BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c757_g1_i1 len=340 path=[1441:0-339]

Length=340
                                                                      Score     E

ref|XP_009625579.1|  PREDICTED: transcription factor LHW isoform X1     155   3e-41   
ref|XP_009625580.1|  PREDICTED: transcription factor LHW isoform X2     155   3e-41   
ref|XP_009804415.1|  PREDICTED: transcription factor LHW-like iso...    145   1e-37   
ref|XP_009804416.1|  PREDICTED: transcription factor LHW-like iso...    145   2e-37   
ref|XP_006361093.1|  PREDICTED: transcription factor LHW-like           144   2e-37   
ref|XP_006362846.1|  PREDICTED: transcription factor LHW-like           144   2e-37   
ref|XP_004251101.1|  PREDICTED: transcription factor LHW-like           144   4e-37   
ref|XP_010322443.1|  PREDICTED: transcription factor LHW-like iso...    140   8e-36   
ref|XP_004242114.1|  PREDICTED: transcription factor LHW-like iso...    139   1e-35   
ref|XP_009629479.1|  PREDICTED: transcription factor LHW-like           136   2e-34   
ref|XP_011088969.1|  PREDICTED: transcription factor LHW                133   3e-33   
ref|XP_009760053.1|  PREDICTED: transcription factor LHW-like           132   4e-33   
emb|CDP15550.1|  unnamed protein product                                131   2e-32   
ref|XP_002513717.1|  expressed protein, putative                        129   5e-32   Ricinus communis
ref|XP_009368308.1|  PREDICTED: transcription factor LHW-like           128   2e-31   
ref|XP_009337709.1|  PREDICTED: transcription factor LHW-like           127   3e-31   
ref|XP_007208256.1|  hypothetical protein PRUPE_ppa016557mg             125   2e-30   
ref|XP_006424092.1|  hypothetical protein CICLE_v10029797mg             124   3e-30   
gb|KDO46593.1|  hypothetical protein CISIN_1g036631mg                   124   3e-30   
ref|XP_010089791.1|  hypothetical protein L484_022306                   124   5e-30   
ref|XP_006494896.1|  PREDICTED: transcription factor LHW-like           122   1e-29   
ref|XP_011090482.1|  PREDICTED: transcription factor LHW-like           122   2e-29   
ref|XP_008361584.1|  PREDICTED: transcription factor LHW-like iso...    120   1e-28   
ref|XP_008230230.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    120   1e-28   
ref|XP_008361589.1|  PREDICTED: transcription factor LHW-like iso...    120   1e-28   
emb|CAN76581.1|  hypothetical protein VITISV_034321                     119   3e-28   Vitis vinifera
emb|CBI24427.3|  unnamed protein product                                118   5e-28   
ref|XP_002274971.1|  PREDICTED: transcription factor LHW-like iso...    118   5e-28   Vitis vinifera
ref|XP_004293110.1|  PREDICTED: transcription factor LHW-like           117   1e-27   
ref|XP_009373890.1|  PREDICTED: transcription factor LHW-like iso...    116   2e-27   
ref|XP_009373889.1|  PREDICTED: transcription factor LHW-like iso...    116   2e-27   
gb|KDP23204.1|  hypothetical protein JCGZ_00320                         116   3e-27   
ref|XP_011021434.1|  PREDICTED: transcription factor LHW-like iso...    115   7e-27   
ref|XP_011021433.1|  PREDICTED: transcription factor LHW-like iso...    115   7e-27   
ref|XP_006592778.1|  PREDICTED: transcription factor LHW-like iso...    114   2e-26   
gb|KEH29770.1|  bHLH transcription factor-like protein                  111   1e-25   
ref|XP_010031564.1|  PREDICTED: transcription factor LHW-like iso...    110   2e-25   
ref|XP_010031563.1|  PREDICTED: transcription factor LHW-like iso...    110   2e-25   
gb|KCW50923.1|  hypothetical protein EUGRSUZ_J00573                     110   2e-25   
ref|XP_004506222.1|  PREDICTED: transcription factor LHW-like           110   2e-25   
ref|XP_003541959.2|  PREDICTED: transcription factor LHW-like iso...    110   3e-25   
ref|XP_003540817.1|  PREDICTED: transcription factor LHW-like           110   3e-25   
gb|KHN21191.1|  Putative basic helix-loop-helix protein                 110   4e-25   
ref|XP_010685440.1|  PREDICTED: transcription factor LHW-like           108   2e-24   
gb|KHN36498.1|  Putative basic helix-loop-helix protein                 108   2e-24   
ref|XP_003539152.1|  PREDICTED: transcription factor LHW-like           107   2e-24   
gb|KHN19923.1|  Putative basic helix-loop-helix protein                 107   3e-24   
ref|XP_002298267.2|  transcription factor-related family protein        106   3e-24   Populus trichocarpa [western balsam poplar]
ref|XP_004139141.1|  PREDICTED: transcription factor LHW-like           107   5e-24   
ref|XP_006408683.1|  hypothetical protein EUTSA_v10001928mg             105   1e-23   
ref|XP_007015676.1|  Transcription factor-related, putative isofo...    104   3e-23   
ref|XP_007015675.1|  Transcription factor-related, putative isofo...    104   3e-23   
dbj|BAH19848.1|  AT2G27230                                              103   3e-23   Arabidopsis thaliana [mouse-ear cress]
ref|NP_565640.1|  transcription factor LHW                              103   3e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007132495.1|  hypothetical protein PHAVU_011G098900g             103   7e-23   
gb|KHG29075.1|  hypothetical protein F383_03858                         103   9e-23   
ref|XP_002879076.1|  hypothetical protein ARALYDRAFT_481620             102   1e-22   
gb|KHG26450.1|  hypothetical protein F383_09948                         102   1e-22   
ref|XP_007150023.1|  hypothetical protein PHAVU_005G119400g             102   2e-22   
ref|XP_010247149.1|  PREDICTED: transcription factor LHW-like iso...    102   2e-22   
ref|XP_010247158.1|  PREDICTED: transcription factor LHW-like iso...    102   2e-22   
ref|XP_004487450.1|  PREDICTED: transcription factor LHW-like iso...    102   2e-22   
ref|XP_003596884.1|  Transcription factor ABA-INDUCIBLE bHLH-TYPE     98.6    3e-22   
ref|XP_006293814.1|  hypothetical protein CARUB_v10022796mg             100   5e-22   
ref|XP_008450293.1|  PREDICTED: transcription factor LHW isoform X2     100   5e-22   
ref|XP_008450292.1|  PREDICTED: transcription factor LHW isoform X1     100   6e-22   
ref|XP_010417875.1|  PREDICTED: transcription factor LHW-like         99.8    1e-21   
ref|XP_010510793.1|  PREDICTED: transcription factor LHW-like iso...  99.8    1e-21   
ref|XP_010473116.1|  PREDICTED: transcription factor LHW              99.4    1e-21   
ref|XP_010263009.1|  PREDICTED: transcription factor LHW-like         99.8    2e-21   
gb|KEH38995.1|  bHLH transcription factor-like protein                98.6    3e-21   
ref|XP_010557442.1|  PREDICTED: transcription factor LHW-like iso...  97.4    7e-21   
emb|CDX77102.1|  BnaC04g38970D                                        97.1    8e-21   
ref|XP_009140783.1|  PREDICTED: transcription factor LHW              97.1    9e-21   
emb|CDY30564.1|  BnaA04g15690D                                        96.7    1e-20   
emb|CDX71466.1|  BnaC04g17010D                                        95.5    3e-20   
gb|EYU28511.1|  hypothetical protein MIMGU_mgv1a003404mg              95.1    3e-20   
gb|KFK33154.1|  hypothetical protein AALP_AA6G337700                  94.0    9e-20   
ref|XP_010045177.1|  PREDICTED: transcription factor LHW-like iso...  94.4    1e-19   
ref|XP_011003843.1|  PREDICTED: transcription factor LHW-like         92.0    8e-19   
ref|XP_011010233.1|  PREDICTED: transcription factor LHW-like         92.0    9e-19   
ref|XP_008338600.1|  PREDICTED: transcription factor LHW              85.9    1e-18   
ref|XP_010544333.1|  PREDICTED: transcription factor LHW-like         88.2    9e-18   
ref|XP_010510794.1|  PREDICTED: transcription factor LHW-like iso...  87.8    1e-17   
ref|XP_006378984.1|  hypothetical protein POPTR_0009s02270g           83.6    6e-16   
ref|XP_010523120.1|  PREDICTED: transcription factor LHW              82.8    8e-16   
gb|EPS58801.1|  hypothetical protein M569_16013                       76.6    3e-15   
gb|KEH29771.1|  bHLH transcription factor-like protein                81.3    4e-15   
gb|EPS62250.1|  hypothetical protein M569_12543                       73.2    3e-14   
ref|XP_010031562.1|  PREDICTED: transcription factor LHW-like iso...  74.3    5e-14   
ref|XP_009103583.1|  PREDICTED: transcription factor LHW-like         76.6    1e-13   
ref|XP_010031561.1|  PREDICTED: transcription factor LHW-like iso...  73.6    1e-13   
gb|ABA91568.2|  expressed protein                                     75.1    6e-13   Oryza sativa Japonica Group [Japonica rice]
emb|CDY04483.1|  BnaA07g13090D                                        73.9    1e-12   
ref|XP_006662753.1|  PREDICTED: transcription factor LHW-like         73.9    1e-12   
gb|EAY82345.1|  hypothetical protein OsI_37555                        73.6    2e-12   Oryza sativa Indica Group [Indian rice]
ref|NP_001066215.1|  Os12g0160400                                     73.6    2e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002441863.1|  hypothetical protein SORBIDRAFT_08g003770        73.2    3e-12   Sorghum bicolor [broomcorn]
ref|XP_004977333.1|  PREDICTED: transcription factor LHW-like         72.8    3e-12   
gb|AFW56113.1|  putative HLH DNA-binding domain superfamily protein   72.0    5e-12   
ref|XP_008674451.1|  PREDICTED: transcription factor LHW-like iso...  71.6    6e-12   
ref|XP_008674450.1|  PREDICTED: transcription factor LHW-like iso...  72.0    7e-12   
ref|XP_006664356.1|  PREDICTED: transcription factor LHW-like         71.6    8e-12   
ref|XP_008662493.1|  PREDICTED: transcription factor LHW-like         71.6    8e-12   
ref|XP_008674454.1|  PREDICTED: transcription factor LHW-like iso...  71.2    9e-12   
ref|XP_010238692.1|  PREDICTED: transcription factor LHW isoform X2   70.9    1e-11   
dbj|BAK06575.1|  predicted protein                                    70.9    2e-11   
gb|EMT30779.1|  Putative basic helix-loop-helix protein               70.9    2e-11   
ref|XP_006594923.1|  PREDICTED: transcription factor LHW-like iso...  70.5    2e-11   
ref|XP_003578882.1|  PREDICTED: transcription factor LHW isoform X1   70.5    2e-11   
ref|XP_010912385.1|  PREDICTED: uncharacterized protein LOC105038...  70.1    3e-11   
gb|ABA96530.2|  expressed protein                                     69.7    3e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010912384.1|  PREDICTED: uncharacterized protein LOC105038...  69.7    4e-11   
ref|XP_006646502.1|  PREDICTED: transcription factor LHW-like         69.7    4e-11   
ref|XP_010912383.1|  PREDICTED: uncharacterized protein LOC105038...  69.7    4e-11   
dbj|BAK00701.1|  predicted protein                                    69.7    4e-11   
ref|XP_008784115.1|  PREDICTED: transcription factor LHW-like         69.3    5e-11   
ref|XP_004978745.1|  PREDICTED: transcription factor LHW-like         68.6    8e-11   
gb|EMT30797.1|  Putative basic helix-loop-helix protein               67.4    2e-10   
gb|AFW65580.1|  putative HLH DNA-binding domain superfamily protein   67.4    2e-10   
ref|XP_008799711.1|  PREDICTED: transcription factor LHW-like         67.0    3e-10   
ref|XP_008679687.1|  PREDICTED: transcription factor LHW              65.1    1e-09   
ref|XP_002449032.1|  hypothetical protein SORBIDRAFT_05g003740        64.7    2e-09   Sorghum bicolor [broomcorn]
gb|EEE55720.1|  hypothetical protein OsJ_04192                        64.7    2e-09   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA39099.1|  TPA: putative HLH DNA-binding domain superfamily...  64.7    2e-09   
gb|EAY76601.1|  hypothetical protein OsI_04550                        63.5    4e-09   Oryza sativa Indica Group [Indian rice]
ref|NP_001044899.2|  Os01g0865600                                     63.5    4e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009420898.1|  PREDICTED: transcription factor LHW-like         63.5    5e-09   
ref|XP_010931062.1|  PREDICTED: transcription factor LHW-like         62.8    9e-09   
ref|XP_008448575.1|  PREDICTED: uncharacterized protein LOC103490712  61.2    2e-08   
ref|XP_004146200.1|  PREDICTED: transcription factor bHLH157-like     61.2    2e-08   
ref|XP_010247165.1|  PREDICTED: transcription factor LHW-like iso...  61.2    3e-08   
ref|XP_010920505.1|  PREDICTED: transcription factor bHLH155 isof...  56.6    7e-07   
ref|XP_010920506.1|  PREDICTED: transcription factor bHLH155 isof...  56.6    8e-07   
gb|KHG17321.1|  hypothetical protein F383_21887                       56.6    1e-06   
ref|XP_011080299.1|  PREDICTED: transcription factor EMB1444          56.2    1e-06   
ref|XP_006854628.1|  hypothetical protein AMTR_s00030p00176130        56.2    1e-06   
gb|KDP25239.1|  hypothetical protein JCGZ_20395                       56.2    1e-06   
ref|XP_006846364.1|  hypothetical protein AMTR_s00012p00261730        54.7    3e-06   
ref|XP_009612748.1|  PREDICTED: transcription factor bHLH155-like...  54.7    4e-06   
ref|XP_009612747.1|  PREDICTED: transcription factor bHLH155-like...  54.7    4e-06   
gb|EYU36027.1|  hypothetical protein MIMGU_mgv1a020569mg              53.9    4e-06   
ref|XP_008801631.1|  PREDICTED: transcription factor bHLH155-like...  54.3    5e-06   
ref|XP_008801630.1|  PREDICTED: transcription factor EMB1444-like...  54.3    5e-06   
ref|XP_007144920.1|  hypothetical protein PHAVU_007G194600g           54.3    5e-06   
ref|XP_008801632.1|  PREDICTED: transcription factor EMB1444-like...  54.3    5e-06   
ref|XP_007144919.1|  hypothetical protein PHAVU_007G194600g           54.3    5e-06   
ref|XP_006368796.1|  hypothetical protein POPTR_0001s11170g           53.9    8e-06   
ref|XP_002299440.2|  hypothetical protein POPTR_0001s11170g           53.5    8e-06   Populus trichocarpa [western balsam poplar]
ref|XP_006606416.1|  PREDICTED: transcription factor bHLH157-like     53.1    1e-05   
gb|KHN05001.1|  Putative basic helix-loop-helix protein               53.1    1e-05   
ref|XP_011070366.1|  PREDICTED: transcription factor LHW isoform X1   52.8    2e-05   
ref|XP_011026816.1|  PREDICTED: transcription factor LHW              52.4    2e-05   
ref|XP_002459194.1|  hypothetical protein SORBIDRAFT_02g000310        52.4    3e-05   Sorghum bicolor [broomcorn]
ref|XP_008390304.1|  PREDICTED: transcription factor bHLH157-like     52.0    3e-05   
ref|XP_010106138.1|  hypothetical protein L484_003641                 52.0    3e-05   
ref|XP_006343800.1|  PREDICTED: transcription factor bHLH157-like     51.6    3e-05   
ref|XP_011006385.1|  PREDICTED: transcription factor EMB1444-like...  51.6    4e-05   
ref|XP_011006384.1|  PREDICTED: transcription factor EMB1444-like...  51.6    4e-05   
ref|XP_009359586.1|  PREDICTED: transcription factor EMB1444-like     51.6    4e-05   
ref|NP_001047714.1|  Os02g0673500                                     51.6    4e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010262289.1|  PREDICTED: transcription factor EMB1444-like...  51.6    4e-05   
gb|KFK32958.1|  hypothetical protein AALP_AA6G311800                  51.2    4e-05   
ref|XP_006589237.1|  PREDICTED: transcription factor bHLH155-like...  51.6    4e-05   
ref|XP_006589236.1|  PREDICTED: transcription factor bHLH155-like...  51.6    4e-05   
ref|XP_009773770.1|  PREDICTED: transcription factor bHLH155-like...  51.2    5e-05   
ref|XP_009773769.1|  PREDICTED: transcription factor bHLH155-like...  51.2    5e-05   
ref|XP_011094905.1|  PREDICTED: transcription factor LHW-like         50.8    6e-05   
ref|XP_010267508.1|  PREDICTED: transcription factor EMB1444-like...  50.8    7e-05   
ref|XP_010679225.1|  PREDICTED: transcription factor EMB1444          50.4    9e-05   
emb|CDY61366.1|  BnaA09g53110D                                        50.4    9e-05   
ref|XP_007039441.1|  Serine/threonine-protein kinase WNK-related,...  50.4    9e-05   
ref|XP_007039440.1|  Serine/threonine-protein kinase WNK-related,...  50.1    1e-04   
ref|XP_007039438.1|  Serine/threonine-protein kinase WNK-related,...  50.1    1e-04   
tpg|DAA59302.1|  TPA: putative HLH DNA-binding domain superfamily...  50.1    1e-04   
ref|XP_008651889.1|  PREDICTED: transcription factor EMB1444-like     50.1    1e-04   
ref|XP_002303679.1|  hypothetical protein POPTR_0003s14480g           50.1    1e-04   Populus trichocarpa [western balsam poplar]
ref|XP_002309084.1|  hypothetical protein POPTR_0006s09100g           49.7    2e-04   Populus trichocarpa [western balsam poplar]
ref|XP_010252756.1|  PREDICTED: uncharacterized protein LOC104594...  49.7    2e-04   
ref|XP_010252749.1|  PREDICTED: uncharacterized protein LOC104594...  49.7    2e-04   
ref|XP_010228486.1|  PREDICTED: transcription factor EMB1444-like...  49.3    2e-04   
ref|XP_010228485.1|  PREDICTED: transcription factor EMB1444-like...  49.3    2e-04   
ref|XP_010043993.1|  PREDICTED: transcription factor bHLH155-like...  49.3    2e-04   
ref|XP_010262290.1|  PREDICTED: transcription factor EMB1444-like...  49.3    2e-04   
ref|XP_010043995.1|  PREDICTED: transcription factor LHW-like iso...  48.9    2e-04   
ref|XP_010043994.1|  PREDICTED: transcription factor bHLH155-like...  49.3    2e-04   
ref|XP_008239218.1|  PREDICTED: transcription factor bHLH157          48.5    4e-04   
emb|CBI34563.3|  unnamed protein product                              48.5    4e-04   
ref|XP_010659858.1|  PREDICTED: transcription factor LHW              48.5    4e-04   
ref|XP_009358669.1|  PREDICTED: transcription factor bHLH155-like     48.5    4e-04   
gb|EEC81367.1|  hypothetical protein OsI_24568                        48.5    4e-04   Oryza sativa Indica Group [Indian rice]
gb|EEE66419.1|  hypothetical protein OsJ_22769                        48.5    4e-04   Oryza sativa Japonica Group [Japonica rice]
gb|EEC73767.1|  hypothetical protein OsI_08440                        48.5    4e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_007026929.1|  Basic helix-loop-helix DNA-binding superfami...  48.1    6e-04   
ref|XP_007026930.1|  Basic helix-loop-helix DNA-binding superfami...  47.8    6e-04   
emb|CDP06574.1|  unnamed protein product                              47.8    6e-04   
ref|XP_007026935.1|  Basic helix-loop-helix DNA-binding superfami...  47.8    7e-04   
ref|XP_007210891.1|  hypothetical protein PRUPE_ppa001838mg           47.8    8e-04   
emb|CDP20971.1|  unnamed protein product                              47.4    8e-04   
ref|XP_010256798.1|  PREDICTED: transcription factor bHLH155-like...  47.4    8e-04   
ref|XP_008644109.1|  PREDICTED: putative HLH DNA-binding domain s...  47.4    8e-04   
ref|XP_008644111.1|  PREDICTED: putative HLH DNA-binding domain s...  47.4    8e-04   
ref|XP_010473730.1|  PREDICTED: transcription factor bHLH157-like     47.0    9e-04   
ref|XP_010256799.1|  PREDICTED: transcription factor LHW-like iso...  47.4    0.001   



>ref|XP_009625579.1| PREDICTED: transcription factor LHW isoform X1 [Nicotiana tomentosiformis]
Length=944

 Score =   155 bits (393),  Expect = 3e-41, Method: Composition-based stats.
 Identities = 77/123 (63%), Positives = 94/123 (76%), Gaps = 10/123 (8%)
 Frame = -2

Query  339  WEECYYEPP---------EVSSSKLAFNNWGACWASDEVLNSRPV-QAGEGVQALVNKMM  190
            WEE Y E           EV + KL F +W ACW S EV NS+ + QAGE ++ LVNKMM
Sbjct  36   WEESYCETSIFSGLHGTREVENPKLVFQDWSACWDSGEVQNSQLLNQAGESLRLLVNKMM  95

Query  189  MENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVL  10
            M+NQF +VGEGL GRAAVTG+HHWILS+G S++A+P EVLKELSQQFS+GI+TI+VIP+L
Sbjct  96   MDNQFNLVGEGLIGRAAVTGNHHWILSKGQSKDAHPPEVLKELSQQFSSGIQTISVIPLL  155

Query  9    PHG  1
            PHG
Sbjct  156  PHG  158



>ref|XP_009625580.1| PREDICTED: transcription factor LHW isoform X2 [Nicotiana tomentosiformis]
Length=908

 Score =   155 bits (392),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 94/123 (76%), Gaps = 10/123 (8%)
 Frame = -2

Query  339  WEECYYEPP---------EVSSSKLAFNNWGACWASDEVLNSRPV-QAGEGVQALVNKMM  190
            WEE Y E           EV + KL F +W ACW S EV NS+ + QAGE ++ LVNKMM
Sbjct  36   WEESYCETSIFSGLHGTREVENPKLVFQDWSACWDSGEVQNSQLLNQAGESLRLLVNKMM  95

Query  189  MENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVL  10
            M+NQF +VGEGL GRAAVTG+HHWILS+G S++A+P EVLKELSQQFS+GI+TI+VIP+L
Sbjct  96   MDNQFNLVGEGLIGRAAVTGNHHWILSKGQSKDAHPPEVLKELSQQFSSGIQTISVIPLL  155

Query  9    PHG  1
            PHG
Sbjct  156  PHG  158



>ref|XP_009804415.1| PREDICTED: transcription factor LHW-like isoform X1 [Nicotiana 
sylvestris]
Length=974

 Score =   145 bits (367),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 73/123 (59%), Positives = 89/123 (72%), Gaps = 10/123 (8%)
 Frame = -2

Query  339  WEECYYEPP---------EVSSSKLAFNNWGACWASDEVLNSRPV-QAGEGVQALVNKMM  190
            WEE Y E           EV + KLAF +W ACW S EV NS+ + QAGE +  LV +MM
Sbjct  36   WEESYCETSTFSGLHGTCEVENPKLAFQDWSACWDSGEVQNSQLLNQAGESLCLLVKRMM  95

Query  189  MENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVL  10
            M+ QF +VGEGL GRAA  G+H WILS+G S++A+P EVLKELSQQFS+GI+TI+VIPVL
Sbjct  96   MDKQFNLVGEGLIGRAAAIGNHQWILSKGQSKDAHPPEVLKELSQQFSSGIQTISVIPVL  155

Query  9    PHG  1
            PHG
Sbjct  156  PHG  158



>ref|XP_009804416.1| PREDICTED: transcription factor LHW-like isoform X2 [Nicotiana 
sylvestris]
Length=948

 Score =   145 bits (365),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 73/123 (59%), Positives = 89/123 (72%), Gaps = 10/123 (8%)
 Frame = -2

Query  339  WEECYYEPP---------EVSSSKLAFNNWGACWASDEVLNSRPV-QAGEGVQALVNKMM  190
            WEE Y E           EV + KLAF +W ACW S EV NS+ + QAGE +  LV +MM
Sbjct  36   WEESYCETSTFSGLHGTCEVENPKLAFQDWSACWDSGEVQNSQLLNQAGESLCLLVKRMM  95

Query  189  MENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVL  10
            M+ QF +VGEGL GRAA  G+H WILS+G S++A+P EVLKELSQQFS+GI+TI+VIPVL
Sbjct  96   MDKQFNLVGEGLIGRAAAIGNHQWILSKGQSKDAHPPEVLKELSQQFSSGIQTISVIPVL  155

Query  9    PHG  1
            PHG
Sbjct  156  PHG  158



>ref|XP_006361093.1| PREDICTED: transcription factor LHW-like [Solanum tuberosum]
Length=912

 Score =   144 bits (364),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 75/123 (61%), Positives = 88/123 (72%), Gaps = 10/123 (8%)
 Frame = -2

Query  339  WEECYYEPPEVSS---------SKLAFNNWGACWASDEVLNSR-PVQAGEGVQALVNKMM  190
            WEE YYE   +S+          +LAF +W   W S  V NS+   QAGE +  LVNKMM
Sbjct  36   WEESYYETSTLSNIHGTSGVENPELAFQDWSTGWVSGGVQNSQLQNQAGENLHLLVNKMM  95

Query  189  MENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVL  10
            M+NQF +VGEGL GRAAVTG+H WILS+G SR A+P EVLKEL QQFSAGI+TI+VIPVL
Sbjct  96   MDNQFNLVGEGLIGRAAVTGNHQWILSEGLSRNAHPPEVLKELCQQFSAGIQTISVIPVL  155

Query  9    PHG  1
            PHG
Sbjct  156  PHG  158



>ref|XP_006362846.1| PREDICTED: transcription factor LHW-like [Solanum tuberosum]
Length=929

 Score =   144 bits (364),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 71/123 (58%), Positives = 88/123 (72%), Gaps = 10/123 (8%)
 Frame = -2

Query  339  WEECYYEPPE---------VSSSKLAFNNWGACWASDEVLNSRPV-QAGEGVQALVNKMM  190
            WEE YYEP           V +S+L+F++WG CW S EV N + + QAGE V  LVNKMM
Sbjct  36   WEESYYEPSTFSGIHGISGVENSELSFHDWGVCWGSGEVRNPQLMNQAGERVHMLVNKMM  95

Query  189  MENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVL  10
            ME+Q  +VGEGL GRAAVTG H W  S+G +R  +P EVLKEL+ Q+SAGI+TIAV+P+L
Sbjct  96   MESQINIVGEGLVGRAAVTGSHQWFHSEGFNRVVHPPEVLKELTGQYSAGIQTIAVVPIL  155

Query  9    PHG  1
            PHG
Sbjct  156  PHG  158



>ref|XP_004251101.1| PREDICTED: transcription factor LHW-like [Solanum lycopersicum]
Length=930

 Score =   144 bits (363),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 87/123 (71%), Gaps = 10/123 (8%)
 Frame = -2

Query  339  WEECYYEP---------PEVSSSKLAFNNWGACWASDEVLNSRPV-QAGEGVQALVNKMM  190
            WEE YYEP         P V + +L F++WG CW   EV N + + QAGE VQ LVNKMM
Sbjct  36   WEESYYEPSTYSGIHGVPMVENPELPFHDWGVCWGPGEVRNPQLMNQAGERVQLLVNKMM  95

Query  189  MENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVL  10
            ME+Q  +VGEGL GRAAVTG H W  S+G SR  +P EVLKEL+ QFSAGI+TIAV+PVL
Sbjct  96   MESQINIVGEGLVGRAAVTGSHQWFHSEGLSRVVHPQEVLKELTGQFSAGIQTIAVVPVL  155

Query  9    PHG  1
            PHG
Sbjct  156  PHG  158



>ref|XP_010322443.1| PREDICTED: transcription factor LHW-like isoform X2 [Solanum 
lycopersicum]
Length=890

 Score =   140 bits (352),  Expect = 8e-36, Method: Composition-based stats.
 Identities = 71/123 (58%), Positives = 86/123 (70%), Gaps = 10/123 (8%)
 Frame = -2

Query  339  WEECYYEPPEVSS---------SKLAFNNWGACWASDEVLNSR-PVQAGEGVQALVNKMM  190
            WEE YYE   +S+          +LAF +W   WA   V NS+   QAGE +  L+NKMM
Sbjct  36   WEESYYETSTLSNIHGTSGVENPELAFQDWSTGWAFGGVQNSQLQNQAGENLHLLINKMM  95

Query  189  MENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVL  10
            M+NQF +VGEGL GRAAVTG H W+LS+G SR  +P EVL+EL QQFSAGI+TI+VIPVL
Sbjct  96   MDNQFNLVGEGLIGRAAVTGKHQWVLSEGLSRNVHPPEVLRELRQQFSAGIQTISVIPVL  155

Query  9    PHG  1
            PHG
Sbjct  156  PHG  158



>ref|XP_004242114.1| PREDICTED: transcription factor LHW-like isoform X1 [Solanum 
lycopersicum]
Length=911

 Score =   139 bits (351),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 71/123 (58%), Positives = 86/123 (70%), Gaps = 10/123 (8%)
 Frame = -2

Query  339  WEECYYEPPEVSS---------SKLAFNNWGACWASDEVLNSR-PVQAGEGVQALVNKMM  190
            WEE YYE   +S+          +LAF +W   WA   V NS+   QAGE +  L+NKMM
Sbjct  36   WEESYYETSTLSNIHGTSGVENPELAFQDWSTGWAFGGVQNSQLQNQAGENLHLLINKMM  95

Query  189  MENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVL  10
            M+NQF +VGEGL GRAAVTG H W+LS+G SR  +P EVL+EL QQFSAGI+TI+VIPVL
Sbjct  96   MDNQFNLVGEGLIGRAAVTGKHQWVLSEGLSRNVHPPEVLRELRQQFSAGIQTISVIPVL  155

Query  9    PHG  1
            PHG
Sbjct  156  PHG  158



>ref|XP_009629479.1| PREDICTED: transcription factor LHW-like [Nicotiana tomentosiformis]
Length=876

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 88/122 (72%), Gaps = 15/122 (12%)
 Frame = -2

Query  339  WEECYYEP---------PEVSSSKLAFNNWGACWASDEVLNSRPVQAGEGVQALVNKMMM  187
            WEE YY+P          E+ +++L+F +WG C  + +++N    QAGE V  LVNKMM 
Sbjct  36   WEESYYQPLTFSGILGISEIENTELSFQDWGVC--NSQLMN----QAGERVHLLVNKMMT  89

Query  186  ENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLP  7
            E+QF +VGEGL GRAAVTG+H W  S G SR A+P EVLKEL+QQF+AGI+TIAV+P+LP
Sbjct  90   ESQFNLVGEGLVGRAAVTGNHQWFHSDGFSRVAHPPEVLKELTQQFNAGIKTIAVVPILP  149

Query  6    HG  1
            HG
Sbjct  150  HG  151



>ref|XP_011088969.1| PREDICTED: transcription factor LHW [Sesamum indicum]
Length=956

 Score =   133 bits (335),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 86/120 (72%), Gaps = 7/120 (6%)
 Frame = -2

Query  339  WEECYYEPPEVS------SSKLAFNNWGACWASDEVLNSRP-VQAGEGVQALVNKMMMEN  181
            WEECYYEP   S      + + AF+++GA W S E  + +   QAG+ V +LVNKMMM+N
Sbjct  36   WEECYYEPASCSGLSVNQNQETAFHDYGASWISAETHSLQSYAQAGDRVHSLVNKMMMDN  95

Query  180  QFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
               +VGEGL GR A TG+H WILS+   +EA+P EVLKE++ QFSAG++T+AV+PVLPHG
Sbjct  96   HVNIVGEGLVGRVAFTGNHQWILSENYCKEAHPPEVLKEVNLQFSAGMQTVAVVPVLPHG  155



>ref|XP_009760053.1| PREDICTED: transcription factor LHW-like [Nicotiana sylvestris]
Length=867

 Score =   132 bits (332),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 86/122 (70%), Gaps = 15/122 (12%)
 Frame = -2

Query  339  WEECYYEPPEVS---------SSKLAFNNWGACWASDEVLNSRPVQAGEGVQALVNKMMM  187
            WEE YY+P   S         + +L+F +WG C  + +++N    QAGE V  LVNKMM 
Sbjct  36   WEESYYQPLTFSEVHGISGLENPELSFQDWGVC--NSQLMN----QAGERVHLLVNKMMT  89

Query  186  ENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLP  7
            E+QF +VGEGL GRAAVTG+H W  S G SR A+P EVLKEL+QQF+AGI+TIAV+P+LP
Sbjct  90   ESQFNLVGEGLVGRAAVTGNHQWFHSDGFSRVAHPPEVLKELTQQFNAGIKTIAVVPILP  149

Query  6    HG  1
            HG
Sbjct  150  HG  151



>emb|CDP15550.1| unnamed protein product [Coffea canephora]
Length=927

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 81/120 (68%), Gaps = 11/120 (9%)
 Frame = -2

Query  339  WEECYYEP-------PEVSSSKLAFNNWGACWASDEVLNSRPVQAGEGVQALVNKMMMEN  181
            WEECYYEP       P  S  +  F NW +  A +  L    V AG  +  LVNKMMMEN
Sbjct  36   WEECYYEPVIYATGLPRNSGIE-GFENWNSAEACNSQLG---VGAGNELHLLVNKMMMEN  91

Query  180  QFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
            Q  V+GEGL GRAA TG H WILS+   R+A+PLEVLKE+ QQFSAG++TIAVIPVLPHG
Sbjct  92   QVNVLGEGLVGRAAFTGSHQWILSENYRRDAHPLEVLKEVVQQFSAGMQTIAVIPVLPHG  151



>ref|XP_002513717.1| expressed protein, putative [Ricinus communis]
 gb|EEF48664.1| expressed protein, putative [Ricinus communis]
Length=933

 Score =   129 bits (325),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 62/113 (55%), Positives = 76/113 (67%), Gaps = 4/113 (4%)
 Frame = -2

Query  339  WEECYYEPPEVSSSKLAFNNWGACWASDEVLNSRPVQAGEGVQALVNKMMMENQFKVVGE  160
            WEECYYEP    + +L F +W  CWASD   +   VQ G+ V  L+NKMM  NQ  +VG+
Sbjct  36   WEECYYEP----NPELPFGDWEGCWASDAHSSQLKVQTGDRVYMLINKMMGNNQVNLVGQ  91

Query  159  GLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
            GL GRAA TG+H WIL+      A+P EVL E+  QFSAG++TIAVIPV PHG
Sbjct  92   GLVGRAAFTGNHEWILANNYIGGAHPPEVLSEIHHQFSAGMQTIAVIPVCPHG  144



>ref|XP_009368308.1| PREDICTED: transcription factor LHW-like [Pyrus x bretschneideri]
Length=964

 Score =   128 bits (321),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 62/123 (50%), Positives = 79/123 (64%), Gaps = 10/123 (8%)
 Frame = -2

Query  339  WEECYYEPPEVSSSK---------LAFNNWGACWASDEVLNS-RPVQAGEGVQALVNKMM  190
            WEEC+YEP   S  K         L F  W  CW S EV +S    Q  E V +L+N MM
Sbjct  36   WEECHYEPSLSSLPKRIAGTERAELPFGEWEGCWVSSEVCSSSNGFQQEESVSSLINTMM  95

Query  189  MENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVL  10
            ++  F +VGEG+ GRAA TG+H WILS   +++A+P EVL E+  QFSAG++T+AVIPVL
Sbjct  96   IDKPFNIVGEGMVGRAAFTGNHQWILSGNYTKDAHPPEVLNEMHHQFSAGMQTVAVIPVL  155

Query  9    PHG  1
            PHG
Sbjct  156  PHG  158



>ref|XP_009337709.1| PREDICTED: transcription factor LHW-like [Pyrus x bretschneideri]
Length=964

 Score =   127 bits (319),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 62/123 (50%), Positives = 79/123 (64%), Gaps = 10/123 (8%)
 Frame = -2

Query  339  WEECYYEPPEVSSSK---------LAFNNWGACWASDEVLNS-RPVQAGEGVQALVNKMM  190
            WEEC+YEP   S  K         L F  W  CW S EV +S    Q  E V +L+N MM
Sbjct  36   WEECHYEPSLSSLPKRIAGTERAELPFGEWEGCWVSSEVCSSSNGFQQEERVSSLINTMM  95

Query  189  MENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVL  10
            ++  F +VGEG+ GRAA TG+H WILS   +++A+P EVL E+  QFSAG++T+AVIPVL
Sbjct  96   IDKPFNIVGEGMVGRAAFTGNHQWILSGNYTKDAHPPEVLNEMHHQFSAGMQTVAVIPVL  155

Query  9    PHG  1
            PHG
Sbjct  156  PHG  158



>ref|XP_007208256.1| hypothetical protein PRUPE_ppa016557mg [Prunus persica]
 gb|EMJ09455.1| hypothetical protein PRUPE_ppa016557mg [Prunus persica]
Length=971

 Score =   125 bits (314),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 61/121 (50%), Positives = 79/121 (65%), Gaps = 10/121 (8%)
 Frame = -2

Query  333  ECYYEPPEVSSSK---------LAFNNWGACWASDEVLNS-RPVQAGEGVQALVNKMMME  184
            EC+YEP   S  K         L F  W  CW S EV +S   +Q  E V +L+N+MMM+
Sbjct  37   ECHYEPSICSLPKRIAGTERAELPFGEWEGCWVSSEVCSSSNGIQPEERVSSLINRMMMD  96

Query  183  NQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPH  4
              F +VGEG+ GRAA TG+H WILS   +++A+P EVL E+  QFSAG++T+AVIPVLPH
Sbjct  97   KPFNIVGEGIVGRAAFTGNHQWILSSNYTKDAHPPEVLNEMHHQFSAGMQTVAVIPVLPH  156

Query  3    G  1
            G
Sbjct  157  G  157



>ref|XP_006424092.1| hypothetical protein CICLE_v10029797mg [Citrus clementina]
 gb|ESR37332.1| hypothetical protein CICLE_v10029797mg [Citrus clementina]
Length=944

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 76/113 (67%), Gaps = 2/113 (2%)
 Frame = -2

Query  339  WEECYYEPPEVSSSKLAFNNWGACWASDEVLNSRPVQAGEGVQALVNKMMMENQFKVVGE  160
            WEEC+YE        + F  W  CW S E+L+   +QA + VQ L+NKMM  NQ  VVGE
Sbjct  36   WEECHYE--STPHPDIPFGEWDGCWGSYEILSRLRIQAEDRVQLLINKMMNNNQVNVVGE  93

Query  159  GLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
            G+ GRAA TG+H W L+  + R+A+P EV  E+  QFSAG++T+AVIP+LPHG
Sbjct  94   GILGRAAFTGNHQWFLANNHIRDAHPPEVQNEVHLQFSAGMQTVAVIPILPHG  146



>gb|KDO46593.1| hypothetical protein CISIN_1g036631mg [Citrus sinensis]
Length=944

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 76/113 (67%), Gaps = 2/113 (2%)
 Frame = -2

Query  339  WEECYYEPPEVSSSKLAFNNWGACWASDEVLNSRPVQAGEGVQALVNKMMMENQFKVVGE  160
            WEEC+YE        + F  W  CW S E+L+   +QA + VQ L+NKMM  NQ  VVGE
Sbjct  36   WEECHYE--STPHPDIPFGEWDGCWGSYEILSRLRIQAEDRVQLLINKMMNNNQVNVVGE  93

Query  159  GLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
            G+ GRAA TG+H W L+  + R+A+P EV  E+  QFSAG++T+AVIP+LPHG
Sbjct  94   GILGRAAFTGNHQWFLANNHIRDAHPPEVQNEVHLQFSAGMQTVAVIPILPHG  146



>ref|XP_010089791.1| hypothetical protein L484_022306 [Morus notabilis]
 gb|EXB38407.1| hypothetical protein L484_022306 [Morus notabilis]
Length=953

 Score =   124 bits (310),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 82/123 (67%), Gaps = 10/123 (8%)
 Frame = -2

Query  339  WEECYYEPPEVS---------SSKLAFNNWGACWASDEVLNSR-PVQAGEGVQALVNKMM  190
            WEEC+YEP + S         S++L F  W   W S E  +S+   Q G+ V +L++KMM
Sbjct  36   WEECHYEPSKSSLPTHMSGAGSAELPFEEWERLWMSSETCSSQLGSQVGDRVSSLISKMM  95

Query  189  MENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVL  10
            + NQF +VGEG+ GRAA TG+H WILS   ++ A+P EVL E+  QFSAG++T+AVIPV 
Sbjct  96   INNQFNIVGEGMVGRAAFTGNHQWILSNNYTKFAHPPEVLNEMHHQFSAGMQTVAVIPVR  155

Query  9    PHG  1
            PHG
Sbjct  156  PHG  158



>ref|XP_006494896.1| PREDICTED: transcription factor LHW-like [Citrus sinensis]
Length=953

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 75/113 (66%), Gaps = 2/113 (2%)
 Frame = -2

Query  339  WEECYYEPPEVSSSKLAFNNWGACWASDEVLNSRPVQAGEGVQALVNKMMMENQFKVVGE  160
            WEEC+YE        + F  W  CW S E+L+   + A + VQ L+NKMM  NQ  VVGE
Sbjct  45   WEECHYE--STPHPDIPFGEWDGCWGSYEILSRLRIHAEDRVQLLINKMMNNNQVNVVGE  102

Query  159  GLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
            G+ GRAA TG+H W L+  + R+A+P EV  E+  QFSAG++T+AVIP+LPHG
Sbjct  103  GILGRAAFTGNHQWFLANNHIRDAHPPEVQNEVHLQFSAGMQTVAVIPILPHG  155



>ref|XP_011090482.1| PREDICTED: transcription factor LHW-like [Sesamum indicum]
Length=878

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 81/123 (66%), Gaps = 10/123 (8%)
 Frame = -2

Query  339  WEECYYEPPEVS---------SSKLAFNNWGACWASDEVLNSR-PVQAGEGVQALVNKMM  190
            WEECYY PP  S         + +++F  + A     E L+S+  + AG  V  LVN+MM
Sbjct  36   WEECYYGPPSCSGLAGISGNGNPEISFQGYDASCVFAETLHSQHNIPAGNKVHLLVNEMM  95

Query  189  MENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVL  10
            M+N  K+VG+GL GR A TG+H WILS+   +EAYP EV  E+ QQFSAG++T+AVIPVL
Sbjct  96   MDNHVKIVGQGLVGRVAFTGNHQWILSENYYKEAYPPEVQNEVCQQFSAGMQTLAVIPVL  155

Query  9    PHG  1
            PHG
Sbjct  156  PHG  158



>ref|XP_008361584.1| PREDICTED: transcription factor LHW-like isoform X1 [Malus domestica]
Length=965

 Score =   120 bits (300),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 59/123 (48%), Positives = 79/123 (64%), Gaps = 10/123 (8%)
 Frame = -2

Query  339  WEECYYEPP---------EVSSSKLAFNNWGACWASDEVLNSRP-VQAGEGVQALVNKMM  190
            WEEC+YEP          E   ++L F  W  CW S +V +S   +Q  E V  L+N MM
Sbjct  36   WEECHYEPSVSSLPKRNAETERAELPFGEWEGCWVSSKVCSSSSGIQQEERVSTLINTMM  95

Query  189  MENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVL  10
            M+  F +VGEG+ GRAA TG+H WI+S    ++A+P EVL E+  QFSAG++T+AVIPV+
Sbjct  96   MDKPFNIVGEGIVGRAAFTGNHQWIVSGNYRKDAHPPEVLNEMHHQFSAGMQTVAVIPVI  155

Query  9    PHG  1
            PHG
Sbjct  156  PHG  158



>ref|XP_008230230.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor LHW [Prunus 
mume]
Length=963

 Score =   120 bits (300),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 59/120 (49%), Positives = 76/120 (63%), Gaps = 16/120 (13%)
 Frame = -2

Query  333  ECYYEPPEVSSSK---------LAFNNWGACWASDEVLNSRPVQAGEGVQALVNKMMMEN  181
            EC+YEP   S  K         L F  W  CW S EV +S        + +L+N+MMM+ 
Sbjct  37   ECHYEPSICSLPKRIAGTERAELPFGEWEGCWVSSEVCSSX-------LSSLINRMMMDK  89

Query  180  QFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
             F +VGEG+ GRAA TG+H WILS   +++A+P EVL E+  QFSAG++TIAVIPVLPHG
Sbjct  90   PFNIVGEGIVGRAAFTGNHQWILSSNYTKDAHPPEVLNEMHHQFSAGMQTIAVIPVLPHG  149



>ref|XP_008361589.1| PREDICTED: transcription factor LHW-like isoform X2 [Malus domestica]
Length=923

 Score =   120 bits (300),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 59/123 (48%), Positives = 79/123 (64%), Gaps = 10/123 (8%)
 Frame = -2

Query  339  WEECYYEPP---------EVSSSKLAFNNWGACWASDEVLNSRP-VQAGEGVQALVNKMM  190
            WEEC+YEP          E   ++L F  W  CW S +V +S   +Q  E V  L+N MM
Sbjct  36   WEECHYEPSVSSLPKRNAETERAELPFGEWEGCWVSSKVCSSSSGIQQEERVSTLINTMM  95

Query  189  MENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVL  10
            M+  F +VGEG+ GRAA TG+H WI+S    ++A+P EVL E+  QFSAG++T+AVIPV+
Sbjct  96   MDKPFNIVGEGIVGRAAFTGNHQWIVSGNYRKDAHPPEVLNEMHHQFSAGMQTVAVIPVI  155

Query  9    PHG  1
            PHG
Sbjct  156  PHG  158



>emb|CAN76581.1| hypothetical protein VITISV_034321 [Vitis vinifera]
Length=1023

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 80/123 (65%), Gaps = 10/123 (8%)
 Frame = -2

Query  339  WEECYYE--PPE-------VSSSKLAFNNWGACWASDEV-LNSRPVQAGEGVQALVNKMM  190
            WEEC+ E  P         + +S++ F +W  CW   E  ++    QA E +  LVNKMM
Sbjct  36   WEECHCEFIPSSGLPHGSGMENSEVPFEDWEGCWVXPETRISQLDGQAVESIYFLVNKMM  95

Query  189  MENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVL  10
            M NQ  +VGEG+ GRAA TG H WILS+  +R+A+P EVL E+  QFSAG++T+AVIPVL
Sbjct  96   MNNQVNIVGEGIVGRAAFTGKHQWILSENYTRDAHPPEVLNEVHHQFSAGMQTVAVIPVL  155

Query  9    PHG  1
            PHG
Sbjct  156  PHG  158



>emb|CBI24427.3| unnamed protein product [Vitis vinifera]
Length=842

 Score =   118 bits (295),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 80/123 (65%), Gaps = 10/123 (8%)
 Frame = -2

Query  339  WEECYYE--PPE-------VSSSKLAFNNWGACWASDEV-LNSRPVQAGEGVQALVNKMM  190
            WEEC+ E  P         + +S++ F +W  CW   E  ++    QA E +  LVNKMM
Sbjct  36   WEECHCEFIPSSGLPHGSGMENSEVPFEDWEGCWVFPETRISQLDGQAVESIYFLVNKMM  95

Query  189  MENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVL  10
            M NQ  +VGEG+ GRAA TG H WILS+  +R+A+P EVL E+  QFSAG++T+AVIPVL
Sbjct  96   MNNQVNIVGEGIVGRAAFTGKHQWILSENYTRDAHPPEVLNEVHHQFSAGMQTVAVIPVL  155

Query  9    PHG  1
            PHG
Sbjct  156  PHG  158



>ref|XP_002274971.1| PREDICTED: transcription factor LHW-like isoform X1 [Vitis vinifera]
 ref|XP_010651649.1| PREDICTED: transcription factor LHW-like isoform X1 [Vitis vinifera]
Length=973

 Score =   118 bits (295),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 80/123 (65%), Gaps = 10/123 (8%)
 Frame = -2

Query  339  WEECYYE--PPE-------VSSSKLAFNNWGACWASDEV-LNSRPVQAGEGVQALVNKMM  190
            WEEC+ E  P         + +S++ F +W  CW   E  ++    QA E +  LVNKMM
Sbjct  36   WEECHCEFIPSSGLPHGSGMENSEVPFEDWEGCWVFPETRISQLDGQAVESIYFLVNKMM  95

Query  189  MENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVL  10
            M NQ  +VGEG+ GRAA TG H WILS+  +R+A+P EVL E+  QFSAG++T+AVIPVL
Sbjct  96   MNNQVNIVGEGIVGRAAFTGKHQWILSENYTRDAHPPEVLNEVHHQFSAGMQTVAVIPVL  155

Query  9    PHG  1
            PHG
Sbjct  156  PHG  158



>ref|XP_004293110.1| PREDICTED: transcription factor LHW-like [Fragaria vesca subsp. 
vesca]
Length=963

 Score =   117 bits (293),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 59/123 (48%), Positives = 78/123 (63%), Gaps = 10/123 (8%)
 Frame = -2

Query  339  WEECYYEPPEVS---------SSKLAFNNWGACWASDEVLNS-RPVQAGEGVQALVNKMM  190
            WEE + EP   S         S +  F  W  CWAS ++ +S   +Q  E V AL+NKM+
Sbjct  36   WEESHCEPSLSSRRTHIDGTESGESPFGEWEGCWASSDMCSSSHGIQPEEFVSALLNKML  95

Query  189  MENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVL  10
            M   F ++GEG+ GRAA TG+H WILS   S+ A+P EV+ E+  QFSAG++T+AVIPVL
Sbjct  96   MNKPFTIMGEGIVGRAAFTGNHQWILSSNYSKYAHPPEVVNEMHHQFSAGMQTVAVIPVL  155

Query  9    PHG  1
            PHG
Sbjct  156  PHG  158



>ref|XP_009373890.1| PREDICTED: transcription factor LHW-like isoform X2 [Pyrus x 
bretschneideri]
Length=963

 Score =   116 bits (291),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 61/124 (49%), Positives = 81/124 (65%), Gaps = 12/124 (10%)
 Frame = -2

Query  339  WEECYYEPPEVSS----------SKLAFNNWGACWASDEVLNSRP-VQAGEGVQALVNKM  193
            WEEC+YE   VSS          ++L F  W  CW S +V +S   +Q  E V +L+N M
Sbjct  36   WEECHYES-SVSSLPKRNAGTERAELPFGEWEGCWVSSKVCSSSSGIQQEERVSSLINTM  94

Query  192  MMENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPV  13
            MM+  F +VGEG+ GRAA TG+H WILS    ++A+P EVL E+  QFS+G++T+AVIPV
Sbjct  95   MMDKPFNIVGEGMVGRAAFTGNHQWILSGNYRKDAHPPEVLNEMHHQFSSGMQTVAVIPV  154

Query  12   LPHG  1
            LPHG
Sbjct  155  LPHG  158



>ref|XP_009373889.1| PREDICTED: transcription factor LHW-like isoform X1 [Pyrus x 
bretschneideri]
Length=965

 Score =   116 bits (291),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 61/124 (49%), Positives = 81/124 (65%), Gaps = 12/124 (10%)
 Frame = -2

Query  339  WEECYYEPPEVSS----------SKLAFNNWGACWASDEVLNSRP-VQAGEGVQALVNKM  193
            WEEC+YE   VSS          ++L F  W  CW S +V +S   +Q  E V +L+N M
Sbjct  36   WEECHYES-SVSSLPKRNAGTERAELPFGEWEGCWVSSKVCSSSSGIQQEERVSSLINTM  94

Query  192  MMENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPV  13
            MM+  F +VGEG+ GRAA TG+H WILS    ++A+P EVL E+  QFS+G++T+AVIPV
Sbjct  95   MMDKPFNIVGEGMVGRAAFTGNHQWILSGNYRKDAHPPEVLNEMHHQFSSGMQTVAVIPV  154

Query  12   LPHG  1
            LPHG
Sbjct  155  LPHG  158



>gb|KDP23204.1| hypothetical protein JCGZ_00320 [Jatropha curcas]
Length=962

 Score =   116 bits (290),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 60/122 (49%), Positives = 76/122 (62%), Gaps = 9/122 (7%)
 Frame = -2

Query  339  WEECYYE------PPEVS---SSKLAFNNWGACWASDEVLNSRPVQAGEGVQALVNKMMM  187
            WEEC++E      PP  S   + +L F       ASD   +   VQ GE V  L+NKMMM
Sbjct  36   WEECHFESKLSSLPPRTSGIENPELPFGECEGHQASDIHFSQPNVQTGEAVHLLINKMMM  95

Query  186  ENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLP  7
             NQ  VVG+G+ GRAA TG+H WIL+   + + +P EV  E+ QQFSAG++TIAVIPV P
Sbjct  96   NNQVNVVGQGIVGRAAFTGNHEWILANNYNGDVHPPEVFTEIHQQFSAGMQTIAVIPVSP  155

Query  6    HG  1
            HG
Sbjct  156  HG  157



>ref|XP_011021434.1| PREDICTED: transcription factor LHW-like isoform X2 [Populus 
euphratica]
Length=948

 Score =   115 bits (287),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 58/122 (48%), Positives = 79/122 (65%), Gaps = 9/122 (7%)
 Frame = -2

Query  339  WEECYYEP------PEVSSSK---LAFNNWGACWASDEVLNSRPVQAGEGVQALVNKMMM  187
            WEEC++EP      P  S ++   L F  W   + SD   +   +QAG  + +L+NKMM+
Sbjct  36   WEECHFEPTSCSVPPSTSGTENLALPFGEWEGHFGSDVHSSHLGIQAGGRLCSLINKMMV  95

Query  186  ENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLP  7
             NQ  +VGEG+ GR A TG+H WIL+   S++A+P EVL E+  QFSAG++TIAVIPV P
Sbjct  96   NNQVNIVGEGIVGRVAFTGNHEWILANNYSKDAHPPEVLNEVHHQFSAGMQTIAVIPVCP  155

Query  6    HG  1
            HG
Sbjct  156  HG  157



>ref|XP_011021433.1| PREDICTED: transcription factor LHW-like isoform X1 [Populus 
euphratica]
Length=976

 Score =   115 bits (287),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 58/122 (48%), Positives = 79/122 (65%), Gaps = 9/122 (7%)
 Frame = -2

Query  339  WEECYYEP------PEVSSSK---LAFNNWGACWASDEVLNSRPVQAGEGVQALVNKMMM  187
            WEEC++EP      P  S ++   L F  W   + SD   +   +QAG  + +L+NKMM+
Sbjct  36   WEECHFEPTSCSVPPSTSGTENLALPFGEWEGHFGSDVHSSHLGIQAGGRLCSLINKMMV  95

Query  186  ENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLP  7
             NQ  +VGEG+ GR A TG+H WIL+   S++A+P EVL E+  QFSAG++TIAVIPV P
Sbjct  96   NNQVNIVGEGIVGRVAFTGNHEWILANNYSKDAHPPEVLNEVHHQFSAGMQTIAVIPVCP  155

Query  6    HG  1
            HG
Sbjct  156  HG  157



>ref|XP_006592778.1| PREDICTED: transcription factor LHW-like isoform X1 [Glycine 
max]
 gb|KHN17978.1| Putative basic helix-loop-helix protein [Glycine soja]
Length=952

 Score =   114 bits (284),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 57/119 (48%), Positives = 75/119 (63%), Gaps = 6/119 (5%)
 Frame = -2

Query  339  WEECYYEP----PEV-SSSKLAFNNWGACWASDEVLNSR-PVQAGEGVQALVNKMMMENQ  178
            WEECYYEP    P +     L + N   CW S E  +S+  +Q  + V +L+NKM + N 
Sbjct  36   WEECYYEPLPCPPHMFGMPDLPYQNGEGCWFSLEYRSSQLGIQEDDQVSSLINKMTVNNS  95

Query  177  FKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
              + GEG+ GRAA TG H WIL    +++AYP +V  E+  QFSAGI+T+AVIPVLPHG
Sbjct  96   VIIAGEGIVGRAAFTGSHQWILLNNFTKDAYPPQVYAEVHHQFSAGIQTVAVIPVLPHG  154



>gb|KEH29770.1| bHLH transcription factor-like protein [Medicago truncatula]
Length=921

 Score =   111 bits (277),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 57/121 (47%), Positives = 77/121 (64%), Gaps = 11/121 (9%)
 Frame = -2

Query  339  WEECYYEP------PE-VSSSKLAFNNWGACW-ASDEVLNSRPVQAGEGVQALVNKMMME  184
            WE+CYYEP      P+ V +S L + +   CW +SD  L    +Q  + V +L+NKMM+ 
Sbjct  36   WEDCYYEPLPSTFLPQNVGTSNLPYQDREGCWFSSDSQLR---IQEDDRVCSLINKMMVN  92

Query  183  NQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPH  4
            N   V G+G+ GRAA TG+H WIL     ++ YP EVL E+  QFSAG++T+ VIPVLPH
Sbjct  93   NSVNVAGQGILGRAAFTGNHQWILLNNFIKDVYPPEVLNEVHCQFSAGMQTVVVIPVLPH  152

Query  3    G  1
            G
Sbjct  153  G  153



>ref|XP_010031564.1| PREDICTED: transcription factor LHW-like isoform X2 [Eucalyptus 
grandis]
 gb|KCW50921.1| hypothetical protein EUGRSUZ_J00573 [Eucalyptus grandis]
Length=863

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 77/123 (63%), Gaps = 10/123 (8%)
 Frame = -2

Query  339  WEECYYEP------PEVSSS---KLAFNNWGACWASDEVLNSRP-VQAGEGVQALVNKMM  190
            WEECYYEP      P  + S   K+    +  C  + E   + P   A + +Q+L++KMM
Sbjct  36   WEECYYEPLRCCVPPSTAVSVIGKVPMGEFDGCLVTPENQFAMPENHAADKIQSLIDKMM  95

Query  189  MENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVL  10
            ++NQ  +VGEG+ GRAA TG+H WILS   + +AYP EV  E   QFSAG++TIAVIP+ 
Sbjct  96   IQNQINIVGEGIIGRAAFTGNHLWILSSSYNGDAYPPEVQNETLHQFSAGMQTIAVIPIT  155

Query  9    PHG  1
            PHG
Sbjct  156  PHG  158



>ref|XP_010031563.1| PREDICTED: transcription factor LHW-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW50922.1| hypothetical protein EUGRSUZ_J00573 [Eucalyptus grandis]
Length=865

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 77/123 (63%), Gaps = 10/123 (8%)
 Frame = -2

Query  339  WEECYYEP------PEVSSS---KLAFNNWGACWASDEVLNSRP-VQAGEGVQALVNKMM  190
            WEECYYEP      P  + S   K+    +  C  + E   + P   A + +Q+L++KMM
Sbjct  36   WEECYYEPLRCCVPPSTAVSVIGKVPMGEFDGCLVTPENQFAMPENHAADKIQSLIDKMM  95

Query  189  MENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVL  10
            ++NQ  +VGEG+ GRAA TG+H WILS   + +AYP EV  E   QFSAG++TIAVIP+ 
Sbjct  96   IQNQINIVGEGIIGRAAFTGNHLWILSSSYNGDAYPPEVQNETLHQFSAGMQTIAVIPIT  155

Query  9    PHG  1
            PHG
Sbjct  156  PHG  158



>gb|KCW50923.1| hypothetical protein EUGRSUZ_J00573 [Eucalyptus grandis]
Length=815

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 77/123 (63%), Gaps = 10/123 (8%)
 Frame = -2

Query  339  WEECYYEP------PEVSSS---KLAFNNWGACWASDEVLNSRP-VQAGEGVQALVNKMM  190
            WEECYYEP      P  + S   K+    +  C  + E   + P   A + +Q+L++KMM
Sbjct  36   WEECYYEPLRCCVPPSTAVSVIGKVPMGEFDGCLVTPENQFAMPENHAADKIQSLIDKMM  95

Query  189  MENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVL  10
            ++NQ  +VGEG+ GRAA TG+H WILS   + +AYP EV  E   QFSAG++TIAVIP+ 
Sbjct  96   IQNQINIVGEGIIGRAAFTGNHLWILSSSYNGDAYPPEVQNETLHQFSAGMQTIAVIPIT  155

Query  9    PHG  1
            PHG
Sbjct  156  PHG  158



>ref|XP_004506222.1| PREDICTED: transcription factor LHW-like [Cicer arietinum]
Length=934

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 76/120 (63%), Gaps = 9/120 (8%)
 Frame = -2

Query  339  WEECYYEP---PEV----SSSKLAFNNWGACWASDEVLNSRPVQAGEGVQALVNKMMMEN  181
            WE+CYYEP   P +    ++S   + +   CW S +  +   +Q  + V +L+NKMM+ N
Sbjct  36   WEDCYYEPLPSPFLQQIGATSNFPYRDAEGCWFSTD--SQLRIQEDDRVCSLINKMMVNN  93

Query  180  QFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
               V G+G+ GRAA TG H WIL     ++AYP EVL EL  QFSAG++T+AVIPVLPHG
Sbjct  94   SVNVAGQGILGRAAFTGSHQWILLNNFIKDAYPPEVLTELQCQFSAGMQTVAVIPVLPHG  153



>ref|XP_003541959.2| PREDICTED: transcription factor LHW-like isoform X1 [Glycine 
max]
Length=965

 Score =   110 bits (275),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 56/119 (47%), Positives = 73/119 (61%), Gaps = 6/119 (5%)
 Frame = -2

Query  339  WEECYYEP----PEV-SSSKLAFNNWGACWASDEVLNSR-PVQAGEGVQALVNKMMMENQ  178
            WEECYYEP    P +     L + N   CW S E L+S+  +Q    + +L+ KM + N 
Sbjct  59   WEECYYEPLPWPPHMFGMPDLPYQNGEGCWFSSESLSSQLGIQEEVRISSLIKKMTVNNS  118

Query  177  FKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
              + GEG+ GRAA TG H WIL    + +AYP +V  E+  QFSAGI+T+AVIPVLPHG
Sbjct  119  VIIAGEGIIGRAAFTGSHQWILLNNFTEDAYPPQVYAEVHHQFSAGIQTVAVIPVLPHG  177



>ref|XP_003540817.1| PREDICTED: transcription factor LHW-like [Glycine max]
Length=957

 Score =   110 bits (275),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 55/120 (46%), Positives = 73/120 (61%), Gaps = 9/120 (8%)
 Frame = -2

Query  339  WEECYYEP-------PEVSSSKLAFNNWGACWASDEVLNSRPVQAGEGVQALVNKMMMEN  181
            WE+ YYEP         V  S   + +   CW S E  +   +Q  + V+ L+NKMM+ N
Sbjct  36   WEDYYYEPLPSPFPPRTVGRSNFPYQDGEGCWFSSE--SQLGIQEEDRVRVLINKMMVNN  93

Query  180  QFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
               + GEG+ GRAA TG++ WIL    +R+AYP EV  EL  QFSAG++T+AVIPVLPHG
Sbjct  94   SVSIAGEGIVGRAAFTGNYQWILLNNFTRDAYPPEVYPELHYQFSAGMQTVAVIPVLPHG  153



>gb|KHN21191.1| Putative basic helix-loop-helix protein [Glycine soja]
Length=957

 Score =   110 bits (274),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 55/120 (46%), Positives = 73/120 (61%), Gaps = 9/120 (8%)
 Frame = -2

Query  339  WEECYYEP-------PEVSSSKLAFNNWGACWASDEVLNSRPVQAGEGVQALVNKMMMEN  181
            WE+ YYEP         V  S   + +   CW S E  +   +Q  + V+ L+NKMM+ N
Sbjct  36   WEDYYYEPLPSPFPPRTVGRSNFPYQDEEGCWFSSE--SQLGIQEEDRVRVLINKMMVNN  93

Query  180  QFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
               + GEG+ GRAA TG++ WIL    +R+AYP EV  EL  QFSAG++T+AVIPVLPHG
Sbjct  94   SVSIAGEGIVGRAAFTGNYQWILLNNFTRDAYPPEVYPELHYQFSAGMQTVAVIPVLPHG  153



>ref|XP_010685440.1| PREDICTED: transcription factor LHW-like [Beta vulgaris subsp. 
vulgaris]
Length=911

 Score =   108 bits (269),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 59/113 (52%), Positives = 72/113 (64%), Gaps = 8/113 (7%)
 Frame = -2

Query  339  WEECYYEPPEVSSSKLAFNNWGACWASDEVLNSRPVQAGEGVQALVNKMMMENQFKVVGE  160
            WEECYY     SSS  A N    C    E  N+   Q GE V  L+++MM+ N   VVGE
Sbjct  36   WEECYYG----SSSSAAQNR---CLQKQEGYNN-GAQVGEKVHMLMDRMMISNHVNVVGE  87

Query  159  GLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
            GL GRAA TG+H WI+S   +  A+P EVL E+  QFSAG++TIAVIPV+PHG
Sbjct  88   GLVGRAAFTGNHQWIVSGLYNEIAHPAEVLNEVRHQFSAGMQTIAVIPVIPHG  140



>gb|KHN36498.1| Putative basic helix-loop-helix protein [Glycine soja]
Length=965

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 73/119 (61%), Gaps = 6/119 (5%)
 Frame = -2

Query  339  WEECYYEP----PEV-SSSKLAFNNWGACWASDEVLNSR-PVQAGEGVQALVNKMMMENQ  178
            WEECYYEP    P +     L + N   CW S E L+S+  +Q    V +L+ KM + N 
Sbjct  59   WEECYYEPLPWPPHMFGMPDLPYQNGEGCWFSSESLSSQLGIQEEVRVSSLIKKMTVNNS  118

Query  177  FKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
              + GEG+ GRAA TG H WIL    + +AYP +V  E+  QFSAGI+T+AVIPVLPHG
Sbjct  119  VIIAGEGIIGRAAFTGSHQWILLNNFTEDAYPPQVYAEVHHQFSAGIQTVAVIPVLPHG  177



>ref|XP_003539152.1| PREDICTED: transcription factor LHW-like [Glycine max]
Length=939

 Score =   107 bits (268),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 55/113 (49%), Positives = 71/113 (63%), Gaps = 6/113 (5%)
 Frame = -2

Query  339  WEECYYEPPEVSSSKLAFNNWGACWASDEVLNSRPVQAGEGVQALVNKMMMENQFKVVGE  160
            WE+ YYEP     S     +   CW S E   S+ +Q  + V  L+NKMM+ N   + GE
Sbjct  36   WEDYYYEP---LPSPFPPRDGEGCWFSSE---SQLIQEEDRVCVLINKMMVNNSVSIAGE  89

Query  159  GLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
            G+ GRAA TG++ WIL    +R+AYP EV  EL  QFSAG++T+AVIPVLPHG
Sbjct  90   GIVGRAAFTGNYQWILLNNFTRDAYPPEVYPELHYQFSAGMQTVAVIPVLPHG  142



>gb|KHN19923.1| Putative basic helix-loop-helix protein [Glycine soja]
Length=939

 Score =   107 bits (268),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 55/113 (49%), Positives = 71/113 (63%), Gaps = 6/113 (5%)
 Frame = -2

Query  339  WEECYYEPPEVSSSKLAFNNWGACWASDEVLNSRPVQAGEGVQALVNKMMMENQFKVVGE  160
            WE+ YYEP     S     +   CW S E   S+ +Q  + V  L+NKMM+ N   + GE
Sbjct  36   WEDYYYEP---LPSPFPPRDGEGCWFSSE---SQLIQEEDRVCVLINKMMVNNSVSIAGE  89

Query  159  GLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
            G+ GRAA TG++ WIL    +R+AYP EV  EL  QFSAG++T+AVIPVLPHG
Sbjct  90   GIVGRAAFTGNYQWILLNNFTRDAYPPEVYPELHYQFSAGMQTVAVIPVLPHG  142



>ref|XP_002298267.2| transcription factor-related family protein [Populus trichocarpa]
 gb|EEE83072.2| transcription factor-related family protein [Populus trichocarpa]
Length=680

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 69/113 (61%), Gaps = 21/113 (19%)
 Frame = -2

Query  339  WEECYYEPPEVSSSKLAFNNWGACWASDEVLNSRPVQAGEGVQALVNKMMMENQFKVVGE  160
            WEEC+YEP   S                       +QAG  + +L+NKMM+ NQ  +VGE
Sbjct  36   WEECHYEPTSCSLG---------------------IQAGGRLCSLINKMMVNNQVNIVGE  74

Query  159  GLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
            G+ GR A TG+H WIL+   S++A+P EVL E+  QFSAG++TIAVIPV PHG
Sbjct  75   GIVGRVAFTGNHEWILANNYSKDAHPPEVLNEVHHQFSAGMQTIAVIPVCPHG  127



>ref|XP_004139141.1| PREDICTED: transcription factor LHW-like [Cucumis sativus]
 ref|XP_004154707.1| PREDICTED: transcription factor LHW-like [Cucumis sativus]
 gb|KGN66585.1| hypothetical protein Csa_1G632370 [Cucumis sativus]
Length=959

 Score =   107 bits (266),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 73/120 (61%), Gaps = 7/120 (6%)
 Frame = -2

Query  339  WEECYYEP------PEVSSSKLAFNNWGACWASDEVLNSRPVQAGEG-VQALVNKMMMEN  181
            WEEC+Y+P          SSK        CW   +  +S     GE  + +L++KM +  
Sbjct  36   WEECHYQPLPSFDSSGSGSSKFPLGELEGCWGYSQSSSSFQANHGEDKLYSLIHKMTLNK  95

Query  180  QFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
               +VGEG+ GRAA TG+H WILS   +R+AYP EVL EL QQF AG++T+AVIPVLPHG
Sbjct  96   HISLVGEGIVGRAAFTGNHLWILSSNYTRDAYPPEVLSELHQQFLAGMQTVAVIPVLPHG  155



>ref|XP_006408683.1| hypothetical protein EUTSA_v10001928mg [Eutrema salsugineum]
 dbj|BAJ33802.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ50136.1| hypothetical protein EUTSA_v10001928mg [Eutrema salsugineum]
Length=655

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 67/113 (59%), Gaps = 11/113 (10%)
 Frame = -2

Query  339  WEECYYEPPEVSSSKLAFNNWGACWASDEVLNSRPVQAGEGVQALVNKMMMENQFKVVGE  160
            WEECY E    SS     +  G              Q  E VQ L N+MM+ N+  +VGE
Sbjct  36   WEECYNETASTSSVPRRGSGLGI-----------DTQGNEKVQLLTNRMMLNNRIILVGE  84

Query  159  GLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
            GL GRAA TGHH WIL+   +R+ +P EV+ E+  QFSAGI+T+AV PV+PHG
Sbjct  85   GLVGRAAFTGHHQWILANSFNRDVHPPEVINEMLLQFSAGIQTVAVFPVVPHG  137



>ref|XP_007015676.1| Transcription factor-related, putative isoform 2 [Theobroma cacao]
 gb|EOY33295.1| Transcription factor-related, putative isoform 2 [Theobroma cacao]
Length=779

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 73/122 (60%), Gaps = 11/122 (9%)
 Frame = -2

Query  339  WEECYYEPP---------EVSSSKLAFNNWGACWASDEVLNSRPVQAGEGVQALVNKMMM  187
            WEECYYEP           V + +L F  W   W S E  +    Q  + V  L+NKMM 
Sbjct  36   WEECYYEPTLSAVPPCIAGVENRELPFGEWEGDWGS-ETSSQLGSQPWDKVHLLINKMM-  93

Query  186  ENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLP  7
             N+  +VG+GL GRAA TG+H WIL+     + +P EVL E+  QFSAG++T+AVIPVLP
Sbjct  94   NNRINIVGQGLVGRAAFTGNHQWILANNYITDTHPPEVLNEVHLQFSAGMQTVAVIPVLP  153

Query  6    HG  1
            HG
Sbjct  154  HG  155



>ref|XP_007015675.1| Transcription factor-related, putative isoform 1 [Theobroma cacao]
 gb|EOY33294.1| Transcription factor-related, putative isoform 1 [Theobroma cacao]
Length=921

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 73/122 (60%), Gaps = 11/122 (9%)
 Frame = -2

Query  339  WEECYYEPP---------EVSSSKLAFNNWGACWASDEVLNSRPVQAGEGVQALVNKMMM  187
            WEECYYEP           V + +L F  W   W S E  +    Q  + V  L+NKMM 
Sbjct  36   WEECYYEPTLSAVPPCIAGVENRELPFGEWEGDWGS-ETSSQLGSQPWDKVHLLINKMM-  93

Query  186  ENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLP  7
             N+  +VG+GL GRAA TG+H WIL+     + +P EVL E+  QFSAG++T+AVIPVLP
Sbjct  94   NNRINIVGQGLVGRAAFTGNHQWILANNYITDTHPPEVLNEVHLQFSAGMQTVAVIPVLP  153

Query  6    HG  1
            HG
Sbjct  154  HG  155



>dbj|BAH19848.1| AT2G27230 [Arabidopsis thaliana]
Length=650

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 68/113 (60%), Gaps = 12/113 (11%)
 Frame = -2

Query  339  WEECYYEPPEVSSSKLAFNNWGACWASDEVLNSRPVQAGEGVQALVNKMMMENQFKVVGE  160
            WEECY E  E SS+       G              Q  E VQ L N+MM+ N+  +VGE
Sbjct  36   WEECYNET-ESSSNPRRLCGLGV-----------DTQGNEKVQLLTNRMMLNNRIILVGE  83

Query  159  GLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
            GL GRAA TGHH WIL+   +R+ +P EV+ E+  QFSAGI+T+AV PV+PHG
Sbjct  84   GLVGRAAFTGHHQWILANSFNRDVHPPEVINEMLLQFSAGIQTVAVFPVVPHG  136



>ref|NP_565640.1| transcription factor LHW [Arabidopsis thaliana]
 ref|NP_001031430.1| transcription factor LHW [Arabidopsis thaliana]
 sp|Q9XIN0.1|LHW_ARATH RecName: Full=Transcription factor LHW; AltName: Full=BHLH transcription 
factor delta; Short=bHLH delta; AltName: Full=Basic 
helix-loop-helix protein 156; Short=AtbHLH156; Short=bHLH 
156; AltName: Full=Protein LONESOME HIGHWAY; AltName: Full=bHLH 
transcription factor bHLH156 [Arabidopsis thaliana]
 gb|AAD42006.1| expressed protein [Arabidopsis thaliana]
 emb|CAE09170.1| bHLH transcription factor [Arabidopsis thaliana]
 dbj|BAH30404.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC07959.1| transcription factor LHW [Arabidopsis thaliana]
 gb|AEC07960.1| transcription factor LHW [Arabidopsis thaliana]
Length=650

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 68/113 (60%), Gaps = 12/113 (11%)
 Frame = -2

Query  339  WEECYYEPPEVSSSKLAFNNWGACWASDEVLNSRPVQAGEGVQALVNKMMMENQFKVVGE  160
            WEECY E  E SS+       G              Q  E VQ L N+MM+ N+  +VGE
Sbjct  36   WEECYNET-ESSSNPRRLCGLGV-----------DTQGNEKVQLLTNRMMLNNRIILVGE  83

Query  159  GLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
            GL GRAA TGHH WIL+   +R+ +P EV+ E+  QFSAGI+T+AV PV+PHG
Sbjct  84   GLVGRAAFTGHHQWILANSFNRDVHPPEVINEMLLQFSAGIQTVAVFPVVPHG  136



>ref|XP_007132495.1| hypothetical protein PHAVU_011G098900g [Phaseolus vulgaris]
 gb|ESW04489.1| hypothetical protein PHAVU_011G098900g [Phaseolus vulgaris]
Length=949

 Score =   103 bits (257),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 71/120 (59%), Gaps = 9/120 (8%)
 Frame = -2

Query  339  WEECYYEP-------PEVSSSKLAFNNWGACWASDEVLNSRPVQAGEGVQALVNKMMMEN  181
            WE+ YYEP         V  S   + +   CW S E  +   +Q  + V  L+NKM++ N
Sbjct  36   WEDHYYEPLPSPFPPRTVGMSNFPYRDGEGCWFSSE--SQLGIQEEDRVGGLINKMIVNN  93

Query  180  QFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
               + GEG+ GRA  TG++ WIL    SR+AYP EV  EL  QFSAG++T+AVIPVLPHG
Sbjct  94   SVSIAGEGIVGRATFTGNYQWILMNNFSRDAYPPEVYPELLYQFSAGMQTVAVIPVLPHG  153



>gb|KHG29075.1| hypothetical protein F383_03858 [Gossypium arboreum]
Length=859

 Score =   103 bits (256),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 55/115 (48%), Positives = 71/115 (62%), Gaps = 4/115 (3%)
 Frame = -2

Query  339  WEECYYEP--PEVSSSKLAFNNWGACWASDEVLNSRPVQAGEGVQALVNKMMMENQFKVV  166
            WEE YYE   P +   +L F  WG C  SD   +    Q  + V  L++KMM  N+  +V
Sbjct  36   WEEYYYESTLPGLRYPELLFQEWGECCGSDTS-SQLGCQPWDKVGLLISKMM-NNRIVIV  93

Query  165  GEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
            G+GL GRAA TG+H WIL+     ++ P EVL EL  QFSAG++T+AVIPV PHG
Sbjct  94   GQGLVGRAAFTGNHQWILANSYMTDSEPPEVLNELHLQFSAGMQTVAVIPVFPHG  148



>ref|XP_002879076.1| hypothetical protein ARALYDRAFT_481620 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55335.1| hypothetical protein ARALYDRAFT_481620 [Arabidopsis lyrata subsp. 
lyrata]
Length=656

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 67/113 (59%), Gaps = 12/113 (11%)
 Frame = -2

Query  339  WEECYYEPPEVSSSKLAFNNWGACWASDEVLNSRPVQAGEGVQALVNKMMMENQFKVVGE  160
            WEECY E    SS+       G              Q  E VQ L N+MM+ N+  +VGE
Sbjct  36   WEECYNETAS-SSNPRRLCGLGV-----------DTQGNEKVQLLTNRMMLNNRIILVGE  83

Query  159  GLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
            GL GRAA TGHH WIL+   +R+ +P EV+ E+  QFSAGI+T+AV PV+PHG
Sbjct  84   GLVGRAAFTGHHQWILANSFNRDVHPPEVINEMLLQFSAGIQTVAVFPVVPHG  136



>gb|KHG26450.1| hypothetical protein F383_09948 [Gossypium arboreum]
Length=906

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 72/122 (59%), Gaps = 9/122 (7%)
 Frame = -2

Query  339  WEECYYEPPEVSSS---------KLAFNNWGACWASDEVLNSRPVQAGEGVQALVNKMMM  187
            WEEC+Y+P   S S         +L+F     CW  +        +  + V  L+NKM +
Sbjct  36   WEECFYQPAPSSVSPSLVGVQNPELSFGEREGCWGLETSSQLGSQKWDDKVHLLINKMNI  95

Query  186  ENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLP  7
             N+  +VG+GL GRAA TG+H WIL+     +A+P EVL E+  Q SAG++T+AVIPVLP
Sbjct  96   NNRINIVGQGLVGRAAFTGNHQWILANNYVTDAHPPEVLNEVQLQVSAGMQTVAVIPVLP  155

Query  6    HG  1
            HG
Sbjct  156  HG  157



>ref|XP_007150023.1| hypothetical protein PHAVU_005G119400g [Phaseolus vulgaris]
 gb|ESW22017.1| hypothetical protein PHAVU_005G119400g [Phaseolus vulgaris]
Length=956

 Score =   102 bits (254),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 52/119 (44%), Positives = 71/119 (60%), Gaps = 6/119 (5%)
 Frame = -2

Query  339  WEECYYEP-----PEVSSSKLAFNNWGACW-ASDEVLNSRPVQAGEGVQALVNKMMMENQ  178
            WEECYYEP     P      L ++N G  W +S    +   +Q  + V +L+ KM + N 
Sbjct  36   WEECYYEPLPCPPPMFGIGDLPYHNGGGHWFSSGSQSSQLGIQEEDRVNSLIKKMTVNNS  95

Query  177  FKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
              + GEG+ GRAA TG+H WIL    +++  P E+  E+  QFSAGI+T+AVIPVLPHG
Sbjct  96   VIIAGEGMIGRAAFTGNHQWILLNSFTKDVNPPELYPEVHHQFSAGIQTVAVIPVLPHG  154



>ref|XP_010247149.1| PREDICTED: transcription factor LHW-like isoform X1 [Nelumbo 
nucifera]
Length=972

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 74/122 (61%), Gaps = 10/122 (8%)
 Frame = -2

Query  339  WEECYYEPPEVSS---------SKLAFNNWGACWASDEVLNSRPVQAGEGVQALVNKMMM  187
            WEECYYEP  +S+         ++L    W    ++ E   SRP Q  + V +LVNKM++
Sbjct  36   WEECYYEPARLSAFPGISGNEGTELLSKEWEGLGSASEGQPSRP-QVDDRVCSLVNKMII  94

Query  186  ENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLP  7
              Q  VVGEG+ GRAA TG H WIL       A+P EV+ E+  QF +G++TIAVIPVLP
Sbjct  95   NGQVHVVGEGIVGRAAFTGAHLWILPGNCLGVAHPSEVMAEVHHQFLSGMQTIAVIPVLP  154

Query  6    HG  1
            HG
Sbjct  155  HG  156



>ref|XP_010247158.1| PREDICTED: transcription factor LHW-like isoform X2 [Nelumbo 
nucifera]
Length=930

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 74/122 (61%), Gaps = 10/122 (8%)
 Frame = -2

Query  339  WEECYYEPPEVSS---------SKLAFNNWGACWASDEVLNSRPVQAGEGVQALVNKMMM  187
            WEECYYEP  +S+         ++L    W    ++ E   SRP Q  + V +LVNKM++
Sbjct  36   WEECYYEPARLSAFPGISGNEGTELLSKEWEGLGSASEGQPSRP-QVDDRVCSLVNKMII  94

Query  186  ENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLP  7
              Q  VVGEG+ GRAA TG H WIL       A+P EV+ E+  QF +G++TIAVIPVLP
Sbjct  95   NGQVHVVGEGIVGRAAFTGAHLWILPGNCLGVAHPSEVMAEVHHQFLSGMQTIAVIPVLP  154

Query  6    HG  1
            HG
Sbjct  155  HG  156



>ref|XP_004487450.1| PREDICTED: transcription factor LHW-like isoform X1 [Cicer arietinum]
 ref|XP_004487451.1| PREDICTED: transcription factor LHW-like isoform X2 [Cicer arietinum]
Length=848

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 71/121 (59%), Gaps = 8/121 (7%)
 Frame = -2

Query  339  WEECYYEP-----PE--VSSSKLAFNNWGACWASDEVLNSR-PVQAGEGVQALVNKMMME  184
            WEECY+EP     P   V  S     N   CW S E  +    +Q  + V +L+NKM + 
Sbjct  36   WEECYHEPLLCPSPRGIVGMSNFPNQNGEGCWFSSESQSFHLGIQEEDKVSSLINKMTVN  95

Query  183  NQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPH  4
            N   V GEG+ GRAA T  H WIL    +++AYP EV  E+  QFSAG++T+AVIPVLPH
Sbjct  96   NLVIVAGEGMIGRAAFTNSHQWILLNNFAKDAYPPEVYAEVHHQFSAGMQTVAVIPVLPH  155

Query  3    G  1
            G
Sbjct  156  G  156



>ref|XP_003596884.1| Transcription factor ABA-INDUCIBLE bHLH-TYPE [Medicago truncatula]
Length=293

 Score = 98.6 bits (244),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 68/121 (56%), Gaps = 8/121 (7%)
 Frame = -2

Query  339  WEECYYEPPEVSS-------SKLAFNNWGACWASDEVLNSR-PVQAGEGVQALVNKMMME  184
            WEECYYEP    S       S     N    W S E  +    +Q  + V +LVNKM + 
Sbjct  37   WEECYYEPVSCPSPHGIDGMSNFPNPNGEGSWFSSEFQSPHLGIQEEDKVSSLVNKMTVN  96

Query  183  NQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPH  4
            N   V GEG+ GR+A T  H WIL    ++ AYP EV  E+  QFSAG++T+AVIPVLPH
Sbjct  97   NLVIVAGEGIIGRSAFTNSHEWILLNDFAKNAYPPEVYAEMHDQFSAGMQTVAVIPVLPH  156

Query  3    G  1
            G
Sbjct  157  G  157



>ref|XP_006293814.1| hypothetical protein CARUB_v10022796mg [Capsella rubella]
 ref|XP_006293815.1| hypothetical protein CARUB_v10022796mg [Capsella rubella]
 gb|EOA26712.1| hypothetical protein CARUB_v10022796mg [Capsella rubella]
 gb|EOA26713.1| hypothetical protein CARUB_v10022796mg [Capsella rubella]
Length=662

 Score =   100 bits (250),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 67/113 (59%), Gaps = 12/113 (11%)
 Frame = -2

Query  339  WEECYYEPPEVSSSKLAFNNWGACWASDEVLNSRPVQAGEGVQALVNKMMMENQFKVVGE  160
            WEECY E    S  +        C    +       Q  + VQ L N+MM+ N+  +VGE
Sbjct  36   WEECYNETASSSHPRRV------CGLGVDT------QGNDKVQLLTNRMMLNNRIILVGE  83

Query  159  GLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
            GL GRAA TGHH WIL+   +R+ +P EV+ E+  QFSAGI+T+AV PV+PHG
Sbjct  84   GLVGRAAFTGHHQWILANSFNRDVHPPEVINEMLLQFSAGIQTVAVFPVVPHG  136



>ref|XP_008450293.1| PREDICTED: transcription factor LHW isoform X2 [Cucumis melo]
Length=913

 Score =   100 bits (250),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 72/120 (60%), Gaps = 7/120 (6%)
 Frame = -2

Query  339  WEECYYEP------PEVSSSKLAFNNWGACWASDEVLNSRPVQAGEG-VQALVNKMMMEN  181
            WEEC+Y+P          SSK        CW   +  +S     GE  + +L++KM +  
Sbjct  36   WEECHYQPLPSFDSSGSESSKFPLGELEGCWGYSQSSSSLQSNHGEDKLYSLIHKMNLNK  95

Query  180  QFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
               +VGEG+ GRAA  G+H WILS   +R+AYP EVL EL QQF AG++T+AVIPVLPHG
Sbjct  96   HVSLVGEGIVGRAAFIGNHLWILSSNYTRDAYPPEVLSELHQQFLAGMQTVAVIPVLPHG  155



>ref|XP_008450292.1| PREDICTED: transcription factor LHW isoform X1 [Cucumis melo]
Length=961

 Score =   100 bits (250),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 72/120 (60%), Gaps = 7/120 (6%)
 Frame = -2

Query  339  WEECYYEP------PEVSSSKLAFNNWGACWASDEVLNSRPVQAGEG-VQALVNKMMMEN  181
            WEEC+Y+P          SSK        CW   +  +S     GE  + +L++KM +  
Sbjct  36   WEECHYQPLPSFDSSGSESSKFPLGELEGCWGYSQSSSSLQSNHGEDKLYSLIHKMNLNK  95

Query  180  QFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
               +VGEG+ GRAA  G+H WILS   +R+AYP EVL EL QQF AG++T+AVIPVLPHG
Sbjct  96   HVSLVGEGIVGRAAFIGNHLWILSSNYTRDAYPPEVLSELHQQFLAGMQTVAVIPVLPHG  155



>ref|XP_010417875.1| PREDICTED: transcription factor LHW-like [Camelina sativa]
Length=659

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 67/113 (59%), Gaps = 12/113 (11%)
 Frame = -2

Query  339  WEECYYEPPEVSSSKLAFNNWGACWASDEVLNSRPVQAGEGVQALVNKMMMENQFKVVGE  160
            WEECY +    SS     +  G              Q  + VQ L N+MM+ N+  +VGE
Sbjct  36   WEECYNDTAS-SSHPRRVSGLGI-----------DAQGNDKVQLLTNRMMLNNRIILVGE  83

Query  159  GLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
            GL GRAA TGHH WIL+   +R+ +P EV+ E+  QFSAGI+T+AV PV+PHG
Sbjct  84   GLVGRAAFTGHHQWILANSFNRDVHPPEVINEMLLQFSAGIQTVAVFPVVPHG  136



>ref|XP_010510793.1| PREDICTED: transcription factor LHW-like isoform X1 [Camelina 
sativa]
Length=659

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 67/113 (59%), Gaps = 12/113 (11%)
 Frame = -2

Query  339  WEECYYEPPEVSSSKLAFNNWGACWASDEVLNSRPVQAGEGVQALVNKMMMENQFKVVGE  160
            WEECY +    SS     +  G              Q  + VQ L N+MM+ N+  +VGE
Sbjct  36   WEECYNDTAS-SSHPRRVSGLGI-----------DAQGNDKVQLLTNRMMLNNRIILVGE  83

Query  159  GLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
            GL GRAA TGHH WIL+   +R+ +P EV+ E+  QFSAGI+T+AV PV+PHG
Sbjct  84   GLVGRAAFTGHHQWILANSFNRDVHPPEVINEMLLQFSAGIQTVAVFPVVPHG  136



>ref|XP_010473116.1| PREDICTED: transcription factor LHW [Camelina sativa]
Length=660

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 67/113 (59%), Gaps = 12/113 (11%)
 Frame = -2

Query  339  WEECYYEPPEVSSSKLAFNNWGACWASDEVLNSRPVQAGEGVQALVNKMMMENQFKVVGE  160
            WEECY +    SS     +  G              Q  + VQ L N+MM+ N+  +VGE
Sbjct  36   WEECYNDTAS-SSHPRRVSGLGI-----------DAQGNDKVQLLTNRMMLNNRIILVGE  83

Query  159  GLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
            GL GRAA TGHH WIL+   +R+ +P EV+ E+  QFSAGI+T+AV PV+PHG
Sbjct  84   GLVGRAAFTGHHQWILANSFNRDVHPPEVINEMLLQFSAGIQTVAVFPVVPHG  136



>ref|XP_010263009.1| PREDICTED: transcription factor LHW-like [Nelumbo nucifera]
Length=943

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 70/114 (61%), Gaps = 17/114 (15%)
 Frame = -2

Query  339  WEECYYEPPEVSSSKLAFNNWGACWASDEVLNSRPVQAGEGVQALVNKMMMENQFKVVGE  160
            WEECYYEP              A ++ +  L+    Q  E V +LVNKM + NQ  VVGE
Sbjct  36   WEECYYEP--------------ARYSPESRLSQLGCQVDE-VCSLVNKMTINNQIHVVGE  80

Query  159  GLAGRAAVTGHHHWILSQGNS-REAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
            G+ GRAA TG H WIL QGN   E +P EVL E+  QF AG++TIAVIPVLPHG
Sbjct  81   GIVGRAAFTGTHLWIL-QGNCIGEGHPSEVLAEVHHQFLAGMQTIAVIPVLPHG  133



>gb|KEH38995.1| bHLH transcription factor-like protein [Medicago truncatula]
Length=881

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 68/121 (56%), Gaps = 8/121 (7%)
 Frame = -2

Query  339  WEECYYEPPEVSS-------SKLAFNNWGACWASDEVLNSR-PVQAGEGVQALVNKMMME  184
            WEECYYEP    S       S     N    W S E  +    +Q  + V +LVNKM + 
Sbjct  37   WEECYYEPVSCPSPHGIDGMSNFPNPNGEGSWFSSEFQSPHLGIQEEDKVSSLVNKMTVN  96

Query  183  NQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPH  4
            N   V GEG+ GR+A T  H WIL    ++ AYP EV  E+  QFSAG++T+AVIPVLPH
Sbjct  97   NLVIVAGEGIIGRSAFTNSHEWILLNDFAKNAYPPEVYAEMHDQFSAGMQTVAVIPVLPH  156

Query  3    G  1
            G
Sbjct  157  G  157



>ref|XP_010557442.1| PREDICTED: transcription factor LHW-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010557443.1| PREDICTED: transcription factor LHW-like isoform X1 [Tarenaya 
hassleriana]
Length=676

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 69/113 (61%), Gaps = 9/113 (8%)
 Frame = -2

Query  339  WEECYYEPPEVSSSKLAFNNWGACWASDEVLNSRPVQAGEGVQALVNKMMMENQFKVVGE  160
            WEECY+E   VSS     + +     S         +  E +  L N+MM+ ++  +VGE
Sbjct  36   WEECYHET-TVSSLPPRISGFSPSHVS--------TRGSEKIPLLTNRMMLNSRIVLVGE  86

Query  159  GLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
            GL GRAA  GHH WIL+   +R+ +P EV+ E+  QFSAGI+T+AV+PVLPHG
Sbjct  87   GLVGRAAFAGHHQWILANRFNRDVHPPEVINEMLLQFSAGIQTVAVVPVLPHG  139



>emb|CDX77102.1| BnaC04g38970D [Brassica napus]
Length=620

 Score = 97.1 bits (240),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  AGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQF  49
            + E VQ L N+MM+ N+  +VGEGL GRAA TGHH W+L+   +R+ +P EV+ E+  QF
Sbjct  45   SNENVQLLTNRMMLNNRIILVGEGLVGRAAFTGHHQWLLANSFNRDVHPPEVINEMLLQF  104

Query  48   SAGIETIAVIPVLPHG  1
            SAGI+T+AV PV+PHG
Sbjct  105  SAGIQTVAVFPVVPHG  120



>ref|XP_009140783.1| PREDICTED: transcription factor LHW [Brassica rapa]
Length=620

 Score = 97.1 bits (240),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 63/113 (56%), Gaps = 28/113 (25%)
 Frame = -2

Query  339  WEECYYEPPEVSSSKLAFNNWGACWASDEVLNSRPVQAGEGVQALVNKMMMENQFKVVGE  160
            WEECY E                             +  E VQ L N+MM+ N+  +VGE
Sbjct  36   WEECYNE----------------------------TEGNENVQLLTNRMMLNNRIILVGE  67

Query  159  GLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
            GL GRAA TGHH W+L+   +R+ +P EV+ E+  QFSAGI+T+AV PV+PHG
Sbjct  68   GLVGRAAFTGHHQWLLANTFNRDVHPPEVINEMLLQFSAGIQTVAVFPVVPHG  120



>emb|CDY30564.1| BnaA04g15690D [Brassica napus]
Length=621

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  AGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQF  49
            + E VQ L N+MM+ N+  +VGEGL GRAA TGHH W+L+   +R+ +P EV+ E+  QF
Sbjct  45   SNENVQLLTNRMMLNNRIILVGEGLVGRAAFTGHHQWLLANTFNRDVHPPEVINEMLLQF  104

Query  48   SAGIETIAVIPVLPHG  1
            SAGI+T+AV PV+PHG
Sbjct  105  SAGIQTVAVFPVVPHG  120



>emb|CDX71466.1| BnaC04g17010D [Brassica napus]
Length=574

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 61/95 (64%), Gaps = 2/95 (2%)
 Frame = -2

Query  279  WGACWASDEVLNSRPVQAGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHHHWILSQG-  103
            W +    +E  N   V   E VQ L N+MM+ N+  +VGEGL GRAA TGHH WIL+   
Sbjct  2    WCSLLIWEECYNETSVSGNENVQLLTNRMMLNNRIILVGEGLVGRAAFTGHHQWILAADS  61

Query  102  -NSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
             N    +P EV+ E+  QFSAGI+T+AVIPV+PHG
Sbjct  62   FNRGGVHPPEVINEMLLQFSAGIQTVAVIPVVPHG  96



>gb|EYU28511.1| hypothetical protein MIMGU_mgv1a003404mg [Erythranthe guttata]
Length=587

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 43/65 (66%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = -2

Query  195  MMMENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIP  16
            MMM+NQ  +VGEGL GR A TG+H WI+S     EA+P EVLKE+ QQFSAG++T+AVIP
Sbjct  1    MMMDNQVNIVGEGLVGRVAFTGNHQWIVSDNCFGEAHPPEVLKEVCQQFSAGMQTVAVIP  60

Query  15   VLPHG  1
            VLPHG
Sbjct  61   VLPHG  65



>gb|KFK33154.1| hypothetical protein AALP_AA6G337700 [Arabis alpina]
Length=637

 Score = 94.0 bits (232),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = -2

Query  234  VQAGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQ  55
            ++A   +  L N+MM+ N+  +VGEGL GRAA TGHH WILS   +R  +P EV+ E+  
Sbjct  41   IEATSKLDLLTNRMMLNNRIILVGEGLVGRAAFTGHHQWILSNSFNRHLHPPEVINEMLL  100

Query  54   QFSAGIETIAVIPVLPHG  1
            QFSAG++T+AV PV+PHG
Sbjct  101  QFSAGVQTVAVFPVVPHG  118



>ref|XP_010045177.1| PREDICTED: transcription factor LHW-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW87330.1| hypothetical protein EUGRSUZ_B03816 [Eucalyptus grandis]
Length=940

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 67/119 (56%), Gaps = 18/119 (15%)
 Frame = -2

Query  339  WEECYYEP------PEVSSSKLAFNNWGACWASDEVLNSRPVQAGEGVQALVNKMMMENQ  178
            WEECYYEP      P+VS S  +    G   A D V            Q L+ +MM + Q
Sbjct  36   WEECYYEPMTFSLPPQVSGSGPSEAPPGGWEAKDRV------------QMLIERMMTKAQ  83

Query  177  FKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
              VVGEG+ GRAA TG H WI+S      A+P EV+ E+  QFSAGI+T+AVIPV  HG
Sbjct  84   ISVVGEGIIGRAAFTGDHEWIVSTSYGGHAHPPEVVNEVHHQFSAGIQTVAVIPVPLHG  142



>ref|XP_011003843.1| PREDICTED: transcription factor LHW-like [Populus euphratica]
Length=966

 Score = 92.0 bits (227),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 70/122 (57%), Gaps = 9/122 (7%)
 Frame = -2

Query  339  WEECYYEP------PEVSSSK---LAFNNWGACWASDEVLNSRPVQAGEGVQALVNKMMM  187
            WEEC  E       P  S ++   L F        S+   +   V  G+ ++ L+NKMM 
Sbjct  36   WEECNSESTLCSVSPSTSGTENLVLPFREREGYLGSEVHSSQFGVHEGDRLRLLINKMMA  95

Query  186  ENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLP  7
             NQ  +VGEG+ GRAA TG+H WIL+    R+A+P E L E   QFSAG++TIAV+PV P
Sbjct  96   NNQVIIVGEGIVGRAAFTGNHEWILANNCCRDAHPPEGLNEAHLQFSAGMQTIAVVPVCP  155

Query  6    HG  1
            +G
Sbjct  156  YG  157



>ref|XP_011010233.1| PREDICTED: transcription factor LHW-like [Populus euphratica]
Length=966

 Score = 92.0 bits (227),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 70/122 (57%), Gaps = 9/122 (7%)
 Frame = -2

Query  339  WEECYYEP------PEVSSSK---LAFNNWGACWASDEVLNSRPVQAGEGVQALVNKMMM  187
            WEEC  E       P  S ++   L F        S+   +   V  G+ ++ L+NKMM 
Sbjct  36   WEECNSESTLCSVSPSTSGTENLVLPFREREGYLGSEVHSSQFGVHEGDRLRLLINKMMA  95

Query  186  ENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLP  7
             NQ  +VGEG+ GRAA TG+H WIL+    R+A+P E L E   QFSAG++TIAV+PV P
Sbjct  96   NNQVIIVGEGIVGRAAFTGNHEWILANNCCRDAHPPEGLNEAHLQFSAGMQTIAVVPVCP  155

Query  6    HG  1
            +G
Sbjct  156  YG  157



>ref|XP_008338600.1| PREDICTED: transcription factor LHW [Malus domestica]
Length=134

 Score = 85.9 bits (211),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 59/99 (60%), Gaps = 10/99 (10%)
 Frame = -2

Query  339  WEECYYEPPEVSSSK---------LAFNNWGACWASDEVLNS-RPVQAGEGVQALVNKMM  190
            WEEC+YEP   S  K         L F  W  CW S EV +S   +Q  E V +L+N MM
Sbjct  36   WEECHYEPSISSLPKHIAGTERAELPFGEWEGCWVSSEVCSSSNGIQQEERVSSLINTMM  95

Query  189  MENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEV  73
            ++  F +VGEG+ GRAA TG+H WILS   +++A+P EV
Sbjct  96   IDKPFNIVGEGIVGRAAFTGNHQWILSGNYTKDAHPPEV  134



>ref|XP_010544333.1| PREDICTED: transcription factor LHW-like [Tarenaya hassleriana]
Length=604

 Score = 88.2 bits (217),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 38/65 (58%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = -2

Query  195  MMMENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIP  16
            MM+ N+  +VGEGL GRAA TGHH WIL+   +R  +P EV+ E+  QFSAGI+T+AV+P
Sbjct  1    MMLNNRIILVGEGLVGRAAFTGHHQWILANSFNRNIHPPEVINEMLLQFSAGIQTVAVVP  60

Query  15   VLPHG  1
            V+PHG
Sbjct  61   VIPHG  65



>ref|XP_010510794.1| PREDICTED: transcription factor LHW-like isoform X2 [Camelina 
sativa]
Length=588

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = -2

Query  195  MMMENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIP  16
            MM+ N+  +VGEGL GRAA TGHH WIL+   +R+ +P EV+ E+  QFSAGI+T+AV P
Sbjct  1    MMLNNRIILVGEGLVGRAAFTGHHQWILANSFNRDVHPPEVINEMLLQFSAGIQTVAVFP  60

Query  15   VLPHG  1
            V+PHG
Sbjct  61   VVPHG  65



>ref|XP_006378984.1| hypothetical protein POPTR_0009s02270g [Populus trichocarpa]
 gb|ERP56781.1| hypothetical protein POPTR_0009s02270g [Populus trichocarpa]
Length=874

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 37/65 (57%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = -2

Query  195  MMMENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIP  16
            MM  NQ  +VGEG+ GRAA TG+H WIL+    ++A+P EVL E   QFSAG++TIAV+P
Sbjct  1    MMANNQVIIVGEGIVGRAAFTGNHEWILANNYCKDAHPPEVLNEAHHQFSAGMQTIAVVP  60

Query  15   VLPHG  1
            V P+G
Sbjct  61   VCPYG  65



>ref|XP_010523120.1| PREDICTED: transcription factor LHW [Tarenaya hassleriana]
Length=719

 Score = 82.8 bits (203),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 63/103 (61%), Gaps = 7/103 (7%)
 Frame = -2

Query  339  WEECYYEPPEVSSSKLAFNNWGACWASDEVLNSRPVQAGEGVQALVNKMMMENQFKVVGE  160
            WEECY+E    S S  +     + ++S E+  S      E V  L N+MM+ N+  +VGE
Sbjct  36   WEECYHE---TSPSPSSLPPRISGFSSSEIDTS----GNEKVPFLTNRMMLNNRIILVGE  88

Query  159  GLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIET  31
            GL GRAA TGHH WIL  G +R+ +P EV+ E+  QFSAGI+T
Sbjct  89   GLVGRAAFTGHHQWILVNGFNRDLHPPEVINEMLLQFSAGIQT  131



>gb|EPS58801.1| hypothetical protein M569_16013, partial [Genlisea aurea]
Length=107

 Score = 76.6 bits (187),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 55/72 (76%), Gaps = 3/72 (4%)
 Frame = -2

Query  207  LVNKMMMENQFKVVGE-GLAGRAAVTGHHHWI-LSQGNSREA-YPLEVLKELSQQFSAGI  37
            L++KMM++++ +V GE GL G  A TG HHWI L   +  EA +P +VL++L +QFSAG+
Sbjct  1    LLSKMMVDDRVQVTGEEGLVGEVAFTGKHHWIQLGNFHGEEAAFPPKVLRDLKRQFSAGV  60

Query  36   ETIAVIPVLPHG  1
            +T+AVIPVLPHG
Sbjct  61   QTVAVIPVLPHG  72



>gb|KEH29771.1| bHLH transcription factor-like protein [Medicago truncatula]
Length=833

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -2

Query  195  MMMENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIP  16
            MM+ N   V G+G+ GRAA TG+H WIL     ++ YP EVL E+  QFSAG++T+ VIP
Sbjct  1    MMVNNSVNVAGQGILGRAAFTGNHQWILLNNFIKDVYPPEVLNEVHCQFSAGMQTVVVIP  60

Query  15   VLPHG  1
            VLPHG
Sbjct  61   VLPHG  65



>gb|EPS62250.1| hypothetical protein M569_12543, partial [Genlisea aurea]
Length=94

 Score = 73.2 bits (178),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = -2

Query  207  LVNKMMMENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETI  28
            L+NKMM+     V+GEGL GRAA TG + WI  +      +P EV KE+ QQ+  GI+T+
Sbjct  6    LMNKMMLNCNVVVLGEGLVGRAAFTGSYQWIDCEKFYGHCHPPEVKKEICQQYLFGIQTV  65

Query  27   AVIPVLPHG  1
            AVIPVLP G
Sbjct  66   AVIPVLPQG  74



>ref|XP_010031562.1| PREDICTED: transcription factor LHW-like isoform X2 [Eucalyptus 
grandis]
Length=183

 Score = 74.3 bits (181),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 61/103 (59%), Gaps = 10/103 (10%)
 Frame = -2

Query  339  WEECYYEP------PEVSSS---KLAFNNWGACWASDEVLNSRP-VQAGEGVQALVNKMM  190
            WEECYYEP      P  + S   K+    +  C  + E   + P   A + +++L++KMM
Sbjct  36   WEECYYEPLRCCVPPSTAVSVIGKVPMGEFDGCLVTPENQFAMPENHAADKIESLIDKMM  95

Query  189  MENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKEL  61
            +++   +VGEG+ GRAA TG+H WILS   + +AYP E+++ +
Sbjct  96   IKDHINIVGEGIIGRAAFTGNHLWILSSSYNGDAYPPEIMENV  138



>ref|XP_009103583.1| PREDICTED: transcription factor LHW-like [Brassica rapa]
Length=599

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = -2

Query  258  DEVLNSRPVQAGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHHHWILSQGNSREA-YP  82
            +E  N   +   E VQ L N+MM+ N+  +VGEGL GRAA TGHH WIL+   +R   +P
Sbjct  37   EECYNETSLSGNENVQLLTNRMMLNNRIILVGEGLVGRAAFTGHHQWILADSFNRGGVHP  96

Query  81   LEVLKELSQQFSAGIET  31
             EV+ E+  QFSAGI+T
Sbjct  97   PEVINEMLLQFSAGIQT  113



>ref|XP_010031561.1| PREDICTED: transcription factor LHW-like isoform X1 [Eucalyptus 
grandis]
Length=213

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 61/103 (59%), Gaps = 10/103 (10%)
 Frame = -2

Query  339  WEECYYEP------PEVSSS---KLAFNNWGACWASDEVLNSRP-VQAGEGVQALVNKMM  190
            WEECYYEP      P  + S   K+    +  C  + E   + P   A + +++L++KMM
Sbjct  36   WEECYYEPLRCCVPPSTAVSVIGKVPMGEFDGCLVTPENQFAMPENHAADKIESLIDKMM  95

Query  189  MENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKEL  61
            +++   +VGEG+ GRAA TG+H WILS   + +AYP E+++ +
Sbjct  96   IKDHINIVGEGIIGRAAFTGNHLWILSSSYNGDAYPPEIMENV  138



>gb|ABA91568.2| expressed protein [Oryza sativa Japonica Group]
 gb|EEE51685.1| hypothetical protein OsJ_33044 [Oryza sativa Japonica Group]
Length=902

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = -2

Query  210  ALVNKMMMENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIET  31
            +LVNK+M  +Q  VVGEG  GRAA TG+H WI+    +    P EV  E+S QF  GI+T
Sbjct  72   SLVNKVMA-SQVHVVGEGTVGRAAFTGNHQWIIHGTANDHGIPSEVAAEMSYQFRVGIQT  130

Query  30   IAVIPVLPHG  1
            IA+IPVLP G
Sbjct  131  IAIIPVLPRG  140



>emb|CDY04483.1| BnaA07g13090D [Brassica napus]
Length=599

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 52/84 (62%), Gaps = 7/84 (8%)
 Frame = -2

Query  279  WGACWASDEVLNSRPVQAGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHHHWILSQGN  100
            W  C+  DE   S      E VQ L N+MM+ N+  +VGEGL GRAA TGHH WIL+   
Sbjct  36   WEECY--DETSPS----GNENVQLLTNRMMLNNRIILVGEGLVGRAAFTGHHQWILADSF  89

Query  99   SREA-YPLEVLKELSQQFSAGIET  31
            +R   +P EV+ E+  QFSAGI+T
Sbjct  90   NRGGVHPPEVINEMLLQFSAGIQT  113



>ref|XP_006662753.1| PREDICTED: transcription factor LHW-like [Oryza brachyantha]
Length=836

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 35/66 (53%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = -2

Query  198  KMMMENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVI  19
            K +M +Q  VVGEG  GRAA TG+H WI+         P EV  E+S QF  GI+TIA+I
Sbjct  8    KKVMASQVHVVGEGTVGRAAFTGNHEWIIHGTAKDHGLPSEVAAEMSNQFRVGIQTIAII  67

Query  18   PVLPHG  1
            PVLP G
Sbjct  68   PVLPRG  73



>gb|EAY82345.1| hypothetical protein OsI_37555 [Oryza sativa Indica Group]
Length=880

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 56/97 (58%), Gaps = 2/97 (2%)
 Frame = -2

Query  291  AFNNWGACWASDEVLNSRPVQAGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHHHWIL  112
             F    +C A  E  +    ++G  V  LV K+M  +Q  VVGEG  GRAA TG+H WI+
Sbjct  38   GFCGHASCSAGSEA-SEAGCESGGAVCTLVRKIM-ASQVHVVGEGTIGRAAFTGNHQWIV  95

Query  111  SQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
             +  +      EV  E++ QF AGI+TIA+IPVLP G
Sbjct  96   HETANDHGLRSEVAAEMNNQFRAGIKTIAIIPVLPRG  132



>ref|NP_001066215.1| Os12g0160400 [Oryza sativa Japonica Group]
 gb|ABG21893.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF29234.1| Os12g0160400 [Oryza sativa Japonica Group]
 gb|EAZ19726.1| hypothetical protein OsJ_35303 [Oryza sativa Japonica Group]
Length=880

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 56/97 (58%), Gaps = 2/97 (2%)
 Frame = -2

Query  291  AFNNWGACWASDEVLNSRPVQAGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHHHWIL  112
             F    +C A  E  +    ++G  V  LV K+M  +Q  VVGEG  GRAA TG+H WI+
Sbjct  38   GFCGHASCSAGSEA-SEAGCESGGAVCTLVRKIM-ASQVHVVGEGTIGRAAFTGNHQWIV  95

Query  111  SQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
             +  +      EV  E++ QF AGI+TIA+IPVLP G
Sbjct  96   HETANDHGLRSEVAAEMNNQFRAGIKTIAIIPVLPRG  132



>ref|XP_002441863.1| hypothetical protein SORBIDRAFT_08g003770 [Sorghum bicolor]
 gb|EES15701.1| hypothetical protein SORBIDRAFT_08g003770 [Sorghum bicolor]
Length=891

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 54/93 (58%), Gaps = 4/93 (4%)
 Frame = -2

Query  273  ACWASDEVLNSRPVQAGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHHHWILSQ--GN  100
            +C A  E       + G  V  LV K+M  +Q  VVGEG  GRAA TG+H WI+     N
Sbjct  44   SCSAGSEAPEEAGCEPGTSVCTLVKKVMA-SQIHVVGEGAIGRAAFTGNHQWIVHDPAAN  102

Query  99   SREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
                 P EV  E++ QF+AGI+TIA+IPVLP G
Sbjct  103  DHNLRP-EVAAEMNHQFAAGIQTIAIIPVLPRG  134



>ref|XP_004977333.1| PREDICTED: transcription factor LHW-like [Setaria italica]
Length=889

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 55/96 (57%), Gaps = 2/96 (2%)
 Frame = -2

Query  288  FNNWGACWASDEVLNSRPVQAGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHHHWILS  109
            F    +C A  E   +   + G GV  LV K+M   Q  VVGEG  GRAA TG+H WI+ 
Sbjct  39   FCGHASCSAGSEAAEAG-CEPGSGVCTLVRKVMAL-QIHVVGEGTIGRAAFTGNHQWIIH  96

Query  108  QGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
               +  +   EV  E++ QF AGI+TIA+IPVLP G
Sbjct  97   DPANEHSLRSEVSAEMNYQFVAGIQTIAIIPVLPRG  132



>gb|AFW56113.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
Length=715

 Score = 72.0 bits (175),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 48/75 (64%), Gaps = 1/75 (1%)
 Frame = -2

Query  225  GEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFS  46
            G  V  LV K+M  +Q  VVGEG  GRAA TG+H WI+    +      EV  E++ QF+
Sbjct  59   GTSVCTLVRKVMT-SQIHVVGEGTIGRAAFTGNHQWIVHDPANDHNLRPEVSAEMNHQFA  117

Query  45   AGIETIAVIPVLPHG  1
            AGI+TIA+IPVLP G
Sbjct  118  AGIQTIAIIPVLPRG  132



>ref|XP_008674451.1| PREDICTED: transcription factor LHW-like isoform X2 [Zea mays]
 ref|XP_008674455.1| PREDICTED: transcription factor LHW-like isoform X3 [Zea mays]
Length=716

 Score = 71.6 bits (174),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 52/79 (66%), Gaps = 3/79 (4%)
 Frame = -2

Query  231  QAGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPL--EVLKELS  58
            + G  V  LV K+M  +Q  V+GEG  GRAA TG+H WI+    +   + L  EV+ E++
Sbjct  57   EPGTSVCTLVGKVMA-SQIHVIGEGTIGRAAFTGNHQWIVHDPATASDHNLRPEVVAEMN  115

Query  57   QQFSAGIETIAVIPVLPHG  1
             QF+AGI+TIA+IPVLP G
Sbjct  116  HQFAAGIQTIAIIPVLPRG  134



>ref|XP_008674450.1| PREDICTED: transcription factor LHW-like isoform X1 [Zea mays]
 ref|XP_008674453.1| PREDICTED: transcription factor LHW-like isoform X1 [Zea mays]
 tpg|DAA55617.1| TPA: putative HLH DNA-binding domain superfamily protein [Zea 
mays]
Length=888

 Score = 72.0 bits (175),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 38/79 (48%), Positives = 52/79 (66%), Gaps = 3/79 (4%)
 Frame = -2

Query  231  QAGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPL--EVLKELS  58
            + G  V  LV K+M  +Q  V+GEG  GRAA TG+H WI+    +   + L  EV+ E++
Sbjct  57   EPGTSVCTLVGKVM-ASQIHVIGEGTIGRAAFTGNHQWIVHDPATASDHNLRPEVVAEMN  115

Query  57   QQFSAGIETIAVIPVLPHG  1
             QF+AGI+TIA+IPVLP G
Sbjct  116  HQFAAGIQTIAIIPVLPRG  134



>ref|XP_006664356.1| PREDICTED: transcription factor LHW-like [Oryza brachyantha]
Length=893

 Score = 71.6 bits (174),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  228  AGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQF  49
            +   V  LV K+M+ +Q  VVGEG  GRAA TG+H WI+    +      EV  E++ QF
Sbjct  60   SSSAVCTLVRKIMV-SQVHVVGEGTIGRAAFTGNHQWIVHDTANDHGLRSEVAAEMNNQF  118

Query  48   SAGIETIAVIPVLPHG  1
             AGI+TIA+IPVLP G
Sbjct  119  RAGIKTIAIIPVLPRG  134



>ref|XP_008662493.1| PREDICTED: transcription factor LHW-like [Zea mays]
 gb|AFW56112.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
Length=890

 Score = 71.6 bits (174),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 38/77 (49%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = -2

Query  231  QAGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQ  52
            + G  V  LV K+M  +Q  VVGEG  GRAA TG+H WI+    +      EV  E++ Q
Sbjct  57   ELGTSVCTLVRKVMT-SQIHVVGEGTIGRAAFTGNHQWIVHDPANDHNLRPEVSAEMNHQ  115

Query  51   FSAGIETIAVIPVLPHG  1
            F+AGI+TIA+IPVLP G
Sbjct  116  FAAGIQTIAIIPVLPRG  132



>ref|XP_008674454.1| PREDICTED: transcription factor LHW-like isoform X2 [Zea mays]
Length=854

 Score = 71.2 bits (173),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 52/79 (66%), Gaps = 3/79 (4%)
 Frame = -2

Query  231  QAGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPL--EVLKELS  58
            + G  V  LV K+M  +Q  V+GEG  GRAA TG+H WI+    +   + L  EV+ E++
Sbjct  57   EPGTSVCTLVGKVMA-SQIHVIGEGTIGRAAFTGNHQWIVHDPATASDHNLRPEVVAEMN  115

Query  57   QQFSAGIETIAVIPVLPHG  1
             QF+AGI+TIA+IPVLP G
Sbjct  116  HQFAAGIQTIAIIPVLPRG  134



>ref|XP_010238692.1| PREDICTED: transcription factor LHW isoform X2 [Brachypodium 
distachyon]
Length=721

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = -2

Query  231  QAGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQ  52
            ++G  V  LV K+M  +Q  VVG+G  GRAA TG+H WI+    +      EV  E++ Q
Sbjct  57   ESGGTVCTLVRKVMA-SQVHVVGDGTIGRAAFTGNHQWIVHDTANDHGLRSEVAAEMNYQ  115

Query  51   FSAGIETIAVIPVLPHG  1
            F AGI+TIA+IPVLP G
Sbjct  116  FRAGIQTIAIIPVLPRG  132



>dbj|BAK06575.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=885

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 38/77 (49%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = -2

Query  231  QAGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQ  52
            ++G  V  LV K+M+ +Q  VVGEG  GRAA TG H WI+           EV  E++ Q
Sbjct  57   ESGGTVCTLVRKVMI-SQVHVVGEGTIGRAAFTGSHQWIIHDTADDHRLRSEVAAEMNYQ  115

Query  51   FSAGIETIAVIPVLPHG  1
            F AGI+TIA+IPVLP G
Sbjct  116  FRAGIQTIAIIPVLPRG  132



>gb|EMT30779.1| Putative basic helix-loop-helix protein [Aegilops tauschii]
Length=886

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 38/77 (49%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = -2

Query  231  QAGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQ  52
            ++G  V  LV K+M  +Q  VVGEG  GRAA TG H WI+    +      EV  E++ Q
Sbjct  48   ESGGTVCTLVRKVM-ASQVHVVGEGTIGRAAFTGSHQWIIHDTANDHRLRSEVAAEMNYQ  106

Query  51   FSAGIETIAVIPVLPHG  1
            F AGI+TIA+IPVLP G
Sbjct  107  FRAGIQTIAIIPVLPRG  123



>ref|XP_006594923.1| PREDICTED: transcription factor LHW-like isoform X2 [Glycine 
max]
Length=880

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/52 (60%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -2

Query  156  LAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
            + GRAA TG H WIL    + +AYP +V  E+  QFSAGI+T+AVIPVLPHG
Sbjct  41   IIGRAAFTGSHQWILLNNFTEDAYPPQVYAEVHHQFSAGIQTVAVIPVLPHG  92



>ref|XP_003578882.1| PREDICTED: transcription factor LHW isoform X1 [Brachypodium 
distachyon]
Length=896

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = -2

Query  231  QAGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQ  52
            ++G  V  LV K+M  +Q  VVG+G  GRAA TG+H WI+    +      EV  E++ Q
Sbjct  57   ESGGTVCTLVRKVMA-SQVHVVGDGTIGRAAFTGNHQWIVHDTANDHGLRSEVAAEMNYQ  115

Query  51   FSAGIETIAVIPVLPHG  1
            F AGI+TIA+IPVLP G
Sbjct  116  FRAGIQTIAIIPVLPRG  132



>ref|XP_010912385.1| PREDICTED: uncharacterized protein LOC105038317 isoform X3 [Elaeis 
guineensis]
Length=940

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = -2

Query  231  QAGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQ  52
            Q+ + V  LVNK+M   Q  VVG G+ G+AA+TG+H WI+           E L E++ Q
Sbjct  214  QSEDRVGMLVNKIMAA-QVHVVGAGIVGQAALTGNHQWIIQDTLHDYGCIAEGLAEINHQ  272

Query  51   FSAGIETIAVIPVLPHG  1
            F AGI+TIA+IPV+PHG
Sbjct  273  FLAGIQTIAIIPVIPHG  289



>gb|ABA96530.2| expressed protein [Oryza sativa Japonica Group]
Length=881

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 42/98 (43%), Positives = 57/98 (58%), Gaps = 3/98 (3%)
 Frame = -2

Query  291  AFNNWGACWASDEVLNSRPVQAGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHHHWIL  112
             F    +C A  E  +    ++G  V  LV K+M  +Q  VVGEG  GRAA TG+H WI+
Sbjct  38   GFCGHASCSAGSEA-SEAGCESGGAVCTLVRKIM-ASQVHVVGEGTIGRAAFTGNHQWIV  95

Query  111  SQGNSREAYPLEVLK-ELSQQFSAGIETIAVIPVLPHG  1
             +  +      EV+  E++ QF AGI+TIA+IPVLP G
Sbjct  96   HETANDHGLRSEVVAAEMNNQFRAGIKTIAIIPVLPRG  133



>ref|XP_010912384.1| PREDICTED: uncharacterized protein LOC105038317 isoform X2 [Elaeis 
guineensis]
Length=1035

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = -2

Query  231  QAGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQ  52
            Q+ + V  LVNK+M   Q  VVG G+ G+AA+TG+H WI+           E L E++ Q
Sbjct  214  QSEDRVGMLVNKIMAA-QVHVVGAGIVGQAALTGNHQWIIQDTLHDYGCIAEGLAEINHQ  272

Query  51   FSAGIETIAVIPVLPHG  1
            F AGI+TIA+IPV+PHG
Sbjct  273  FLAGIQTIAIIPVIPHG  289



>ref|XP_006646502.1| PREDICTED: transcription factor LHW-like [Oryza brachyantha]
Length=904

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 41/79 (52%), Positives = 49/79 (62%), Gaps = 4/79 (5%)
 Frame = -2

Query  228  AGEG---VQALVNKMMMENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELS  58
            AG G   V  LV+K M + Q  VVG+G+ G+AAVTG H WIL           EVL E+ 
Sbjct  94   AGHGQDRVDELVHKAMAQ-QLHVVGKGVIGQAAVTGLHRWILHDSLDECEEEDEVLLEMK  152

Query  57   QQFSAGIETIAVIPVLPHG  1
             QF AGI+T+AVIPVLP G
Sbjct  153  DQFCAGIQTVAVIPVLPQG  171



>ref|XP_010912383.1| PREDICTED: uncharacterized protein LOC105038317 isoform X1 [Elaeis 
guineensis]
Length=1084

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = -2

Query  231  QAGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQ  52
            Q+ + V  LVNK+M   Q  VVG G+ G+AA+TG+H WI+           E L E++ Q
Sbjct  214  QSEDRVGMLVNKIMAA-QVHVVGAGIVGQAALTGNHQWIIQDTLHDYGCIAEGLAEINHQ  272

Query  51   FSAGIETIAVIPVLPHG  1
            F AGI+TIA+IPV+PHG
Sbjct  273  FLAGIQTIAIIPVIPHG  289



>dbj|BAK00701.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=887

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 50/95 (53%), Gaps = 6/95 (6%)
 Frame = -2

Query  270  CWASDEVLNSRPVQAG-----EGVQALVNKMMMENQFKVVGEGLAGRAAVTGHHHWILSQ  106
            C A  E   +R  + G     + + +LV K M E Q  VVGEG  GR A TG H WI+  
Sbjct  45   CPAGSEASQARATELGCSAAVDSICSLVRKDMAE-QVHVVGEGTIGRVAFTGTHQWIIHG  103

Query  105  GNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
                     EV  E+  QF AGI+TIA+IPVLP G
Sbjct  104  TADDHGLSSEVASEMHYQFRAGIKTIAIIPVLPRG  138



>ref|XP_008784115.1| PREDICTED: transcription factor LHW-like [Phoenix dactylifera]
Length=948

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = -2

Query  231  QAGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQ  52
            QA + V  LVNK+M   Q  VVG G+ G+AA+TG+H WI+           E   E++ Q
Sbjct  78   QAEDRVGMLVNKIMAA-QVHVVGAGMVGQAALTGNHQWIIQDILHEYGSIAEGFAEINHQ  136

Query  51   FSAGIETIAVIPVLPHG  1
            F AGI+TIAVIPV+PHG
Sbjct  137  FLAGIQTIAVIPVIPHG  153



>ref|XP_004978745.1| PREDICTED: transcription factor LHW-like [Setaria italica]
Length=897

 Score = 68.6 bits (166),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = -2

Query  234  VQAGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQ  55
            V A + + +LVNK+M  ++  VVG+G  GRAA +G+H WI+    +      EV  E++ 
Sbjct  63   VPAADTICSLVNKVMA-SEIHVVGQGTVGRAAFSGNHQWIVHGTANGHELSSEVAAEMNN  121

Query  54   QFSAGIETIAVIPVLPHG  1
            QF  GI+TIA+IPVLP G
Sbjct  122  QFRVGIQTIAIIPVLPRG  139



>gb|EMT30797.1| Putative basic helix-loop-helix protein [Aegilops tauschii]
Length=887

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 40/95 (42%), Positives = 50/95 (53%), Gaps = 6/95 (6%)
 Frame = -2

Query  270  CWASDEVLNSRPVQAG-----EGVQALVNKMMMENQFKVVGEGLAGRAAVTGHHHWILSQ  106
            C A  E   +R  + G     + + +LV K M + Q  VVGEG  GR A TG H WI+  
Sbjct  45   CPAGSEASQARATELGCSAAVDSICSLVRKDMAQ-QVHVVGEGTIGRVAFTGSHQWIIHG  103

Query  105  GNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
                     EV  E+  QF AGI+TIA+IPVLP G
Sbjct  104  TADDHGLSSEVASEMHYQFIAGIKTIAIIPVLPRG  138



>gb|AFW65580.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
Length=830

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 53/97 (55%), Gaps = 7/97 (7%)
 Frame = -2

Query  273  ACWASDEVLNSRPVQAGEGVQA------LVNKMMMENQFKVVGEGLAGRAAVTGHHHWIL  112
            +C    E   S P  AG  V A      LV+ +M  +Q  VVG+G  GRAA +G+H WI+
Sbjct  44   SCPVGSEPSESLPSDAGCSVPAANTICSLVHSVM-ASQVHVVGQGTVGRAAFSGNHQWIV  102

Query  111  SQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
                +      EV  E++ QF  GI+TIA+IPVLP G
Sbjct  103  RGTANGHGLSSEVAAEMNNQFRVGIQTIAIIPVLPRG  139



>ref|XP_008799711.1| PREDICTED: transcription factor LHW-like [Phoenix dactylifera]
Length=947

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 35/76 (46%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = -2

Query  228  AGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQF  49
            A + V  LVNK+M  +Q  +VG+G+ G+AA+TG+H WI+           E L E++ QF
Sbjct  79   ADDRVSVLVNKIM-ASQVHLVGDGIIGQAALTGNHQWIVRDNLKDCGSTTEGLAEINCQF  137

Query  48   SAGIETIAVIPVLPHG  1
             A I+TIA+IPV PHG
Sbjct  138  LADIQTIAIIPVFPHG  153



>ref|XP_008679687.1| PREDICTED: transcription factor LHW [Zea mays]
 gb|AFW65579.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
Length=866

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 53/97 (55%), Gaps = 7/97 (7%)
 Frame = -2

Query  273  ACWASDEVLNSRPVQAGEGVQA------LVNKMMMENQFKVVGEGLAGRAAVTGHHHWIL  112
            +C    E   S P  AG  V A      LV+ +M  +Q  VVG+G  GRAA +G+H WI+
Sbjct  44   SCPVGSEPSESLPSDAGCSVPAANTICSLVHSVMA-SQVHVVGQGTVGRAAFSGNHQWIV  102

Query  111  SQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
                +      EV  E++ QF  GI+TIA+IPVLP G
Sbjct  103  RGTANGHGLSSEVAAEMNNQFRVGIQTIAIIPVLPRG  139



>ref|XP_002449032.1| hypothetical protein SORBIDRAFT_05g003740 [Sorghum bicolor]
 gb|EES08020.1| hypothetical protein SORBIDRAFT_05g003740 [Sorghum bicolor]
Length=870

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = -2

Query  228  AGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQF  49
            A + + +LVN +M  +Q  VVG+G  GRAA +G+H WI+    +      EV  E++ Q 
Sbjct  66   AADTICSLVNNVMA-SQVHVVGQGTVGRAAFSGNHQWIVHGTANGHGLSSEVAAEMNNQL  124

Query  48   SAGIETIAVIPVLPHG  1
              GI+TIA+IPVLP G
Sbjct  125  RVGIQTIAIIPVLPRG  140



>gb|EEE55720.1| hypothetical protein OsJ_04192 [Oryza sativa Japonica Group]
Length=904

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 40/76 (53%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = -2

Query  228  AGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQF  49
            A  G+ ALV+K M + Q  VVGEG+ G+AA+TG H WI+           EVL E+  QF
Sbjct  95   AMTGLNALVHKAMAQ-QVHVVGEGVIGQAALTGLHRWIVHDIVDECEEEDEVLLEMKGQF  153

Query  48   SAGIETIAVIPVLPHG  1
             AGI+TIAVIPVLP G
Sbjct  154  CAGIQTIAVIPVLPRG  169



>tpg|DAA39099.1| TPA: putative HLH DNA-binding domain superfamily protein [Zea 
mays]
Length=834

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 48/78 (62%), Gaps = 1/78 (1%)
 Frame = -2

Query  234  VQAGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQ  55
            V A + +  LVN  M  +Q  VVG+G+ GRAA +G+H WI+    +      EV  E++ 
Sbjct  65   VPAADTICWLVNNDMA-SQVHVVGQGIVGRAAFSGNHQWIVHGTANGHGLSSEVAAEVNN  123

Query  54   QFSAGIETIAVIPVLPHG  1
            QF  GI+TIA+IPVLP G
Sbjct  124  QFRVGIKTIAIIPVLPRG  141



>gb|EAY76601.1| hypothetical protein OsI_04550 [Oryza sativa Indica Group]
Length=895

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 39/72 (54%), Positives = 47/72 (65%), Gaps = 1/72 (1%)
 Frame = -2

Query  216  VQALVNKMMMENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGI  37
            V ALV+K M + Q  VVGEG+ G+AA+TG H WI+           EVL E+  QF AGI
Sbjct  99   VDALVHKAMAQ-QVHVVGEGVIGQAALTGLHRWIVHDIVDECEEEDEVLLEMKGQFCAGI  157

Query  36   ETIAVIPVLPHG  1
            +TIAVIPVLP G
Sbjct  158  QTIAVIPVLPRG  169



>ref|NP_001044899.2| Os01g0865600 [Oryza sativa Japonica Group]
 dbj|BAD81907.1| bHLH transcription factor-like protein [Oryza sativa Japonica 
Group]
 dbj|BAG90720.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF06813.2| Os01g0865600 [Oryza sativa Japonica Group]
Length=904

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 39/72 (54%), Positives = 47/72 (65%), Gaps = 1/72 (1%)
 Frame = -2

Query  216  VQALVNKMMMENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGI  37
            V ALV+K M + Q  VVGEG+ G+AA+TG H WI+           EVL E+  QF AGI
Sbjct  99   VDALVHKAMAQ-QVHVVGEGVIGQAALTGLHRWIVHDIVDECEEEDEVLLEMKGQFCAGI  157

Query  36   ETIAVIPVLPHG  1
            +TIAVIPVLP G
Sbjct  158  QTIAVIPVLPRG  169



>ref|XP_009420898.1| PREDICTED: transcription factor LHW-like [Musa acuminata subsp. 
malaccensis]
Length=936

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 40/117 (34%), Positives = 60/117 (51%), Gaps = 6/117 (5%)
 Frame = -2

Query  339  WEECYYEP----PEVSSSKLAFNNWGACWASDEVLNSRPVQAGEGVQALVNKMMMENQFK  172
            WE+ Y +     P    S+L     G   ++D  L     QA +G+  LV+K+M  +Q  
Sbjct  37   WEDGYCDQNPGMPRSKVSELLLKEQGVIKSTDSFL-ELGCQADDGLGVLVHKIM-ASQVH  94

Query  171  VVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
            VVG+GL G AA  G H WI      +  +  +   +++ Q  AGI+T+ V+PVLP G
Sbjct  95   VVGDGLVGHAASMGKHQWINQNNLDKFGFVSKGFADMNCQVLAGIQTVVVVPVLPFG  151



>ref|XP_010931062.1| PREDICTED: transcription factor LHW-like [Elaeis guineensis]
Length=947

 Score = 62.8 bits (151),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 34/72 (47%), Positives = 45/72 (63%), Gaps = 1/72 (1%)
 Frame = -2

Query  216  VQALVNKMMMENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGI  37
            V  LVNK+M  +Q  VVG+G+ G+AA+TG+H WI+           E L E+  QF A I
Sbjct  83   VGVLVNKIM-ASQVHVVGDGIIGQAALTGNHQWIVRDNLKDSGSITEGLAEIKCQFLADI  141

Query  36   ETIAVIPVLPHG  1
            +TIA+IPV P G
Sbjct  142  QTIAIIPVFPLG  153



>ref|XP_008448575.1| PREDICTED: uncharacterized protein LOC103490712 [Cucumis melo]
Length=772

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 39/103 (38%), Positives = 56/103 (54%), Gaps = 10/103 (10%)
 Frame = -2

Query  285  NNW--GACWASDE----VLNSRPVQAGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHH  124
            N+W  G  W+ D     +L    +   E V  +   M+   Q  ++GEG+ G AA TG+H
Sbjct  17   NHWSYGVFWSFDRRNSMLLTLEDIWYEEQVVLVAANML--QQVHMLGEGVIGTAAFTGNH  74

Query  123  HWILSQGNSRE--AYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
             WI S  ++ E  +   +   EL QQFS G++T+AVIPV PHG
Sbjct  75   RWIFSDASNGEWNSSMFQDNLELQQQFSYGVKTVAVIPVHPHG  117



>ref|XP_004146200.1| PREDICTED: transcription factor bHLH157-like [Cucumis sativus]
 gb|KGN55678.1| hypothetical protein Csa_3G002970 [Cucumis sativus]
Length=772

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 39/103 (38%), Positives = 55/103 (53%), Gaps = 10/103 (10%)
 Frame = -2

Query  285  NNW--GACWASDE----VLNSRPVQAGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHH  124
            N+W  G  W+ D     +L    +   E V  +   M+   Q  ++GEG+ G AA TG H
Sbjct  17   NHWSYGVFWSFDRRNSMLLTLEDIWYEEQVVLVAANML--QQVHMLGEGVIGTAAFTGKH  74

Query  123  HWILSQGNSRE--AYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
             WI S  ++ E  +   +   EL QQFS G++T+AVIPV PHG
Sbjct  75   QWIFSDASNGEWNSSMFQDNLELQQQFSYGVKTVAVIPVHPHG  117



>ref|XP_010247165.1| PREDICTED: transcription factor LHW-like isoform X3 [Nelumbo 
nucifera]
Length=900

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -2

Query  156  LAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
            + GRAA TG H WIL       A+P EV+ E+  QF +G++TIAVIPVLPHG
Sbjct  33   IVGRAAFTGAHLWILPGNCLGVAHPSEVMAEVHHQFLSGMQTIAVIPVLPHG  84



>ref|XP_010920505.1| PREDICTED: transcription factor bHLH155 isoform X1 [Elaeis guineensis]
Length=732

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 27/63 (43%), Positives = 38/63 (60%), Gaps = 1/63 (2%)
 Frame = -2

Query  189  MENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVL  10
            M  Q   +GEG+ G+ A TG+H WI + G      P E  ++   QF AGI+TI ++PV+
Sbjct  93   MSCQLYSLGEGIIGKVAQTGNHRWIFA-GEFNSKSPSECREKWELQFEAGIKTILLVPVI  151

Query  9    PHG  1
            PHG
Sbjct  152  PHG  154



>ref|XP_010920506.1| PREDICTED: transcription factor bHLH155 isoform X2 [Elaeis guineensis]
Length=699

 Score = 56.6 bits (135),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 27/63 (43%), Positives = 38/63 (60%), Gaps = 1/63 (2%)
 Frame = -2

Query  189  MENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVL  10
            M  Q   +GEG+ G+ A TG+H WI + G      P E  ++   QF AGI+TI ++PV+
Sbjct  93   MSCQLYSLGEGIIGKVAQTGNHRWIFA-GEFNSKSPSECREKWELQFEAGIKTILLVPVI  151

Query  9    PHG  1
            PHG
Sbjct  152  PHG  154



>gb|KHG17321.1| hypothetical protein F383_21887 [Gossypium arboreum]
Length=818

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 31/71 (44%), Positives = 44/71 (62%), Gaps = 8/71 (11%)
 Frame = -2

Query  207  LVNKMMMENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYP------LEVLKELSQQFS  46
            LV+KM++  +F ++GEG+ G+AA TG H WI S  N + +         +   EL  QFS
Sbjct  53   LVDKMLL--KFHILGEGIIGQAAFTGKHQWIFSDSNGKGSDSAGNENIFQDESELQDQFS  110

Query  45   AGIETIAVIPV  13
            +GI+TIAVI V
Sbjct  111  SGIKTIAVISV  121



>ref|XP_011080299.1| PREDICTED: transcription factor EMB1444 [Sesamum indicum]
Length=729

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 39/114 (34%), Positives = 57/114 (50%), Gaps = 11/114 (10%)
 Frame = -2

Query  339  WEECYYEPPEVSSSKLAFNNWGACWASDEVLNSRPVQAGEGVQALVNKMMMENQFKVVGE  160
            WE+ YY+  +       ++N  AC  ++   +  P+  G  V        M  Q   +GE
Sbjct  61   WEDAYYDSNQYPDK--MWSNATACSMNEGSYSHDPL--GLAVAK------MSYQVYSLGE  110

Query  159  GLAGRAAVTGHHHWI-LSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
            G+ G+ AV+G H WI L Q     +   E+      QFSAGI+TIAV+ V+PHG
Sbjct  111  GVVGQVAVSGKHSWIFLDQIVVDSSSSSELFGGWQTQFSAGIKTIAVVAVIPHG  164



>ref|XP_006854628.1| hypothetical protein AMTR_s00030p00176130 [Amborella trichopoda]
 gb|ERN16095.1| hypothetical protein AMTR_s00030p00176130 [Amborella trichopoda]
Length=926

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 48/82 (59%), Gaps = 7/82 (9%)
 Frame = -2

Query  231  QAGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHHHWIL-SQGNSREAYPLEVLKELS-  58
            Q  + ++A+V KM+  +Q  V+GEG  G  A+ G H WI  + GNS      + + E++ 
Sbjct  82   QGEDQLRAVVGKMV--DQIHVIGEGFVGHVALAGKHQWIFRTGGNSMGPADFKSVSEVAS  139

Query  57   ---QQFSAGIETIAVIPVLPHG  1
               +QF  GI+TIAVI V PHG
Sbjct  140  GWKEQFLVGIQTIAVISVSPHG  161



>gb|KDP25239.1| hypothetical protein JCGZ_20395 [Jatropha curcas]
Length=864

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 55/110 (50%), Gaps = 17/110 (15%)
 Frame = -2

Query  285  NNW--GACWASDE----VLNSRPVQAGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHH  124
            N W  G  W  D+    +L        E + A VN M++  Q  ++GEGL GRAA++G  
Sbjct  16   NGWSYGVFWRLDQRNSMLLTMEDAYYEEEMGAAVNNMLL--QAHMLGEGLVGRAALSGKC  73

Query  123  HWILSQGNSREAYPLEVLK---------ELSQQFSAGIETIAVIPVLPHG  1
             WI S  N+ E+     +          E+ QQ S+G++TIAVIPV   G
Sbjct  74   QWIFSDANNGESSSASSIGGQAMCQDDYEIQQQVSSGLKTIAVIPVESRG  123



>ref|XP_006846364.1| hypothetical protein AMTR_s00012p00261730 [Amborella trichopoda]
 gb|ERN08039.1| hypothetical protein AMTR_s00012p00261730 [Amborella trichopoda]
Length=717

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 63/125 (50%), Gaps = 15/125 (12%)
 Frame = -2

Query  339  WEECYY---EPP---EVSSSKLAFNNWGACWASDEVLNSRPVQAGEGVQALVNKMMMENQ  178
            WE+ YY   +PP   + +++   FN+ G    S + ++ R       V+  +   +    
Sbjct  36   WEDGYYNFPKPPCNIQDTTTNAFFNSIGGADYSSDAIDGR---VRHSVRDPIGAAVANMS  92

Query  177  FKV--VGEGLAGRAAVTGHHHWILSQ----GNSREAYPLEVLKELSQQFSAGIETIAVIP  16
            + V  +GEG+ G+ A +G H+W  ++    G     +  E   E   QF+AGI+TI +IP
Sbjct  93   YLVYALGEGIIGQVAFSGRHYWAFAEKVFNGEGNSQFVPEYPSEWQFQFAAGIKTIVLIP  152

Query  15   VLPHG  1
            V+PHG
Sbjct  153  VVPHG  157



>ref|XP_009612748.1| PREDICTED: transcription factor bHLH155-like isoform X2 [Nicotiana 
tomentosiformis]
Length=760

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 35/107 (33%), Positives = 54/107 (50%), Gaps = 15/107 (14%)
 Frame = -2

Query  282  NWGACWASDE----VLNSRPVQAGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHHHWI  115
            ++G  W  D     +L  +     E + A++++M++  Q  +VG G+ G+AA T  H W+
Sbjct  24   SYGVFWGFDHRNSLLLTLQDAYYEEQMGAVIDEMLL--QVHIVGAGIIGQAAFTKKHKWM  81

Query  114  LSQ---------GNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
             S          G+S  +   +   E  QQFS GI+TIAVI V P G
Sbjct  82   FSDANHEKQISIGSSNNSNLFQDAAEFEQQFSTGIKTIAVISVEPLG  128



>ref|XP_009612747.1| PREDICTED: transcription factor bHLH155-like isoform X1 [Nicotiana 
tomentosiformis]
Length=761

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 35/107 (33%), Positives = 54/107 (50%), Gaps = 15/107 (14%)
 Frame = -2

Query  282  NWGACWASDE----VLNSRPVQAGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHHHWI  115
            ++G  W  D     +L  +     E + A++++M++  Q  +VG G+ G+AA T  H W+
Sbjct  24   SYGVFWGFDHRNSLLLTLQDAYYEEQMGAVIDEMLL--QVHIVGAGIIGQAAFTKKHKWM  81

Query  114  LSQ---------GNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
             S          G+S  +   +   E  QQFS GI+TIAVI V P G
Sbjct  82   FSDANHEKQISIGSSNNSNLFQDAAEFEQQFSTGIKTIAVISVEPLG  128



>gb|EYU36027.1| hypothetical protein MIMGU_mgv1a020569mg, partial [Erythranthe 
guttata]
Length=386

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 33/87 (38%), Positives = 41/87 (47%), Gaps = 20/87 (23%)
 Frame = -2

Query  336  EECYYEPPEVSSSKLAFNNWGACWASDEVLNSRPVQAGEGVQALVNKMMMENQFKVVGEG  157
            EECYY P   S S                  ++PV+  + V  L NK M +N   +VGEG
Sbjct  5    EECYYGPAAASFS------------------TQPVR--DNVHLLANKTMNDNYVNIVGEG  44

Query  156  LAGRAAVTGHHHWILSQGNSREAYPLE  76
              G AA TG H W+ S+   REA P E
Sbjct  45   SVGDAAFTGIHQWVQSENCYREADPPE  71



>ref|XP_008801631.1| PREDICTED: transcription factor bHLH155-like isoform X2 [Phoenix 
dactylifera]
Length=698

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 29/76 (38%), Positives = 45/76 (59%), Gaps = 3/76 (4%)
 Frame = -2

Query  228  AGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQF  49
            AG  ++ +V  M  E     +GEG+ G+ A TG+H WI + G      P +  ++   QF
Sbjct  82   AGCPIEMVVASMSCE--LYSLGEGIIGKVAQTGNHRWIFA-GEFNSKSPSKCSEKWQLQF  138

Query  48   SAGIETIAVIPVLPHG  1
            +AGI+TI ++PV+PHG
Sbjct  139  AAGIKTILLVPVIPHG  154



>ref|XP_008801630.1| PREDICTED: transcription factor EMB1444-like isoform X1 [Phoenix 
dactylifera]
Length=731

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 29/76 (38%), Positives = 45/76 (59%), Gaps = 3/76 (4%)
 Frame = -2

Query  228  AGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQF  49
            AG  ++ +V  M  E     +GEG+ G+ A TG+H WI + G      P +  ++   QF
Sbjct  82   AGCPIEMVVASMSCE--LYSLGEGIIGKVAQTGNHRWIFA-GEFNSKSPSKCSEKWQLQF  138

Query  48   SAGIETIAVIPVLPHG  1
            +AGI+TI ++PV+PHG
Sbjct  139  AAGIKTILLVPVIPHG  154



>ref|XP_007144920.1| hypothetical protein PHAVU_007G194600g [Phaseolus vulgaris]
 gb|ESW16914.1| hypothetical protein PHAVU_007G194600g [Phaseolus vulgaris]
Length=701

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 53/117 (45%), Gaps = 14/117 (12%)
 Frame = -2

Query  339  WEECYYEPPEV---SSSKLAFNNWGACWASDEVLNSRPVQAGEGVQALVNKMMMENQFKV  169
            WE+ YY+ P +   S +K   N W    ++D   +  P+  G  V        M      
Sbjct  36   WEDAYYDNPNICDSSENKSCQNTWERIGSAD--FSHDPL--GLAVAK------MSYHVYS  85

Query  168  VGEGLAGRAAVTGHHHWILSQGNSREAYP-LEVLKELSQQFSAGIETIAVIPVLPHG  1
            +GEG+ G+ AVTG H WI        + P  E       QFSAGI TI VI V+P G
Sbjct  86   LGEGIVGQVAVTGKHRWICVDNQVTSSVPSFEFADGWQSQFSAGIRTIVVIAVVPLG  142



>ref|XP_008801632.1| PREDICTED: transcription factor EMB1444-like isoform X3 [Phoenix 
dactylifera]
Length=667

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 29/76 (38%), Positives = 45/76 (59%), Gaps = 3/76 (4%)
 Frame = -2

Query  228  AGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQF  49
            AG  ++ +V  M  E     +GEG+ G+ A TG+H WI + G      P +  ++   QF
Sbjct  82   AGCPIEMVVASMSCE--LYSLGEGIIGKVAQTGNHRWIFA-GEFNSKSPSKCSEKWQLQF  138

Query  48   SAGIETIAVIPVLPHG  1
            +AGI+TI ++PV+PHG
Sbjct  139  AAGIKTILLVPVIPHG  154



>ref|XP_007144919.1| hypothetical protein PHAVU_007G194600g [Phaseolus vulgaris]
 gb|ESW16913.1| hypothetical protein PHAVU_007G194600g [Phaseolus vulgaris]
Length=741

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 53/117 (45%), Gaps = 14/117 (12%)
 Frame = -2

Query  339  WEECYYEPPEV---SSSKLAFNNWGACWASDEVLNSRPVQAGEGVQALVNKMMMENQFKV  169
            WE+ YY+ P +   S +K   N W    ++D   +  P+  G  V        M      
Sbjct  36   WEDAYYDNPNICDSSENKSCQNTWERIGSAD--FSHDPL--GLAVAK------MSYHVYS  85

Query  168  VGEGLAGRAAVTGHHHWILSQGNSREAYP-LEVLKELSQQFSAGIETIAVIPVLPHG  1
            +GEG+ G+ AVTG H WI        + P  E       QFSAGI TI VI V+P G
Sbjct  86   LGEGIVGQVAVTGKHRWICVDNQVTSSVPSFEFADGWQSQFSAGIRTIVVIAVVPLG  142



>ref|XP_006368796.1| hypothetical protein POPTR_0001s11170g [Populus trichocarpa]
 gb|ERP65365.1| hypothetical protein POPTR_0001s11170g [Populus trichocarpa]
Length=823

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 57/110 (52%), Gaps = 17/110 (15%)
 Frame = -2

Query  285  NNW--GACWASDEV----LNSRPVQAGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHH  124
            N W  G  W  D++    L        E + A+VN M+ E    ++GEG+ G+AA TG H
Sbjct  17   NGWSYGVFWCFDQINSMLLTMEDAYYEEEMGAVVNSMLSEAH--ILGEGIVGQAASTGKH  74

Query  123  HWIL---SQGNSREAYPL---EVLK---ELSQQFSAGIETIAVIPVLPHG  1
             WI    S G    A  +   ++ +   E+ +QFS+GI+TIA+I V  HG
Sbjct  75   QWIFSDASDGGWDSAASIGGQDIFQDDSEIHRQFSSGIKTIAIISVESHG  124



>ref|XP_002299440.2| hypothetical protein POPTR_0001s11170g [Populus trichocarpa]
 gb|EEE84245.2| hypothetical protein POPTR_0001s11170g [Populus trichocarpa]
Length=819

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 57/110 (52%), Gaps = 17/110 (15%)
 Frame = -2

Query  285  NNW--GACWASDEV----LNSRPVQAGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHH  124
            N W  G  W  D++    L        E + A+VN M+ E    ++GEG+ G+AA TG H
Sbjct  17   NGWSYGVFWCFDQINSMLLTMEDAYYEEEMGAVVNSMLSEAH--ILGEGIVGQAASTGKH  74

Query  123  HWIL---SQGNSREAYPL---EVLK---ELSQQFSAGIETIAVIPVLPHG  1
             WI    S G    A  +   ++ +   E+ +QFS+GI+TIA+I V  HG
Sbjct  75   QWIFSDASDGGWDSAASIGGQDIFQDDSEIHRQFSSGIKTIAIISVESHG  124



>ref|XP_006606416.1| PREDICTED: transcription factor bHLH157-like [Glycine max]
Length=813

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/64 (45%), Positives = 36/64 (56%), Gaps = 5/64 (8%)
 Frame = -2

Query  189  MENQFKVVGEGLAGRAAVTGHHHWILSQG-----NSREAYPLEVLKELSQQFSAGIETIA  25
            M  Q  ++GEG+ G AA TG H W+ S G     N       E   EL QQFS+GI+TI 
Sbjct  55   MHPQVHLLGEGIVGEAAFTGKHSWVHSDGLTHDWNLTGQNTCEDDSELQQQFSSGIKTIV  114

Query  24   VIPV  13
            V+PV
Sbjct  115  VVPV  118



>gb|KHN05001.1| Putative basic helix-loop-helix protein [Glycine soja]
Length=812

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/64 (45%), Positives = 36/64 (56%), Gaps = 5/64 (8%)
 Frame = -2

Query  189  MENQFKVVGEGLAGRAAVTGHHHWILSQG-----NSREAYPLEVLKELSQQFSAGIETIA  25
            M  Q  ++GEG+ G AA TG H W+ S G     N       E   EL QQFS+GI+TI 
Sbjct  55   MHPQVHLLGEGIVGEAAFTGKHSWVHSDGLTHDWNLTGQNTCEDDSELQQQFSSGIKTIV  114

Query  24   VIPV  13
            V+PV
Sbjct  115  VVPV  118



>ref|XP_011070366.1| PREDICTED: transcription factor LHW isoform X1 [Sesamum indicum]
Length=840

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 59/110 (54%), Gaps = 17/110 (15%)
 Frame = -2

Query  285  NNW--GACWASDE----VLNSRPVQAGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHH  124
            N W  G  W  D+    +L  +     E + AL++ M++  Q  V G G+ G+AA T  H
Sbjct  21   NGWCYGIFWGFDQRNSLLLTLKDDYYEEQMGALIDSMLL--QVHVFGGGVIGQAAFTKKH  78

Query  123  HWILSQG-----NSREAY-PLEVLKELSQ---QFSAGIETIAVIPVLPHG  1
            HW+ S       NS  ++  LEVL++ S+   QFS GI+TIA+I V P G
Sbjct  79   HWMYSDAYQERQNSLGSFESLEVLQDDSEFYCQFSVGIKTIALISVEPWG  128



>ref|XP_011026816.1| PREDICTED: transcription factor LHW [Populus euphratica]
Length=823

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 37/107 (35%), Positives = 57/107 (53%), Gaps = 15/107 (14%)
 Frame = -2

Query  282  NWGACWASDEV----LNSRPVQAGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHHHWI  115
            ++G  W  D++    L        E + A+VN+M+ E    ++GEG+ G+AA TG H WI
Sbjct  20   SYGVFWCFDQINSMLLTMEDAYYEEEMGAVVNRMLSEAH--ILGEGIVGQAASTGKHQWI  77

Query  114  L---SQGNSREAYPL---EVLK---ELSQQFSAGIETIAVIPVLPHG  1
                S G    A  +   ++ +   E+ +QFS+GI+TIAVI V   G
Sbjct  78   FSDASDGGWDSAASIGDQDIFQDDSEIHRQFSSGIKTIAVISVESQG  124



>ref|XP_002459194.1| hypothetical protein SORBIDRAFT_02g000310 [Sorghum bicolor]
 gb|EER95715.1| hypothetical protein SORBIDRAFT_02g000310 [Sorghum bicolor]
Length=847

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 26/66 (39%), Positives = 40/66 (61%), Gaps = 3/66 (5%)
 Frame = -2

Query  195  MMMENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQ-QFSAGIETIAVI  19
            M M +    +GEG+ G+ A+TG H WI    N   +  +   +E  Q QF+AGI+T+ ++
Sbjct  760  MRMPSHLYPLGEGIIGKVALTGQHCWI--SANELGSTAMHKYQEDWQLQFAAGIKTVLLV  817

Query  18   PVLPHG  1
            PV+PHG
Sbjct  818  PVVPHG  823



>ref|XP_008390304.1| PREDICTED: transcription factor bHLH157-like [Malus domestica]
Length=792

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 39/111 (35%), Positives = 53/111 (48%), Gaps = 19/111 (17%)
 Frame = -2

Query  285  NNW--GACWASDEVLNSRPVQAGEG-----VQALVNKMMMENQFKVVGEGLAGRAAVTGH  127
            N W  G  W  D   NS  +  G+      V A++  M+   Q  V+GEG+ G+ A TG 
Sbjct  21   NGWSYGVFWCFDH-RNSMLLTMGDAYYEDHVGAVIENML--PQVHVLGEGIIGQTAFTGK  77

Query  126  HHWILSQGNSREAYPLEVLK---------ELSQQFSAGIETIAVIPVLPHG  1
            H W+ S  +     P   L+         E S QFS+GI+TIA+I V P G
Sbjct  78   HRWMHSDAHGGGWNPCSSLENQDMFQDYSEFSCQFSSGIKTIAIISVEPRG  128



>ref|XP_010106138.1| hypothetical protein L484_003641 [Morus notabilis]
 gb|EXC07932.1| hypothetical protein L484_003641 [Morus notabilis]
Length=816

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 48/85 (56%), Gaps = 15/85 (18%)
 Frame = -2

Query  222  EGVQALVNKMMMENQFKVVGEGLAGRAAVTGHHHWILSQGNS-----------REAYPLE  76
            + V A+++ M++     ++GEG  G+AA++G H WIL    S           RE +  +
Sbjct  49   DQVGAVLDNMLL--MVHLLGEGTIGQAALSGKHRWILEDDQSGEWDSVRSSEIRETFQDD  106

Query  75   VLKELSQQFSAGIETIAVIPVLPHG  1
               ++S QFS+GI+TIA IP+ P G
Sbjct  107  --SDVSFQFSSGIKTIAAIPIEPRG  129



>ref|XP_006343800.1| PREDICTED: transcription factor bHLH157-like [Solanum tuberosum]
Length=769

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 34/107 (32%), Positives = 55/107 (51%), Gaps = 15/107 (14%)
 Frame = -2

Query  282  NWGACWASDE----VLNSRPVQAGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHHHWI  115
            ++G  W  D+    +L  +     E + +++++M++  Q  ++G G+ G+ A T  H W+
Sbjct  20   SYGVFWGFDQTNSLLLTLQDAYYEEQMGSVIDEMLL--QVHILGRGMIGQTAFTKKHKWM  77

Query  114  LSQ---------GNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
             S          G+S  +  L    E  QQFSAGI+TIAVI V P G
Sbjct  78   FSAANHERQISIGSSHNSNLLLDDNEFEQQFSAGIKTIAVISVEPLG  124



>ref|XP_011006385.1| PREDICTED: transcription factor EMB1444-like isoform X2 [Populus 
euphratica]
Length=667

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 59/124 (48%), Gaps = 13/124 (10%)
 Frame = -2

Query  339  WEECYY------EPPEVSSSKLAFNNWGACWASDEVLNSRPVQAGEGVQALVNKMMMENQ  178
            WEE Y+      EP +  SS +  N      +S    ++     G     LV   M+  Q
Sbjct  37   WEEGYFDCPKPREPLQTISSDVYCNGGNDLVSSLRDASASNANFGGHQLELVVADMLHLQ  96

Query  177  FKVVGEGLAGRAAVTGHHHW-----ILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPV  13
            + + GEG+ G  A TG H W     I S   S+   P E  +E   QF++GI+TI ++PV
Sbjct  97   YPL-GEGVVGEVAYTGDHFWLSFNSIFSSEMSKNLVP-EFPEEWLLQFASGIKTILLVPV  154

Query  12   LPHG  1
            LPHG
Sbjct  155  LPHG  158



>ref|XP_011006384.1| PREDICTED: transcription factor EMB1444-like isoform X1 [Populus 
euphratica]
Length=708

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 59/124 (48%), Gaps = 13/124 (10%)
 Frame = -2

Query  339  WEECYY------EPPEVSSSKLAFNNWGACWASDEVLNSRPVQAGEGVQALVNKMMMENQ  178
            WEE Y+      EP +  SS +  N      +S    ++     G     LV   M+  Q
Sbjct  37   WEEGYFDCPKPREPLQTISSDVYCNGGNDLVSSLRDASASNANFGGHQLELVVADMLHLQ  96

Query  177  FKVVGEGLAGRAAVTGHHHW-----ILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPV  13
            + + GEG+ G  A TG H W     I S   S+   P E  +E   QF++GI+TI ++PV
Sbjct  97   YPL-GEGVVGEVAYTGDHFWLSFNSIFSSEMSKNLVP-EFPEEWLLQFASGIKTILLVPV  154

Query  12   LPHG  1
            LPHG
Sbjct  155  LPHG  158



>ref|XP_009359586.1| PREDICTED: transcription factor EMB1444-like [Pyrus x bretschneideri]
Length=785

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 39/111 (35%), Positives = 53/111 (48%), Gaps = 19/111 (17%)
 Frame = -2

Query  285  NNW--GACWASDEVLNSRPVQAGEG-----VQALVNKMMMENQFKVVGEGLAGRAAVTGH  127
            N W  G  W  D   NS  +  G+      V A++  M+   Q  V+GEG+ G+ A TG 
Sbjct  21   NGWSYGVFWRFDH-RNSMLLTMGDAYYEDHVGAVIENML--PQVHVLGEGIIGQTAFTGK  77

Query  126  HHWILSQGNSREAYPLEVLK---------ELSQQFSAGIETIAVIPVLPHG  1
            H W+ S  +     P   L+         E S QFS+GI+TIA+I V P G
Sbjct  78   HRWMHSDAHGGGWNPCSSLENQDMFQDYSEFSCQFSSGIKTIAIISVEPRG  128



>ref|NP_001047714.1| Os02g0673500 [Oryza sativa Japonica Group]
 dbj|BAD29456.1| transcription factor-like [Oryza sativa Japonica Group]
 dbj|BAF09628.1| Os02g0673500 [Oryza sativa Japonica Group]
 gb|EEE57559.1| hypothetical protein OsJ_07902 [Oryza sativa Japonica Group]
Length=792

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 54/105 (51%), Gaps = 15/105 (14%)
 Frame = -2

Query  279  WGACWASDEVLNSRPVQAGE-----GVQALVNKMMMENQFKVVGEGLAGRAAVTGHHHWI  115
            + A W SD   + R +  GE     G + +V KM+  NQ  VVGEG+ GRA V+G   WI
Sbjct  18   YAAIWRSDR-RDPRLLTIGEFHSEDGTRNVVEKML--NQVHVVGEGIIGRALVSGECQWI  74

Query  114  ----LSQGNSREAYPLEVLKELS---QQFSAGIETIAVIPVLPHG  1
                 S   + +A   ++ +  +    QF  GI+TIAVIP+   G
Sbjct  75   SDTSFSFAQTSDADNQDLFQGYTWWQHQFLCGIKTIAVIPIADLG  119



>ref|XP_010262289.1| PREDICTED: transcription factor EMB1444-like isoform X1 [Nelumbo 
nucifera]
Length=728

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 25/57 (44%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = -2

Query  168  VGEGLAGRAAVTGHHHWILSQGNSREAY-PLEVLKELSQQFSAGIETIAVIPVLPHG  1
            +GEG+ G+ A+TG HHWI S   +  ++   E       QF+AGI TIA + V+PHG
Sbjct  86   LGEGIIGQVALTGKHHWIFSDIYASSSWLSSEYCDGWQIQFAAGIRTIAAVAVVPHG  142



>gb|KFK32958.1| hypothetical protein AALP_AA6G311800 [Arabis alpina]
Length=551

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 32/98 (33%), Positives = 50/98 (51%), Gaps = 11/98 (11%)
 Frame = -2

Query  282  NWGACWASDEV----LNSRPVQAGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHHHWI  115
            ++G  W  D +    L    V   E   A+VN M++  Q  ++G+G+ G AA+TG+H W+
Sbjct  16   SYGVFWCYDPINPMLLRFEQVYNDEQSVAVVNDMIL--QPHILGQGIVGEAALTGNHQWL  73

Query  114  LSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
             S     +    +   E   QF +G +TIA+IPV   G
Sbjct  74   FS-----DTLFFQCGHEFQHQFLSGFKTIAIIPVGSSG  106



>ref|XP_006589237.1| PREDICTED: transcription factor bHLH155-like isoform X2 [Glycine 
max]
Length=811

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 27/64 (42%), Positives = 36/64 (56%), Gaps = 5/64 (8%)
 Frame = -2

Query  189  MENQFKVVGEGLAGRAAVTGHHHWILSQGNSRE-----AYPLEVLKELSQQFSAGIETIA  25
            M  Q  ++GEG+ G AA TG H W+ S G + +         E   E  QQFS+GI+TI 
Sbjct  59   MHPQVHLLGEGIVGEAASTGKHSWVHSDGQTHDWNLTGQNICEDDSEFQQQFSSGIKTIV  118

Query  24   VIPV  13
            V+PV
Sbjct  119  VVPV  122



>ref|XP_006589236.1| PREDICTED: transcription factor bHLH155-like isoform X1 [Glycine 
max]
 gb|KHN14753.1| Putative basic helix-loop-helix protein [Glycine soja]
Length=815

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 27/64 (42%), Positives = 36/64 (56%), Gaps = 5/64 (8%)
 Frame = -2

Query  189  MENQFKVVGEGLAGRAAVTGHHHWILSQGNSRE-----AYPLEVLKELSQQFSAGIETIA  25
            M  Q  ++GEG+ G AA TG H W+ S G + +         E   E  QQFS+GI+TI 
Sbjct  59   MHPQVHLLGEGIVGEAASTGKHSWVHSDGQTHDWNLTGQNICEDDSEFQQQFSSGIKTIV  118

Query  24   VIPV  13
            V+PV
Sbjct  119  VVPV  122



>ref|XP_009773770.1| PREDICTED: transcription factor bHLH155-like isoform X2 [Nicotiana 
sylvestris]
Length=784

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 33/107 (31%), Positives = 54/107 (50%), Gaps = 15/107 (14%)
 Frame = -2

Query  282  NWGACWASDE----VLNSRPVQAGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHHHWI  115
            ++G  W  D+    +L  +     E + A++++M++  Q  ++G G+ G+ A T  H W+
Sbjct  24   SYGVFWGFDQRNSLLLTLQDAYYEEQMGAVIDEMLL--QVHILGAGIIGKTAFTKKHKWM  81

Query  114  LSQ---------GNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
             S          G+S  +   +   E  QQFS GI+TIAVI V P G
Sbjct  82   FSDANNGKQISIGSSNNSNLFQDDVEFEQQFSTGIKTIAVISVEPLG  128



>ref|XP_009773769.1| PREDICTED: transcription factor bHLH155-like isoform X1 [Nicotiana 
sylvestris]
Length=785

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 33/107 (31%), Positives = 54/107 (50%), Gaps = 15/107 (14%)
 Frame = -2

Query  282  NWGACWASDE----VLNSRPVQAGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHHHWI  115
            ++G  W  D+    +L  +     E + A++++M++  Q  ++G G+ G+ A T  H W+
Sbjct  24   SYGVFWGFDQRNSLLLTLQDAYYEEQMGAVIDEMLL--QVHILGAGIIGKTAFTKKHKWM  81

Query  114  LSQ---------GNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
             S          G+S  +   +   E  QQFS GI+TIAVI V P G
Sbjct  82   FSDANNGKQISIGSSNNSNLFQDDVEFEQQFSTGIKTIAVISVEPLG  128



>ref|XP_011094905.1| PREDICTED: transcription factor LHW-like [Sesamum indicum]
Length=714

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 40/67 (60%), Gaps = 4/67 (6%)
 Frame = -2

Query  189  MENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAY----PLEVLKELSQQFSAGIETIAV  22
            M + F V+G+G+ G AA TG+  WI +   + + +      E   E   QF+AGI+TI +
Sbjct  81   MSSAFHVMGKGVVGEAAFTGNTRWIYADNIAPDVFNSVLAPEYPDEWLLQFAAGIKTILL  140

Query  21   IPVLPHG  1
            +PV+PHG
Sbjct  141  LPVIPHG  147



>ref|XP_010267508.1| PREDICTED: transcription factor EMB1444-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010267509.1| PREDICTED: transcription factor EMB1444-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010267510.1| PREDICTED: transcription factor EMB1444-like isoform X1 [Nelumbo 
nucifera]
Length=798

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 34/110 (31%), Positives = 53/110 (48%), Gaps = 17/110 (15%)
 Frame = -2

Query  285  NNW--GACW----ASDEVLNSRPVQAGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHH  124
            N W  G  W     +  +L +  V   E +  +V++M+   Q  ++G+G+ G AA TG +
Sbjct  16   NRWSYGVFWRINHPNSMLLTAEDVYFKEYIGVVVDRML--QQVHMLGQGIIGEAAFTGKN  73

Query  123  HWILSQGNSREAYPLEVL---------KELSQQFSAGIETIAVIPVLPHG  1
             W+ S    RE  P E +          +   QFS+G++TI VI V P G
Sbjct  74   RWLFSDTYYREYCPQESVDNQNAFQDSTDFHHQFSSGVKTIVVIAVTPQG  123



>ref|XP_010679225.1| PREDICTED: transcription factor EMB1444 [Beta vulgaris subsp. 
vulgaris]
Length=719

 Score = 50.4 bits (119),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = -2

Query  168  VGEGLAGRAAVTGHHHWILS-QGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
            +GEG+ G+ AVTG H WI + +       PLE+      QF+AGI+TI V  V+P+G
Sbjct  112  LGEGIVGQVAVTGKHRWIFAGEQTVTSCSPLELCDGWQAQFAAGIKTIVVAAVVPYG  168



>emb|CDY61366.1| BnaA09g53110D [Brassica napus]
Length=541

 Score = 50.4 bits (119),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 30/98 (31%), Positives = 48/98 (49%), Gaps = 12/98 (12%)
 Frame = -2

Query  282  NWGACWASDEV----LNSRPVQAGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHHHWI  115
            ++   W SD +    L        E   ALV+ M++  Q  V+G+G+ G AA+TG+H W+
Sbjct  19   SYAVFWRSDPINPMLLRVEEAHNDEQSAALVDDMIL--QIHVLGQGIVGEAALTGNHQWL  76

Query  114  LSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
             S          +   E   QF +G ++IA+IP+   G
Sbjct  77   FSDT------LFQCEHEFQNQFLSGFKSIAIIPIGSSG  108



>ref|XP_007039441.1| Serine/threonine-protein kinase WNK-related, putative isoform 
4 [Theobroma cacao]
 gb|EOY23942.1| Serine/threonine-protein kinase WNK-related, putative isoform 
4 [Theobroma cacao]
Length=801

 Score = 50.4 bits (119),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 35/107 (33%), Positives = 55/107 (51%), Gaps = 14/107 (13%)
 Frame = -2

Query  285  NNW--GACWASDE----VLNSRPVQAGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHH  124
            N W  G  W  D+    +L        E +  LV+ M++  +F ++G+G+ G+AA TG H
Sbjct  21   NGWSYGVFWRFDQRNSMLLTMEDAYYEEQMGPLVDSMLL--KFHILGQGIIGQAAFTGKH  78

Query  123  HWIL--SQGNSREAYPLEVL----KELSQQFSAGIETIAVIPVLPHG  1
             WI   S G + ++   + +     E   QFS+GI+TIA+I V   G
Sbjct  79   QWIFPDSHGKAWDSTGNQNIFQDESEFQNQFSSGIKTIAIISVETRG  125



>ref|XP_007039440.1| Serine/threonine-protein kinase WNK-related, putative isoform 
3 [Theobroma cacao]
 gb|EOY23941.1| Serine/threonine-protein kinase WNK-related, putative isoform 
3 [Theobroma cacao]
Length=800

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 35/107 (33%), Positives = 55/107 (51%), Gaps = 14/107 (13%)
 Frame = -2

Query  285  NNW--GACWASDE----VLNSRPVQAGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHH  124
            N W  G  W  D+    +L        E +  LV+ M++  +F ++G+G+ G+AA TG H
Sbjct  21   NGWSYGVFWRFDQRNSMLLTMEDAYYEEQMGPLVDSMLL--KFHILGQGIIGQAAFTGKH  78

Query  123  HWIL--SQGNSREAYPLEVL----KELSQQFSAGIETIAVIPVLPHG  1
             WI   S G + ++   + +     E   QFS+GI+TIA+I V   G
Sbjct  79   QWIFPDSHGKAWDSTGNQNIFQDESEFQNQFSSGIKTIAIISVETRG  125



>ref|XP_007039438.1| Serine/threonine-protein kinase WNK-related, putative isoform 
1 [Theobroma cacao]
 ref|XP_007039439.1| Serine/threonine-protein kinase WNK-related, putative isoform 
1 [Theobroma cacao]
 gb|EOY23939.1| Serine/threonine-protein kinase WNK-related, putative isoform 
1 [Theobroma cacao]
 gb|EOY23940.1| Serine/threonine-protein kinase WNK-related, putative isoform 
1 [Theobroma cacao]
Length=843

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 35/107 (33%), Positives = 55/107 (51%), Gaps = 14/107 (13%)
 Frame = -2

Query  285  NNW--GACWASDE----VLNSRPVQAGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHH  124
            N W  G  W  D+    +L        E +  LV+ M++  +F ++G+G+ G+AA TG H
Sbjct  21   NGWSYGVFWRFDQRNSMLLTMEDAYYEEQMGPLVDSMLL--KFHILGQGIIGQAAFTGKH  78

Query  123  HWIL--SQGNSREAYPLEVL----KELSQQFSAGIETIAVIPVLPHG  1
             WI   S G + ++   + +     E   QFS+GI+TIA+I V   G
Sbjct  79   QWIFPDSHGKAWDSTGNQNIFQDESEFQNQFSSGIKTIAIISVETRG  125



>tpg|DAA59302.1| TPA: putative HLH DNA-binding domain superfamily protein [Zea 
mays]
Length=678

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 26/66 (39%), Positives = 40/66 (61%), Gaps = 3/66 (5%)
 Frame = -2

Query  195  MMMENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQ-QFSAGIETIAVI  19
            M M +    +GEG+ G+ A+TG H WI    N   +  +   +E  Q QF+AGI+T+ ++
Sbjct  131  MRMPSHLYPLGEGIIGKVALTGQHCWI--SANELCSTAMHKYQEDWQLQFAAGIKTVLLV  188

Query  18   PVLPHG  1
            PV+PHG
Sbjct  189  PVVPHG  194



>ref|XP_008651889.1| PREDICTED: transcription factor EMB1444-like [Zea mays]
 ref|XP_008651890.1| PREDICTED: transcription factor EMB1444-like [Zea mays]
 ref|XP_008651891.1| PREDICTED: transcription factor EMB1444-like [Zea mays]
 ref|XP_008651892.1| PREDICTED: transcription factor EMB1444-like [Zea mays]
 ref|XP_008651893.1| PREDICTED: transcription factor EMB1444-like [Zea mays]
Length=623

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 26/66 (39%), Positives = 40/66 (61%), Gaps = 3/66 (5%)
 Frame = -2

Query  195  MMMENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQ-QFSAGIETIAVI  19
            M M +    +GEG+ G+ A+TG H WI    N   +  +   +E  Q QF+AGI+T+ ++
Sbjct  92   MRMPSHLYPLGEGIIGKVALTGQHCWI--SANELCSTAMHKYQEDWQLQFAAGIKTVLLV  149

Query  18   PVLPHG  1
            PV+PHG
Sbjct  150  PVVPHG  155



>ref|XP_002303679.1| hypothetical protein POPTR_0003s14480g [Populus trichocarpa]
 gb|EEE78658.1| hypothetical protein POPTR_0003s14480g [Populus trichocarpa]
Length=831

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 38/110 (35%), Positives = 55/110 (50%), Gaps = 17/110 (15%)
 Frame = -2

Query  285  NNW--GACWASDE----VLNSRPVQAGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHH  124
            N W  G  W  D+    +L        E +  +VN M+ E   +++GEG+ G+AA TG H
Sbjct  16   NGWSYGVFWCFDQRNSMLLTMEDAYYEEEMGVVVNNMLSEA--RMLGEGIVGQAASTGKH  73

Query  123  HWILSQG-----NSREAYPLEVL----KELSQQFSAGIETIAVIPVLPHG  1
             WI S       NS  +   + +     E+ +QFS+GI+TIAVI V   G
Sbjct  74   QWIFSDASDGGWNSAASIGGQDIFQDDSEIHRQFSSGIKTIAVISVESQG  123



>ref|XP_002309084.1| hypothetical protein POPTR_0006s09100g [Populus trichocarpa]
 gb|EEE92607.1| hypothetical protein POPTR_0006s09100g [Populus trichocarpa]
Length=708

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 59/124 (48%), Gaps = 13/124 (10%)
 Frame = -2

Query  339  WEECYY------EPPEVSSSKLAFNNWGACWASDEVLNSRPVQAGEGVQALVNKMMMENQ  178
            WE+ Y+      EP +  SS +  N      +S    ++     G     LV   M+  Q
Sbjct  37   WEDGYFDCPKPREPLQTISSDVYCNGGNDLASSLRDASASNANFGGHQIELVVADMLHLQ  96

Query  177  FKVVGEGLAGRAAVTGHHHW-----ILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPV  13
            + + GEG+ G  A TG H W     I S   S+   P E  +E   QF++GI+TI ++PV
Sbjct  97   YPL-GEGVVGEVAYTGDHFWLSFNNIFSCEMSKNLVP-EFPEEWLLQFASGIKTILLVPV  154

Query  12   LPHG  1
            LPHG
Sbjct  155  LPHG  158



>ref|XP_010252756.1| PREDICTED: uncharacterized protein LOC104594230 isoform X2 [Nelumbo 
nucifera]
Length=878

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 31/83 (37%), Positives = 43/83 (52%), Gaps = 11/83 (13%)
 Frame = -2

Query  222  EGVQALVNKMMMENQFKVVGEGLAGRAAVTGHHHWILSQGNSRE-AYPLEV--------L  70
            E +  +V+KM+   Q  ++G+G+ G  A TG H W+ S     E  YP  V         
Sbjct  44   EPISMVVDKML--QQVHMLGQGIIGETAFTGKHRWLFSDTYFEEWGYPGSVDNENTFQDN  101

Query  69   KELSQQFSAGIETIAVIPVLPHG  1
             E   QFS+GI+TIAV+ V P G
Sbjct  102  SEFHHQFSSGIKTIAVVSVAPLG  124



>ref|XP_010252749.1| PREDICTED: uncharacterized protein LOC104594230 isoform X1 [Nelumbo 
nucifera]
Length=879

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 31/83 (37%), Positives = 43/83 (52%), Gaps = 11/83 (13%)
 Frame = -2

Query  222  EGVQALVNKMMMENQFKVVGEGLAGRAAVTGHHHWILSQGNSRE-AYPLEV--------L  70
            E +  +V+KM+   Q  ++G+G+ G  A TG H W+ S     E  YP  V         
Sbjct  44   EPISMVVDKML--QQVHMLGQGIIGETAFTGKHRWLFSDTYFEEWGYPGSVDNENTFQDN  101

Query  69   KELSQQFSAGIETIAVIPVLPHG  1
             E   QFS+GI+TIAV+ V P G
Sbjct  102  SEFHHQFSSGIKTIAVVSVAPLG  124



>ref|XP_010228486.1| PREDICTED: transcription factor EMB1444-like isoform X2 [Brachypodium 
distachyon]
Length=630

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 35/56 (63%), Gaps = 1/56 (2%)
 Frame = -2

Query  168  VGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
            +GE + G+ AVTG H WI S  + R     +  ++   QF+AGI T+ ++PV+PHG
Sbjct  96   LGEQIIGKVAVTGQHCWI-SANDFRSTLMYKYHEDWQFQFAAGIRTVLLVPVMPHG  150



>ref|XP_010228485.1| PREDICTED: transcription factor EMB1444-like isoform X1 [Brachypodium 
distachyon]
Length=666

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 35/56 (63%), Gaps = 1/56 (2%)
 Frame = -2

Query  168  VGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
            +GE + G+ AVTG H WI S  + R     +  ++   QF+AGI T+ ++PV+PHG
Sbjct  96   LGEQIIGKVAVTGQHCWI-SANDFRSTLMYKYHEDWQFQFAAGIRTVLLVPVMPHG  150



>ref|XP_010043993.1| PREDICTED: transcription factor bHLH155-like isoform X1 [Eucalyptus 
grandis]
Length=718

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 25/60 (42%), Positives = 36/60 (60%), Gaps = 4/60 (7%)
 Frame = -2

Query  168  VGEGLAGRAAVTGHHHWILSQ----GNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
            +GEGL G  A+TG++ W+ S       S    PLE+ +E   Q  AG++TI ++P LPHG
Sbjct  99   LGEGLVGEVALTGNYCWVSSDDILASQSNLETPLELPEEWLPQIFAGVKTILLLPALPHG  158



>ref|XP_010262290.1| PREDICTED: transcription factor EMB1444-like isoform X2 [Nelumbo 
nucifera]
Length=595

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = -2

Query  168  VGEGLAGRAAVTGHHHWILSQGNSREAY-PLEVLKELSQQFSAGIETIAVIPVLPHG  1
            +GEG+ G+ A+TG HHWI S   +  ++   E       QF+AGI TIA + V+PHG
Sbjct  86   LGEGIIGQVALTGKHHWIFSDIYASSSWLSSEYCDGWQIQFAAGIRTIAAVAVVPHG  142



>ref|XP_010043995.1| PREDICTED: transcription factor LHW-like isoform X3 [Eucalyptus 
grandis]
Length=608

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 25/60 (42%), Positives = 36/60 (60%), Gaps = 4/60 (7%)
 Frame = -2

Query  168  VGEGLAGRAAVTGHHHWILSQ----GNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
            +GEGL G  A+TG++ W+ S       S    PLE+ +E   Q  AG++TI ++P LPHG
Sbjct  99   LGEGLVGEVALTGNYCWVSSDDILASQSNLETPLELPEEWLPQIFAGVKTILLLPALPHG  158



>ref|XP_010043994.1| PREDICTED: transcription factor bHLH155-like isoform X2 [Eucalyptus 
grandis]
Length=711

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 25/60 (42%), Positives = 36/60 (60%), Gaps = 4/60 (7%)
 Frame = -2

Query  168  VGEGLAGRAAVTGHHHWILSQ----GNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
            +GEGL G  A+TG++ W+ S       S    PLE+ +E   Q  AG++TI ++P LPHG
Sbjct  99   LGEGLVGEVALTGNYCWVSSDDILASQSNLETPLELPEEWLPQIFAGVKTILLLPALPHG  158



>ref|XP_008239218.1| PREDICTED: transcription factor bHLH157 [Prunus mume]
Length=796

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 38/111 (34%), Positives = 55/111 (50%), Gaps = 19/111 (17%)
 Frame = -2

Query  285  NNW--GACWASDEVLNSRPVQAG-----EGVQALVNKMMMENQFKVVGEGLAGRAAVTGH  127
            N W  G  W  D+  NS  +  G     E + A+++ M+  +Q  ++GEG+ G+ A TG 
Sbjct  21   NGWSYGVFWRFDQ-RNSMLLTMGDAYYEEHMGAVMDSML--SQVHMLGEGIIGQTAFTGK  77

Query  126  HHWILSQGNSREAYPLEVLK---------ELSQQFSAGIETIAVIPVLPHG  1
            H W+ S  +S E      L+         E   QFS+GI+TIA I V P G
Sbjct  78   HRWMHSDASSGEWNSCNSLESQDMFQDDSEFRCQFSSGIKTIATISVEPRG  128



>emb|CBI34563.3| unnamed protein product [Vitis vinifera]
Length=868

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 37/111 (33%), Positives = 54/111 (49%), Gaps = 18/111 (16%)
 Frame = -2

Query  285  NNW--GACWASDE----VLNSRPVQAGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHH  124
            N W  G  W  DE    +L S      E +  +++ M+  ++   + EG+ G+ A TG H
Sbjct  22   NGWTYGVFWRFDERNSMLLTSEDAYYDEQMGVVIDSML--SKVHTLREGIIGQVAFTGKH  79

Query  123  HWILSQGNSREAYPLEVL---------KELSQQFSAG-IETIAVIPVLPHG  1
             W+ S   S E   L  +          E+ +QFS+G I+TIAVIPV P G
Sbjct  80   CWVFSDAQSGEWNSLCSIDGEDISQDDSEIHRQFSSGIIKTIAVIPVEPRG  130



>ref|XP_010659858.1| PREDICTED: transcription factor LHW [Vitis vinifera]
 emb|CAN74602.1| hypothetical protein VITISV_028112 [Vitis vinifera]
Length=893

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 37/111 (33%), Positives = 54/111 (49%), Gaps = 18/111 (16%)
 Frame = -2

Query  285  NNW--GACWASDE----VLNSRPVQAGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHH  124
            N W  G  W  DE    +L S      E +  +++ M+  ++   + EG+ G+ A TG H
Sbjct  22   NGWTYGVFWRFDERNSMLLTSEDAYYDEQMGVVIDSML--SKVHTLREGIIGQVAFTGKH  79

Query  123  HWILSQGNSREAYPLEVL---------KELSQQFSAG-IETIAVIPVLPHG  1
             W+ S   S E   L  +          E+ +QFS+G I+TIAVIPV P G
Sbjct  80   CWVFSDAQSGEWNSLCSIDGEDISQDDSEIHRQFSSGIIKTIAVIPVEPRG  130



>ref|XP_009358669.1| PREDICTED: transcription factor bHLH155-like [Pyrus x bretschneideri]
Length=790

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 36/111 (32%), Positives = 52/111 (47%), Gaps = 19/111 (17%)
 Frame = -2

Query  285  NNW--GACWASDEVLNSRPVQAGEG-----VQALVNKMMMENQFKVVGEGLAGRAAVTGH  127
            N W  G  W  D + NS  +  G+      V A++  M+  +Q  ++GEG+ G+ A  G 
Sbjct  18   NGWSYGVFWRFDHI-NSMLLTMGDAYYEDHVGAVIENML--SQVHILGEGVIGQTAFAGK  74

Query  126  HHWILSQGNSREAYPLEVLK---------ELSQQFSAGIETIAVIPVLPHG  1
            H W+ S  +     P   L+         E   QFS+GI+TIA I V P G
Sbjct  75   HQWMHSDVHGGGWNPCTSLESQDMFQDCSEFGSQFSSGIKTIAAISVEPQG  125



>gb|EEC81367.1| hypothetical protein OsI_24568 [Oryza sativa Indica Group]
Length=1380

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 25/65 (38%), Positives = 38/65 (58%), Gaps = 1/65 (2%)
 Frame = -2

Query  195  MMMENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIP  16
            + M +    +GE L G+ A+TG H WI S   S   +  +  ++   QF+AGI+TI  +P
Sbjct  820  LSMSSHTYSLGEELIGKVALTGQHCWISSYEFS-STFMYKYHEDWQLQFAAGIKTILFVP  878

Query  15   VLPHG  1
            V+PHG
Sbjct  879  VVPHG  883



>gb|EEE66419.1| hypothetical protein OsJ_22769 [Oryza sativa Japonica Group]
Length=1393

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 25/65 (38%), Positives = 38/65 (58%), Gaps = 1/65 (2%)
 Frame = -2

Query  195  MMMENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIETIAVIP  16
            + M +    +GE L G+ A+TG H WI S   S   +  +  ++   QF+AGI+TI  +P
Sbjct  834  LSMSSHTYSLGEELIGKVALTGQHCWISSYEFS-STFMYKYHEDWQLQFAAGIKTILFVP  892

Query  15   VLPHG  1
            V+PHG
Sbjct  893  VVPHG  897



>gb|EEC73767.1| hypothetical protein OsI_08440 [Oryza sativa Indica Group]
Length=793

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 34/100 (34%), Positives = 51/100 (51%), Gaps = 13/100 (13%)
 Frame = -2

Query  279  WGACWASDE----VLNSRPVQAGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHHHWI-  115
            +   W SD     +L      + +G + +V KM+  NQ  VVGEG+ GRA V+G   WI 
Sbjct  18   YAVIWRSDRRDPRLLTIGEFHSEDGTRNVVEKML--NQVHVVGEGIIGRALVSGECQWIS  75

Query  114  ---LSQGNSREAYPLEVLKELS---QQFSAGIETIAVIPV  13
                S   + +A   ++ +  +    QF  GI+TIAVIP+
Sbjct  76   DTSFSFAQTSDADNQDLFQGYTWWQHQFLCGIKTIAVIPI  115



>ref|XP_007026929.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
 ref|XP_007026934.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY07431.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY07436.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
Length=682

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 35/59 (59%), Gaps = 4/59 (7%)
 Frame = -2

Query  165  GEGLAGRAAVTGHHHWI----LSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
            GEG+ G+ A TG H W+    +  G +      E  +E   QF++GI+TI ++PVLPHG
Sbjct  98   GEGVVGKVAYTGKHCWVSYDDIFTGKANSKLVPECPEEWLLQFASGIKTIVLVPVLPHG  156



>ref|XP_007026930.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 2 [Theobroma cacao]
 ref|XP_007026931.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 2 [Theobroma cacao]
 ref|XP_007026932.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 2 [Theobroma cacao]
 ref|XP_007026933.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 2 [Theobroma cacao]
 gb|EOY07432.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 2 [Theobroma cacao]
 gb|EOY07433.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 2 [Theobroma cacao]
 gb|EOY07434.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 2 [Theobroma cacao]
 gb|EOY07435.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 2 [Theobroma cacao]
Length=650

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 35/59 (59%), Gaps = 4/59 (7%)
 Frame = -2

Query  165  GEGLAGRAAVTGHHHWI----LSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
            GEG+ G+ A TG H W+    +  G +      E  +E   QF++GI+TI ++PVLPHG
Sbjct  66   GEGVVGKVAYTGKHCWVSYDDIFTGKANSKLVPECPEEWLLQFASGIKTIVLVPVLPHG  124



>emb|CDP06574.1| unnamed protein product [Coffea canephora]
Length=728

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 37/71 (52%), Gaps = 12/71 (17%)
 Frame = -2

Query  189  MENQFKVVGEGLAGRAAVTGHHHWILSQG--------NSREAYPLEVLKELSQQFSAGIE  34
            M N + VVG+GL G AA T    WI            N    YP E+L     QF AG++
Sbjct  93   MSNTYYVVGKGLVGEAAYTECPSWIFVDNFMAGGLSSNGVSEYPEELL----HQFVAGVK  148

Query  33   TIAVIPVLPHG  1
            T+ ++P++PHG
Sbjct  149  TMLLVPLIPHG  159



>ref|XP_007026935.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 7, partial [Theobroma cacao]
 gb|EOY07437.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 7, partial [Theobroma cacao]
Length=713

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 35/59 (59%), Gaps = 4/59 (7%)
 Frame = -2

Query  165  GEGLAGRAAVTGHHHWI----LSQGNSREAYPLEVLKELSQQFSAGIETIAVIPVLPHG  1
            GEG+ G+ A TG H W+    +  G +      E  +E   QF++GI+TI ++PVLPHG
Sbjct  98   GEGVVGKVAYTGKHCWVSYDDIFTGKANSKLVPECPEEWLLQFASGIKTIVLVPVLPHG  156



>ref|XP_007210891.1| hypothetical protein PRUPE_ppa001838mg [Prunus persica]
 gb|EMJ12090.1| hypothetical protein PRUPE_ppa001838mg [Prunus persica]
Length=758

 Score = 47.8 bits (112),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 39/111 (35%), Positives = 54/111 (49%), Gaps = 19/111 (17%)
 Frame = -2

Query  285  NNW--GACWASDEVLNSRPVQAG-----EGVQALVNKMMMENQFKVVGEGLAGRAAVTGH  127
            N W  G  W  D+  NS  +  G     E + A+++ M+   Q  ++GEG+ G+ A TG 
Sbjct  21   NGWSYGVFWRFDK-RNSMLLTMGDAYYEEHMGAVMDSML--PQVHMLGEGIIGQTAFTGK  77

Query  126  HHWILSQGNSREAYPLEVLK---------ELSQQFSAGIETIAVIPVLPHG  1
            H W+ S   S E      L+         EL  QFS+GI+TIA I V P G
Sbjct  78   HRWMHSDAPSGEWSSCNSLESQDMFQDDSELRCQFSSGIKTIATISVEPRG  128



>emb|CDP20971.1| unnamed protein product [Coffea canephora]
Length=817

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 34/110 (31%), Positives = 59/110 (54%), Gaps = 17/110 (15%)
 Frame = -2

Query  285  NNW--GACWASDE----VLNSRPVQAGEGVQALVNKMMMENQFKVVGEGLAGRAAVTGHH  124
            N W  GA W  D+    +L  + V   E +  +++ M++  Q  ++G+G+ G++A + +H
Sbjct  17   NGWSYGAFWGFDQKNSLLLTLQDVYCEEHLGVVIDDMLV--QVHMLGQGVIGQSAFSKNH  74

Query  123  HWILSQGNSREAYP------LEVLKELSQ---QFSAGIETIAVIPVLPHG  1
             W++S  +S +  P       + L++ S    QFS GI+TI VI V P G
Sbjct  75   RWMISDSHSGKLSPSGSLQNSDALQDYSAFHCQFSNGIKTIVVISVEPLG  124



>ref|XP_010256798.1| PREDICTED: transcription factor bHLH155-like isoform X1 [Nelumbo 
nucifera]
Length=733

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 41/121 (34%), Positives = 58/121 (48%), Gaps = 14/121 (12%)
 Frame = -2

Query  339  WEECYY------EPPEVSSSKLAFNNW-GACWASDEVLNSRPVQAGEGVQALVNKMMMEN  181
            WE+ YY      EP E  S  + F    G      E   S     G  ++ +V  M    
Sbjct  37   WEDGYYDHPKLIEPIESISDNVCFKETDGIKSFGCETNTSNGNSVGSPIELVVADM--SC  94

Query  180  QFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPL-EVLKELSQQFSAGIETIAVIPVLPH  4
            Q  ++GEG+ G+ A T  H W+ +     E+Y + E   E S QF+AGI+TI ++PVL H
Sbjct  95   QLYLLGEGIVGKVASTAKHCWVYA---GIESYLVPEYPDEWSIQFAAGIKTILLVPVL-H  150

Query  3    G  1
            G
Sbjct  151  G  151



>ref|XP_008644109.1| PREDICTED: putative HLH DNA-binding domain superfamily protein 
isoform X1 [Zea mays]
 ref|XP_008644110.1| PREDICTED: putative HLH DNA-binding domain superfamily protein 
isoform X1 [Zea mays]
 gb|AFW72762.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
Length=758

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 54/107 (50%), Gaps = 16/107 (15%)
 Frame = -2

Query  282  NWGACWASDEVLNSRPVQAGEG-----VQALVNKMMMENQFKVVGEGLAGRAAVTGHHHW  118
            ++GA W  D   + R +  GE       + +V+KM+  NQ  VVGEGL GR  ++G H W
Sbjct  15   SYGAIWRPDR-RDPRLLTVGECHCEDEARKVVDKMV--NQVHVVGEGLIGRTLISGEHQW  71

Query  117  I-------LSQGNSREAYPL-EVLKELSQQFSAGIETIAVIPVLPHG  1
            I        SQ +  +   L +       QF +GI+TIAV+P+   G
Sbjct  72   ISDDIPFSFSQISDEDNLGLCQGYTWWQHQFLSGIKTIAVVPMPAFG  118



>ref|XP_008644111.1| PREDICTED: putative HLH DNA-binding domain superfamily protein 
isoform X2 [Zea mays]
Length=752

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 54/107 (50%), Gaps = 16/107 (15%)
 Frame = -2

Query  282  NWGACWASDEVLNSRPVQAGEG-----VQALVNKMMMENQFKVVGEGLAGRAAVTGHHHW  118
            ++GA W  D   + R +  GE       + +V+KM+  NQ  VVGEGL GR  ++G H W
Sbjct  15   SYGAIWRPDR-RDPRLLTVGECHCEDEARKVVDKMV--NQVHVVGEGLIGRTLISGEHQW  71

Query  117  I-------LSQGNSREAYPL-EVLKELSQQFSAGIETIAVIPVLPHG  1
            I        SQ +  +   L +       QF +GI+TIAV+P+   G
Sbjct  72   ISDDIPFSFSQISDEDNLGLCQGYTWWQHQFLSGIKTIAVVPMPAFG  118



>ref|XP_010473730.1| PREDICTED: transcription factor bHLH157-like, partial [Camelina 
sativa]
Length=432

 Score = 47.0 bits (110),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 25/70 (36%), Positives = 39/70 (56%), Gaps = 8/70 (11%)
 Frame = -2

Query  210  ALVNKMMMENQFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPLEVLKELSQQFSAGIET  31
            ALV+ M+++    V+G+G+ G  A+TG+H W+ S          +   E   QF +G +T
Sbjct  48   ALVDDMILKAH--VLGQGIVGEVALTGNHQWLFSDS------LFQCEHEFQNQFLSGCKT  99

Query  30   IAVIPVLPHG  1
            IA+IPV   G
Sbjct  100  IAIIPVGSRG  109



>ref|XP_010256799.1| PREDICTED: transcription factor LHW-like isoform X2 [Nelumbo 
nucifera]
Length=698

 Score = 47.4 bits (111),  Expect = 0.001, Method: Composition-based stats.
 Identities = 41/121 (34%), Positives = 58/121 (48%), Gaps = 14/121 (12%)
 Frame = -2

Query  339  WEECYY------EPPEVSSSKLAFNNW-GACWASDEVLNSRPVQAGEGVQALVNKMMMEN  181
            WE+ YY      EP E  S  + F    G      E   S     G  ++ +V  M    
Sbjct  37   WEDGYYDHPKLIEPIESISDNVCFKETDGIKSFGCETNTSNGNSVGSPIELVVADM--SC  94

Query  180  QFKVVGEGLAGRAAVTGHHHWILSQGNSREAYPL-EVLKELSQQFSAGIETIAVIPVLPH  4
            Q  ++GEG+ G+ A T  H W+ +     E+Y + E   E S QF+AGI+TI ++PVL H
Sbjct  95   QLYLLGEGIVGKVASTAKHCWVYA---GIESYLVPEYPDEWSIQFAAGIKTILLVPVL-H  150

Query  3    G  1
            G
Sbjct  151  G  151



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 513730317888