 Score =   250 bits (638),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 138/171 (81%), Gaps = 1/171 (1%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDF-GKTFRKWG  416
            AKW+FFFDVDEF++VP K T+ SV++SL GYSQFTIEQMPMS++LC   D   +T+RKWG
Sbjct  332  AKWVFFFDVDEFVYVPAKETISSVMESLKGYSQFTIEQMPMSSQLCYDGDGPARTYRKWG  391

Query  415  FEKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAE  236
            FEKL Y+DVK+  RRDRKYAVQPRNVFATGVHMSQN  GKT H+ E QI YFHYHG+I++
Sbjct  392  FEKLAYRDVKKVPRRDRKYAVQPRNVFATGVHMSQNLQGKTYHRAEKQIRYFHYHGSISQ  451

Query  235  RREPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            RREPCR L N T +  D  PYVLDTTMRD   AVK FE++TIG RL +TRQ
Sbjct  452  RREPCRHLYNGTRIVHDNNPYVLDTTMRDIGLAVKTFEVRTIGDRLLRTRQ  502



>ref|XP_006280340.1| hypothetical protein CARUB_v10026267mg [Capsella rubella]
 gb|EOA13238.1| hypothetical protein CARUB_v10026267mg [Capsella rubella]
Length=502

 Score =   249 bits (637),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 138/171 (81%), Gaps = 1/171 (1%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDF-GKTFRKWG  416
            AKW+FFFDVDEF++VP K T+ SV++SL GYSQFTIEQMPMS++LC   D   +T+RKWG
Sbjct  332  AKWVFFFDVDEFVYVPAKETISSVMESLKGYSQFTIEQMPMSSQLCYNGDGPARTYRKWG  391

Query  415  FEKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAE  236
            FEKL Y+DVK+  RRDRKYAVQPRNVFATGVHMSQN  GKT H+ E QI YFHYHG+I++
Sbjct  392  FEKLAYRDVKKVPRRDRKYAVQPRNVFATGVHMSQNLQGKTYHRAEKQIRYFHYHGSISQ  451

Query  235  RREPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            RREPCR L N T +  +  PYVLDTTMRD   AVK FE++TIG RL +TRQ
Sbjct  452  RREPCRHLYNGTRIVHENNPYVLDTTMRDIGLAVKTFEIRTIGDRLIRTRQ  502



>emb|CDY71149.1| BnaCnng71560D, partial [Brassica napus]
Length=175

 Score =   236 bits (601),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/171 (66%), Positives = 133/171 (78%), Gaps = 1/171 (1%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDF-GKTFRKWG  416
            AKW+FFFDVDEFI +P  +T+ SV+++L  YSQFTI QMPMS++LC   D   +T+RKWG
Sbjct  5    AKWIFFFDVDEFIGIPPNNTISSVMETLEEYSQFTIGQMPMSSQLCFSGDGPARTYRKWG  64

Query  415  FEKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAE  236
            FEKL Y+DVK+  RRDRKYAVQPRNVFATGVHMSQN  GKT H T   I YFHYHG+I++
Sbjct  65   FEKLAYRDVKKVPRRDRKYAVQPRNVFATGVHMSQNLQGKTYHGTGSLIRYFHYHGSISQ  124

Query  235  RREPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            RREPCR L N T +  D  PYVLDTTMRD   AVK FE++TIG RL +TRQ
Sbjct  125  RREPCRHLFNGTRIMFDNNPYVLDTTMRDVGFAVKTFEIRTIGDRLIRTRQ  175



>ref|NP_199280.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAK32745.1|AF361577_1 AT5g44670/K15C23_12 [Arabidopsis thaliana]
 dbj|BAA98120.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAN72243.1| At5g44670/K15C23_12 [Arabidopsis thaliana]
 gb|AED95145.1| uncharacterized protein AT5G44670 [Arabidopsis thaliana]
 gb|AHL38590.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=519

 Score =   246 bits (628),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 138/171 (81%), Gaps = 1/171 (1%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDF-GKTFRKWG  416
            AKWMFFFDVDEFI+VP KS++ SV+ SL  YSQFTIEQMPMS++LC   D   +T+RKWG
Sbjct  349  AKWMFFFDVDEFIYVPAKSSISSVMVSLEEYSQFTIEQMPMSSQLCYDGDGPARTYRKWG  408

Query  415  FEKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAE  236
            FEKL Y+DVK+  RRDRKYAVQPRNVFATGVHMSQ+  GKT H+ EG+I YFHYHG+I++
Sbjct  409  FEKLAYRDVKKVPRRDRKYAVQPRNVFATGVHMSQHLQGKTYHRAEGKIRYFHYHGSISQ  468

Query  235  RREPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            RREPCR L N T +  +  PYVLDTTMRD   AVK FE++TIG RL +TRQ
Sbjct  469  RREPCRHLYNGTRIVHENNPYVLDTTMRDIGLAVKTFEIRTIGDRLLRTRQ  519



>ref|XP_002863553.1| hypothetical protein ARALYDRAFT_494517 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39812.1| hypothetical protein ARALYDRAFT_494517 [Arabidopsis lyrata subsp. 
lyrata]
Length=519

 Score =   246 bits (628),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 117/170 (69%), Positives = 136/170 (80%), Gaps = 1/170 (1%)
 Frame = -2

Query  589  KWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDF-GKTFRKWGF  413
            KWMFFFDVDEF+ VP K T+ SV++SL  YSQFTIEQMPMS++LC   D   +T+RKWGF
Sbjct  350  KWMFFFDVDEFLHVPVKETISSVMESLEEYSQFTIEQMPMSSQLCYDGDGPARTYRKWGF  409

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKL Y+DVK+  RRDRKYAVQPRNVFATGVHMSQN  GKT H+ EG+I YFHYHG+I++R
Sbjct  410  EKLAYRDVKKVPRRDRKYAVQPRNVFATGVHMSQNLQGKTYHRAEGKIRYFHYHGSISQR  469

Query  232  REPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            REPCR L N T +  D  PYVLDTTMRD   AVK FE++TIG RL +TRQ
Sbjct  470  REPCRHLYNGTRIVHDNNPYVLDTTMRDIGLAVKTFEIRTIGDRLLRTRQ  519



>ref|XP_010529310.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104806225 
[Tarenaya hassleriana]
Length=516

 Score =   246 bits (627),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 137/170 (81%), Gaps = 1/170 (1%)
 Frame = -2

Query  589  KWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDF-GKTFRKWGF  413
            KWMFFFDVDEFI+VP K+T+ SV++S+  YSQFTIEQMPMS++LC   D   +T+RKWGF
Sbjct  347  KWMFFFDVDEFIYVPPKNTIASVMESMDEYSQFTIEQMPMSSELCFSGDGPARTYRKWGF  406

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKL Y+DVK+  R DRKYAVQPRNVFATGVHMSQN  G+T HK EG+I YFHYHG+I++R
Sbjct  407  EKLAYRDVKKVPRMDRKYAVQPRNVFATGVHMSQNLQGRTYHKAEGKIRYFHYHGSISQR  466

Query  232  REPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            REPCR L N T +   G PYVLDTT+RD   +VK FEL+TIG RL +TRQ
Sbjct  467  REPCRHLFNDTRIVFRGNPYVLDTTLRDVGLSVKTFELRTIGDRLLRTRQ  516



>emb|CDY69573.1| BnaAnng30860D [Brassica napus]
Length=495

 Score =   244 bits (623),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/171 (67%), Positives = 137/171 (80%), Gaps = 1/171 (1%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDF-GKTFRKWG  416
            AKWMFFFDVDEFI+VP+K T+KSV++SL  YSQFTIEQMPMS+K+C   D   +T+R WG
Sbjct  325  AKWMFFFDVDEFIYVPEKETIKSVMESLEEYSQFTIEQMPMSSKICYSGDGPARTYRNWG  384

Query  415  FEKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAE  236
            FEK+ Y+DVK+  RRDRKYAVQP NVFATGVHMSQN  GKT HK E +I YFHYHG+I++
Sbjct  385  FEKMAYRDVKKVPRRDRKYAVQPSNVFATGVHMSQNLQGKTYHKAESKIRYFHYHGSISQ  444

Query  235  RREPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            RREPCR L N + +  +  PYVLDTT+RD   AVK FE++TIG RL +TRQ
Sbjct  445  RREPCRHLFNDSRVVFENNPYVLDTTIRDVGLAVKTFEMRTIGNRLLRTRQ  495



>ref|XP_010449215.1| PREDICTED: uncharacterized protein LOC104731515 [Camelina sativa]
Length=513

 Score =   244 bits (624),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/171 (66%), Positives = 138/171 (81%), Gaps = 1/171 (1%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDF-GKTFRKWG  416
            AKWMFFFDVDEF++VP K T+ SV++SL GYSQFTIEQMPMS+++C   D   +T+RKWG
Sbjct  343  AKWMFFFDVDEFVYVPAKETISSVMESLEGYSQFTIEQMPMSSRICYDGDGPARTYRKWG  402

Query  415  FEKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAE  236
             EKLVY+DVK+  RRDRKYAVQP NVFATGVHMSQN  G+T HK E +I YFHYHG+I++
Sbjct  403  IEKLVYRDVKKVPRRDRKYAVQPENVFATGVHMSQNLQGRTYHKAESKIRYFHYHGSISQ  462

Query  235  RREPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            RREPCR L N +++  +  PYVLDTT+RD   AV+ FEL+TIG RL +TRQ
Sbjct  463  RREPCRYLFNDSNVFFENTPYVLDTTIRDVGLAVRTFELRTIGDRLLRTRQ  513



>gb|KFK31618.1| hypothetical protein AALP_AA6G136500 [Arabis alpina]
Length=509

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/171 (66%), Positives = 138/171 (81%), Gaps = 1/171 (1%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDF-GKTFRKWG  416
            AKW+FFFDVDEF++VP K ++ SV++SL  YSQFTIEQMPMS+++C   D   +T+RKWG
Sbjct  339  AKWIFFFDVDEFVYVPVKESIDSVMESLKEYSQFTIEQMPMSSQICYSGDGPARTYRKWG  398

Query  415  FEKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAE  236
            FEKL Y+DVK+  RRDRKYAVQPRNVFATGVHMSQN +GKT HK EG+I YFHYHG+I++
Sbjct  399  FEKLAYRDVKKVPRRDRKYAVQPRNVFATGVHMSQNLLGKTYHKAEGKIRYFHYHGSISQ  458

Query  235  RREPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            RREPCR L N T +  +  PYVLDTTMRD   AVK FE++ IG RL +T+Q
Sbjct  459  RREPCRHLFNDTRIVFNNNPYVLDTTMRDIGLAVKTFEIRKIGDRLLRTKQ  509



>ref|XP_006283465.1| hypothetical protein CARUB_v10004512mg, partial [Capsella rubella]
 gb|EOA16363.1| hypothetical protein CARUB_v10004512mg, partial [Capsella rubella]
Length=553

 Score =   246 bits (627),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/171 (67%), Positives = 136/171 (80%), Gaps = 1/171 (1%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDF-GKTFRKWG  416
            AKWMFFFDVDEF++VP K T+ SV++SL GYSQFTIEQMPMS+++C   D   +T+RKWG
Sbjct  383  AKWMFFFDVDEFVYVPAKETISSVMESLEGYSQFTIEQMPMSSRICYSGDGPARTYRKWG  442

Query  415  FEKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAE  236
             EKL Y+DVK+  RRDRKYAVQP NVFATGVHMSQN  G+T HK E +I YFHYHG+I++
Sbjct  443  IEKLAYRDVKKVPRRDRKYAVQPENVFATGVHMSQNLQGRTYHKAESKIRYFHYHGSISQ  502

Query  235  RREPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            RREPCR L N + L  +  PYVLDTT+RD   AVK FEL+TIG RL +TRQ
Sbjct  503  RREPCRYLFNDSKLVFENTPYVLDTTIRDVGLAVKTFELRTIGNRLLRTRQ  553



>emb|CDX78979.1| BnaA01g10460D [Brassica napus]
Length=497

 Score =   244 bits (623),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 140/172 (81%), Gaps = 1/172 (1%)
 Frame = -2

Query  595  QAKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDF-GKTFRKW  419
            +AKWMFFFDVDEF++VP+K T+KSV++SL  YSQFTIEQMPMS+++C   D   +T+RKW
Sbjct  326  KAKWMFFFDVDEFMYVPEKETIKSVMESLEEYSQFTIEQMPMSSRICYSGDGPARTYRKW  385

Query  418  GFEKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIA  239
            GFEK+ Y+DVK+  RRDRKYAVQP+NVFATGVHMSQN  GKT HK E +I YFHYHG+I+
Sbjct  386  GFEKMAYRDVKKVPRRDRKYAVQPQNVFATGVHMSQNLQGKTYHKAESKIRYFHYHGSIS  445

Query  238  ERREPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            +RREPCR L N + +  +  PYVLDTT+RD   AVK FE++TIG RL +TRQ
Sbjct  446  QRREPCRHLFNDSRVVFENNPYVLDTTIRDVGLAVKMFEMRTIGDRLLRTRQ  497



>emb|CDY31450.1| BnaC03g63740D [Brassica napus]
Length=495

 Score =   244 bits (622),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/171 (67%), Positives = 137/171 (80%), Gaps = 1/171 (1%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDF-GKTFRKWG  416
            AKWMFFFDVDEFI+VP+K T+KSV++SL  YSQFTIEQMPMS+K+C   D   +T+R WG
Sbjct  325  AKWMFFFDVDEFIYVPEKETIKSVMESLEEYSQFTIEQMPMSSKICYSGDGPARTYRNWG  384

Query  415  FEKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAE  236
            FEK+ Y+DVK+  RRDRKYAVQP NVFATGVHMSQN  GKT HK E +I YFHYHG+I++
Sbjct  385  FEKMAYRDVKKVPRRDRKYAVQPSNVFATGVHMSQNLQGKTYHKAESKIRYFHYHGSISQ  444

Query  235  RREPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            RREPCR L N + +  +  PYVLDTT+RD   AVK FE++TIG RL +TRQ
Sbjct  445  RREPCRHLFNDSRVVFENNPYVLDTTIRDVGLAVKTFEMRTIGNRLLRTRQ  495



>ref|XP_010434312.1| PREDICTED: uncharacterized protein LOC104718293 [Camelina sativa]
Length=513

 Score =   244 bits (623),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 139/171 (81%), Gaps = 1/171 (1%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDF-GKTFRKWG  416
            AKWMFFFDVDEF++VP K T+ SV++SL GYSQFTIEQMPMS+++C   D   +T+RKWG
Sbjct  343  AKWMFFFDVDEFVYVPAKETISSVMESLEGYSQFTIEQMPMSSRICYDGDGPARTYRKWG  402

Query  415  FEKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAE  236
             EKLVY+DVK+  RRDRKYAVQP NVFATGVHMSQN  G+T HK E +I YFHYHG+I++
Sbjct  403  IEKLVYRDVKKVPRRDRKYAVQPENVFATGVHMSQNLQGRTYHKAESKIRYFHYHGSISQ  462

Query  235  RREPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            RREPCR+L N +++  +  PYVLDTT+R+   AV+ FEL+TIG RL +TRQ
Sbjct  463  RREPCRQLFNDSNVFFENTPYVLDTTIREVGLAVRTFELRTIGDRLLRTRQ  513



>ref|XP_009133537.1| PREDICTED: uncharacterized protein LOC103858013 isoform X1 [Brassica 
rapa]
Length=468

 Score =   243 bits (619),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 140/172 (81%), Gaps = 1/172 (1%)
 Frame = -2

Query  595  QAKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDF-GKTFRKW  419
            +AKWMFFFDVDEF++VP++ T+KSV++SL  YSQFTIEQMPMS+++C   D   +T+RKW
Sbjct  297  KAKWMFFFDVDEFMYVPEEETIKSVMESLEEYSQFTIEQMPMSSRICYSGDGPARTYRKW  356

Query  418  GFEKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIA  239
            GFEK+ Y+DVK+  RRDRKYAVQP+NVFATGVHMSQN  GKT HK E +I YFHYHG+I+
Sbjct  357  GFEKMAYRDVKKVPRRDRKYAVQPQNVFATGVHMSQNLQGKTYHKAESKIRYFHYHGSIS  416

Query  238  ERREPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            +RREPCR L N + +  +  PYVLDTT+RD   AVK FE++TIG RL +TRQ
Sbjct  417  QRREPCRHLSNDSRVVFENNPYVLDTTIRDVGLAVKMFEMRTIGDRLLRTRQ  468



>ref|XP_009133544.1| PREDICTED: uncharacterized protein LOC103858013 isoform X2 [Brassica 
rapa]
Length=499

 Score =   243 bits (620),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 140/172 (81%), Gaps = 1/172 (1%)
 Frame = -2

Query  595  QAKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDF-GKTFRKW  419
            +AKWMFFFDVDEF++VP++ T+KSV++SL  YSQFTIEQMPMS+++C   D   +T+RKW
Sbjct  328  KAKWMFFFDVDEFMYVPEEETIKSVMESLEEYSQFTIEQMPMSSRICYSGDGPARTYRKW  387

Query  418  GFEKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIA  239
            GFEK+ Y+DVK+  RRDRKYAVQP+NVFATGVHMSQN  GKT HK E +I YFHYHG+I+
Sbjct  388  GFEKMAYRDVKKVPRRDRKYAVQPQNVFATGVHMSQNLQGKTYHKAESKIRYFHYHGSIS  447

Query  238  ERREPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            +RREPCR L N + +  +  PYVLDTT+RD   AVK FE++TIG RL +TRQ
Sbjct  448  QRREPCRHLSNDSRVVFENNPYVLDTTIRDVGLAVKMFEMRTIGDRLLRTRQ  499



>ref|XP_006413894.1| hypothetical protein EUTSA_v10024965mg [Eutrema salsugineum]
 gb|ESQ55347.1| hypothetical protein EUTSA_v10024965mg [Eutrema salsugineum]
Length=505

 Score =   243 bits (620),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 136/172 (79%), Gaps = 1/172 (1%)
 Frame = -2

Query  595  QAKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDF-GKTFRKW  419
             AKW+FFFDVDEFI+VP  +++ SV++SL  YSQFTIEQMPMS+KLC   D   +T+RKW
Sbjct  334  SAKWIFFFDVDEFIYVPANNSISSVMESLEEYSQFTIEQMPMSSKLCYSGDGPARTYRKW  393

Query  418  GFEKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIA  239
            GFEKL Y+DVK+  RRDRKYAVQP NVFATGVHMSQN  GKT HK E +I YFHYHG+I+
Sbjct  394  GFEKLAYRDVKKVPRRDRKYAVQPSNVFATGVHMSQNLQGKTYHKAESKIRYFHYHGSIS  453

Query  238  ERREPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            +RREPCR L N + +  +  PYVLDTT+RD   AVK FE++TIG RL +TRQ
Sbjct  454  QRREPCRNLFNDSRVVFENNPYVLDTTIRDVGLAVKTFEMRTIGDRLLRTRQ  505



>ref|XP_010439609.1| PREDICTED: uncharacterized protein LOC104723016 [Camelina sativa]
Length=511

 Score =   243 bits (620),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 138/171 (81%), Gaps = 1/171 (1%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDF-GKTFRKWG  416
            AKWMFFFDVDEF++VP K T+ SV++SL GYSQFTIEQMPMS+++C   D   +T+RKWG
Sbjct  341  AKWMFFFDVDEFVYVPAKETISSVMESLQGYSQFTIEQMPMSSRICYDGDGPARTYRKWG  400

Query  415  FEKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAE  236
             EKLVY+DVK+  RRDRKYAVQP NVFATGVHMSQN  G+T HK E +I YFHYHG+I++
Sbjct  401  IEKLVYRDVKKVPRRDRKYAVQPENVFATGVHMSQNLQGRTYHKAESKIRYFHYHGSISQ  460

Query  235  RREPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            RREPCR+L N +++  +  PYVLDTT+ D   AV+ FEL+TIG RL +TRQ
Sbjct  461  RREPCRQLFNDSNVFFENTPYVLDTTIGDVGLAVRTFELRTIGDRLLRTRQ  511



>ref|XP_006855865.1| hypothetical protein AMTR_s00037p00116470 [Amborella trichopoda]
 gb|ERN17332.1| hypothetical protein AMTR_s00037p00116470 [Amborella trichopoda]
Length=513

 Score =   242 bits (618),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 141/170 (83%), Gaps = 0/170 (0%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            ++W+FFFDVDE+I+VP  +TL S+L SLS Y+QFTIEQMPMSNKLCL +D+ +  R+WG 
Sbjct  344  SRWIFFFDVDEYIYVPPGNTLPSLLSSLSNYTQFTIEQMPMSNKLCLLQDYRRAPREWGI  403

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLV+++VKRGIRRDRKYA+Q RN FATGVHMS+N VGK  HKTEG+I YFHYHGTI+ R
Sbjct  404  EKLVFRNVKRGIRRDRKYAIQARNAFATGVHMSENVVGKAQHKTEGRIKYFHYHGTISTR  463

Query  232  REPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            REPCRK VN + L  +  P+VLDTTMR  A ++K+FELKTIG RL+ TRQ
Sbjct  464  REPCRKFVNASELIFESSPFVLDTTMRALAPSIKKFELKTIGERLRSTRQ  513



>ref|XP_009108462.1| PREDICTED: uncharacterized protein LOC103834153 [Brassica rapa]
Length=495

 Score =   241 bits (615),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 136/171 (80%), Gaps = 1/171 (1%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDF-GKTFRKWG  416
            AKWMFFFDVDEFI+VP+K T+ SV++SL  YSQFTIEQMPMS+K+C   D   +T+R WG
Sbjct  325  AKWMFFFDVDEFIYVPEKETISSVMESLEEYSQFTIEQMPMSSKICYSGDGPARTYRNWG  384

Query  415  FEKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAE  236
            FEK+ Y+DVK+  RRDRKYAVQP NVFATGVHMSQN  GKT HK E +I YFHYHG+I++
Sbjct  385  FEKMAYRDVKKVPRRDRKYAVQPSNVFATGVHMSQNLQGKTYHKAESKIRYFHYHGSISQ  444

Query  235  RREPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            RREPCR L N + +  +  PYVLDTT+R+   AVK FE++TIG RL +TRQ
Sbjct  445  RREPCRHLFNDSRVVFENNPYVLDTTIRNVGLAVKTFEMRTIGNRLLRTRQ  495



>emb|CDY50064.1| BnaCnng18710D [Brassica napus]
Length=498

 Score =   241 bits (615),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 138/171 (81%), Gaps = 1/171 (1%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDF-GKTFRKWG  416
            AKW+FFFDVDEF++VP+K T+KSV++SL  YSQFTIEQMPMS+K+C   D   +T+RKWG
Sbjct  328  AKWVFFFDVDEFMYVPEKETIKSVMESLEEYSQFTIEQMPMSSKICYSGDGPARTYRKWG  387

Query  415  FEKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAE  236
            FEK+ Y+DVK+  RRDRKYAVQP+NVFATGVHMSQN  GKT HK E +I YFHYHG+I++
Sbjct  388  FEKMAYRDVKKVPRRDRKYAVQPQNVFATGVHMSQNLQGKTYHKAESKIRYFHYHGSISQ  447

Query  235  RREPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            RREPCR L N + +  +  PYVLDTT+RD   A K FE++TIG RL +TRQ
Sbjct  448  RREPCRHLFNDSRVVFENNPYVLDTTIRDVGLAAKMFEMRTIGDRLLRTRQ  498



>emb|CDY49028.1| BnaAnng10220D [Brassica napus]
Length=519

 Score =   239 bits (609),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/171 (66%), Positives = 134/171 (78%), Gaps = 1/171 (1%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLRED-FGKTFRKWG  416
            AKW+FFFDVDEFI +P  +T+ SV+++L  YSQFTIEQMPMS++LC   D   +T+RKWG
Sbjct  349  AKWIFFFDVDEFIGIPPNNTISSVMETLEEYSQFTIEQMPMSSQLCFSGDGAARTYRKWG  408

Query  415  FEKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAE  236
            FEKL Y+DVK+  RRDRKYAVQPR+VFATGVHMSQN  GKT H T   I YFHYHG+I++
Sbjct  409  FEKLAYRDVKKVPRRDRKYAVQPRHVFATGVHMSQNVQGKTYHGTGSLIRYFHYHGSISQ  468

Query  235  RREPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            RREPCR L N T +  D  PYVLDTTMRD   AVK FE++TIG RL +TRQ
Sbjct  469  RREPCRHLFNGTRIMFDNNPYVLDTTMRDVGLAVKTFEIRTIGDRLIRTRQ  519



>ref|XP_009101686.1| PREDICTED: uncharacterized protein LOC103827882 [Brassica rapa]
Length=532

 Score =   239 bits (609),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 134/172 (78%), Gaps = 1/172 (1%)
 Frame = -2

Query  595  QAKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLRED-FGKTFRKW  419
             AKW+FFFDVDEFI +P  +T+ SV+++L  YSQFTIEQMPMS++LC   D   +T+RKW
Sbjct  361  DAKWIFFFDVDEFIGIPPNNTISSVMETLEEYSQFTIEQMPMSSQLCFSGDGAARTYRKW  420

Query  418  GFEKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIA  239
            GFEKL Y+DVK+  RRDRKYAVQPR+VFATGVHMSQN  GKT H T   I YFHYHG+I+
Sbjct  421  GFEKLAYRDVKKVPRRDRKYAVQPRHVFATGVHMSQNVQGKTYHGTGSLIRYFHYHGSIS  480

Query  238  ERREPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            +RREPCR L N T +  D  PYVLDTTMRD   AVK FE++TIG RL +TRQ
Sbjct  481  QRREPCRHLFNGTRIMFDNNPYVLDTTMRDVGLAVKTFEIRTIGDRLIRTRQ  532



>ref|XP_002869945.1| hypothetical protein ARALYDRAFT_492851 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46204.1| hypothetical protein ARALYDRAFT_492851 [Arabidopsis lyrata subsp. 
lyrata]
Length=495

 Score =   237 bits (605),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 111/170 (65%), Positives = 133/170 (78%), Gaps = 1/170 (1%)
 Frame = -2

Query  589  KWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDF-GKTFRKWGF  413
            KWMFFFDVDEF+ VP K T+ SV++SL  YSQFTIEQMPMS+++C   D   +T+RKWG 
Sbjct  326  KWMFFFDVDEFLHVPVKETISSVMESLEEYSQFTIEQMPMSSRICYSGDGPARTYRKWGI  385

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKL Y+DVK+  RRDRKYAVQP NVFATGVHMSQN  GKT HK E +I YFHYHG+I++R
Sbjct  386  EKLAYRDVKKVPRRDRKYAVQPENVFATGVHMSQNLQGKTYHKAESKIHYFHYHGSISQR  445

Query  232  REPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            REPCR L N + +  +  PYVLDTT+RD   AV+ FEL+TIG RL +TRQ
Sbjct  446  REPCRHLFNDSRVVFENTPYVLDTTIRDVGLAVRTFELRTIGDRLLRTRQ  495



>gb|AAL24253.1| AT4g20170/F1C12_90 [Arabidopsis thaliana]
 gb|AAN18139.1| At4g20170/F1C12_90 [Arabidopsis thaliana]
Length=388

 Score =   234 bits (597),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 110/170 (65%), Positives = 133/170 (78%), Gaps = 1/170 (1%)
 Frame = -2

Query  589  KWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDF-GKTFRKWGF  413
            KWMFFFDVDEF+ VP K T+ SV++SL  YSQFTIEQMPMS+++C   D   +T+RKWG 
Sbjct  219  KWMFFFDVDEFLHVPVKETISSVMESLEEYSQFTIEQMPMSSRICYSGDGPARTYRKWGI  278

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKL Y+DVK+  RRDRKYAVQP NVFATGVHMSQN  GKT HK E +I YFHYHG+I++R
Sbjct  279  EKLAYRDVKKVPRRDRKYAVQPENVFATGVHMSQNLQGKTYHKAESKIRYFHYHGSISQR  338

Query  232  REPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            REPCR+L N + +  +  PYVLDTT+ D   AV+ FEL+TIG RL +TRQ
Sbjct  339  REPCRQLFNDSRVVFENTPYVLDTTICDVGLAVRTFELRTIGDRLLRTRQ  388



>ref|XP_009388895.1| PREDICTED: uncharacterized protein LOC103975608 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=415

 Score =   233 bits (593),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 131/170 (77%), Gaps = 0/170 (0%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            AKW+F FD+DEFI++P ++ L+ +L+S SGY+QFTIEQMPMSN LC  +D+GKT R WG 
Sbjct  246  AKWIFVFDMDEFIYLPSETKLEPLLESFSGYTQFTIEQMPMSNTLCQFKDYGKTSRMWGI  305

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLVY+D +R +RRD KYA+QPR+  ATGVH+SQN  G +  +T G I YFHYHGT+A R
Sbjct  306  EKLVYRDARRKVRRDHKYAIQPRSASATGVHLSQNVAGPSLSETGGMIKYFHYHGTLAMR  365

Query  232  REPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            R+PCR+L+N T +  D  PYVLD T+R  AG V+ FELK IGPRL  TR+
Sbjct  366  RDPCRELLNVTKIFFDNTPYVLDETLRSVAGEVRMFELKMIGPRLAHTRE  415



>ref|NP_193750.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAA18242.1| putative protein [Arabidopsis thaliana]
 emb|CAB79017.1| putative protein [Arabidopsis thaliana]
 gb|AEE84282.1| uncharacterized protein AT4G20170 [Arabidopsis thaliana]
 gb|AHL38683.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=504

 Score =   234 bits (598),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 110/170 (65%), Positives = 133/170 (78%), Gaps = 1/170 (1%)
 Frame = -2

Query  589  KWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDF-GKTFRKWGF  413
            KWMFFFDVDEF+ VP K T+ SV++SL  YSQFTIEQMPMS+++C   D   +T+RKWG 
Sbjct  335  KWMFFFDVDEFLHVPVKETISSVMESLEEYSQFTIEQMPMSSRICYSGDGPARTYRKWGI  394

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKL Y+DVK+  RRDRKYAVQP NVFATGVHMSQN  GKT HK E +I YFHYHG+I++R
Sbjct  395  EKLAYRDVKKVPRRDRKYAVQPENVFATGVHMSQNLQGKTYHKAESKIRYFHYHGSISQR  454

Query  232  REPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            REPCR+L N + +  +  PYVLDTT+ D   AV+ FEL+TIG RL +TRQ
Sbjct  455  REPCRQLFNDSRVVFENTPYVLDTTICDVGLAVRTFELRTIGDRLLRTRQ  504



>ref|XP_010684202.1| PREDICTED: uncharacterized protein LOC104898791 [Beta vulgaris 
subsp. vulgaris]
Length=493

 Score =   234 bits (597),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/169 (64%), Positives = 137/169 (81%), Gaps = 0/169 (0%)
 Frame = -2

Query  589  KWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGFE  410
            +WMFFFDVDE+I+VP K +L+SV+DSL  ++QFTIEQ+P+SN+LCL +D GKT +KW  E
Sbjct  325  RWMFFFDVDEYIYVPSKFSLRSVVDSLGDFTQFTIEQIPISNQLCLTQDAGKTSKKWVME  384

Query  409  KLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAERR  230
            KLVY++VK+ IRRDRKYAVQPRNVFATGVH+S+N  G++ HKTE  I YFHYHGTIA RR
Sbjct  385  KLVYRNVKKVIRRDRKYAVQPRNVFATGVHLSKNFQGESAHKTEKFIKYFHYHGTIATRR  444

Query  229  EPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            + C+  +N TS+T+   PYV DT+MR  A  VKRFEL TIG +LQ T+Q
Sbjct  445  DTCKDFINDTSVTLGDTPYVRDTSMRSIAAFVKRFELHTIGSKLQFTKQ  493



>ref|XP_009388894.1| PREDICTED: uncharacterized protein LOC103975608 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=490

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 131/170 (77%), Gaps = 0/170 (0%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            AKW+F FD+DEFI++P ++ L+ +L+S SGY+QFTIEQMPMSN LC  +D+GKT R WG 
Sbjct  321  AKWIFVFDMDEFIYLPSETKLEPLLESFSGYTQFTIEQMPMSNTLCQFKDYGKTSRMWGI  380

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLVY+D +R +RRD KYA+QPR+  ATGVH+SQN  G +  +T G I YFHYHGT+A R
Sbjct  381  EKLVYRDARRKVRRDHKYAIQPRSASATGVHLSQNVAGPSLSETGGMIKYFHYHGTLAMR  440

Query  232  REPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            R+PCR+L+N T +  D  PYVLD T+R  AG V+ FELK IGPRL  TR+
Sbjct  441  RDPCRELLNVTKIFFDNTPYVLDETLRSVAGEVRMFELKMIGPRLAHTRE  490



>ref|XP_003530546.1| PREDICTED: uncharacterized protein LOC100795928 [Glycine max]
Length=522

 Score =   228 bits (581),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 133/170 (78%), Gaps = 1/170 (1%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            AKWMFFFDVDE+I+VP  +T+K+V+DSLS Y QF    MPM+NK+CL ED+GKT RKWGF
Sbjct  354  AKWMFFFDVDEYIYVPPNNTIKTVVDSLSKYDQFIFNMMPMNNKICLYEDYGKTCRKWGF  413

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLVY+D    IRR++KYAVQPR+++ATGVH SQ+  GK T+KTE ++ YFHYHG IA+R
Sbjct  414  EKLVYRDSTTNIRRNKKYAVQPRSLYATGVHFSQHLAGK-TYKTEDRMKYFHYHGIIAKR  472

Query  232  REPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
            RE C+    +T +T   I YV+DTTMRD A  +K+FE K IG RL+KTRQ
Sbjct  473  RESCKIFATSTQVTQAKITYVIDTTMRDIARVIKKFEFKMIGSRLEKTRQ  522



>ref|XP_010684201.1| PREDICTED: uncharacterized protein LOC104898790 [Beta vulgaris 
subsp. vulgaris]
Length=506

 Score =   219 bits (559),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 100/168 (60%), Positives = 129/168 (77%), Gaps = 1/168 (1%)
 Frame = -2

Query  589  KWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGFE  410
            KWMFFFDVDE+I++P KS+L+S++DSL  Y+ F IEQ+ MSN+LCL ED  +  +KWGFE
Sbjct  339  KWMFFFDVDEYIYLPGKSSLQSIMDSLKDYTLFVIEQVSMSNRLCLSEDAAQISKKWGFE  398

Query  409  KLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAERR  230
            KLVYK+ K+  RRD KYA+QPRNV+ATGVHMS+N VGK+T      + YFHY GT+A+R 
Sbjct  399  KLVYKNAKKA-RRDNKYAIQPRNVYATGVHMSENFVGKSTRLPNTLMKYFHYQGTVADRH  457

Query  229  EPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTR  86
            EPCR+ ++  S+ V+  PYV DT++R  A  VKRFEL TIG RLQ T+
Sbjct  458  EPCRQFLDNPSIKVENTPYVQDTSIRSVAPFVKRFELDTIGSRLQSTK  505



>gb|AFK35556.1| unknown [Lotus japonicus]
Length=126

 Score =   198 bits (503),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 115/170 (68%), Gaps = 45/170 (26%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
             KWMFFFDVDEFI+VP KST+K+VLDSLS Y+QFTIEQMPMS+KLCL  D+GKT+RKWGF
Sbjct  2    GKWMFFFDVDEFIYVPPKSTIKTVLDSLSEYNQFTIEQMPMSSKLCLSSDYGKTYRKWGF  61

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EK VYKDVK+GIRRDRKYAVQPR+++ATGVHMSQN  GKTTHKTEG+I            
Sbjct  62   EKFVYKDVKKGIRRDRKYAVQPRSLYATGVHMSQNLEGKTTHKTEGKI------------  109

Query  232  REPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
                                             K+FELK IG RLQKTRQ
Sbjct  110  ---------------------------------KKFELKMIGDRLQKTRQ  126



>gb|ACF84457.1| unknown [Zea mays]
 gb|ACF86839.2| unknown [Zea mays]
 gb|AFW77063.1| hypothetical protein ZEAMMB73_000862 [Zea mays]
Length=332

 Score =   194 bits (493),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 118/166 (71%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W FFFDVDE+I++P   TL+ VL  L  Y+QFTIEQ PMS+KLC+ +   +  RKWGF
Sbjct  163  ANWTFFFDVDEYIYLPDGRTLQEVLGQLEPYTQFTIEQNPMSSKLCVEDPTMEYSRKWGF  222

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLV+++    +RRDRKYA++ RN ++TGVHMSQN +G+TTHKTE  I+Y+HYH +I   
Sbjct  223  EKLVFRNSITRVRRDRKYAIRARNAYSTGVHMSQNVIGRTTHKTESLILYYHYHNSINVM  282

Query  232  REPCRKLV----NTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             EPCR+ V    N + +  +GIPYV D  M   AG +KRFE +T+G
Sbjct  283  GEPCREFVPRPNNGSKVMFEGIPYVYDDNMERVAGEIKRFEEETLG  328



>ref|XP_003560772.1| PREDICTED: uncharacterized protein LOC100838543 [Brachypodium 
distachyon]
Length=502

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 117/167 (70%), Gaps = 4/167 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W FFFDVDE++++P   TL+ VL  L  Y+QFTIEQ PMS+KLCL +   +  RKWGF
Sbjct  334  ANWTFFFDVDEYMYLPDGRTLEEVLGQLQRYTQFTIEQNPMSSKLCLEDPAKEYSRKWGF  393

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLV+++   G+RRDRKYAVQ RN ++ GVHMSQN  G+TTH+TE  I Y+HYH TI   
Sbjct  394  EKLVFRNSITGVRRDRKYAVQARNAYSAGVHMSQNVYGRTTHRTESLIRYYHYHNTINVM  453

Query  232  REPCRKLV----NTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGP  104
             EPCR+ V    N + +T +GIPYV D  M+  AG +K FE  T+GP
Sbjct  454  GEPCREFVSKPTNGSKVTFEGIPYVYDDNMKRLAGDIKHFEEATVGP  500



>ref|NP_001047907.2| Os02g0712500 [Oryza sativa Japonica Group]
 dbj|BAD72474.1| unknown protein [Oryza sativa Japonica Group]
 gb|EEE57676.1| hypothetical protein OsJ_08123 [Oryza sativa Japonica Group]
 dbj|BAF09821.2| Os02g0712500 [Oryza sativa Japonica Group]
Length=518

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 116/166 (70%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W FFFDVDE+I++P   TL  VL  LSGYSQFTIEQ PMS+KLC+++      R+WGF
Sbjct  349  ANWTFFFDVDEYIYLPNGQTLDQVLGKLSGYSQFTIEQNPMSSKLCVQDPSKDYSREWGF  408

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLV+++    +RRDRKYA+Q RN ++ GVHMSQN  G+TTHKTE  I Y+HYH +I   
Sbjct  409  EKLVFRNSITKVRRDRKYAIQARNAYSAGVHMSQNVYGRTTHKTESLIRYYHYHNSINVM  468

Query  232  REPCRKL----VNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             EPCR+     VN + L  +GIPYV D  M+  AG +KRFE + IG
Sbjct  469  GEPCREFVPVPVNGSKLMFEGIPYVYDDNMKRLAGQIKRFEKEAIG  514



>gb|EEC73881.1| hypothetical protein OsI_08667 [Oryza sativa Indica Group]
Length=518

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 116/166 (70%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W FFFDVDE+I++P   TL  VL  LSGYSQFTIEQ PMS+KLC+++      R+WGF
Sbjct  349  ANWTFFFDVDEYIYLPNGQTLDQVLGKLSGYSQFTIEQNPMSSKLCVQDPSKDYSREWGF  408

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLV+++    +RRDRKYA+Q RN ++ GVHMSQN  G+TTHKTE  I Y+HYH +I   
Sbjct  409  EKLVFRNSITKVRRDRKYAIQARNAYSAGVHMSQNVYGRTTHKTESLIRYYHYHNSINVM  468

Query  232  REPCRKL----VNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             EPCR+     VN + L  +GIPYV D  M+  AG +KRFE + IG
Sbjct  469  GEPCREFVPVPVNGSKLMFEGIPYVYDDNMKRLAGQIKRFEKEAIG  514



>ref|XP_002436975.1| hypothetical protein SORBIDRAFT_10g013010 [Sorghum bicolor]
 gb|EER88342.1| hypothetical protein SORBIDRAFT_10g013010 [Sorghum bicolor]
Length=522

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 118/166 (71%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W FFFDVDE+I++P   TL+ VL  L  Y+QFTIEQ PMS+KLC+ +   +  RKWGF
Sbjct  353  ANWTFFFDVDEYIYLPDGRTLQEVLGQLEAYTQFTIEQNPMSSKLCVEDPTMEYSRKWGF  412

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLV+++   G+RRDRKYA+Q RN ++TGVHMSQN +G+TTHKTE  I Y+HYH +I   
Sbjct  413  EKLVFRNSITGVRRDRKYAIQARNAYSTGVHMSQNVIGRTTHKTESLIRYYHYHNSINVM  472

Query  232  REPCRKLV----NTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             EPCR+ V    N + +  +GIPYV D  M+   G +KRFE +T+G
Sbjct  473  GEPCREFVPTPTNGSKVMFEGIPYVYDDNMKRITGEIKRFEEETLG  518



>gb|EMS62496.1| hypothetical protein TRIUR3_23927 [Triticum urartu]
Length=183

 Score =   188 bits (477),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 115/166 (69%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W FFFDVDE+I++P   +L+ VL  L  Y+QFTIEQ PMS+KLC+ +      R+WGF
Sbjct  14   ANWTFFFDVDEYIYLPDGRSLEEVLGQLERYTQFTIEQNPMSSKLCVEDPTKAYSRQWGF  73

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLV+++   G+RRDRKYA+Q R+ ++TGVHMSQN  G+TTHKTE  I Y+HYH TI   
Sbjct  74   EKLVFRNSITGVRRDRKYAIQARHAYSTGVHMSQNVYGRTTHKTESLIRYYHYHNTINVM  133

Query  232  REPCRKLV----NTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             EPCR+ V    N + +  + +P+V D  M+  AG +KRFE  T+G
Sbjct  134  EEPCREFVPKPTNGSKVMSEEVPFVYDDNMKRLAGDIKRFEEDTVG  179



>ref|XP_010555291.1| PREDICTED: uncharacterized protein LOC104824814 [Tarenaya hassleriana]
Length=479

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 122/172 (71%), Gaps = 25/172 (15%)
 Frame = -2

Query  589  KWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDF-GKTFRKWGF  413
            KWMFFFDVDEFI+VP K+T+ SV++S+  YSQFTIEQMPMS++LC   D   KT+RKWG 
Sbjct  330  KWMFFFDVDEFIYVPPKNTIASVMESMEKYSQFTIEQMPMSSELCFSGDGPAKTYRKWGI  389

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAE-  236
            EKL Y+DVK+  RRDRKYAVQPR+V+ATGVHMSQN  GKTTHK EG+I YFHYHG+I++ 
Sbjct  390  EKLAYRDVKKVHRRDRKYAVQPRSVYATGVHMSQNLEGKTTHKVEGKIRYFHYHGSISQL  449

Query  235  -RREPCRKLVNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
             +++ C                      RD    V+ FEL+TIG RL +TRQ
Sbjct  450  IKKQGC----------------------RDVGLTVRTFELRTIGDRLLRTRQ  479



>gb|EEC80517.1| hypothetical protein OsI_22786 [Oryza sativa Indica Group]
Length=332

 Score =   192 bits (488),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 116/166 (70%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W FFFDVDE+I++P    L+ VL  L  Y+QFTIEQ PMS+KLC+ +      R+WGF
Sbjct  163  ANWTFFFDVDEYIYLPDGRALEDVLAQLQPYTQFTIEQNPMSSKLCIDDPTEDYSREWGF  222

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLV+++   G+RRDRKYA+Q RN ++TGVHMSQN  G+TTHKTE  I Y+HYH +I   
Sbjct  223  EKLVFRNSITGVRRDRKYAIQARNAYSTGVHMSQNVYGRTTHKTESLIRYYHYHNSINVM  282

Query  232  REPCRKLV----NTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             EPC+K V    N + +  +GIPYV D  M+  AG ++RFE +TIG
Sbjct  283  GEPCQKFVPKPANGSKVMFEGIPYVYDDNMKRLAGEIRRFEKQTIG  328



>ref|XP_006647788.1| PREDICTED: uncharacterized protein LOC102718338 [Oryza brachyantha]
Length=519

 Score =   197 bits (500),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 115/166 (69%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W FFFDVDE+I++P   TL  VL  LSGYSQFTIEQ PMS+KLC+++      R+WGF
Sbjct  350  ANWTFFFDVDEYIYLPNGQTLDQVLGKLSGYSQFTIEQNPMSSKLCVQDPSKDYSREWGF  409

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLV+++    +RRDRKYA+Q RN ++ GVHMSQN  G+TTHKTE  I Y+HYH  I   
Sbjct  410  EKLVFRNSITKVRRDRKYAIQARNAYSAGVHMSQNVYGRTTHKTESLIRYYHYHNAINVM  469

Query  232  REPCRKL----VNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             EPCR+     VN + L  +G+PYV D  M+  AG +K FE +TIG
Sbjct  470  GEPCREFVSVPVNGSKLMFEGVPYVYDDNMKRLAGEIKHFETETIG  515



>gb|EMS60568.1| hypothetical protein TRIUR3_26687 [Triticum urartu]
Length=271

 Score =   189 bits (480),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 114/166 (69%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W FFFDVDE++++P    L  VL  LSGY+QFTIEQ PMS KLC++       R+WGF
Sbjct  101  ANWTFFFDVDEYLYLPNGQALDQVLGRLSGYTQFTIEQNPMSTKLCVKNPRNDYSREWGF  160

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EK V+++    +RRDRKYA+Q RN +ATGVHMSQN  G++THKTE  I Y+HYH +I   
Sbjct  161  EKFVFRNSITRVRRDRKYAIQARNAYATGVHMSQNIYGRSTHKTEALIRYYHYHNSINVL  220

Query  232  REPCRKLV----NTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             EPC++ V    +   +T +G+PYV D  M+  AG V+RFE +TIG
Sbjct  221  GEPCQEFVPRPGSGRKVTFEGVPYVYDDAMKRLAGEVRRFENETIG  266



>gb|EMT03263.1| hypothetical protein F775_13698 [Aegilops tauschii]
Length=246

 Score =   188 bits (477),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 113/166 (68%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W FFFDVDE++++P    L  VL  LSGY+QFTIEQ PMS KLC++       R+WGF
Sbjct  76   ANWTFFFDVDEYLYLPNGQALDQVLGRLSGYTQFTIEQNPMSTKLCVKNPRNDYSREWGF  135

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EK V+++    +RRDRKYA+Q RN +ATGVHMSQN  G++THKTE  I Y+HYH +I   
Sbjct  136  EKFVFRNSITRVRRDRKYAIQARNAYATGVHMSQNVYGRSTHKTEALIRYYHYHNSINVL  195

Query  232  REPCRKLV----NTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             EPC++ V        +T +G+PYV D  M+  AG ++RFE +TIG
Sbjct  196  GEPCQEFVPRPGGGRKVTFEGVPYVYDDAMKRLAGEIRRFENETIG  241



>ref|XP_008796313.1| PREDICTED: uncharacterized protein LOC103711805 [Phoenix dactylifera]
 ref|XP_008796320.1| PREDICTED: uncharacterized protein LOC103711805 [Phoenix dactylifera]
Length=503

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 118/166 (71%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W FFFDVDE++++P+  TL SVLD LSGY+QFTIEQ PMS+KLC+ +      ++WGF
Sbjct  334  ANWTFFFDVDEYLYLPEGRTLASVLDKLSGYTQFTIEQNPMSSKLCVLDPKKDYSKEWGF  393

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLV+++   G+RRDRKYA+Q R  +ATGVHMSQN +GKTTHKTE  I Y+HYH +I   
Sbjct  394  EKLVFRNSITGVRRDRKYAIQARKAYATGVHMSQNVIGKTTHKTEDMIRYYHYHNSINVL  453

Query  232  REPCRKLVNT----TSLTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             EPCR+ +       +   + IPYV D  M+  AG +K+FE +TIG
Sbjct  454  GEPCREFIPVPPKGNATWFEKIPYVYDDNMKRVAGTIKQFEKETIG  499



>gb|KHG02318.1| hypothetical protein F383_24787 [Gossypium arboreum]
Length=509

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 122/166 (73%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W FFFDVDE+I++P  +TL+SVL+  SGY+QFTI+Q PMS+ LCL     +  R+WGF
Sbjct  338  ANWTFFFDVDEYIYLPNGNTLESVLNEFSGYTQFTIQQNPMSSMLCLNGSSQEYSRQWGF  397

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKL++++ +  IRRDRKYA+Q +N FATGVHMS+N VGK+ HKTE +I Y+HYH TI + 
Sbjct  398  EKLLFRESRTKIRRDRKYAIQAKNAFATGVHMSENIVGKSLHKTETKIHYYHYHNTITQH  457

Query  232  REPCRKLVNTTSLT----VDGIPYVLDTTMRDAAGAVKRFELKTIG  107
            +E CR+ + +T++      + +PYV D  M+  A  +K+FEL+TIG
Sbjct  458  QELCREYLPSTAVKQVTWFNKLPYVYDNNMKKLANTIKQFELQTIG  503



>ref|NP_001057533.1| Os06g0328800 [Oryza sativa Japonica Group]
 dbj|BAD33290.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF19447.1| Os06g0328800 [Oryza sativa Japonica Group]
 dbj|BAG89758.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE65624.1| hypothetical protein OsJ_21187 [Oryza sativa Japonica Group]
Length=521

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 116/166 (70%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W FFFDVDE+I++P    L+ VL  L  Y+QFTIEQ PMS+KLC+ +      R+WGF
Sbjct  352  ANWTFFFDVDEYIYLPDGRALEDVLAQLQPYTQFTIEQNPMSSKLCIDDPTEDYSREWGF  411

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLV+++   G+RRDRKYA+Q RN ++TGVHMSQN  G+TTHKTE  I Y+HYH +I   
Sbjct  412  EKLVFRNSITGVRRDRKYAIQARNAYSTGVHMSQNVYGRTTHKTESLIRYYHYHNSINVM  471

Query  232  REPCRKLV----NTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             EPCRK V    N + +  +GIPYV D  M+  AG ++RFE +TIG
Sbjct  472  GEPCRKFVPKPANGSKVMFEGIPYVYDDNMKRLAGEIRRFEKQTIG  517



>ref|NP_001143123.1| uncharacterized protein LOC100275601 [Zea mays]
 gb|ACG29169.1| hypothetical protein [Zea mays]
 gb|AFW77062.1| hypothetical protein ZEAMMB73_000862 [Zea mays]
Length=522

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 118/166 (71%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W FFFDVDE+I++P   TL+ VL  L  Y+QFTIEQ PMS+KLC+ +   +  RKWGF
Sbjct  353  ANWTFFFDVDEYIYLPDGRTLQEVLGQLEPYTQFTIEQNPMSSKLCVEDPTMEYSRKWGF  412

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLV+++    +RRDRKYA++ RN ++TGVHMSQN +G+TTHKTE  I+Y+HYH +I   
Sbjct  413  EKLVFRNSITRVRRDRKYAIRARNAYSTGVHMSQNVIGRTTHKTESLILYYHYHNSINVM  472

Query  232  REPCRKLV----NTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             EPCR+ V    N + +  +GIPYV D  M   AG +KRFE +T+G
Sbjct  473  GEPCREFVPRPNNGSKVMFEGIPYVYDDNMERVAGEIKRFEEETLG  518



>ref|NP_001145321.1| uncharacterized protein LOC100278639 [Zea mays]
 gb|ACG46771.1| hypothetical protein [Zea mays]
Length=525

 Score =   194 bits (493),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 116/166 (70%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W FFFDVDE++++P    L  V+  LSGYSQFTIEQ PMS+KLCL++      R+WGF
Sbjct  356  ANWTFFFDVDEYLYLPNGQKLAEVIGQLSGYSQFTIEQNPMSSKLCLQDPSRNYSREWGF  415

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLV+++    +RRDRKYA+Q RNV++ GVHMSQN  G+TTHKTEG I Y+HYH +I   
Sbjct  416  EKLVFRNSITKVRRDRKYAIQARNVYSAGVHMSQNLYGRTTHKTEGLIRYYHYHDSINVM  475

Query  232  REPCRKLV----NTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             EPCR+ V    N +    +G+PYV D  M+  AG +KRFE  T+G
Sbjct  476  GEPCREFVPMPANGSKTMFEGVPYVYDDNMKRLAGEIKRFEKVTLG  521



>gb|EMT20191.1| hypothetical protein F775_11280 [Aegilops tauschii]
Length=245

 Score =   186 bits (473),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 115/166 (69%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W FFFDVDE+I++P   +L+ VL  L  Y+QFTIEQ PMS+KLC+ +      R+WGF
Sbjct  76   ANWTFFFDVDEYIYLPDGRSLEEVLGQLERYTQFTIEQNPMSSKLCVEDPTKGYSRQWGF  135

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLV+++   G+RRDRKYA++ RN ++TGVHMSQN  G+TTHKTE  I Y+HYH +I   
Sbjct  136  EKLVFRNSITGVRRDRKYAIRARNAYSTGVHMSQNVYGRTTHKTESLIRYYHYHNSINVM  195

Query  232  REPCRKLV----NTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             EPCR+ V    N + +  + +PY  D  M+  AG +KRFE +T+G
Sbjct  196  EEPCREFVPKPTNGSKVMFEEVPYFYDDNMKRLAGDIKRFEEETVG  241



>ref|XP_010927291.1| PREDICTED: uncharacterized protein LOC105049368 [Elaeis guineensis]
Length=503

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 119/168 (71%), Gaps = 8/168 (5%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W FFFDVDE++++P+  TL SVLD LSGY+QFTIEQ PMS+KLC+ +      ++WGF
Sbjct  334  ANWTFFFDVDEYLYLPEGRTLASVLDKLSGYTQFTIEQNPMSSKLCVLDPKKDYSKEWGF  393

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLV+++   G+RRDRKYA+Q R  +ATGVHMS+N +GKTTHKTE  I Y+HYH +I   
Sbjct  394  EKLVFRNSITGVRRDRKYAIQARKAYATGVHMSENVIGKTTHKTEDMIRYYHYHNSINVL  453

Query  232  REPCRKLV------NTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             EPCR+ +      N T    + IPYV D  M+  AG +K+FE +TIG
Sbjct  454  GEPCREFIPLPPKGNVTWF--EKIPYVYDDNMKRIAGTIKQFEKETIG  499



>gb|ACN33511.1| unknown [Zea mays]
 gb|AFW73082.1| hypothetical protein ZEAMMB73_523261 [Zea mays]
Length=523

 Score =   191 bits (486),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 115/166 (69%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W FFFDVDE++++P    L  V+  LSGYSQFTIEQ PMS+KLCL++      R+WGF
Sbjct  354  ANWTFFFDVDEYLYLPNGQKLAEVIGQLSGYSQFTIEQNPMSSKLCLQDPSRNYSREWGF  413

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLV+++    +RRDRKY +Q RNV++ GVHMSQN  G+TTHKTEG I Y+HYH +I   
Sbjct  414  EKLVFRNSITKVRRDRKYVIQGRNVYSAGVHMSQNLYGRTTHKTEGLIRYYHYHDSINVM  473

Query  232  REPCRKLV----NTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             EPCR+ V    N +    +G+PYV D  M+  AG +KRFE  T+G
Sbjct  474  GEPCREFVPMPANGSKTMFEGVPYVYDDNMKRLAGEIKRFEKVTLG  519



>dbj|BAK07794.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=513

 Score =   191 bits (486),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 116/166 (70%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W FFFDVDE+I++P    L+ VL  L  Y+QFTIEQ PMS+KLC+ E   +  R+WGF
Sbjct  344  ANWTFFFDVDEYIYLPDGRPLEEVLGQLERYTQFTIEQNPMSSKLCVEEPTKEYSRQWGF  403

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLV+++   G+RRDRKYA++ RN ++TGVHMSQN  G+TTHKTE  I Y+HYH +I   
Sbjct  404  EKLVFRNSITGVRRDRKYAIRARNAYSTGVHMSQNVYGRTTHKTENLIRYYHYHNSINVM  463

Query  232  REPCRKLV----NTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             EPCR+ V    N + +  + +PYV D  M+  AG +KRFE +TIG
Sbjct  464  EEPCREFVPKPSNGSKVMFEEVPYVYDDNMKRLAGDIKRFEAETIG  509



>ref|XP_006656994.1| PREDICTED: uncharacterized protein LOC102714566 [Oryza brachyantha]
Length=477

 Score =   190 bits (482),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 116/166 (70%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W FFFDVDE+I++P   TL+ VL  L  Y+QFTIEQ PMS+KLC+ +      R+WGF
Sbjct  308  ANWTFFFDVDEYIYLPDGRTLEQVLGPLERYTQFTIEQNPMSSKLCVDDPTEDYSREWGF  367

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLV+++   G+RRDRKYA+Q RN ++TGVHMSQN  G+TTHKTE  I Y+HYH +I   
Sbjct  368  EKLVFRNSITGVRRDRKYAIQARNAYSTGVHMSQNVYGRTTHKTETLIRYYHYHNSINVM  427

Query  232  REPCRKL----VNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             EPCRK     VN + +  +GI YV D  M+  AG ++RFE +TIG
Sbjct  428  GEPCRKFVPKPVNGSKVMFEGIAYVYDDKMKRLAGEIRRFEKQTIG  473



>ref|XP_010266306.1| PREDICTED: uncharacterized protein LOC104603843 [Nelumbo nucifera]
Length=478

 Score =   190 bits (482),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 118/166 (71%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W F+FDVDE+I++P  +TL+SVL+  S Y+QFTIEQ PMS+ LCL +      R+WGF
Sbjct  309  ANWTFYFDVDEYIYLPDGNTLESVLEEFSNYTQFTIEQNPMSSSLCLNDSTQDYSRQWGF  368

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKL++++ + GIRRDRKYA+Q +N ++TGVHMS+N +GKT HKTE +I Y+HYH +I+  
Sbjct  369  EKLIFRESRTGIRRDRKYAIQAKNAYSTGVHMSENVIGKTLHKTETKIRYYHYHNSISLE  428

Query  232  REPCRKLVNTTSLT----VDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             EPCR+ +  ++      VD +PYV D  M+  A  +K+ E K IG
Sbjct  429  GEPCREFLPISAKNNVTWVDKLPYVYDDNMKKLADTIKQLEKKMIG  474



>ref|XP_008782820.1| PREDICTED: uncharacterized protein LOC103702263 [Phoenix dactylifera]
Length=504

 Score =   190 bits (483),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 114/167 (68%), Gaps = 4/167 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W FFFDVDE++++P  STL+SVL  LSGY+QFTIEQ PMSN LC+ +      R+WGF
Sbjct  335  ANWTFFFDVDEYLYLPDGSTLESVLGKLSGYTQFTIEQNPMSNMLCVLDPKRNYSREWGF  394

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLV+++   G+RRDRKYA+Q RN FATGVHMS+N VGKTTH TE  I Y+HYH +I   
Sbjct  395  EKLVFRNSITGVRRDRKYAIQARNAFATGVHMSENVVGKTTHNTESMIRYYHYHNSINVL  454

Query  232  REPCRKLVNTTS----LTVDGIPYVLDTTMRDAAGAVKRFELKTIGP  104
             EPC+  V           + IPYV D  M   A  +++FE +TIGP
Sbjct  455  GEPCQVFVQMPDKGNVTWFEKIPYVYDDNMTRQADTIRQFEEETIGP  501



>ref|XP_004966964.1| PREDICTED: uncharacterized protein LOC101757183 [Setaria italica]
Length=490

 Score =   190 bits (482),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 117/166 (70%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W FFFDVDE+I++P   TL+ VL  L  Y+QFTIEQ PMS+KLC+ +   +  R+WGF
Sbjct  321  ANWTFFFDVDEYIYLPDGRTLQEVLGQLERYTQFTIEQNPMSSKLCVEDPNKEYSREWGF  380

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLV+++   G+RRDRKYA+Q RN ++TGVHMSQN +G+T+HKTE  I Y+HYH +I   
Sbjct  381  EKLVFRNSITGVRRDRKYAIQARNAYSTGVHMSQNVIGRTSHKTERLIRYYHYHNSINIM  440

Query  232  REPCRKLV----NTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             EPCR+ V    N + +  +GIPYV D  M+     +KRFE +TIG
Sbjct  441  GEPCREFVQKPTNGSKVMFEGIPYVYDDNMKRLTVEIKRFEEETIG  486



>ref|XP_009417284.1| PREDICTED: uncharacterized protein LOC103997703 [Musa acuminata 
subsp. malaccensis]
Length=520

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 119/166 (72%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W FFFDVDE+I++P+  TL+SVL +LS Y+QFTIEQ PMS+KLC+++      ++WGF
Sbjct  350  ANWTFFFDVDEYIYLPQGRTLESVLRNLSDYTQFTIEQNPMSSKLCVQDPKKDYSKEWGF  409

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLV+++   G+RRDRKYA+Q +N +ATGVHMS+N +GKTTHKTE  I Y+HYH +I   
Sbjct  410  EKLVFRNSITGVRRDRKYAIQAKNAYATGVHMSENVIGKTTHKTEDMIRYYHYHNSINVL  469

Query  232  REPCRKLVNTTSLT----VDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             EPCR+ V   +       + IPYV D  M+  A  ++RFE +TIG
Sbjct  470  GEPCREFVPLPAAGNVTWFEKIPYVYDDNMKRVADTIRRFEKQTIG  515



>gb|KHG18440.1| hypothetical protein F383_21802 [Gossypium arboreum]
Length=502

 Score =   189 bits (481),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 118/166 (71%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W F+FDVDE+I++P  +TL+SVL+  S Y+QFTIEQ PMS+ LCL +   +  R+WGF
Sbjct  332  ANWTFYFDVDEYIYLPDGNTLESVLNEFSAYTQFTIEQNPMSSLLCLNDSSQQYSRQWGF  391

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKL++++ + GIRRDRKYA+Q +N FATGVHMS+N +GKT HKTE +I Y+HYH TI   
Sbjct  392  EKLLFRESRTGIRRDRKYAIQAKNAFATGVHMSENVIGKTLHKTETKIRYYHYHNTITVH  451

Query  232  REPCRKLVNTTSLT----VDGIPYVLDTTMRDAAGAVKRFELKTIG  107
            +E CR+ +  ++       + +PYV D  M+  A  +K FE KTIG
Sbjct  452  QELCREYLPPSAKNNVTWFNKLPYVYDDNMKKLANTIKEFEHKTIG  497



>ref|XP_008776506.1| PREDICTED: uncharacterized protein LOC103696604 [Phoenix dactylifera]
Length=467

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 115/167 (69%), Gaps = 4/167 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W FFFDVDE++++P  +TL++VL  L+ Y+QFTIEQ PMS+KLC+ +      R+WGF
Sbjct  298  ANWTFFFDVDEYLYLPDGNTLETVLGELADYTQFTIEQNPMSSKLCVLDPKRDYSREWGF  357

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLV+++   G+RRDRKYA+Q RN  ATGVHMS N +GKTTHKTE  I Y+HYH +I   
Sbjct  358  EKLVFRNSITGVRRDRKYAIQARNALATGVHMSANVIGKTTHKTESMIRYYHYHDSINVL  417

Query  232  REPCRKLVNTTS----LTVDGIPYVLDTTMRDAAGAVKRFELKTIGP  104
             EPCR+ V   +       + IPYV D  M   A  +KRFE +TIGP
Sbjct  418  GEPCREFVPMPAKGNVTWFEKIPYVYDDNMTRLAATIKRFEEQTIGP  464



>ref|XP_002452656.1| hypothetical protein SORBIDRAFT_04g030080 [Sorghum bicolor]
 gb|EES05632.1| hypothetical protein SORBIDRAFT_04g030080 [Sorghum bicolor]
Length=524

 Score =   189 bits (480),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 113/166 (68%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W FFFDVDE++++P    L  VL  LSGYSQFTIEQ PMS+KLCL++      R+WGF
Sbjct  355  ANWTFFFDVDEYLYLPSGQKLDEVLGQLSGYSQFTIEQNPMSSKLCLQDPSRNYSREWGF  414

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLV+++    +RRDRKYA+Q RN ++ GVHMSQN  G+TTHKTE  I Y+HYH +I   
Sbjct  415  EKLVFRNSITKVRRDRKYAIQARNAYSAGVHMSQNLYGRTTHKTESLIRYYHYHNSINVM  474

Query  232  REPCRKLV----NTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             EPCR+ V    N +    +G+PYV D  M+  A  +KRFE  T+G
Sbjct  475  GEPCREFVPMPANGSKTMFEGVPYVYDDNMKRLADEIKRFEKVTLG  520



>ref|XP_010270611.1| PREDICTED: uncharacterized protein LOC104606894 [Nelumbo nucifera]
Length=462

 Score =   187 bits (476),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 118/166 (71%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W F+FDVDE+I++P  +TL+SVL   S Y+QF+IEQ PMS+ LCL +      ++WGF
Sbjct  293  ANWTFYFDVDEYIYLPDGNTLESVLQEFSDYTQFSIEQYPMSSNLCLNDSTQNYSKQWGF  352

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKL++K+ + GI RDRKYA+Q +N +ATGVHMS+N +GKT HKTE +I Y+HYH +I+ +
Sbjct  353  EKLLFKESRTGIWRDRKYAIQAKNAYATGVHMSENVIGKTLHKTETKIRYYHYHNSISVQ  412

Query  232  REPCRKLVNTTSLT----VDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             E CRKL+  ++      +D +PYV D  M+  A  +K+FE K IG
Sbjct  413  GELCRKLLPVSAKNNVTWIDDLPYVYDDNMKKLADKIKQFEQKAIG  458



>ref|XP_007028812.1| Domain of Uncharacterized protein function (DUF23) [Theobroma 
cacao]
 gb|EOY09314.1| Domain of Uncharacterized protein function (DUF23) [Theobroma 
cacao]
Length=501

 Score =   188 bits (478),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 117/166 (70%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W FFFDVDE+I++P  +TL+SVL+  S Y+QFTIEQ PMS+ LCL     +  R+WGF
Sbjct  331  ANWTFFFDVDEYIYLPDGNTLESVLNEFSDYTQFTIEQNPMSSVLCLNNSSEQYSRQWGF  390

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKL++++ + GIRRDRKYA+Q +N +ATGVHMS+N +GKT HKTE +I Y+HYH TI   
Sbjct  391  EKLLFRESRTGIRRDRKYAIQAKNAYATGVHMSENVIGKTLHKTETKIRYYHYHNTITVH  450

Query  232  REPCRKLVNTTSLT----VDGIPYVLDTTMRDAAGAVKRFELKTIG  107
            +E CR+ +  ++       + +PYV D  M+  A  +K FE KTIG
Sbjct  451  QELCREFLPLSAKNNVTWFNKLPYVYDDNMKKLANTIKEFERKTIG  496



>ref|XP_007208842.1| hypothetical protein PRUPE_ppa025548mg [Prunus persica]
 gb|EMJ10041.1| hypothetical protein PRUPE_ppa025548mg [Prunus persica]
Length=516

 Score =   187 bits (476),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 117/166 (70%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W F+FDVDE+I++P  +TL+SVL   S Y+QFTIEQ PMS+ LCL +      R+WGF
Sbjct  323  ANWTFYFDVDEYIYLPHGNTLESVLSDFSDYTQFTIEQNPMSSGLCLNDPTQDYSRQWGF  382

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKL+++D + G+RRDRKYA+Q +N F+TGVHMS+N  GKT H TE +I Y+HYH +I  +
Sbjct  383  EKLLFRDSRTGLRRDRKYAIQAKNAFSTGVHMSENVTGKTLHDTETKIRYYHYHNSITVQ  442

Query  232  REPCRKLVNTTS----LTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             E CR+LV  ++       + +PYV D  M+  A  +K+FELKTIG
Sbjct  443  GEICRELVPMSAKKNVTWFNKLPYVYDDNMKKLASTIKQFELKTIG  488



>gb|EPS59182.1| hypothetical protein M569_15627, partial [Genlisea aurea]
Length=480

 Score =   187 bits (474),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 116/166 (70%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W F+FDVDE+I++P  +TL+SVL   S Y+QFTIEQ PMS+ LCL +      R+WGF
Sbjct  314  ANWTFYFDVDEYIYLPAGNTLESVLGDFSNYTQFTIEQNPMSSLLCLNDSSRDYSREWGF  373

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLV++D +  IRRDRKYA+Q +N FATGVHMS+N +GK+ H TE +I Y+H+H +I   
Sbjct  374  EKLVFRDSRTRIRRDRKYAIQAKNAFATGVHMSENVIGKSLHATESRIRYYHFHNSITVH  433

Query  232  REPCRKLVNTTSLT----VDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             E CRK++  ++      +D  PYV D +MR  A  +K+FEL +IG
Sbjct  434  EELCRKMLPASAANATTWIDKTPYVYDDSMRKLAPIIKQFELDSIG  479



>ref|XP_008237881.1| PREDICTED: uncharacterized protein LOC103336601 [Prunus mume]
Length=508

 Score =   187 bits (475),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 117/166 (70%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W F+FDVDE+I++P  ++L+SVL   S Y+QFTIEQ PMS+ LCL +      R+WGF
Sbjct  315  ANWTFYFDVDEYIYLPHGNSLESVLSDFSDYTQFTIEQNPMSSALCLNDPTQDYSRQWGF  374

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKL+++D + G+RRDRKYA+Q +N F+TGVHMS+N  GKT H TE +I Y+HYH +I  +
Sbjct  375  EKLLFRDSRTGLRRDRKYAIQAKNAFSTGVHMSENVTGKTLHDTETKIRYYHYHNSITVQ  434

Query  232  REPCRKLVNTTS----LTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             E CR+LV  ++       + +PYV D  M+  A  +K+FELKTIG
Sbjct  435  GEVCRELVPMSAKKNVTWFNKLPYVYDDNMKKLASTIKQFELKTIG  480



>dbj|BAJ98571.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91412.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=623

 Score =   188 bits (478),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 86/166 (52%), Positives = 113/166 (68%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W FFFDVDE++++P    L  VL  LSGY+QFTIEQ PMS KLC++       R+WGF
Sbjct  453  ANWTFFFDVDEYLYLPDGQALDQVLAKLSGYTQFTIEQNPMSTKLCVKNPRNDYSREWGF  512

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EK V+++    +RRDRKYA+Q RN +ATGVHMSQN  G++THKTE  I Y+HYH +I   
Sbjct  513  EKFVFRNSITRVRRDRKYAIQARNAYATGVHMSQNVYGRSTHKTETLIRYYHYHNSINVL  572

Query  232  REPCRKLV----NTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             EPC++ V        +  +G+PYV D TM+  AG ++RFE +TIG
Sbjct  573  GEPCQEFVPRPGRGRKVMFEGVPYVYDDTMKRLAGEIRRFENETIG  618



>ref|XP_010910409.1| PREDICTED: uncharacterized protein LOC105036334 [Elaeis guineensis]
Length=542

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 118/167 (71%), Gaps = 4/167 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W FFFDVDE++++P  +TL++VL  L+ Y+QFTIEQ PMS+KLC+ +       +WGF
Sbjct  373  ANWTFFFDVDEYLYLPDGNTLETVLGRLAEYTQFTIEQNPMSSKLCVLDPKRDYSSEWGF  432

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLV+++   GIRRDRKYA+Q RN FATGVHMS+N +GKTTHKTE  I Y+HYH +I   
Sbjct  433  EKLVFRNSITGIRRDRKYAIQARNAFATGVHMSENVIGKTTHKTESMIRYYHYHDSINVL  492

Query  232  REPCRKLV---NTTSLT-VDGIPYVLDTTMRDAAGAVKRFELKTIGP  104
             EPCR+ V      S+T  + IPYV D  M   A  +K+FE +TIGP
Sbjct  493  GEPCREFVLMPAKGSVTWFEKIPYVYDDNMTRLAATIKQFEKQTIGP  539



>ref|XP_006294085.1| hypothetical protein CARUB_v10023079mg [Capsella rubella]
 gb|EOA26983.1| hypothetical protein CARUB_v10023079mg [Capsella rubella]
Length=495

 Score =   186 bits (471),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 114/166 (69%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W FFFDVDE+I++P  +TL+SVLD  S  +QFTIEQ PMS+ LCL +      R+WGF
Sbjct  323  ANWTFFFDVDEYIYLPHGNTLESVLDEFSVNTQFTIEQNPMSSVLCLNDSSQDYPRQWGF  382

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKL++KD +R IRRDRKYA+Q +N FATGVHMS+N VGKT HKTE +I Y+HYH TI   
Sbjct  383  EKLLFKDSRRNIRRDRKYAIQAKNAFATGVHMSENIVGKTLHKTETKIRYYHYHNTITVH  442

Query  232  REPCRKLVNTTS----LTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             E CR+++  ++       + +PYV D  M+     +K FE K +G
Sbjct  443  EELCREMLPNSAKKKVTLYNKLPYVYDDNMKKLVKTIKEFEQKKLG  488



>emb|CBI40790.3| unnamed protein product [Vitis vinifera]
Length=472

 Score =   184 bits (468),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 116/166 (70%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W F+FDVDE+I++P   TL+SV++  S Y+QFTIEQ PMS+ LCL +      R+WGF
Sbjct  301  ANWTFYFDVDEYIYLPDGRTLESVMEEFSDYTQFTIEQNPMSSVLCLNDSSRNYSREWGF  360

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKL+++D +  IRRDRKYA+Q +N ++TGVHMS+N +GKT HKTE +I Y+HYH +I+ +
Sbjct  361  EKLLFRDSRTRIRRDRKYAIQAKNAYSTGVHMSENVIGKTLHKTETKIRYYHYHNSISVQ  420

Query  232  REPCRKLVNTTSLT----VDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             EPCR+ +  ++       D +PYV D  M   A  +K+FE  TIG
Sbjct  421  GEPCREFLPISAKNNVTWFDKLPYVYDDNMTKLANTIKQFERNTIG  466



>ref|XP_010509864.1| PREDICTED: uncharacterized protein LOC104786207 [Camelina sativa]
Length=508

 Score =   185 bits (469),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 114/166 (69%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W FFFDVDE+I++P  +TL+SVLD  S  +QFTIEQ PMS+ LCL +      R+WGF
Sbjct  336  ANWTFFFDVDEYIYLPHGNTLESVLDEFSVNTQFTIEQNPMSSVLCLNDSSQDYPRQWGF  395

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKL++KD +R IRRDRKYA+Q +N FATGVHMS+N VGKT HKTE +I Y+HYH TI   
Sbjct  396  EKLLFKDSRRNIRRDRKYAIQAKNAFATGVHMSENIVGKTLHKTETKIRYYHYHNTITVH  455

Query  232  REPCRKLVNTTS----LTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             E CR+++  ++       + +PYV D  M+     +K FE K +G
Sbjct  456  EELCREMLPDSAKKRVTLYNKLPYVYDDNMKKLVKTIKEFEQKKLG  501



>ref|XP_002273918.1| PREDICTED: uncharacterized protein LOC100247851 [Vitis vinifera]
Length=504

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 116/166 (70%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W F+FDVDE+I++P   TL+SV++  S Y+QFTIEQ PMS+ LCL +      R+WGF
Sbjct  333  ANWTFYFDVDEYIYLPDGRTLESVMEEFSDYTQFTIEQNPMSSVLCLNDSSRNYSREWGF  392

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKL+++D +  IRRDRKYA+Q +N ++TGVHMS+N +GKT HKTE +I Y+HYH +I+ +
Sbjct  393  EKLLFRDSRTRIRRDRKYAIQAKNAYSTGVHMSENVIGKTLHKTETKIRYYHYHNSISVQ  452

Query  232  REPCRKLVNTTSLT----VDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             EPCR+ +  ++       D +PYV D  M   A  +K+FE  TIG
Sbjct  453  GEPCREFLPISAKNNVTWFDKLPYVYDDNMTKLANTIKQFERNTIG  498



>ref|XP_002879458.1| hypothetical protein ARALYDRAFT_902431 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55717.1| hypothetical protein ARALYDRAFT_902431 [Arabidopsis lyrata subsp. 
lyrata]
Length=495

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 113/166 (68%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W FFFDVDE+I++P  +TL+SVLD  S  +QFTIEQ PMS+ LCL +      R+WGF
Sbjct  323  ANWTFFFDVDEYIYLPHGNTLESVLDEFSVNTQFTIEQNPMSSVLCLNDSSQDYPRQWGF  382

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLV+KD +  IRRDRKYA+Q +N FATGVHMS+N VGKT HKTE +I Y+HYH TI   
Sbjct  383  EKLVFKDSRTNIRRDRKYAIQAKNAFATGVHMSENIVGKTLHKTETKIRYYHYHNTITVH  442

Query  232  REPCRKLVNTTS----LTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             E CR+++  ++       + +PYV D  M+     +K FE K +G
Sbjct  443  EELCREMLPNSAKKKVTLYNKLPYVYDDNMKKLVKTIKEFEQKKLG  488



>ref|XP_004301605.1| PREDICTED: uncharacterized protein LOC101298030 [Fragaria vesca 
subsp. vesca]
Length=509

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 114/166 (69%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W F+FDVDE+I++P  +TL+SVL+    Y+QFTIEQ PMS+ LCL +      R+WGF
Sbjct  328  ANWTFYFDVDEYIYLPDGNTLESVLNEFLDYTQFTIEQNPMSSALCLNDSTQDYSRQWGF  387

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKL+++D + G+RRDRKYA+Q +  +ATGVHMS+N  GKT HKTE +I Y+HYH +I   
Sbjct  388  EKLLFRDSRTGLRRDRKYAIQAKQAYATGVHMSENVAGKTLHKTEDKIRYYHYHNSITVP  447

Query  232  REPCRKLVNTTS----LTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             E CR+LV  ++       + +PYV D  M+  A  VK FE KTIG
Sbjct  448  GEVCRELVPMSAKNNVTMYNNLPYVFDDNMKKLASTVKEFERKTIG  493



>gb|KDP36721.1| hypothetical protein JCGZ_08012 [Jatropha curcas]
Length=498

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 114/166 (69%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W F+FDVDE+I++P  +TL+SVL   S Y+QFTIEQ PMS+ LCL +      R+WGF
Sbjct  327  ANWTFYFDVDEYIYLPLGNTLESVLKEFSDYTQFTIEQNPMSSVLCLNDSTRDYSREWGF  386

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKL++++ + GIRRDRKYA+Q +  FATGVHMS+N VGKT HKTE +I Y+HYH +I   
Sbjct  387  EKLLFRESRTGIRRDRKYAIQAKKAFATGVHMSENVVGKTLHKTEDKIRYYHYHNSITVP  446

Query  232  REPCRKLVNTTS----LTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             E CR+ +  ++       D +PYV D  M+  A  +K FE KTIG
Sbjct  447  GELCREFLPPSAKKNVTLYDKLPYVYDDNMKKLAATIKEFERKTIG  492



>ref|XP_010469454.1| PREDICTED: uncharacterized protein LOC104749510 [Camelina sativa]
Length=508

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 114/166 (69%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W FFFDVDE+I++P  +TL+SVL+  S  +QFTIEQ PMS+ LCL +      R+WGF
Sbjct  336  ANWTFFFDVDEYIYLPHGNTLESVLEEFSVNTQFTIEQNPMSSVLCLNDSSQDYPRQWGF  395

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKL++KD +R IRRDRKYA+Q +N FATGVHMS+N VGKT HKTE +I Y+HYH TI   
Sbjct  396  EKLLFKDSRRNIRRDRKYAIQAKNAFATGVHMSENIVGKTLHKTETKIRYYHYHNTITVH  455

Query  232  REPCRKLVNTTS----LTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             E CR+++  ++       + +PYV D  M+     +K FE K +G
Sbjct  456  EELCREMLPNSAKKKVTLYNKLPYVYDDNMKKLVKTIKEFEQKKLG  501



>ref|XP_010413841.1| PREDICTED: uncharacterized protein LOC104700087 [Camelina sativa]
Length=504

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 114/166 (69%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W FFFDVDE+I++P  +TL+SVL+  S  +QFTIEQ PMS+ LCL +      R+WGF
Sbjct  332  ANWTFFFDVDEYIYLPHGNTLESVLEEFSVNTQFTIEQNPMSSVLCLNDSSQDYPRQWGF  391

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKL++KD +R IRRDRKYA+Q +N FATGVHMS+N VGKT HKTE +I Y+HYH TI   
Sbjct  392  EKLLFKDSRRNIRRDRKYAIQAKNAFATGVHMSENIVGKTLHKTETKIRYYHYHNTITVH  451

Query  232  REPCRKLVNTTS----LTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             E CR+++  ++       + +PYV D  M+     +K FE K +G
Sbjct  452  EELCREMLPNSAKKKVTLYNKLPYVYDDNMKKLVKTIKEFEQKKLG  497



>ref|XP_011041123.1| PREDICTED: uncharacterized protein LOC105137176 [Populus euphratica]
Length=495

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 115/166 (69%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W FFFDVDE+I++P+ +TL+SVL   S Y+QFTIEQ PMS+ LC  +      R+WGF
Sbjct  324  ANWTFFFDVDEYIYLPEGNTLESVLKDFSNYTQFTIEQNPMSSALCFNDSTQDYPRQWGF  383

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKL++++ + GIRRDRKYA+Q +N +ATGVHMS+N +GKT H+TE +I Y+HYH +I   
Sbjct  384  EKLLFRESRTGIRRDRKYAIQAKNAYATGVHMSENVIGKTLHQTETKIRYYHYHNSIQVL  443

Query  232  REPCRKLVNTTSLT----VDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             E CR+ +  ++       +G+PYV D  M+  A  +K FE  TIG
Sbjct  444  GELCREFLPLSAKNNVTWYNGLPYVYDDNMKKLASTIKDFERNTIG  489



>emb|CAN76802.1| hypothetical protein VITISV_000632 [Vitis vinifera]
Length=556

 Score =   184 bits (467),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 116/166 (70%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W F+FDVDE+I++P   TL+SV++  S Y+QFTIEQ PMS+ LCL +      R+WGF
Sbjct  385  ANWTFYFDVDEYIYLPDGRTLESVMEEFSDYTQFTIEQNPMSSVLCLNDSSRNYSREWGF  444

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKL+++D +  IRRDRKYA+Q +N ++TGVHMS+N +GKT HKTE +I Y+HYH +I+ +
Sbjct  445  EKLLFRDSRTRIRRDRKYAIQAKNAYSTGVHMSENVIGKTLHKTETKIRYYHYHNSISVQ  504

Query  232  REPCRKLVNTTSLT----VDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             EPCR+ +  ++       D +PYV D  M   A  +K+FE  TIG
Sbjct  505  GEPCREFLPISAKNNVTWFDKLPYVYDDNMTKLANTIKQFERNTIG  550



>emb|CDX84681.1| BnaA03g15490D [Brassica napus]
Length=449

 Score =   182 bits (461),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 113/166 (68%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A+W FFFDVDE+I++P  +TLKSVL   S Y+QFTIEQ PMS+ LCL +      R+WGF
Sbjct  276  AEWTFFFDVDEYIYLPGGNTLKSVLAEFSDYTQFTIEQNPMSSVLCLNDSTQDYPRQWGF  335

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKL++++ +  IRRDRKYA+Q +N FATGVHMS+N VGKT HKTE +I Y+HYH TI   
Sbjct  336  EKLLFRESRTNIRRDRKYAIQAKNAFATGVHMSENVVGKTLHKTETKIRYYHYHNTITVH  395

Query  232  REPCRKLVNTTS----LTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             E CR+++  ++         +PYV D  M+     +K FE K +G
Sbjct  396  EELCREMLPVSAKKKVTLYKKLPYVYDDNMKKLVNTIKEFEQKKLG  441



>ref|XP_002510749.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52936.1| conserved hypothetical protein [Ricinus communis]
Length=487

 Score =   182 bits (463),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 115/166 (69%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W F+FDVDE+I++P  STL+SVL   S Y+QFTIEQ PMS+ LCL +      R+WGF
Sbjct  316  ANWTFYFDVDEYIYLPDGSTLQSVLAEFSDYTQFTIEQNPMSSVLCLNDSSHDYPREWGF  375

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKL++++ + GIRRDRKYA+Q +N FATGVHMS+N VGKT HKTE +I Y+HYH +I  +
Sbjct  376  EKLLFRESRSGIRRDRKYAIQAKNAFATGVHMSENVVGKTLHKTETKIRYYHYHNSITVQ  435

Query  232  REPCRKLVNTTS----LTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             E CR+L+  ++       + +PYV D  M+     ++ FE  TIG
Sbjct  436  GELCRQLLPASAKHNVTWYNKLPYVYDDNMKKLVTTIRDFERNTIG  481



>emb|CDY27956.1| BnaCnng05410D [Brassica napus]
Length=383

 Score =   180 bits (457),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 114/166 (69%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A+W FFFDVDE+I++P  +TL++VL+  S Y+QFTIEQ PMSN LCL +      R+WGF
Sbjct  210  ARWTFFFDVDEYIYLPDGNTLEAVLNEFSRYTQFTIEQNPMSNVLCLNDSTQDYPRQWGF  269

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EK+++++ +  IRRDRKYA+Q +N FATGVHMS+N VGKT HKTE +I Y+HYH TI   
Sbjct  270  EKMLFRESRTNIRRDRKYAIQAKNAFATGVHMSENVVGKTLHKTERKIRYYHYHNTITVH  329

Query  232  REPCRKLVNTTS----LTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             E CR+++  ++         +PYV D  M+     VK FE K +G
Sbjct  330  EELCREMLPVSAKDNVTFYKKLPYVYDDKMKKLVNTVKEFEEKKLG  375



>ref|XP_010094491.1| hypothetical protein L484_024782 [Morus notabilis]
 gb|EXB56245.1| hypothetical protein L484_024782 [Morus notabilis]
Length=492

 Score =   182 bits (463),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 116/169 (69%), Gaps = 4/169 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W F+FDVDE+I++P  + L+SVL  LS Y+QFTIEQ PMS+ LCL        R+WGF
Sbjct  319  ANWTFYFDVDEYIYLPDGNGLESVLSELSDYTQFTIEQNPMSSSLCLNVSTHNYSREWGF  378

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKL++++ + GIRRDRKYA+Q +N +ATGVHMS+N +GKT H TE +I Y+HYH +I+  
Sbjct  379  EKLLFRESRTGIRRDRKYAIQAKNAYATGVHMSENVIGKTQHNTETKIRYYHYHNSISVM  438

Query  232  REPCRKLVNTTS----LTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRL  98
             EPCR+ +  T+       + +PYV D  M+  A  +K+FE  +IG  L
Sbjct  439  GEPCREWLALTAKDNVTWHNKLPYVYDDNMKKLAKTIKQFERDSIGTLL  487



>ref|XP_002307008.1| hypothetical protein POPTR_0005s28030g [Populus trichocarpa]
 gb|EEE94004.1| hypothetical protein POPTR_0005s28030g [Populus trichocarpa]
Length=495

 Score =   182 bits (463),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 115/166 (69%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W F+FDVDE+I++P+ +TL+SVL   S Y+QFTIEQ PMS+ LC  +      R+WGF
Sbjct  324  ANWTFYFDVDEYIYLPEGNTLESVLKDFSNYTQFTIEQNPMSSALCFNDSTQDYPRQWGF  383

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKL++++ + GIRRDRKYA+Q +N +ATGVHMS+N +GKT H+TE +I Y+HYH +I   
Sbjct  384  EKLLFRESRTGIRRDRKYAIQAKNAYATGVHMSENVIGKTLHQTETKIRYYHYHNSIQVP  443

Query  232  REPCRKLVNTTSLT----VDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             E CR+ +  ++       +G+PYV D  M+  A  +K FE  TIG
Sbjct  444  GELCREFLPLSAKNNVTWYNGLPYVYDDNMKKLASTIKDFERNTIG  489



>ref|XP_010666271.1| PREDICTED: uncharacterized protein LOC104883439 [Beta vulgaris 
subsp. vulgaris]
Length=511

 Score =   182 bits (462),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 119/166 (72%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            AKW F+FDVDE+I+VP+ ++LK+V++   G++QFTIEQ PMS+ LCL +      R+WGF
Sbjct  339  AKWTFYFDVDEYIYVPQGNSLKNVMEEFDGFTQFTIEQNPMSSSLCLNDSSQDYSRQWGF  398

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLV++D +  IRRDRKYA+Q RN  ATGVHMS+N VGK  H+T+ +I Y+HYH +I   
Sbjct  399  EKLVFRDWRTRIRRDRKYAIQARNALATGVHMSENIVGKALHRTDKKIRYYHYHNSIQVP  458

Query  232  REPCRKLVNTTS---LTV-DGIPYVLDTTMRDAAGAVKRFELKTIG  107
             EPCR  +  ++   +T+ + +PYV D  M++ A  +KR E +T+G
Sbjct  459  GEPCRVFLPPSAKKKITIHEKLPYVYDDNMKNLADTIKRSERETLG  504



>emb|CDY17187.1| BnaA05g10010D [Brassica napus]
Length=490

 Score =   181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 113/166 (68%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W FFFDVDE+I++P  +TL+SVL+  S Y+QFTIEQ PMSN LCL +      R+WGF
Sbjct  317  ANWTFFFDVDEYIYLPDGNTLESVLNEFSRYTQFTIEQNPMSNVLCLNDSSQDYPRQWGF  376

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EK+++++ +  IRRDRKYA+Q +N FATGVHMS+N VGKT HKTE +I Y+HYH TI   
Sbjct  377  EKMLFRESRTNIRRDRKYAIQAKNAFATGVHMSENVVGKTLHKTERKIRYYHYHNTITVH  436

Query  232  REPCRKLVNTTS----LTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             E CR+++  ++         +PYV D  M+     VK FE K +G
Sbjct  437  EELCREMLPVSAKDNVTFYKKLPYVYDDKMKKLVNTVKEFEEKKLG  482



>ref|XP_009143843.1| PREDICTED: uncharacterized protein LOC103867522 [Brassica rapa]
Length=491

 Score =   181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 113/166 (68%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W FFFDVDE+I++P  +TL+SVL+  S Y+QFTIEQ PMSN LCL +      R+WGF
Sbjct  318  ANWTFFFDVDEYIYLPDGNTLESVLNEFSRYTQFTIEQNPMSNVLCLNDSSQDYPRQWGF  377

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EK+++++ +  IRRDRKYA+Q +N FATGVHMS+N VGKT HKTE +I Y+HYH TI   
Sbjct  378  EKMLFRESRTNIRRDRKYAIQAKNAFATGVHMSENVVGKTLHKTERKIRYYHYHNTITVH  437

Query  232  REPCRKLVNTTS----LTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             E CR+++  ++         +PYV D  M+     VK FE K +G
Sbjct  438  EELCREMLPVSAKDNVTFYKKLPYVYDDKMKKLVNTVKEFEEKKLG  483



>ref|XP_009415437.1| PREDICTED: uncharacterized protein LOC103996273 [Musa acuminata 
subsp. malaccensis]
Length=506

 Score =   181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 116/166 (70%), Gaps = 5/166 (3%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W F+FDVDE++++P+  TL+SVL +LS Y+QFTIEQ PMS+KLC   D     R WGF
Sbjct  338  ANWTFYFDVDEYLYLPEGRTLESVLANLSAYTQFTIEQNPMSSKLCAL-DSKDYSRDWGF  396

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLV+++    +RRDRKYA+Q +N +ATGVHMS+N +GKTTH+TE  I Y+HYH +I   
Sbjct  397  EKLVFRNSITRVRRDRKYAIQAKNAYATGVHMSENIIGKTTHRTEDMIRYYHYHNSINVL  456

Query  232  REPCRKLVNTTS----LTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             EPCR+ V + +       + IPYV D  M+  A  +KRFE +TIG
Sbjct  457  GEPCREFVPSPAQGNVTWFEKIPYVYDDNMKRLAETIKRFEKQTIG  502



>ref|NP_565768.1| galactan synthase 1 [Arabidopsis thaliana]
 gb|AAB80674.2| expressed protein [Arabidopsis thaliana]
 gb|AAM61399.1| unknown [Arabidopsis thaliana]
 gb|AAM98200.1| expressed protein [Arabidopsis thaliana]
 gb|AAP68307.1| At2g33570 [Arabidopsis thaliana]
 gb|AEC08854.1| uncharacterized protein AT2G33570 [Arabidopsis thaliana]
 gb|AHL38815.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=496

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 113/166 (68%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W FFFDVDE+I++P  +TL+SVLD  S  +QFTIEQ PMS+ LC+ +      R+WGF
Sbjct  324  ANWTFFFDVDEYIYLPHGNTLESVLDEFSVNTQFTIEQNPMSSVLCINDSSQDYPRQWGF  383

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKL++KD +  IRRDRKYA+Q +N FATGVHMS+N VGKT HKTE +I Y+HYH TI   
Sbjct  384  EKLLFKDSRTKIRRDRKYAIQAKNAFATGVHMSENIVGKTLHKTETKIRYYHYHNTITVH  443

Query  232  REPCRKLVNTTS----LTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             E CR+++  ++       + +PYV D  M+     +K FE K +G
Sbjct  444  EELCREMLPNSAKKKVTLYNKLPYVYDDNMKKLVKTIKEFEQKKLG  489



>emb|CDX79534.1| BnaC03g18700D [Brassica napus]
Length=488

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 114/166 (69%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A+W FFFDVDE+I++P  +TL+SVL   S Y+QFTIEQ PMS+ LCL +      R+WGF
Sbjct  315  AEWTFFFDVDEYIYLPDGNTLESVLAEFSDYTQFTIEQNPMSSVLCLNDSTQGYPRQWGF  374

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKL++++ +  IRRDRKYA+Q +N FATGVHMS+N VGKT HKTE +I Y+HYH TI   
Sbjct  375  EKLLFRESRTNIRRDRKYAIQAKNAFATGVHMSENVVGKTLHKTETKIRYYHYHNTITVH  434

Query  232  REPCRKLVNTTS----LTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             E CR+++  ++         +P+V D +M+     +K FE K IG
Sbjct  435  EELCREMLPASAKEKVTLYKKLPFVYDDSMKKLVNTIKEFEQKKIG  480



>ref|XP_009132936.1| PREDICTED: uncharacterized protein LOC103857495 [Brassica rapa]
Length=493

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 113/166 (68%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A+W FFFDVDE+I++P  +TL+SVL   S Y+QFTIEQ PMS+ LCL +      R+WGF
Sbjct  320  AEWTFFFDVDEYIYLPGGNTLESVLAEFSDYTQFTIEQNPMSSVLCLNDSTQDYPRQWGF  379

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKL++++ +  IRRDRKYA+Q +N FATGVHMS+N VGKT HKTE +I Y+HYH TI   
Sbjct  380  EKLLFRESRTNIRRDRKYAIQAKNAFATGVHMSENVVGKTLHKTETKIRYYHYHNTITVH  439

Query  232  REPCRKLVNTTS----LTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             E CR+++  ++         +PYV D  M+     +K FE K +G
Sbjct  440  EELCREMLPVSAKKKVTLYKKLPYVYDDNMKKLVNTIKEFEQKKLG  485



>gb|EMS66628.1| hypothetical protein TRIUR3_12773 [Triticum urartu]
Length=224

 Score =   174 bits (440),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/172 (51%), Positives = 113/172 (66%), Gaps = 13/172 (8%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLR------EDFGKT  431
            A+W FFFDVDE+IF+P   TL  VL  L  Y+QFTIEQ PMS++LC R       D+ K 
Sbjct  52   ARWTFFFDVDEYIFLPDGRTLDGVLAELDPYTQFTIEQNPMSSRLCARGANDSEADYSK-  110

Query  430  FRKWGFEKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYH  251
              +WGFEKLV+++   G+RRDRKYA+Q +N +ATGVHMS+N +G TTHKTE  I Y+HYH
Sbjct  111  --QWGFEKLVFRNSITGVRRDRKYAIQAKNAYATGVHMSENVIGNTTHKTEHLIRYYHYH  168

Query  250  GTIAERREPCRKLVNTTS----LTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             TI    E CR+LV        +  +  P+  D +M+  A AV+ FE +TIG
Sbjct  169  NTINVPGELCRELVPVPPKGGVMWSEKTPWYHDDSMKRLANAVREFEKRTIG  220



>gb|KFK31016.1| hypothetical protein AALP_AA6G057400 [Arabis alpina]
Length=500

 Score =   180 bits (457),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 112/166 (67%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W FFFDVDE+I++P  +TL+SVLD  S  +QFTIEQ PMS+ LCL +      R+WGF
Sbjct  327  ANWTFFFDVDEYIYLPDGNTLESVLDGFSDNTQFTIEQNPMSSVLCLNDSSQDYPRQWGF  386

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKL++K+ +  IRRDRKYA+Q +N FATGVHMS+N VGKT HKTE +I Y+HYH TI   
Sbjct  387  EKLLFKESRTNIRRDRKYAIQAKNAFATGVHMSENVVGKTLHKTEKKIRYYHYHNTITVH  446

Query  232  REPCRKLVNTTSLT----VDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             E CR+++  ++         +P+V D  M+     +K FE K IG
Sbjct  447  EELCREMLPASAKNNVTFYKKLPFVFDDNMKKLVKTIKEFEQKKIG  492



>ref|XP_010063184.1| PREDICTED: uncharacterized protein LOC104450362 [Eucalyptus grandis]
 gb|KCW70384.1| hypothetical protein EUGRSUZ_F03619 [Eucalyptus grandis]
Length=504

 Score =   179 bits (455),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 111/166 (67%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W FFFDVDE+IF+P  S+L+SVL     Y+QFTIEQ PMS+ LCL +      R+WGF
Sbjct  330  ANWTFFFDVDEYIFLPDGSSLESVLTEFGNYTQFTIEQNPMSSVLCLNDSSQDYSREWGF  389

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKL+++D + GIRRDRKYA+Q +N FATGVHMS+N VG+  HKTE +I Y+HYH +I   
Sbjct  390  EKLLFRDSRTGIRRDRKYAIQAKNAFATGVHMSENVVGEALHKTEDKIRYYHYHNSITVP  449

Query  232  REPCRKLVNTTS----LTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             E CR+L+  ++       D  P+V D  M+  A  +K FE   IG
Sbjct  450  GELCRELLPMSARRNVTWYDKRPFVYDDHMKKLAPVIKEFERNAIG  495



>ref|XP_008799144.1| PREDICTED: uncharacterized protein LOC103713874 [Phoenix dactylifera]
Length=503

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 114/167 (68%), Gaps = 6/167 (4%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRK-WG  416
            A W FFFDVDE++++P+  TL SVLD LS Y+QFTI Q PMS+KLC+  D  K + K WG
Sbjct  336  ANWTFFFDVDEYLYLPEGRTLASVLDKLSQYTQFTIVQNPMSSKLCVL-DLNKDYSKEWG  394

Query  415  FEKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAE  236
            FEKLV+++   G+RRDRKYA+Q RN FATGVHMS+N +GKTTH T+  I Y+HYH +I  
Sbjct  395  FEKLVFRNSITGVRRDRKYAIQARNAFATGVHMSENVIGKTTHNTKDMIRYYHYHSSINV  454

Query  235  RREPCRKLVNTTS----LTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
              EPC + +   +       + IPYV D  M+  A  VK+FE + IG
Sbjct  455  LGEPCHEFMPMPAKGKVTWFEKIPYVYDDNMKRMAEVVKQFEKEAIG  501



>ref|NP_001130404.1| uncharacterized protein LOC100191500 [Zea mays]
 gb|ACF78602.1| unknown [Zea mays]
 gb|ACF84215.1| unknown [Zea mays]
 gb|ACF85531.1| unknown [Zea mays]
 gb|ACN26644.1| unknown [Zea mays]
 gb|ACN34683.1| unknown [Zea mays]
 gb|AFW87401.1| hypothetical protein ZEAMMB73_107903 [Zea mays]
Length=501

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/168 (51%), Positives = 112/168 (67%), Gaps = 6/168 (4%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            AKW FFFDVDE++F+P    L+ VL  L  Y+QFTIEQ PMS+KLC+ +       +WGF
Sbjct  330  AKWTFFFDVDEYMFLPDGRALEDVLAELEPYTQFTIEQNPMSSKLCVDDPAADYSNQWGF  389

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLV+++   G+RRDRKYA+Q +N +ATGVHMS+N +G TTHKTE  I Y+HYH TI   
Sbjct  390  EKLVFRNSITGVRRDRKYAIQAKNAYATGVHMSENVIGNTTHKTEHLIRYYHYHNTINVL  449

Query  232  REPCRKLVNTTSLTVDGI------PYVLDTTMRDAAGAVKRFELKTIG  107
             E CR+ V+       G+      P+  D +M+  AGAV+ FE +TIG
Sbjct  450  GEVCREFVSVPPKKGGGLTWSEKTPWYYDGSMKRVAGAVREFERETIG  497



>ref|XP_010932160.1| PREDICTED: uncharacterized protein LOC105052881 [Elaeis guineensis]
Length=527

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 113/166 (68%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W FFFDVDE++++P+   L SVLD LS Y+QFTIEQ  MS+KLC+ +      ++WG 
Sbjct  360  ANWTFFFDVDEYLYLPEGRRLASVLDKLSQYTQFTIEQNSMSSKLCVLDPNKDYSKEWGL  419

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLV+++   G+RRDRKYA+Q RN +ATGVHMS+N +GKTTH TE    Y+HYH +I   
Sbjct  420  EKLVFRNSITGVRRDRKYAIQARNAYATGVHMSENVIGKTTHNTEDMFRYYHYHNSINVL  479

Query  232  REPCRKLVNTTS----LTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             EPC++ +   +       +GIPYV D  M+  A  VK+FE +TIG
Sbjct  480  GEPCQEFMPMPAKGKVTWFEGIPYVYDNNMKRMAEVVKQFEKETIG  525



>ref|XP_011083362.1| PREDICTED: uncharacterized protein LOC105165907 [Sesamum indicum]
 ref|XP_011083363.1| PREDICTED: uncharacterized protein LOC105165907 [Sesamum indicum]
 ref|XP_011083364.1| PREDICTED: uncharacterized protein LOC105165907 [Sesamum indicum]
Length=544

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 111/166 (67%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W F+FDVDE+I++P  +TL+SVL   S  +QFTIEQ  MS+ LCL +      R+WG 
Sbjct  370  ANWTFYFDVDEYIYLPDGNTLESVLRDFSNNTQFTIEQNAMSSVLCLNDSPQGYSRQWGL  429

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLV++D +  IRRDRKYA+Q +N +ATGVHMS+N +G T HKTE +I Y+HYH TI   
Sbjct  430  EKLVFRDSRTRIRRDRKYAIQAKNAYATGVHMSENVIGGTLHKTESRIRYYHYHNTITVH  489

Query  232  REPCRKLVNTTSLT----VDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             E CR LV  ++      +D IP+V D  MR  A  +K FE KTIG
Sbjct  490  EELCRNLVPVSAKNATTWLDKIPFVYDDNMRKLAPTIKEFERKTIG  535



>gb|EYU41216.1| hypothetical protein MIMGU_mgv1a005071mg [Erythranthe guttata]
Length=498

 Score =   178 bits (451),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/175 (49%), Positives = 114/175 (65%), Gaps = 4/175 (2%)
 Frame = -2

Query  595  QAKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWG  416
             A W F+FDVDE+I++P   +L+SVL   S  +QFTIEQ  +S+ LCL +      R+WG
Sbjct  320  SANWTFYFDVDEYIYIPDGDSLESVLHDFSNNTQFTIEQNAISSVLCLNDSTQDYSRQWG  379

Query  415  FEKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAE  236
            FEK+V++D +  IRRDRKYA+Q RN +ATGVHMS+N VG T H TE +I Y+HYH TI  
Sbjct  380  FEKMVFRDSRTKIRRDRKYAIQARNAYATGVHMSENVVGGTLHDTESRIRYYHYHSTITV  439

Query  235  RREPCRKLVNTTS----LTVDGIPYVLDTTMRDAAGAVKRFELKTIGPRLQKTRQ  83
              E CR ++  ++      +D IPYV D  M+  A  VK+FE  TIG   Q+ R+
Sbjct  440  HEELCRNMLPMSAKKATTYLDKIPYVYDDNMKKLAPTVKKFERDTIGVGSQRRRR  494



>ref|XP_003570222.1| PREDICTED: uncharacterized protein LOC100831738 [Brachypodium 
distachyon]
Length=528

 Score =   178 bits (451),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 112/166 (67%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W FFFDVDE++++P   TL  VL +LSGY+Q TI+Q PMS+KLCL+     + R+WGF
Sbjct  359  ANWTFFFDVDEYMYLPNGRTLDQVLGNLSGYTQLTIKQNPMSSKLCLKNPSKDSSREWGF  418

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EK V+ +     RRDRKYAVQ RN ++ GVH+SQN  G++TH TE  I Y+H+H +I   
Sbjct  419  EKFVFFNAVVKPRRDRKYAVQARNTYSAGVHLSQNLYGRSTHDTENVIRYYHFHNSINVL  478

Query  232  REPCRKLV----NTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             EPC+K V    N + +  +G P+V D  ++  AG +KRFE +TIG
Sbjct  479  GEPCKKFVAKPANGSQIMFEGAPFVYDYNLKRLAGEIKRFEKETIG  524



>ref|XP_002437304.1| hypothetical protein SORBIDRAFT_10g024570 [Sorghum bicolor]
 gb|EER88671.1| hypothetical protein SORBIDRAFT_10g024570 [Sorghum bicolor]
Length=509

 Score =   177 bits (448),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 113/166 (68%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            AKW FFFDVDE+IF+P   +L+ VL  L  Y+QFTIEQ PMS+KLC+ +       +WGF
Sbjct  340  AKWTFFFDVDEYIFLPDGRSLEDVLAELEPYTQFTIEQNPMSSKLCVDDPEADYSNQWGF  399

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLV+++   G+RRDRKYA+Q +N +ATGVHMS+N +G TTHKTE  I Y+HYH TI   
Sbjct  400  EKLVFRNSITGVRRDRKYAIQAKNAYATGVHMSENVIGNTTHKTEHLIRYYHYHNTINVL  459

Query  232  REPCRKLVNTT---SLT-VDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             E CR+ V+      LT  +  P+  D +M+  A AV+ FE +TIG
Sbjct  460  GEVCREFVSVPPKGGLTWSEKTPWYYDNSMKRVADAVREFERETIG  505



>ref|XP_010539085.1| PREDICTED: uncharacterized protein LOC104813216 [Tarenaya hassleriana]
Length=493

 Score =   176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 111/166 (67%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W FFFDVDE+I++P  +TL+S+L   S  +QFTIEQ PMS+ LCL +       +WGF
Sbjct  319  ANWTFFFDVDEYIYLPNGNTLESILAEFSDNTQFTIEQNPMSSVLCLNDSTQDYAGQWGF  378

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLV+++ + GIRRDRKYA+Q RN +ATGVHMS+N +GKT H+TE +I Y+HYH TI   
Sbjct  379  EKLVFRESRTGIRRDRKYAIQARNTYATGVHMSENAIGKTLHRTETKIRYYHYHNTITFH  438

Query  232  REPCRKLVNTTS----LTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             E CR+L+  ++       + +PY  D  M      VK FE +T+G
Sbjct  439  EELCRELLPASAKKKVTLYNKLPYNYDDNMNKLVKTVKEFEQRTLG  484



>ref|XP_006657150.1| PREDICTED: uncharacterized protein LOC102701737 [Oryza brachyantha]
Length=288

 Score =   170 bits (430),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 88/169 (52%), Positives = 113/169 (67%), Gaps = 7/169 (4%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLRE-DFGKT--FRK  422
            AKW FFFDVDE+IF+P   TL++VL  L  Y+QFTIEQ PMS++LC R  D  +T    +
Sbjct  116  AKWTFFFDVDEYIFLPDGRTLEAVLADLEPYTQFTIEQNPMSSRLCARNPDDPETDYSNQ  175

Query  421  WGFEKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTI  242
            WGFEKL +++   G+RRDRKYA+Q +N +ATGVHMS+N +G TTHKTE  I Y+HYH TI
Sbjct  176  WGFEKLAFRNSITGVRRDRKYAIQAKNAYATGVHMSENVIGNTTHKTEHLIRYYHYHNTI  235

Query  241  AERREPCRKLVNTTS---LT-VDGIPYVLDTTMRDAAGAVKRFELKTIG  107
                E CR+ V       LT  +  P+  D +M+  A  V+ FE KTIG
Sbjct  236  NVLGEVCREFVPIPPKGGLTWSEKTPWYYDDSMKRLADTVREFERKTIG  284



>ref|XP_006410501.1| hypothetical protein EUTSA_v10016550mg [Eutrema salsugineum]
 gb|ESQ51954.1| hypothetical protein EUTSA_v10016550mg [Eutrema salsugineum]
Length=502

 Score =   174 bits (442),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 110/166 (66%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W FFFDVDE+I++P  +TL+SVL   S  +QFTIEQ PMSN LCL +      R+WGF
Sbjct  329  ANWTFFFDVDEYIYLPDGNTLESVLAEFSVNTQFTIEQNPMSNVLCLNDASQDYPRQWGF  388

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKL++K+ +  IRRDRKYA+Q +N FATGVHMS+N VGKT HKTE +I Y+HYH TI   
Sbjct  389  EKLLFKESRTNIRRDRKYAIQAKNAFATGVHMSENVVGKTLHKTEKKIRYYHYHNTITVH  448

Query  232  REPCRKLVNTTSLT----VDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             E CR+++  ++          P+V D  M+     VK FE K +G
Sbjct  449  EELCREMLPVSAKNNVTFYKKRPFVYDDNMKKLVKTVKEFEKKKLG  494



>gb|EMT15330.1| hypothetical protein F775_17170 [Aegilops tauschii]
Length=576

 Score =   175 bits (444),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 88/172 (51%), Positives = 113/172 (66%), Gaps = 13/172 (8%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLR------EDFGKT  431
            A+W FFFDVDE+IF+P   TL+ VL  L  Y+QFTIEQ PMS++LC R       DF K 
Sbjct  332  ARWTFFFDVDEYIFLPDGRTLEGVLAELDPYTQFTIEQNPMSSRLCARGANDSEADFSK-  390

Query  430  FRKWGFEKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYH  251
              +WGFEKLV+++   G+RRDRKYA+Q +N +ATGVHMS+N +G TTHKTE  I Y+HYH
Sbjct  391  --QWGFEKLVFRNSITGVRRDRKYAIQAKNAYATGVHMSENVIGNTTHKTEHLIRYYHYH  448

Query  250  GTIAERREPCRKLVNTTS----LTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             TI    E CR+LV           +  P+  D +M+  A AV+ FE +TIG
Sbjct  449  NTINVPGELCRELVPVPPKGGVTWSEKTPWYYDDSMKRVANAVREFEKRTIG  500



>ref|XP_003563598.1| PREDICTED: uncharacterized protein LOC100821285 [Brachypodium 
distachyon]
Length=508

 Score =   174 bits (440),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 112/172 (65%), Gaps = 13/172 (8%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLRE------DFGKT  431
            AKW FFFDVDE+IF+P   TL+SV+  L  Y+QFTIEQ PMS++LC R+      D+   
Sbjct  336  AKWTFFFDVDEYIFIPGGRTLESVMAELEPYTQFTIEQNPMSSRLCARDPGDPKADYSN-  394

Query  430  FRKWGFEKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYH  251
              +WGFEKLV+++   G+RRDRKYA+Q +N +ATGVHMS+N +G TTHKTE  I Y+HYH
Sbjct  395  --QWGFEKLVFRNSITGVRRDRKYAIQAKNAYATGVHMSENVIGNTTHKTEHLIRYYHYH  452

Query  250  GTIAERREPCRKLVNTTS----LTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             TI    E CR+ V           +  P+  D +M+  A AV+ FE  TIG
Sbjct  453  NTINVLGEVCREFVPVPPKGGVTWSEKTPWYYDDSMKRVANAVREFERNTIG  504



>ref|XP_010556045.1| PREDICTED: uncharacterized protein LOC104825419 [Tarenaya hassleriana]
Length=505

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 110/166 (66%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W F+FDVDE+I++P  +TL+SVL   S  +QFTIEQ PMS+ LCL +       +WGF
Sbjct  330  ANWTFYFDVDEYIYLPGGNTLESVLSEFSDNTQFTIEQNPMSSVLCLNDSAQDYAGQWGF  389

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKL +++ + GIRRDRKYA+Q +N +ATGVHMS+N VGKT HKTE  I Y+HYH TI   
Sbjct  390  EKLQFRESRTGIRRDRKYAIQAKNAYATGVHMSENVVGKTLHKTETNIRYYHYHNTITVH  449

Query  232  REPCRKLVNTTS----LTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             E CR+L+  ++       +  PYV D  M+     V+ FE +T+G
Sbjct  450  EELCRELLPVSAKKKVTLFNKHPYVYDDNMKKLVKTVREFEQRTLG  495



>ref|XP_004965848.1| PREDICTED: uncharacterized protein LOC101759875 [Setaria italica]
Length=512

 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 111/166 (67%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            AKW FFFDVDE+IF+P    L+ VL  L  Y+QFTIEQ PMS++LC+ +       +WGF
Sbjct  343  AKWTFFFDVDEYIFLPDGRKLEDVLAELEPYTQFTIEQNPMSSRLCVDDPEADYSNQWGF  402

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKLV+++   G+RRDRKYA+Q +N +ATGVHMS+N +G TTHKTE  I Y+HYH TI   
Sbjct  403  EKLVFRNSITGVRRDRKYAIQAKNAYATGVHMSENVIGNTTHKTEHLIRYYHYHNTINVL  462

Query  232  REPCRKLVNTTS---LT-VDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             E CR+ V       LT  +  P+  D +M+  A AV+ FE +TIG
Sbjct  463  DEVCREFVPIPPKGGLTWSEKTPWYYDDSMKRVANAVREFERETIG  508



>dbj|BAK07243.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=505

 Score =   172 bits (435),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 112/169 (66%), Gaps = 7/169 (4%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLR---EDFGKTFRK  422
            A+W FFFDVDE+IF+P   TL  VL  L  Y+QFTIEQ PMS++LC R   +      ++
Sbjct  333  ARWTFFFDVDEYIFLPDGRTLDGVLAELDPYTQFTIEQNPMSSRLCARGANDSMADYSKQ  392

Query  421  WGFEKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTI  242
            WGFEKLV+++   G+RRDRKYA+Q +N +ATGVHMS+N +G TTHKTE  I Y+HYH TI
Sbjct  393  WGFEKLVFRNSITGVRRDRKYAIQAKNAYATGVHMSENVIGNTTHKTEHLIRYYHYHNTI  452

Query  241  AERREPCRKLVNTT---SLT-VDGIPYVLDTTMRDAAGAVKRFELKTIG  107
                E CR++V       LT  +  P+  D +M+  A AV+ FE + IG
Sbjct  453  NVPGELCREIVPVPPKGGLTWSEKTPWYYDDSMKLVANAVREFEKRNIG  501



>ref|NP_001058107.1| Os06g0624700 [Oryza sativa Japonica Group]
 dbj|BAD35683.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF20021.1| Os06g0624700 [Oryza sativa Japonica Group]
Length=489

 Score =   171 bits (434),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 112/169 (66%), Gaps = 7/169 (4%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLR---EDFGKTFRK  422
            A+W FFFDVDE+IF+P   +L++VL  L  Y+QFTIEQ PMS++LC R   E       +
Sbjct  317  ARWTFFFDVDEYIFLPDGRSLEAVLAELEPYTQFTIEQNPMSSRLCARNPDEPETDYSNE  376

Query  421  WGFEKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTI  242
            WGFEKLV+++   G+RRDRKYA+Q +N +ATGVHMS+N +G TTHKTE  I Y+HYH TI
Sbjct  377  WGFEKLVFRNSITGVRRDRKYAIQAKNAYATGVHMSENVIGNTTHKTEHLIRYYHYHNTI  436

Query  241  AERREPCRKLV----NTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
                E CR+ V    N   +  +  P+  D +M+  A  V+ FE KTIG
Sbjct  437  NVIGEVCREFVPIPPNGGLIWSEKTPWYYDDSMKRIADTVREFERKTIG  485



>gb|EAZ37686.1| hypothetical protein OsJ_22025 [Oryza sativa Japonica Group]
Length=522

 Score =   172 bits (435),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 112/169 (66%), Gaps = 7/169 (4%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLR---EDFGKTFRK  422
            A+W FFFDVDE+IF+P   +L++VL  L  Y+QFTIEQ PMS++LC R   E       +
Sbjct  350  ARWTFFFDVDEYIFLPDGRSLEAVLAELEPYTQFTIEQNPMSSRLCARNPDEPETDYSNE  409

Query  421  WGFEKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTI  242
            WGFEKLV+++   G+RRDRKYA+Q +N +ATGVHMS+N +G TTHKTE  I Y+HYH TI
Sbjct  410  WGFEKLVFRNSITGVRRDRKYAIQAKNAYATGVHMSENVIGNTTHKTEHLIRYYHYHNTI  469

Query  241  AERREPCRKLV----NTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
                E CR+ V    N   +  +  P+  D +M+  A  V+ FE KTIG
Sbjct  470  NVIGEVCREFVPIPPNGGLIWSEKTPWYYDDSMKRIADTVREFERKTIG  518



>gb|EAZ01730.1| hypothetical protein OsI_23756 [Oryza sativa Indica Group]
Length=522

 Score =   171 bits (434),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 112/169 (66%), Gaps = 7/169 (4%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLR---EDFGKTFRK  422
            A+W FFFDVDE+IF+P   +L++VL  L  Y+QFTIEQ PMS++LC R   E       +
Sbjct  350  ARWTFFFDVDEYIFLPDGRSLEAVLAELEPYTQFTIEQNPMSSRLCARNPDEPETDYSNE  409

Query  421  WGFEKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTI  242
            WGFEKLV+++   G+RRDRKYA+Q +N +ATGVHMS+N +G TTHKTE  I Y+HYH TI
Sbjct  410  WGFEKLVFRNSITGVRRDRKYAIQAKNAYATGVHMSENVIGNTTHKTEHLIRYYHYHNTI  469

Query  241  AERREPCRKLV----NTTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
                E CR+ V    N   +  +  P+  D +M+  A  V+ FE KTIG
Sbjct  470  NVIGEVCREFVPIPPNGGLIWSEKTPWYYDDSMKRIADTVREFERKTIG  518



>ref|XP_009778585.1| PREDICTED: uncharacterized protein LOC104227908 [Nicotiana sylvestris]
Length=480

 Score =   169 bits (429),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 108/166 (65%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W F+FDVDE+I++P  +TL+SVL   S  +QFTIEQ  MS+ LC  +      R+WGF
Sbjct  306  ANWTFYFDVDEYIYLPDGNTLESVLREFSNNTQFTIEQNAMSSMLCFNDSSQDYSRQWGF  365

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKL+++D +  IRRDRKYA+Q +N +ATGVHMS+N +G T H+TE +I Y+HYH +I   
Sbjct  366  EKLLFRDSRTNIRRDRKYAIQAKNAYATGVHMSENVIGGTLHQTETKIRYYHYHNSITVH  425

Query  232  REPCRKLVNTTS----LTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             E CR+ V ++S       D  PYV D  M+  A  +K FE  TI 
Sbjct  426  EELCREFVPSSSKHNITWFDKRPYVYDDNMKKLAQTIKDFERHTIN  471



>ref|XP_009595951.1| PREDICTED: uncharacterized protein LOC104092135 [Nicotiana tomentosiformis]
 ref|XP_009595953.1| PREDICTED: uncharacterized protein LOC104092135 [Nicotiana tomentosiformis]
Length=468

 Score =   168 bits (426),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 107/166 (64%), Gaps = 4/166 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W F+FDVDE+I++P  +TL+SVL   S  +QFTIEQ  MS+ LC  +      R+WGF
Sbjct  294  ANWTFYFDVDEYIYLPDGNTLESVLREFSNNTQFTIEQNAMSSMLCFNDSSQDYSRQWGF  353

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAER  233
            EKL+++D +  IRRDRKYA+Q +N +ATGVHMS+N +G T H+TE +I Y+HYH +I   
Sbjct  354  EKLLFRDSRTNIRRDRKYAIQAKNAYATGVHMSENVIGGTLHQTETKIRYYHYHNSITVH  413

Query  232  REPCRKLVNTTS----LTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             E CR+ V  +S       D  PYV D  M+  A  +K FE  TI 
Sbjct  414  EELCREFVPLSSKHNITWFDKRPYVYDDNMKKLAQTIKDFERNTIN  459



>ref|XP_006342202.1| PREDICTED: uncharacterized protein LOC102591298 [Solanum tuberosum]
Length=460

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 106/167 (63%), Gaps = 5/167 (3%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVP-KKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWG  416
            A W F+FDVDE+I++P   +TL+SVL   S  +QFTIEQ  MS+ LCL +      R WG
Sbjct  285  ANWTFYFDVDEYIYLPDANTTLESVLRDFSNNTQFTIEQNAMSSILCLNDSSQNYSRLWG  344

Query  415  FEKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAE  236
            FEKL+++D +  IRRDRKYA+Q +N +ATGVHMS+N VG T H+TE +I Y+HYH +I  
Sbjct  345  FEKLLFRDSRSNIRRDRKYAIQAKNAYATGVHMSENVVGGTLHQTETKIRYYHYHNSITV  404

Query  235  RREPCRKLVNTTS----LTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
              E CR+ +  ++       D +PY  D  M+     +K FE  TI 
Sbjct  405  HEELCREFLPISAKHNITWFDKVPYEYDDNMKKLTQTIKDFERNTIN  451



>ref|XP_004238474.1| PREDICTED: uncharacterized protein LOC101247215 [Solanum lycopersicum]
Length=448

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 106/168 (63%), Gaps = 5/168 (3%)
 Frame = -2

Query  595  QAKWMFFFDVDEFIFVP-KKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKW  419
             A W F+FDVDE+I++P   +TL+SVL   S  +QFTIEQ  MS+ LCL        R W
Sbjct  270  SAYWTFYFDVDEYIYLPDANTTLESVLRDFSNNTQFTIEQNAMSSILCLNNSSQNYSRLW  329

Query  418  GFEKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIA  239
            GFEKL+++D +  IRRDRKYA+Q +N +ATGVHMS+N VG T H+TE +I Y+HYH +I 
Sbjct  330  GFEKLLFRDSRSNIRRDRKYAIQAKNAYATGVHMSENVVGGTLHQTETKIRYYHYHNSIT  389

Query  238  ERREPCRKLVNTTS----LTVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
               E CR+ +  ++       D +PY  D +M+     +K FE  TI 
Sbjct  390  VHEELCREFLPMSAKHNITWFDKVPYEYDDSMKKLTQTIKDFERNTIN  437



>ref|XP_002964794.1| hypothetical protein SELMODRAFT_82649 [Selaginella moellendorffii]
 gb|EFJ33632.1| hypothetical protein SELMODRAFT_82649 [Selaginella moellendorffii]
Length=441

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/169 (44%), Positives = 108/169 (64%), Gaps = 7/169 (4%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSG-YSQFTIEQMPMSNKLCLREDFGKTFRKWG  416
            A W FFFDVDE++ VP  STL SVL+ L   YSQ   +Q PM + +C+  +     R+WG
Sbjct  271  ANWTFFFDVDEYVHVPGPSTLGSVLNELGQKYSQIIFKQTPMGHNVCIDSNRTNLSRQWG  330

Query  415  FEKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAE  236
            FEKLV+ +V++ +R DRKY ++     + GVH+S+N  GK+ + + GQI YFH+H TI E
Sbjct  331  FEKLVFINVQKSVRLDRKYVLRAPLADSAGVHLSENVRGKSLY-SRGQISYFHFHNTITE  389

Query  235  RREPCRKLVN-----TTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGP  104
             +E CR+ V      T+ + ++ IPY+ D  +   A  VK+FEL+TIGP
Sbjct  390  HQENCREFVKVPKNRTSKVWLNKIPYLYDDKLSTLADEVKQFELQTIGP  438



>ref|XP_002961724.1| hypothetical protein SELMODRAFT_77156 [Selaginella moellendorffii]
 gb|EFJ36984.1| hypothetical protein SELMODRAFT_77156 [Selaginella moellendorffii]
Length=441

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/169 (44%), Positives = 108/169 (64%), Gaps = 7/169 (4%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSG-YSQFTIEQMPMSNKLCLREDFGKTFRKWG  416
            A W FFFDVDE++ VP  STL SVL+ L   YSQ   +Q PM + +C+  +     R+WG
Sbjct  271  ANWTFFFDVDEYVHVPGPSTLDSVLNELGQKYSQIIFKQTPMGHNVCIDSNRTNLSRQWG  330

Query  415  FEKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAE  236
            FEKLV+ +V++ +R DRKY ++     + GVH+S+N  GK+ + + GQI YFH+H TI E
Sbjct  331  FEKLVFINVQKSVRLDRKYVLRAPLADSAGVHLSENVRGKSLY-SRGQISYFHFHNTITE  389

Query  235  RREPCRKLVN-----TTSLTVDGIPYVLDTTMRDAAGAVKRFELKTIGP  104
             +E CR+ V      T+ + ++ +PY+ D  +   A  VK+FEL+TIGP
Sbjct  390  HQENCREFVKVPKNRTSKVWLNKVPYLYDDKLSTLADEVKQFELQTIGP  438



>ref|NP_191658.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_199630.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB94135.1| putative protein [Arabidopsis thaliana]
 dbj|BAA96999.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED95631.1| uncharacterized protein AT5G48190 [Arabidopsis thaliana]
 gb|AEE80135.1| uncharacterized protein AT3G60990 [Arabidopsis thaliana]
Length=102

 Score =   140 bits (353),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 78/100 (78%), Gaps = 1/100 (1%)
 Frame = -2

Query  589  KWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDF-GKTFRKWGF  413
            KWMFFFDVDEF+ VP K T+ SV++SL  Y QFTIE MPMS+++C   D   +T+RKWG 
Sbjct  3    KWMFFFDVDEFLHVPVKETISSVMESLEEYFQFTIELMPMSSRVCYSGDGPARTYRKWGI  62

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKT  293
            EKL Y+DVK+  RRDRKYAVQP NVFA GVHMSQN  GKT
Sbjct  63   EKLAYRDVKKVPRRDRKYAVQPENVFAIGVHMSQNLQGKT  102



>ref|NP_187394.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF02147.1|AC009853_7 unknown protein [Arabidopsis thaliana]
 gb|AEE74536.1| uncharacterized protein AT3G07380 [Arabidopsis thaliana]
Length=102

 Score =   138 bits (347),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 77/100 (77%), Gaps = 1/100 (1%)
 Frame = -2

Query  589  KWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDF-GKTFRKWGF  413
            KWMFF DVDEF+ VP K T+ SV++SL  Y QFTIE MPMS+++C   D   +T+RKWG 
Sbjct  3    KWMFFVDVDEFLHVPVKETISSVMESLEEYFQFTIELMPMSSQVCYSGDGPARTYRKWGI  62

Query  412  EKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKT  293
            EKL Y+DVK+  RRDRKYAVQP NVFA GVHMSQN  GKT
Sbjct  63   EKLAYRDVKKVPRRDRKYAVQPENVFAIGVHMSQNLQGKT  102



>ref|XP_001775945.1| predicted protein [Physcomitrella patens]
 gb|EDQ59310.1| predicted protein [Physcomitrella patens]
Length=397

 Score =   138 bits (347),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 106/170 (62%), Gaps = 8/170 (5%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDF--GKTFRKW  419
            A W FFFDVDE+++V   +TL  VL+     +Q TIEQ+PM+  +C+ ++   G     W
Sbjct  227  ANWTFFFDVDEYMYVEPTTTLSQVLNENPNITQITIEQVPMAKDICVADNATRGDLKSSW  286

Query  418  GFEKLVYKDV-KRGIRRDRKYAVQPRNVFATGVHMSQNTV-GKTTHKTEGQIMYFHYHGT  245
            GFEKLVY+ V K G+R DRKYAVQ R+  A G+HMS N + G+  +    +I Y+HYHGT
Sbjct  287  GFEKLVYRKVLKPGLRYDRKYAVQARHAEAAGIHMSMNMLKGQNLYPKGDKIRYYHYHGT  346

Query  244  IAERREPCRKLV---NTTSL-TVDGIPYVLDTTMRDAAGAVKRFELKTIG  107
            I +R E C+K V   N T+L T D   + L+ T+   A  VK +EL T+G
Sbjct  347  INKRGEVCKKFVDAGNKTALQTHDNHYHRLEETIAKMAKDVKLYELNTVG  396



>ref|XP_001777796.1| predicted protein [Physcomitrella patens]
 gb|EDQ57334.1| predicted protein [Physcomitrella patens]
Length=382

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 99/165 (60%), Gaps = 3/165 (2%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W FFFD+DE+++V   +TL  VL+     SQ  I+Q+P+ + LC+ ++      +W  
Sbjct  212  ANWTFFFDIDEYMYVDPSTTLSDVLNEKPDVSQIVIKQVPIESGLCVADNTRDQHERWLT  271

Query  412  EKLVYKDV-KRGIRRDRKYAVQPRNVFATGVHMSQNT-VGKTTHKTEGQIMYFHYHGTIA  239
            E+L+Y+ V K GI  DRKYAVQ R+  ATG+HMS N   GKT    + ++ Y+HYHGTI 
Sbjct  272  ERLIYRRVLKHGIHYDRKYAVQARHAEATGIHMSMNLRRGKTRVLQDERLRYYHYHGTIT  331

Query  238  ERREPCRKLVNTTSLT-VDGIPYVLDTTMRDAAGAVKRFELKTIG  107
             R   C K V++ + T V  +   LD TM   A  VK +ELK IG
Sbjct  332  NRGNLCNKFVDSKNKTAVKSVQLRLDETMMKMAKDVKSYELKMIG  376



>ref|XP_001758982.1| predicted protein [Physcomitrella patens]
 gb|EDQ76051.1| predicted protein [Physcomitrella patens]
Length=386

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 99/170 (58%), Gaps = 8/170 (5%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKT--FRKW  419
            A W FFFDVDE++ VP  +TL  VL+     +Q T EQ+P+SN LC+ ++       RKW
Sbjct  216  ANWTFFFDVDEYLHVPPTTTLDKVLNDNPNVTQITFEQVPISNNLCVADNITTDGHARKW  275

Query  418  GFEKLVYKDVKR-GIRRDRKYAVQPRNVFATGVHMSQNT-VGKTTHKTEGQIMYFHYHGT  245
              EKL+Y+ V R G+R DRKYAVQ R   ATGVHMS N   GK  +    +I Y+HYH T
Sbjct  276  AIEKLMYRKVLRSGVRYDRKYAVQARYAAATGVHMSMNMRKGKNMYPKGYKIRYYHYHDT  335

Query  244  IAERREPCRKLV---NTTSLTVDG-IPYVLDTTMRDAAGAVKRFELKTIG  107
            I +R E C+  V   N TSL       Y LD T+      +K +E +TIG
Sbjct  336  INKREELCQAFVSPQNKTSLQRHQRQNYRLDETLAMTTQLIKDYERRTIG  385



>ref|XP_001758423.1| predicted protein [Physcomitrella patens]
 gb|EDQ76825.1| predicted protein [Physcomitrella patens]
Length=472

 Score =   115 bits (289),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 107/170 (63%), Gaps = 8/170 (5%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLRED--FGKTFRKW  419
            A W FFFD+DEFIFV   +TL +VL+     +Q TIEQ PM+  LC+ ++   G+   +W
Sbjct  297  ANWTFFFDIDEFIFVEPTTTLSAVLNENPNITQITIEQTPMAKDLCVADNTTSGEHESRW  356

Query  418  GFEKLVYKDV-KRGIRRDRKYAVQPRNVFATGVHMSQNT-VGKTTHKTEGQIMYFHYHGT  245
            GFEKL+Y+ V KRGIR DRK+ VQ R+  ATG+HMS +T  G+  +    +I Y+HYHGT
Sbjct  357  GFEKLIYRKVLKRGIRYDRKFVVQARHAEATGIHMSMDTRHGQNLYPKGDKIRYYHYHGT  416

Query  244  IAERREPCRKLVNTTSLTV----DGIPYVLDTTMRDAAGAVKRFELKTIG  107
            I +R+E C + V+  + T     +   + LD +M   A  VK FEL T+G
Sbjct  417  INKRQEVCTRFVDAGNKTAVQRHEKHYHRLDESMAKLAKDVKLFELNTVG  466



>ref|XP_001769268.1| predicted protein [Physcomitrella patens]
 gb|EDQ65980.1| predicted protein [Physcomitrella patens]
Length=414

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/174 (36%), Positives = 90/174 (52%), Gaps = 10/174 (6%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVP-KKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKT-----  431
            A W+FFFDVDE+I+ P   ++L S+L      SQ  I Q PMS  LC ++    +     
Sbjct  237  AHWLFFFDVDEYIWAPPNDNSLASILARFEDQSQIIIWQKPMSKSLCAQDQGAASNDSSF  296

Query  430  FRKWGFEKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYH  251
              KW FEKLV+K +K     D KYA++     ATG+H S   +G         + Y+HYH
Sbjct  297  ASKWTFEKLVFKSIKWRESHDCKYAIRGLKAMATGIHRSGYLIGSNATTYADPLNYYHYH  356

Query  250  GTIAERREPCRKLVNTTSLTVDG----IPYVLDTTMRDAAGAVKRFELKTIGPR  101
             TI +R E C + +++ S+ V+       +  D  +   A  +K FEL  IGP+
Sbjct  357  NTINKREEVCEQFIDSNSVYVNPRNRTDKFAYDDGLAVLADHIKEFELDVIGPQ  410



>ref|XP_001759086.1| predicted protein [Physcomitrella patens]
 gb|EDQ76155.1| predicted protein [Physcomitrella patens]
Length=414

 Score =   112 bits (281),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 64/176 (36%), Positives = 91/176 (52%), Gaps = 14/176 (8%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVP-KKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLRE-----DFGKT  431
            A+W+FFFDVDEFI+ P   ++L ++L      SQ  I Q PMS  LC +E     +    
Sbjct  237  ARWIFFFDVDEFIWAPPNDNSLPAILARYENQSQIIIWQKPMSKSLCAQEQGEAGNDSSF  296

Query  430  FRKWGFEKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYH  251
             RKW FEKLV+K +K     D KYA+Q +    TG+H S + +G         + Y+HYH
Sbjct  297  SRKWTFEKLVFKSIKWRESHDCKYAIQGQKAMGTGIHRSGHLIGGNATTYADPLNYYHYH  356

Query  250  GTIAERREPCRKLVNTTSLTVDGIP------YVLDTTMRDAAGAVKRFELKTIGPR  101
             TI +R E C   ++ + + V+  P      Y  D  +   A  +K FE   IGP+
Sbjct  357  NTINKRDEVCEDFIDKSVVYVN--PRNRTDIYTHDDGLAVLADHIKEFERDVIGPQ  410



>gb|AFG70562.1| hypothetical protein 0_12697_01, partial [Pinus taeda]
 gb|AFG70563.1| hypothetical protein 0_12697_01, partial [Pinus taeda]
 gb|AFG70564.1| hypothetical protein 0_12697_01, partial [Pinus taeda]
 gb|AFG70565.1| hypothetical protein 0_12697_01, partial [Pinus taeda]
 gb|AFG70566.1| hypothetical protein 0_12697_01, partial [Pinus taeda]
Length=95

 Score =   100 bits (248),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 66/94 (70%), Gaps = 4/94 (4%)
 Frame = -2

Query  376  RRDRKYAVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAERREPCRKLVNTT-  200
            RRDRKYAVQ RNV+ATGVH S+N +G+T  +TEG+I Y+HYH TI+ R EPC + V  + 
Sbjct  1    RRDRKYAVQARNVYATGVHFSENLMGETQRRTEGKIRYYHYHNTISNREEPCMEWVKPSM  60

Query  199  --SLTV-DGIPYVLDTTMRDAAGAVKRFELKTIG  107
              ++TV +GIPY  D +++     VK+FE   IG
Sbjct  61   KKNVTVLEGIPYKYDGSIKAVTSLVKQFERLAIG  94



>ref|XP_001757048.1| predicted protein [Physcomitrella patens]
 gb|EDQ78279.1| predicted protein [Physcomitrella patens]
Length=505

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 64/182 (35%), Positives = 90/182 (49%), Gaps = 24/182 (13%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLS--GYSQFTIEQMPMSNKLCLREDF-------  440
            + W FFFDVDE++++P    L+ +LD      ++Q  ++ + M++ LC + D        
Sbjct  322  SNWTFFFDVDEYLYIPPNKILQQILDESERMNFTQIRMKTIKMNDALCTKPDPPLDDAAR  381

Query  439  -GKTFRKWGFEKLVYKDVKRGIR--RDRKYAVQPRNVFATGVHMSQNT-VGKTTHKTEGQ  272
                 RKW  EKLVY +   G      RKYA++PR  +ATGVH  +    G      E  
Sbjct  382  DAYWRRKWAIEKLVYANCDYGWEPVESRKYALKPRAAWATGVHYCEYLKEGGLMDADENL  441

Query  271  IMYFHYHGTIAERREPCRKLVNTTSLTVDGIPYVL-------DTTMRDAAGAVKRFELKT  113
            +  +HYHGT    +E CR   N T    +G P  L       D TM   A  VK+FEL+T
Sbjct  442  LRLYHYHGTTPGPKEVCRDFTNGT----NGEPNYLGVKNCTVDRTMTTLANPVKQFELQT  497

Query  112  IG  107
            IG
Sbjct  498  IG  499



>ref|XP_008346109.1| PREDICTED: uncharacterized protein LOC103409067 [Malus domestica]
Length=411

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRK  422
            AKWMFFFDVDE+I++P KS LKSVLDSLS Y+QFTIEQMPMS+KLCL ED+ KT+ +
Sbjct  353  AKWMFFFDVDEYIYMPPKSNLKSVLDSLSDYTQFTIEQMPMSSKLCLLEDYHKTYSE  409



>ref|XP_007040981.1| Domain of Uncharacterized protein function isoform 2 [Theobroma 
cacao]
 gb|EOX96812.1| Domain of Uncharacterized protein function isoform 2 [Theobroma 
cacao]
Length=427

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 51/63 (81%), Gaps = 2/63 (3%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFR-KW-  419
            AKW+FFFDVDEFI+VP KST++SVLDSLS YSQFTIEQMPMS+KLC   D  K  R  W 
Sbjct  347  AKWIFFFDVDEFIYVPPKSTIRSVLDSLSDYSQFTIEQMPMSSKLCHTVDAAKRNRWNWS  406

Query  418  GFE  410
            GF+
Sbjct  407  GFQ  409



>gb|KHN06995.1| hypothetical protein glysoja_042235 [Glycine soja]
Length=293

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFR  425
            AKWMFFFDVDE+I+VP  +T+K+V+DSLS Y QF    MPM+NK+CL ED+GKT R
Sbjct  217  AKWMFFFDVDEYIYVPPNNTIKTVVDSLSKYDQFIFNMMPMNNKICLYEDYGKTCR  272



>ref|XP_001778370.1| predicted protein [Physcomitrella patens]
 gb|EDQ56821.1| predicted protein [Physcomitrella patens]
Length=356

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 72/132 (55%), Gaps = 8/132 (6%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVP--KKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKW  419
            + W FFFDVDEF+F    KK       ++ +  +QF  + + MS+ LCL+E+      KW
Sbjct  225  SNWTFFFDVDEFLFSSGDKKPVDLLAENARNNVTQFLFKTVKMSDGLCLKEN---KREKW  281

Query  418  GFEKLVYKDVKRG--IRRDRKYAVQPRNVFATGVHMSQNT-VGKTTHKTEGQIMYFHYHG  248
             FEKLVY     G      RKYAVQP+ V+ATGVH S++   GK        +  +HYH 
Sbjct  282  AFEKLVYAKCDYGWTTVESRKYAVQPQMVWATGVHYSEHMKQGKRIDMDPDVLRSYHYHN  341

Query  247  TIAERREPCRKL  212
            T+  R E C++ 
Sbjct  342  TVNGRTELCKEF  353



>ref|XP_001767951.1| predicted protein [Physcomitrella patens]
 gb|EDQ67226.1| predicted protein [Physcomitrella patens]
Length=349

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 70/128 (55%), Gaps = 8/128 (6%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYSQFTIEQMPMSNKLCLREDFGKTFRKWGF  413
            A W FFFD+DE++++P+  + +++L+ L+  ++       +   L L E      RKW F
Sbjct  225  ASWTFFFDIDEYLYIPEAHSPRAILNLLAEQARNNRSLRVVFTFLPLHE-----CRKWAF  279

Query  412  EKLVYKDVKRGIR--RDRKYAVQPRNVFATGVHMSQNT-VGKTTHKTEGQIMYFHYHGTI  242
            EKLVY D   G      RKYA+QP+ V+ATGVH S++   G         +  +HYH T+
Sbjct  280  EKLVYADCNYGWEPVESRKYALQPQLVWATGVHYSEHLKQGHYITMDPTVLRSYHYHNTL  339

Query  241  AERREPCR  218
              R E C+
Sbjct  340  NGRWETCK  347



>gb|AFG56179.1| hypothetical protein 0_17802_01, partial [Pinus taeda]
 gb|AFG56180.1| hypothetical protein 0_17802_01, partial [Pinus taeda]
 gb|AFG56181.1| hypothetical protein 0_17802_01, partial [Pinus taeda]
 gb|AFG56182.1| hypothetical protein 0_17802_01, partial [Pinus taeda]
 gb|AFG56183.1| hypothetical protein 0_17802_01, partial [Pinus taeda]
 gb|AFG56184.1| hypothetical protein 0_17802_01, partial [Pinus taeda]
 gb|AFG56185.1| hypothetical protein 0_17802_01, partial [Pinus taeda]
 gb|AFG56187.1| hypothetical protein 0_17802_01, partial [Pinus taeda]
 gb|AFG56188.1| hypothetical protein 0_17802_01, partial [Pinus taeda]
 gb|AFG56189.1| hypothetical protein 0_17802_01, partial [Pinus taeda]
 gb|AFG56190.1| hypothetical protein 0_17802_01, partial [Pinus taeda]
 gb|AFG56191.1| hypothetical protein 0_17802_01, partial [Pinus taeda]
 gb|AFG56192.1| hypothetical protein 0_17802_01, partial [Pinus taeda]
 gb|AFG56193.1| hypothetical protein 0_17802_01, partial [Pinus taeda]
 gb|AFG56194.1| hypothetical protein 0_17802_01, partial [Pinus taeda]
 gb|AFG56195.1| hypothetical protein 0_17802_01, partial [Pinus taeda]
Length=76

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 47/76 (62%), Gaps = 4/76 (5%)
 Frame = -2

Query  298  KTTHKTEGQIMYFHYHGTIAERREPCRKLVNTTSLT----VDGIPYVLDTTMRDAAGAVK  131
            KT HKTEG+I Y+HYH TI  R EPCR+ V  +       V GIPYV D TM+  A ++K
Sbjct  1    KTQHKTEGKIRYYHYHNTITTREEPCRQFVRQSMRNNVTWVGGIPYVYDATMKALAPSIK  60

Query  130  RFELKTIGPRLQKTRQ  83
            +FE + +G  L   +Q
Sbjct  61   KFESELMGSELASIQQ  76



>ref|XP_001785941.1| predicted protein [Physcomitrella patens]
 gb|EDQ49246.1| predicted protein [Physcomitrella patens]
Length=412

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 59/181 (33%), Positives = 84/181 (46%), Gaps = 23/181 (13%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYS-------QFTIEQMPMSNKLCLREDFGK  434
            AKW +FFDVDE+I  P  S L  V+  +   +       + +I+QM M    CLR     
Sbjct  228  AKWTWFFDVDEYIHRPAGSNLNEVIKRIETENFWGKRLQRVSIKQMSMDYSHCLRGSQPN  287

Query  433  TFRKWGFEKLVYKDVKRGIRRDRKYAVQPRNVFATGVH----MSQNTVGKTTH---KTEG  275
            +  +WG  K+VY+    G   DRK  V   +  ATG H    MS       TH   K EG
Sbjct  288  S-NEWGISKMVYRKTDVGEYPDRKNFVLSDSCLATGPHEPMAMSMPPGANQTHHVTKWEG  346

Query  274  QIM-YFHYHGTIAERR-EPCRKL----VNTTSLTVDGIPYVLDTTMRDAAGAVKRFELKT  113
            +++ Y+H+HG I +   E C  L    VN TS   + + +  D  ++     V  FE + 
Sbjct  347  ELLQYYHFHGAIGKAEGEICVDLLDPDVNVTSF--NNVTHQFDDALKSLVDDVMAFEHRM  404

Query  112  I  110
            I
Sbjct  405  I  405



>gb|AEW08052.1| hypothetical protein 0_17802_01, partial [Pinus radiata]
 gb|AFG56186.1| hypothetical protein 0_17802_01, partial [Pinus taeda]
Length=76

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 45/76 (59%), Gaps = 4/76 (5%)
 Frame = -2

Query  298  KTTHKTEGQIMYFHYHGTIAERREPCRKLVNTTSLT----VDGIPYVLDTTMRDAAGAVK  131
            KT HKTEG+I Y+HYH TI  R EPC + V  +       V G PYV D TM+  A ++K
Sbjct  1    KTQHKTEGKIRYYHYHNTITTREEPCSQFVRQSMRNNVTWVGGTPYVYDATMKALAPSIK  60

Query  130  RFELKTIGPRLQKTRQ  83
            +FE + +G  L   +Q
Sbjct  61   KFESELMGSELASIQQ  76



>ref|XP_006435485.1| hypothetical protein CICLE_v10003494mg [Citrus clementina]
 gb|ESR48725.1| hypothetical protein CICLE_v10003494mg [Citrus clementina]
Length=172

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 52/84 (62%), Gaps = 3/84 (4%)
 Frame = -2

Query  358  AVQPRNVFATGVHMSQNTVGKTTHKTEGQIMYFHYHGTIAERREPCRKLVNTTSLTVDGI  179
            A+Q    +ATGVH+S+N + KT H  E +I Y+HYH TI    E C +LV   S + +  
Sbjct  74   AIQATIAYATGVHVSENVISKTLH--EIKIHYYHYHNTITVHEEVCGELV-PPSPSANQY  130

Query  178  PYVLDTTMRDAAGAVKRFELKTIG  107
            PYVL+  M+  A  +K+FE KTIG
Sbjct  131  PYVLEHIMKKLANTIKQFEHKTIG  154



>ref|XP_001777720.1| predicted protein [Physcomitrella patens]
 gb|EDQ57500.1| predicted protein [Physcomitrella patens]
Length=542

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 82/181 (45%), Gaps = 23/181 (13%)
 Frame = -2

Query  592  AKWMFFFDVDEFIFVPKKSTLKSVLDSLSGYS----QFTIEQMPMSNKLCLREDFGKTFR  425
            A W FFFD+DE++FV    ++  +L+  +       ++T ++M  S     + +     R
Sbjct  360  ANWTFFFDMDEYLFVEPPHSITKLLEEKTQQDVSVIRYTGKRMSTSMCSLPKANVDNATR  419

Query  424  K------WGFEKLVYKDVKRGIRRDRKYAVQPRNVFATGVHMS------QNTVGKTTHKT  281
                   WGFEK +         RD KYAVQ R+++A  +H +      QN +     + 
Sbjct  420  DAINSKLWGFEKFLLHWHWEHGPRDPKYAVQARHMWAVEIHNAVLARRGQNRL----LQY  475

Query  280  EGQIMYFHYHGTIAERREPCRKLVNTT---SLTVDGIPYVLDTTMRDAAGAVKRFELKTI  110
               I + H+HG I  R E CR  V  +   ++ V    Y  D T+   A  +K+FE   +
Sbjct  476  RDHIWFHHFHGFIINRAEGCRDFVEASENKAIAVGKSQYSGDYTIARLAKDIKQFEQAMV  535

Query  109  G  107
            G
Sbjct  536  G  536



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 717231537738