BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7580_g1_i1 len=805 path=[1:0-682 684:683-804]

Length=805
                                                                      Score     E

ref|XP_009759089.1|  PREDICTED: uncharacterized protein LOC104211693    143   3e-38   
ref|XP_009592398.1|  PREDICTED: auxin-induced protein X10A-like         142   6e-38   
ref|XP_009592396.1|  PREDICTED: auxin-induced protein X10A-like         142   8e-38   
ref|XP_010325465.1|  PREDICTED: auxin-induced protein X10A-like         140   3e-37   
ref|XP_009771366.1|  PREDICTED: auxin-induced protein X10A-like         140   4e-37   
ref|XP_006355494.1|  PREDICTED: auxin-induced protein X10A-like         139   7e-37   
ref|XP_009771535.1|  PREDICTED: auxin-induced protein X10A-like         138   1e-36   
ref|XP_006355495.1|  PREDICTED: uncharacterized protein LOC102583229    136   9e-36   
emb|CDP09911.1|  unnamed protein product                                136   1e-35   
ref|XP_010325681.1|  PREDICTED: auxin-induced protein 10A5-like         135   2e-35   
ref|XP_004245734.1|  PREDICTED: uncharacterized protein LOC101246270    134   8e-35   
ref|XP_010324594.1|  PREDICTED: uncharacterized protein LOC101258390    127   3e-32   
ref|XP_011069607.1|  PREDICTED: uncharacterized protein LOC105155428    124   4e-31   
ref|XP_009799980.1|  PREDICTED: auxin-induced protein X10A-like         124   4e-31   
ref|XP_009587310.1|  PREDICTED: auxin-induced protein X10A-like         123   9e-31   
ref|XP_002265485.1|  PREDICTED: auxin-induced protein X10A              118   6e-29   Vitis vinifera
ref|XP_002280387.1|  PREDICTED: uncharacterized protein LOC100260776    115   8e-28   Vitis vinifera
ref|XP_010088880.1|  hypothetical protein L484_020868                   115   1e-27   
gb|AFK48613.1|  unknown                                                 114   2e-27   
ref|XP_006440378.1|  hypothetical protein CICLE_v10022581mg             114   2e-27   
gb|EYU24760.1|  hypothetical protein MIMGU_mgv1a015151mg                114   2e-27   
ref|XP_007039930.1|  SAUR family protein, putative                      114   2e-27   
ref|XP_009785335.1|  PREDICTED: uncharacterized protein LOC104233609    114   2e-27   
ref|XP_009602309.1|  PREDICTED: uncharacterized protein LOC104097455    114   4e-27   
ref|XP_006573419.1|  PREDICTED: uncharacterized protein LOC100808164    114   4e-27   
ref|XP_011081200.1|  PREDICTED: uncharacterized protein LOC105164282    113   5e-27   
ref|XP_011093368.1|  PREDICTED: uncharacterized protein LOC105173359    113   8e-27   
ref|XP_006445300.1|  hypothetical protein CICLE_v10022560mg             112   1e-26   
ref|XP_009609783.1|  PREDICTED: uncharacterized protein LOC104103572    112   1e-26   
ref|XP_011090420.1|  PREDICTED: uncharacterized protein LOC105171100    112   1e-26   
emb|CDY52310.1|  BnaCnng22170D                                          111   3e-26   
gb|EYU31967.1|  hypothetical protein MIMGU_mgv1a020147mg                111   3e-26   
ref|XP_007052109.1|  SAUR family protein                                111   4e-26   
emb|CDO97719.1|  unnamed protein product                                111   4e-26   
ref|XP_008232597.1|  PREDICTED: uncharacterized protein LOC103331728    111   4e-26   
ref|XP_004306941.1|  PREDICTED: uncharacterized protein LOC101300951    110   5e-26   
ref|XP_010259029.1|  PREDICTED: uncharacterized protein LOC104598585    110   6e-26   
ref|XP_006477252.1|  PREDICTED: uncharacterized protein LOC102623442    110   6e-26   
ref|XP_002509576.1|  Auxin-induced protein X10A, putative               108   7e-26   Ricinus communis
ref|XP_006347888.1|  PREDICTED: auxin-induced protein 10A5-like         110   9e-26   
ref|XP_009137271.1|  PREDICTED: indole-3-acetic acid-induced prot...    109   9e-26   
ref|XP_007218501.1|  hypothetical protein PRUPE_ppa012367mg             110   9e-26   
emb|CDX98761.1|  BnaA03g45460D                                          109   9e-26   
ref|XP_010056342.1|  PREDICTED: uncharacterized protein LOC104444383    110   1e-25   
ref|XP_004229795.1|  PREDICTED: auxin-induced protein 10A5              109   1e-25   
ref|XP_002511675.1|  Auxin-induced protein X10A, putative               109   1e-25   Ricinus communis
ref|XP_003521966.1|  PREDICTED: uncharacterized protein LOC100796005    109   1e-25   
ref|XP_004298667.1|  PREDICTED: uncharacterized protein LOC101292210    110   2e-25   
ref|XP_006282748.1|  hypothetical protein CARUB_v10005919mg             109   2e-25   
ref|XP_006289429.1|  hypothetical protein CARUB_v10002934mg             109   2e-25   
emb|CDY21268.1|  BnaC03g29520D                                          108   2e-25   
ref|XP_008372725.1|  PREDICTED: uncharacterized protein LOC103436089    108   3e-25   
ref|XP_009114622.1|  PREDICTED: uncharacterized protein LOC103839891    108   3e-25   
emb|CDX86707.1|  BnaA09g20970D                                          108   3e-25   
emb|CDX94106.1|  BnaC07g37400D                                          108   4e-25   
ref|XP_010439309.1|  PREDICTED: uncharacterized protein LOC104722783    108   4e-25   
ref|XP_008354757.1|  PREDICTED: uncharacterized protein LOC103418405    108   5e-25   
gb|KDP25623.1|  hypothetical protein JCGZ_20779                         107   8e-25   
ref|XP_009134268.1|  PREDICTED: uncharacterized protein LOC103858630    107   8e-25   
ref|XP_009375775.1|  PREDICTED: uncharacterized protein LOC103964554    107   9e-25   
ref|XP_004147644.1|  PREDICTED: uncharacterized protein LOC101208334    106   2e-24   
ref|XP_004160639.1|  PREDICTED: uncharacterized LOC101208334            106   2e-24   
ref|XP_010422206.1|  PREDICTED: uncharacterized protein LOC104707531    106   2e-24   
ref|XP_010538764.1|  PREDICTED: indole-3-acetic acid-induced prot...    106   2e-24   
ref|XP_002869817.1|  auxin-responsive family protein                    105   3e-24   
ref|XP_010434013.1|  PREDICTED: uncharacterized protein LOC104718053    106   3e-24   
ref|XP_010455681.1|  PREDICTED: uncharacterized protein LOC104737249    105   4e-24   
ref|XP_010539798.1|  PREDICTED: indole-3-acetic acid-induced prot...    105   4e-24   
ref|XP_006413639.1|  hypothetical protein EUTSA_v10026450mg             105   4e-24   
gb|KDP28782.1|  hypothetical protein JCGZ_14553                         105   4e-24   
ref|XP_010264205.1|  PREDICTED: uncharacterized protein LOC104602283    105   4e-24   
gb|KFK26933.1|  hypothetical protein AALP_AA8G312000                    105   4e-24   
ref|XP_011017472.1|  PREDICTED: uncharacterized protein LOC105120790    105   4e-24   
ref|XP_010433480.1|  PREDICTED: uncharacterized protein LOC104717582    105   4e-24   
ref|XP_010544631.1|  PREDICTED: uncharacterized protein LOC104817230    105   7e-24   
ref|XP_010053431.1|  PREDICTED: uncharacterized protein LOC104441880    105   7e-24   
ref|NP_192978.1|  SAUR-like auxin-responsive protein                    104   7e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010524373.1|  PREDICTED: auxin-induced protein X10A-like         105   8e-24   
ref|XP_006367568.1|  PREDICTED: auxin-induced protein X15-like          104   8e-24   
ref|NP_193993.1|  SAUR-like auxin-responsive protein                    104   8e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008439035.1|  PREDICTED: uncharacterized protein LOC103483942    104   9e-24   
ref|XP_002874769.1|  auxin-responsive family protein                    104   1e-23   
gb|ABK28644.1|  unknown                                                 104   1e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002301272.2|  auxin-responsive family protein                    104   1e-23   Populus trichocarpa [western balsam poplar]
gb|KCW77727.1|  hypothetical protein EUGRSUZ_D02026                     105   1e-23   
ref|XP_006396766.1|  hypothetical protein EUTSA_v10029032mg             103   1e-23   
ref|XP_010676252.1|  PREDICTED: uncharacterized protein LOC104892118    103   2e-23   
ref|XP_007134829.1|  hypothetical protein PHAVU_010G079700g             103   2e-23   
ref|XP_009108573.1|  PREDICTED: indole-3-acetic acid-induced prot...    103   2e-23   
ref|XP_010448866.1|  PREDICTED: uncharacterized protein LOC104731245    103   2e-23   
ref|XP_011033963.1|  PREDICTED: uncharacterized protein LOC105132279    103   2e-23   
ref|XP_008238623.1|  PREDICTED: uncharacterized protein LOC103337238    103   2e-23   
ref|XP_004248559.1|  PREDICTED: auxin-induced protein 15A-like          102   3e-23   
ref|XP_007208830.1|  hypothetical protein PRUPE_ppa025324mg             103   3e-23   
emb|CDY71452.1|  BnaCnng72960D                                          103   4e-23   
ref|XP_007161917.1|  hypothetical protein PHAVU_001G108500g             102   5e-23   
ref|XP_002320048.1|  hypothetical protein POPTR_0014s06240g             102   5e-23   Populus trichocarpa [western balsam poplar]
ref|XP_010093668.1|  hypothetical protein L484_019007                   103   5e-23   
ref|XP_003517959.1|  PREDICTED: uncharacterized protein LOC100783436    102   7e-23   
ref|XP_009136028.1|  PREDICTED: indole-3-acetic acid-induced prot...    102   9e-23   
emb|CDX95639.1|  BnaC03g25200D                                          101   1e-22   
emb|CDX95640.1|  BnaC03g25210D                                          101   1e-22   
gb|KHN09786.1|  Auxin-induced protein X10A                              100   1e-22   
ref|XP_006397701.1|  hypothetical protein EUTSA_v10001787mg             101   1e-22   
ref|XP_009133717.1|  PREDICTED: uncharacterized protein LOC103858166    101   2e-22   
ref|XP_009347833.1|  PREDICTED: uncharacterized protein LOC103939462    101   2e-22   
gb|KFK37314.1|  hypothetical protein AALP_AA4G241000                    100   3e-22   
ref|XP_008369535.1|  PREDICTED: uncharacterized protein LOC103433088    100   3e-22   
ref|XP_002880165.1|  hypothetical protein ARALYDRAFT_903961             100   3e-22   
ref|XP_002303522.2|  auxin-responsive family protein                    100   3e-22   Populus trichocarpa [western balsam poplar]
ref|XP_006368680.1|  hypothetical protein POPTR_0001s07700g             100   4e-22   
ref|XP_004514848.1|  PREDICTED: uncharacterized protein LOC101506835    100   4e-22   
ref|XP_006601450.1|  PREDICTED: auxin-induced protein 10A5-like       99.0    4e-22   
ref|XP_010506459.1|  PREDICTED: uncharacterized protein LOC104783073  99.8    5e-22   
ref|NP_182046.1|  SAUR-like auxin-responsive protein                  99.8    6e-22   Arabidopsis thaliana [mouse-ear cress]
emb|CDY65616.1|  BnaC02g46720D                                        97.4    6e-22   
ref|XP_010508200.1|  PREDICTED: uncharacterized protein LOC104784811  99.4    9e-22   
ref|XP_011033922.1|  PREDICTED: uncharacterized protein LOC105132253  99.8    1e-21   
ref|XP_010518134.1|  PREDICTED: uncharacterized protein LOC104793478  98.6    1e-21   
gb|KHN04333.1|  Indole-3-acetic acid-induced protein ARG7             97.1    2e-21   
ref|XP_010241750.1|  PREDICTED: uncharacterized protein LOC104586277  97.1    5e-21   
ref|XP_006295154.1|  hypothetical protein CARUB_v10024230mg           96.7    8e-21   
ref|XP_010053911.1|  PREDICTED: uncharacterized protein LOC104442256  96.3    1e-20   
ref|XP_003599697.1|  Auxin-induced SAUR-like protein                  95.5    1e-20   
ref|XP_011018252.1|  PREDICTED: uncharacterized protein LOC105121359  95.5    3e-20   
ref|XP_009397869.1|  PREDICTED: uncharacterized protein LOC103982612  94.7    6e-20   
ref|XP_006402554.1|  hypothetical protein EUTSA_v10006509mg           94.0    1e-19   
ref|NP_191628.1|  SAUR-like auxin-responsive protein                  92.8    2e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010054898.1|  PREDICTED: uncharacterized protein LOC104443264  92.8    4e-19   
emb|CDY48371.1|  BnaC04g22040D                                        92.0    4e-19   
emb|CDX97341.1|  BnaA02g21320D                                        91.3    6e-19   
gb|KFK35270.1|  hypothetical protein AALP_AA5G263400                  91.7    6e-19   
ref|XP_010469153.1|  PREDICTED: auxin-induced protein X10A-like       91.7    6e-19   
ref|XP_010512403.1|  PREDICTED: auxin-induced protein X10A-like       91.3    7e-19   
ref|XP_002876576.1|  auxin-responsive family protein                  91.3    8e-19   
ref|XP_009588676.1|  PREDICTED: auxin-induced protein 15A-like        89.7    9e-19   
ref|XP_006291944.1|  hypothetical protein CARUB_v10018131mg           91.3    9e-19   
emb|CDX89071.1|  BnaA04g01150D                                        90.5    1e-18   
ref|XP_009138820.1|  PREDICTED: uncharacterized protein LOC103862867  90.5    1e-18   
ref|XP_009387875.1|  PREDICTED: uncharacterized protein LOC103974723  90.9    1e-18   
ref|XP_009406324.1|  PREDICTED: uncharacterized protein LOC103989213  90.9    2e-18   
ref|XP_004159805.1|  PREDICTED: auxin-induced protein 6B-like         89.7    2e-18   
ref|XP_008809045.1|  PREDICTED: uncharacterized protein LOC103720874  90.5    2e-18   
ref|XP_010413528.1|  PREDICTED: auxin-induced protein X10A-like       90.1    2e-18   
ref|XP_009116750.1|  PREDICTED: auxin-induced protein X10A            89.7    3e-18   
emb|CDY41147.1|  BnaA09g38680D                                        89.4    3e-18   
gb|KHN47895.1|  Auxin-induced protein X10A                            88.2    6e-18   
ref|XP_009796475.1|  PREDICTED: auxin-induced protein 15A-like        87.4    7e-18   
gb|EPS59338.1|  hypothetical protein M569_15471                       87.4    8e-18   
ref|XP_004147976.1|  PREDICTED: uncharacterized protein LOC101210462  88.2    8e-18   
gb|KGN45710.1|  hypothetical protein Csa_6G007440                     89.4    8e-18   
emb|CDX71789.1|  BnaC08g30850D                                        88.2    9e-18   
ref|XP_008796846.1|  PREDICTED: uncharacterized protein LOC103712176  89.4    9e-18   
ref|XP_008812363.1|  PREDICTED: uncharacterized protein LOC103723263  88.6    1e-17   
ref|XP_008448892.1|  PREDICTED: uncharacterized protein LOC103490920  87.4    1e-17   
ref|XP_008458152.1|  PREDICTED: uncharacterized protein LOC103497676  87.8    2e-17   
ref|XP_010933719.1|  PREDICTED: uncharacterized protein LOC105054040  88.2    2e-17   
ref|XP_006828033.1|  hypothetical protein AMTR_s00008p00255330        86.7    3e-17   
gb|EAZ23974.1|  hypothetical protein OsJ_07701                        87.0    4e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004953271.1|  PREDICTED: uncharacterized protein LOC101757474  86.3    7e-17   
ref|XP_004230018.1|  PREDICTED: auxin-induced protein 15A             83.6    1e-16   
ref|XP_002454566.1|  hypothetical protein SORBIDRAFT_04g033550        85.5    1e-16   Sorghum bicolor [broomcorn]
ref|XP_003626587.1|  Auxin-induced protein X15                        82.8    2e-16   
ref|XP_006339758.1|  PREDICTED: auxin-induced protein 15A-like        82.8    2e-16   
dbj|BAJ89028.1|  predicted protein                                    84.7    2e-16   
ref|XP_008794848.1|  PREDICTED: uncharacterized protein LOC103710746  84.3    3e-16   
gb|ADM74031.1|  auxin responsive family-like protein                  83.6    3e-16   
gb|ADM73997.1|  auxin responsive family-like protein                  83.6    3e-16   
gb|ADM73999.1|  auxin responsive family-like protein                  83.6    3e-16   
gb|ADM74001.1|  auxin responsive family-like protein                  83.6    3e-16   
gb|ADM74023.1|  auxin responsive family-like protein                  83.6    3e-16   
gb|ADM74015.1|  auxin responsive family-like protein                  83.6    3e-16   
ref|XP_010906625.1|  PREDICTED: uncharacterized protein LOC105033493  84.0    4e-16   
ref|XP_004494852.1|  PREDICTED: auxin-induced protein 10A5-like       81.6    4e-16   
ref|NP_001053425.1|  Os04g0537100                                     83.2    5e-16   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ31465.1|  hypothetical protein OsJ_15602                        83.2    6e-16   Oryza sativa Japonica Group [Japonica rice]
gb|ACG44233.1|  SAUR11 - auxin-responsive SAUR family member          83.6    6e-16   Zea mays [maize]
ref|XP_008678880.1|  PREDICTED: uncharacterized protein LOC103653849  83.6    7e-16   
gb|ADM74030.1|  auxin responsive family-like protein                  82.4    7e-16   
gb|KHN35614.1|  Auxin-induced protein X10A                            81.3    8e-16   
ref|XP_010271569.1|  PREDICTED: auxin-induced protein 15A-like        80.9    9e-16   
ref|XP_004502720.1|  PREDICTED: uncharacterized protein LOC101503085  82.0    9e-16   
gb|ADM74027.1|  auxin responsive family-like protein                  81.6    1e-15   
gb|ADM74010.1|  auxin responsive family-like protein                  81.6    1e-15   
gb|KCW78293.1|  hypothetical protein EUGRSUZ_D02472                   80.9    1e-15   
ref|XP_008645998.1|  PREDICTED: uncharacterized protein LOC103627479  82.8    1e-15   
ref|XP_007200167.1|  hypothetical protein PRUPE_ppa016712mg           80.1    1e-15   
ref|XP_010054899.1|  PREDICTED: auxin-induced protein 15A-like        80.9    2e-15   
gb|AIS67841.1|  SAUR3                                                 80.1    2e-15   
ref|XP_004510629.1|  PREDICTED: auxin-induced protein 10A5-like       79.7    2e-15   
gb|KHN25461.1|  Auxin-induced protein X10A                            79.3    3e-15   
ref|XP_006423551.1|  hypothetical protein CICLE_v10029685mg           79.0    3e-15   
ref|XP_010664793.1|  PREDICTED: auxin-induced protein 15A             79.3    3e-15   
ref|XP_003540900.2|  PREDICTED: auxin-induced protein X10A-like       79.7    4e-15   
emb|CDY42185.1|  BnaC03g65060D                                        77.8    5e-15   
ref|XP_010251734.1|  PREDICTED: auxin-induced protein X15-like        79.0    5e-15   
ref|NP_001047561.1|  Os02g0643800                                     80.9    5e-15   Oryza sativa Japonica Group [Japonica rice]
gb|EAY86867.1|  hypothetical protein OsI_08251                        80.9    5e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_004976373.1|  PREDICTED: uncharacterized protein LOC101773025  80.1    6e-15   
ref|XP_002320219.1|  auxin-responsive family protein                  78.6    7e-15   Populus trichocarpa [western balsam poplar]
ref|XP_003627497.1|  Auxin-induced protein 10A5                       78.6    7e-15   
emb|CBI37960.3|  unnamed protein product                              78.2    8e-15   
gb|KDO42793.1|  hypothetical protein CISIN_1g047919mg                 78.2    8e-15   
gb|KHN11782.1|  Auxin-induced protein X10A                            79.7    9e-15   
ref|XP_004147006.1|  PREDICTED: auxin-induced protein 10A5-like       77.8    9e-15   
ref|XP_010530798.1|  PREDICTED: auxin-induced protein 15A             78.2    9e-15   
ref|XP_008457625.1|  PREDICTED: auxin-induced protein 15A-like        77.8    9e-15   
ref|XP_008457631.1|  PREDICTED: auxin-induced protein 15A-like        77.8    1e-14   
ref|XP_004505827.1|  PREDICTED: auxin-induced protein X10A-like       77.4    1e-14   
ref|XP_009765341.1|  PREDICTED: auxin-induced protein 15A-like        78.2    1e-14   
gb|AFK37533.1|  unknown                                               77.8    1e-14   
ref|XP_003580232.1|  PREDICTED: uncharacterized protein LOC100846166  79.3    1e-14   
ref|XP_006423557.1|  hypothetical protein CICLE_v10030256mg           77.4    2e-14   
emb|CAE03018.3|  OSJNBa0091D06.3                                      83.2    2e-14   Oryza sativa [red rice]
ref|XP_011088768.1|  PREDICTED: auxin-induced protein 15A-like        77.4    2e-14   
emb|CAN79758.1|  hypothetical protein VITISV_009898                   76.6    2e-14   Vitis vinifera
ref|XP_010086682.1|  hypothetical protein L484_000889                 77.4    2e-14   
ref|XP_010248164.1|  PREDICTED: auxin-induced protein 15A-like        77.0    2e-14   
ref|XP_004248873.1|  PREDICTED: auxin-induced protein 15A-like        77.0    2e-14   
ref|XP_006423558.1|  hypothetical protein CICLE_v10030013mg           77.0    2e-14   
ref|XP_004147010.1|  PREDICTED: auxin-induced protein X10A-like       77.0    2e-14   
ref|XP_007051462.1|  SAUR-like auxin-responsive protein family        77.4    2e-14   
ref|XP_009385180.1|  PREDICTED: uncharacterized protein LOC103972549  78.2    2e-14   
emb|CDO96966.1|  unnamed protein product                              77.0    2e-14   
ref|XP_004155191.1|  PREDICTED: auxin-induced protein 15A-like        77.4    2e-14   
ref|XP_004133791.1|  PREDICTED: auxin-induced protein 15A-like        77.4    2e-14   
ref|XP_003602327.1|  Auxin-induced protein 10A5                       77.8    2e-14   
ref|XP_010469007.1|  PREDICTED: auxin-induced protein 15A-like        77.8    2e-14   
ref|XP_010246396.1|  PREDICTED: auxin-induced protein 15A-like        77.0    2e-14   
gb|KHN06346.1|  Auxin-induced protein 10A5                            77.0    2e-14   
ref|XP_003528773.1|  PREDICTED: auxin-induced protein 10A5-like       77.0    2e-14   
gb|AFK49405.1|  unknown                                               76.6    2e-14   
ref|XP_002271501.1|  PREDICTED: auxin-induced protein X15             76.6    2e-14   Vitis vinifera
ref|XP_006350722.1|  PREDICTED: indole-3-acetic acid-induced prot...  77.4    3e-14   
emb|CAN62606.1|  hypothetical protein VITISV_016867                   75.9    3e-14   Vitis vinifera
ref|XP_006444768.1|  hypothetical protein CICLE_v10022948mg           77.0    3e-14   
ref|NP_191749.1|  SAUR-like auxin-responsive protein                  77.4    3e-14   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001151006.1|  SAUR11 - auxin-responsive SAUR family member     79.0    3e-14   Zea mays [maize]
ref|XP_002276058.2|  PREDICTED: auxin-induced protein X15             76.3    3e-14   Vitis vinifera
ref|XP_006838622.1|  hypothetical protein AMTR_s00002p00232820        78.2    3e-14   
ref|XP_004144912.1|  PREDICTED: indole-3-acetic acid-induced prot...  77.0    3e-14   
ref|XP_007135297.1|  hypothetical protein PHAVU_010G117500g           76.6    3e-14   
ref|XP_008343461.1|  PREDICTED: indole-3-acetic acid-induced prot...  77.0    3e-14   
emb|CDX76596.1|  BnaC08g31820D                                        76.6    4e-14   
emb|CBI37949.3|  unnamed protein product                              75.9    4e-14   
ref|XP_010544871.1|  PREDICTED: auxin-induced protein 15A-like        76.6    4e-14   
gb|KHN15899.1|  Auxin-induced protein 10A5                            76.6    4e-14   
emb|CBI37962.3|  unnamed protein product                              77.0    5e-14   
gb|KDO42792.1|  hypothetical protein CISIN_1g040932mg                 75.9    5e-14   
emb|CDY17486.1|  BnaC03g65770D                                        75.9    5e-14   
ref|XP_008376188.1|  PREDICTED: auxin-induced protein X15             76.3    5e-14   
ref|XP_007131725.1|  hypothetical protein PHAVU_011G036500g           75.5    5e-14   
ref|XP_009765339.1|  PREDICTED: auxin-induced protein 15A-like        75.5    6e-14   
ref|XP_006397860.1|  hypothetical protein EUTSA_v10001684mg           76.3    6e-14   
ref|XP_010035304.1|  PREDICTED: indole-3-acetic acid-induced prot...  76.6    6e-14   
ref|XP_007147345.1|  hypothetical protein PHAVU_006G116200g           75.9    6e-14   
ref|XP_009366624.1|  PREDICTED: indole-3-acetic acid-induced prot...  76.3    6e-14   
ref|XP_010527467.1|  PREDICTED: auxin-induced protein 15A-like        75.5    6e-14   
ref|XP_006347637.1|  PREDICTED: indole-3-acetic acid-induced prot...  75.9    6e-14   
ref|XP_011023120.1|  PREDICTED: auxin-induced protein 15A-like        75.9    7e-14   
ref|XP_002272231.1|  PREDICTED: auxin-induced protein X15-like        75.5    7e-14   Vitis vinifera
ref|XP_002276412.1|  PREDICTED: auxin-induced protein 15A             75.5    7e-14   Vitis vinifera
ref|XP_009142437.1|  PREDICTED: auxin-induced protein 15A-like        75.9    7e-14   
ref|XP_002271660.2|  PREDICTED: uncharacterized protein LOC100252964  77.8    7e-14   Vitis vinifera
gb|EYU35297.1|  hypothetical protein MIMGU_mgv1a021816mg              75.1    7e-14   
ref|XP_010413332.1|  PREDICTED: auxin-induced protein 15A-like        76.3    7e-14   
ref|XP_004235010.1|  PREDICTED: auxin-induced protein X15-like        75.9    7e-14   
ref|XP_010507984.1|  PREDICTED: auxin-induced protein 15A-like        75.9    8e-14   
gb|KFK37448.1|  hypothetical protein AALP_AA4G258100                  75.9    8e-14   
ref|XP_002272387.1|  PREDICTED: auxin-induced protein 15A-like        75.5    8e-14   Vitis vinifera
ref|XP_010246403.1|  PREDICTED: auxin-induced protein 15A-like        75.1    8e-14   
ref|XP_009606929.1|  PREDICTED: auxin-induced protein 15A-like        75.1    8e-14   
ref|XP_008457635.1|  PREDICTED: auxin-induced protein 15A-like        75.1    8e-14   
ref|XP_008237099.1|  PREDICTED: auxin-induced protein 15A-like        75.9    8e-14   
gb|ADN34225.1|  auxin-responsive family protein                       75.5    8e-14   
ref|XP_002271395.1|  PREDICTED: auxin-induced protein 15A             75.1    8e-14   Vitis vinifera
ref|XP_010271404.1|  PREDICTED: auxin-induced protein 15A-like        75.1    9e-14   
ref|XP_009116859.1|  PREDICTED: auxin-induced protein X15             75.9    9e-14   
gb|EYU43813.1|  hypothetical protein MIMGU_mgv1a024258mg              75.5    9e-14   
ref|XP_010512568.1|  PREDICTED: auxin-induced protein 15A-like        75.9    9e-14   
ref|XP_010506685.1|  PREDICTED: auxin-induced protein 15A-like        75.5    9e-14   
ref|NP_182192.1|  SAUR-like auxin-responsive protein                  75.9    9e-14   
ref|XP_002301429.2|  auxin-responsive family protein                  75.5    9e-14   
gb|KDP27603.1|  hypothetical protein JCGZ_19608                       75.1    9e-14   
ref|XP_007201447.1|  hypothetical protein PRUPE_ppa013863mg           75.1    9e-14   
ref|XP_002880259.1|  auxin-responsive family protein                  75.5    1e-13   
ref|XP_008233080.1|  PREDICTED: auxin-induced protein 15A             75.5    1e-13   
emb|CDY41548.1|  BnaC04g00740D                                        75.5    1e-13   
ref|XP_008459757.1|  PREDICTED: indole-3-acetic acid-induced prot...  75.1    1e-13   
ref|XP_010100683.1|  hypothetical protein L484_023452                 75.5    1e-13   
ref|XP_010463845.1|  PREDICTED: auxin-induced protein 15A-like        74.7    1e-13   
ref|XP_009351936.1|  PREDICTED: auxin-induced protein 15A-like        75.9    1e-13   
ref|XP_004290377.1|  PREDICTED: indole-3-acetic acid-induced prot...  74.7    1e-13   
ref|XP_009368353.1|  PREDICTED: auxin-induced protein 15A-like        74.7    1e-13   
ref|XP_010523830.1|  PREDICTED: indole-3-acetic acid-induced prot...  75.1    1e-13   
ref|XP_006402430.1|  hypothetical protein EUTSA_v10006318mg           75.1    1e-13   
ref|XP_004169675.1|  PREDICTED: indole-3-acetic acid-induced prot...  74.7    1e-13   
ref|XP_011044712.1|  PREDICTED: auxin-induced protein X15             75.1    1e-13   
emb|CBI37953.3|  unnamed protein product                              74.7    1e-13   
gb|EYU35308.1|  hypothetical protein MIMGU_mgv1a026507mg              74.3    1e-13   
ref|XP_004240979.1|  PREDICTED: auxin-induced protein X15             75.1    1e-13   
ref|XP_004165219.1|  PREDICTED: indole-3-acetic acid-induced prot...  74.3    1e-13   
ref|XP_008376800.1|  PREDICTED: auxin-induced protein 15A             75.5    1e-13   
ref|XP_010246401.1|  PREDICTED: auxin-induced protein 15A-like        74.3    2e-13   
gb|KDP34550.1|  hypothetical protein JCGZ_11100                       74.7    2e-13   
ref|XP_002271620.1|  PREDICTED: auxin-induced protein 15A             74.3    2e-13   
ref|XP_010246391.1|  PREDICTED: auxin-induced protein 15A-like        74.7    2e-13   
ref|XP_007131736.1|  hypothetical protein PHAVU_011G037600g           74.3    2e-13   
ref|XP_006441210.1|  hypothetical protein CICLE_v10022912mg           75.1    2e-13   
ref|XP_007039174.1|  SAUR family protein                              75.1    2e-13   
ref|XP_010105322.1|  hypothetical protein L484_000538                 74.3    2e-13   
ref|XP_004231443.1|  PREDICTED: auxin-induced protein 15A-like        74.3    2e-13   
ref|XP_002271793.1|  PREDICTED: auxin-induced protein X15             74.3    2e-13   
ref|XP_002318465.1|  hypothetical protein POPTR_0012s03050g           75.5    2e-13   
gb|EYU37899.1|  hypothetical protein MIMGU_mgv1a019099mg              73.9    2e-13   
ref|XP_006493175.1|  PREDICTED: auxin-induced protein 10A5-like       75.1    2e-13   
ref|XP_010255165.1|  PREDICTED: auxin-induced protein 15A-like        74.3    2e-13   
ref|XP_009786096.1|  PREDICTED: auxin-induced protein 15A-like        74.3    2e-13   
ref|NP_195596.1|  SAUR-like auxin-responsive protein                  73.9    2e-13   
gb|EYU23193.1|  hypothetical protein MIMGU_mgv11b024059mg             73.9    2e-13   
ref|XP_002876644.1|  auxin-responsive family protein                  75.1    2e-13   
ref|XP_006295248.1|  hypothetical protein CARUB_v10024336mg           74.7    2e-13   
ref|XP_010267445.1|  PREDICTED: auxin-induced protein X15-like        74.3    2e-13   
ref|XP_010536046.1|  PREDICTED: auxin-induced protein 15A-like        74.7    2e-13   
gb|KHN23320.1|  Auxin-induced protein X15                             75.1    2e-13   
ref|XP_003569974.1|  PREDICTED: uncharacterized protein LOC100833079  76.3    2e-13   
ref|NP_179717.1|  SAUR-like auxin-responsive protein                  73.9    2e-13   
ref|XP_010647407.1|  PREDICTED: auxin-induced protein X15-like        73.9    2e-13   
ref|XP_010101891.1|  hypothetical protein L484_015481                 73.9    2e-13   
emb|CDO96967.1|  unnamed protein product                              73.9    2e-13   
gb|KDP27616.1|  hypothetical protein JCGZ_19621                       73.9    2e-13   
emb|CBI17632.3|  unnamed protein product                              74.7    2e-13   
ref|XP_010536039.1|  PREDICTED: auxin-induced protein 15A-like        73.9    2e-13   
ref|XP_009361302.1|  PREDICTED: auxin-induced protein 15A             74.7    2e-13   
gb|KDP27614.1|  hypothetical protein JCGZ_19619                       73.9    3e-13   
ref|XP_009347325.1|  PREDICTED: indole-3-acetic acid-induced prot...  73.9    3e-13   
ref|XP_007201545.1|  hypothetical protein PRUPE_ppa017462mg           73.9    3e-13   
ref|XP_002276250.1|  PREDICTED: auxin-induced protein X15             73.6    3e-13   
ref|XP_008381430.1|  PREDICTED: auxin-induced protein 15A-like        74.7    3e-13   
gb|KFK37818.1|  hypothetical protein AALP_AA3G033200                  73.6    3e-13   
ref|XP_010271401.1|  PREDICTED: uncharacterized protein LOC104607462  75.9    3e-13   
ref|XP_009368356.1|  PREDICTED: indole-3-acetic acid-induced prot...  73.6    3e-13   
ref|XP_007218591.1|  hypothetical protein PRUPE_ppa013301mg           74.3    3e-13   
ref|XP_010691630.1|  PREDICTED: auxin-induced protein X15             73.6    3e-13   
ref|XP_011088528.1|  PREDICTED: auxin-induced protein X15-like        73.6    3e-13   
ref|XP_007201444.1|  hypothetical protein PRUPE_ppa013844mg           73.6    3e-13   
ref|XP_009793415.1|  PREDICTED: auxin-induced protein 15A-like        73.6    3e-13   
ref|XP_002276204.1|  PREDICTED: auxin-induced protein X15             73.6    3e-13   
gb|ABK27017.1|  unknown                                               74.7    3e-13   
ref|XP_010692322.1|  PREDICTED: auxin-induced protein X15             74.3    3e-13   
gb|KDP34548.1|  hypothetical protein JCGZ_11098                       73.6    3e-13   
ref|XP_010485737.1|  PREDICTED: auxin-induced protein 15A             73.6    3e-13   
ref|XP_010246393.1|  PREDICTED: auxin-induced protein 15A-like        73.6    3e-13   
ref|XP_003604019.1|  Auxin-induced protein 6B                         73.6    3e-13   
emb|CBI17630.3|  unnamed protein product                              72.8    3e-13   
ref|XP_006292049.1|  hypothetical protein CARUB_v10018241mg           74.3    3e-13   
emb|CAN70456.1|  hypothetical protein VITISV_035060                   72.8    4e-13   
gb|AES89366.2|  SAUR-like auxin-responsive family protein             73.2    4e-13   
ref|XP_002866819.1|  SAUR_AC1                                         73.2    4e-13   
ref|XP_004158416.1|  PREDICTED: uncharacterized protein LOC101225517  75.5    4e-13   
ref|XP_010091187.1|  hypothetical protein L484_002582                 74.7    4e-13   
ref|XP_002271427.1|  PREDICTED: auxin-induced protein 15A             73.2    4e-13   
ref|XP_008236177.1|  PREDICTED: auxin-induced protein 15A             73.6    4e-13   
ref|XP_004306629.1|  PREDICTED: auxin-induced protein X15-like        73.9    4e-13   
emb|CBI17626.3|  unnamed protein product                              73.2    4e-13   
emb|CDY40657.1|  BnaA03g53060D                                        74.7    4e-13   
ref|XP_006365925.1|  PREDICTED: auxin-induced protein 10A5-like       73.2    4e-13   
emb|CBI37951.3|  unnamed protein product                              73.2    4e-13   
ref|XP_006359717.1|  PREDICTED: auxin-induced protein 15A-like        72.8    4e-13   
ref|NP_195206.1|  SAUR-like auxin-responsive protein                  73.2    4e-13   
ref|XP_010246394.1|  PREDICTED: auxin-induced protein 15A-like        73.2    4e-13   
gb|EYU35295.1|  hypothetical protein MIMGU_mgv1a023063mg              72.4    5e-13   
ref|XP_010246400.1|  PREDICTED: auxin-induced protein 15A-like        72.8    5e-13   
ref|XP_003533479.1|  PREDICTED: auxin-induced protein X10A-like       73.2    5e-13   
ref|XP_009765338.1|  PREDICTED: auxin-induced protein 15A-like        73.2    5e-13   
ref|XP_009621717.1|  PREDICTED: auxin-induced protein 15A-like        73.2    5e-13   
ref|XP_006352406.1|  PREDICTED: auxin-induced protein 15A-like        72.8    5e-13   
ref|XP_009138328.1|  PREDICTED: auxin-induced protein X15-like        72.8    5e-13   
ref|XP_006577905.1|  PREDICTED: auxin-induced protein X10A-like       73.2    5e-13   
ref|XP_008234672.1|  PREDICTED: auxin-induced protein 15A-like        73.9    5e-13   
ref|XP_010248232.1|  PREDICTED: auxin-induced protein X10A-like       73.2    5e-13   
ref|XP_011004678.1|  PREDICTED: auxin-induced protein 15A-like        73.2    5e-13   
ref|XP_006849181.1|  hypothetical protein AMTR_s00027p00198570        73.6    5e-13   
ref|XP_009101928.1|  PREDICTED: auxin-induced protein X15-like        72.8    6e-13   
gb|KFK37817.1|  hypothetical protein AALP_AA3G033100                  72.8    6e-13   
ref|XP_002271861.2|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  75.1    6e-13   
ref|XP_009347320.1|  PREDICTED: auxin-induced protein 15A-like        72.8    6e-13   
ref|XP_009142614.1|  PREDICTED: auxin-induced protein X15             73.6    6e-13   
ref|NP_001235246.1|  uncharacterized protein LOC100526867             73.9    6e-13   
ref|XP_006408253.1|  hypothetical protein EUTSA_v10021846mg           72.8    6e-13   
ref|XP_007041961.1|  SAUR-like auxin-responsive protein family        74.7    6e-13   
ref|XP_003534344.1|  PREDICTED: auxin-induced protein 10A5-like       72.8    6e-13   
ref|XP_009615595.1|  PREDICTED: auxin-induced protein 15A-like        72.4    6e-13   
ref|XP_006411675.1|  hypothetical protein EUTSA_v10027066mg           72.4    6e-13   
ref|XP_004147016.1|  PREDICTED: auxin-induced protein X10A-like       72.8    7e-13   
ref|XP_009774274.1|  PREDICTED: auxin-induced protein 15A-like        73.2    7e-13   
ref|XP_002446859.1|  hypothetical protein SORBIDRAFT_06g023800        74.3    7e-13   
ref|XP_004163654.1|  PREDICTED: auxin-induced protein 15A-like        72.8    7e-13   
ref|XP_002263012.1|  PREDICTED: auxin-induced protein 15A             73.2    7e-13   
gb|EYU40730.1|  hypothetical protein MIMGU_mgv1a023017mg              72.8    7e-13   
ref|XP_004307934.1|  PREDICTED: auxin-induced protein 10A5-like       73.2    7e-13   
ref|XP_006352409.1|  PREDICTED: auxin-induced protein 15A-like        72.4    7e-13   
ref|XP_003607098.1|  Auxin-induced protein 6B                         72.4    7e-13   
ref|XP_003631579.1|  PREDICTED: auxin-induced protein X15             72.4    7e-13   
ref|XP_007218348.1|  hypothetical protein PRUPE_ppa010986mg           75.1    7e-13   
ref|XP_003523333.1|  PREDICTED: auxin-induced protein X15             73.2    7e-13   
ref|XP_002312989.1|  hypothetical protein POPTR_0009s13020g           72.8    7e-13   
ref|XP_004250224.1|  PREDICTED: auxin-induced protein X15-like        72.4    8e-13   
ref|XP_009368357.1|  PREDICTED: indole-3-acetic acid-induced prot...  72.4    8e-13   
ref|XP_010255167.1|  PREDICTED: auxin-induced protein X10A-like       72.8    8e-13   
ref|XP_008457637.1|  PREDICTED: auxin-induced protein 15A-like        72.4    8e-13   
ref|XP_010649243.1|  PREDICTED: auxin-induced protein 15A             72.4    8e-13   
ref|XP_006349639.1|  PREDICTED: auxin-induced protein 15A-like        72.0    8e-13   
ref|XP_010919470.1|  PREDICTED: uncharacterized protein LOC105043588  74.3    8e-13   
gb|EYU35268.1|  hypothetical protein MIMGU_mgv1a021605mg              72.0    8e-13   
ref|XP_010312723.1|  PREDICTED: auxin-induced protein 15A-like        72.4    8e-13   
gb|EYU35271.1|  hypothetical protein MIMGU_mgv1a020811mg              72.0    9e-13   
ref|XP_009606928.1|  PREDICTED: auxin-induced protein 15A-like        72.4    9e-13   
ref|XP_008448001.1|  PREDICTED: auxin-induced protein 15A             72.4    9e-13   
ref|XP_007199259.1|  hypothetical protein PRUPE_ppa022603mg           72.0    1e-12   
gb|AGQ56867.1|  SAUR family protein 22                                73.2    1e-12   
ref|XP_002869125.1|  auxin-responsive family protein                  72.0    1e-12   
emb|CAN70455.1|  hypothetical protein VITISV_035059                   72.4    1e-12   
ref|XP_010649236.1|  PREDICTED: auxin-induced protein 15A-like        72.0    1e-12   
gb|KHN25448.1|  Auxin-induced protein X10A                            72.0    1e-12   
ref|XP_009770670.1|  PREDICTED: auxin-induced protein 15A-like        72.4    1e-12   
gb|KDP27617.1|  hypothetical protein JCGZ_19622                       72.0    1e-12   
gb|KGN61871.1|  hypothetical protein Csa_2G258670                     72.0    1e-12   
emb|CDX69088.1|  BnaC01g03650D                                        72.0    1e-12   
ref|XP_003631553.1|  PREDICTED: auxin-induced protein X15-like        72.0    1e-12   
gb|KDP27613.1|  hypothetical protein JCGZ_19618                       72.0    1e-12   
ref|XP_003607169.1|  Auxin-induced SAUR-like protein                  73.2    1e-12   
ref|XP_004147009.1|  PREDICTED: uncharacterized protein LOC101211443  73.9    1e-12   
ref|XP_002313745.1|  hypothetical protein POPTR_0009s13050g           72.8    1e-12   
ref|XP_006284839.1|  hypothetical protein CARUB_v10006121mg           72.0    1e-12   
gb|KDO42791.1|  hypothetical protein CISIN_1g039421mg                 72.4    1e-12   
ref|XP_006423556.1|  hypothetical protein CICLE_v10030035mg           72.4    1e-12   
ref|XP_007041959.1|  SAUR-like auxin-responsive protein family        72.4    1e-12   
ref|XP_006494590.1|  PREDICTED: auxin-induced protein X10A-like       71.6    1e-12   
ref|XP_006352413.1|  PREDICTED: auxin-induced protein 15A-like        71.6    1e-12   
ref|XP_002321970.1|  hypothetical protein POPTR_0015s00920g           72.4    1e-12   
ref|XP_008237037.1|  PREDICTED: indole-3-acetic acid-induced prot...  71.6    1e-12   
ref|XP_010514749.1|  PREDICTED: auxin-induced protein 15A-like        71.6    1e-12   
ref|XP_002306151.1|  hypothetical protein POPTR_0004s17190g           71.6    1e-12   
gb|EYU40726.1|  hypothetical protein MIMGU_mgv1a023467mg              71.2    1e-12   
ref|XP_009358224.1|  PREDICTED: auxin-induced protein 15A-like        72.0    1e-12   
ref|XP_007201445.1|  hypothetical protein PRUPE_ppa013846mg           71.6    1e-12   
ref|XP_002276227.1|  PREDICTED: auxin-induced protein 15A             71.6    1e-12   
ref|XP_006494595.1|  PREDICTED: auxin-induced protein 10A5-like       72.0    2e-12   
ref|XP_004290376.1|  PREDICTED: indole-3-acetic acid-induced prot...  71.6    2e-12   
ref|XP_010263886.1|  PREDICTED: auxin-induced protein 15A-like        71.6    2e-12   
ref|XP_006359715.1|  PREDICTED: auxin-induced protein 10A5-like       71.6    2e-12   
gb|KDP27610.1|  hypothetical protein JCGZ_19615                       71.6    2e-12   
ref|XP_011088519.1|  PREDICTED: auxin-induced protein 15A-like        71.6    2e-12   
ref|XP_008365898.1|  PREDICTED: auxin-induced protein 15A-like        71.6    2e-12   
ref|XP_008392043.1|  PREDICTED: auxin-induced protein 15A-like        71.6    2e-12   
ref|XP_009793038.1|  PREDICTED: auxin-induced protein X15-like        72.0    2e-12   
ref|XP_008457636.1|  PREDICTED: auxin-induced protein 15A-like        71.6    2e-12   
ref|XP_008360591.1|  PREDICTED: auxin-induced protein 15A-like        71.6    2e-12   
gb|KGN61881.1|  hypothetical protein Csa_2G258770                     71.6    2e-12   
ref|XP_003540914.1|  PREDICTED: auxin-induced protein 6B-like         71.2    2e-12   
ref|XP_004292145.1|  PREDICTED: auxin-induced protein X10A-like       72.0    2e-12   
ref|XP_008448012.1|  PREDICTED: auxin-induced protein 15A-like        70.9    2e-12   
ref|XP_006412185.1|  hypothetical protein EUTSA_v10026844mg           71.2    2e-12   
ref|XP_006423562.1|  hypothetical protein CICLE_v10030395mg           71.2    2e-12   
gb|EYU37882.1|  hypothetical protein MIMGU_mgv1a022555mg              71.2    2e-12   
ref|XP_002305476.2|  hypothetical protein POPTR_0004s17370g           71.2    2e-12   
ref|XP_006360733.1|  PREDICTED: auxin-induced protein 15A-like        71.2    2e-12   
ref|XP_002313746.2|  hypothetical protein POPTR_0009s13040g           71.2    2e-12   
emb|CDP15258.1|  unnamed protein product                              72.4    2e-12   
ref|XP_009379590.1|  PREDICTED: auxin-induced protein 15A-like        71.2    2e-12   
ref|XP_006362801.1|  PREDICTED: indole-3-acetic acid-induced prot...  71.2    2e-12   
ref|XP_010542788.1|  PREDICTED: auxin-induced protein X15             72.0    2e-12   
gb|EYU40725.1|  hypothetical protein MIMGU_mgv1a017774mg              70.9    2e-12   
ref|XP_004250217.1|  PREDICTED: auxin-induced protein X15-like        70.9    2e-12   
gb|EYU35302.1|  hypothetical protein MIMGU_mgv1a020374mg              70.5    2e-12   
gb|KGN61877.1|  hypothetical protein Csa_2G258730                     71.2    2e-12   
ref|XP_009620275.1|  PREDICTED: auxin-induced protein 15A-like        70.9    2e-12   
ref|XP_010244080.1|  PREDICTED: auxin-induced protein 15A-like        71.2    2e-12   
ref|XP_007199401.1|  hypothetical protein PRUPE_ppa026172mg           70.9    2e-12   
ref|XP_010472101.1|  PREDICTED: auxin-induced protein X15             71.2    2e-12   
ref|XP_010101890.1|  hypothetical protein L484_015480                 71.2    2e-12   
ref|XP_006423555.1|  hypothetical protein CICLE_v10030043mg           71.2    2e-12   
ref|XP_009592061.1|  PREDICTED: auxin-induced protein 15A-like        70.9    2e-12   
ref|XP_006300074.1|  hypothetical protein CARUB_v10016302mg           70.9    2e-12   
ref|XP_002313000.1|  hypothetical protein POPTR_0009s12910g           70.9    3e-12   
ref|XP_010446400.1|  PREDICTED: auxin-induced protein 15A             70.9    3e-12   
emb|CBI37958.3|  unnamed protein product                              70.9    3e-12   
ref|XP_006408256.1|  hypothetical protein EUTSA_v10022124mg           70.9    3e-12   
gb|KDP27609.1|  hypothetical protein JCGZ_19614                       70.9    3e-12   
ref|XP_002306154.1|  hypothetical protein POPTR_0004s17260g           70.9    3e-12   
emb|CDY49145.1|  BnaC09g52080D                                        70.9    3e-12   
ref|XP_010536042.1|  PREDICTED: auxin-induced protein 15A-like        70.9    3e-12   
ref|XP_003607106.1|  Auxin-induced protein 6B                         70.9    3e-12   
gb|KDP27604.1|  hypothetical protein JCGZ_19609                       70.9    3e-12   
ref|XP_004501106.1|  PREDICTED: auxin-induced protein X10A-like       70.9    3e-12   
ref|XP_008236178.1|  PREDICTED: auxin-induced protein 15A-like        70.9    3e-12   
gb|AFG56380.1|  hypothetical protein 0_8672_01                        72.0    3e-12   
ref|XP_007136493.1|  hypothetical protein PHAVU_009G049900g           71.2    3e-12   
gb|EYU35300.1|  hypothetical protein MIMGU_mgv1a018533mg              70.9    3e-12   



>ref|XP_009759089.1| PREDICTED: uncharacterized protein LOC104211693 [Nicotiana sylvestris]
Length=170

 Score =   143 bits (360),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 82/110 (75%), Gaps = 2/110 (2%)
 Frame = +2

Query  284  GRRVLAVVKRDVRLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLF  463
            G + L + K +    RVGQE    +K SVP GHLAVYVGE +  TCR+VVPV YFNHPLF
Sbjct  58   GVKSLCIAKPNSGFFRVGQELIESKKVSVPKGHLAVYVGEDKDDTCRIVVPVIYFNHPLF  117

Query  464  ANLLREAETVYGFDHPGGIQIPCRISEFENVKSRIAADGDARRVR--RSW  607
            A+LLREAE VYG++H GGIQIPCRISEFENV+SRIAA G   + R  RSW
Sbjct  118  ADLLREAEMVYGYNHSGGIQIPCRISEFENVQSRIAATGGGGKCRGERSW  167



>ref|XP_009592398.1| PREDICTED: auxin-induced protein X10A-like [Nicotiana tomentosiformis]
Length=162

 Score =   142 bits (357),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 78/105 (74%), Gaps = 0/105 (0%)
 Frame = +2

Query  284  GRRVLAVVKRDVRLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLF  463
            G + L   K +   IRVGQEP  P++ SVP GHLAVYVGE    TCRVVVPV YFNHPLF
Sbjct  57   GAKGLCFAKPNSGYIRVGQEPIDPKQVSVPKGHLAVYVGEKIDDTCRVVVPVIYFNHPLF  116

Query  464  ANLLREAETVYGFDHPGGIQIPCRISEFENVKSRIAADGDARRVR  598
            A+LLREAE  YG++H GGIQIPCRISEFENVKSRIAA G     R
Sbjct  117  ADLLREAEMTYGYNHSGGIQIPCRISEFENVKSRIAATGGGGNCR  161



>ref|XP_009592396.1| PREDICTED: auxin-induced protein X10A-like [Nicotiana tomentosiformis]
Length=170

 Score =   142 bits (357),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 83/111 (75%), Gaps = 2/111 (2%)
 Frame = +2

Query  284  GRRVLAVVKRDVRLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLF  463
            G + L   + +   IRVG +P  P++ +VP GHLAVYVGE +  TCR+VVPV YFNHPLF
Sbjct  57   GAKGLCFARPNSGYIRVGHDPVEPKQVTVPKGHLAVYVGEKKDDTCRIVVPVIYFNHPLF  116

Query  464  ANLLREAETVYGFDHPGGIQIPCRISEFENVKSRIAADGDAR--RVRRSWS  610
            ANLLREAE +YG++H GGIQIPC ISEFENV+SRIAA G     RV RSWS
Sbjct  117  ANLLREAEMIYGYNHSGGIQIPCPISEFENVQSRIAATGGGENCRVERSWS  167



>ref|XP_010325465.1| PREDICTED: auxin-induced protein X10A-like [Solanum lycopersicum]
Length=148

 Score =   140 bits (352),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 76/97 (78%), Gaps = 2/97 (2%)
 Frame = +2

Query  326  IRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFD  505
            IRVGQEP   ++ SVP GHLAVYVGE +  TCRV+VPV YFNHPLFA LL+EAE VYG++
Sbjct  50   IRVGQEPIASKQVSVPKGHLAVYVGEKKDDTCRVMVPVIYFNHPLFAELLKEAEMVYGYN  109

Query  506  HPGGIQIPCRISEFENVKSRIAADGDARRVR--RSWS  610
            H GGIQIPCR+SEFENVKSRIAA G     R  RSW 
Sbjct  110  HSGGIQIPCRVSEFENVKSRIAAMGGGGNSRGERSWK  146



>ref|XP_009771366.1| PREDICTED: auxin-induced protein X10A-like [Nicotiana sylvestris]
Length=162

 Score =   140 bits (352),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 78/106 (74%), Gaps = 0/106 (0%)
 Frame = +2

Query  284  GRRVLAVVKRDVRLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLF  463
            G + L   + +   IRVGQEP   ++ SVP GHLAVYVGE    TCRVVVPV YFNHPLF
Sbjct  57   GAKGLCFARPNSGYIRVGQEPVDSKQVSVPKGHLAVYVGEKIDDTCRVVVPVIYFNHPLF  116

Query  464  ANLLREAETVYGFDHPGGIQIPCRISEFENVKSRIAADGDARRVRR  601
            A+LLREAE  YG++H GGIQIPCRISEFENVKSRIAA G     RR
Sbjct  117  ADLLREAEMTYGYNHSGGIQIPCRISEFENVKSRIAATGGGGNCRR  162



>ref|XP_006355494.1| PREDICTED: auxin-induced protein X10A-like [Solanum tuberosum]
Length=148

 Score =   139 bits (349),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +2

Query  326  IRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFD  505
            IRVGQEP  P+K SVP GHLAVYVGE +  TCR++VPV YFNHPLFA LL+EAE VYG++
Sbjct  50   IRVGQEPIAPKKVSVPKGHLAVYVGEKKDDTCRIMVPVIYFNHPLFAELLKEAEMVYGYN  109

Query  506  HPGGIQIPCRISEFENVKSRIAADG  580
            H GGI+IPCR+SEFENVKSRIAA G
Sbjct  110  HSGGIRIPCRVSEFENVKSRIAATG  134



>ref|XP_009771535.1| PREDICTED: auxin-induced protein X10A-like [Nicotiana sylvestris]
Length=162

 Score =   138 bits (348),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 80/105 (76%), Gaps = 0/105 (0%)
 Frame = +2

Query  284  GRRVLAVVKRDVRLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLF  463
            G + L   + +   IRVG++P  P++ +VP GHLAVYVGE +  TCR+VVPV YFNHPLF
Sbjct  57   GAKGLCFARPNSGYIRVGEDPVEPKQVTVPKGHLAVYVGEKKDDTCRIVVPVMYFNHPLF  116

Query  464  ANLLREAETVYGFDHPGGIQIPCRISEFENVKSRIAADGDARRVR  598
            A+LLREAE +YG++H GGIQIPCRIS+FENVKSRIAA G     R
Sbjct  117  ADLLREAEMIYGYNHSGGIQIPCRISDFENVKSRIAATGGGENCR  161



>ref|XP_006355495.1| PREDICTED: uncharacterized protein LOC102583229 [Solanum tuberosum]
Length=164

 Score =   136 bits (343),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +2

Query  326  IRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFD  505
            IRVGQEP   ++ SVP GHLAVYVGE +  TCR+VVPV YFNHPLFA LLREAE VYG++
Sbjct  68   IRVGQEPIDLKQVSVPKGHLAVYVGEKDDDTCRIVVPVIYFNHPLFAELLREAEMVYGYN  127

Query  506  HPGGIQIPCRISEFENVKSRIAADG  580
            +PG IQIPCRISEFENVKSRIAA G
Sbjct  128  YPGRIQIPCRISEFENVKSRIAATG  152



>emb|CDP09911.1| unnamed protein product [Coffea canephora]
Length=183

 Score =   136 bits (343),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 81/114 (71%), Gaps = 5/114 (4%)
 Frame = +2

Query  281  VGRRVLAVVKRDVRLIRVGQEPPGPEKASV--PAGHLAVYVGEAEGATCRVVVPVFYFNH  454
            +G + L   KR    IRVGQEP    K SV  P GHLAVYVGE +  TCRV+VPV YFNH
Sbjct  56   LGAKGLCFAKRKPGYIRVGQEPVAESKNSVSTPKGHLAVYVGEDDDETCRVLVPVIYFNH  115

Query  455  PLFANLLREAETVYGFDHPGGIQIPCRISEFENVKSRIAADGDA---RRVRRSW  607
            PLFA+LLREAE V+GFDHPGGIQIPC+ SEFE+VK RIAA G      R  RSW
Sbjct  116  PLFADLLREAEKVHGFDHPGGIQIPCQKSEFESVKMRIAAAGSGGVNSRGGRSW  169



>ref|XP_010325681.1| PREDICTED: auxin-induced protein 10A5-like [Solanum lycopersicum]
Length=134

 Score =   135 bits (339),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 82/108 (76%), Gaps = 7/108 (6%)
 Frame = +2

Query  287  RRVLAVVKRDVRLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFA  466
            ++VL + K +    RVGQEP   +K SVP GHLA+YVGE +  TCRVVVPV YFNHPLFA
Sbjct  17   KQVLCLGKNNSGYFRVGQEPM--KKVSVPKGHLAMYVGEQDDDTCRVVVPVIYFNHPLFA  74

Query  467  NLLREAETVYGFDHPGGIQIPCRISEFENVKSRIAA-----DGDARRV  595
             LLREAE VYG+++PG IQIPCRIS+FENVKSRIAA     +GD  RV
Sbjct  75   ELLREAEMVYGYNYPGRIQIPCRISDFENVKSRIAATVGGGNGDEGRV  122



>ref|XP_004245734.1| PREDICTED: uncharacterized protein LOC101246270 [Solanum lycopersicum]
Length=162

 Score =   134 bits (336),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +2

Query  326  IRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFD  505
            +RVGQEP   ++ SVP GHLAVYVGE E  TCR+VVPV YFNHPLFA LLREAE VY ++
Sbjct  65   VRVGQEPIDLKQVSVPKGHLAVYVGEKEDDTCRIVVPVIYFNHPLFAELLREAEMVYEYN  124

Query  506  HPGGIQIPCRISEFENVKSRIAADG  580
            +PG IQIPCRISEFENVKSRIAA G
Sbjct  125  YPGRIQIPCRISEFENVKSRIAATG  149



>ref|XP_010324594.1| PREDICTED: uncharacterized protein LOC101258390 [Solanum lycopersicum]
Length=164

 Score =   127 bits (319),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 73/96 (76%), Gaps = 4/96 (4%)
 Frame = +2

Query  326  IRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFD  505
            IRVG E    ++  +P GHLAVYVGE +   CRV+VPV YFNHPLF +LLREAE VYGF+
Sbjct  68   IRVGSELM--DQNQIPKGHLAVYVGEKQDVACRVLVPVIYFNHPLFVDLLREAEMVYGFN  125

Query  506  HPGGIQIPCRISEFENVKSRIAAD--GDARRVRRSW  607
            H GGIQIPCRISEFENV+SRIAA   G + R  RSW
Sbjct  126  HSGGIQIPCRISEFENVQSRIAATSRGGSCRGGRSW  161



>ref|XP_011069607.1| PREDICTED: uncharacterized protein LOC105155428 [Sesamum indicum]
Length=166

 Score =   124 bits (312),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 77/110 (70%), Gaps = 3/110 (3%)
 Frame = +2

Query  284  GRRVLAVVKRDVRLIRVGQEPPGPE-KASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPL  460
            G R L   KRD   IR GQE   P+   +VP GHLAVYVG+ E    RV+VPV YFNHPL
Sbjct  57   GARSLCSGKRDTGYIRAGQEVEQPKLPPNVPKGHLAVYVGDKEDDASRVLVPVIYFNHPL  116

Query  461  FANLLREAETVYGFDHPGGIQIPCRISEFENVKSRIAA--DGDARRVRRS  604
            FA LLREAE VYGF+ PGGIQIPCRISE ENV+ +IAA   G + R +RS
Sbjct  117  FAELLREAEKVYGFNQPGGIQIPCRISELENVQMKIAAASGGGSWRRKRS  166



>ref|XP_009799980.1| PREDICTED: auxin-induced protein X10A-like [Nicotiana sylvestris]
Length=170

 Score =   124 bits (312),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = +2

Query  326  IRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFD  505
            IRVGQ+    ++  VP GHLAVYVGE E   CRV+VPV YFNHPLFA+LLREAE  YGF+
Sbjct  71   IRVGQDFMEQKEMIVPKGHLAVYVGEKEDNACRVLVPVIYFNHPLFADLLREAEMEYGFN  130

Query  506  HPGGIQIPCRISEFENVKSRIAA  574
            H GGIQIPCRISEFE V+SRIAA
Sbjct  131  HSGGIQIPCRISEFEYVQSRIAA  153



>ref|XP_009587310.1| PREDICTED: auxin-induced protein X10A-like [Nicotiana tomentosiformis]
Length=171

 Score =   123 bits (309),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 71/98 (72%), Gaps = 0/98 (0%)
 Frame = +2

Query  284  GRRVLAVVKRDVRLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLF  463
            G + L   + +   IRVGQ+    ++  VP GHLAVYVGE E   CRV+VPV YFNHPLF
Sbjct  57   GAKGLNFTRPNSGYIRVGQDFMEQKEMIVPKGHLAVYVGEKEDNACRVLVPVIYFNHPLF  116

Query  464  ANLLREAETVYGFDHPGGIQIPCRISEFENVKSRIAAD  577
            A LLREAE  YGF+H GGIQIPCRISEFE V+SRIAA 
Sbjct  117  AGLLREAEMEYGFNHSGGIQIPCRISEFEYVQSRIAAT  154



>ref|XP_002265485.1| PREDICTED: auxin-induced protein X10A [Vitis vinifera]
 emb|CBI31878.3| unnamed protein product [Vitis vinifera]
Length=163

 Score =   118 bits (296),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 72/112 (64%), Gaps = 4/112 (4%)
 Frame = +2

Query  275  CGVGRRVLAVVKR----DVRLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVF  442
            C  GRR+L   K         +RVG EP   +   VP GHLAVYVG++   T RV+VPV 
Sbjct  47   CNWGRRLLMKAKGLCFPKSGYVRVGHEPCETKPMEVPKGHLAVYVGDSGDHTHRVLVPVL  106

Query  443  YFNHPLFANLLREAETVYGFDHPGGIQIPCRISEFENVKSRIAADGDARRVR  598
            YFNHPLF  LLR AE VYGF+HPGGI IPC I+EFE VK+RI A    RR R
Sbjct  107  YFNHPLFGELLRNAEKVYGFNHPGGITIPCPITEFEKVKTRIDAGEHFRRYR  158



>ref|XP_002280387.1| PREDICTED: uncharacterized protein LOC100260776 [Vitis vinifera]
Length=172

 Score =   115 bits (289),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 80/124 (65%), Gaps = 15/124 (12%)
 Frame = +2

Query  275  CGVGRRVLAVVKRDVRL----------IRVGQEPPGPEKASVPAGHLAVYVGEAEGATCR  424
            C  G+R+    KR   L          + VG+E P    A+VP GHLAVYVG+ +G   R
Sbjct  47   CNWGQRLKTKAKRICSLNPGPACFSGYLPVGEEMPA---ATVPKGHLAVYVGQKDGDFQR  103

Query  425  VVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCRISEFENVKSRIAADGDARRV--R  598
            V+VPV YFNHPLF  LLRE+E  YGF HPGGI IPCRISEFE+V++RIAA    R++  R
Sbjct  104  VLVPVIYFNHPLFGELLRESEEEYGFQHPGGITIPCRISEFESVQTRIAACQGCRKMTWR  163

Query  599  RSWS  610
            R +S
Sbjct  164  RHYS  167



>ref|XP_010088880.1| hypothetical protein L484_020868 [Morus notabilis]
 gb|EXB37077.1| hypothetical protein L484_020868 [Morus notabilis]
Length=167

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 66/88 (75%), Gaps = 0/88 (0%)
 Frame = +2

Query  332  VGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHP  511
            +GQEP   ++ +VP GHLAVYVG+ +G   R +VPV YFNHPLF+ LLR+AE  YGF H 
Sbjct  74   LGQEPVESKQTTVPRGHLAVYVGQKDGDFHRFMVPVIYFNHPLFSELLRDAEEEYGFQHQ  133

Query  512  GGIQIPCRISEFENVKSRIAADGDARRV  595
            GGI IPCRISEFE V++RIAA    R++
Sbjct  134  GGITIPCRISEFERVQTRIAAGSGHRKL  161



>gb|AFK48613.1| unknown [Medicago truncatula]
 gb|KEH29128.1| SAUR-like auxin-responsive family protein [Medicago truncatula]
Length=162

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 66/94 (70%), Gaps = 0/94 (0%)
 Frame = +2

Query  332  VGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHP  511
            VG +P     + VP GHLAVYVG+ +G   RV+VPV YFNHPLF  LL+EAE  YGF H 
Sbjct  67   VGSDPVEQSGSPVPKGHLAVYVGQKDGEFRRVLVPVVYFNHPLFGELLKEAEKEYGFCHQ  126

Query  512  GGIQIPCRISEFENVKSRIAADGDARRVRRSWSF  613
            GGI IPCR++EFE VK+RIA+  D RR+ R   F
Sbjct  127  GGITIPCRVTEFERVKTRIASGSDTRRLTRRGHF  160



>ref|XP_006440378.1| hypothetical protein CICLE_v10022581mg [Citrus clementina]
 gb|ESR53618.1| hypothetical protein CICLE_v10022581mg [Citrus clementina]
 gb|KDO48389.1| hypothetical protein CISIN_1g036854mg [Citrus sinensis]
Length=167

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 65/89 (73%), Gaps = 4/89 (4%)
 Frame = +2

Query  323  LIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGF  502
             I++GQE P    A VP GHLAVYVGE++    RV VPV YFNHPLF  LL++AE VYGF
Sbjct  74   FIQLGQEKP----AEVPKGHLAVYVGESDDEARRVFVPVIYFNHPLFGELLKQAERVYGF  129

Query  503  DHPGGIQIPCRISEFENVKSRIAADGDAR  589
            +HPGGI IPCRISEFE VK+RI A    R
Sbjct  130  NHPGGITIPCRISEFEKVKTRIDAWDHCR  158



>gb|EYU24760.1| hypothetical protein MIMGU_mgv1a015151mg [Erythranthe guttata]
Length=166

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 67/92 (73%), Gaps = 2/92 (2%)
 Frame = +2

Query  326  IRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFD  505
            IR GQEP   ++  +P GHLAVYVG+ E  TCRVVVPV YFNHPLF+ LLREAE VYGF+
Sbjct  73   IRAGQEPV--QQPKLPKGHLAVYVGDKEDDTCRVVVPVIYFNHPLFSELLREAEKVYGFN  130

Query  506  HPGGIQIPCRISEFENVKSRIAADGDARRVRR  601
            H GGIQIPC  SE E+++ +IAA       RR
Sbjct  131  HDGGIQIPCPRSELEDIQMKIAAASGGGSWRR  162



>ref|XP_007039930.1| SAUR family protein, putative [Theobroma cacao]
 gb|EOY24431.1| SAUR family protein, putative [Theobroma cacao]
Length=163

 Score =   114 bits (285),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 72/103 (70%), Gaps = 2/103 (2%)
 Frame = +2

Query  284  GRRVLAVVKRDVRLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLF  463
            G + L     D   I++G+E  G ++  VP GHLAVYVG++EG T RVVVPV YFNHPLF
Sbjct  56   GTKGLCNSNADPGFIQLGEE--GVKRVGVPKGHLAVYVGDSEGDTTRVVVPVIYFNHPLF  113

Query  464  ANLLREAETVYGFDHPGGIQIPCRISEFENVKSRIAADGDARR  592
            A LL+EAE VYG++H GGI +PC ISEFE VK RIA     RR
Sbjct  114  AELLKEAERVYGYNHSGGITLPCGISEFEKVKMRIADWEHCRR  156



>ref|XP_009785335.1| PREDICTED: uncharacterized protein LOC104233609 [Nicotiana sylvestris]
Length=161

 Score =   114 bits (285),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = +2

Query  326  IRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFD  505
            +++GQ+P   E  +VP GHLAVYVG+ +G   RV+VPV Y NHPLF+ LLREAE  YGF+
Sbjct  75   MQIGQDPIEEEAVTVPKGHLAVYVGQKDGDYRRVLVPVIYINHPLFSELLREAEDEYGFN  134

Query  506  HPGGIQIPCRISEFENVKSRI  568
            HPGGI IPCRISEFE V++RI
Sbjct  135  HPGGITIPCRISEFERVQTRI  155



>ref|XP_009602309.1| PREDICTED: uncharacterized protein LOC104097455 [Nicotiana tomentosiformis]
Length=170

 Score =   114 bits (284),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = +2

Query  326  IRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFD  505
            I++GQEP   +  +VP GH+AVYVG+ +G   RV+VPV YFNHPLF+ LLRE E  YGF+
Sbjct  81   IQIGQEPVEEKSMAVPKGHMAVYVGQKDGDFKRVLVPVIYFNHPLFSGLLREVEDEYGFN  140

Query  506  HPGGIQIPCRISEFENVKSRI  568
            HPGGI IPCRISEFE V++RI
Sbjct  141  HPGGITIPCRISEFERVQTRI  161



>ref|XP_006573419.1| PREDICTED: uncharacterized protein LOC100808164 [Glycine max]
Length=168

 Score =   114 bits (284),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 68/91 (75%), Gaps = 1/91 (1%)
 Frame = +2

Query  332  VGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHP  511
            +G +P      +VP GHLAVYVGE +G   RV++PV YFNHPLF++LLREAE  +GF+HP
Sbjct  71   IGSDPACDRAPAVPKGHLAVYVGEEDGEFRRVLIPVIYFNHPLFSDLLREAEKKFGFEHP  130

Query  512  GGIQIPCRISEFENVKSRIAADGDAR-RVRR  601
            GGI IPCR++EFE VK+RIA+    R R RR
Sbjct  131  GGITIPCRLTEFERVKTRIASGSGQRGRTRR  161



>ref|XP_011081200.1| PREDICTED: uncharacterized protein LOC105164282 [Sesamum indicum]
Length=165

 Score =   113 bits (283),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 69/95 (73%), Gaps = 2/95 (2%)
 Frame = +2

Query  284  GRRVLAVVKRDVRLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLF  463
            G R L   K +   I+VG++P   E+  +P GHLAVYVG+ +  TCRV+VPV YFNHPLF
Sbjct  56   GARSLCSFKINSGYIQVGKDPV--EQPKLPKGHLAVYVGDKKDDTCRVLVPVIYFNHPLF  113

Query  464  ANLLREAETVYGFDHPGGIQIPCRISEFENVKSRI  568
              LLREAE VYGF+HPGGIQIPC  SE E+V+ +I
Sbjct  114  GELLREAEKVYGFNHPGGIQIPCPKSELESVQMKI  148



>ref|XP_011093368.1| PREDICTED: uncharacterized protein LOC105173359 [Sesamum indicum]
Length=169

 Score =   113 bits (282),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = +2

Query  326  IRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFD  505
            IRVGQEP   +    P G++ VYVG+ +G   RV+VPV YFNHPLF +LL+E+E  YGFD
Sbjct  73   IRVGQEPAIEKPVPAPKGYMGVYVGQKDGDHQRVLVPVVYFNHPLFGDLLKESENEYGFD  132

Query  506  HPGGIQIPCRISEFENVKSRIAA  574
            HPGGI IPCRISEFE V++RI A
Sbjct  133  HPGGITIPCRISEFERVQTRIKA  155



>ref|XP_006445300.1| hypothetical protein CICLE_v10022560mg [Citrus clementina]
 ref|XP_006490881.1| PREDICTED: uncharacterized protein LOC102615286 [Citrus sinensis]
 gb|ESR58540.1| hypothetical protein CICLE_v10022560mg [Citrus clementina]
 gb|KDO85748.1| hypothetical protein CISIN_1g030768mg [Citrus sinensis]
Length=171

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 71/109 (65%), Gaps = 0/109 (0%)
 Frame = +2

Query  284  GRRVLAVVKRDVRLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLF  463
            G + L + K     + + Q+P   +  SVP GHLAVYVG+ +G   RV+VPV YFNHPLF
Sbjct  60   GAKSLCLAKPASGYVPMDQDPIREKPVSVPKGHLAVYVGQKDGDFHRVLVPVIYFNHPLF  119

Query  464  ANLLREAETVYGFDHPGGIQIPCRISEFENVKSRIAADGDARRVRRSWS  610
              LLR+AE  YGF+  GGI IPCR SEFE V++RIAA   AR  + +W 
Sbjct  120  GKLLRDAEEEYGFNQQGGITIPCRFSEFEQVQTRIAAGNGARTRKLTWK  168



>ref|XP_009609783.1| PREDICTED: uncharacterized protein LOC104103572 [Nicotiana tomentosiformis]
Length=161

 Score =   112 bits (280),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 63/81 (78%), Gaps = 0/81 (0%)
 Frame = +2

Query  326  IRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFD  505
            +++GQ+P   E  +VP GHLAVYVG+ +G   RV+VPV Y NHPLF  LLR+AE  YGF+
Sbjct  75   MQIGQDPIEKEAVTVPKGHLAVYVGQKDGDYRRVLVPVIYINHPLFTELLRDAEEEYGFN  134

Query  506  HPGGIQIPCRISEFENVKSRI  568
            HPGGI IPCRISEFE V++RI
Sbjct  135  HPGGITIPCRISEFERVQTRI  155



>ref|XP_011090420.1| PREDICTED: uncharacterized protein LOC105171100 [Sesamum indicum]
Length=172

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 69/95 (73%), Gaps = 1/95 (1%)
 Frame = +2

Query  326  IRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFD  505
            IR GQEP   + A VP GH+AVYVG+ +G   R++VPV YFNHPLF +LL+E+E  YGF+
Sbjct  70   IRAGQEPVLEKPAPVPKGHMAVYVGQKDGDFQRILVPVVYFNHPLFGDLLKESEKEYGFN  129

Query  506  HPGGIQIPCRISEFENVKSRIAADGDARRVRRSWS  610
            H GGI IPCRISEFE V++RI A    R++  SW 
Sbjct  130  HSGGITIPCRISEFERVQTRIKAVQCNRKL-LSWK  163



>emb|CDY52310.1| BnaCnng22170D [Brassica napus]
Length=160

 Score =   111 bits (277),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 67/91 (74%), Gaps = 4/91 (4%)
 Frame = +2

Query  326  IRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFD  505
            IR+G++P    K +VP GHL V+VGE++G T RVVVPV YFNHPLF  LL +AE V+GFD
Sbjct  69   IRLGKDP----KTAVPKGHLVVHVGESDGDTRRVVVPVIYFNHPLFGELLEQAERVHGFD  124

Query  506  HPGGIQIPCRISEFENVKSRIAADGDARRVR  598
             PG I IPCR+S+FE V+ RIAA    RR R
Sbjct  125  QPGRITIPCRVSDFEKVQMRIAAWDHCRRKR  155



>gb|EYU31967.1| hypothetical protein MIMGU_mgv1a020147mg [Erythranthe guttata]
Length=167

 Score =   111 bits (278),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 69/93 (74%), Gaps = 1/93 (1%)
 Frame = +2

Query  323  LIRVGQEPPGPEKASVPAGHLAVYVGEAEGATC-RVVVPVFYFNHPLFANLLREAETVYG  499
             IRVGQEP   + A VP GH+AVYVG+ +G    R+ VPV +FNHPLF +LL+E+E  YG
Sbjct  75   FIRVGQEPFIEKPAPVPKGHMAVYVGQKDGGDFQRIFVPVAFFNHPLFGDLLKESEKEYG  134

Query  500  FDHPGGIQIPCRISEFENVKSRIAADGDARRVR  598
            F++PGGI IPCRISEFE +++RI +    R++R
Sbjct  135  FNYPGGITIPCRISEFERIQTRIKSGQSTRKLR  167



>ref|XP_007052109.1| SAUR family protein [Theobroma cacao]
 gb|EOX96266.1| SAUR family protein [Theobroma cacao]
Length=167

 Score =   111 bits (277),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 67/104 (64%), Gaps = 0/104 (0%)
 Frame = +2

Query  284  GRRVLAVVKRDVRLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLF  463
            G + +  VK     + +GQ+P   +   VP GHLAVYVG+ +G   RV VPV YFNHPLF
Sbjct  58   GAKSICSVKPGSGYLPIGQDPVDEKPKEVPKGHLAVYVGQKDGDLHRVFVPVIYFNHPLF  117

Query  464  ANLLREAETVYGFDHPGGIQIPCRISEFENVKSRIAADGDARRV  595
              LLREAE  YGF  PGGI IPCR SEFE V++RI A    R++
Sbjct  118  GELLREAEEEYGFTQPGGITIPCRFSEFERVQTRITAGTGGRKL  161



>emb|CDO97719.1| unnamed protein product [Coffea canephora]
Length=178

 Score =   111 bits (278),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 73/112 (65%), Gaps = 2/112 (2%)
 Frame = +2

Query  266  EVWCGVGRRVLAVVKRDVRLIRVGQEPPG--PEKASVPAGHLAVYVGEAEGATCRVVVPV  439
            ++ CG  + ++         ++ GQEP G  P+   VP GH+A+YVG+  G   RV+VPV
Sbjct  60   DICCGSSKNLVPGRAMSRGCMQTGQEPVGAKPQPVEVPKGHMAIYVGQKGGNFQRVLVPV  119

Query  440  FYFNHPLFANLLREAETVYGFDHPGGIQIPCRISEFENVKSRIAADGDARRV  595
             YFNHPLF  LLREAE  +G++HPG I IPCRISEFE+V++RI      R++
Sbjct  120  IYFNHPLFGQLLREAEEEFGYNHPGAITIPCRISEFEHVQTRIKQGRSTRKL  171



>ref|XP_008232597.1| PREDICTED: uncharacterized protein LOC103331728 [Prunus mume]
Length=172

 Score =   111 bits (277),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = +2

Query  329  RVGQEPPGPEK-ASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFD  505
            ++GQ P    K  +VP GHLAVYVG+ +G   RV+VPV YFNHPLF+ LLREAE  YGF 
Sbjct  75   QLGQNPVESSKPVTVPKGHLAVYVGQKDGDFHRVLVPVIYFNHPLFSRLLREAEKEYGFQ  134

Query  506  HPGGIQIPCRISEFENVKSRIAADGDARRV  595
            H GGI IPC IS+FE+VK+RIAA    RR+
Sbjct  135  HEGGITIPCPISDFESVKTRIAAGSTQRRL  164



>ref|XP_004306941.1| PREDICTED: uncharacterized protein LOC101300951 [Fragaria vesca 
subsp. vesca]
Length=167

 Score =   110 bits (276),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 70/106 (66%), Gaps = 1/106 (1%)
 Frame = +2

Query  281  VGRRVLAVVKRDVRLIRVGQEPPGPEK-ASVPAGHLAVYVGEAEGATCRVVVPVFYFNHP  457
             G + L   +     +++GQ P    K  +VP GHLAVYVG+ +G   RV+VPV YFNHP
Sbjct  60   TGAKSLCCSRPGSGYMQLGQNPVEETKPVTVPKGHLAVYVGQKDGDFHRVLVPVIYFNHP  119

Query  458  LFANLLREAETVYGFDHPGGIQIPCRISEFENVKSRIAADGDARRV  595
            LF  LL+EAE  YGF HPGGI IPC IS+FE VK+RIAA    RR+
Sbjct  120  LFGQLLKEAEQEYGFAHPGGITIPCPISDFEKVKTRIAAGSGHRRL  165



>ref|XP_010259029.1| PREDICTED: uncharacterized protein LOC104598585 [Nelumbo nucifera]
Length=166

 Score =   110 bits (276),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 65/88 (74%), Gaps = 0/88 (0%)
 Frame = +2

Query  329  RVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDH  508
            R  +E    +  +VP GHLAVYVG+ +G   R +VPV YFNHPLFA LLREAE  YGF H
Sbjct  72   RFDREALDEKPVTVPKGHLAVYVGQKDGDPHRFLVPVIYFNHPLFAQLLREAEDEYGFHH  131

Query  509  PGGIQIPCRISEFENVKSRIAADGDARR  592
            PGGI IPC+ISEFE+V++RIAA  + R+
Sbjct  132  PGGITIPCQISEFESVQTRIAAGVNCRK  159



>ref|XP_006477252.1| PREDICTED: uncharacterized protein LOC102623442 [Citrus sinensis]
Length=167

 Score =   110 bits (275),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 63/88 (72%), Gaps = 4/88 (5%)
 Frame = +2

Query  326  IRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFD  505
            I++GQ  P    A VP GHLAVYVGE++    RV VPV YFNHPLF  LL++AE  YGF+
Sbjct  75   IQLGQAKP----AEVPKGHLAVYVGESDDEARRVFVPVIYFNHPLFGELLKQAERAYGFN  130

Query  506  HPGGIQIPCRISEFENVKSRIAADGDAR  589
            HPGGI IPCRISEFE VK+RI A    R
Sbjct  131  HPGGITIPCRISEFEKVKTRIDAWDHCR  158



>ref|XP_002509576.1| Auxin-induced protein X10A, putative [Ricinus communis]
 gb|EEF50963.1| Auxin-induced protein X10A, putative [Ricinus communis]
Length=109

 Score =   108 bits (271),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 70/107 (65%), Gaps = 7/107 (7%)
 Frame = +2

Query  290  RVLAVVKRDVRLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFAN  469
            R L    RD   I +GQ  P  E   VP GHLAVYVGE+   T R VVPV YFNHPLF  
Sbjct  5    RKLQSPNRD--YILLGQAKPVSE---VPKGHLAVYVGESNDETRREVVPVIYFNHPLFGE  59

Query  470  LLREAETVYGFDHPGGIQIPCRISEFENVKSRIAADGDARRVRRSWS  610
            LL++AE VYG++HPGGI+IPC  SEFE +K RIAA  +    R SW+
Sbjct  60   LLKDAERVYGYNHPGGIKIPCGYSEFEKIKMRIAAWDNCN--RNSWT  104



>ref|XP_006347888.1| PREDICTED: auxin-induced protein 10A5-like [Solanum tuberosum]
Length=159

 Score =   110 bits (274),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 62/81 (77%), Gaps = 2/81 (2%)
 Frame = +2

Query  326  IRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFD  505
            I VGQ+P   E  SVP GHLAVYVG  +G   RV+VPV Y NHPLF+ LLREAE  YGF+
Sbjct  75   IHVGQDPIKEE--SVPKGHLAVYVGRKDGDYKRVLVPVIYINHPLFSELLREAEEEYGFN  132

Query  506  HPGGIQIPCRISEFENVKSRI  568
            HPGGI IPCRISEFE V++RI
Sbjct  133  HPGGITIPCRISEFERVQTRI  153



>ref|XP_009137271.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Brassica 
rapa]
Length=152

 Score =   109 bits (273),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 63/90 (70%), Gaps = 3/90 (3%)
 Frame = +2

Query  353  PEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPC  532
            PE   VP GHL V+VGE+   T RVVVPVFYFNHPLF  LL +AE VYGFD PG I IPC
Sbjct  66   PESLGVPKGHLVVHVGESGDDTRRVVVPVFYFNHPLFGELLEQAERVYGFDQPGRITIPC  125

Query  533  RISEFENVKSRIAADGDARRVRRSWSF*IV  622
            R+S+FE V+ +IAA       RR WSF I+
Sbjct  126  RVSDFEQVQMKIAAWDHC---RRKWSFKIL  152



>ref|XP_007218501.1| hypothetical protein PRUPE_ppa012367mg [Prunus persica]
 gb|EMJ19700.1| hypothetical protein PRUPE_ppa012367mg [Prunus persica]
Length=172

 Score =   110 bits (275),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 70/106 (66%), Gaps = 1/106 (1%)
 Frame = +2

Query  281  VGRRVLAVVKRDVRLIRVGQEPPGPEK-ASVPAGHLAVYVGEAEGATCRVVVPVFYFNHP  457
             G + L   K      ++GQ P    K  +VP GHLA+YVG+ +G   RV+VPV YFNHP
Sbjct  59   AGAKSLCCRKSGSGYKQLGQNPVETSKPVTVPKGHLALYVGQNDGDFHRVLVPVIYFNHP  118

Query  458  LFANLLREAETVYGFDHPGGIQIPCRISEFENVKSRIAADGDARRV  595
            LF+ LLREAE  YGF H GGI IPC IS+FE+VK+RIAA    RR+
Sbjct  119  LFSRLLREAEKEYGFQHEGGITIPCPISDFESVKTRIAAGSTQRRL  164



>emb|CDX98761.1| BnaA03g45460D [Brassica napus]
Length=152

 Score =   109 bits (273),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 63/90 (70%), Gaps = 3/90 (3%)
 Frame = +2

Query  353  PEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPC  532
            PE   VP GHL V+VGE+   T RVVVPVFYFNHPLF  LL +AE VYGFD PG I IPC
Sbjct  66   PESLGVPKGHLVVHVGESGDDTRRVVVPVFYFNHPLFGELLEQAERVYGFDQPGRITIPC  125

Query  533  RISEFENVKSRIAADGDARRVRRSWSF*IV  622
            R+S+FE V+ +IAA       RR WSF I+
Sbjct  126  RVSDFEQVQMKIAAWDHC---RRKWSFKIL  152



>ref|XP_010056342.1| PREDICTED: uncharacterized protein LOC104444383 [Eucalyptus grandis]
Length=185

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 62/80 (78%), Gaps = 1/80 (1%)
 Frame = +2

Query  332  VGQEP-PGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDH  508
            VG++P P    A+VP GHLAVYVG+ +   CRV+VPV YFNHPLF  LLREAE  +G+DH
Sbjct  87   VGKDPQPASAAAAVPKGHLAVYVGQKDADFCRVLVPVIYFNHPLFGELLREAEEEFGYDH  146

Query  509  PGGIQIPCRISEFENVKSRI  568
            PGGI IPC +SEFE VK++I
Sbjct  147  PGGITIPCGVSEFERVKTKI  166



>ref|XP_004229795.1| PREDICTED: auxin-induced protein 10A5 [Solanum lycopersicum]
Length=159

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 62/81 (77%), Gaps = 2/81 (2%)
 Frame = +2

Query  326  IRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFD  505
            I VGQ+P   E  SVP GHLAVYVG  +G   RV+VPV Y NHPLF+ LLREAE  YGF+
Sbjct  75   IHVGQDPIKEE--SVPKGHLAVYVGRKDGDYKRVLVPVIYINHPLFSELLREAEEEYGFN  132

Query  506  HPGGIQIPCRISEFENVKSRI  568
            HPGGI IPCRISEFE V++RI
Sbjct  133  HPGGITIPCRISEFERVQTRI  153



>ref|XP_002511675.1| Auxin-induced protein X10A, putative [Ricinus communis]
 gb|EEF50344.1| Auxin-induced protein X10A, putative [Ricinus communis]
Length=168

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 68/106 (64%), Gaps = 0/106 (0%)
 Frame = +2

Query  284  GRRVLAVVKRDVRLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLF  463
            G + L   K       +G+EP   +  +VP GHLAVYVG+ +G   RV+VPV YFNHPLF
Sbjct  58   GAKSLCSAKPGSGYTHIGEEPIHEKPVTVPKGHLAVYVGQKDGDFHRVLVPVIYFNHPLF  117

Query  464  ANLLREAETVYGFDHPGGIQIPCRISEFENVKSRIAADGDARRVRR  601
              LLREAE  YGF+  GGI IPCR SEFE V++RIAA    R + R
Sbjct  118  GELLREAEREYGFNQQGGITIPCRYSEFERVQTRIAAGSGVRALMR  163



>ref|XP_003521966.1| PREDICTED: uncharacterized protein LOC100796005 [Glycine max]
Length=170

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 67/91 (74%), Gaps = 1/91 (1%)
 Frame = +2

Query  332  VGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHP  511
            +G +P      +VP GHLAVYVGE +G   RV++PV Y NHPLF++LLREAE  +GF+HP
Sbjct  72   IGSDPLCDRAPAVPKGHLAVYVGEEDGGFRRVLIPVIYCNHPLFSDLLREAEKEFGFEHP  131

Query  512  GGIQIPCRISEFENVKSRIAADGDAR-RVRR  601
            GGI IPCR++EFE VK+RIA+    R R RR
Sbjct  132  GGITIPCRLTEFERVKTRIASGSGQRGRTRR  162



>ref|XP_004298667.1| PREDICTED: uncharacterized protein LOC101292210 [Fragaria vesca 
subsp. vesca]
Length=178

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 63/86 (73%), Gaps = 1/86 (1%)
 Frame = +2

Query  326  IRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFD  505
            +RVGQ P   +   VP GH+AVYVGE++  T R +VPV YFNHPLF  LL+EAE VYGF+
Sbjct  79   MRVGQSPDEAKPVVVPKGHMAVYVGESDDDTQRYLVPVIYFNHPLFGELLKEAEKVYGFN  138

Query  506  HPGGIQIPCRISEFENVKSRIAADGD  583
            HPG I IPC  SEFE V+ RIAA GD
Sbjct  139  HPGRIVIPCEASEFEKVQMRIAA-GD  163



>ref|XP_006282748.1| hypothetical protein CARUB_v10005919mg [Capsella rubella]
 gb|EOA15646.1| hypothetical protein CARUB_v10005919mg [Capsella rubella]
Length=160

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 65/90 (72%), Gaps = 3/90 (3%)
 Frame = +2

Query  329  RVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDH  508
            R+G+EP  P   +VP GHL V+VGE+   T RVVVPV YFNHPLF  LL +AE VYGFD 
Sbjct  69   RLGEEPKTP---AVPKGHLVVHVGESGDDTRRVVVPVIYFNHPLFGELLEQAERVYGFDQ  125

Query  509  PGGIQIPCRISEFENVKSRIAADGDARRVR  598
            PG I IPCR+S+FE V+ RIAA   +RR R
Sbjct  126  PGRIMIPCRVSDFEKVQMRIAAWDHSRRKR  155



>ref|XP_006289429.1| hypothetical protein CARUB_v10002934mg [Capsella rubella]
 gb|EOA22327.1| hypothetical protein CARUB_v10002934mg [Capsella rubella]
Length=163

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 66/91 (73%), Gaps = 1/91 (1%)
 Frame = +2

Query  326  IRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFD  505
            IR+G++P    +  VP GHL V+VGE++G T RVVVPV YFNHPLF  LL +AE V+GFD
Sbjct  72   IRLGKDPKSSNRV-VPRGHLVVHVGESDGDTRRVVVPVIYFNHPLFGELLEQAERVHGFD  130

Query  506  HPGGIQIPCRISEFENVKSRIAADGDARRVR  598
             PG I IPCR+S+FE V+ RIAA    RR R
Sbjct  131  QPGRITIPCRVSDFEKVQMRIAAWDHCRRKR  161



>emb|CDY21268.1| BnaC03g29520D [Brassica napus]
Length=165

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = +2

Query  326  IRVGQEP-PGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGF  502
            IR+G++P       +VP GHL V+VGE++G T RVVVPV YFNHPLF  LL +AE V+GF
Sbjct  69   IRLGKDPRTSASIKAVPKGHLVVHVGESDGDTRRVVVPVIYFNHPLFGELLEQAERVHGF  128

Query  503  DHPGGIQIPCRISEFENVKSRIAADGDARR  592
            D PG I IPCR+S+FE V+ RIAA    RR
Sbjct  129  DQPGRITIPCRVSDFEKVQMRIAAWDHCRR  158



>ref|XP_008372725.1| PREDICTED: uncharacterized protein LOC103436089 [Malus domestica]
Length=171

 Score =   108 bits (271),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 68/106 (64%), Gaps = 1/106 (1%)
 Frame = +2

Query  281  VGRRVLAVVKRDVRLIRVGQEPPGPEK-ASVPAGHLAVYVGEAEGATCRVVVPVFYFNHP  457
             G + L   K      ++GQ P    K   VP GHLAVYVG+ +G   RV+VPV YFNHP
Sbjct  58   AGAKSLCCXKSGSGYKQLGQSPVEKNKPVXVPKGHLAVYVGQKDGDFQRVLVPVIYFNHP  117

Query  458  LFANLLREAETVYGFDHPGGIQIPCRISEFENVKSRIAADGDARRV  595
            LF  LLREAE  YG+ H GGI IPC +S+FE+VK+RIAA    RR+
Sbjct  118  LFGQLLREAEEEYGYQHDGGITIPCPMSDFESVKTRIAAGSGQRRL  163



>ref|XP_009114622.1| PREDICTED: uncharacterized protein LOC103839891 [Brassica rapa]
Length=160

 Score =   108 bits (270),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 66/91 (73%), Gaps = 4/91 (4%)
 Frame = +2

Query  326  IRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFD  505
            IR+G++P    K +VP GHL V+VGE++G T RVVVPV YFNHPLF  LL +AE V+GF 
Sbjct  69   IRLGKDP----KTAVPKGHLVVHVGESDGDTRRVVVPVIYFNHPLFGELLEQAERVHGFH  124

Query  506  HPGGIQIPCRISEFENVKSRIAADGDARRVR  598
             PG I IPCR+S+FE V+ RIAA    RR R
Sbjct  125  QPGRITIPCRVSDFEKVQMRIAAWDHCRRKR  155



>emb|CDX86707.1| BnaA09g20970D [Brassica napus]
Length=160

 Score =   108 bits (270),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 66/91 (73%), Gaps = 4/91 (4%)
 Frame = +2

Query  326  IRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFD  505
            IR+G++P    K +VP GHL V+VGE++G T RVVVPV YFNHPLF  LL +AE V+GF 
Sbjct  69   IRLGKDP----KTAVPKGHLVVHVGESDGDTRRVVVPVIYFNHPLFGELLEQAERVHGFH  124

Query  506  HPGGIQIPCRISEFENVKSRIAADGDARRVR  598
             PG I IPCR+S+FE V+ RIAA    RR R
Sbjct  125  QPGRITIPCRVSDFEKVQMRIAAWDHCRRKR  155



>emb|CDX94106.1| BnaC07g37400D [Brassica napus]
Length=152

 Score =   108 bits (269),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 63/90 (70%), Gaps = 3/90 (3%)
 Frame = +2

Query  353  PEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPC  532
            P+   +P GHL V+VGE+   T RVVVPVFYFNHPLF  LL +AE VYGFD PG I IPC
Sbjct  66   PKSLGIPKGHLVVHVGESGDDTRRVVVPVFYFNHPLFGELLEQAERVYGFDQPGRITIPC  125

Query  533  RISEFENVKSRIAADGDARRVRRSWSF*IV  622
            R+S+FE V+ +IAA       RR WSF I+
Sbjct  126  RVSDFEQVQMKIAAWDHC---RRKWSFKIL  152



>ref|XP_010439309.1| PREDICTED: uncharacterized protein LOC104722783 [Camelina sativa]
Length=161

 Score =   108 bits (269),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 65/92 (71%), Gaps = 3/92 (3%)
 Frame = +2

Query  323  LIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGF  502
            L R+G EP  P   +VP GHL V+VGE+   T RVVVPV YFNHPLF  LL +AE VYGF
Sbjct  68   LTRLGDEPKTP---AVPKGHLVVHVGESGDDTRRVVVPVIYFNHPLFGELLEQAERVYGF  124

Query  503  DHPGGIQIPCRISEFENVKSRIAADGDARRVR  598
            + PG I IPCR+S+FE V+ RIAA   +RR R
Sbjct  125  EQPGRIMIPCRVSDFEKVQMRIAAWDHSRRKR  156



>ref|XP_008354757.1| PREDICTED: uncharacterized protein LOC103418405 [Malus domestica]
Length=172

 Score =   108 bits (269),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 75/132 (57%), Gaps = 4/132 (3%)
 Frame = +2

Query  212  RMNPvsvfrrfvgrrgssEVW---CGVGRRVLAVVKRDVRLIRVGQEPPGPEK-ASVPAG  379
            R+NP S              W      G + L   K      R+GQ P    K   VP G
Sbjct  33   RLNPGSPSACSYKPMSRLLTWGRKLSAGAKSLCCSKPGSGYKRLGQNPVEKNKPVPVPKG  92

Query  380  HLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCRISEFENVK  559
            HLAVYVG+ +G   RV+VPV YFNHPLF  LLREAE  YG++H GGI IPC +S+FE+VK
Sbjct  93   HLAVYVGQKDGDFHRVLVPVIYFNHPLFGQLLREAEEEYGYEHDGGITIPCPMSDFESVK  152

Query  560  SRIAADGDARRV  595
            +RIAA    RR+
Sbjct  153  TRIAAGSGHRRL  164



>gb|KDP25623.1| hypothetical protein JCGZ_20779 [Jatropha curcas]
Length=164

 Score =   107 bits (268),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 66/103 (64%), Gaps = 4/103 (4%)
 Frame = +2

Query  284  GRRVLAVVKRDVRLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLF  463
            G +    +  +   +R+G   P    A VP GHLAVYVGE+ G   R VVPV YFNHPLF
Sbjct  57   GTKTAGFLNSNRGYVRLGHAKP----AEVPRGHLAVYVGESNGDARREVVPVIYFNHPLF  112

Query  464  ANLLREAETVYGFDHPGGIQIPCRISEFENVKSRIAADGDARR  592
              LL+ AE VYG++H GGI+IPCR SEFE VK RIAA  +  R
Sbjct  113  GELLKSAERVYGYNHSGGIKIPCRYSEFEKVKMRIAAWDNCHR  155



>ref|XP_009134268.1| PREDICTED: uncharacterized protein LOC103858630 [Brassica rapa]
 emb|CDX90829.1| BnaA03g25090D [Brassica napus]
Length=165

 Score =   107 bits (268),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 64/90 (71%), Gaps = 1/90 (1%)
 Frame = +2

Query  326  IRVGQEPPGPEKASV-PAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGF  502
            IR+G++P       V P GHL V+VGE++G T RVVVPV YFNHPLF  LL +AE V+GF
Sbjct  69   IRLGKDPRTSASIKVVPKGHLVVHVGESDGDTRRVVVPVIYFNHPLFGELLEQAERVHGF  128

Query  503  DHPGGIQIPCRISEFENVKSRIAADGDARR  592
            D PG I IPCR+S+FE V+ RIAA    RR
Sbjct  129  DQPGQITIPCRVSDFEKVQMRIAAWDHCRR  158



>ref|XP_009375775.1| PREDICTED: uncharacterized protein LOC103964554 [Pyrus x bretschneideri]
Length=171

 Score =   107 bits (268),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 67/103 (65%), Gaps = 1/103 (1%)
 Frame = +2

Query  290  RVLAVVKRDVRLIRVGQEPPGPEK-ASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFA  466
            + L   K      ++GQ P    K  +VP GHLAVYVG+ +G   RV+VPV YFNHPLF 
Sbjct  61   KSLCCSKSGSGYKQLGQSPVEKNKPVTVPKGHLAVYVGQKDGDFQRVLVPVIYFNHPLFG  120

Query  467  NLLREAETVYGFDHPGGIQIPCRISEFENVKSRIAADGDARRV  595
             LLREAE  YG+ H GGI IPC +S+FE VK+RIAA    RR+
Sbjct  121  QLLREAEEEYGYQHDGGITIPCPMSDFERVKTRIAAGSGQRRL  163



>ref|XP_004147644.1| PREDICTED: uncharacterized protein LOC101208334 [Cucumis sativus]
 gb|KGN57225.1| hypothetical protein Csa_3G171820 [Cucumis sativus]
Length=169

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 69/104 (66%), Gaps = 0/104 (0%)
 Frame = +2

Query  284  GRRVLAVVKRDVRLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLF  463
            G + +   +R +  + + ++    + A+VP GHLAVYVG+ +G   RV+VPV YFNHPLF
Sbjct  56   GAKSICSSRRRLSYVPLDRDLKEKKSAAVPKGHLAVYVGQNDGEFHRVLVPVIYFNHPLF  115

Query  464  ANLLREAETVYGFDHPGGIQIPCRISEFENVKSRIAADGDARRV  595
              LLREAE  YGF+H GGI IPC  +EFENV+SRI +    R+ 
Sbjct  116  GELLREAEEEYGFEHEGGITIPCPYAEFENVQSRIKSGSSGRKA  159



>ref|XP_004160639.1| PREDICTED: uncharacterized LOC101208334 [Cucumis sativus]
Length=169

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 69/104 (66%), Gaps = 0/104 (0%)
 Frame = +2

Query  284  GRRVLAVVKRDVRLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLF  463
            G + +   +R +  + + ++    + A+VP GHLAVYVG+ +G   RV+VPV YFNHPLF
Sbjct  56   GAKSICSSRRRLSYVPLDRDLKEKKSAAVPKGHLAVYVGQNDGEFHRVLVPVIYFNHPLF  115

Query  464  ANLLREAETVYGFDHPGGIQIPCRISEFENVKSRIAADGDARRV  595
              LLREAE  YGF+H GGI IPC  +EFENV+SRI +    R+ 
Sbjct  116  GELLREAEEEYGFEHEGGITIPCPYAEFENVQSRIKSGSSGRKA  159



>ref|XP_010422206.1| PREDICTED: uncharacterized protein LOC104707531 [Camelina sativa]
Length=161

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 65/91 (71%), Gaps = 1/91 (1%)
 Frame = +2

Query  326  IRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFD  505
            IR+G++P    +  VP GHL V+VGE++  T RVVVPV YFNHPLF  LL +AE V+GFD
Sbjct  70   IRLGKDPKTSNRV-VPRGHLVVHVGESDDDTRRVVVPVIYFNHPLFGELLEQAERVHGFD  128

Query  506  HPGGIQIPCRISEFENVKSRIAADGDARRVR  598
             PG I IPCR+S+FE V+ RIAA    RR R
Sbjct  129  QPGRITIPCRVSDFEKVQMRIAAWDHCRRKR  159



>ref|XP_010538764.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Tarenaya 
hassleriana]
Length=165

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 65/91 (71%), Gaps = 2/91 (2%)
 Frame = +2

Query  326  IRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFD  505
            I +G++P     A VP GHLAVY+GE+ G T RV+VPV +FNHPLF  LL +AE VYGFD
Sbjct  72   ILLGKDPN--SAAVVPKGHLAVYIGESGGDTRRVLVPVIHFNHPLFGELLEQAEQVYGFD  129

Query  506  HPGGIQIPCRISEFENVKSRIAADGDARRVR  598
             PG I IPCR+S+FE V+ RIAA    RR R
Sbjct  130  QPGRITIPCRVSDFEKVQMRIAAWDHCRRKR  160



>ref|XP_002869817.1| auxin-responsive family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46076.1| auxin-responsive family protein [Arabidopsis lyrata subsp. lyrata]
Length=148

 Score =   105 bits (263),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 62/85 (73%), Gaps = 3/85 (4%)
 Frame = +2

Query  320  RLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYG  499
            + +++G EP  P   SVP GHL V+VGE+   T RVVVPV YFNHPLF  LL +AE VYG
Sbjct  64   KQVQLGNEPKTP---SVPKGHLVVHVGESGDDTRRVVVPVIYFNHPLFGELLEQAERVYG  120

Query  500  FDHPGGIQIPCRISEFENVKSRIAA  574
            FD PG I IPCR+S+FE V+ RIAA
Sbjct  121  FDQPGRITIPCRVSDFEKVQMRIAA  145



>ref|XP_010434013.1| PREDICTED: uncharacterized protein LOC104718053 [Camelina sativa]
Length=161

 Score =   106 bits (264),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 63/90 (70%), Gaps = 3/90 (3%)
 Frame = +2

Query  329  RVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDH  508
            R+G E   P   +VP GHL V+VGE+   T RVVVPV YFNHPLF  LL +AE VYGFD 
Sbjct  70   RLGDEQKTP---AVPKGHLVVHVGESGDDTRRVVVPVIYFNHPLFGELLEQAELVYGFDQ  126

Query  509  PGGIQIPCRISEFENVKSRIAADGDARRVR  598
            PG I IPCR+S+FE V+ RIAA   +RR R
Sbjct  127  PGRIMIPCRVSDFEKVQMRIAAWDHSRRKR  156



>ref|XP_010455681.1| PREDICTED: uncharacterized protein LOC104737249 [Camelina sativa]
Length=164

 Score =   105 bits (263),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 65/91 (71%), Gaps = 1/91 (1%)
 Frame = +2

Query  326  IRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFD  505
            IR+G++P    +  VP GHL V+VGE++G T RVVVPV YFNHPLF  LL +AE V+GFD
Sbjct  73   IRLGKDPKTSNRV-VPRGHLVVHVGESDGDTRRVVVPVIYFNHPLFGELLEQAERVHGFD  131

Query  506  HPGGIQIPCRISEFENVKSRIAADGDARRVR  598
              G I IPCR+S+FE V+ RIAA    RR R
Sbjct  132  QQGRITIPCRVSDFEKVQMRIAAWDHCRRKR  162



>ref|XP_010539798.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Tarenaya 
hassleriana]
Length=166

 Score =   105 bits (263),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 59/79 (75%), Gaps = 0/79 (0%)
 Frame = +2

Query  362  ASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCRIS  541
            A VP GHLAVYVGE+ G T RVVVPV YFNHPLF  LL +AE VYGF+ PG I IPCR+S
Sbjct  80   AVVPKGHLAVYVGESGGDTRRVVVPVIYFNHPLFGELLDQAERVYGFEQPGRITIPCRVS  139

Query  542  EFENVKSRIAADGDARRVR  598
            +FE V+ RIAA    RR R
Sbjct  140  DFEKVQMRIAAWDHCRRKR  158



>ref|XP_006413639.1| hypothetical protein EUTSA_v10026450mg [Eutrema salsugineum]
 gb|ESQ55092.1| hypothetical protein EUTSA_v10026450mg [Eutrema salsugineum]
Length=159

 Score =   105 bits (262),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 63/90 (70%), Gaps = 3/90 (3%)
 Frame = +2

Query  329  RVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDH  508
            R+G +P  P   +VP GHL V+VGE+   T RVVVPV YFNHPLF  LL +AE VYGFD 
Sbjct  68   RLGNDPKPP---AVPKGHLVVHVGESGDDTRRVVVPVIYFNHPLFGELLEQAERVYGFDQ  124

Query  509  PGGIQIPCRISEFENVKSRIAADGDARRVR  598
            PG I IPCR+S+FE V+ RIAA    RR R
Sbjct  125  PGRITIPCRVSDFEKVQMRIAAWDHCRRKR  154



>gb|KDP28782.1| hypothetical protein JCGZ_14553 [Jatropha curcas]
Length=168

 Score =   105 bits (263),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 68/105 (65%), Gaps = 0/105 (0%)
 Frame = +2

Query  281  VGRRVLAVVKRDVRLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPL  460
             G ++L   K     + VG+E    +  +VP GHLAVYVG+ +G   RV++PV Y NHPL
Sbjct  57   TGAKLLCSAKPGSGYVPVGEEAIIDKPVTVPKGHLAVYVGQKDGDFHRVLIPVIYINHPL  116

Query  461  FANLLREAETVYGFDHPGGIQIPCRISEFENVKSRIAADGDARRV  595
            F  LLREAE  YGF+  GGI IPCR SEFE V++RIAA    R++
Sbjct  117  FGKLLREAEQEYGFNQQGGITIPCRYSEFERVQTRIAAGSGGRKL  161



>ref|XP_010264205.1| PREDICTED: uncharacterized protein LOC104602283 [Nelumbo nucifera]
Length=166

 Score =   105 bits (263),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 64/91 (70%), Gaps = 0/91 (0%)
 Frame = +2

Query  329  RVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDH  508
            R  +E    +   VP GH+AVYVG+ +    R +VPV YFNHPLFA+LLREAE  YGF H
Sbjct  75   RCDREALEDKPVQVPKGHMAVYVGQKDDGLHRFLVPVIYFNHPLFADLLREAEEEYGFHH  134

Query  509  PGGIQIPCRISEFENVKSRIAADGDARRVRR  601
            PGGI IPCRI+EFE+V+++IAA   +   RR
Sbjct  135  PGGITIPCRITEFESVQTKIAAGVKSTWKRR  165



>gb|KFK26933.1| hypothetical protein AALP_AA8G312000 [Arabis alpina]
Length=164

 Score =   105 bits (262),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 64/91 (70%), Gaps = 3/91 (3%)
 Frame = +2

Query  326  IRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFD  505
            IR+G +P   +   VP GHL V+VGE++G T RVVVPV YFNHPLF  LL + E V+GFD
Sbjct  72   IRLGTDP---KNRVVPRGHLVVHVGESDGDTRRVVVPVIYFNHPLFGELLEQMERVHGFD  128

Query  506  HPGGIQIPCRISEFENVKSRIAADGDARRVR  598
             PG I IPCR+S+FE V+ RIAA    RR R
Sbjct  129  QPGRITIPCRVSDFEKVQMRIAAWDHCRRKR  159



>ref|XP_011017472.1| PREDICTED: uncharacterized protein LOC105120790 [Populus euphratica]
Length=172

 Score =   105 bits (263),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 68/109 (62%), Gaps = 2/109 (2%)
 Frame = +2

Query  284  GRRVLAVVKRDVRLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLF  463
            G + +   K     I VG EP   +   VP GHLAVYVG+ +G   RV+VP+ YFNHPLF
Sbjct  62   GAKSICSAKPRSGYIPVGHEPACDKPVPVPKGHLAVYVGQKDGEFHRVLVPLIYFNHPLF  121

Query  464  ANLLREAETVYGFDHPGGIQIPCRISEFENVKSRIAADGDARRVRRSWS  610
              LLREAE  YGFD  GGI IPCR +EFE V++RI +    R++  +W 
Sbjct  122  GELLREAEEEYGFDQQGGITIPCRFAEFERVQTRIKSGSCGRKL--TWK  168



>ref|XP_010433480.1| PREDICTED: uncharacterized protein LOC104717582 [Camelina sativa]
Length=164

 Score =   105 bits (262),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 65/91 (71%), Gaps = 1/91 (1%)
 Frame = +2

Query  326  IRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFD  505
            IR+G++P    +  VP GHL V+VGE++  T RVVVPV YFNHPLF  LL +AE V+GFD
Sbjct  73   IRLGKDPKTSNRV-VPRGHLVVHVGESDCDTRRVVVPVIYFNHPLFGELLEQAERVHGFD  131

Query  506  HPGGIQIPCRISEFENVKSRIAADGDARRVR  598
             PG I IPCR+S+FE V+ RIAA    RR R
Sbjct  132  QPGRITIPCRVSDFEKVQMRIAAWDHCRRKR  162



>ref|XP_010544631.1| PREDICTED: uncharacterized protein LOC104817230 [Tarenaya hassleriana]
Length=171

 Score =   105 bits (262),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 65/95 (68%), Gaps = 2/95 (2%)
 Frame = +2

Query  326  IRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFD  505
            I +GQ+P       VP GH+AVYVG+ +G   RV+VPV YFNHPLF  LLREAE  YGF 
Sbjct  73   IPMGQDPIRTNPDPVPKGHMAVYVGQKDGDFHRVLVPVVYFNHPLFGELLREAEAEYGFC  132

Query  506  HPGGIQIPCRISEFENVKSRIAADGDARRVRRSWS  610
            H GGI IPC  S+FE VK+RIA+   +R +  SWS
Sbjct  133  HQGGITIPCPYSDFERVKTRIASGSGSRML--SWS  165



>ref|XP_010053431.1| PREDICTED: uncharacterized protein LOC104441880 [Eucalyptus grandis]
Length=180

 Score =   105 bits (262),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 64/86 (74%), Gaps = 3/86 (3%)
 Frame = +2

Query  326  IRVGQEPPGPEKAS--VPAGHLAVYV-GEAEGATCRVVVPVFYFNHPLFANLLREAETVY  496
            +RVG + PG +  S  VP GHLAVYV G++   T RV VPV YFNHPLF  LLREAE VY
Sbjct  76   VRVGHDGPGEKAPSPDVPKGHLAVYVVGQSVDDTRRVTVPVIYFNHPLFGELLREAERVY  135

Query  497  GFDHPGGIQIPCRISEFENVKSRIAA  574
            G+DHPGGI +PC ISE E V++RIAA
Sbjct  136  GYDHPGGITLPCGISELEMVQTRIAA  161



>ref|NP_192978.1| SAUR-like auxin-responsive protein [Arabidopsis thaliana]
 emb|CAB45988.1| putative protein [Arabidopsis thaliana]
 emb|CAB78284.1| putative protein [Arabidopsis thaliana]
 gb|AEE83127.1| SAUR-like auxin-responsive protein [Arabidopsis thaliana]
Length=157

 Score =   104 bits (260),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 64/89 (72%), Gaps = 1/89 (1%)
 Frame = +2

Query  326  IRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFD  505
            IR+G++P    +  VP GHL V+VGE++  T RVVVPV YFNHPLF  LL +AE V+GFD
Sbjct  63   IRLGKDPKKSNRV-VPRGHLVVHVGESDDDTRRVVVPVIYFNHPLFGELLEQAERVHGFD  121

Query  506  HPGGIQIPCRISEFENVKSRIAADGDARR  592
             PG I IPCR+S+FE V+ RIAA    RR
Sbjct  122  QPGRITIPCRVSDFEKVQLRIAAWDHCRR  150



>ref|XP_010524373.1| PREDICTED: auxin-induced protein X10A-like [Tarenaya hassleriana]
Length=168

 Score =   105 bits (261),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 64/90 (71%), Gaps = 0/90 (0%)
 Frame = +2

Query  326  IRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFD  505
            I VGQ+P G +   VP GHLAVYVG+ +G   RV+VPV YFNHPLF  LLREAE  +GF 
Sbjct  72   IPVGQDPIGTKPDPVPKGHLAVYVGKKDGDFHRVLVPVVYFNHPLFGELLREAEEEFGFS  131

Query  506  HPGGIQIPCRISEFENVKSRIAADGDARRV  595
            H GGI IPC  S+FE V++RI +   +R++
Sbjct  132  HQGGITIPCPYSDFERVQTRIESWSGSRKL  161



>ref|XP_006367568.1| PREDICTED: auxin-induced protein X15-like [Solanum tuberosum]
Length=138

 Score =   104 bits (259),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 63/81 (78%), Gaps = 1/81 (1%)
 Frame = +2

Query  356  EKASV-PAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPC  532
            EKA+V P GH+A+YVG+ +G   RV+VPV YFNHPLF+ LLRE E  YGF++PGGI IPC
Sbjct  55   EKANVVPKGHMAIYVGQKDGDFKRVLVPVIYFNHPLFSELLREVEDEYGFNYPGGITIPC  114

Query  533  RISEFENVKSRIAADGDARRV  595
            RISEFE V+++I     AR++
Sbjct  115  RISEFERVQTQIKQGRVARKM  135



>ref|NP_193993.1| SAUR-like auxin-responsive protein [Arabidopsis thaliana]
 emb|CAA16547.1| predicted protein [Arabidopsis thaliana]
 emb|CAA22167.1| putative protein [Arabidopsis thaliana]
 emb|CAB79217.1| putative protein [Arabidopsis thaliana]
 gb|ABE66085.1| auxin-responsive family protein [Arabidopsis thaliana]
 gb|AEE84631.1| SAUR-like auxin-responsive protein [Arabidopsis thaliana]
Length=160

 Score =   104 bits (260),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 62/88 (70%), Gaps = 3/88 (3%)
 Frame = +2

Query  329  RVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDH  508
            R+G EP  P   +VP GHL V+VGE+   T RVVVPV YFNHPLF  LL +AE VYGF+ 
Sbjct  69   RLGNEPKTP---TVPRGHLVVHVGESGEDTRRVVVPVIYFNHPLFGELLEQAERVYGFEQ  125

Query  509  PGGIQIPCRISEFENVKSRIAADGDARR  592
            PG I IPCR+S+FE V+ RIAA    RR
Sbjct  126  PGRIMIPCRVSDFEKVQMRIAAWDHCRR  153



>ref|XP_008439035.1| PREDICTED: uncharacterized protein LOC103483942 [Cucumis melo]
Length=169

 Score =   104 bits (260),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 68/104 (65%), Gaps = 0/104 (0%)
 Frame = +2

Query  284  GRRVLAVVKRDVRLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLF  463
            G + +   +R +  + + ++    + A+VP GHLAVYVG+ +G   RV+VPV YFNHPLF
Sbjct  56   GAKSICSSRRRLSYVPLDRDSEEKKSAAVPKGHLAVYVGQNDGEFHRVLVPVIYFNHPLF  115

Query  464  ANLLREAETVYGFDHPGGIQIPCRISEFENVKSRIAADGDARRV  595
              LLREAE  YGF H GGI IPC  +EFENV+SRI +    R+ 
Sbjct  116  GELLREAEEEYGFQHQGGITIPCPYAEFENVQSRIKSGCTRRKA  159



>ref|XP_002874769.1| auxin-responsive family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51028.1| auxin-responsive family protein [Arabidopsis lyrata subsp. lyrata]
Length=160

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 65/89 (73%), Gaps = 1/89 (1%)
 Frame = +2

Query  326  IRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFD  505
            IR+G++P    + + P GHL V+VGE++G T RVVVPV YFNHPLF  LL +AE V+GF+
Sbjct  66   IRLGKDPKTSNRVA-PRGHLVVHVGESDGDTRRVVVPVIYFNHPLFEELLEQAERVHGFN  124

Query  506  HPGGIQIPCRISEFENVKSRIAADGDARR  592
             PG I IPCR+S+FE V+ RIAA    RR
Sbjct  125  QPGRITIPCRVSDFEKVQMRIAAWDHCRR  153



>gb|ABK28644.1| unknown [Arabidopsis thaliana]
Length=161

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 62/88 (70%), Gaps = 3/88 (3%)
 Frame = +2

Query  329  RVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDH  508
            R+G EP  P   +VP GHL V+VGE+   T RVVVPV YFNHPLF  LL +AE VYGF+ 
Sbjct  69   RLGNEPKTP---TVPRGHLVVHVGESGEDTRRVVVPVIYFNHPLFGELLEQAERVYGFEQ  125

Query  509  PGGIQIPCRISEFENVKSRIAADGDARR  592
            PG I IPCR+S+FE V+ RIAA    RR
Sbjct  126  PGRIMIPCRVSDFEKVQMRIAAWDHCRR  153



>ref|XP_002301272.2| auxin-responsive family protein [Populus trichocarpa]
 gb|EEE80545.2| auxin-responsive family protein [Populus trichocarpa]
Length=172

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 66/104 (63%), Gaps = 0/104 (0%)
 Frame = +2

Query  284  GRRVLAVVKRDVRLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLF  463
            G + +   K     I VG EP   +   VP GHLAVYVG+ +G   RV+VP+ YFNHPLF
Sbjct  62   GAKSICSAKPRSGYIPVGHEPVCDKPVPVPKGHLAVYVGQKDGEFHRVLVPLIYFNHPLF  121

Query  464  ANLLREAETVYGFDHPGGIQIPCRISEFENVKSRIAADGDARRV  595
              LLREAE  YGF+  GGI IPCR SEFE V++RI +    R++
Sbjct  122  GELLREAEEEYGFNQQGGITIPCRFSEFERVQTRIKSGSCGRKL  165



>gb|KCW77727.1| hypothetical protein EUGRSUZ_D02026, partial [Eucalyptus grandis]
Length=200

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 64/86 (74%), Gaps = 3/86 (3%)
 Frame = +2

Query  326  IRVGQEPPGPEKAS--VPAGHLAVYV-GEAEGATCRVVVPVFYFNHPLFANLLREAETVY  496
            +RVG + PG +  S  VP GHLAVYV G++   T RV VPV YFNHPLF  LLREAE VY
Sbjct  96   VRVGHDGPGEKAPSPDVPKGHLAVYVVGQSVDDTRRVTVPVIYFNHPLFGELLREAERVY  155

Query  497  GFDHPGGIQIPCRISEFENVKSRIAA  574
            G+DHPGGI +PC ISE E V++RIAA
Sbjct  156  GYDHPGGITLPCGISELEMVQTRIAA  181



>ref|XP_006396766.1| hypothetical protein EUTSA_v10029032mg [Eutrema salsugineum]
 gb|ESQ38219.1| hypothetical protein EUTSA_v10029032mg [Eutrema salsugineum]
Length=161

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 65/90 (72%), Gaps = 3/90 (3%)
 Frame = +2

Query  329  RVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDH  508
            R+G++P   +   VP GHL V+VGE++G T RVVVPV YFNHPLF  LL +AE V+GFD 
Sbjct  70   RLGKDP---KMRVVPRGHLVVHVGESDGDTRRVVVPVIYFNHPLFGELLEQAERVHGFDQ  126

Query  509  PGGIQIPCRISEFENVKSRIAADGDARRVR  598
            PG I IPCR+S+FE V+ RIAA    R+ R
Sbjct  127  PGRITIPCRVSDFEKVQMRIAAWDHCRKKR  156



>ref|XP_010676252.1| PREDICTED: uncharacterized protein LOC104892118 [Beta vulgaris 
subsp. vulgaris]
Length=145

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 67/105 (64%), Gaps = 6/105 (6%)
 Frame = +2

Query  275  CGVGRRVL-----AVVKRDVRLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPV  439
            C  GR++      +V  RD   + V       +   +P GHLAV+V E EG T RV+VPV
Sbjct  21   CSWGRKIQRGLFNSVTTRDYSRV-VHDSLIDSKPTHIPKGHLAVHVEEPEGDTRRVLVPV  79

Query  440  FYFNHPLFANLLREAETVYGFDHPGGIQIPCRISEFENVKSRIAA  574
             + NHPLF  LL EAE VYG+DHPG I IPC ISEFENV++RIAA
Sbjct  80   IFLNHPLFGKLLEEAENVYGYDHPGQITIPCPISEFENVQTRIAA  124



>ref|XP_007134829.1| hypothetical protein PHAVU_010G079700g [Phaseolus vulgaris]
 gb|ESW06823.1| hypothetical protein PHAVU_010G079700g [Phaseolus vulgaris]
Length=162

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +2

Query  329  RVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDH  508
            + G  P      +VP GHLAVYV E +G   RV+VPV YFNHPLF+ LL EAE  +GF H
Sbjct  64   KSGSGPVCESAPAVPKGHLAVYVAEDDGECRRVLVPVIYFNHPLFSGLLMEAEKEFGFQH  123

Query  509  PGGIQIPCRISEFENVKSRIAA  574
            PGGI IPCR++EFE VK+RIA+
Sbjct  124  PGGITIPCRLTEFERVKTRIAS  145



>ref|XP_009108573.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Brassica 
rapa]
 emb|CDX76364.1| BnaA08g10360D [Brassica napus]
Length=159

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 61/90 (68%), Gaps = 3/90 (3%)
 Frame = +2

Query  329  RVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDH  508
            R+G EP   +  +VP GHL V+VGE    T RVVVPV YFNHPLF  LL E E VYGFD 
Sbjct  68   RLGNEP---KPQAVPKGHLVVHVGECGDDTRRVVVPVVYFNHPLFGELLEEKERVYGFDQ  124

Query  509  PGGIQIPCRISEFENVKSRIAADGDARRVR  598
            PG I IPCR+S+FE V+ RIAA    RR R
Sbjct  125  PGRITIPCRVSDFEKVQMRIAAWDHCRRKR  154



>ref|XP_010448866.1| PREDICTED: uncharacterized protein LOC104731245 [Camelina sativa]
Length=161

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 63/90 (70%), Gaps = 3/90 (3%)
 Frame = +2

Query  329  RVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDH  508
            R+G E   P   +VP GHL V+VGE+   T RVVVPV YFNHPLF  LL +AE VYGF+ 
Sbjct  70   RLGDEQKTP---AVPKGHLVVHVGESGDDTRRVVVPVIYFNHPLFGELLEQAERVYGFEQ  126

Query  509  PGGIQIPCRISEFENVKSRIAADGDARRVR  598
            PG I IPCR+S+FE V+ RIAA   +RR R
Sbjct  127  PGRIMIPCRVSDFEKVQMRIAAWDHSRRKR  156



>ref|XP_011033963.1| PREDICTED: uncharacterized protein LOC105132279 [Populus euphratica]
Length=170

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 67/103 (65%), Gaps = 1/103 (1%)
 Frame = +2

Query  284  GRRVLAVVKRDVRLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLF  463
            G + L   K     I +G E    +  +VP GHLAVYVG+ +G   RV+VPV YFNHPLF
Sbjct  61   GAKSLCAAKPGSGYIPMGHELVCDKPVTVPKGHLAVYVGQKDGDFHRVLVPVIYFNHPLF  120

Query  464  ANLLREAETVYGFDHPGGIQIPCRISEFENVKSRIAADGDARR  592
              LLREAE  YGF+  GGI IPCR SEFE+V++RI A G  R+
Sbjct  121  GELLREAEEEYGFNQQGGITIPCRFSEFESVQTRIKA-GSGRK  162



>ref|XP_008238623.1| PREDICTED: uncharacterized protein LOC103337238 [Prunus mume]
Length=166

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = +2

Query  365  SVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCRISE  544
            SVP GHLAVYVGE+   T R +VPV YFNHPLF +LL+EAE VYGF+HPG I IPC +SE
Sbjct  84   SVPKGHLAVYVGESGDDTQRYLVPVMYFNHPLFGDLLKEAEKVYGFNHPGRIVIPCEVSE  143

Query  545  FENVKSRIAADGD  583
            FE V+ +IAA GD
Sbjct  144  FEKVQMKIAA-GD  155



>ref|XP_004248559.1| PREDICTED: auxin-induced protein 15A-like [Solanum lycopersicum]
Length=138

 Score =   102 bits (255),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +2

Query  356  EKASV-PAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPC  532
            EKASV P GH+A+YVG+ +G   RV+VPV YFNHPLF+ LLRE E  YGF++ GGI IPC
Sbjct  55   EKASVVPKGHMAIYVGQRDGDCKRVLVPVIYFNHPLFSELLREVEDEYGFNYSGGITIPC  114

Query  533  RISEFENVKSRIAADGDARRV  595
            RISEFE +++RI      R+V
Sbjct  115  RISEFERIQTRIKQGRVVRKV  135



>ref|XP_007208830.1| hypothetical protein PRUPE_ppa025324mg [Prunus persica]
 gb|EMJ10029.1| hypothetical protein PRUPE_ppa025324mg [Prunus persica]
Length=166

 Score =   103 bits (256),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = +2

Query  365  SVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCRISE  544
            SVP GHLAVYVGE+   T R +VPV YFNHPLF +LL+EAE VYGF+HPG I IPC +SE
Sbjct  84   SVPKGHLAVYVGESGDDTQRYLVPVMYFNHPLFGDLLKEAEKVYGFNHPGRIVIPCEVSE  143

Query  545  FENVKSRIAADGD  583
            FE V+ +IAA GD
Sbjct  144  FEKVQMKIAA-GD  155



>emb|CDY71452.1| BnaCnng72960D [Brassica napus]
Length=159

 Score =   103 bits (256),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 64/90 (71%), Gaps = 3/90 (3%)
 Frame = +2

Query  329  RVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDH  508
            R+G EP   + A+VP GHL V+VGEA   T RVVVPV YFNHPLF  LL++AE VYGF+ 
Sbjct  68   RLGNEP---KPAAVPKGHLVVHVGEAGDDTRRVVVPVIYFNHPLFGELLKQAERVYGFEQ  124

Query  509  PGGIQIPCRISEFENVKSRIAADGDARRVR  598
             G I IPCR+S+FE V+ RIAA    R+ R
Sbjct  125  SGRITIPCRVSDFEKVQMRIAAWDRCRQKR  154



>ref|XP_007161917.1| hypothetical protein PHAVU_001G108500g [Phaseolus vulgaris]
 gb|ESW33911.1| hypothetical protein PHAVU_001G108500g [Phaseolus vulgaris]
Length=166

 Score =   102 bits (255),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = +2

Query  365  SVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCRISE  544
            SVP GHLAVYVG+ +G   RV++PV YFNHPLF  LL+EAE  +GF H GGI IPCR +E
Sbjct  85   SVPKGHLAVYVGQKDGELHRVLLPVIYFNHPLFGELLKEAEEEFGFHHDGGITIPCRFTE  144

Query  545  FENVKSRIAA  574
            FE VK+RIA+
Sbjct  145  FERVKTRIAS  154



>ref|XP_002320048.1| hypothetical protein POPTR_0014s06240g [Populus trichocarpa]
 gb|EEE98363.1| hypothetical protein POPTR_0014s06240g [Populus trichocarpa]
Length=170

 Score =   102 bits (255),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 65/102 (64%), Gaps = 0/102 (0%)
 Frame = +2

Query  284  GRRVLAVVKRDVRLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLF  463
            G + L   K     I +G E    +  +VP GHLAVYVG+ +G   RV+VPV YFNHPLF
Sbjct  61   GAKSLCGAKPGSGYIPMGHELVCDKPVTVPKGHLAVYVGQKDGDFHRVLVPVIYFNHPLF  120

Query  464  ANLLREAETVYGFDHPGGIQIPCRISEFENVKSRIAADGDAR  589
              LLREAE  YGF+  GGI IPCR SEFE+V++RI A    +
Sbjct  121  GELLREAEEEYGFNQQGGITIPCRFSEFESVQTRIKAGSGGK  162



>ref|XP_010093668.1| hypothetical protein L484_019007 [Morus notabilis]
 gb|EXB54448.1| hypothetical protein L484_019007 [Morus notabilis]
Length=178

 Score =   103 bits (256),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +2

Query  353  PEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPC  532
            P +  +P GHLAVYVGE++  T R +VPV YFNHPLF  LL+EAE VYGF+HPG I IPC
Sbjct  85   PGRDGIPKGHLAVYVGESQDETQRYLVPVIYFNHPLFGELLKEAEKVYGFNHPGRITIPC  144

Query  533  RISEFENVKSRIAADGDARRVRR  601
              SEFE V+ RIA+  +  + RR
Sbjct  145  GASEFEKVQMRIASGEEYCQRRR  167



>ref|XP_003517959.1| PREDICTED: uncharacterized protein LOC100783436 [Glycine max]
Length=162

 Score =   102 bits (254),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = +2

Query  365  SVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCRISE  544
            SVP GHLAVYVG+ +G   RV+VPV YFNHPLF  LL++AE  +GF H GGI IPCR +E
Sbjct  79   SVPKGHLAVYVGQKDGELHRVLVPVIYFNHPLFGELLKQAEEEFGFHHEGGITIPCRFTE  138

Query  545  FENVKSRIAA  574
            FE VK+RIA+
Sbjct  139  FERVKTRIAS  148



>ref|XP_009136028.1| PREDICTED: indole-3-acetic acid-induced protein ARG7 [Brassica 
rapa]
 emb|CDX79167.1| BnaA01g12340D [Brassica napus]
Length=160

 Score =   102 bits (253),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 63/90 (70%), Gaps = 3/90 (3%)
 Frame = +2

Query  329  RVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDH  508
            R+G EP   + A+VP GHL V+VGEA   T RVVVPV YFNHPLF  LL +AE VYGF+ 
Sbjct  68   RLGNEP---KPAAVPKGHLVVHVGEAGDDTRRVVVPVIYFNHPLFGELLEQAERVYGFEQ  124

Query  509  PGGIQIPCRISEFENVKSRIAADGDARRVR  598
             G I IPCR+S+FE V+ RIAA    R+ R
Sbjct  125  SGRITIPCRVSDFEKVQMRIAAWDRCRQKR  154



>emb|CDX95639.1| BnaC03g25200D [Brassica napus]
Length=161

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = +2

Query  368  VPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCRISEF  547
            VP GHLAVYVG+ EG   RV+VP+ YFNHPLF  LLRE+E  YGF H GGI IPC  S+F
Sbjct  77   VPRGHLAVYVGQKEGDFRRVLVPIVYFNHPLFGELLRESEKEYGFRHEGGITIPCLYSDF  136

Query  548  ENVKSRIAADGDARRV  595
            + VK+RIA+  D+ R+
Sbjct  137  QRVKTRIASGLDSDRI  152



>emb|CDX95640.1| BnaC03g25210D [Brassica napus]
 emb|CDX83393.1| BnaA03g21130D [Brassica napus]
Length=161

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = +2

Query  368  VPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCRISEF  547
            VP GHLAVYVG+ EG   RV+VP+ YFNHPLF  LLRE+E  YGF H GGI IPC  S+F
Sbjct  77   VPRGHLAVYVGQKEGDFRRVLVPIVYFNHPLFGELLRESEKEYGFRHEGGITIPCLYSDF  136

Query  548  ENVKSRIAADGDARRV  595
            + VK+RIA+  D+ R+
Sbjct  137  QRVKTRIASGLDSDRI  152



>gb|KHN09786.1| Auxin-induced protein X10A [Glycine soja]
Length=112

 Score =   100 bits (248),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 60/92 (65%), Gaps = 4/92 (4%)
 Frame = +2

Query  326  IRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFD  505
            +++G  P G     +P GHLAVYVGE+E    RV+VPV YFNHPL   LL +AE VYGFD
Sbjct  19   VQLGHSPIG----LLPKGHLAVYVGESEDEKQRVLVPVTYFNHPLLGKLLEDAEKVYGFD  74

Query  506  HPGGIQIPCRISEFENVKSRIAADGDARRVRR  601
            HPG I IPCR+SEFE V+  IA      R  R
Sbjct  75   HPGVITIPCRVSEFERVQKIIATTRGYHRCLR  106



>ref|XP_006397701.1| hypothetical protein EUTSA_v10001787mg [Eutrema salsugineum]
 gb|ESQ39154.1| hypothetical protein EUTSA_v10001787mg [Eutrema salsugineum]
Length=168

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 63/93 (68%), Gaps = 6/93 (6%)
 Frame = +2

Query  332  VGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHP  511
            VG + P P    VP GHLAVYVG+ +G   RV+VP+ YFNHPLF  LLRE+E  YGF H 
Sbjct  77   VGHKQPDP----VPKGHLAVYVGQKDGDFHRVLVPIVYFNHPLFGELLRESEEEYGFCHE  132

Query  512  GGIQIPCRISEFENVKSRIAADGDARRVRRSWS  610
            GGI IPC  S+FE VK+RIA+   +R  R  WS
Sbjct  133  GGITIPCPYSDFERVKTRIASGSGSRIFR--WS  163



>ref|XP_009133717.1| PREDICTED: uncharacterized protein LOC103858166 [Brassica rapa]
Length=161

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = +2

Query  368  VPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCRISEF  547
            VP GHLAVYVG+ EG   RV+VP+ YFNHPLF  LLRE+E  YGF H GGI IPC  S+F
Sbjct  77   VPRGHLAVYVGQEEGDFRRVLVPIVYFNHPLFGELLRESEKEYGFRHEGGITIPCLYSDF  136

Query  548  ENVKSRIAADGDARRV  595
            + VK+RIA+  D+ R+
Sbjct  137  QRVKTRIASGLDSDRI  152



>ref|XP_009347833.1| PREDICTED: uncharacterized protein LOC103939462 [Pyrus x bretschneideri]
 ref|XP_009347834.1| PREDICTED: uncharacterized protein LOC103939463 [Pyrus x bretschneideri]
Length=168

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 63/89 (71%), Gaps = 1/89 (1%)
 Frame = +2

Query  317  VRLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVY  496
            +R+    +E    +   VP GH+AVYVGE++  T R +VPV YFNHPLF  LL+EAE VY
Sbjct  68   IRIRGAPEETKATKPVGVPKGHMAVYVGESDADTHRYLVPVLYFNHPLFGELLKEAEKVY  127

Query  497  GFDHPGGIQIPCRISEFENVKSRIAADGD  583
            G++HPG I IPC +SEFE V+ +IAA GD
Sbjct  128  GYNHPGRIVIPCGVSEFEKVQMKIAA-GD  155



>gb|KFK37314.1| hypothetical protein AALP_AA4G241000 [Arabis alpina]
Length=158

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = +2

Query  368  VPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCRISEF  547
            VP GHLAVYVG+ +G   RV+VP+ YFNHPLF  LLRE+E  YGF H GGI IPC  S+F
Sbjct  74   VPKGHLAVYVGQQDGDFHRVLVPIVYFNHPLFGELLRESEKEYGFSHEGGITIPCLYSDF  133

Query  548  ENVKSRIAADGDAR  589
            E VK+RIA+   +R
Sbjct  134  EQVKTRIASGSGSR  147



>ref|XP_008369535.1| PREDICTED: uncharacterized protein LOC103433088 [Malus domestica]
Length=168

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 67/102 (66%), Gaps = 6/102 (6%)
 Frame = +2

Query  317  VRLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVY  496
            +R+    +E    +   VP GH+A+YV E++  T R +VPV YFNHPLF  LL+EAE VY
Sbjct  68   IRIRGAPEETKATKPVGVPKGHMALYVDESDADTHRYLVPVLYFNHPLFGELLKEAEKVY  127

Query  497  GFDHPGGIQIPCRISEFENVKSRIAADGDA-----RRVRRSW  607
            G++HPG I IPC +SEFE V+ +IAA GD      R+ RR W
Sbjct  128  GYNHPGRIVIPCGVSEFEKVQMKIAA-GDQCPRQRRKNRRYW  168



>ref|XP_002880165.1| hypothetical protein ARALYDRAFT_903961 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56424.1| hypothetical protein ARALYDRAFT_903961 [Arabidopsis lyrata subsp. 
lyrata]
Length=162

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 60/88 (68%), Gaps = 4/88 (5%)
 Frame = +2

Query  326  IRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFD  505
            I V  + P P    VP GHLA+YVG+ +G   RV+VP+ YFNHPLF  LLREAE  YGF 
Sbjct  69   IPVDHKKPDP----VPRGHLAIYVGQKDGDCHRVLVPIVYFNHPLFGELLREAEKEYGFC  124

Query  506  HPGGIQIPCRISEFENVKSRIAADGDAR  589
            H GGI IPC  S+FE VK+RIA+   +R
Sbjct  125  HEGGITIPCLYSDFERVKTRIASGSSSR  152



>ref|XP_002303522.2| auxin-responsive family protein [Populus trichocarpa]
 gb|EEE78501.2| auxin-responsive family protein [Populus trichocarpa]
Length=176

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 63/105 (60%), Gaps = 4/105 (4%)
 Frame = +2

Query  284  GRRVLAVVKRDVRLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLF  463
            G + L     D   IR+G   P      VP GH+AVYVG+ +G T R +VPV YFNHPLF
Sbjct  64   GAKTLCFPHSDPGYIRLGHAKP----MEVPKGHMAVYVGQPDGDTKRELVPVIYFNHPLF  119

Query  464  ANLLREAETVYGFDHPGGIQIPCRISEFENVKSRIAADGDARRVR  598
              LL+  E VYG++H GGI IPC  SEFE VK RIAA     + R
Sbjct  120  GELLKGTERVYGYNHSGGITIPCGYSEFEKVKVRIAAWNHCHKSR  164



>ref|XP_006368680.1| hypothetical protein POPTR_0001s07700g [Populus trichocarpa]
 gb|ERP65249.1| hypothetical protein POPTR_0001s07700g [Populus trichocarpa]
Length=167

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 63/97 (65%), Gaps = 4/97 (4%)
 Frame = +2

Query  284  GRRVLAVVKRDVRLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLF  463
            G + L     D   I++G   P      VP GHLAVYVGE++G T R +VPV +FNHPLF
Sbjct  59   GAKTLCFPNSDPGYIKLGHAKP----MEVPKGHLAVYVGESDGDTRRELVPVIFFNHPLF  114

Query  464  ANLLREAETVYGFDHPGGIQIPCRISEFENVKSRIAA  574
            A LL+  E V G++H GGI IPC  SEFE VK+RIAA
Sbjct  115  AELLQRTERVNGYNHSGGITIPCGYSEFEKVKTRIAA  151



>ref|XP_004514848.1| PREDICTED: uncharacterized protein LOC101506835 [Cicer arietinum]
Length=163

 Score =   100 bits (248),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = +2

Query  368  VPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCRISEF  547
            VP GHLAVYVG+ +    RV+VPV YFNHPLF  LL+EAE  YGF H GGI IPCR+++F
Sbjct  80   VPKGHLAVYVGQKDCEFHRVLVPVVYFNHPLFNELLKEAEKEYGFCHQGGITIPCRVTDF  139

Query  548  ENVKSRIAADGDARRVR  598
            E V++RIA+    RR++
Sbjct  140  ERVRTRIASGSGLRRLK  156



>ref|XP_006601450.1| PREDICTED: auxin-induced protein 10A5-like [Glycine max]
Length=120

 Score = 99.0 bits (245),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = +2

Query  368  VPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCRISEF  547
            +P GHLAVYVGE+E    RV+VPV YFNHPL   LL +AE VYGFDHPG I IPCR+SEF
Sbjct  37   LPKGHLAVYVGESEDEKQRVLVPVTYFNHPLLGKLLEDAEKVYGFDHPGVITIPCRVSEF  96

Query  548  ENVKSRIAADGDARRVRR  601
            E V+  IA      R  R
Sbjct  97   ERVQKIIATTRGYHRCLR  114



>ref|XP_010506459.1| PREDICTED: uncharacterized protein LOC104783073 [Camelina sativa]
Length=157

 Score = 99.8 bits (247),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 61/93 (66%), Gaps = 4/93 (4%)
 Frame = +2

Query  311  RDVRLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAET  490
            R  R  R  +  P P    VP GHLA+YVG+ +G   RV+VP+ YFNHPLF  LL+E+E 
Sbjct  59   RHFRSTRRSEYIPDP----VPKGHLAIYVGQKDGDCHRVLVPIVYFNHPLFGELLKESEK  114

Query  491  VYGFDHPGGIQIPCRISEFENVKSRIAADGDAR  589
             YGF H GGI IPC  S+FE VK+RIA+   +R
Sbjct  115  EYGFCHEGGITIPCLYSDFERVKTRIASGSSSR  147



>ref|NP_182046.1| SAUR-like auxin-responsive protein [Arabidopsis thaliana]
 gb|AAB82641.1| putative auxin-regulated protein [Arabidopsis thaliana]
 gb|AAO22615.1| putative auxin-regulated protein [Arabidopsis thaliana]
 gb|AAO42351.1| putative auxin-regulated protein [Arabidopsis thaliana]
 gb|AEC10526.1| SAUR-like auxin-responsive protein [Arabidopsis thaliana]
Length=162

 Score = 99.8 bits (247),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = +2

Query  368  VPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCRISEF  547
            VP GHLA+YVG+ +G   RV+VP+ YFNHPLF  LLREAE  YGF H GGI IPC  S+F
Sbjct  79   VPRGHLAIYVGQKDGDCHRVLVPIVYFNHPLFGELLREAEKEYGFCHEGGITIPCLYSDF  138

Query  548  ENVKSRIAADGDAR  589
            E VK+RIA+   +R
Sbjct  139  ERVKTRIASGSSSR  152



>emb|CDY65616.1| BnaC02g46720D [Brassica napus]
Length=86

 Score = 97.4 bits (241),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 59/79 (75%), Gaps = 0/79 (0%)
 Frame = +2

Query  368  VPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCRISEF  547
            VP GHL V+VGE++  T RVVVP+ YFN+PLF  LL +AE V+GFD+PG I IPCR+ +F
Sbjct  4    VPKGHLVVHVGESDADTRRVVVPLIYFNYPLFGELLEQAELVHGFDYPGRITIPCRVYDF  63

Query  548  ENVKSRIAADGDARRVRRS  604
            E V+ RIAA  D  R +R+
Sbjct  64   EKVQMRIAAAWDHCRRKRT  82



>ref|XP_010508200.1| PREDICTED: uncharacterized protein LOC104784811 [Camelina sativa]
Length=157

 Score = 99.4 bits (246),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 61/93 (66%), Gaps = 4/93 (4%)
 Frame = +2

Query  311  RDVRLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAET  490
            R  R  R  +  P P    VP GHLA+YVG+ +G   RV+VP+ YFNHPLF  LL+E+E 
Sbjct  59   RHFRSTRRSECIPDP----VPKGHLAIYVGQKDGDCHRVLVPIVYFNHPLFGELLKESEK  114

Query  491  VYGFDHPGGIQIPCRISEFENVKSRIAADGDAR  589
             YGF H GGI IPC  S+FE VK+RIA+   +R
Sbjct  115  EYGFCHEGGITIPCLYSDFERVKTRIASGSSSR  147



>ref|XP_011033922.1| PREDICTED: uncharacterized protein LOC105132253 [Populus euphratica]
Length=176

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 64/105 (61%), Gaps = 4/105 (4%)
 Frame = +2

Query  284  GRRVLAVVKRDVRLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLF  463
            G + L     D   IR+G   P      VP GH+AVYVG+ +G T R +VPV Y NHPLF
Sbjct  64   GAQTLCFPHSDPGYIRLGHAKP----MEVPKGHMAVYVGQPDGDTKRELVPVIYVNHPLF  119

Query  464  ANLLREAETVYGFDHPGGIQIPCRISEFENVKSRIAADGDARRVR  598
              LL+  E VYG++H GGI +PC  SEFE VK RIAA  + ++ R
Sbjct  120  GELLKGTERVYGYNHSGGITLPCGYSEFEKVKGRIAAWNNCQKSR  164



>ref|XP_010518134.1| PREDICTED: uncharacterized protein LOC104793478 [Camelina sativa]
Length=156

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = +2

Query  368  VPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCRISEF  547
            VP GHLA+YVG+ +G   RV+VP+ YFNHPLF  LL+E+E  YGF H GGI IPC  S+F
Sbjct  73   VPKGHLAIYVGQTDGDCHRVLVPIVYFNHPLFGELLKESEKEYGFCHEGGITIPCLYSDF  132

Query  548  ENVKSRIAADGDAR  589
            E VK+RIA+   +R
Sbjct  133  ERVKTRIASGSSSR  146



>gb|KHN04333.1| Indole-3-acetic acid-induced protein ARG7 [Glycine soja]
Length=112

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 54/75 (72%), Gaps = 0/75 (0%)
 Frame = +2

Query  368  VPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCRISEF  547
            +P GHLAV+VGE+E    RV+VPV +FNHPL   LL +AE VYGFDHPG I IPCR+SEF
Sbjct  29   LPKGHLAVHVGESEDEKQRVLVPVTHFNHPLLGKLLEDAEKVYGFDHPGVITIPCRVSEF  88

Query  548  ENVKSRIAADGDARR  592
            E V+  IA  G   R
Sbjct  89   ERVQKIIATTGGYHR  103



>ref|XP_010241750.1| PREDICTED: uncharacterized protein LOC104586277 [Nelumbo nucifera]
Length=156

 Score = 97.1 bits (240),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +2

Query  329  RVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDH  508
            R  +E    +   VP GH+ VYVG+ +    R +VPV YFNHPLFA+LLREAE  YGF  
Sbjct  75   RYDREALEDKPVQVPKGHMVVYVGQKDDGLHRFLVPVIYFNHPLFADLLREAEEEYGFHC  134

Query  509  PGGIQIPCRISEFENVKSRIAA  574
            PGGI IPCRI+EFE+V+ +IA 
Sbjct  135  PGGITIPCRIAEFESVQKKIAG  156



>ref|XP_006295154.1| hypothetical protein CARUB_v10024230mg [Capsella rubella]
 gb|EOA28052.1| hypothetical protein CARUB_v10024230mg [Capsella rubella]
Length=157

 Score = 96.7 bits (239),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 54/74 (73%), Gaps = 0/74 (0%)
 Frame = +2

Query  368  VPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCRISEF  547
            VP GHL +YVG+ +G   RV+VP+ YFNHPLF  LL+++E  YGF H GGI IPC  S+F
Sbjct  74   VPKGHLVIYVGQKDGDCHRVLVPIVYFNHPLFGELLKQSEKEYGFRHEGGITIPCLYSDF  133

Query  548  ENVKSRIAADGDAR  589
            E VK+RIA+   +R
Sbjct  134  ERVKTRIASGSSSR  147



>ref|XP_010053911.1| PREDICTED: uncharacterized protein LOC104442256 [Eucalyptus grandis]
 gb|KCW78292.1| hypothetical protein EUGRSUZ_D02471 [Eucalyptus grandis]
Length=180

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 59/91 (65%), Gaps = 2/91 (2%)
 Frame = +2

Query  338  QEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDH-PG  514
            + P      +VP GHLAVYVG   G   RV+VPV YFNHPLF +LLREAE  +G  H  G
Sbjct  87   ERPTRMTTMTVPKGHLAVYVGRRSGEFRRVLVPVVYFNHPLFGDLLREAEEEFGISHRGG  146

Query  515  GIQIPCRISEFENVKSRIAADGDARRVRRSW  607
            GI IPC +SEFE VKSR+A  G   R R +W
Sbjct  147  GITIPCEVSEFERVKSRVATAGYGGR-RSTW  176



>ref|XP_003599697.1| Auxin-induced SAUR-like protein [Medicago truncatula]
 ref|XP_003599737.1| Auxin-induced SAUR-like protein [Medicago truncatula]
 gb|KEH16004.1| SAUR-like auxin-responsive family protein [Medicago truncatula]
Length=150

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 56/82 (68%), Gaps = 4/82 (5%)
 Frame = +2

Query  329  RVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDH  508
            R+G  P    K SVP G + VYVG  E    RV+VPV YFNHPLF+ LL++ E  YGF+H
Sbjct  66   RLGSSP----KFSVPKGQMVVYVGHKEEEINRVMVPVIYFNHPLFSELLKDVEEEYGFNH  121

Query  509  PGGIQIPCRISEFENVKSRIAA  574
             GGI IPCR +EFE +K+ IA+
Sbjct  122  QGGITIPCRFTEFERIKTWIAS  143



>ref|XP_011018252.1| PREDICTED: uncharacterized protein LOC105121359 [Populus euphratica]
Length=166

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 61/97 (63%), Gaps = 4/97 (4%)
 Frame = +2

Query  284  GRRVLAVVKRDVRLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLF  463
            G + L     D   I++G   P      VP G LAVYVGE++G T R +VPV +FNHPLF
Sbjct  58   GAKTLCFPNSDPGYIKLGHAKP----MEVPKGRLAVYVGESDGDTRRELVPVIFFNHPLF  113

Query  464  ANLLREAETVYGFDHPGGIQIPCRISEFENVKSRIAA  574
            A LL+  E V G++H GGI IPC  SEF+ VK RIAA
Sbjct  114  AELLQRTERVNGYNHSGGITIPCGYSEFQKVKMRIAA  150



>ref|XP_009397869.1| PREDICTED: uncharacterized protein LOC103982612 [Musa acuminata 
subsp. malaccensis]
Length=186

 Score = 94.7 bits (234),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 62/97 (64%), Gaps = 9/97 (9%)
 Frame = +2

Query  329  RVGQEPPGPEKASVPAGHLAVYVG-EAEGATCR-VVVPVFYFNHPLFANLLREAETVYGF  502
            R G  PP       P GHLAVYVG E EG   R  +VPV YFNHPLF  LLREAE  +GF
Sbjct  94   RRGWTPP-------PKGHLAVYVGGEKEGGPPRRYMVPVIYFNHPLFGELLREAEEEFGF  146

Query  503  DHPGGIQIPCRISEFENVKSRIAADGDARRVRRSWSF  613
             HPGGI IPC  ++FE V+SRIAA  +  R +R+ S 
Sbjct  147  HHPGGITIPCPAAKFERVRSRIAAGSERLRCKRASSL  183



>ref|XP_006402554.1| hypothetical protein EUTSA_v10006509mg [Eutrema salsugineum]
 dbj|BAJ34476.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ44007.1| hypothetical protein EUTSA_v10006509mg [Eutrema salsugineum]
Length=172

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 61/95 (64%), Gaps = 0/95 (0%)
 Frame = +2

Query  290  RVLAVVKRDVRLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFAN  469
            R L   + +   I +GQEP   +   VP GH AVYVG+ +G   RV+VP+ YFNHPLF  
Sbjct  64   RFLGSKRSNSGYIPIGQEPIRDKPDPVPKGHSAVYVGKQDGDFHRVLVPIVYFNHPLFGE  123

Query  470  LLREAETVYGFDHPGGIQIPCRISEFENVKSRIAA  574
            LLREAE  +GF   GGI IPC  S+F+ V++RI +
Sbjct  124  LLREAEEEFGFCQEGGITIPCPYSDFKRVQTRIES  158



>ref|NP_191628.1| SAUR-like auxin-responsive protein [Arabidopsis thaliana]
 gb|AAK55720.1|AF380639_1 AT3g60690/T4C21_100 [Arabidopsis thaliana]
 emb|CAB82673.1| putative protein [Arabidopsis thaliana]
 gb|AAL06796.1| AT3g60690/T4C21_100 [Arabidopsis thaliana]
 gb|AEE80097.1| SAUR-like auxin-responsive protein [Arabidopsis thaliana]
Length=170

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = +2

Query  326  IRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFD  505
            I +GQEP   +   VP GH AVY+G+ +G   RV+VP+ YFNHPLF  LLREAE  +GF 
Sbjct  74   IPIGQEPIREKPDPVPKGHSAVYIGKKDGDFQRVLVPIVYFNHPLFGELLREAEEEFGFS  133

Query  506  HPGGIQIPCRISEFENVKSRIAA  574
              GGI IPC  S+F+ V++RI +
Sbjct  134  QEGGITIPCPYSDFKRVQTRIES  156



>ref|XP_010054898.1| PREDICTED: uncharacterized protein LOC104443264 [Eucalyptus grandis]
 gb|KCW78291.1| hypothetical protein EUGRSUZ_D02470 [Eucalyptus grandis]
Length=193

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 55/82 (67%), Gaps = 3/82 (4%)
 Frame = +2

Query  332  VGQEP--PGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFD  505
             GQ+P    P   +VP GHL VYVG   G  CRV+VPV Y NHPLF +LLREAE   GF 
Sbjct  80   AGQDPVEERPAAKTVPKGHLPVYVGRRSGEFCRVLVPVVYINHPLFVDLLREAEEELGFS  139

Query  506  H-PGGIQIPCRISEFENVKSRI  568
            H  GGI IPC +SEFE VKS++
Sbjct  140  HRGGGITIPCEVSEFERVKSQV  161



>emb|CDY48371.1| BnaC04g22040D [Brassica napus]
Length=170

 Score = 92.0 bits (227),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 61/95 (64%), Gaps = 0/95 (0%)
 Frame = +2

Query  290  RVLAVVKRDVRLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFAN  469
            R L   + +   I +G+EP   +   VP GH AVYVG+ +G   RV+VP+ YFNHPLF  
Sbjct  62   RFLGYKRSNSGYIPIGEEPVQTKPDPVPKGHSAVYVGKKDGDFHRVLVPIVYFNHPLFGE  121

Query  470  LLREAETVYGFDHPGGIQIPCRISEFENVKSRIAA  574
            LLREAE  +GF   GGI IPC  S+F+ V++RI +
Sbjct  122  LLREAEEEFGFCQEGGITIPCPYSDFKRVQTRIES  156



>emb|CDX97341.1| BnaA02g21320D [Brassica napus]
Length=146

 Score = 91.3 bits (225),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = +2

Query  326  IRVGQEPPGPEKASV-PAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGF  502
            IR+G++P      +V P  HL V+VGE++G T RVVVP+ YFNHPLF  LL +AE V GF
Sbjct  69   IRLGKDPNASLSMNVVPKRHLVVHVGESDGDTRRVVVPLIYFNHPLFGELLEQAELVDGF  128

Query  503  DHPGGIQIPCRISEFENV  556
            D PG I I CR+S+FE V
Sbjct  129  DQPGRITITCRVSDFEKV  146



>gb|KFK35270.1| hypothetical protein AALP_AA5G263400 [Arabis alpina]
Length=172

 Score = 91.7 bits (226),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = +2

Query  326  IRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFD  505
            I++GQ+P   +   VP GH AVYVG+ +G   RV+VP+ YFNHPLF  LLREAE  +GF 
Sbjct  76   IQLGQDPVREKPNPVPKGHSAVYVGKKDGDFHRVLVPIVYFNHPLFGELLREAEEEFGFC  135

Query  506  HPGGIQIPCRISEFENVKSRIAA  574
              GGI IPC  S+F+ V++RI +
Sbjct  136  QEGGITIPCPYSDFKEVQTRIES  158



>ref|XP_010469153.1| PREDICTED: auxin-induced protein X10A-like [Camelina sativa]
Length=170

 Score = 91.7 bits (226),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 60/95 (63%), Gaps = 0/95 (0%)
 Frame = +2

Query  290  RVLAVVKRDVRLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFAN  469
            R L      +  I +GQEP   +   VP GH AVYVG+ +G   RV+VP+ YFNHPLF  
Sbjct  62   RFLGSKCSSLGYIPIGQEPIREKPDPVPKGHSAVYVGKKDGDFQRVLVPIVYFNHPLFGE  121

Query  470  LLREAETVYGFDHPGGIQIPCRISEFENVKSRIAA  574
            LLREAE  +GF   GGI IPC  S+F+ V++RI +
Sbjct  122  LLREAEEEFGFCQEGGITIPCPYSDFKRVQTRIES  156



>ref|XP_010512403.1| PREDICTED: auxin-induced protein X10A-like [Camelina sativa]
Length=170

 Score = 91.3 bits (225),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 60/95 (63%), Gaps = 0/95 (0%)
 Frame = +2

Query  290  RVLAVVKRDVRLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFAN  469
            R L      +  I +GQEP   +   VP GH AVYVG+ +G   RV+VP+ YFNHPLF  
Sbjct  62   RFLGSKCSSLGYIPIGQEPIREKPDPVPKGHSAVYVGKKDGDFQRVLVPIVYFNHPLFGE  121

Query  470  LLREAETVYGFDHPGGIQIPCRISEFENVKSRIAA  574
            LLREAE  +GF   GGI IPC  S+F+ V++RI +
Sbjct  122  LLREAEEEFGFCQEGGITIPCPYSDFKRVQTRIES  156



>ref|XP_002876576.1| auxin-responsive family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52835.1| auxin-responsive family protein [Arabidopsis lyrata subsp. lyrata]
Length=168

 Score = 91.3 bits (225),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = +2

Query  326  IRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFD  505
            I +GQEP   +   VP GH AVY+G+ +G   RV+VP+ YFNHPLF  LLREAE  +GF 
Sbjct  72   IPIGQEPIRAQPDPVPKGHSAVYIGKKDGDFQRVLVPIVYFNHPLFGELLREAEEEFGFC  131

Query  506  HPGGIQIPCRISEFENVKSRIAA  574
              GGI IPC  S+F+ V++RI +
Sbjct  132  QEGGITIPCPYSDFKRVQTRIES  154



>ref|XP_009588676.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana tomentosiformis]
Length=118

 Score = 89.7 bits (221),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 60/101 (59%), Gaps = 4/101 (4%)
 Frame = +2

Query  278  GVGRRVLAVVKRDVR----LIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFY  445
            G G R L+++ + +     LI   Q     +K  +P G+LA+ VG+AE    R VVPV Y
Sbjct  2    GGGERSLSLLNKHLHFSHLLIHHHQGKKQGKKDVLPKGYLAIKVGQAEEEQQRFVVPVSY  61

Query  446  FNHPLFANLLREAETVYGFDHPGGIQIPCRISEFENVKSRI  568
            FNHPLF  LL+EAE VYGFDH G I IPC +  F  V+  I
Sbjct  62   FNHPLFIQLLKEAEEVYGFDHKGNITIPCHVEHFRCVQGEI  102



>ref|XP_006291944.1| hypothetical protein CARUB_v10018131mg [Capsella rubella]
 gb|EOA24842.1| hypothetical protein CARUB_v10018131mg [Capsella rubella]
Length=170

 Score = 91.3 bits (225),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +2

Query  332  VGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHP  511
            +GQEP   +   VP GH AVYVG+ +G   RV+VP+ YFNHPLF  LLREAE  +GF   
Sbjct  76   IGQEPIREKPDPVPKGHSAVYVGKKDGDFQRVLVPIVYFNHPLFGELLREAEEEFGFCQE  135

Query  512  GGIQIPCRISEFENVKSRIAA  574
            GGI IPC  S+F+ V++RI +
Sbjct  136  GGITIPCPYSDFKRVQTRIES  156



>emb|CDX89071.1| BnaA04g01150D [Brassica napus]
Length=170

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = +2

Query  326  IRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFD  505
            I +G+EP   +   VP GH AVYVG+ +G   RV+VP+ YFNHPLF  LLREAE  +GF 
Sbjct  74   IPIGKEPVQTKPEPVPKGHSAVYVGKKDGDFHRVLVPIVYFNHPLFGELLREAEEEFGFC  133

Query  506  HPGGIQIPCRISEFENVKSRIAA  574
              GGI IPC  S+F+ V++RI +
Sbjct  134  QEGGITIPCPYSDFKRVQTRIES  156



>ref|XP_009138820.1| PREDICTED: uncharacterized protein LOC103862867 [Brassica rapa]
 emb|CDX89069.1| BnaA04g01170D [Brassica napus]
Length=170

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = +2

Query  326  IRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFD  505
            I +G+EP   +   VP GH AVYVG+ +G   RV+VP+ YFNHPLF  LLREAE  +GF 
Sbjct  74   IPIGKEPVQTKPDPVPKGHSAVYVGKKDGDFHRVLVPIVYFNHPLFGELLREAEEEFGFC  133

Query  506  HPGGIQIPCRISEFENVKSRIAA  574
              GGI IPC  S+F+ V++RI +
Sbjct  134  QEGGITIPCPYSDFKRVQTRIES  156



>ref|XP_009387875.1| PREDICTED: uncharacterized protein LOC103974723 [Musa acuminata 
subsp. malaccensis]
Length=190

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 55/80 (69%), Gaps = 2/80 (3%)
 Frame = +2

Query  371  PAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCRISEFE  550
            P GHLAVYVG   G   R VVPV YFNHPLF  LLREAE  +GF HPGGI IPC  ++FE
Sbjct  108  PKGHLAVYVGG--GQPRRYVVPVIYFNHPLFGELLREAEEEFGFQHPGGITIPCPAAKFE  165

Query  551  NVKSRIAADGDARRVRRSWS  610
             +++RIAA G   R + S S
Sbjct  166  LIRTRIAAAGCHLRRKSSSS  185



>ref|XP_009406324.1| PREDICTED: uncharacterized protein LOC103989213 [Musa acuminata 
subsp. malaccensis]
Length=195

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 55/79 (70%), Gaps = 2/79 (3%)
 Frame = +2

Query  371  PAGHLAVYVG-EAEGATCR-VVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCRISE  544
            P GHLAVYVG E EG   R   VPV YFNHPLF  LLRE+E  +GF HPGGI IPC  ++
Sbjct  117  PKGHLAVYVGGEKEGGPPRRYTVPVIYFNHPLFGELLRESEEEFGFHHPGGITIPCPAAK  176

Query  545  FENVKSRIAADGDARRVRR  601
            FE V++RIAA     ++RR
Sbjct  177  FELVRTRIAAAAHNNKLRR  195



>ref|XP_004159805.1| PREDICTED: auxin-induced protein 6B-like [Cucumis sativus]
Length=150

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 53/81 (65%), Gaps = 6/81 (7%)
 Frame = +2

Query  368  VPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCRISEF  547
            VP G LAVYVGE+ G   RV+VPV YF H LF  LLREAE  YGF H  GI +PC  SEF
Sbjct  52   VPKGQLAVYVGESGGGLSRVLVPVVYFKHRLFIELLREAEEEYGFRHEKGITLPCGYSEF  111

Query  548  ENVKSRIAADGDARRVRRSWS  610
            E ++++I      R  RRSW+
Sbjct  112  ERIQTKI------RDCRRSWA  126



>ref|XP_008809045.1| PREDICTED: uncharacterized protein LOC103720874 [Phoenix dactylifera]
Length=185

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 60/93 (65%), Gaps = 8/93 (9%)
 Frame = +2

Query  335  GQEPPGPEKASVPAGHLAVYV-----GEAEGATCRVVVPVFYFNHPLFANLLREAETVYG  499
            G+E P P   S P GHLAVYV     GE   +  R VVPV  FNHPLF  LLREAE  +G
Sbjct  92   GRESPPP---STPKGHLAVYVSGGRKGEEAVSPRRFVVPVIDFNHPLFVELLREAEEEFG  148

Query  500  FDHPGGIQIPCRISEFENVKSRIAADGDARRVR  598
            F HPGGI IPC +S FE V++RIAA+   + +R
Sbjct  149  FHHPGGITIPCPVSRFERVRNRIAAEPARKGIR  181



>ref|XP_010413528.1| PREDICTED: auxin-induced protein X10A-like [Camelina sativa]
Length=170

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 60/95 (63%), Gaps = 0/95 (0%)
 Frame = +2

Query  290  RVLAVVKRDVRLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFAN  469
            R+L      +  I +G EP   +   VP GH AVYVG+ +G   RV+VP+ YFNHPLF  
Sbjct  62   RLLGSKCSSLGYIPIGHEPIREKPDPVPKGHSAVYVGKKDGDFQRVLVPIVYFNHPLFGE  121

Query  470  LLREAETVYGFDHPGGIQIPCRISEFENVKSRIAA  574
            LLREAE  +GF   GGI IPC  S+F+ V++RI +
Sbjct  122  LLREAEEEFGFCQEGGITIPCPYSDFKRVQTRIES  156



>ref|XP_009116750.1| PREDICTED: auxin-induced protein X10A [Brassica rapa]
Length=170

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +2

Query  332  VGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHP  511
            +G++P   +   VP GH AVYVG+ +G   RV+VP+ YFNHPLF  LLREAE  +GF   
Sbjct  76   IGKDPIQSKPDPVPKGHSAVYVGKKDGDFQRVLVPIVYFNHPLFGELLREAEEEFGFCQE  135

Query  512  GGIQIPCRISEFENVKSRIAA  574
            GGI IPC  S+F+ V++RI +
Sbjct  136  GGITIPCPYSDFKRVQTRIES  156



>emb|CDY41147.1| BnaA09g38680D [Brassica napus]
Length=170

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +2

Query  332  VGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHP  511
            +G++P   +   VP GH AVYVG+ +G   RV+VP+ YFNHPLF  LLREAE  +GF   
Sbjct  76   IGKDPIQSKPDPVPKGHSAVYVGKKDGDFHRVLVPIVYFNHPLFGELLREAEEEFGFCQE  135

Query  512  GGIQIPCRISEFENVKSRIAA  574
            GGI IPC  S+F+ V++RI +
Sbjct  136  GGITIPCPYSDFKRVQTRIES  156



>gb|KHN47895.1| Auxin-induced protein X10A [Glycine soja]
Length=146

 Score = 88.2 bits (217),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 57/95 (60%), Gaps = 17/95 (18%)
 Frame = +2

Query  356  EKASVPAGHLAVYVGE-----------------AEGATCRVVVPVFYFNHPLFANLLREA  484
            EK+   A HL   + E                  +G   RV++PV YFNHPLF++LLREA
Sbjct  26   EKSHNKASHLGAKIKERSEDPMREKRVGLSSNREDGEFRRVLIPVIYFNHPLFSDLLREA  85

Query  485  ETVYGFDHPGGIQIPCRISEFENVKSRIAADGDAR  589
            E  +GF+HPGGI IPCR++EFE VK+RIA+    R
Sbjct  86   EKKFGFEHPGGITIPCRLTEFERVKTRIASGSGQR  120



>ref|XP_009796475.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana sylvestris]
Length=120

 Score = 87.4 bits (215),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 59/101 (58%), Gaps = 4/101 (4%)
 Frame = +2

Query  278  GVGRRVLAVVKRDVR----LIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFY  445
            G G R L+++ + +     LI   Q     +K  +P G+LA+ VG+ E    R VVPV Y
Sbjct  2    GGGERSLSLLNKHLHFSHLLIHHHQGKKHGKKDVLPKGYLAIKVGQEEEEQQRFVVPVSY  61

Query  446  FNHPLFANLLREAETVYGFDHPGGIQIPCRISEFENVKSRI  568
            FNHPLF  LL+EAE VYGFDH G I IPC +  F  V+  I
Sbjct  62   FNHPLFIQLLKEAEEVYGFDHKGNITIPCHVEHFRCVQGEI  102



>gb|EPS59338.1| hypothetical protein M569_15471 [Genlisea aurea]
Length=129

 Score = 87.4 bits (215),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 55/74 (74%), Gaps = 1/74 (1%)
 Frame = +2

Query  356  EKASVPAGHLAVYVGEAEGATC-RVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPC  532
            ++  VP GH+AVYVGE +G    ++ VPVFY NHPLF +LL+E+E  +GF++ GG+ IPC
Sbjct  53   DRLPVPKGHVAVYVGEGDGDELEKIWVPVFYLNHPLFCDLLKESEREFGFNYSGGLTIPC  112

Query  533  RISEFENVKSRIAA  574
            RIS FE V ++I +
Sbjct  113  RISVFETVWTQIGS  126



>ref|XP_004147976.1| PREDICTED: uncharacterized protein LOC101210462 [Cucumis sativus]
 ref|XP_004159531.1| PREDICTED: uncharacterized LOC101210462 [Cucumis sativus]
 gb|KGN55902.1| hypothetical protein Csa_3G035310 [Cucumis sativus]
Length=153

 Score = 88.2 bits (217),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 59/93 (63%), Gaps = 4/93 (4%)
 Frame = +2

Query  311  RDVRLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAET  490
            R  RL RV   PP     + P G+LAV+VG  E    R +VPV YFNHP+F  LL+ AE 
Sbjct  50   RYARLNRVRSTPP----VATPKGYLAVHVGGPENERERHLVPVIYFNHPMFRKLLQAAEV  105

Query  491  VYGFDHPGGIQIPCRISEFENVKSRIAADGDAR  589
            +YGFD+PG I IP  +SEFE VK+ IAA  + R
Sbjct  106  IYGFDYPGRIVIPVDVSEFEEVKNGIAATENGR  138



>gb|KGN45710.1| hypothetical protein Csa_6G007440 [Cucumis sativus]
Length=213

 Score = 89.4 bits (220),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 53/81 (65%), Gaps = 6/81 (7%)
 Frame = +2

Query  368  VPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCRISEF  547
            VP G LAVYVGE+ G   RV+VPV YF H LF  LLREAE  YGF H  GI +PC  SEF
Sbjct  78   VPKGQLAVYVGESGGGLSRVLVPVVYFKHRLFIELLREAEEEYGFRHEKGITLPCGYSEF  137

Query  548  ENVKSRIAADGDARRVRRSWS  610
            E ++++I      R  RRSW+
Sbjct  138  ERIQTKI------RDCRRSWA  152



>emb|CDX71789.1| BnaC08g30850D [Brassica napus]
Length=170

 Score = 88.2 bits (217),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +2

Query  332  VGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHP  511
            +G++P   +   VP GH AVYVG+ +G   RV+VP+ YFNHPLF  LLREAE  +GF   
Sbjct  76   IGKDPIQNKPDPVPKGHSAVYVGKKDGDFHRVLVPIVYFNHPLFGELLREAEEEFGFCQQ  135

Query  512  GGIQIPCRISEFENVKSRIAA  574
            GGI IPC  S+F+ V++RI +
Sbjct  136  GGITIPCPYSDFKRVQTRIES  156



>ref|XP_008796846.1| PREDICTED: uncharacterized protein LOC103712176 [Phoenix dactylifera]
Length=207

 Score = 89.4 bits (220),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 50/70 (71%), Gaps = 2/70 (3%)
 Frame = +2

Query  371  PAGHLAVYVGEAE--GATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCRISE  544
            P GHL VYVG  +  G   R +VPV YFNHPLF  LLREAE  +G+ HPGGI IPC +S 
Sbjct  121  PKGHLVVYVGGQKDGGPPQRYLVPVIYFNHPLFGELLREAEEEFGYHHPGGITIPCPVSR  180

Query  545  FENVKSRIAA  574
            FE V++RIAA
Sbjct  181  FERVRTRIAA  190



>ref|XP_008812363.1| PREDICTED: uncharacterized protein LOC103723263 [Phoenix dactylifera]
Length=193

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 55/81 (68%), Gaps = 2/81 (2%)
 Frame = +2

Query  338  QEPPGPEKASVPAGHLAVYVGEAE--GATCRVVVPVFYFNHPLFANLLREAETVYGFDHP  511
            Q+  G +K   P GHL VYVG  +  G   R +VPV  FNHPLFA LLREAE  +G+ HP
Sbjct  108  QKGGGRQKPPPPKGHLVVYVGGQKDGGPPKRYLVPVIDFNHPLFAELLREAEDEFGYHHP  167

Query  512  GGIQIPCRISEFENVKSRIAA  574
            GGI IPC +S FE V++RIAA
Sbjct  168  GGITIPCPVSRFERVQTRIAA  188



>ref|XP_008448892.1| PREDICTED: uncharacterized protein LOC103490920 [Cucumis melo]
Length=153

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 58/90 (64%), Gaps = 4/90 (4%)
 Frame = +2

Query  320  RLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYG  499
            RL RV   P      + P G+LAV+VG  E  T R +VPV YFNHP+F  LL+ AE +YG
Sbjct  53   RLNRVRSTP----AVATPKGYLAVHVGGPEDETERHLVPVIYFNHPMFRKLLQAAEVIYG  108

Query  500  FDHPGGIQIPCRISEFENVKSRIAADGDAR  589
            FD+PG I IP  +SEFE VK+ IAA  + R
Sbjct  109  FDYPGRIVIPVDVSEFEEVKNGIAAAENGR  138



>ref|XP_008458152.1| PREDICTED: uncharacterized protein LOC103497676 [Cucumis melo]
Length=174

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 51/80 (64%), Gaps = 6/80 (8%)
 Frame = +2

Query  368  VPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCRISEF  547
            VP G LAVYVGE+ G   RV+VPV YF H LF  LLREAE  YGF H  GI +PC  SEF
Sbjct  76   VPKGQLAVYVGESGGGLSRVLVPVVYFKHKLFIELLREAEEEYGFRHEKGITLPCGYSEF  135

Query  548  ENVKSRIAADGDARRVRRSW  607
            E ++++I   G      RSW
Sbjct  136  ERIQTKIRDCG------RSW  149



>ref|XP_010933719.1| PREDICTED: uncharacterized protein LOC105054040 [Elaeis guineensis]
Length=208

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 50/70 (71%), Gaps = 2/70 (3%)
 Frame = +2

Query  371  PAGHLAVYVG--EAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCRISE  544
            P GHL VYVG  +  G   R +VPV YFNHPLF  LLREAE  +G+ HPGGI IPC +S 
Sbjct  122  PKGHLVVYVGGRKDGGPPQRYLVPVIYFNHPLFGELLREAEEEFGYHHPGGITIPCPVSR  181

Query  545  FENVKSRIAA  574
            FE V++RIAA
Sbjct  182  FERVQTRIAA  191



>ref|XP_006828033.1| hypothetical protein AMTR_s00008p00255330 [Amborella trichopoda]
 gb|ERM95449.1| hypothetical protein AMTR_s00008p00255330 [Amborella trichopoda]
Length=164

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 59/91 (65%), Gaps = 5/91 (5%)
 Frame = +2

Query  332  VGQEP-PGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDH  508
            +G +P  GPE   VP G++AVYVG+ +    R +VPV Y NHPLFA LLR  E  YGF+ 
Sbjct  73   LGYQPLDGPE---VPKGYMAVYVGQND-EQYRFLVPVLYVNHPLFAALLRVTEEEYGFEQ  128

Query  509  PGGIQIPCRISEFENVKSRIAADGDARRVRR  601
             GGI IPC +S FE V+ RIA DG  + + R
Sbjct  129  VGGITIPCDVSHFETVRKRIAGDGWKKLLHR  159



>gb|EAZ23974.1| hypothetical protein OsJ_07701 [Oryza sativa Japonica Group]
Length=190

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 59/94 (63%), Gaps = 3/94 (3%)
 Frame = +2

Query  329  RVGQEPPGPEKASVPAGHLAVYVGEAE-GATCRVVVPVFYFNHPLFANLLREAETVYGFD  505
            R+ +E PG  +A+ P G +AVYVG  E G + R VVPV YFNHPLF  LLREAE  +GF 
Sbjct  99   RLLEESPG--EATTPKGQVAVYVGGGEPGESMRYVVPVVYFNHPLFGELLREAEEEFGFA  156

Query  506  HPGGIQIPCRISEFENVKSRIAADGDARRVRRSW  607
            HPGGI IPC  + FE      AA G  R+V   W
Sbjct  157  HPGGITIPCAAARFERAAPLAAAGGGGRKVPTWW  190



>ref|XP_004953271.1| PREDICTED: uncharacterized protein LOC101757474 [Setaria italica]
Length=201

 Score = 86.3 bits (212),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 48/66 (73%), Gaps = 2/66 (3%)
 Frame = +2

Query  359  KASVPAGHLAVYVGEAE--GATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPC  532
            +A+ P G +AVYVG AE  G + R VVPV YFNHPLF  LLREAE  +GF+HPGGI IPC
Sbjct  117  EATTPKGQVAVYVGGAEPGGESMRYVVPVVYFNHPLFGELLREAEEEFGFEHPGGITIPC  176

Query  533  RISEFE  550
              S FE
Sbjct  177  AASRFE  182



>ref|XP_004230018.1| PREDICTED: auxin-induced protein 15A [Solanum lycopersicum]
Length=109

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = +2

Query  359  KASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCRI  538
            K  VP G+LA+ VG+AE    R +VPV YFNHPLF  LL+EAE VYGF H G I IPC +
Sbjct  26   KRDVPKGYLAIKVGQAEEEQQRFIVPVSYFNHPLFIQLLKEAEEVYGFHHKGTITIPCHV  85

Query  539  SEFENVKSRI  568
             +F  V+ +I
Sbjct  86   EQFRCVQGKI  95



>ref|XP_002454566.1| hypothetical protein SORBIDRAFT_04g033550 [Sorghum bicolor]
 gb|EES07542.1| hypothetical protein SORBIDRAFT_04g033550 [Sorghum bicolor]
Length=207

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 48/70 (69%), Gaps = 2/70 (3%)
 Frame = +2

Query  359  KASVPAGHLAVYVGEAE--GATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPC  532
            +A+ P G +AVYVG AE  G + R VVPV YFNHPLF  LLREAE  +GF HPGGI IPC
Sbjct  123  EATTPKGQVAVYVGGAEPGGESMRYVVPVVYFNHPLFGELLREAEEEFGFQHPGGITIPC  182

Query  533  RISEFENVKS  562
              S FE   +
Sbjct  183  AASRFERAAA  192



>ref|XP_003626587.1| Auxin-induced protein X15 [Medicago truncatula]
 gb|AES82805.1| SAUR-like auxin-responsive family protein [Medicago truncatula]
Length=105

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 47/71 (66%), Gaps = 1/71 (1%)
 Frame = +2

Query  356  EKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCR  535
            E   VP G LA+ VG+ E    R VVPV YFNHPLF  LL+EAE  YGFDH G I IPCR
Sbjct  19   EFRGVPKGCLAIKVGQGEDQQ-RFVVPVIYFNHPLFMQLLKEAEEEYGFDHKGAITIPCR  77

Query  536  ISEFENVKSRI  568
            + EF N++  I
Sbjct  78   VEEFRNIRGLI  88



>ref|XP_006339758.1| PREDICTED: auxin-induced protein 15A-like [Solanum tuberosum]
Length=109

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = +2

Query  359  KASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCRI  538
            K  VP G+LA+ VG+AE    R +VPV YFNHPLF  LL++AE VYGF H G I IPC +
Sbjct  26   KRDVPKGYLAIKVGQAEEVQQRFIVPVSYFNHPLFIQLLKQAEEVYGFHHKGTITIPCHV  85

Query  539  SEFENVKSRI  568
             +F  V+ +I
Sbjct  86   EQFRCVQGKI  95



>dbj|BAJ89028.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=188

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 57/93 (61%), Gaps = 8/93 (9%)
 Frame = +2

Query  281  VGRRVLAVVKRDVRLIRVGQEPPGPEKASVPAGHLAVYVGEAE--GATCRVVVPVFYFNH  454
            + RR+  + +R  RL+    E      A+ P G +AVYVG  E  G + R VVPV YFNH
Sbjct  85   LARRMRLLPRRGERLLEEAGE------ATTPKGQVAVYVGGDEPGGESMRYVVPVVYFNH  138

Query  455  PLFANLLREAETVYGFDHPGGIQIPCRISEFEN  553
            PLF  LLREAE  +GF+HPGGI IPC  + FE 
Sbjct  139  PLFGELLREAEEEFGFEHPGGITIPCAATRFER  171



>ref|XP_008794848.1| PREDICTED: uncharacterized protein LOC103710746 [Phoenix dactylifera]
Length=179

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 52/71 (73%), Gaps = 5/71 (7%)
 Frame = +2

Query  380  HLAVYVGEA----EGATCR-VVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCRISE  544
            HLA+YVG      EGA  R  VVPV +FNHPLF  LL+EAE  +GF+HPGGI IPC +S 
Sbjct  94   HLAIYVGGGRNGEEGAPPRRFVVPVIHFNHPLFGELLKEAEEEFGFNHPGGITIPCPVSR  153

Query  545  FENVKSRIAAD  577
            FE ++SRIAA+
Sbjct  154  FERLRSRIAAE  164



>gb|ADM74031.1| auxin responsive family-like protein, partial [Picea sitchensis]
 gb|ADM74032.1| auxin responsive family-like protein, partial [Picea sitchensis]
 gb|ADM74033.1| auxin responsive family-like protein, partial [Picea sitchensis]
 gb|ADM74034.1| auxin responsive family-like protein, partial [Picea sitchensis]
Length=153

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 53/83 (64%), Gaps = 0/83 (0%)
 Frame = +2

Query  311  RDVRLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAET  490
            R +  +   ++  G     VP G +AVYVG+A+    R V+PVFYFNHPLF +LL E E 
Sbjct  58   RRIGFVEENEKKSGNPPKDVPKGFVAVYVGDAQEEQTRFVIPVFYFNHPLFLHLLEETEH  117

Query  491  VYGFDHPGGIQIPCRISEFENVK  559
            VYGF+  G   IPC++S+FE ++
Sbjct  118  VYGFNQKGVFTIPCQVSDFEYLQ  140



>gb|ADM73997.1| auxin responsive family-like protein, partial [Picea sitchensis]
 gb|ADM73998.1| auxin responsive family-like protein, partial [Picea sitchensis]
 gb|ADM74002.1| auxin responsive family-like protein, partial [Picea sitchensis]
 gb|ADM74003.1| auxin responsive family-like protein, partial [Picea sitchensis]
 gb|ADM74004.1| auxin responsive family-like protein, partial [Picea sitchensis]
 gb|ADM74005.1| auxin responsive family-like protein, partial [Picea sitchensis]
 gb|ADM74006.1| auxin responsive family-like protein, partial [Picea sitchensis]
 gb|ADM74007.1| auxin responsive family-like protein, partial [Picea sitchensis]
 gb|ADM74008.1| auxin responsive family-like protein, partial [Picea sitchensis]
 gb|ADM74009.1| auxin responsive family-like protein, partial [Picea sitchensis]
 gb|ADM74011.1| auxin responsive family-like protein, partial [Picea sitchensis]
 gb|ADM74012.1| auxin responsive family-like protein, partial [Picea sitchensis]
 gb|ADM74013.1| auxin responsive family-like protein, partial [Picea sitchensis]
 gb|ADM74014.1| auxin responsive family-like protein, partial [Picea sitchensis]
 gb|ADM74016.1| auxin responsive family-like protein, partial [Picea sitchensis]
 gb|ADM74017.1| auxin responsive family-like protein, partial [Picea sitchensis]
 gb|ADM74018.1| auxin responsive family-like protein, partial [Picea sitchensis]
 gb|ADM74019.1| auxin responsive family-like protein, partial [Picea sitchensis]
 gb|ADM74020.1| auxin responsive family-like protein, partial [Picea sitchensis]
 gb|ADM74021.1| auxin responsive family-like protein, partial [Picea sitchensis]
 gb|ADM74022.1| auxin responsive family-like protein, partial [Picea sitchensis]
 gb|ADM74024.1| auxin responsive family-like protein, partial [Picea sitchensis]
 gb|ADM74025.1| auxin responsive family-like protein, partial [Picea sitchensis]
 gb|ADM74026.1| auxin responsive family-like protein, partial [Picea sitchensis]
 gb|ADM74028.1| auxin responsive family-like protein, partial [Picea sitchensis]
 gb|ADM74029.1| auxin responsive family-like protein, partial [Picea sitchensis]
 gb|ADM74035.1| auxin responsive family-like protein, partial [Picea sitchensis]
 gb|ADM74036.1| auxin responsive family-like protein, partial [Picea sitchensis]
 gb|ADM74037.1| auxin responsive family-like protein, partial [Picea sitchensis]
 gb|ADM74038.1| auxin responsive family-like protein, partial [Picea sitchensis]
 gb|ADM74039.1| auxin responsive family-like protein, partial [Picea sitchensis]
 gb|ADM74040.1| auxin responsive family-like protein, partial [Picea sitchensis]
Length=153

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 53/83 (64%), Gaps = 0/83 (0%)
 Frame = +2

Query  311  RDVRLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAET  490
            R +  +   ++  G     VP G +AVYVG+A+    R V+PVFYFNHPLF +LL E E 
Sbjct  58   RRIGFVEENEKKSGNPPKDVPKGFVAVYVGDAQEEQTRFVIPVFYFNHPLFLHLLEETEH  117

Query  491  VYGFDHPGGIQIPCRISEFENVK  559
            VYGF+  G   IPC++S+FE ++
Sbjct  118  VYGFNQKGVFTIPCQVSDFEYLQ  140



>gb|ADM73999.1| auxin responsive family-like protein, partial [Picea sitchensis]
 gb|ADM74000.1| auxin responsive family-like protein, partial [Picea sitchensis]
Length=153

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 53/83 (64%), Gaps = 0/83 (0%)
 Frame = +2

Query  311  RDVRLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAET  490
            R +  +   ++  G     VP G +AVYVG+A+    R V+PVFYFNHPLF +LL E E 
Sbjct  58   RRIGFVEENEKKSGNPPKDVPKGFVAVYVGDAQEEQTRFVIPVFYFNHPLFLHLLEETEH  117

Query  491  VYGFDHPGGIQIPCRISEFENVK  559
            VYGF+  G   IPC++S+FE ++
Sbjct  118  VYGFNQKGVFTIPCQVSDFEYLQ  140



>gb|ADM74001.1| auxin responsive family-like protein, partial [Picea sitchensis]
Length=153

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 53/83 (64%), Gaps = 0/83 (0%)
 Frame = +2

Query  311  RDVRLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAET  490
            R +  +   ++  G     VP G +AVYVG+A+    R V+PVFYFNHPLF +LL E E 
Sbjct  58   RRIGFVEENEKKSGNPPKDVPKGFVAVYVGDAQEEQTRFVIPVFYFNHPLFLHLLEETEH  117

Query  491  VYGFDHPGGIQIPCRISEFENVK  559
            VYGF+  G   IPC++S+FE ++
Sbjct  118  VYGFNQKGVFTIPCQVSDFEYLQ  140



>gb|ADM74023.1| auxin responsive family-like protein, partial [Picea sitchensis]
Length=153

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 53/83 (64%), Gaps = 0/83 (0%)
 Frame = +2

Query  311  RDVRLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAET  490
            R +  +   ++  G     VP G +AVYVG+A+    R V+PVFYFNHPLF +LL E E 
Sbjct  58   RRIGFVEENEKKSGNPPKDVPKGFVAVYVGDAQEEQTRFVIPVFYFNHPLFLHLLEETEH  117

Query  491  VYGFDHPGGIQIPCRISEFENVK  559
            VYGF+  G   IPC++S+FE ++
Sbjct  118  VYGFNQKGVFTIPCQVSDFEYLQ  140



>gb|ADM74015.1| auxin responsive family-like protein, partial [Picea sitchensis]
Length=153

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 53/83 (64%), Gaps = 0/83 (0%)
 Frame = +2

Query  311  RDVRLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAET  490
            R +  +   ++  G     VP G +AVYVG+A+    R V+PVFYFNHPLF +LL E E 
Sbjct  58   RRIGFVEENEKKSGNPPKDVPKGFVAVYVGDAQEEQTRFVIPVFYFNHPLFLHLLEETEH  117

Query  491  VYGFDHPGGIQIPCRISEFENVK  559
            VYGF+  G   IPC++S+FE ++
Sbjct  118  VYGFNQKGVFTIPCQVSDFEYLQ  140



>ref|XP_010906625.1| PREDICTED: uncharacterized protein LOC105033493 [Elaeis guineensis]
Length=185

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 48/71 (68%), Gaps = 5/71 (7%)
 Frame = +2

Query  380  HLAVYV-----GEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCRISE  544
            HLAVYV     GE      R VVPV  FNHPLF  LLREAE  +GFDHPGGI IPC +S 
Sbjct  104  HLAVYVSGGRKGEEVAPPRRFVVPVIDFNHPLFVELLREAEEEFGFDHPGGITIPCPVSR  163

Query  545  FENVKSRIAAD  577
            FE V++RIA +
Sbjct  164  FERVRTRIAGE  174



>ref|XP_004494852.1| PREDICTED: auxin-induced protein 10A5-like [Cicer arietinum]
Length=93

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 51/86 (59%), Gaps = 1/86 (1%)
 Frame = +2

Query  356  EKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCR  535
            +K  VP G LA+ VG+ E    R VVPV YFNHPLF +LL+EAE  +GFD  G I IPC 
Sbjct  9    KKQGVPKGCLAIKVGQGEEQQ-RFVVPVMYFNHPLFMHLLKEAEEEFGFDQKGTITIPCH  67

Query  536  ISEFENVKSRIAADGDARRVRRSWSF  613
            + EF N++  I  +       R + F
Sbjct  68   VEEFRNIRGLIDREKSFHHHTRCFGF  93



>ref|NP_001053425.1| Os04g0537100 [Oryza sativa Japonica Group]
 dbj|BAF15339.1| Os04g0537100 [Oryza sativa Japonica Group]
 emb|CAH67117.1| H0502G05.8 [Oryza sativa Indica Group]
 gb|EAY94980.1| hypothetical protein OsI_16787 [Oryza sativa Indica Group]
Length=167

 Score = 83.2 bits (204),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 54/88 (61%), Gaps = 6/88 (7%)
 Frame = +2

Query  290  RVLAVVKRDVRLIRVGQEPPGPEKASVPAGHLAVYVGEAE-GATCRVVVPVFYFNHPLFA  466
            R L++ ++D    R+  EP      S P G +AVYVG    G + R VVPV YFNHP+F 
Sbjct  69   RRLSLGRKDGGRRRILDEP-----VSTPKGQVAVYVGGGNPGESLRYVVPVVYFNHPMFG  123

Query  467  NLLREAETVYGFDHPGGIQIPCRISEFE  550
             LLREAE  +GF HPGGI IPC  S FE
Sbjct  124  ELLREAEEEFGFQHPGGITIPCAASRFE  151



>gb|EAZ31465.1| hypothetical protein OsJ_15602 [Oryza sativa Japonica Group]
Length=162

 Score = 83.2 bits (204),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 54/88 (61%), Gaps = 6/88 (7%)
 Frame = +2

Query  290  RVLAVVKRDVRLIRVGQEPPGPEKASVPAGHLAVYVGEAE-GATCRVVVPVFYFNHPLFA  466
            R L++ ++D    R+  EP      S P G +AVYVG    G + R VVPV YFNHP+F 
Sbjct  64   RRLSLGRKDGGRRRILDEP-----VSTPKGQVAVYVGGGNPGESLRYVVPVVYFNHPMFG  118

Query  467  NLLREAETVYGFDHPGGIQIPCRISEFE  550
             LLREAE  +GF HPGGI IPC  S FE
Sbjct  119  ELLREAEEEFGFQHPGGITIPCAASRFE  146



>gb|ACG44233.1| SAUR11 - auxin-responsive SAUR family member [Zea mays]
Length=199

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 46/66 (70%), Gaps = 2/66 (3%)
 Frame = +2

Query  359  KASVPAGHLAVYVGEAE--GATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPC  532
            +A+ P G +AVYVG AE    + R VVPV YFNHPLF  LLREAE  +GF HPGGI IPC
Sbjct  113  EATTPKGQVAVYVGGAEPGAESMRYVVPVVYFNHPLFGELLREAEEEFGFQHPGGITIPC  172

Query  533  RISEFE  550
              S FE
Sbjct  173  AASRFE  178



>ref|XP_008678880.1| PREDICTED: uncharacterized protein LOC103653849 [Zea mays]
 gb|AFW63197.1| SAUR11-auxin-responsive SAUR family member [Zea mays]
Length=199

 Score = 83.6 bits (205),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 46/66 (70%), Gaps = 2/66 (3%)
 Frame = +2

Query  359  KASVPAGHLAVYVGEAE--GATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPC  532
            +A+ P G +AVYVG AE    + R VVPV YFNHPLF  LLREAE  +GF HPGGI IPC
Sbjct  113  EATTPKGQVAVYVGGAEPGAESMRYVVPVVYFNHPLFGELLREAEEEFGFQHPGGITIPC  172

Query  533  RISEFE  550
              S FE
Sbjct  173  AASRFE  178



>gb|ADM74030.1| auxin responsive family-like protein, partial [Picea sitchensis]
Length=153

 Score = 82.4 bits (202),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 53/83 (64%), Gaps = 0/83 (0%)
 Frame = +2

Query  311  RDVRLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAET  490
            R +  +   ++  G     VP G +AVYVG+A+    R V+PVFYFNHPLF +LL E E 
Sbjct  58   RRIGFVEENEKKSGNPPKDVPKGFVAVYVGDAQEEQTRFVIPVFYFNHPLFLHLLEETEH  117

Query  491  VYGFDHPGGIQIPCRISEFENVK  559
            VYGF+  G   IPC++S+FE ++
Sbjct  118  VYGFNQKGVFIIPCQVSDFEYLQ  140



>gb|KHN35614.1| Auxin-induced protein X10A [Glycine soja]
Length=107

 Score = 81.3 bits (199),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 47/59 (80%), Gaps = 1/59 (2%)
 Frame = +2

Query  428  VVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCRISEFENVKSRIAADGDAR-RVRR  601
            ++PV Y NHPLF++LLREAE  +GF+HPGGI IPCR++EFE VK+RIA+    R R RR
Sbjct  41   LIPVIYCNHPLFSDLLREAEKEFGFEHPGGITIPCRLTEFERVKTRIASGSGQRGRTRR  99



>ref|XP_010271569.1| PREDICTED: auxin-induced protein 15A-like [Nelumbo nucifera]
Length=103

 Score = 80.9 bits (198),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 56/87 (64%), Gaps = 4/87 (5%)
 Frame = +2

Query  320  RLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYG  499
            RL+   + P G  +  VP GHLAVYVGE +    R V+PV Y  HPLF +LL +AE  +G
Sbjct  20   RLLARDEFPAGAIR-DVPKGHLAVYVGETQKK--RFVIPVSYLKHPLFQDLLSQAEEEFG  76

Query  500  FDHP-GGIQIPCRISEFENVKSRIAAD  577
            FDHP GG+ IPC+ + F N+ SR+ A 
Sbjct  77   FDHPMGGLTIPCKEAAFINLTSRMTAS  103



>ref|XP_004502720.1| PREDICTED: uncharacterized protein LOC101503085 [Cicer arietinum]
Length=146

 Score = 82.0 bits (201),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 51/87 (59%), Gaps = 2/87 (2%)
 Frame = +2

Query  356  EKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCR  535
            EK  +P G LAV VG+ E    R V+PV Y NHPLF  LL+EAE  YGFD  G I IPC 
Sbjct  59   EKKDIPKGCLAVMVGQGEEQQ-RFVIPVIYINHPLFMELLKEAEEEYGFDQKGPITIPCH  117

Query  536  ISEFENVKSRIAADGD-ARRVRRSWSF  613
            + EF  V+  I +D + +     +W F
Sbjct  118  VEEFRTVQYMIDSDREKSHHHHHAWCF  144



>gb|ADM74027.1| auxin responsive family-like protein, partial [Picea sitchensis]
Length=153

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 52/83 (63%), Gaps = 0/83 (0%)
 Frame = +2

Query  311  RDVRLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAET  490
            R +  +   ++  G     VP G +AVYVG+ +    R V+PVFYFNHPLF +LL E E 
Sbjct  58   RRIGFVEENEKKSGNPPKDVPKGFVAVYVGDGQEEQTRFVIPVFYFNHPLFLHLLEETEH  117

Query  491  VYGFDHPGGIQIPCRISEFENVK  559
            VYGF+  G   IPC++S+FE ++
Sbjct  118  VYGFNQKGVFTIPCQVSDFEYLQ  140



>gb|ADM74010.1| auxin responsive family-like protein, partial [Picea sitchensis]
Length=153

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 52/83 (63%), Gaps = 0/83 (0%)
 Frame = +2

Query  311  RDVRLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAET  490
            R +  +   ++  G     VP G +AVYVG+ +    R V+PVFYFNHPLF +LL E E 
Sbjct  58   RRIGFVEENEKKSGNPPKDVPKGFVAVYVGDGQEEQTRFVIPVFYFNHPLFLHLLEETEH  117

Query  491  VYGFDHPGGIQIPCRISEFENVK  559
            VYGF+  G   IPC++S+FE ++
Sbjct  118  VYGFNQKGVFTIPCQVSDFEYLQ  140



>gb|KCW78293.1| hypothetical protein EUGRSUZ_D02472, partial [Eucalyptus grandis]
Length=117

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 48/69 (70%), Gaps = 1/69 (1%)
 Frame = +2

Query  365  SVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDH-PGGIQIPCRIS  541
            +VP GHLAVYVG   G   RV+VPV  FNHPLF +LLREAE    F H  GGI +PC +S
Sbjct  36   TVPKGHLAVYVGRRSGEFRRVLVPVVDFNHPLFRDLLREAEEELWFSHGGGGITVPCEVS  95

Query  542  EFENVKSRI  568
            EFE VKS +
Sbjct  96   EFERVKSWV  104



>ref|XP_008645998.1| PREDICTED: uncharacterized protein LOC103627479 [Zea mays]
 gb|AFW72541.1| SAUR11-auxin-responsive SAUR family member [Zea mays]
Length=198

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 45/64 (70%), Gaps = 1/64 (2%)
 Frame = +2

Query  359  KASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCRI  538
            +A+ P G +AVYVG   G + R VVPV YFNHPLF  LLREAE  +GF HPGGI IPC  
Sbjct  113  EATTPKGQVAVYVGGG-GESMRYVVPVVYFNHPLFGELLREAEEEFGFQHPGGITIPCAA  171

Query  539  SEFE  550
            S FE
Sbjct  172  SRFE  175



>ref|XP_007200167.1| hypothetical protein PRUPE_ppa016712mg [Prunus persica]
 gb|EMJ01366.1| hypothetical protein PRUPE_ppa016712mg [Prunus persica]
Length=97

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 51/76 (67%), Gaps = 3/76 (4%)
 Frame = +2

Query  350  GPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHP-GGIQI  526
             P  + VP G+LAVYVG+ E    RVV+P+ Y N PLF  LL EAE  +GFDHP GG+ I
Sbjct  23   SPNLSDVPKGYLAVYVGDGEWQ--RVVIPMSYVNQPLFQELLSEAEDEFGFDHPMGGLTI  80

Query  527  PCRISEFENVKSRIAA  574
            PCR  +F ++ SR+ +
Sbjct  81   PCRQDDFMDLLSRLNS  96



>ref|XP_010054899.1| PREDICTED: auxin-induced protein 15A-like [Eucalyptus grandis]
Length=130

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 48/69 (70%), Gaps = 1/69 (1%)
 Frame = +2

Query  365  SVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDH-PGGIQIPCRIS  541
            +VP GHLAVYVG   G   RV+VPV  FNHPLF +LLREAE    F H  GGI +PC +S
Sbjct  36   TVPKGHLAVYVGRRSGEFRRVLVPVVDFNHPLFRDLLREAEEELWFSHGGGGITVPCEVS  95

Query  542  EFENVKSRI  568
            EFE VKS +
Sbjct  96   EFERVKSWV  104



>gb|AIS67841.1| SAUR3 [Gossypium hirsutum]
Length=122

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 44/71 (62%), Gaps = 0/71 (0%)
 Frame = +2

Query  365  SVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCRISE  544
             VP G+LA+ VG       R VVPV YFNHPLF  LL+EAE  YGFD  G I IPC + E
Sbjct  34   DVPKGYLAIMVGSQGEERQRFVVPVMYFNHPLFMRLLKEAEEEYGFDQKGTITIPCHVEE  93

Query  545  FENVKSRIAAD  577
            F N++  I  +
Sbjct  94   FRNIRGLIDKE  104



>ref|XP_004510629.1| PREDICTED: auxin-induced protein 10A5-like [Cicer arietinum]
Length=107

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +2

Query  356  EKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCR  535
            E   VP G +A+ VG+ E    R VVPV YFNHPLF  LL+EAE  YGFD  G I IPC 
Sbjct  23   EFKGVPKGFMAIKVGQGE-EQQRFVVPVMYFNHPLFIQLLKEAEEEYGFDQKGTITIPCH  81

Query  536  ISEFENVKSRIAADGD  583
            + EF NV+  I  D +
Sbjct  82   VEEFRNVRGLIDRDKN  97



>gb|KHN25461.1| Auxin-induced protein X10A [Glycine soja]
Length=92

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 55/85 (65%), Gaps = 3/85 (4%)
 Frame = +2

Query  323  LIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGF  502
            ++   ++     K++VP GH+AVYVGE +    R VVP+ Y NHPLF +LL  AE  +GF
Sbjct  9    MVHAAKQTSSSFKSNVPKGHVAVYVGEMQKK--RFVVPISYLNHPLFLDLLNRAEEEFGF  66

Query  503  DHP-GGIQIPCRISEFENVKSRIAA  574
            +HP GG+ IPC+   F N+ S++ A
Sbjct  67   NHPMGGLTIPCKEDAFINLTSQLRA  91



>ref|XP_006423551.1| hypothetical protein CICLE_v10029685mg [Citrus clementina]
 ref|XP_006494592.1| PREDICTED: auxin-induced protein 15A-like [Citrus sinensis]
 gb|ESR36791.1| hypothetical protein CICLE_v10029685mg [Citrus clementina]
 gb|KDO42787.1| hypothetical protein CISIN_1g034523mg [Citrus sinensis]
Length=92

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 49/72 (68%), Gaps = 3/72 (4%)
 Frame = +2

Query  356  EKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHP-GGIQIPC  532
            E ++VP GHLAVYVGE E +  R VVPV Y  HP F NLL +AE  +GFDHP GG+ IPC
Sbjct  23   EASTVPKGHLAVYVGEIEKS--RFVVPVSYLKHPSFQNLLSQAEEEFGFDHPMGGLTIPC  80

Query  533  RISEFENVKSRI  568
                F ++ SR+
Sbjct  81   SEKVFMDLTSRL  92



>ref|XP_010664793.1| PREDICTED: auxin-induced protein 15A [Vitis vinifera]
 emb|CBI19838.3| unnamed protein product [Vitis vinifera]
Length=104

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 57/93 (61%), Gaps = 3/93 (3%)
 Frame = +2

Query  305  VKRDVRLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREA  484
            VK+ ++L  + +       A VP G+ AVYVGE +    R VVP+ Y NHP F +LL +A
Sbjct  13   VKQIMKLQPLAKNRLAAATADVPKGYFAVYVGENQKQ--RFVVPISYLNHPSFQDLLSQA  70

Query  485  ETVYGFDHP-GGIQIPCRISEFENVKSRIAADG  580
            E  +GFDHP GG+ IPC+I+ F  + SR+  + 
Sbjct  71   EEEFGFDHPMGGLTIPCKIANFIELTSRLQVNN  103



>ref|XP_003540900.2| PREDICTED: auxin-induced protein X10A-like [Glycine max]
Length=121

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 55/85 (65%), Gaps = 3/85 (4%)
 Frame = +2

Query  323  LIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGF  502
            ++   ++     K++VP GH+AVYVGE +    R VVP+ Y NHPLF +LL  AE  +GF
Sbjct  38   MVHAAKQTSSSFKSNVPKGHVAVYVGELQKK--RFVVPISYLNHPLFLDLLNRAEEEFGF  95

Query  503  DHP-GGIQIPCRISEFENVKSRIAA  574
            +HP GG+ IPC+   F N+ S++ A
Sbjct  96   NHPMGGLTIPCKEDAFINLTSQLRA  120



>emb|CDY42185.1| BnaC03g65060D [Brassica napus]
Length=66

 Score = 77.8 bits (190),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +2

Query  425  VVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCRISEFENVKSRIAADGDARRVR  598
            +VVPV YFNHPLF  LL   E VYGFD PG I IPCR+S+FE V+ RIAA   ++R R
Sbjct  1    MVVPVIYFNHPLFGELLEHKERVYGFDQPGRIMIPCRVSDFETVRMRIAAWDHSQRKR  58



>ref|XP_010251734.1| PREDICTED: auxin-induced protein X15-like [Nelumbo nucifera]
Length=115

 Score = 79.0 bits (193),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 47/74 (64%), Gaps = 1/74 (1%)
 Frame = +2

Query  356  EKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCR  535
            E   +P G+LA+ VG+ E    R V+P+FYFNHPLF  LL+EAE  YGFD  G I IPC 
Sbjct  27   EMRDIPKGYLAIMVGQGE-EQQRFVIPIFYFNHPLFMQLLKEAEDEYGFDQKGTITIPCH  85

Query  536  ISEFENVKSRIAAD  577
            + EF  V+  I  +
Sbjct  86   VEEFRYVQGIIDKE  99



>ref|NP_001047561.1| Os02g0643800 [Oryza sativa Japonica Group]
 dbj|BAD25785.1| auxin-responsive protein-like [Oryza sativa Japonica Group]
 dbj|BAF09475.1| Os02g0643800 [Oryza sativa Japonica Group]
 dbj|BAH01591.1| unnamed protein product [Oryza sativa Japonica Group]
Length=190

 Score = 80.9 bits (198),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 49/69 (71%), Gaps = 3/69 (4%)
 Frame = +2

Query  329  RVGQEPPGPEKASVPAGHLAVYVGEAE-GATCRVVVPVFYFNHPLFANLLREAETVYGFD  505
            R+ +E PG  +A+ P G +AVYVG  E G + R VVPV YFNHPLF  LLREAE  +GF 
Sbjct  99   RLLEESPG--EATTPKGQVAVYVGGGEPGESMRYVVPVVYFNHPLFGELLREAEEEFGFA  156

Query  506  HPGGIQIPC  532
            HPGGI IPC
Sbjct  157  HPGGITIPC  165



>gb|EAY86867.1| hypothetical protein OsI_08251 [Oryza sativa Indica Group]
Length=190

 Score = 80.9 bits (198),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 49/69 (71%), Gaps = 3/69 (4%)
 Frame = +2

Query  329  RVGQEPPGPEKASVPAGHLAVYVGEAE-GATCRVVVPVFYFNHPLFANLLREAETVYGFD  505
            R+ +E PG  +A+ P G +AVYVG  E G + R VVPV YFNHPLF  LLREAE  +GF 
Sbjct  99   RLLEESPG--EATTPKGQVAVYVGGGEPGESMRYVVPVVYFNHPLFGELLREAEEEFGFA  156

Query  506  HPGGIQIPC  532
            HPGGI IPC
Sbjct  157  HPGGITIPC  165



>ref|XP_004976373.1| PREDICTED: uncharacterized protein LOC101773025 [Setaria italica]
Length=167

 Score = 80.1 bits (196),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 44/63 (70%), Gaps = 1/63 (2%)
 Frame = +2

Query  365  SVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCRISE  544
            + P G +AVYVG  E A+ R VVPV YFNHP+F  LLREAE  +GF HPGGI IPC  + 
Sbjct  91   TTPKGQVAVYVGGGE-ASLRYVVPVVYFNHPMFGELLREAEEEFGFHHPGGITIPCPAAR  149

Query  545  FEN  553
            FE 
Sbjct  150  FEQ  152



>ref|XP_002320219.1| auxin-responsive family protein [Populus trichocarpa]
 gb|EEE98534.1| auxin-responsive family protein [Populus trichocarpa]
Length=110

 Score = 78.6 bits (192),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 44/68 (65%), Gaps = 1/68 (1%)
 Frame = +2

Query  365  SVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCRISE  544
             VP G LA+ VG+ E    R VVPV YFNHPLF  LL+EAE  YGFD  G I IPC + E
Sbjct  27   DVPKGCLAIKVGQGEEQQ-RFVVPVIYFNHPLFIQLLKEAEEEYGFDQKGTISIPCHVEE  85

Query  545  FENVKSRI  568
            F NV+  I
Sbjct  86   FRNVQGMI  93



>ref|XP_003627497.1| Auxin-induced protein 10A5 [Medicago truncatula]
 gb|ACJ85932.1| unknown [Medicago truncatula]
 gb|AET01973.1| SAUR-like auxin-responsive family protein [Medicago truncatula]
 gb|AFK33805.1| unknown [Medicago truncatula]
Length=108

 Score = 78.6 bits (192),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 46/76 (61%), Gaps = 1/76 (1%)
 Frame = +2

Query  356  EKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCR  535
            E   VP G +A+ VG  E    R VVPV YFNHPLF  LL+EAE  YGFD  G I IPC 
Sbjct  23   EFKGVPKGFMAIKVGLGEEQQ-RFVVPVMYFNHPLFIQLLKEAEEEYGFDQKGTITIPCH  81

Query  536  ISEFENVKSRIAADGD  583
            + EF NV+  I  D +
Sbjct  82   VEEFRNVRGLIDRDKN  97



>emb|CBI37960.3| unnamed protein product [Vitis vinifera]
Length=107

 Score = 78.2 bits (191),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 48/75 (64%), Gaps = 3/75 (4%)
 Frame = +2

Query  347  PGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHP-GGIQ  523
            P PE  +VP GH+ VYVGE E    R V+P+ Y  HP F NLL +AE  +GFDHP GG+ 
Sbjct  20   PSPESTNVPKGHVPVYVGETEKK--RFVIPISYLKHPSFQNLLSQAEEEFGFDHPLGGLT  77

Query  524  IPCRISEFENVKSRI  568
            IPCR   F ++  +I
Sbjct  78   IPCREEAFIDLTCKI  92



>gb|KDO42793.1| hypothetical protein CISIN_1g047919mg [Citrus sinensis]
Length=101

 Score = 78.2 bits (191),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 51/70 (73%), Gaps = 3/70 (4%)
 Frame = +2

Query  362  ASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHP-GGIQIPCRI  538
            A VP GH+AVYVGE E    R VVP+ Y NHPLFA+LL++AE  +GF+HP GG+ +PC+ 
Sbjct  30   AEVPKGHIAVYVGEMERK--RFVVPISYLNHPLFADLLKKAEEEFGFNHPMGGLTVPCKE  87

Query  539  SEFENVKSRI  568
             +F ++  R+
Sbjct  88   DDFIDLTYRL  97



>gb|KHN11782.1| Auxin-induced protein X10A [Glycine soja]
Length=172

 Score = 79.7 bits (195),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 55/92 (60%), Gaps = 2/92 (2%)
 Frame = +2

Query  338  QEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHP-G  514
            Q      K++VP GH+AVYV        R VVP+ Y NHPLF +LL  AE  +GF+HP G
Sbjct  17   QTSSSSFKSNVPKGHVAVYVVGELQKNKRFVVPISYLNHPLFLDLLNRAEEEFGFNHPLG  76

Query  515  GIQIPCRISEFENVKSRIAA-DGDARRVRRSW  607
            G+ IPC+   F N+ S+++    D R  +R+W
Sbjct  77   GLTIPCKEDAFINLTSQLSTLTLDLRLCKRNW  108



>ref|XP_004147006.1| PREDICTED: auxin-induced protein 10A5-like [Cucumis sativus]
 gb|KGN61866.1| hypothetical protein Csa_2G258620 [Cucumis sativus]
Length=97

 Score = 77.8 bits (190),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 50/71 (70%), Gaps = 3/71 (4%)
 Frame = +2

Query  359  KASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHP-GGIQIPCR  535
            K+ +P GH+AVYVGE +  T R VVP+ + NHP F NLL+ AE  +GF+HP GG+ IPCR
Sbjct  26   KSDIPKGHIAVYVGEIQ--TKRFVVPISFLNHPSFLNLLKRAEEEFGFNHPMGGLTIPCR  83

Query  536  ISEFENVKSRI  568
               F ++ SR+
Sbjct  84   EETFIDLTSRL  94



>ref|XP_010530798.1| PREDICTED: auxin-induced protein 15A [Tarenaya hassleriana]
Length=105

 Score = 78.2 bits (191),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 45/72 (63%), Gaps = 1/72 (1%)
 Frame = +2

Query  365  SVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHP-GGIQIPCRIS  541
            +VP GH+ VYVGE  G   R +VP+ Y NHPLF +LL  AE  YGFDHP GG+ IPC   
Sbjct  34   NVPKGHVGVYVGEKYGEKKRFMVPISYLNHPLFQDLLNLAEEEYGFDHPMGGLTIPCSED  93

Query  542  EFENVKSRIAAD  577
             F  + S ++  
Sbjct  94   HFTGIASALSGS  105



>ref|XP_008457625.1| PREDICTED: auxin-induced protein 15A-like [Cucumis melo]
Length=97

 Score = 77.8 bits (190),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 50/71 (70%), Gaps = 3/71 (4%)
 Frame = +2

Query  359  KASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHP-GGIQIPCR  535
            K+ VP GH+AVYVGE +  T R VVP+ + NHP F NLL+ AE  +GF+HP GG+ IPCR
Sbjct  26   KSDVPRGHIAVYVGEIQ--TKRFVVPISFLNHPSFLNLLKTAEEEFGFNHPMGGLTIPCR  83

Query  536  ISEFENVKSRI  568
               F ++ SR+
Sbjct  84   EETFIDLTSRL  94



>ref|XP_008457631.1| PREDICTED: auxin-induced protein 15A-like [Cucumis melo]
Length=97

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 54/86 (63%), Gaps = 3/86 (3%)
 Frame = +2

Query  314  DVRLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETV  493
              + I   Q   G  ++SVP GH+AVYVGE +    R +VP+ Y NHP F +LLR AE  
Sbjct  11   SAKQILKAQSISGRCQSSVPKGHIAVYVGEVQKT--RFLVPISYLNHPSFLDLLRRAEEE  68

Query  494  YGFDHP-GGIQIPCRISEFENVKSRI  568
            +GF+HP GG+ IPC+   F +V SR+
Sbjct  69   FGFNHPTGGLTIPCKEEAFIDVTSRL  94



>ref|XP_004505827.1| PREDICTED: auxin-induced protein X10A-like [Cicer arietinum]
Length=100

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 52/74 (70%), Gaps = 3/74 (4%)
 Frame = +2

Query  356  EKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHP-GGIQIPC  532
            ++++VP GH+AVYVGE +    R VVP+ Y NHP F +LL  AE  +GF+HP GG+ IPC
Sbjct  28   KQSNVPKGHMAVYVGELQKK--RFVVPISYLNHPSFLDLLNRAEEEFGFNHPMGGLTIPC  85

Query  533  RISEFENVKSRIAA  574
            +   F NV S+++A
Sbjct  86   KEDAFINVTSQLSA  99



>ref|XP_009765341.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana sylvestris]
Length=130

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 54/88 (61%), Gaps = 3/88 (3%)
 Frame = +2

Query  308  KRDVRLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAE  487
            K+ V+ +   Q      ++ VP GH AVYVGE E    R VVP+ Y NHP F NLLR+AE
Sbjct  43   KKRVKQMHKLQSIVTRNQSDVPKGHFAVYVGEKEKK--RYVVPITYLNHPSFQNLLRKAE  100

Query  488  TVYGFDHP-GGIQIPCRISEFENVKSRI  568
              +GF HP  G+ IPC  ++F +V SR+
Sbjct  101  EEFGFHHPTSGLTIPCNENDFVDVTSRL  128



>gb|AFK37533.1| unknown [Medicago truncatula]
 gb|AES72578.2| SAUR-like auxin-responsive family protein [Medicago truncatula]
Length=114

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 50/86 (58%), Gaps = 2/86 (2%)
 Frame = +2

Query  356  EKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCR  535
            +   +P G LAV VG+ E    + V+PV Y NHPLF  LL+EAE  YGFDH G I IPC+
Sbjct  29   KNKDIPKGCLAVMVGQGEEQQ-KFVIPVIYINHPLFMQLLKEAEEEYGFDHKGPIIIPCQ  87

Query  536  ISEFENVKSRIAADGDARRVRRSWSF  613
            + EF  V+  I  +  +     +W F
Sbjct  88   VEEFRTVQGMIDME-KSHHHHHAWCF  112



>ref|XP_003580232.1| PREDICTED: uncharacterized protein LOC100846166 [Brachypodium 
distachyon]
Length=177

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 50/82 (61%), Gaps = 1/82 (1%)
 Frame = +2

Query  290  RVLAVVKRDVRLIRVGQEPPGPEKASVPAGHLAVYVGEA-EGATCRVVVPVFYFNHPLFA  466
            R+L++ +RD     +     G E A  P G +AVYVG    G   R VVPV YFNHP+F 
Sbjct  74   RLLSLGRRDGGRRTLDGGGGGGEAAKTPKGQVAVYVGGGGPGEPLRYVVPVVYFNHPMFG  133

Query  467  NLLREAETVYGFDHPGGIQIPC  532
             LLREAE  +GF HPGGI IPC
Sbjct  134  ELLREAEEAFGFQHPGGITIPC  155



>ref|XP_006423557.1| hypothetical protein CICLE_v10030256mg [Citrus clementina]
 gb|ESR36797.1| hypothetical protein CICLE_v10030256mg [Citrus clementina]
Length=97

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 60/98 (61%), Gaps = 4/98 (4%)
 Frame = +2

Query  281  VGRRVLAVVKRDVRLI-RVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHP  457
            +G R+L+++    +++ R            VP GH+AVYVGE E    R VVP+ Y NHP
Sbjct  1    MGIRLLSMIHNAKQILKRHNNHALKSADQVVPRGHIAVYVGEMERK--RFVVPISYLNHP  58

Query  458  LFANLLREAETVYGFDHP-GGIQIPCRISEFENVKSRI  568
            LFA+LL  AE  +GF+HP GG+ IPC+   F ++ SR+
Sbjct  59   LFADLLNRAEEEFGFNHPMGGLTIPCKEDAFIDLTSRL  96



>emb|CAE03018.3| OSJNBa0091D06.3 [Oryza sativa Japonica Group]
Length=753

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 54/88 (61%), Gaps = 6/88 (7%)
 Frame = +2

Query  290  RVLAVVKRDVRLIRVGQEPPGPEKASVPAGHLAVYVGEAE-GATCRVVVPVFYFNHPLFA  466
            R L++ ++D    R+  EP      S P G +AVYVG    G + R VVPV YFNHP+F 
Sbjct  655  RRLSLGRKDGGRRRILDEP-----VSTPKGQVAVYVGGGNPGESLRYVVPVVYFNHPMFG  709

Query  467  NLLREAETVYGFDHPGGIQIPCRISEFE  550
             LLREAE  +GF HPGGI IPC  S FE
Sbjct  710  ELLREAEEEFGFQHPGGITIPCAASRFE  737



>ref|XP_011088768.1| PREDICTED: auxin-induced protein 15A-like [Sesamum indicum]
Length=108

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 45/68 (66%), Gaps = 1/68 (1%)
 Frame = +2

Query  368  VPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHP-GGIQIPCRISE  544
            VP GHLAVYVGE      R VVP+ Y  HPLF +LLR +E  YGFDHP GG+ IPC  + 
Sbjct  37   VPKGHLAVYVGENASKINRFVVPISYLKHPLFQDLLRSSEEEYGFDHPMGGLTIPCTENA  96

Query  545  FENVKSRI  568
            F +V S +
Sbjct  97   FRSVTSYL  104



>emb|CAN79758.1| hypothetical protein VITISV_009898 [Vitis vinifera]
Length=80

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 35/72 (49%), Positives = 50/72 (69%), Gaps = 3/72 (4%)
 Frame = +2

Query  356  EKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHP-GGIQIPC  532
            +++ VP GH AVYVG+ +    R VVP+ Y NHP F +LL++AE  +GFDHP GG+ IPC
Sbjct  8    QESDVPRGHFAVYVGDTQKK--RFVVPISYLNHPSFQDLLQQAEEEFGFDHPMGGLTIPC  65

Query  533  RISEFENVKSRI  568
            +   F ++ SR+
Sbjct  66   KEETFVDLASRL  77



>ref|XP_010086682.1| hypothetical protein L484_000889 [Morus notabilis]
 gb|EXB22714.1| hypothetical protein L484_000889 [Morus notabilis]
Length=103

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 48/82 (59%), Gaps = 3/82 (4%)
 Frame = +2

Query  329  RVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDH  508
            R G          VP GH AVYVGEAE    R V+P+ Y NHPLF +LL  AE  +GFDH
Sbjct  22   RYGTLVSATSTHDVPKGHFAVYVGEAEKK--RFVIPISYLNHPLFQDLLNRAEEEFGFDH  79

Query  509  P-GGIQIPCRISEFENVKSRIA  571
            P GG+ IPC    F ++ S ++
Sbjct  80   PTGGLSIPCSEDYFSSLTSALS  101



>ref|XP_010248164.1| PREDICTED: auxin-induced protein 15A-like [Nelumbo nucifera]
Length=97

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +2

Query  347  PGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHP-GGIQ  523
            P    A+VP GH+AVYVG+ +    R VVP+ Y +HP F +LL +AE  +GF HP GG+ 
Sbjct  21   PSTSTANVPKGHVAVYVGDLQTQKKRFVVPISYLSHPSFQDLLGQAEEEFGFHHPMGGLT  80

Query  524  IPCRISEFENVKSRIAA  574
            IPC+  +F ++ SR++ 
Sbjct  81   IPCKEDQFLHLTSRLSG  97



>ref|XP_004248873.1| PREDICTED: auxin-induced protein 15A-like [Solanum lycopersicum]
Length=95

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 47/71 (66%), Gaps = 3/71 (4%)
 Frame = +2

Query  362  ASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHP-GGIQIPCRI  538
            + VP GH AVYVGE E    R VVP+ Y NHP F  LLR++E  +GF HP GG+ IPC  
Sbjct  27   SDVPKGHFAVYVGETEKK--RYVVPITYLNHPSFQKLLRKSEEEFGFHHPMGGLTIPCNE  84

Query  539  SEFENVKSRIA  571
             +F N+ SR++
Sbjct  85   DDFFNITSRLS  95



>ref|XP_006423558.1| hypothetical protein CICLE_v10030013mg [Citrus clementina]
 gb|ESR36798.1| hypothetical protein CICLE_v10030013mg [Citrus clementina]
Length=101

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 51/70 (73%), Gaps = 3/70 (4%)
 Frame = +2

Query  362  ASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHP-GGIQIPCRI  538
            A VP GH+AVYVGE E    + VVP+ Y NHPLFA+LL++AE  +GF+HP GG+ +PC+ 
Sbjct  30   AEVPKGHIAVYVGEMERK--KFVVPISYLNHPLFADLLKKAEEEFGFNHPMGGLTVPCKE  87

Query  539  SEFENVKSRI  568
             +F ++  R+
Sbjct  88   DDFIDLTYRL  97



>ref|XP_004147010.1| PREDICTED: auxin-induced protein X10A-like [Cucumis sativus]
 ref|XP_004165224.1| PREDICTED: auxin-induced protein X10A-like [Cucumis sativus]
 gb|KGN61875.1| hypothetical protein Csa_2G258710 [Cucumis sativus]
Length=97

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 54/86 (63%), Gaps = 3/86 (3%)
 Frame = +2

Query  314  DVRLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETV  493
              + I   Q   G  ++SVP GH+AVYVGE +    R +VP+ Y NHP F +LLR AE  
Sbjct  11   SAKQILKAQSISGRCQSSVPKGHIAVYVGEIQKK--RFLVPISYLNHPSFLDLLRRAEEE  68

Query  494  YGFDHP-GGIQIPCRISEFENVKSRI  568
            +GF+HP GG+ IPC+   F +V SR+
Sbjct  69   FGFNHPTGGLTIPCKEEAFIDVTSRL  94



>ref|XP_007051462.1| SAUR-like auxin-responsive protein family [Theobroma cacao]
 gb|EOX95619.1| SAUR-like auxin-responsive protein family [Theobroma cacao]
Length=115

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 42/68 (62%), Gaps = 0/68 (0%)
 Frame = +2

Query  365  SVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCRISE  544
             VP G LA+ VG       R VVPV YFNHPLF  LL+EAE  YGFD  G I IPC + E
Sbjct  31   DVPKGCLAIKVGSLGEEQQRFVVPVIYFNHPLFMQLLKEAEEEYGFDQKGTITIPCHVEE  90

Query  545  FENVKSRI  568
            F NV+  I
Sbjct  91   FRNVRGLI  98



>ref|XP_009385180.1| PREDICTED: uncharacterized protein LOC103972549 [Musa acuminata 
subsp. malaccensis]
Length=144

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +2

Query  422  RVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCRISEFENVKSRIAADG  580
            R VVPV YFNHPLF  LL+EAE  +GF HPGGI IPC  +EFE V++R+AA G
Sbjct  78   RYVVPVIYFNHPLFGELLQEAEEEFGFHHPGGITIPCPAAEFERVRTRVAAAG  130



>emb|CDO96966.1| unnamed protein product [Coffea canephora]
Length=98

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 49/73 (67%), Gaps = 3/73 (4%)
 Frame = +2

Query  359  KASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHP-GGIQIPCR  535
            ++ VP GH AVYVGE E    R V+P+ Y NHP F +LLR+AE  +G+DHP GG+ IPC 
Sbjct  27   QSDVPKGHFAVYVGEMEKK--RFVLPISYLNHPTFQDLLRKAEEEFGYDHPMGGLTIPCN  84

Query  536  ISEFENVKSRIAA  574
               F ++ SR+ +
Sbjct  85   EDAFVDLTSRLNS  97



>ref|XP_004155191.1| PREDICTED: auxin-induced protein 15A-like [Cucumis sativus]
Length=111

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +2

Query  362  ASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCRIS  541
            A+VP G LAV VG+      R VVPV YFNHP F  LL+EAE  YGFD  G I IPC + 
Sbjct  12   ATVPKGCLAVKVGQKGEEQQRFVVPVMYFNHPRFMQLLKEAEEEYGFDQKGTIAIPCHVE  71

Query  542  EFENVKSRI  568
            EF +V+  I
Sbjct  72   EFRHVQGMI  80



>ref|XP_004133791.1| PREDICTED: auxin-induced protein 15A-like [Cucumis sativus]
 gb|KGN56389.1| hypothetical protein Csa_3G118740 [Cucumis sativus]
Length=111

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +2

Query  362  ASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCRIS  541
            A+VP G LAV VG+      R VVPV YFNHP F  LL+EAE  YGFD  G I IPC + 
Sbjct  12   ATVPKGCLAVKVGQKGEEQQRFVVPVMYFNHPRFMQLLKEAEEEYGFDQKGTIAIPCHVE  71

Query  542  EFENVKSRI  568
            EF +V+  I
Sbjct  72   EFRHVQGMI  80



>ref|XP_003602327.1| Auxin-induced protein 10A5 [Medicago truncatula]
Length=135

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 50/86 (58%), Gaps = 2/86 (2%)
 Frame = +2

Query  356  EKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCR  535
            +   +P G LAV VG+ E    + V+PV Y NHPLF  LL+EAE  YGFDH G I IPC+
Sbjct  50   KNKDIPKGCLAVMVGQGEEQQ-KFVIPVIYINHPLFMQLLKEAEEEYGFDHKGPIIIPCQ  108

Query  536  ISEFENVKSRIAADGDARRVRRSWSF  613
            + EF  V+  I  +  +     +W F
Sbjct  109  VEEFRTVQGMIDME-KSHHHHHAWCF  133



>ref|XP_010469007.1| PREDICTED: auxin-induced protein 15A-like [Camelina sativa]
Length=127

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 42/68 (62%), Gaps = 0/68 (0%)
 Frame = +2

Query  365  SVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCRISE  544
             VP G LA+ VG  E    R VVPVFYFNHPLF  LLREAE  YGF+  G I IPC +  
Sbjct  29   DVPKGCLAIKVGSKEEEKQRFVVPVFYFNHPLFMQLLREAEEEYGFEQKGTITIPCHVDV  88

Query  545  FENVKSRI  568
            F  V+  I
Sbjct  89   FRYVQDMI  96



>ref|XP_010246396.1| PREDICTED: auxin-induced protein 15A-like [Nelumbo nucifera]
Length=102

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 45/63 (71%), Gaps = 3/63 (5%)
 Frame = +2

Query  362  ASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHP-GGIQIPCRI  538
            A+VP GHLAVYVGEAE    R V+PV Y NHP F  LLR+AE  +GFDHP GG+ IPC+ 
Sbjct  32   ANVPKGHLAVYVGEAEKR--RFVIPVSYLNHPSFQELLRQAEEEFGFDHPMGGLTIPCKE  89

Query  539  SEF  547
              F
Sbjct  90   DTF  92



>gb|KHN06346.1| Auxin-induced protein 10A5 [Glycine soja]
Length=113

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 44/70 (63%), Gaps = 1/70 (1%)
 Frame = +2

Query  368  VPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCRISEF  547
            VP G +A+ VG+ E    R VVPV Y NHPLF  LL+EAE  YGFD  G I IPC + EF
Sbjct  29   VPKGCMAIKVGQGEEQQ-RFVVPVIYINHPLFMQLLKEAEEEYGFDQKGTITIPCHVEEF  87

Query  548  ENVKSRIAAD  577
             NV+  I  D
Sbjct  88   RNVRGLIDRD  97



>ref|XP_003528773.1| PREDICTED: auxin-induced protein 10A5-like [Glycine max]
Length=115

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 44/70 (63%), Gaps = 1/70 (1%)
 Frame = +2

Query  368  VPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCRISEF  547
            VP G +A+ VG+ E    R VVPV Y NHPLF  LL+EAE  YGFD  G I IPC + EF
Sbjct  29   VPKGCMAIKVGQGEEQQ-RFVVPVIYINHPLFMQLLKEAEEEYGFDQKGTITIPCHVEEF  87

Query  548  ENVKSRIAAD  577
             NV+  I  D
Sbjct  88   RNVRGLIDRD  97



>gb|AFK49405.1| unknown [Lotus japonicus]
Length=101

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 56/96 (58%), Gaps = 3/96 (3%)
 Frame = +2

Query  293  VLAVVKRDVRLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANL  472
            ++A  K+  +         G +++ VP GHLAVYVGE +    R VVP+ Y NHP F  L
Sbjct  8    MIAHAKQIFKFTSQHHLQSGTKQSDVPKGHLAVYVGELQKK--RFVVPISYLNHPSFLAL  65

Query  473  LREAETVYGFDHP-GGIQIPCRISEFENVKSRIAAD  577
            L  AE  +GF+HP GG+ IPC+   F N+ S++ A 
Sbjct  66   LNRAEEEFGFNHPMGGLTIPCKEDAFINLTSQLRAS  101



>ref|XP_002271501.1| PREDICTED: auxin-induced protein X15 [Vitis vinifera]
Length=95

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 48/75 (64%), Gaps = 3/75 (4%)
 Frame = +2

Query  347  PGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHP-GGIQ  523
            P PE  +VP GH+ VYVGEA+    R V+P+ Y  HP F NLL +AE  +GFDHP GG+ 
Sbjct  20   PSPESTNVPKGHVPVYVGEAQKK--RFVIPISYLKHPSFQNLLSQAEEEFGFDHPLGGLT  77

Query  524  IPCRISEFENVKSRI  568
            IPCR   F ++   +
Sbjct  78   IPCREEAFIDLTCSL  92



>ref|XP_006350722.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Solanum 
tuberosum]
Length=122

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 50/89 (56%), Gaps = 4/89 (4%)
 Frame = +2

Query  356  EKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCR  535
            E   +P G LA+ VG+ E    R V+PV Y NHPLF  LL+EAE  YGFDH G I IPC 
Sbjct  33   ELKDIPKGCLAITVGQGEEQQ-RFVIPVIYINHPLFMQLLKEAEEEYGFDHNGPINIPCH  91

Query  536  ISEFENVKSRIAADGDARRVRRS---WSF  613
            I EF +V+  I  +  ++        W F
Sbjct  92   IEEFRHVQGIIDKETTSQHQHTHNNPWCF  120



>emb|CAN62606.1| hypothetical protein VITISV_016867 [Vitis vinifera]
Length=75

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 37/74 (50%), Positives = 49/74 (66%), Gaps = 3/74 (4%)
 Frame = +2

Query  353  PEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHP-GGIQIP  529
            P  A+VP GH AVYVGE++    R V+P+ Y NHPLF +LL  AE  +GFDHP GG+ IP
Sbjct  2    PPTANVPKGHFAVYVGESQKK--RFVIPISYLNHPLFQDLLHRAEEEFGFDHPMGGLTIP  59

Query  530  CRISEFENVKSRIA  571
            C    F ++ S ++
Sbjct  60   CSEDYFISLTSHLS  73



>ref|XP_006444768.1| hypothetical protein CICLE_v10022948mg [Citrus clementina]
 ref|XP_006444769.1| hypothetical protein CICLE_v10022948mg [Citrus clementina]
 ref|XP_006491342.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like isoform 
X1 [Citrus sinensis]
 ref|XP_006491343.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like isoform 
X2 [Citrus sinensis]
 gb|ESR58008.1| hypothetical protein CICLE_v10022948mg [Citrus clementina]
 gb|ESR58009.1| hypothetical protein CICLE_v10022948mg [Citrus clementina]
 gb|KDO86568.1| hypothetical protein CISIN_1g033760mg [Citrus sinensis]
 gb|KDO86569.1| hypothetical protein CISIN_1g033760mg [Citrus sinensis]
Length=112

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 44/68 (65%), Gaps = 1/68 (1%)
 Frame = +2

Query  365  SVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCRISE  544
             VP G LA+ VG+ E    RVVVPV YFNHPLF  LL+EAE  YGFD  G I IPC + E
Sbjct  29   DVPKGCLAIKVGQGEEQQ-RVVVPVIYFNHPLFMQLLKEAEEEYGFDQKGTITIPCHVEE  87

Query  545  FENVKSRI  568
            F  V+  I
Sbjct  88   FRYVQGMI  95



>ref|NP_191749.1| SAUR-like auxin-responsive protein [Arabidopsis thaliana]
 emb|CAB71897.1| putative protein [Arabidopsis thaliana]
 gb|AEE80277.1| SAUR-like auxin-responsive protein [Arabidopsis thaliana]
Length=136

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 42/68 (62%), Gaps = 0/68 (0%)
 Frame = +2

Query  365  SVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCRISE  544
             VP G LA+ VG  E    R VVPVFYFNHPLF  LLREAE  YGF+  G I IPC +  
Sbjct  29   DVPKGCLAIKVGSKEEEKQRFVVPVFYFNHPLFMQLLREAEEEYGFEQKGTITIPCHVEV  88

Query  545  FENVKSRI  568
            F  V+  I
Sbjct  89   FRYVQDMI  96



>ref|NP_001151006.1| SAUR11 - auxin-responsive SAUR family member [Zea mays]
 gb|ACG41253.1| SAUR11 - auxin-responsive SAUR family member [Zea mays]
Length=202

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 43/63 (68%), Gaps = 1/63 (2%)
 Frame = +2

Query  362  ASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCRIS  541
            A+ P G +AVYV    G + R VVPV YFNHPLF  LLREAE  +GF HPGGI IPC  S
Sbjct  118  ATTPKGQVAVYV-VGGGESMRYVVPVVYFNHPLFGELLREAEEEFGFQHPGGITIPCAAS  176

Query  542  EFE  550
             FE
Sbjct  177  RFE  179



>ref|XP_002276058.2| PREDICTED: auxin-induced protein X15 [Vitis vinifera]
 emb|CAN65270.1| hypothetical protein VITISV_040137 [Vitis vinifera]
Length=95

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 47/75 (63%), Gaps = 3/75 (4%)
 Frame = +2

Query  347  PGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHP-GGIQ  523
            P PE  +VP GH+ VYVGE E    R V+P+ Y  HP F NLL +AE  +GFDHP GG+ 
Sbjct  20   PSPESTNVPKGHVPVYVGETEKK--RFVIPISYLKHPSFQNLLSQAEEEFGFDHPLGGLT  77

Query  524  IPCRISEFENVKSRI  568
            IPCR   F ++   +
Sbjct  78   IPCREEAFIDLTCSL  92



>ref|XP_006838622.1| hypothetical protein AMTR_s00002p00232820 [Amborella trichopoda]
 gb|ERN01191.1| hypothetical protein AMTR_s00002p00232820 [Amborella trichopoda]
Length=173

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 64/100 (64%), Gaps = 7/100 (7%)
 Frame = +2

Query  281  VGRRVLA-VVKRDVRLIRVGQEPPGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHP  457
            +G+ +L+  VKR++R     +E    +  ++P G+L VY G+ +    R +VPV Y NHP
Sbjct  72   MGKTLLSGFVKREIR-----EEGSVCKGKTIPKGYLVVYAGQRDDDH-RFLVPVVYCNHP  125

Query  458  LFANLLREAETVYGFDHPGGIQIPCRISEFENVKSRIAAD  577
            LF  LL EAE  YG++  GG+ IPC + EFE VK++IA++
Sbjct  126  LFGKLLEEAEEEYGYNSSGGLIIPCGVPEFECVKTKIASE  165



>ref|XP_004144912.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Cucumis 
sativus]
Length=128

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 52/82 (63%), Gaps = 8/82 (10%)
 Frame = +2

Query  365  SVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHP-GGIQIPCRIS  541
            +VP GH AVYVGE +    R VVP++Y NHPLF +LL  AE  +GFDHP GG+ IPC   
Sbjct  33   NVPKGHFAVYVGETQKK--RFVVPIWYLNHPLFKDLLNLAEEEFGFDHPMGGLTIPCTED  90

Query  542  EFENVKSRI-----AADGDARR  592
             F ++ S++     A  GD RR
Sbjct  91   YFISLTSKVENRSAAYGGDCRR  112



>ref|XP_007135297.1| hypothetical protein PHAVU_010G117500g [Phaseolus vulgaris]
 gb|ESW07291.1| hypothetical protein PHAVU_010G117500g [Phaseolus vulgaris]
Length=108

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 44/70 (63%), Gaps = 1/70 (1%)
 Frame = +2

Query  368  VPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCRISEF  547
            VP G +A+ VG+ E    R VVPV Y NHPLF  LL+EAE  YGFD  G I IPC + EF
Sbjct  26   VPKGCMAIKVGQGEEQQ-RFVVPVMYINHPLFMQLLKEAEEEYGFDQKGTITIPCHVEEF  84

Query  548  ENVKSRIAAD  577
             NV+  I  D
Sbjct  85   RNVRGLIDRD  94



>ref|XP_008343461.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Malus 
domestica]
Length=123

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 44/68 (65%), Gaps = 1/68 (1%)
 Frame = +2

Query  365  SVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCRISE  544
             VP G LA+ VG+ E    R VVPV YFNHPLF  LL+EAE  YGFD  G I IPC + E
Sbjct  34   DVPKGCLAIKVGQGEEQQ-RFVVPVIYFNHPLFIQLLKEAEEEYGFDQKGTITIPCHVEE  92

Query  545  FENVKSRI  568
            F +V+  I
Sbjct  93   FRSVQGMI  100



>emb|CDX76596.1| BnaC08g31820D [Brassica napus]
Length=119

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 43/68 (63%), Gaps = 0/68 (0%)
 Frame = +2

Query  365  SVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCRISE  544
             VP G LA+ VG  E    R VVP+FYFNHPLF  LL+EAE  YGF+  G I IPC +  
Sbjct  26   DVPKGCLAIKVGSREEEKQRFVVPIFYFNHPLFMQLLKEAEEEYGFEQKGTITIPCHVEV  85

Query  545  FENVKSRI  568
            F  V+ +I
Sbjct  86   FRYVQDKI  93



>emb|CBI37949.3| unnamed protein product [Vitis vinifera]
Length=87

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 38/73 (52%), Positives = 48/73 (66%), Gaps = 3/73 (4%)
 Frame = +2

Query  359  KASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHP-GGIQIPCR  535
            ++SVP GH AVYVGE +    R VVP+ Y NHP F +LL  AE  +GFDHP GG+ IPC 
Sbjct  13   QSSVPKGHCAVYVGEIQKK--RFVVPISYLNHPAFQDLLHLAEEEFGFDHPMGGLTIPCE  70

Query  536  ISEFENVKSRIAA  574
               F ++ SR+ A
Sbjct  71   EDAFIDLTSRLNA  83



>ref|XP_010544871.1| PREDICTED: auxin-induced protein 15A-like [Tarenaya hassleriana]
Length=123

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 45/68 (66%), Gaps = 1/68 (1%)
 Frame = +2

Query  365  SVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCRISE  544
             VP G LA+ VG+ E    R++VPV YFNHPLF  LL+EAE  YGF+  G I IPC + E
Sbjct  28   DVPKGCLAIKVGQGEEQQ-RIIVPVVYFNHPLFMQLLKEAEEEYGFEQKGTITIPCHVEE  86

Query  545  FENVKSRI  568
            F  V+S I
Sbjct  87   FRYVQSMI  94



>gb|KHN15899.1| Auxin-induced protein 10A5 [Glycine soja]
Length=116

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 44/70 (63%), Gaps = 1/70 (1%)
 Frame = +2

Query  368  VPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHPGGIQIPCRISEF  547
            VP G +A+ VG+ E    R VVPV Y NHPLF  LL+EAE  YGFD  G I IPC + EF
Sbjct  32   VPKGCMAIKVGQGEEQQ-RFVVPVIYINHPLFMQLLKEAEEEYGFDQKGTITIPCHVEEF  90

Query  548  ENVKSRIAAD  577
             NV+  I  D
Sbjct  91   RNVRGLIDRD  100



>emb|CBI37962.3| unnamed protein product [Vitis vinifera]
Length=136

 Score = 77.0 bits (188),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 45/68 (66%), Gaps = 3/68 (4%)
 Frame = +2

Query  347  PGPEKASVPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHP-GGIQ  523
            P PE  +VP GH+ VYVGEA+    R V+P+ Y  HP F NLL +AE  +GFDHP GG+ 
Sbjct  20   PSPESTNVPKGHVPVYVGEAQKK--RFVIPISYLKHPSFQNLLSQAEEEFGFDHPLGGLT  77

Query  524  IPCRISEF  547
            IPCR   F
Sbjct  78   IPCREEAF  85



>gb|KDO42792.1| hypothetical protein CISIN_1g040932mg [Citrus sinensis]
Length=97

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 48/68 (71%), Gaps = 3/68 (4%)
 Frame = +2

Query  368  VPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETVYGFDHP-GGIQIPCRISE  544
            VP GH+AVYVGE E    R VVP+ Y NHPLFA+LL  AE  +GF+HP GG+ IPC+   
Sbjct  31   VPRGHIAVYVGEMERK--RFVVPISYLNHPLFADLLNRAEEEFGFNHPMGGLTIPCKEDA  88

Query  545  FENVKSRI  568
            F ++ SR+
Sbjct  89   FIDLTSRL  96



>emb|CDY17486.1| BnaC03g65770D [Brassica napus]
Length=95

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 48/79 (61%), Gaps = 2/79 (3%)
 Frame = +2

Query  317  VRLIRVGQEPPGPEKAS-VPAGHLAVYVGEAEGATCRVVVPVFYFNHPLFANLLREAETV  493
            +RL RV       ++ S VP GH+AVYVGE      R VVP+ Y NHPLF  LL  AE  
Sbjct  4    IRLSRVTNSKQSQKQQSRVPKGHVAVYVGEEMENNKRFVVPISYLNHPLFQGLLNRAEEE  63

Query  494  YGFDHP-GGIQIPCRISEF  547
            +GF+HP GG+ IPCR   F
Sbjct  64   FGFNHPVGGLTIPCREETF  82



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1535292905272