BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7577_g1_i1 len=1956 path=[1:0-1655 1657:1656-1955]

Length=1956
                                                                      Score     E

emb|CDO99442.1|  unnamed protein product                                234   1e-64   
ref|XP_006353392.1|  PREDICTED: low-temperature-induced 65 kDa pr...    220   1e-58   
ref|XP_009775169.1|  PREDICTED: low-temperature-induced 65 kDa pr...    214   9e-57   
dbj|BAC53927.1|  hypothetical protein                                   214   9e-57   Nicotiana tabacum [American tobacco]
ref|XP_009626657.1|  PREDICTED: low-temperature-induced 65 kDa pr...    208   2e-54   
ref|XP_009626658.1|  PREDICTED: low-temperature-induced 65 kDa pr...    199   2e-51   
gb|KHG03450.1|  Low-temperature-induced 65 kDa -like protein            187   7e-48   
ref|XP_011030111.1|  PREDICTED: low-temperature-induced 65 kDa pr...    182   5e-46   
ref|XP_002318815.2|  stress-responsive family protein                   177   2e-44   Populus trichocarpa [western balsam poplar]
ref|XP_007038688.1|  CAP160 protein, putative                           172   8e-43   
ref|XP_009340018.1|  PREDICTED: low-temperature-induced 65 kDa pr...    162   2e-39   
ref|XP_008343721.1|  PREDICTED: low-temperature-induced 65 kDa pr...    162   2e-39   
ref|XP_002268167.1|  PREDICTED: low-temperature-induced 65 kDa pr...    160   5e-39   Vitis vinifera
ref|XP_010662765.1|  PREDICTED: low-temperature-induced 65 kDa pr...    160   7e-39   
ref|XP_002510792.1|  hypothetical protein RCOM_1496000                  159   3e-38   Ricinus communis
gb|KDP22282.1|  hypothetical protein JCGZ_26113                         157   9e-38   
ref|XP_011076169.1|  PREDICTED: LOW QUALITY PROTEIN: low-temperat...    150   1e-35   
ref|XP_010107443.1|  hypothetical protein L484_015784                   150   2e-35   
gb|KDO60004.1|  hypothetical protein CISIN_1g007806mg                   147   2e-34   
ref|XP_006490382.1|  PREDICTED: low-temperature-induced 65 kDa pr...    148   3e-34   
ref|XP_004234447.1|  PREDICTED: low-temperature-induced 65 kDa pr...    147   5e-34   
ref|XP_004308090.1|  PREDICTED: uncharacterized protein LOC101294513    147   8e-34   
gb|EYU19545.1|  hypothetical protein MIMGU_mgv1a022832mg                140   1e-33   
ref|XP_006421916.1|  hypothetical protein CICLE_v10004574mg             145   1e-33   
ref|XP_010273089.1|  PREDICTED: low-temperature-induced 65 kDa pr...    143   2e-33   
ref|XP_006421915.1|  hypothetical protein CICLE_v10004574mg             145   2e-33   
ref|XP_011084415.1|  PREDICTED: low-temperature-induced 65 kDa pr...    143   3e-33   
ref|XP_009349342.1|  PREDICTED: low-temperature-induced 65 kDa pr...    140   2e-31   
ref|XP_009349341.1|  PREDICTED: low-temperature-induced 65 kDa pr...    139   6e-31   
ref|XP_009371330.1|  PREDICTED: low-temperature-induced 65 kDa pr...    139   6e-31   
gb|KHN42539.1|  Low-temperature-induced 65 kDa protein                  125   7e-27   
gb|EYU25094.1|  hypothetical protein MIMGU_mgv1a023652mg                124   9e-27   
ref|XP_008376577.1|  PREDICTED: low-temperature-induced 65 kDa pr...    123   7e-26   
ref|XP_010671967.1|  PREDICTED: low-temperature-induced 65 kDa pr...    120   5e-25   
ref|XP_003556105.1|  PREDICTED: low-temperature-induced 65 kDa pr...    110   4e-22   
ref|XP_008234251.1|  PREDICTED: low-temperature-induced 65 kDa pr...    110   8e-22   
ref|XP_008354240.1|  PREDICTED: low-temperature-induced 65 kDa pr...    108   1e-21   
ref|XP_007143406.1|  hypothetical protein PHAVU_007G069800g             103   4e-20   
ref|XP_003535616.2|  PREDICTED: low-temperature-induced 65 kDa pr...    102   1e-19   
ref|XP_008376575.1|  PREDICTED: low-temperature-induced 65 kDa pr...    103   1e-19   
ref|XP_008376576.1|  PREDICTED: low-temperature-induced 65 kDa pr...    103   2e-19   
emb|CBI22749.3|  unnamed protein product                              99.4    5e-19   
ref|XP_007143405.1|  hypothetical protein PHAVU_007G069800g             100   6e-19   
gb|KHN26655.1|  Low-temperature-induced 65 kDa protein                  100   7e-19   
ref|XP_010061041.1|  PREDICTED: low-temperature-induced 65 kDa pr...  99.8    2e-18   
ref|XP_006600079.1|  PREDICTED: low-temperature-induced 65 kDa pr...  96.3    5e-18   
gb|KEH26136.1|  seed maturation protein PM39, putative                99.0    5e-18   
ref|XP_004515723.1|  PREDICTED: putative uncharacterized protein ...  98.6    6e-18   
ref|XP_003533194.1|  PREDICTED: low-temperature-induced 65 kDa pr...  98.2    8e-18   
ref|XP_006587319.1|  PREDICTED: low-temperature-induced 65 kDa pr...  97.8    1e-17   
gb|AAD51627.1|  seed maturation protein PM39                          95.1    2e-17   Glycine max [soybeans]
ref|XP_010438860.1|  PREDICTED: low-temperature-induced 65 kDa pr...  93.2    2e-16   
gb|KEH43710.1|  hypothetical protein MTR_1g100627                     92.8    2e-16   
ref|NP_001032061.1|  protein LOW-TEMPERATURE-INDUCED 65               93.2    2e-16   Arabidopsis thaliana [mouse-ear cress]
ref|NP_200043.2|  protein LOW-TEMPERATURE-INDUCED 65                  93.2    2e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006600062.1|  PREDICTED: uncharacterized protein LOC100790856  90.1    9e-16   
ref|XP_010521328.1|  PREDICTED: low-temperature-induced 65 kDa pr...  89.4    2e-15   
ref|XP_010521329.1|  PREDICTED: low-temperature-induced 65 kDa pr...  89.4    2e-15   
dbj|BAA02375.1|  RD29B                                                89.7    2e-15   Arabidopsis thaliana [mouse-ear cress]
gb|AAB25482.1|  RD29B=responsive-to-dessication protein               89.4    3e-15   
ref|XP_010521327.1|  PREDICTED: low-temperature-induced 65 kDa pr...  89.0    3e-15   
emb|CAA47902.1|  lti65                                                88.6    5e-15   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB10527.1|  low-temperature-induced 65 kD protein                88.6    5e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002864162.1|  hypothetical protein ARALYDRAFT_495299           88.2    6e-15   
ref|XP_009127250.1|  PREDICTED: low-temperature-induced 65 kDa pr...  87.8    8e-15   
ref|XP_010433614.1|  PREDICTED: low-temperature-induced 65 kDa pr...  87.4    1e-14   
emb|CDX91632.1|  BnaC02g15280D                                        87.4    1e-14   
ref|XP_010448411.1|  PREDICTED: low-temperature-induced 65 kDa pr...  86.3    3e-14   
emb|CDY27078.1|  BnaA02g10980D                                        85.9    3e-14   
dbj|BAH20238.1|  AT5G52300                                            84.3    4e-14   Arabidopsis thaliana [mouse-ear cress]
gb|AEX92028.1|  CDeT11-24 isoform                                     84.0    9e-14   
gb|KFK29057.1|  hypothetical protein AALP_AA7G083100                  84.0    9e-14   
ref|XP_009770362.1|  PREDICTED: low-temperature-induced 78 kDa pr...  81.3    1e-13   
ref|XP_003638371.1|  Low-temperature-induced 65 kDa protein           83.6    2e-13   
ref|XP_010255439.1|  PREDICTED: low-temperature-induced 65 kDa pr...  82.4    3e-13   
ref|XP_002869666.1|  hypothetical protein ARALYDRAFT_492269           82.8    4e-13   
emb|CAB81368.1|  putative protein                                     82.4    5e-13   Arabidopsis thaliana [mouse-ear cress]
emb|CAA18168.1|  putative protein                                     82.0    6e-13   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194288.2|  CAP160 protein                                      82.0    7e-13   Arabidopsis thaliana [mouse-ear cress]
emb|CAA05780.1|  CDet11-24                                            80.9    9e-13   Craterostigma plantagineum
ref|XP_007220235.1|  hypothetical protein PRUPE_ppa001989mg           80.9    2e-12   
ref|XP_009599625.1|  PREDICTED: low-temperature-induced 65 kDa pr...  77.4    2e-12   
ref|XP_006827687.1|  hypothetical protein AMTR_s00009p00256730        79.7    3e-12   
ref|XP_006285597.1|  hypothetical protein CARUB_v10007046mg           76.6    3e-11   
ref|XP_009137538.1|  PREDICTED: low-temperature-induced 65 kDa pr...  76.6    3e-11   
ref|XP_006599753.1|  PREDICTED: receptor-like protein 12-like         77.0    3e-11   
ref|XP_006607076.1|  PREDICTED: low-temperature-induced 65 kDa pr...  73.2    5e-11   
emb|CDX92720.1|  BnaC07g39780D                                        75.5    7e-11   
ref|XP_006401839.1|  hypothetical protein EUTSA_v10013021mg           75.1    8e-11   
ref|XP_010920779.1|  PREDICTED: low-temperature-induced 65 kDa pr...  74.3    9e-11   
ref|XP_006599602.1|  PREDICTED: low-temperature-induced 65 kDa pr...  70.9    3e-10   
ref|XP_010937576.1|  PREDICTED: low-temperature-induced 65 kDa pr...  72.8    3e-10   
ref|XP_006281549.1|  hypothetical protein CARUB_v10027650mg           73.6    3e-10   
ref|XP_006401838.1|  hypothetical protein EUTSA_v10013021mg           73.6    3e-10   
emb|CDY50195.1|  BnaA03g47530D                                        73.2    3e-10   
ref|XP_007152289.1|  hypothetical protein PHAVU_004G117100g           73.9    3e-10   
ref|XP_003549082.1|  PREDICTED: low-temperature-induced 65 kDa pr...  72.4    8e-10   
ref|XP_006413293.1|  hypothetical protein EUTSA_v10024860mg           71.6    1e-09   
ref|XP_010262567.1|  PREDICTED: low-temperature-induced 65 kDa pr...  70.9    1e-09   
ref|XP_010262568.1|  PREDICTED: low-temperature-induced 65 kDa pr...  70.9    1e-09   
ref|XP_008803155.1|  PREDICTED: uncharacterized protein LOC103716775  69.7    2e-09   
ref|XP_010442755.1|  PREDICTED: low-temperature-induced 65 kDa pr...  70.5    2e-09   
ref|XP_008801611.1|  PREDICTED: uncharacterized protein LOC103715...  69.3    4e-09   
ref|XP_008801609.1|  PREDICTED: uncharacterized protein LOC103715...  69.3    4e-09   
emb|CDY32583.1|  BnaC03g15510D                                        68.2    1e-08   
ref|XP_006607103.1|  PREDICTED: uncharacterized protein LOC102665694  64.3    3e-08   
ref|XP_004496835.1|  PREDICTED: low-temperature-induced 65 kDa pr...  66.6    5e-08   
ref|XP_010433615.1|  PREDICTED: low-temperature-induced 65 kDa pr...  66.2    5e-08   
ref|XP_010438861.1|  PREDICTED: low-temperature-induced 65 kDa pr...  66.2    5e-08   
gb|KFK26849.1|  hypothetical protein AALP_AA8G301300                  66.2    6e-08   
gb|ACV60548.1|  responsive to dessication 29B                         62.8    1e-07   Eucalyptus globulus [blue gum]
ref|XP_006374623.1|  hypothetical protein POPTR_0015s13130g           64.3    1e-07   
ref|XP_010473734.1|  PREDICTED: low-temperature-induced 65 kDa pr...  63.5    4e-07   
ref|XP_010482580.1|  PREDICTED: low-temperature-induced 65 kDa pr...  63.5    4e-07   
ref|XP_009132533.1|  PREDICTED: low-temperature-induced 65 kDa pr...  63.5    5e-07   
ref|XP_006361910.1|  PREDICTED: low-temperature-induced 78 kDa pr...  60.1    7e-07   
ref|XP_002270855.1|  PREDICTED: low-temperature-induced 65 kDa pr...  61.6    1e-06   Vitis vinifera
emb|CDY52364.1|  BnaA08g30990D                                        59.7    1e-06   
gb|ACA49510.1|  desiccation-related protein LbLEA-like_11-24          58.9    1e-06   Lindernia brevidens
gb|KDO39281.1|  hypothetical protein CISIN_1g016497mg                 61.2    1e-06   
emb|CDP09099.1|  unnamed protein product                              62.0    1e-06   
ref|XP_008465872.1|  PREDICTED: low-temperature-induced 65 kDa pr...  60.8    2e-06   
gb|KGN60472.1|  hypothetical protein Csa_3G914030                     60.5    2e-06   
ref|XP_004162420.1|  PREDICTED: uncharacterized LOC101214579          60.1    4e-06   
ref|XP_010326296.1|  PREDICTED: low-temperature-induced 78 kDa pr...  57.4    5e-06   
emb|CDY54087.1|  BnaC08g47270D                                        57.8    5e-06   
ref|XP_008794540.1|  PREDICTED: low-temperature-induced 65 kDa pr...  59.3    6e-06   
gb|KGN65746.1|  hypothetical protein Csa_1G524680                     59.7    6e-06   
ref|XP_008794541.1|  PREDICTED: low-temperature-induced 65 kDa pr...  59.3    6e-06   
ref|XP_004145331.1|  PREDICTED: uncharacterized protein LOC101208083  59.3    8e-06   
ref|XP_006846301.1|  hypothetical protein AMTR_s00012p00252930        57.8    9e-06   
ref|XP_004173885.1|  PREDICTED: uncharacterized LOC101208083          58.5    9e-06   
ref|XP_004148379.1|  PREDICTED: uncharacterized protein LOC101214579  58.9    1e-05   
ref|XP_009385275.1|  PREDICTED: uncharacterized protein LOC103972656  58.2    1e-05   
ref|XP_009779629.1|  PREDICTED: uncharacterized protein LOC104228788  58.2    1e-05   
emb|CDY38913.1|  BnaA03g12660D                                        58.5    1e-05   
ref|XP_010326274.1|  PREDICTED: low-temperature-induced 65 kDa pr...  55.8    1e-05   
ref|XP_006424892.1|  hypothetical protein CICLE_v10029821mg           57.8    1e-05   
ref|XP_003638372.1|  Low-temperature-induced 65 kDa protein           58.9    1e-05   
ref|XP_009411251.1|  PREDICTED: uncharacterized protein LOC103993050  57.8    1e-05   
ref|XP_003638373.1|  Low-temperature-induced 65 kDa protein           58.5    1e-05   
ref|XP_009622243.1|  PREDICTED: uncharacterized protein LOC104113696  58.2    2e-05   
gb|KEH43709.1|  hypothetical protein MTR_1g100623                     58.5    2e-05   
gb|KEH43708.1|  hypothetical protein MTR_1g100623                     58.5    2e-05   
ref|XP_006488670.1|  PREDICTED: muscle M-line assembly protein un...  57.8    2e-05   
ref|XP_008457449.1|  PREDICTED: low-temperature-induced 65 kDa pr...  57.8    2e-05   
gb|AAC49998.1|  cold acclimation protein                              57.8    3e-05   Spinacia oleracea
ref|XP_008457450.1|  PREDICTED: low-temperature-induced 65 kDa pr...  57.4    3e-05   
ref|XP_009398835.1|  PREDICTED: low-temperature-induced 65 kDa pr...  56.2    4e-05   
ref|XP_002314161.2|  hypothetical protein POPTR_0009s04010g           55.8    6e-05   Populus trichocarpa [western balsam poplar]
ref|XP_006418865.1|  hypothetical protein EUTSA_v10002567mg           55.8    7e-05   
ref|XP_011016353.1|  PREDICTED: uncharacterized protein LOC105119857  55.8    7e-05   
ref|XP_010685703.1|  PREDICTED: uncharacterized protein LOC104900...  55.8    8e-05   
ref|XP_010685702.1|  PREDICTED: uncharacterized protein LOC104900...  55.8    9e-05   
ref|XP_010473741.1|  PREDICTED: low-temperature-induced 65 kDa pr...  55.1    1e-04   
gb|ACI87805.1|  putative low-temperature-induced protein              52.8    1e-04   Cupressus sempervirens
ref|XP_004982668.1|  PREDICTED: retinitis pigmentosa 1-like 1 pro...  55.1    1e-04   
gb|AGY78336.1|  hypothetical protein                                  55.1    2e-04   
ref|XP_011032251.1|  PREDICTED: uncharacterized protein LOC105131131  54.7    2e-04   
ref|XP_010426121.1|  PREDICTED: low-temperature-induced 65 kDa pr...  54.3    2e-04   
ref|XP_010520258.1|  PREDICTED: low-temperature-induced 65 kDa pr...  53.9    3e-04   
ref|XP_009109201.1|  PREDICTED: low-temperature-induced 65 kDa pr...  52.4    3e-04   
ref|XP_010905104.1|  PREDICTED: LOW QUALITY PROTEIN: low-temperat...  52.8    6e-04   
ref|XP_010503295.1|  PREDICTED: low-temperature-induced 65 kDa pr...  52.4    0.001   



>emb|CDO99442.1| unnamed protein product [Coffea canephora]
Length=539

 Score =   234 bits (596),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 174/378 (46%), Positives = 215/378 (57%), Gaps = 50/378 (13%)
 Frame = +1

Query  646   GLEEDPHAPSDRP--RPPSNYESKTFDPTGAGGEEARISPLVQSFEKMEVRGDEAKPQQN  819
             GLEEDP AP +RP   PPSNYE+K  DPTG GGEE  I+PL+QSF KM V  DE+ P+  
Sbjct  185   GLEEDPQAPKNRPGEVPPSNYETKVTDPTGKGGEEIGITPLIQSFNKMGVY-DESVPKSE  243

Query  820   IRPQAGTHHKLYTGSHDQFAPEPMATNVYTSSKDTESIPKSFDPTNPE-NLPRDPIDGKP  996
                   +  + YTGSH QFAPEP  T        ++S PKS DP+ PE NLPRD + GK 
Sbjct  244   ------SGQEGYTGSHGQFAPEPNPTE-----GKSDSAPKSCDPSKPEDNLPRDTLTGKS  292

Query  997   QQEGSYAGKMQGEHEAASPVDYAKTAAMAVAEKLAPVYDRVAGAGSAVMEKLPIGAsger  1176
               +  Y  K+      ++  D A +A   VA KL        G G     K+P     + 
Sbjct  293   SDQSGYVEKIS--LATSTIADKAMSAKNVVASKL--------GYGGTEGGKVPETDEKKN  342

Query  1177  gkgeveg---egksvTSTVKEKLAPFYDKVAGAGSTLMSKVKGP-GTGQAVVVEGYEEGN  1344
                           V++TV +KLAP Y KVA AGS+++SKVKG  GTGQ    EG E   
Sbjct  343   AAKSGASPAEYAHKVSATVTDKLAPVYQKVAVAGSSVVSKVKGSTGTGQ----EGSETSG  398

Query  1345  DVRTDKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEET--VVEGKPVGKVTESEE  1518
                 DKGVS+KE+L EK KP EEDKALS++IS T L ++KEE     E KP+GKVTESEE
Sbjct  399   GKVPDKGVSVKEYLVEKFKPREEDKALSEVISET-LHKKKEEVGKTGESKPMGKVTESEE  457

Query  1519  VARRLGRIGDSPREG---------SEEKGMVDMLKGAVNSWL--GRDSQPQ---TTDTTN  1656
             VAR LG   +  REG         S  KGMVD LKGAV+SW+  GR+ Q     + D++N
Sbjct  458   VARHLGTGMERKREGEDAIAAGRESSGKGMVDRLKGAVSSWIVKGREDQQYSQGSADSSN  517

Query  1657  VRNEEVGHQSAVGERRLE  1710
             VRNE       +G RRL+
Sbjct  518   VRNEGSAASDEIGHRRLQ  535



>ref|XP_006353392.1| PREDICTED: low-temperature-induced 65 kDa protein-like [Solanum 
tuberosum]
Length=685

 Score =   220 bits (561),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 160/395 (41%), Positives = 216/395 (55%), Gaps = 66/395 (17%)
 Frame = +1

Query  577   PPFVSETHHQTSGHGRGDFLQPG----------GLEEDPHAPSDRPRPPSNYESKTFDPT  726
             PP V++T       GRG+    G          GLEEDP+ P D P P +NY+SK  DPT
Sbjct  308   PPVVTDT----GARGRGELNDQGLQGHKFKVLTGLEEDPNVPKDYPNP-TNYQSKVTDPT  362

Query  727   GAGGEEARISPLVQSFEKMEVRGDEAKPQQNIRPQAG-------THHKLYTGSHDQFAPE  885
             GA  EEA +SPLVQSFEKM V       +    P+AG       T H  YTGSHDQFAP+
Sbjct  363   GANNEEAGVSPLVQSFEKMGVNDVPETTRIRTEPKAGDFQFDQGTEHSQYTGSHDQFAPQ  422

Query  886   PMATNVYTSSKDTESIPKSFDPTNPENLPRDPIDGKPQQEGSYAGKMQGEHEAASPVDYA  1065
                T   +  ++TESIPKS +P+NPE+LP+D + GKP   GSY  K+            +
Sbjct  423   ESPTVFPSVRENTESIPKSINPSNPEDLPQDTLTGKP---GSYTEKLS-----------S  468

Query  1066  KTAAMAVAEKLAPVYDRVAGAGSAVMEKLPIGAsgergkgevegegksvTSTVKEKLAPF  1245
              T+A+A         D+   A + V  KL  G + E  +     +  + T++  E     
Sbjct  469   ATSAIA---------DKAVAAKNIVASKLGYGGTEEETQATAGDKDATKTTSATEFAQKA  519

Query  1246  YDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEG------NDVRTDKGVSIKEFLAEKLKPG  1407
                VAG  + +  KV   G+     V G+E        ++V+TDKGVS+ E+LAEK KPG
Sbjct  520   ASAVAGKLAPVYEKVAVAGSTVVTKVTGHENRGGVDAEHEVKTDKGVSMTEYLAEKFKPG  579

Query  1408  EEDKALSDMISGTLLSRQKEET--VVEGKPVGKVTESEEVARRLGRIGDSPRE----GSE  1569
             EED+ALS++ISG+ LSRQKE+T    E KP+GKVTES EV RRLG I  + +E     S 
Sbjct  580   EEDRALSEVISGS-LSRQKEKTEETGEAKPMGKVTESVEVERRLGPIESTKKEEEVGASG  638

Query  1570  E--------KGMVDMLKGAVNSWLGRDSQPQTTDT  1650
             E        +G++D +KGAV++WLG+  + Q  D+
Sbjct  639   ETKVGENFGQGVMDRVKGAVSTWLGKGVEAQANDS  673



>ref|XP_009775169.1| PREDICTED: low-temperature-induced 65 kDa protein-like [Nicotiana 
sylvestris]
Length=669

 Score =   214 bits (546),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 171/429 (40%), Positives = 212/429 (49%), Gaps = 134/429 (31%)
 Frame = +1

Query  640   PGGLEEDPHAPSDRPR---PPSNYESKTFDPTGAGGEEARISPLVQSFEKMEVRGD--EA  804
             P G+EEDPHAP DRP     P+NY+SK  DPTGA  EEA +SPLV  FEKM V     E 
Sbjct  295   PTGIEEDPHAPKDRPELSPNPTNYQSKVTDPTGATNEEAGVSPLVPLFEKMGVNDAPPET  354

Query  805   KPQQ---NIRPQAG---------THHKLYTGSHDQFAPEPMATNVYTSSKDTESIPKSFD  948
              P+Q    I P+ G         T H LYTG+HDQFAP+   T   +  K+TES+PKS +
Sbjct  355   TPKQGTEQIMPELGAGDNKFDQGTEHSLYTGTHDQFAPQEEPTGFPSVPKNTESLPKSMN  414

Query  949   PTNPENLPRDPIDGKPQQEGSYAGKMQGEHEA----------------------------  1044
             P+ PE+ P+D + GKP   GSY  K+     A                            
Sbjct  415   PSKPEDSPQDALTGKP---GSYTEKISSATSAIADKAVAAKNVVASKLGYGGTEEDTRKS  471

Query  1045  ------------ASPVDYAKTAAMAVAEKLAPVYDRVAGAGSAVMEKLPIGAsgergkge  1188
                          S  + A+ A   VAEKLAPVY++VAGAG+ VM               
Sbjct  472   QASVGDEDKAKTTSATELAQKAVSTVAEKLAPVYEKVAGAGTRVM---------------  516

Query  1189  vegegksvTSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYE---------EG  1341
                                            +KV+G  TG    V G+E         E 
Sbjct  517   -------------------------------AKVEGTATG----VTGHESRGGVDAEHED  541

Query  1342  NDVRTDKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEETVVEGKPVGKVTESEEV  1521
                 TDKGVS+KE+LAEK KPGEEDKALS++ISG+ LSRQKE+T  E KP+GKVTESEE 
Sbjct  542   KTKATDKGVSMKEYLAEKFKPGEEDKALSEVISGS-LSRQKEKT-EESKPMGKVTESEEE  599

Query  1522  ARRLGRIGDSPRE---GSEE--------KGMVDMLKGAVNSWLGRDSQPQTTDTTNVRNE  1668
              RRLG I D+ +E    S E        +G+VD LK AV +WLG+  + QT  +TN  N 
Sbjct  600   ERRLGPIEDAKKEEDGASGETQVGEGFGQGVVDRLKDAVTTWLGKGGETQT--STNGTNS  657

Query  1669  EVGHQSAVG  1695
              V   + VG
Sbjct  658   AVDGGAVVG  666



>dbj|BAC53927.1| hypothetical protein [Nicotiana tabacum]
Length=669

 Score =   214 bits (546),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 171/429 (40%), Positives = 212/429 (49%), Gaps = 134/429 (31%)
 Frame = +1

Query  640   PGGLEEDPHAPSDRPR---PPSNYESKTFDPTGAGGEEARISPLVQSFEKMEVRGD--EA  804
             P G+EEDPHAP DRP     P+NY+SK  DPTGA  EEA +SPLV  FEKM V     E 
Sbjct  295   PTGIEEDPHAPKDRPELSPNPTNYQSKVTDPTGATNEEAGVSPLVPLFEKMGVNDAPPET  354

Query  805   KPQQ---NIRPQAG---------THHKLYTGSHDQFAPEPMATNVYTSSKDTESIPKSFD  948
              P+Q    I P+ G         T H LYTG+HDQFAP+   T   +  K+TES+PKS +
Sbjct  355   TPKQGTEQIMPELGAGDNKFDQGTEHSLYTGTHDQFAPQEEPTGFPSVPKNTESLPKSMN  414

Query  949   PTNPENLPRDPIDGKPQQEGSYAGKMQGEHEA----------------------------  1044
             P+ PE+ P+D + GKP   GSY  K+     A                            
Sbjct  415   PSKPEDSPQDALTGKP---GSYTEKISSATSAIADKAVAAKNVVASKLGYGGTEEDTRKS  471

Query  1045  ------------ASPVDYAKTAAMAVAEKLAPVYDRVAGAGSAVMEKLPIGAsgergkge  1188
                          S  + A+ A   VAEKLAPVY++VAGAG+ VM               
Sbjct  472   QASVGDEDKAKTTSATELAQKAVSTVAEKLAPVYEKVAGAGTRVM---------------  516

Query  1189  vegegksvTSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYE---------EG  1341
                                            +KV+G  TG    V G+E         E 
Sbjct  517   -------------------------------AKVEGTATG----VTGHESRGGVDAEHED  541

Query  1342  NDVRTDKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEETVVEGKPVGKVTESEEV  1521
                 TDKGVS+KE+LAEK KPGEEDKALS++ISG+ LSRQKE+T  E KP+GKVTESEE 
Sbjct  542   KTKATDKGVSMKEYLAEKFKPGEEDKALSEVISGS-LSRQKEKT-EESKPMGKVTESEEE  599

Query  1522  ARRLGRIGDSPRE---GSEE--------KGMVDMLKGAVNSWLGRDSQPQTTDTTNVRNE  1668
              RRLG I D+ +E    S E        +G+VD LK AV +WLG+  + QT  +TN  N 
Sbjct  600   ERRLGPIEDAKKEEDGASGETQVGEGFGQGVVDRLKDAVTTWLGKGGETQT--STNGTNS  657

Query  1669  EVGHQSAVG  1695
              V   + VG
Sbjct  658   AVHGGAVVG  666



>ref|XP_009626657.1| PREDICTED: low-temperature-induced 65 kDa protein-like isoform 
X1 [Nicotiana tomentosiformis]
Length=650

 Score =   208 bits (529),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 173/430 (40%), Positives = 214/430 (50%), Gaps = 134/430 (31%)
 Frame = +1

Query  640   PGGLEEDPHAPSDRPR---PPSNYESKTFDPTGAGGEEARISPLVQSFEKMEVR-GDEAK  807
             P G+EEDPHAP  RP     P+NY+SK  DPTGA  EEA +SPLV+SFEKM V    E  
Sbjct  274   PTGIEEDPHAPKGRPELSPNPTNYQSKVADPTGANNEEAGVSPLVRSFEKMGVHDAPETT  333

Query  808   PQQ---NIRPQAG---------THHKLYTGSHDQFAPEPMATNVYTSSKDTESIPKSFDP  951
              +Q    IRP+ G         T H LYTGSHDQFAP+   T+  +  K TES+PKS +P
Sbjct  334   LKQRTEQIRPELGAGETKFDRGTEHSLYTGSHDQFAPQEAPTDFPSVPKQTESLPKSMNP  393

Query  952   TNPENLPRDPIDGKPQQEGSYAGKMQG-------------------------------EH  1038
             + PE+ P+D + GKP   GSY  K+                                  H
Sbjct  394   SKPEDSPQDTLTGKP---GSYTEKISSATSAIADKAVAAKNVVASKLGYGGTEEESSKSH  450

Query  1039  EAASPVDYAKTAAMA---------VAEKLAPVYDRVAGAGSAVMEKLPIGAsgergkgev  1191
                S  D AKT + A         VAEKLAPVY++VAGAG+ VM                
Sbjct  451   ATGSDEDKAKTNSAAELAQKAVSTVAEKLAPVYEKVAGAGTTVM----------------  494

Query  1192  egegksvTSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYE---------EGN  1344
                                           +KV+G  TG    V G+E         E  
Sbjct  495   ------------------------------AKVQGTATG----VTGHESRGGVDAEHEDK  520

Query  1345  DVRTDKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEETVVEGKP--VGKVTESEE  1518
                TDKGVS+KE+LAEK KPGEEDKALS++ISG+ LSRQKE+T   G+   +GKVTESEE
Sbjct  521   TKATDKGVSMKEYLAEKFKPGEEDKALSEVISGS-LSRQKEKTEETGEEKLIGKVTESEE  579

Query  1519  VARRLGRIGDSPRE---GSEE--------KGMVDMLKGAVNSWLGRDSQPQTTDTTNVRN  1665
             V RRLG I D+ +E    S E        +G+VD LK  V +WLG+  + QT  +TN  N
Sbjct  580   VERRLGPIEDAKKEEDGASGETQVGEGFGQGVVDRLKDVVTTWLGKGGETQT--STNGTN  637

Query  1666  EEVGHQSAVG  1695
               V   + VG
Sbjct  638   SAVDGGAVVG  647



>ref|XP_009626658.1| PREDICTED: low-temperature-induced 65 kDa protein-like isoform 
X2 [Nicotiana tomentosiformis]
Length=648

 Score =   199 bits (505),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 171/430 (40%), Positives = 212/430 (49%), Gaps = 136/430 (32%)
 Frame = +1

Query  640   PGGLEEDPHAPSDRPR---PPSNYESKTFDPTGAGGEEARISPLVQSFEKMEVR-GDEAK  807
             P G+EEDPHAP  RP     P+NY+SK  DPT    EEA +SPLV+SFEKM V    E  
Sbjct  274   PTGIEEDPHAPKGRPELSPNPTNYQSKVADPTD--NEEAGVSPLVRSFEKMGVHDAPETT  331

Query  808   PQQ---NIRPQAG---------THHKLYTGSHDQFAPEPMATNVYTSSKDTESIPKSFDP  951
              +Q    IRP+ G         T H LYTGSHDQFAP+   T+  +  K TES+PKS +P
Sbjct  332   LKQRTEQIRPELGAGETKFDRGTEHSLYTGSHDQFAPQEAPTDFPSVPKQTESLPKSMNP  391

Query  952   TNPENLPRDPIDGKPQQEGSYAGKMQG-------------------------------EH  1038
             + PE+ P+D + GKP   GSY  K+                                  H
Sbjct  392   SKPEDSPQDTLTGKP---GSYTEKISSATSAIADKAVAAKNVVASKLGYGGTEEESSKSH  448

Query  1039  EAASPVDYAKTAAMA---------VAEKLAPVYDRVAGAGSAVMEKLPIGAsgergkgev  1191
                S  D AKT + A         VAEKLAPVY++VAGAG+ VM                
Sbjct  449   ATGSDEDKAKTNSAAELAQKAVSTVAEKLAPVYEKVAGAGTTVM----------------  492

Query  1192  egegksvTSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYE---------EGN  1344
                                           +KV+G  TG    V G+E         E  
Sbjct  493   ------------------------------AKVQGTATG----VTGHESRGGVDAEHEDK  518

Query  1345  DVRTDKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEETVVEGKP--VGKVTESEE  1518
                TDKGVS+KE+LAEK KPGEEDKALS++ISG+ LSRQKE+T   G+   +GKVTESEE
Sbjct  519   TKATDKGVSMKEYLAEKFKPGEEDKALSEVISGS-LSRQKEKTEETGEEKLIGKVTESEE  577

Query  1519  VARRLGRIGDSPRE---GSEE--------KGMVDMLKGAVNSWLGRDSQPQTTDTTNVRN  1665
             V RRLG I D+ +E    S E        +G+VD LK  V +WLG+  + QT  +TN  N
Sbjct  578   VERRLGPIEDAKKEEDGASGETQVGEGFGQGVVDRLKDVVTTWLGKGGETQT--STNGTN  635

Query  1666  EEVGHQSAVG  1695
               V   + VG
Sbjct  636   SAVDGGAVVG  645



>gb|KHG03450.1| Low-temperature-induced 65 kDa -like protein [Gossypium arboreum]
Length=563

 Score =   187 bits (475),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 156/400 (39%), Positives = 214/400 (54%), Gaps = 53/400 (13%)
 Frame = +1

Query  610   SGHGRGDFLQPGGLEEDPHAPSDRPRP--PSNYESKTFDPTGAGGEEARISPLVQSFEKM  783
             SG  + +  +P GLEEDP AP D P     +NY+SK  DPTG GGE   I+PL+ S +KM
Sbjct  201   SGQPKVNLQRPIGLEEDPAAPKDNPDAYVTTNYQSKVTDPTGEGGEARGITPLLHSMDKM  260

Query  784   EVRGDEAKPQQNIRPQAGTH---HKLY-TGSHDQFAPEPMATNVYTSSKDTESIPKSFDP  951
              +  ++   + N+ P   TH    +LY TGSH+QF+P P      +   DT +  ++ D 
Sbjct  261   SIYEEDKGRKDNLPPP--THPVASELYPTGSHNQFSPGP------SPPLDTGTPAETMD-  311

Query  952   TNPENLPRDPIDGKPQQEGSYAGKMQGEHEAASPVDYAKTAAMAVAEKLAPVYDRVAGAG  1131
             T PE  PR+    +P  + SY  K+       +  D A +A   VA KL        G G
Sbjct  312   TKPEEHPRNVAADEPVNQSSYTEKLSSATSVIA--DKAVSAKNIVASKL--------GYG  361

Query  1132  SAVMEKLPIGAsgergkgevegegksvTSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQ  1311
                  +     S    +G     GK + +T+ +KL+P Y+KVAGAGST++SK+ GPG+G 
Sbjct  362   EKDESRTTTNGSSPTTQGSAIDYGKKMAATMADKLSPVYEKVAGAGSTMVSKLHGPGSGT  421

Query  1312  AVVVEGYEEGNDVRTDKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKE---ETVVE  1482
             A+ V   +  +    DKGVS+K ++AEKLKPGEED+ALS++IS  L  R++E   ET  E
Sbjct  422   AIEVYPDQVQDQ---DKGVSMKSYIAEKLKPGEEDRALSEVISEALQKRKEEPEKETTAE  478

Query  1483  GKPVGKVTESEEVARRLG-------RIGDSPREGSEEKGMVDMLKGAVNSWLGRDSQPQT  1641
                 GKVTESEEVARRLG       R+G S    S  K +VD LKG V SW G+      
Sbjct  479   ---RGKVTESEEVARRLGTTDETNERVG-SGSMNSPTKSVVDKLKGTVGSWFGKSE----  530

Query  1642  TDTTNVRNEEVGHQSAVGERRLEHQDAMAEGRSRLQESGH  1761
                 + +  E GH S+     +      + G  RLQESG+
Sbjct  531   ---VSSQGTEQGHGSSSSNNGV----PCSTGERRLQESGN  563



>ref|XP_011030111.1| PREDICTED: low-temperature-induced 65 kDa protein-like [Populus 
euphratica]
Length=579

 Score =   182 bits (462),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 146/383 (38%), Positives = 195/383 (51%), Gaps = 29/383 (8%)
 Frame = +1

Query  628   DFLQPGGLEEDPHAPSDR--PRPPSNYESKTFDPTGAGGEEARISPLVQSFEKMEVRGDE  801
             +   P GLEEDP+AP  R     PSNY++K  DPTG+GG+EA I+P++ SF+KM +  + 
Sbjct  200   NLKMPVGLEEDPYAPKGRLGDHAPSNYQTKVTDPTGSGGKEAGITPILHSFDKMNIYDES  259

Query  802   AKPQQNIRPQA--GTHHKLYTGSHDQFAPEPMATNVYTSSKDTESIPKSFDPTNPENLPR  975
                +QN+   +  G    L TGSHDQF+ EP      +S ++  S  KSF     +    
Sbjct  260   RGEKQNLSTGSRDGQLSLLPTGSHDQFSAEPTPPISISSQENPVSRSKSFVTLKAKEHTL  319

Query  976   DPIDGKPQQEGSYAGKMQGEHEAASPVDYAKTAAMAVAEKLAPVYDRVAGAGSAVMEKLP  1155
               I GKP  +  Y  K+     A   VD AK A   +A  L    +R   +    M    
Sbjct  320   SGIGGKPSNQSGYTEKISSATSAI--VDKAKAATNVMASNLG-YGERDNNSKEHTMTHE-  375

Query  1156  IGAsgergkgevegegksvTSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYE  1335
              G      K     E     +TV EKL P Y+KVAG GST+MSK+ G  T  +       
Sbjct  376   -GQVQNAAKPASTVEYGKKIATVTEKLTPLYEKVAGVGSTVMSKLHG-NTNASTNTSNEA  433

Query  1336  EGNDVRTDKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEETVV--EGKPVGKVTE  1509
             E      DKGVS+K++ AEKL+PGEED+ALS++IS T L++ K ET +   G+P+GKVT+
Sbjct  434   ESRIEGKDKGVSVKDYFAEKLRPGEEDRALSEVISET-LNKGKTETGMWKNGRPMGKVTD  492

Query  1510  SEEVARRLG-------RIGDSPREGSEEKGMVDMLKGAVNSWL-----GRDSQPQTTDTT  1653
             SEEV + LG        I DS       K + D LKGAV S        R+SQ     +T
Sbjct  493   SEEVEKSLGSEEENSDEITDSVSVHIPAKAVADKLKGAVGSLFVNSEESRESQQHPLCST  552

Query  1654  NVRNEEVGHQSA----VGERRLE  1710
             N   E      A    +GERRL+
Sbjct  553   NAGAEGFSSTYASGEEIGERRLQ  575



>ref|XP_002318815.2| stress-responsive family protein [Populus trichocarpa]
 gb|EEE97035.2| stress-responsive family protein [Populus trichocarpa]
Length=580

 Score =   177 bits (449),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 154/396 (39%), Positives = 200/396 (51%), Gaps = 40/396 (10%)
 Frame = +1

Query  640   PGGLEEDPHAPSDR--PRPPSNYESKTFDPTGAGGEEARISPLVQSFEKMEVRGDEAKPQ  813
             P GLEEDPHAP  R     PSNY++K  DPTG+GG+EA I+P++ SF+KM +  +    +
Sbjct  203   PVGLEEDPHAPKGRLGDHAPSNYQTKVTDPTGSGGKEAGITPILYSFDKMNIYDESRGEK  262

Query  814   QNIRPQA--GTHHKLYTGSHDQFAPEPMATNVYTSSKDTESIPKSFDPTNPENLPRDPID  987
             QN+   +  G    L TGSHDQF+ EP      +S ++  S  KSF     +      I 
Sbjct  263   QNLSTGSRDGQLSLLPTGSHDQFSAEPTPPISISSQENPVSGSKSFVTLKSKEHTLGGIG  322

Query  988   GKPQQEGSYAGKMQGEHEAASPVDYAKTAAMAVAEKLAPVYDRVAGAGSAVMEKLPIGAs  1167
              KP  +  Y  K+     A   VD AK A   +A  L    +R        M     G +
Sbjct  323   DKPPNQSGYTEKISSATSAI--VDKAKAATNVMASNLG-YGERDNNIKEHTMTHEGQGQN  379

Query  1168  gergkgevegegksvTSTVKEKLAPFYDKVAGAGSTLMSKVKG---PGTGQAVVVEGYEE  1338
               +    VE   K  T TV EKL P Y+KVAG GST+MSK+ G     T      E   E
Sbjct  380   AAKPASTVEYGKKIAT-TVTEKLTPVYEKVAGVGSTVMSKLHGNTNASTNTCNEAESRIE  438

Query  1339  GNDVRTDKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEETVV--EGKPVGKVTES  1512
             G D    KG S+K++ AEKL+PGEED+ALS++IS T L++ K ET +   G+P+GKVT+S
Sbjct  439   GKD----KGASVKDYFAEKLRPGEEDRALSEVISET-LNKGKTETGMWKNGRPMGKVTDS  493

Query  1513  EEVARRLG--------RIGDSPREGSEEKGMVDMLKGAVNSWL-----GRDSQPQTTDTT  1653
             EEV +RLG         I DS       KG+VD LKGAV S        R SQ     ++
Sbjct  494   EEVEKRLGSGEEENSDEITDSVSVHIPAKGVVDKLKGAVGSLFVKSEESRASQQHPLSSS  553

Query  1654  NVRNEEVGHQSAVGERRLEHQDAMAEGRSRLQESGH  1761
             N   E      A GE           G  RLQE+G+
Sbjct  554   NAGAEGFPSTYASGEEI---------GEKRLQETGN  580



>ref|XP_007038688.1| CAP160 protein, putative [Theobroma cacao]
 gb|EOY23189.1| CAP160 protein, putative [Theobroma cacao]
Length=590

 Score =   172 bits (437),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 146/395 (37%), Positives = 203/395 (51%), Gaps = 58/395 (15%)
 Frame = +1

Query  613   GHGRGDFLQPGGLEEDPHAPSDRPRP--PSNYESKTFDPTGAGGEEARISPLVQSFEKME  786
             G  + +  +P GLEEDP AP D P     +NY+SK  DPTG GGE   I+P++ S +KM+
Sbjct  221   GQPKVNLQRPKGLEEDPAAPEDTPHAYTTTNYQSKVTDPTGNGGEATGITPILHSLDKMK  280

Query  787   VRGDE-AKPQQNIRPQAGTHHK-----LYTGSHDQFAPEPMATNVYTSSKDTESIPKSFD  948
             +  ++    +QN+ P  GTHH+        GSHDQF+PEP         + +  + ++ +
Sbjct  281   IYDEQNIGREQNLPP--GTHHRSSKLTFPMGSHDQFSPEPTPAIPIKIPEKSPLVSETME  338

Query  949   PTNPE----NLPRDPIDGKPQQEGSYAGKMQGEHEAASPVDYAKTAAMAVAEKL------  1098
              T PE    N+P D    K     SY+ K+     A +    A++A   VA KL      
Sbjct  339   TTKPEEHVHNIPSD----KQSNLTSYSEKISSATSAIA--GKAESAKDMVASKLGYGEKD  392

Query  1099  -APVYDRVAGAGSAVMEKLPIGAsgergkgevegegksvTSTVKEKLAPFYDKVAGAGST  1275
               P  +   G G+  +                   GK +   V EKL P Y+KVA  GST
Sbjct  393   QTPANESHEGQGATKL-------------ASAVDYGKKMAVAVTEKLTPVYEKVAEVGST  439

Query  1276  LMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEFLAEKLKPGEEDKALSDMISGTLLS  1455
             ++SK+ GPGTG A  V    E      D+GVS+K ++AEKL+PG+ED+ALS++I+  L  
Sbjct  440   VVSKLHGPGTGTASEVHTEVE----EQDEGVSMKGYIAEKLRPGDEDRALSEVITDALHK  495

Query  1456  RQKEETVVEGKPVGKVTESEEVARRLGRIGDSPRE-------GSEEKGMVDMLKGAVNSW  1614
             R KE+   E +P  KV ES EV+RRLG  GD   E        S   G+VD LKGAV SW
Sbjct  496   R-KEDPEKETRPREKVIESVEVSRRLG-TGDERDERAGSGSVNSPTTGVVDKLKGAVGSW  553

Query  1615  LGRDSQP---QTTDTTNVRNEEVGHQSAVGERRLE  1710
              G+  +    Q    ++  NE  G  S+ GERRL+
Sbjct  554   FGKGEESPGIQQAHGSSYGNE--GFSSSTGERRLQ  586



>ref|XP_009340018.1| PREDICTED: low-temperature-induced 65 kDa protein-like [Pyrus 
x bretschneideri]
Length=595

 Score =   162 bits (411),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 135/385 (35%), Positives = 187/385 (49%), Gaps = 54/385 (14%)
 Frame = +1

Query  613   GHGRGDFLQPGGLEEDPHAPSDRPR--PPSNYESKTFDPTGAGGEEARISPLVQSFEKME  786
             G  R +  +P GLEEDPHAP   P+   PSNYE+K  DPT AGGEE  ISP++ SF K+ 
Sbjct  185   GQSRVNLDRPRGLEEDPHAPKANPQGYTPSNYETKGTDPTHAGGEEIGISPILHSFGKIN  244

Query  787   VRGDEAKPQQNIRPQAGTHHKLYTGSHDQFAPEPMATNVYTSSK----------DTESIP  936
             + G +AKP  N   Q  ++ +  + +    A E ++     +SK            +  P
Sbjct  245   IHGGDAKPSSN---QGSSYTEKVSSATSAIAEEAISAKNAVASKLGYGGGNNGQHEDVNP  301

Query  937   KSFDPTNPENLPRDPIDGKPQQEGSYAGKMQ----GEHEAASP---VDYAKTAAMAVAEK  1095
              ++ P N         D        Y G  Q    G H+  SP    +   +    V+  
Sbjct  302   HAYSPAN---------DSTNTGLHHYVGTNQNPSTGSHDQFSPEHPSNQGGSYTEKVSSA  352

Query  1096  LAPVYDRVAGAGSAVMEKLPIG-----------AsgergkgevegegksvTSTVKEKLAP  1242
              + + D+   A +A+  KL  G           A+   G      + + +T+ V EKL P
Sbjct  353   TSAIVDKAISAKNAIASKLGYGGDTDQQQHGDQAAVRSGSAAPGQQDEGITAAVTEKLTP  412

Query  1243  FYDKVAGAGSTLMSKVKGPGTGQAVVVEGYE---------EGNDVRTDKGVSIKEFLAEK  1395
              Y+K AGAGS +MSK+ G G G A   E +          E N    DKG+S+K +L EK
Sbjct  413   VYEKFAGAGSAVMSKLPG-GAGTAGKEEVHRGTGTTTTGGEYNKAGQDKGISMKGYLFEK  471

Query  1396  LKPGEEDKALSDMISGTLLSRQKEETVVEGKPVGKVTESEEVARRLG--RIGDSPREGSE  1569
             LKPGEED+ALS++IS TL   +        +PVGKVTES EV +RLG     D  ++ S 
Sbjct  472   LKPGEEDRALSEVISETLHMHKAGHPGSRARPVGKVTESMEVTQRLGPDYGDDGVQQSSY  531

Query  1570  EKGMVDMLKGAVNSWLGRDSQPQTT  1644
              K + D LKGAV S LG+  Q  T+
Sbjct  532   GKVVADTLKGAVGSLLGKADQSATS  556



>ref|XP_008343721.1| PREDICTED: low-temperature-induced 65 kDa protein-like [Malus 
domestica]
Length=592

 Score =   162 bits (411),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 152/449 (34%), Positives = 197/449 (44%), Gaps = 118/449 (26%)
 Frame = +1

Query  628   DFLQPGGLEEDPHAPSDRPR--PPSNYESKTFDPTGAGGEEARISPLVQSFEKMEVRGDE  801
             +  +P GLEEDPHAP   P+   PSNYE+K  DPT AGGEE  ISP++ SF K+ + G +
Sbjct  187   NLDRPRGLEEDPHAPKANPQGYTPSNYETKVTDPTHAGGEEIGISPILHSFNKINIHGGD  246

Query  802   AKPQQN-------------------------------------------IRPQA------  834
             AKP  N                                           + P A      
Sbjct  247   AKPSSNRGSSYTEKVSSATSAIAEEAISAKNAVASKLGYGGGNNDQHEDVNPHAYSPAHD  306

Query  835   ----GTHHKL------YTGSHDQFAPEPMATN--VYTSSKDTESIPKSFDPTNPENLPRD  978
                 G HH +       TGSHDQF+PE  +     YT    + +   +    + +N    
Sbjct  307   STNTGLHHYVGTNQNPSTGSHDQFSPEHPSNQGGSYTEKVSSATSAIADKAISAKNAVAS  366

Query  979   PI----DGKPQQEGSYAGKMQGEHEAASPVDYAKTAAMAVAEKLAPVYDRVAGAGSAVME  1146
              +    D   QQ G  A    G   +A+P    K    AV EKL PVY++VAGAGSAVM 
Sbjct  367   KLGYGGDTDQQQHGDQAAVRSG---SAAPGQQGKGITAAVTEKLTPVYEKVAGAGSAVMS  423

Query  1147  KLPIGAsgergkgevegegksvTSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVE  1326
             KLP G                               V  AG   + +  G  T       
Sbjct  424   KLPGG-------------------------------VGTAGKEEVHRSTGTATTGG----  448

Query  1327  GYEEGNDVRTDKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEETVVEGKPVGKVT  1506
                E N    DKG+S+K +L EKLKPGEED+ALS++IS TL   + E+     +PVGKVT
Sbjct  449   ---EYNKSGQDKGISVKGYLFEKLKPGEEDRALSEVISETLHMHKAEQPRSGARPVGKVT  505

Query  1507  ESEEVARRLG-RIGDSP-REGSEEKGMVDMLKGAVNSWLGR----DSQPQTTDTTNVRNE  1668
             ES EV +RLG   GD   ++ S  K + D +KGAV S LG+     + PQ+  ++     
Sbjct  506   ESMEVTQRLGPDYGDGDVQQSSYGKVVADTVKGAVGSLLGKADESATSPQSLGSSTGTEG  565

Query  1669  EVGHQSAVGERRLEHQDAMAEGRSRLQES  1755
                  S V ERR  H DA    + RLQ S
Sbjct  566   FSSSGSGVAERR-GHGDAE---QRRLQGS  590



>ref|XP_002268167.1| PREDICTED: low-temperature-induced 65 kDa protein-like isoform 
X1 [Vitis vinifera]
Length=542

 Score =   160 bits (406),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 139/373 (37%), Positives = 182/373 (49%), Gaps = 62/373 (17%)
 Frame = +1

Query  646   GLEEDPHAPSDRPRP--PSNYESKTFDPTGAGGEEARISPLVQSFEKMEVRGDEAKPQQN  819
             GLEE+PHAP DRP    P NY++K  DPTG GGEE  I+P++ SF+K+ V+    KP+Q 
Sbjct  202   GLEENPHAPKDRPEAVDPPNYQTKVADPTGDGGEEVVIAPIISSFDKISVQD---KPEQP  258

Query  820   IRPQAGTHHKLYTGSHDQFAPEPMATNVYTSSKDTESIPKSFDPTNPENLPRDPIDGKPQ  999
                +        TGSHDQF+PEP+     T+           DP +  N        KP 
Sbjct  259   FATR--------TGSHDQFSPEPLPAETKTTE----------DPQDTNNAE------KPS  294

Query  1000  QEGSYAGKMQGEHEAASPVDYAKTAAMAVAEKLAPVYDRVAGAGSAVMEKLPIGAsgerg  1179
              E +Y  K+            A +A   VA KL        G      E    G    + 
Sbjct  295   NEKTYTEKIS---------TAAISAKNTVASKLG------YGGTDKGEETHEGGDQTAKK  339

Query  1180  kgevegegksvTSTVKEKLAPFYDKVAGAGSTLMSKVKGPGT---GQAVVVEGYEEGNDV  1350
                V   GK + +T+ E L+P Y KVA AGS + SKV+G G+   G     +G E     
Sbjct  340   TSSVTEYGKKIANTLTETLSPVYGKVAEAGSAVKSKVQGTGSEREGPKEHDKGSEPEGCR  399

Query  1351  RTDKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKE-ETVVEGKPVGKVTESEEVAR  1527
               D  VS+K +LAEKLKP +ED+ALS++IS  L  R++E E   + KP+GKVTESEEVAR
Sbjct  400   APDNVVSMKAYLAEKLKPSDEDRALSEVISDALQKRKQEPELETKSKPMGKVTESEEVAR  459

Query  1528  RLGRIGDSPREGSEEKGM--------------VDMLKGAVNSWLGRDSQPQTTDTTNVRN  1665
             RLG       E S+   +              VD L+GAV+SWLG+    QT       N
Sbjct  460   RLGTENKPSGEASDSGDVKFDSSSNVNSGSGVVDKLRGAVSSWLGKGGDSQTRPQPIAGN  519

Query  1666  EEVGHQSAVGERR  1704
             E        GER+
Sbjct  520   EGFSTSGNGGERQ  532



>ref|XP_010662765.1| PREDICTED: low-temperature-induced 65 kDa protein-like isoform 
X2 [Vitis vinifera]
Length=541

 Score =   160 bits (405),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 134/352 (38%), Positives = 176/352 (50%), Gaps = 62/352 (18%)
 Frame = +1

Query  646   GLEEDPHAPSDRPRP--PSNYESKTFDPTGAGGEEARISPLVQSFEKMEVRGDEAKPQQN  819
             GLEE+PHAP DRP    P NY++K  DPTG GGEE  I+P++ SF+K+ V+    KP+Q 
Sbjct  202   GLEENPHAPKDRPEAVDPPNYQTKVADPTGDGGEEVVIAPIISSFDKISVQD---KPEQP  258

Query  820   IRPQAGTHHKLYTGSHDQFAPEPMATNVYTSSKDTESIPKSFDPTNPENLPRDPIDGKPQ  999
                +        TGSHDQF+PEP+     T+           DP +  N        KP 
Sbjct  259   FATR--------TGSHDQFSPEPLPAETKTTE----------DPQDTNNAE------KPS  294

Query  1000  QEGSYAGKMQGEHEAASPVDYAKTAAMAVAEKLAPVYDRVAGAGSAVMEKLPIGAsgerg  1179
              E +Y  K+            A +A   VA KL        G      E    G    + 
Sbjct  295   NEKTYTEKIS---------TAAISAKNTVASKLG------YGGTDKGEETHEGGDQTAKK  339

Query  1180  kgevegegksvTSTVKEKLAPFYDKVAGAGSTLMSKVKGPGT---GQAVVVEGYEEGNDV  1350
                V   GK + +T+ E L+P Y KVA AGS + SKV+G G+   G     +G E     
Sbjct  340   TSSVTEYGKKIANTLTETLSPVYGKVAEAGSAVKSKVQGTGSEREGPKEHDKGSEPEGCR  399

Query  1351  RTDKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKE-ETVVEGKPVGKVTESEEVAR  1527
               D  VS+K +LAEKLKP +ED+ALS++IS  L  R++E E   + KP+GKVTESEEVAR
Sbjct  400   APDNVVSMKAYLAEKLKPSDEDRALSEVISDALQKRKQEPELETKSKPMGKVTESEEVAR  459

Query  1528  RLGRIGDSPREGSEEKGM--------------VDMLKGAVNSWLGRDSQPQT  1641
             RLG       E S+   +              VD L+GAV+SWLG+    QT
Sbjct  460   RLGTENKPSGEASDSGDVKFDSSSNVNSGSGVVDKLRGAVSSWLGKGGDSQT  511



>ref|XP_002510792.1| hypothetical protein RCOM_1496000 [Ricinus communis]
 gb|EEF51394.1| hypothetical protein RCOM_1496000 [Ricinus communis]
Length=576

 Score =   159 bits (401),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 131/358 (37%), Positives = 188/358 (53%), Gaps = 48/358 (13%)
 Frame = +1

Query  628   DFLQPGGLEEDPHAPSDRPR--PPSNYESKTFDPTGAGGEEARISPLVQSFEKMEVRGDE  801
             +   P GLEEDPHAP DRP    PSNY++K  DPTGAGG E  I+ ++ SF+KM +   E
Sbjct  205   NLEMPKGLEEDPHAPKDRPEDTTPSNYQTKVADPTGAGGGEIGITSILPSFDKMNITS-E  263

Query  802   AKPQQNIRPQAGTHHK--LYTGSHDQFAPEPMATNVYTSSKDTESIPKSFDPTNPENLPR  975
              KP+         H K    TGSHDQF+PEP++     S   + S+ ++ D +       
Sbjct  264   PKPRAEEDLPTRPHDKSIFPTGSHDQFSPEPISPMPVDSHDSSRSVSETPDAS-------  316

Query  976   DPIDGKPQQEGSYAGKMQGEHEAASPVDYAKTAAMAVAEKLAPVYDRVAGAGSAVMEKLP  1155
                     ++GSY  K+     A +  D A +A   +A K+   Y       +    ++ 
Sbjct  317   --------KQGSYKEKIYSATSAIA--DKAISAKNVIASKIG--YQE----NNNKEHEMH  360

Query  1156  IGAsgergkgevegeg--ksvTSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEG  1329
             +G    +           K V +TV EKL+P Y+KVA   + +MSKV G G         
Sbjct  361   VGEEQRKTNLASSPVEYGKKVAATVTEKLSPVYEKVAETSNIVMSKVPGIGGSIGS----  416

Query  1330  YEEGNDVR-TDKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEETVVEGKPVGKVT  1506
              E  N+V+  DKGVS+K++ AEKL+PG+ED+ALS++IS   L +QK+E     +P+GKVT
Sbjct  417   -EGANNVKGQDKGVSVKDYFAEKLRPGDEDRALSEVIS-EALHKQKQEM---DQPIGKVT  471

Query  1507  ESEEVARRLGRIGDSPREGSEEKG--------MVDMLKGAVNSWLGRDSQPQTTDTTN  1656
             ESEEV RRLG   ++  E  ++          M+D +KGAV S LG+  + Q +   N
Sbjct  472   ESEEVKRRLGSNEENLEENVDQSSVRIPGGGMMIDKIKGAVGSMLGKRVETQGSSAGN  529



>gb|KDP22282.1| hypothetical protein JCGZ_26113 [Jatropha curcas]
Length=542

 Score =   157 bits (396),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 142/406 (35%), Positives = 191/406 (47%), Gaps = 131/406 (32%)
 Frame = +1

Query  649   LEEDPHAPSDRPRP--PSNYESKTFDPTGAGGEEARISPLVQSFEKMEVRGDEAKPQ---  813
             LEEDP AP DRP    PSNY++K  DPTGAGG+E  ++P+V+SF+++ +  DE KP+   
Sbjct  212   LEEDPDAPKDRPEDYIPSNYQTKVADPTGAGGKEIDVTPIVRSFKEVNIH-DEPKPEAED  270

Query  814   QNIRPQAGTHHKLYTGSHDQFAPEPMATNVYTSSKDTESIPKSFDPTNPENLPRDPIDGK  993
             Q+I P         TGSHDQF+P P +    TS +  +S+ K+ +    E         K
Sbjct  271   QSIFP---------TGSHDQFSPGPTSPIPITSQESPKSVSKTSNDDAAE---------K  312

Query  994   PQQEGSYAGKMQG--------------------------EHE------AASPVDYAKTAA  1077
               ++GSY  K+                            EHE      A SPV+Y K  A
Sbjct  313   TSKQGSYTEKISSAISDKAISAKNVVASKLGYGEKGDNKEHEGEEHAKATSPVEYGKKIA  372

Query  1078  MAVAEKLAPVYDRVAGAGSAVMEKLPIGAsgergkgevegegksvTSTVKEKLAPFYDKV  1257
               V EK++PVY++VA  GS ++ K+P                   T T  E+        
Sbjct  373   ATVTEKISPVYEKVAETGSNMISKVP----------------GMGTETANEE--------  408

Query  1258  AGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEFLAEKLKPGEEDKALSDMI  1437
                     SKVKG                    DKGVS+K +LAEKLKPGEEDKALS++I
Sbjct  409   -------ESKVKG-------------------QDKGVSMKNYLAEKLKPGEEDKALSEVI  442

Query  1438  SGTLLSRQKEETV--VEGKPVGKVTESEEVARRLGRIGDSPREGSEEK-----------G  1578
             S  L   + EE     + KP GKVTESE+V ++L        E S+E+            
Sbjct  443   SEALHKPKAEENENGNKNKPTGKVTESEKVKKQLAIT----EENSDERVDPSSVHNAGSA  498

Query  1579  MVDMLKGAVNSWLGRDSQPQ--TTDTTNVRNEEVGHQSAVGERRLE  1710
             MVD LKG V S  G+ ++ +  TT TT    +E       GERRL+
Sbjct  499   MVDKLKGVVGSVFGKGTETRGSTTGTTVFSGDE------TGERRLQ  538



>ref|XP_011076169.1| PREDICTED: LOW QUALITY PROTEIN: low-temperature-induced 65 kDa 
protein [Sesamum indicum]
Length=505

 Score =   150 bits (378),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 126/343 (37%), Positives = 160/343 (47%), Gaps = 68/343 (20%)
 Frame = +1

Query  646   GLEEDPHAPSDRP--RPPSNYESKTFDPTGAGGEEARISPLVQSFEKMEVRGDEAKPQQN  819
             GLEEDPH+P  R    P SNY +K  DPTG G +EA ++PLVQ  + + + GD+ KP+  
Sbjct  189   GLEEDPHSPKSRTGEIPASNYGAKVLDPTGEGPKEADVAPLVQRLDNLNI-GDK-KPEAK  246

Query  820   IRPQAGTHHKLYTGSHDQFAPEPMATNVYTSSKDT---------ESIPKSFDPTNPENLP  972
               P        YTGSHDQFAP+   T  Y + +           +S PK  +PT PE++P
Sbjct  247   PEP--------YTGSHDQFAPQTTPTADYFNPESNPLVGENPEPDSAPKISNPTQPESIP  298

Query  973   RDPIDGKPQQEGSYAGKMQGEHEAASPVDYAKTAAMAVAEKLAPVYDRVAGAGSAVMEKL  1152
             RD + GK     S            +  D A +A   VA KL        G      E L
Sbjct  299   RDTLAGKISSATS------------TIADKAISAKNVVALKLG-----YGGQLQEAGEDL  341

Query  1153  PIGAsgergkgevegegksvTSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGY  1332
             P                      V E LAP Y K+AGA + L    +G G       EG 
Sbjct  342   P------------RKPAADYGHKVAETLAPVYGKLAGAXAVLSKVRRGGGDEHESKGEGV  389

Query  1333  EEGNDVRTDKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEETVVEGKPVGKVTES  1512
              EG    TDKGVS+KE+L EKL+PGEEDK LS++I+     +Q         P G+ TES
Sbjct  390   GEG----TDKGVSVKEYLVEKLRPGEEDKMLSEVITEAFHKKQ---------PTGRKTES  436

Query  1513  EEVARRLGRIGDSPREGSEEKGMVDMLKGAVNSWLGRDSQPQT  1641
               V       G      +   G+VD LKGAV SWLG+    QT
Sbjct  437   AVVENTTVARGQ-----TSNAGVVDRLKGAVGSWLGKSGGTQT  474



>ref|XP_010107443.1| hypothetical protein L484_015784 [Morus notabilis]
 gb|EXC15981.1| hypothetical protein L484_015784 [Morus notabilis]
Length=546

 Score =   150 bits (379),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 150/428 (35%), Positives = 211/428 (49%), Gaps = 80/428 (19%)
 Frame = +1

Query  643   GGLEEDPHAPSDRPR-PPSNYESKTFDPTGAGGEEARISPLVQSFEKMEVRGDEAKP--Q  813
             GGL EDPHA  D P   P NY++K  DPTGAG EE  ++P++ SF+KM +  DE++P  Q
Sbjct  140   GGLVEDPHAAKDTPSYTPPNYQTKVTDPTGAGNEEIGVTPILSSFDKMNIH-DESEPKSQ  198

Query  814   QNIRPQAGTHHKLYTGSHDQFAPE----PMAT---------NV-----YTSSKDTESIPK  939
             +N+   +       TGSHDQF+P+    P+ T         N+      T+S  TE I  
Sbjct  199   RNVTNSS-------TGSHDQFSPDDAHKPIITPQHPQILQENIDTVKPETNSTLTEKISS  251

Query  940   SF-----DPTNPENL--------PRDPIDGKPQQEGSYAGKMQGEHEAASPVDYAK-TAA  1077
             +         + +N+         +D I G   +  + AG   G ++ +S  +Y K TA 
Sbjct  252   ATYSVADKAISAKNVVASKLGYGKKDEISGTRDESSTGAGPGSGNYKPSSAAEYGKKTAT  311

Query  1078  MAVAEKLAPVYDRVA---GAG-----SAVMEKLPIGA---sgergkgevegegksvTSTV  1224
              +VA+K     + VA   G G     S   ++   G    SG          GK   +TV
Sbjct  312   YSVADKAISAKNVVASKLGYGKKDEVSGTHDESSTGTGPGSGNYKPSSAAEYGKKTAATV  371

Query  1225  KEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEFLAEKLKP  1404
              EK  P Y+KVA AG+T +SK +G  T      E    G      +G S++++ AEKL+P
Sbjct  372   TEKPTPAYEKVAEAGTTAVSKTQGATTTTKPENESTSSGQG----RGASVRDYFAEKLRP  427

Query  1405  GEEDKALSDMISGTLLSRQKEETVVEGKPVGKVTESEEVARRLGRIGDSPREGSE-----  1569
             GEED+ALS +IS   L + K +     +PVGKVTESEEVAR+LG  GD   +  E     
Sbjct  428   GEEDRALSGVISD-ALHKGKHDQPETTRPVGKVTESEEVARKLG-TGDERDDEKEQSSNV  485

Query  1570  ----EKGMVDMLKGAVNSWLGRDSQPQTTDTTNVRNEEVGHQSAVGERRLEHQDAMAEGR  1737
                 EK +VD +KG V SWLG     Q+ D+          Q + G  + E  D + +G+
Sbjct  486   NQAGEKSVVDKVKGTVGSWLGFGGD-QSKDSV--------QQQSSGNSQGEVADNVQQGK  536

Query  1738  S--RLQES  1755
                RLQES
Sbjct  537   EERRLQES  544



>gb|KDO60004.1| hypothetical protein CISIN_1g007806mg [Citrus sinensis]
Length=589

 Score =   147 bits (371),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 136/412 (33%), Positives = 174/412 (42%), Gaps = 141/412 (34%)
 Frame = +1

Query  643   GGLEEDPHAPSDRPRPPSNYESKTFDPTGAGGEEARISPLVQSFEKMEVRGDEAKPQQNI  822
             GGL EDP   +     PSNY++K  DPTG GGEEA ISP + SFEKM +  DE+K +   
Sbjct  209   GGLVEDP--ATAGAYTPSNYQTKATDPTGKGGEEAGISPTLSSFEKMSIS-DESKSKSGQ  265

Query  823   RPQAGT-----HHKLYTGSHDQFAPE-----PMATNVYTSSKDTESIPKSFDPTNPENL-  969
             +    T     H  L TGSHDQF+PE     P+    + S+  T+  P        E L 
Sbjct  266   KQNWPTGTEDFHTSLSTGSHDQFSPELTPPKPVTGEAFHST-GTQDHPHDDYAEAKEALD  324

Query  970   -PRDPIDGKPQQEGSYAGKMQ-----------------------------GEHEA-----  1044
               RD   G+   +GSY  K+                              G HE      
Sbjct  325   SSRDTASGRQPNQGSYTEKISSATPAIAAKAISAKNVVASKLGYGEQGDTGGHEMHATGD  384

Query  1045  -------ASPVDYAKTAAMAVAEKLAPVYDRVAGAGSAVMEKLPIGAsgergkgevegeg  1203
                    AS VDY K   + V EKL+PVY++VAGAGS +M K+P                
Sbjct  385   KSKSSMPASTVDYGKKIGVTVTEKLSPVYEKVAGAGSTLMSKIP----------------  428

Query  1204  ksvTSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEF  1383
                                  G+T     K  G G                DKGVS+K++
Sbjct  429   ---------------------GTTNTGSEKEHGVGAQ--------------DKGVSVKDY  453

Query  1384  LAEKLKPGEEDKALSDMI-------------------------SGTLLSRQKEETVVEGK  1488
              AEKL+PGEED+ALS +I                         S  L +R +E   +  +
Sbjct  454   FAEKLRPGEEDRALSQVITEALRKKKAKQENKSTSSRPVTEVVSDALHNRNEEPEEITSR  513

Query  1489  PVGKVTESEEVARRLGRI-GDSPREG-------SEEKGMVDMLKGAVNSWLG  1620
             P+GKVTESEEVARRLG    D+  EG       +   G+V  +KGAV SW G
Sbjct  514   PMGKVTESEEVARRLGTTEHDTSNEGIDSSFVNNSNMGVVGKIKGAVGSWFG  565



>ref|XP_006490382.1| PREDICTED: low-temperature-induced 65 kDa protein-like [Citrus 
sinensis]
Length=668

 Score =   148 bits (373),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 148/459 (32%), Positives = 195/459 (42%), Gaps = 146/459 (32%)
 Frame = +1

Query  643   GGLEEDPHAPSDRPRPPSNYESKTFDPTGAGGEEARISPLVQSFEKMEVRGDEAKPQQNI  822
             GGL EDP   +     PSNY++K  DPTG GGEEA ISP + SFEKM +  DE+K +   
Sbjct  270   GGLVEDP--ATAGAYTPSNYQTKATDPTGKGGEEAGISPTLSSFEKMSI-SDESKSKSGQ  326

Query  823   RPQAGT-----HHKLYTGSHDQFAPE-----PMATNVYTSSKDTESIPKSFDPTNPENL-  969
             +    T     H  L TGSHDQF+PE     P+    + S+  T+  P        E L 
Sbjct  327   KQNWPTGTEDFHTSLSTGSHDQFSPELTPPKPVTGEAFHST-GTQDHPHDDYAEAKEALD  385

Query  970   -PRDPIDGKPQQEGSYAGKMQ-----------------------------GEHEA-----  1044
               RD   G+   +GSY  K+                              G HE      
Sbjct  386   SSRDTASGRQPNQGSYTEKISSATPAIAAKAISAKNVVASKLGYGEQGDTGGHEMHATGD  445

Query  1045  -------ASPVDYAKTAAMAVAEKLAPVYDRVAGAGSAVMEKLPIGAsgergkgevegeg  1203
                    AS VDY K   + V EKL+PVY++VAGAGS +M K+P                
Sbjct  446   KSKSSMPASTVDYGKKIGVTVTEKLSPVYEKVAGAGSTLMSKIP----------------  489

Query  1204  ksvTSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEF  1383
                                  G+T     K  G G                DKGVS+K++
Sbjct  490   ---------------------GTTNTGSEKEHGVGAQ--------------DKGVSVKDY  514

Query  1384  LAEKLKPGEEDKALSDMI-------------------------SGTLLSRQKEETVVEGK  1488
              AEKL+PGEED+ALS +I                         S  L +R +E   +  +
Sbjct  515   FAEKLRPGEEDRALSQVITEALRKKKAKQENKSTSSRPVTEVVSDALHNRNEEPEEITSR  574

Query  1489  PVGKVTESEEVARRLGRI-GDSPREG-------SEEKGMVDMLKGAVNSWLGRDSQPQTT  1644
             P+GKVTESEEVARRLG    D+  EG       +   G+V  +KGAV SW G   + +T 
Sbjct  575   PMGKVTESEEVARRLGTTEHDTSNEGIDSSFVNNSNMGVVGKIKGAVGSWFGGKGE-ETP  633

Query  1645  DTTNVRNEEVGHQSAVGERRLEHQDAMAEGRSRLQESGH  1761
              +    +  VG  SA+ E    + +    G  RLQE+G+
Sbjct  634   GSQQSHSAPVG--SALDEAGRNNNNTT--GERRLQETGN  668



>ref|XP_004234447.1| PREDICTED: low-temperature-induced 65 kDa protein-like [Solanum 
lycopersicum]
Length=659

 Score =   147 bits (371),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 100/244 (41%), Positives = 125/244 (51%), Gaps = 60/244 (25%)
 Frame = +1

Query  577   PPFVSETHHQTSGHGRGDFLQPG----------GLEEDPHAPSDRPRPPSNYESKTFDPT  726
             PP V++T       GRG+    G          GLEEDP+ P D P P +NY+SK  DPT
Sbjct  283   PPVVTDT----GARGRGELNDQGLQGHKFKVLTGLEEDPNVPKDYPNP-TNYQSKVTDPT  337

Query  727   GAGGEEARISPLVQSFEKMEVRGDEAKPQQNIRPQAG-------THHKLYTGSHDQFAPE  885
             GA  EEA +SPLVQSFEKM V       +    P+AG       T  + YTGSHDQFAP+
Sbjct  338   GANNEEAGVSPLVQSFEKMGVNDVPEATRMRTEPKAGDFQFDHGTERRQYTGSHDQFAPQ  397

Query  886   PMATNVYTSSKDTESIPKSFDPTNPENLPRDPIDGKPQQEGSYAGKMQGEHEA-------  1044
                T   +  +DTESIPKS +P+NP++LP+D + GKP   GSY   +     A       
Sbjct  398   ESPTVFPSVGEDTESIPKSMNPSNPQDLPQDTLTGKP---GSYTETLSSATSAIADKAVA  454

Query  1045  ----------------------------ASPVDYAKTAAMAVAEKLAPVYDRVAGAGSAV  1140
                                          S  +YA+ AA  VAEKLAPVY++VAGAGS V
Sbjct  455   AKNIVASKLGYGGTEEETRVTGGDATKTTSATEYAQKAASTVAEKLAPVYEKVAGAGSTV  514

Query  1141  MEKL  1152
             M K+
Sbjct  515   MAKV  518



>ref|XP_004308090.1| PREDICTED: uncharacterized protein LOC101294513 [Fragaria vesca 
subsp. vesca]
Length=714

 Score =   147 bits (371),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 147/432 (34%), Positives = 200/432 (46%), Gaps = 98/432 (23%)
 Frame = +1

Query  652   EEDPHAPSDRPRP--PSNYESKTFDPTGAGGEEARISPLVQSFEKMEVRGDEAKPQQNIR  825
             EEDPHAP   P+   PSNYE+K  DPT +GGEE  ++P++ SF+KM + GD+ +   N  
Sbjct  319   EEDPHAPKANPQADTPSNYETKVTDPTKSGGEETGVTPVLHSFDKMNLHGDDRQYLNNGA  378

Query  826   PQAGTHHKLYTGSHDQFAP--------------EPMATNVYTSSKD----------TESI  933
              Q        TGSHDQF+P                  +N   S+K+          TES 
Sbjct  379   DQD-------TGSHDQFSPGKPSNQGSSYISSAASAISNTAISAKNVVASKLGYGGTESA  431

Query  934   ---------PKSFDPTNPENLPRDPIDG--KPQQEGSYAGKMQGEHEAASPVDYAKTAAM  1080
                           P   +N   DP     +P +     G +Q +H  AS V  +  +  
Sbjct  432   EHDGYPGAGKSGSSPRQHQNQVLDPATNQFRPAETPQIRGTIQPDHNTASDVKQSNQSGG  491

Query  1081  AVAEKLAPVYDRVAG----AGSAVMEKL---------------PIGAsgergkgevegeg  1203
                EK++     +AG    A + V  KL               P        + + +G+G
Sbjct  492   TYTEKISSATSAIAGRALSAKNVVTSKLGYGSSDQVHDNRVVTPTNVQPGSTQADQQGKG  551

Query  1204  ksvTSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEF  1383
             K +TSTV EKL+P Y KVAGAG+ +MSK KG  T         E   +   DK  S+K++
Sbjct  552   KPITSTVAEKLSPVYGKVAGAGTAVMSKFKGGSTASTGRDTSTEAVGEAGKDKRGSVKDY  611

Query  1384  LAEKLKPGEEDKALSDMISGTLLSRQ---KEE--TVVEGKPVGKVTESEEVARRLGRIGD  1548
             L EKL PGEED+ALS +IS  L   +   KE+       KP+GKVTESEEV +RLG    
Sbjct  612   LVEKLSPGEEDRALSKVISEKLQIHKPGVKEQGGDSASAKPMGKVTESEEVRQRLGST--  669

Query  1549  SPREGSEEKGMVDMLKGAVNSWLGRDSQPQTTDTTNVRNEEVGHQS-AVGERRLEHQDAM  1725
                EG++   +V+ ++ +V S LG          TN   +E  HQS A GE R       
Sbjct  670   ---EGNDNY-VVNKIEDSVGSMLG---------GTNKNGDE--HQSAATGENR-------  707

Query  1726  AEGRSRLQESGH  1761
                  RLQESG+
Sbjct  708   -----RLQESGN  714



>gb|EYU19545.1| hypothetical protein MIMGU_mgv1a022832mg [Erythranthe guttata]
Length=314

 Score =   140 bits (354),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 136/348 (39%), Positives = 175/348 (50%), Gaps = 81/348 (23%)
 Frame = +1

Query  646   GLEEDPHAPSDRPR---PPSNYESKTFDPTGAGGEEARISPLVQSFEKMEVRGD-EAKPQ  813
             GLEEDP++P + P     PSNY+SK   P  +G +EA ++PLV  F+ + V G+ + +P+
Sbjct  21    GLEEDPNSPENSPSDNITPSNYQSKVAHPARSGSKEAEVAPLVSRFDTLNVGGESKTEPE  80

Query  814   QNIRPQAGTHHKLYTGSHDQFAPEPMATNVYTSSKDTESIPKSFDPTNPE--NLPRDPID  987
             Q            YT SHDQFAP+P  T        T+ I       NPE  NL +D   
Sbjct  81    Q---------RSSYTWSHDQFAPQPTPTK-------TQFI-------NPESANLKKD---  114

Query  988   GKPQQEGSYAGKMQGEHEAASPVDYAKTAAMAVAEKLAPVYDRVAGAGSAVMEKLPIGAs  1167
                Q   + AGK+     A +  D A +A  AVA KL        G G+A     P+ AS
Sbjct  115   ---QDPSTIAGKISATTSAIA--DKALSAKNAVASKLG------YGGGAAEAGNKPVSAS  163

Query  1168  gergkgevegegksvTSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGND  1347
                               V EKL P Y+KVAGAG+ +MSKV G G G AV V        
Sbjct  164   ATEYAH-----------MVAEKLTPAYEKVAGAGNAVMSKVVGGGGGDAVGVPA------  206

Query  1348  VRTDKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEETVVEGKP-VGKVTESEEVA  1524
                  G SI E+LAEKL+PG+EDKALS+ I+G            EG+P  GKVT S+EVA
Sbjct  207   ---KGGGSIGEYLAEKLRPGDEDKALSEAITGAFKG--------EGRPAAGKVTVSKEVA  255

Query  1525  RRLGRIGDSPREG---------SEEKGMVDMLKGAVNSWLGRDSQPQT  1641
              RLG + +S REG         S  +GMVD L+ AV  WLG+ +  QT
Sbjct  256   DRLGPVEESKREGEDAVAAGLESSGQGMVDRLRDAVGVWLGKSAGMQT  303



>ref|XP_006421916.1| hypothetical protein CICLE_v10004574mg [Citrus clementina]
 gb|ESR35156.1| hypothetical protein CICLE_v10004574mg [Citrus clementina]
Length=601

 Score =   145 bits (366),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 147/459 (32%), Positives = 192/459 (42%), Gaps = 146/459 (32%)
 Frame = +1

Query  643   GGLEEDPHAPSDRPRPPSNYESKTFDPTGAGGEEARISPLVQSFEKMEVRGDEAKPQQNI  822
             GGL EDP         PSNY++K  DPTG GGEEA ISP + SFEKM +  DE+K +   
Sbjct  203   GGLVEDPATAG--AYTPSNYQTKATDPTGKGGEEAGISPTLSSFEKMSIS-DESKSKSGQ  259

Query  823   RPQAGT-----HHKLYTGSHDQFAPE-----PMATNVYTSSKDTESIPKSFDPTNPENL-  969
             +    T     H  L TGSHDQF+PE     P+    + S+  T+  P        E L 
Sbjct  260   KQNWPTGTEDFHTSLSTGSHDQFSPELTPPKPVTGEAFHST-GTQDHPHDDYAEAKEALD  318

Query  970   -PRDPIDGKPQQEGSYAGKMQ-----------------------------GEHEA-----  1044
               RD   G+   +GSY  K+                              G HE      
Sbjct  319   SSRDTASGRQPNQGSYTEKISSATPAIAAKAISAKNVVASKLGYGEQGDTGGHEMHATGD  378

Query  1045  -------ASPVDYAKTAAMAVAEKLAPVYDRVAGAGSAVMEKLPIGAsgergkgevegeg  1203
                     S VDY K   + V EKL+PVY+ VAGAGS +M K+P                
Sbjct  379   KSKSSMPESTVDYGKKIGVTVTEKLSPVYEEVAGAGSTLMSKIP----------------  422

Query  1204  ksvTSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEF  1383
                                  G+T     K  G G                DKGVS+K++
Sbjct  423   ---------------------GTTNTGSEKEHGVGAQ--------------DKGVSVKDY  447

Query  1384  LAEKLKPGEEDKALSDMI-------------------------SGTLLSRQKEETVVEGK  1488
              AEKL+PGEED+ALS +I                         S  L +R +E   +  +
Sbjct  448   FAEKLRPGEEDRALSQVITEALRKKKAKQENKSTSSRPVTEVVSDALHNRNEEPEEITSR  507

Query  1489  PVGKVTESEEVARRLGRI-GDSPREG-------SEEKGMVDMLKGAVNSWLGRDSQPQTT  1644
             P+GKVTESEEVARRLG    D+  EG       +   G+V  +KGAV SW G   + +T 
Sbjct  508   PMGKVTESEEVARRLGTTEHDTSNEGIDSSFVNNSNMGVVGKIKGAVGSWFGGKGE-ETP  566

Query  1645  DTTNVRNEEVGHQSAVGERRLEHQDAMAEGRSRLQESGH  1761
              +    +  VG  SA+ E    + +    G  RLQE+G+
Sbjct  567   GSQQSHSAPVG--SALDEAGRNNNNTT--GERRLQETGN  601



>ref|XP_010273089.1| PREDICTED: low-temperature-induced 65 kDa protein-like [Nelumbo 
nucifera]
Length=467

 Score =   143 bits (361),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 128/353 (36%), Positives = 176/353 (50%), Gaps = 59/353 (17%)
 Frame = +1

Query  649   LEEDPHAPSDR--PRPPSNYESKTFDPTGAGGEEARISPLVQSFEKMEVRGDEAKPQQNI  822
             L +DP AP  R     P+NY++K  DPTGAGGEE R+ P+++SF KM+V        +  
Sbjct  128   LLKDPDAPKGRGDTSDPANYQTKATDPTGAGGEEVRVEPILESFGKMKV-------SEQP  180

Query  823   RPQAGTHHKLYTGSHDQFAPEPMATNVYTSSKDTESIP--------KSFDPTNPENLPRD  978
              P+A ++    TGSHDQF+P+       TS  + +++P        ++ +  NP   P  
Sbjct  181   EPEAWSN----TGSHDQFSPDLPPDQTNTSPGNAQTVPVTEAVVHSQAGEAGNPTTQPS-  235

Query  979   PIDGKPQQEGSYAGKMQGEHEAASPVDYAKTAAMAVAEKLAPVYDRVAGAGSAVMEKLPI  1158
                       SY  K+     A +  + A +A  AVA KL        G   A +   P 
Sbjct  236   ----------SYTEKISSATSAIA--EKAVSAKNAVASKLG------YGGNDAAVPGTPE  277

Query  1159  GAsgergkgevegegksvTSTVKEKLAPFYDKVAGAGSTLMSKVK----GPGTGQAVVVE  1326
             G    +     E   K     V   LAP Y+KV+GAGS ++SK++    G G G A    
Sbjct  278   GGDSTKSAPAGEYGRKFAEG-VTGTLAPVYEKVSGAGSAVVSKMQMNSNGRGNGTATAAA  336

Query  1327  ---GYEEGNDVRTDKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEETVVEGKPVG  1497
                G E GN +  DKGVS+KE+LAEKL+PG+EDKALS++IS  L +R KEE      P  
Sbjct  337   SGTGSEGGNVIVPDKGVSVKEYLAEKLRPGDEDKALSEVISEALNNR-KEEPEKGSPPQR  395

Query  1498  KVTESEEVARRLG--------RIGDSPREGSEEKGMVDMLKGAVNSWLGRDSQ  1632
             +VTES     RL         R+  S  +    KGMV  +KGAV SW G++ Q
Sbjct  396   EVTESTGTQIRLSSEEKNSTERV--SSADEKYRKGMVSKIKGAVYSWFGKEGQ  446



>ref|XP_006421915.1| hypothetical protein CICLE_v10004574mg [Citrus clementina]
 gb|ESR35155.1| hypothetical protein CICLE_v10004574mg [Citrus clementina]
Length=606

 Score =   145 bits (365),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 147/459 (32%), Positives = 193/459 (42%), Gaps = 146/459 (32%)
 Frame = +1

Query  643   GGLEEDPHAPSDRPRPPSNYESKTFDPTGAGGEEARISPLVQSFEKMEVRGDEAKPQQNI  822
             GGL EDP   +     PSNY++K  DPTG GGEEA ISP + SFEKM +  DE+K +   
Sbjct  208   GGLVEDP--ATAGAYTPSNYQTKATDPTGKGGEEAGISPTLSSFEKMSIS-DESKSKSGQ  264

Query  823   RPQAGT-----HHKLYTGSHDQFAPE-----PMATNVYTSSKDTESIPKSFDPTNPENL-  969
             +    T     H  L TGSHDQF+PE     P+    + S+  T+  P        E L 
Sbjct  265   KQNWPTGTEDFHTSLSTGSHDQFSPELTPPKPVTGEAFHST-GTQDHPHDDYAEAKEALD  323

Query  970   -PRDPIDGKPQQEGSYAGKMQ-----------------------------GEHEA-----  1044
               RD   G+   +GSY  K+                              G HE      
Sbjct  324   SSRDTASGRQPNQGSYTEKISSATPAIAAKAISAKNVVASKLGYGEQGDTGGHEMHATGD  383

Query  1045  -------ASPVDYAKTAAMAVAEKLAPVYDRVAGAGSAVMEKLPIGAsgergkgevegeg  1203
                     S VDY K   + V EKL+PVY+ VAGAGS +M K+P                
Sbjct  384   KSKSSMPESTVDYGKKIGVTVTEKLSPVYEEVAGAGSTLMSKIP----------------  427

Query  1204  ksvTSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEF  1383
                                  G+T     K  G G                DKGVS+K++
Sbjct  428   ---------------------GTTNTGSEKEHGVGAQ--------------DKGVSVKDY  452

Query  1384  LAEKLKPGEEDKALSDMI-------------------------SGTLLSRQKEETVVEGK  1488
              AEKL+PGEED+ALS +I                         S  L +R +E   +  +
Sbjct  453   FAEKLRPGEEDRALSQVITEALRKKKAKQENKSTSSRPVTEVVSDALHNRNEEPEEITSR  512

Query  1489  PVGKVTESEEVARRLGRI-GDSPREG-------SEEKGMVDMLKGAVNSWLGRDSQPQTT  1644
             P+GKVTESEEVARRLG    D+  EG       +   G+V  +KGAV SW G   + +T 
Sbjct  513   PMGKVTESEEVARRLGTTEHDTSNEGIDSSFVNNSNMGVVGKIKGAVGSWFGGKGE-ETP  571

Query  1645  DTTNVRNEEVGHQSAVGERRLEHQDAMAEGRSRLQESGH  1761
              +    +  VG  SA+ E    + +    G  RLQE+G+
Sbjct  572   GSQQSHSAPVG--SALDEAGRNNNNTT--GERRLQETGN  606



>ref|XP_011084415.1| PREDICTED: low-temperature-induced 65 kDa protein-like [Sesamum 
indicum]
Length=523

 Score =   143 bits (361),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 128/348 (37%), Positives = 171/348 (49%), Gaps = 62/348 (18%)
 Frame = +1

Query  637   QPGGLEEDPHAPSDRPR---PPSNYESKTFDPTGAGGEEARISPLVQSFEKMEVRGDEAK  807
             Q  GLEEDPH+         PPSNY+SK  DPTGAGG+EA ++   + F  + V  D + 
Sbjct  189   QTMGLEEDPHSTKTTRAAEIPPSNYQSKVTDPTGAGGKEADVA---RQFNNLNVH-DASA  244

Query  808   PQQNIRPQAGTHHKLYTGSHDQFAPEPMATNVYTSSKDTESIPKSFDPTNPENLPRDPID  987
               + +  QAG+      G      P     N +   +D E   K+ DP   E+LP++   
Sbjct  245   VSKPVAGQAGS------GGPLTPPPPKPTLNQF--DRDRELKGKTQDPAMSEDLPQETFT  296

Query  988   GKPQQEGSYAGKMQGEHEAASPVDYAKTAAMAVAEKLAPVYDRVAGA-GSAVMEKLPIGA  1164
             GK    G            A   D A +A  AVA KL   YD  +G  G       P   
Sbjct  297   GKISSTG------------AVIADKAVSAKNAVASKLG--YDGTSGQEGQEYSSGKP---  339

Query  1165  sgergkgevegegksvTSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGN  1344
                                V E LAP Y+KVAGAG+ +MSKV G  TG+    + ++EG 
Sbjct  340   --------ASELVTDYAHKVVETLAPVYEKVAGAGTVVMSKVHGS-TGE----DKHKEG-  385

Query  1345  DVRTDKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEETVVEGKPVGKVTESEEVA  1524
                 DKGV+  ++LAEKL+PG+EDKALS++I+       K++   E  PVGKVTESEEVA
Sbjct  386   ---ADKGVATTDYLAEKLRPGDEDKALSEVITEAF---HKKKDAGEKHPVGKVTESEEVA  439

Query  1525  RRLGRIGDSPREG---------SEEKGMVDMLKGAVNSWLGRDSQPQT  1641
              RLG   ++ REG         S  + + D +K AV SWLG+ +  QT
Sbjct  440   ARLGTGAETKREGDDALAAGAESSGQSVTDRVKDAVGSWLGKSTGIQT  487



>ref|XP_009349342.1| PREDICTED: low-temperature-induced 65 kDa protein-like isoform 
X2 [Pyrus x bretschneideri]
Length=754

 Score =   140 bits (353),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 174/553 (31%), Positives = 233/553 (42%), Gaps = 172/553 (31%)
 Frame = +1

Query  520   DTRQTT-------GGISRVQPLHNRP----PPF----------VSETHHQTSGHGRGDFL  636
             DTRQT+        G +RV PLH+R      P           V++  H ++    G F 
Sbjct  233   DTRQTSVTGKEGHSGQTRV-PLHHRGLDDRAPISSRGDYQKTNVTDPSHTSATGNEGHFG  291

Query  637   Q-------PGGLEEDPHAPSDRPRP--PSNYESKTFDPTGAGGEEARISPLVQSFEKMEV  789
             Q       P GLEEDP+A    P+   PSN ++K  DPT AGG+E  I+ + +SF+KM +
Sbjct  292   QSEVNLDRPRGLEEDPNAHMADPQAFTPSNVQTKVTDPTNAGGDEFGITQIHRSFDKMSI  351

Query  790   RGDEAKP------------------------------------------QQNIRPQA---  834
                + KP                                          ++++ P A   
Sbjct  352   HAGDTKPSNQGSSYTEKASSAASAIAGKATSAKNAVASTLGYGGGNNDQREDVNPYASSP  411

Query  835   -------------GTHHKLYTGSHDQFAPEP---------------MATNVYTS------  912
                          GT+  L TGSHDQF+PE                 A N   S      
Sbjct  412   ENDSTKSGLHRDVGTNQNLGTGSHDQFSPEHPPNQGGSYAVADKAISAKNAVASKLGYGG  471

Query  913   -SKDTESIPK---SFDPTNPENL--PRDPIDGKPQQEGSYAGKMQGEHEAASPVDYAKTA  1074
              + D     K   S   T  +NL  P +P +     +GSYAGK+     A   VD A +A
Sbjct  472   GNNDQHEFVKPQASSYQTTGQNLSTPENPSN-----QGSYAGKISSATNAL--VDTAISA  524

Query  1075  AMAVAEKLAPVYDR---------VAGAGSAVMEKLPIGAsgergkgevegegksvTSTVK  1227
                VA KL    D            G GSA  E    G                 T+ V 
Sbjct  525   KNVVASKLGYGGDTDQQQHGDHAAVGLGSAAPEHQGKGI----------------TAAVT  568

Query  1228  EKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRT-------DKGVSIKEFL  1386
             EK  P  +KVAGAGSTLMSK+ G  TG A   E ++     R        DKGVS+K +L
Sbjct  569   EKPTPVSEKVAGAGSTLMSKLPGS-TGTAGKEEVHQGTATTRAEYDKAGKDKGVSVKGYL  627

Query  1387  AEKLKPGEEDKALSDMISGTLLSRQKEETVVEGKPVGKVTESEEVARRLGRIGDSPREGS  1566
             +EKLKPGEED+A S+++S +L  R+ E++    +PVGKVTE+E V R+LG     P  G+
Sbjct  628   SEKLKPGEEDRAPSEVVSESLHERKAEQSRSGARPVGKVTETEAVTRQLG-----PDYGA  682

Query  1567  EE-------KGMVDMLKGAVNSWLGRDSQPQTTDTTNVRNEEVGHQ--SAVGERRLEHQD  1719
             E+       K + D LKGAV S  G+    QTT +   R    G +  S+ G    E + 
Sbjct  683   EDVQQSGYGKVVADTLKGAVGSLFGKAD--QTTASPESRGSSTGTEGFSSSGSGVAEQRG  740

Query  1720  AMAEGRSRLQESG  1758
                  + RL ESG
Sbjct  741   RGGVEKRRLDESG  753



>ref|XP_009349341.1| PREDICTED: low-temperature-induced 65 kDa protein-like isoform 
X1 [Pyrus x bretschneideri]
Length=756

 Score =   139 bits (349),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 172/552 (31%), Positives = 230/552 (42%), Gaps = 168/552 (30%)
 Frame = +1

Query  520   DTRQTT-------GGISRVQPLHNRP----PPF----------VSETHHQTSGHGRGDFL  636
             DTRQT+        G +RV PLH+R      P           V++  H ++    G F 
Sbjct  233   DTRQTSVTGKEGHSGQTRV-PLHHRGLDDRAPISSRGDYQKTNVTDPSHTSATGNEGHFG  291

Query  637   Q-------PGGLEEDPHAPSDRPRP--PSNYESKTFDPTGAGGEEARISPLVQSFEKMEV  789
             Q       P GLEEDP+A    P+   PSN ++K  DPT AGG+E  I+ + +SF+KM +
Sbjct  292   QSEVNLDRPRGLEEDPNAHMADPQAFTPSNVQTKVTDPTNAGGDEFGITQIHRSFDKMSI  351

Query  790   RGDEAKP------------------------------------------QQNIRPQA---  834
                + KP                                          ++++ P A   
Sbjct  352   HAGDTKPSNQGSSYTEKASSAASAIAGKATSAKNAVASTLGYGGGNNDQREDVNPYASSP  411

Query  835   -------------GTHHKLYTGSHDQFAPEP---------------MATNVYTS------  912
                          GT+  L TGSHDQF+PE                 A N   S      
Sbjct  412   ENDSTKSGLHRDVGTNQNLGTGSHDQFSPEHPPNQGGSYAVADKAISAKNAVASKLGYGG  471

Query  913   -SKDTESIPK----SFDPTNPENLPRDPIDGKPQQEGSYAGKMQGEHEAASPVDYAKTAA  1077
              + D     K    S+  T        P +  P  +GSYAGK+     A   VD A +A 
Sbjct  472   GNNDQHEFVKPQASSYQTTGTGQNLSTPEN--PSNQGSYAGKISSATNAL--VDTAISAK  527

Query  1078  MAVAEKLAPVYDR---------VAGAGSAVMEKLPIGAsgergkgevegegksvTSTVKE  1230
               VA KL    D            G GSA  E    G                 T+ V E
Sbjct  528   NVVASKLGYGGDTDQQQHGDHAAVGLGSAAPEHQGKGI----------------TAAVTE  571

Query  1231  KLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRT-------DKGVSIKEFLA  1389
             K  P  +KVAGAGSTLMSK+ G  TG A   E ++     R        DKGVS+K +L+
Sbjct  572   KPTPVSEKVAGAGSTLMSKLPGS-TGTAGKEEVHQGTATTRAEYDKAGKDKGVSVKGYLS  630

Query  1390  EKLKPGEEDKALSDMISGTLLSRQKEETVVEGKPVGKVTESEEVARRLGRIGDSPREGSE  1569
             EKLKPGEED+A S+++S +L  R+ E++    +PVGKVTE+E V R+LG     P  G+E
Sbjct  631   EKLKPGEEDRAPSEVVSESLHERKAEQSRSGARPVGKVTETEAVTRQLG-----PDYGAE  685

Query  1570  E-------KGMVDMLKGAVNSWLGRDSQPQTTDTTNVRNEEVGHQ--SAVGERRLEHQDA  1722
             +       K + D LKGAV S  G+    QTT +   R    G +  S+ G    E +  
Sbjct  686   DVQQSGYGKVVADTLKGAVGSLFGK--ADQTTASPESRGSSTGTEGFSSSGSGVAEQRGR  743

Query  1723  MAEGRSRLQESG  1758
                 + RL ESG
Sbjct  744   GGVEKRRLDESG  755



>ref|XP_009371330.1| PREDICTED: low-temperature-induced 65 kDa protein-like [Pyrus 
x bretschneideri]
Length=756

 Score =   139 bits (349),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 148/451 (33%), Positives = 195/451 (43%), Gaps = 149/451 (33%)
 Frame = +1

Query  628   DFLQPGGLEEDPHAPSDRPRP--PSNYESKTFDPTGAGGEEARISPLVQSFEKMEVRGDE  801
             +  +P GLEEDP+A    PR   PSN ++K  DPT AGG+E  I  + +SF+KM +   +
Sbjct  296   NLDRPRGLEEDPNARMANPRAFTPSNDQTKVTDPTNAGGDEFGIKQIHRSFDKMSIHAGD  355

Query  802   AKP------------------------------------------QQNIRPQA-------  834
              KP                                          ++++ P A       
Sbjct  356   TKPSNQGSSYTEKASSAASAIAGKATSAKNAVASTLGYGGGNNDQREDVNPYASSPENDS  415

Query  835   ---------GTHHKLYTGSHDQFAPE---------------PMATNVYTS-------SKD  921
                      GT+  L TGSHDQF+PE                 A N   S       + D
Sbjct  416   TKSGLHHDVGTNQNLGTGSHDQFSPEHPPNQGGSYAIADKAISAKNAIASKLGYGGGNND  475

Query  922   TESIPK----SFDPT-------NPENLPRDPIDGKPQQEGSYAGKMQGEHEAASPVDYAK  1068
                  K    S+  T        PEN         P  +GSY GK+     A +  D A 
Sbjct  476   QHEFVKPQASSYQTTGTGQNLSTPEN---------PSNQGSYTGKISSATTAIA--DTAI  524

Query  1069  TAAMAVAEKLAPVYDR---------VAGAGSAVMEKLPIGAsgergkgevegegksvTST  1221
             +A   VA KL    D            G+GSA  E+                +GK +T+ 
Sbjct  525   SAKNVVASKLGYGGDTDQQRHGDHAAVGSGSAAPEQ----------------QGKVITAA  568

Query  1222  VKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYE-------EGNDVRTDKGVSIKE  1380
             V EK  P  +KVAGAGSTLMSK+ G  TG A   E ++       E +    DKGVS+K 
Sbjct  569   VTEKPTPVSEKVAGAGSTLMSKLPGS-TGTAGKEEVHQGTATTRGEYDKAGKDKGVSVKG  627

Query  1381  FLAEKLKPGEEDKALSDMISGTLLSRQKEETVVEGKPVGKVTESEEVARRLGRIGDSPRE  1560
             +L+EKLKPGEED ALS++IS TL  R+ E+     +PVGKVTE+EEV R+LG     P  
Sbjct  628   YLSEKLKPGEEDLALSEVISETLHERKAEQPRSGARPVGKVTETEEVTRQLG-----PDY  682

Query  1561  GSEE-------KGMVDMLKGAVNSWLGRDSQ  1632
             G+E+       K + D LKGAV S  G+  Q
Sbjct  683   GAEDVQQSGYGKVVADTLKGAVGSLFGKADQ  713



>gb|KHN42539.1| Low-temperature-induced 65 kDa protein [Glycine soja]
Length=568

 Score =   125 bits (314),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 126/413 (31%), Positives = 186/413 (45%), Gaps = 71/413 (17%)
 Frame = +1

Query  616   HGRGDFLQPGGLEEDPHAP--SDRPRPPSNYESKTFDPTGAGGEEARISPLVQSFEKMEV  789
             H + +  +P  LEEDPHAP  + +   P+NY++K  DPTGAGG E  I+P+ +SF +M V
Sbjct  171   HRKVNLERPMYLEEDPHAPRSTSQAYAPANYQTKVTDPTGAGGAEIDITPVEKSFSRMAV  230

Query  790   RGD-EAKPQQNIRPQAGTHHKLYTGSHDQFAPE-PMATNVYTSSKDTESIPKSFDPTNPE  963
               + +  P+  +       H    GSH Q APE   ATN  T+    +S  K+   +   
Sbjct  231   HNEPKPYPEPKLFSTVPETHYPSAGSHSQLAPELSSATNYPTNYPSAQSYAKNTVASKLG  290

Query  964   NLPRDPIDGKPQQEGSYAGKMQGEHEAASPVDYAKTAAMAVAEKLAPVYDRVAGAGSAVM  1143
                          +     K  G +E  S +  A +A          + D+   A + V 
Sbjct  291   YGNNTETKTTQTTQTRNQLKNTG-NEKPSTISSATSA----------IADKAVSAKNTVA  339

Query  1144  EKLPIGAsgergkgevegegksv--------TSTVKEKLAPFYDKVAGAGSTLMSKVKGP  1299
              KL  G +    + E   +  +           +++EKLAP   K AG GS + SKV G 
Sbjct  340   SKLGFGDTATTTQQEKRTDHAAAPTEYGKSVAQSLREKLAPVSGKDAGVGSGVKSKVSGT  399

Query  1300  GTGQAVVVEGYEEGNDVRTDKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQK--EET  1473
              T              V  DKGVS+K++L +KL+PG+ED+ALS++IS TL  ++    E 
Sbjct  400   QTSSV----------GVEQDKGVSVKDYLVDKLRPGDEDRALSEVISETLHKKELPPVEV  449

Query  1474  VVEG-----------------------KPVGKVTESEEVARRLGRIGDSPREGSEE----  1572
               EG                       + +GKVTESEEV RRLG       +  +E    
Sbjct  450   TEEGVRKVVSDAVHKREDDPERRMEHQRILGKVTESEEVKRRLGGESVVTEKKYQEMYVN  509

Query  1573  ---KGMVDMLKGAVNSWLGRDSQPQTTDTTNVRNE------EVGHQSAVGERR  1704
                KG+VD LKG V +     ++ Q++  +++  E      E  +Q A GERR
Sbjct  510   SPGKGVVDKLKGVVGTCFTNPAENQSSQDSSMNYEAGRAEVEQVNQGAAGERR  562



>gb|EYU25094.1| hypothetical protein MIMGU_mgv1a023652mg [Erythranthe guttata]
Length=536

 Score =   124 bits (312),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 115/333 (35%), Positives = 154/333 (46%), Gaps = 83/333 (25%)
 Frame = +1

Query  646   GLEEDPHAPSDRPRPPSNYESKTFDP-TGAGGEEARISPLVQSFEKMEVRGDEAKPQQNI  822
             GLEEDPH+P +   P SNY+SK  DP TG GG+EA ++PL+Q  + + +           
Sbjct  202   GLEEDPHSPKNIRIPSSNYQSKVADPNTGRGGKEADVAPLLQRLDNIHI-----------  250

Query  823   RPQAGTHHKLYTGSHDQFAPEPMATNVYTSSKDTESIPKSFDPTNPENLPRDPIDGKPQQ  1002
                           HDQ   +P A +  +S  +           NPE LPR  I  K   
Sbjct  251   --------------HDQ--SKPAAASEQSSCTE-----------NPE-LPRGTIGEKISS  282

Query  1003  EGSYAGKMQGEHEAASPVDYAKTAAMAVAEKLAPVYDRVAGAGSAVMEKLPIGAsgergk  1182
               S               D A +A   VA KL   Y   A  G     K P+        
Sbjct  283   ATSVIA------------DKAVSAKNVVASKLG--YGGEAKEGGVDSSKKPVSELATEYG  328

Query  1183  gevegegksvTSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDK  1362
              +           V E LAP Y++VAGAGS ++SKV+G G     VV+G         DK
Sbjct  329   HK-----------VAETLAPVYERVAGAGSAVLSKVQGGGD---TVVQG------AAADK  368

Query  1363  GVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEETVV---EGKPVG-KVTESEEVARR  1530
             GVS+K++LAEK KPGEEDKALS+ I+      ++EE V+   E +P+G  V   E V  R
Sbjct  369   GVSMKQYLAEKFKPGEEDKALSEAIADAF--HKREEVVMKTEEDRPIGVAVIPEEAVVER  426

Query  1531  L---GRIGDSPREGSEEKGMVDMLKGAVNSWLG  1620
             +    R    P  GS++ G+V+ LKG V  W+G
Sbjct  427   VISTDRKEVVPPAGSDQTGVVNRLKGTVKMWIG  459



>ref|XP_008376577.1| PREDICTED: low-temperature-induced 65 kDa protein isoform X3 
[Malus domestica]
Length=755

 Score =   123 bits (309),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 142/444 (32%), Positives = 194/444 (44%), Gaps = 125/444 (28%)
 Frame = +1

Query  613   GHGRGDFLQPGGLEEDPHAPSDRPRP--PSNYESKTFDPTGAGGEEARISPLVQSFEKME  786
             G  + +  +P GLEEDP+A    P    PSN ++K   PT AGG+E  I+P+++SF+KM 
Sbjct  290   GQSKVNLDRPRGLEEDPNAHMADPLAFTPSNDQTKVTGPTNAGGDEIGITPILRSFDKMS  349

Query  787   VRGDEAKP------------------------------------------QQNIRP----  828
             +   + KP                                          ++++ P    
Sbjct  350   MHAGDTKPSNQGSSYTEKASSAASAIADKATSAKNAVASTLGYGGGNNDQREDVNPYTSS  409

Query  829   ------QAGTHH------KLYTGSHDQFAPE--PMATNVYT---SSKDTESIPKSFDP--  951
                   ++G HH       L TGSHDQF     P     YT   SS  +    KS     
Sbjct  410   PENDSTKSGLHHDVGTNQNLGTGSHDQFCSTHPPNQGGSYTEKVSSATSAVADKSISAEK  469

Query  952   ---------------------------TNPENL--PRDPIDGKPQQEGSYAGKMQGEHEA  1044
                                        T  +NL  P +P +     +GSY GK+     A
Sbjct  470   AVASKLGYGGGNKDQHEFVKPQASSYQTTGQNLSTPENPSN-----QGSYTGKISSATNA  524

Query  1045  ASPVDYAKTAAMAVAEKLAPVYDRVAGAGSAVMEKLPIG-AsgergkgevegegksvTST  1221
              S    A +A   VA KL        G G A  ++ P   A+   G    E +GK +T+ 
Sbjct  525   ISGT--AVSAKNVVASKL--------GYGGATDQQQPGDHAAVRSGSAAPEQQGKGITAP  574

Query  1222  VKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEFLAEKLK  1401
             V EK    Y+KVAGAGSTLMS + G  TG A   E ++     R +   + K++L+EKLK
Sbjct  575   VTEKPTTVYEKVAGAGSTLMSMLPG-STGTAGKEEIHQGTATTRGEYDKAGKDYLSEKLK  633

Query  1402  PGEEDKALSDMISGTLLSRQKEETVVEGKPVGKVTESEEVARRLGRIGDSPREGSEE---  1572
             PGEED+ALS++IS      + E+     +PVGKVTESEEV+RRLG     P  G+EE   
Sbjct  634   PGEEDRALSEVISENSHEGKAEQPRSGARPVGKVTESEEVSRRLG-----PDYGAEEVQQ  688

Query  1573  ----KGMVDMLKGAVNSWLGRDSQ  1632
                 K M D L+GAV S  G+  Q
Sbjct  689   SGYGKVMADTLRGAVGSLFGKADQ  712



>ref|XP_010671967.1| PREDICTED: low-temperature-induced 65 kDa protein-like [Beta 
vulgaris subsp. vulgaris]
Length=895

 Score =   120 bits (302),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 130/383 (34%), Positives = 181/383 (47%), Gaps = 79/383 (21%)
 Frame = +1

Query  649   LEEDPHAPSD--RPRPPSNYESKTFDPTGAGGEEARISPLVQSFEKMEVRGDEAKPQQNI  822
             LE+DPHAP+     R   NYESK  DPTG GGEE  ++P+++  ++M ++ DE++ Q+ I
Sbjct  505   LEKDPHAPTGPGEKRHADNYESKVTDPTGKGGEEIGVTPILRHLDRMNIQ-DESQ-QKAI  562

Query  823   RPQAGTHHKL---------YTGSHDQFAPEPMATNVYTSSKDTESIPKSFDPTNPENLPR  975
               Q  +  KL         +TGSHDQF+PEP+ +     S+  ES  + FD T+   L  
Sbjct  563   TSQQKSMFKLKQSPQDEKIFTGSHDQFSPEPVTSKTAVFSEVPESGSQ-FDTTSSGVLGS  621

Query  976   DPIDGKPQQEGSYAGKM------------QGEHEAASPVDYA------KTAAMA------  1083
                D   Q +GSY  K+            Q      S + Y        T+A +      
Sbjct  622   H--DDSEQTQGSYTEKITSAAAMMADKAKQATSSVTSKLGYGGSSDQHSTSATSGPHDTH  679

Query  1084  -----VAEKLAPVYDRVAG----AGSAVMEKLPIGAsgergkgevegegksvTSTVKEKL  1236
                    EK++ V   + G    A  AV  KL  G + ER               V+E  
Sbjct  680   SESGGYGEKISNVTASITGKAVQAKDAVATKLGYGGTHERQP-------------VQEGA  726

Query  1237  APFYDKVAGAG-STLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEFLAEKLKPGEE  1413
             +     V     ST+ S V G   G   V      G    TD+GVS+K +LAEKLKPGEE
Sbjct  727   SKGGSNVETVTRSTVGSDVHGSEMGHE-VDPSTTTGPSAWTDRGVSVKTYLAEKLKPGEE  785

Query  1414  DKALSDMISGTL-LSRQKEET--VVE--GK----PVGKVTESEEVARRLGRIGDSPRE--  1560
             DKAL+D+I+  L L + KE+    VE  G+      G+VTESEEVAR LGR  D+  +  
Sbjct  786   DKALADVIADALPLHKHKEDVSGAVEEDGRRKVTIKGRVTESEEVARELGRSEDTSYDDA  845

Query  1561  ----GSEEKGMVDMLKGAVNSWL  1617
                  S  KG+++ +K A  +W 
Sbjct  846   GAGLASPGKGVMERIKDAAGAWF  868



>ref|XP_003556105.1| PREDICTED: low-temperature-induced 65 kDa protein-like [Glycine 
max]
Length=538

 Score =   110 bits (275),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 115/344 (33%), Positives = 159/344 (46%), Gaps = 52/344 (15%)
 Frame = +1

Query  649   LEEDPHAPSDRPR--PPSNYESKTFDPTGAGGEEAR-ISPLVQSFEKMEVRGDEAKPQQN  819
             LEE+PHAP  RP   PP+NY++K  DP+  G +E   I+P+ +SF KM +  DE KP   
Sbjct  188   LEEEPHAPGSRPEAYPPTNYQTKITDPSVIGKDEIEEITPVEESFAKMNMH-DEPKPTPE  246

Query  820   IRPQAGTHHKLY--TGSHDQFAPEPMATNVYTSSKDTESIPKSFDPTNPENLPRDPIDGK  993
                QA      Y   G+HDQF P  ++    T     ES  +    T   N+ R+ ++  
Sbjct  247   PNIQATVVDSEYPPVGNHDQFVPH-LSAATQTQYPSAESHDQFNQETTSTNINRNLVN--  303

Query  994   PQQEGSYAGKMQGEHEAASPVDYAKTAAMAVAEKLAPVYDRVAGAGSAVMEKL-------  1152
             P + G     +    E   P+  AKT  + ++ K     +  +G   A+ +K+       
Sbjct  304   PTETGQTFNTITTTIEE-KPLYEAKTDEV-ISPKDVIASEAGSGEKDAIKDKVVTNKEQQ  361

Query  1153  PIGAsgergkgevegegksvTSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGY  1332
              IG +        +       S + EKLAP YDKVA  GS + SKV G  TG        
Sbjct  362   KIGDASNMSGSTAQHGKNIAHS-LTEKLAPVYDKVAVVGSAVKSKVTGTSTGGV------  414

Query  1333  EEGNDVRTDKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEETVVEGKPVGKVTES  1512
                    T   VS+K++LAEKLKPGEEDKALS++IS   L ++KEE              
Sbjct  415   ----GTETKNEVSVKDYLAEKLKPGEEDKALSELIS-EALHKKKEEP-------------  456

Query  1513  EEVARRLGRIGDSPREGSEE-------KGMVDMLKGAVNSWLGR  1623
               V    G + D   +  EE       KG+V  LKG V SW G+
Sbjct  457   --VKNEDGNLDDGNDKMCEEISVKSPGKGVVGKLKGVVGSWFGK  498



>ref|XP_008234251.1| PREDICTED: low-temperature-induced 65 kDa protein-like [Prunus 
mume]
Length=715

 Score =   110 bits (275),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 102/343 (30%), Positives = 151/343 (44%), Gaps = 55/343 (16%)
 Frame = +1

Query  613   GHGRGDFLQPGGLEEDPHAPSDRPRPPSNYESKTFDPTGAGGEEARISPLVQSFEKMEVR  792
             G  R +  +P GLEEDP+    +   PSNY++K  DPT AGGEE  I+P++ S +KM + 
Sbjct  383   GQSRVNLDRPRGLEEDPNP---QAYTPSNYQNKVTDPTNAGGEELGITPIIHSLDKMNIH  439

Query  793   GDEAKPQQNIRPQAGTHHKLYTGSHDQFAPEPM-ATNVYTSSKDTESIPKSFDPTNPENL  969
                          AGT    YT +    A + + A NV  S               P+  
Sbjct  440   -------------AGTEQSSYTSATSAIADKAISAENVAASKLGYGGNNDQHGDIKPQAC  486

Query  970   PRDPIDGKPQQEGSYAGKMQGEHE---AASPVDYAKTAAMAVAEKLAPVYDRVAGAGSAV  1140
                   G   ++  +     G H+   A SP + + T    ++   + + D    A + V
Sbjct  487   TASSNAGGGDEQKPHQNLSTGSHDQFCAESPSNQSSTYTEKISSATSAIADTAISAKNVV  546

Query  1141  MEKLPIGAsgergkgevegegksvTSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVV  1320
               KL  G + +                         +  A  G +   + +G G  Q   
Sbjct  547   ASKLGYGGNNDDDD--------------------HQEVTAKPGGSTSPEQQGKGVSQGKA  586

Query  1321  VEGYEEGNDVRTDKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEETVVEGKPVGK  1500
              +G          KGV++K++ AEKLKPGEED+ALS +IS  L   + E++    +PVGK
Sbjct  587   GQG----------KGVAVKDYFAEKLKPGEEDRALSAVISEALHKPKAEDSA---RPVGK  633

Query  1501  VTESEEVARRLGRIGDSPR--EGSEEKGMVDMLKGAVNSWLGR  1623
             VTESEEV +RLG      R  + S  K + D +KGAV+S  G+
Sbjct  634   VTESEEVTKRLGPDCGIERVEQSSYGKIVSDTVKGAVSSLFGK  676



>ref|XP_008354240.1| PREDICTED: low-temperature-induced 65 kDa protein-like [Malus 
domestica]
Length=499

 Score =   108 bits (271),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 120/322 (37%), Positives = 155/322 (48%), Gaps = 63/322 (20%)
 Frame = +1

Query  835   GTHHKLYTGSHDQFAPEPMATNVYTSSKDTESIPKSFDPTNPENLPRDPIDGKPQQEGSY  1014
             GT+    TGSHDQF+PE                       +P N           Q GSY
Sbjct  224   GTNQNPSTGSHDQFSPE-----------------------HPSN-----------QGGSY  249

Query  1015  AGKMQGEHEAASPVDYAKTAAMAVAEKLAPVYDRVAGAGSAVMEKLPIGAsgergkgeve  1194
               K+     A +  D A +A  AVA KL          G    ++    A+   G     
Sbjct  250   TEKVSSATSAIA--DKAISAKNAVASKLGY-------GGDTDQQQHGDQAAVRSGSAAPG  300

Query  1195  gegksvTSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYE---------EGND  1347
              +GK +T+ V EKL P Y+KVAGAGS +MSK+ G G G A   E +          E N 
Sbjct  301   QQGKGITAAVTEKLTPVYEKVAGAGSAVMSKLPG-GVGTAGKEEVHRSTGTATTGGEYNK  359

Query  1348  VRTDKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEETVVEGKPVGKVTESEEVAR  1527
                DKG+S+K +L EKLKPGEED+ALS++IS TL   + E+     +PVGKVTES EV +
Sbjct  360   SGQDKGISVKGYLFEKLKPGEEDRALSEVISETLHMHKAEQPRSGARPVGKVTESMEVTQ  419

Query  1528  RLG-RIGDS-PREGSEEKGMVDMLKGAVNSWLGR----DSQPQTTDTTNVRNEEVGHQSA  1689
             RLG   GD   ++ S  K + D +KGAV S LG+     + PQ+  ++          S 
Sbjct  420   RLGPDYGDGDVQQSSYGKVVADTVKGAVGSLLGKADESATSPQSLGSSTGTEGFSSSGSG  479

Query  1690  VGERRLEHQDAMAEGRSRLQES  1755
             V ERR  H D  AE R RLQ S
Sbjct  480   VAERR-GHGD--AEQR-RLQGS  497



>ref|XP_007143406.1| hypothetical protein PHAVU_007G069800g [Phaseolus vulgaris]
 gb|ESW15400.1| hypothetical protein PHAVU_007G069800g [Phaseolus vulgaris]
Length=463

 Score =   103 bits (257),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 108/346 (31%), Positives = 156/346 (45%), Gaps = 70/346 (20%)
 Frame = +1

Query  649   LEEDPHAPSDRPRP--PSNYESKTFDPTGAGGEEARISPLVQSFEKMEVRGDEAK--PQQ  816
             LEE+P++P  RP    P  Y +K   P     EEA    + +SF +M V+ DE K  P+ 
Sbjct  121   LEEEPYSPG-RPEAYTPPIYHTKVTHPI----EEAVKDEMEESFARMNVQ-DEPKSIPEL  174

Query  817   NIRPQ----------------AGTHHKLY--TGSHDQFAPEPMATNVYTSSKDTESIPKS  942
             N++P                 +      Y  + SH+QF  E M+ N+  + ++     ++
Sbjct  175   NLQPTVVDSEYPHVDQFLPHLSAAMQTQYPSSESHEQFTQETMSPNINKNLQNVTDSRQT  234

Query  943   FDPTNPENLPRDPIDGKPQQEGSYAGKMQGEHEAASPVDYAKTAAMAVAEKLAPVYDRVA  1122
             F+           I    ++   Y       + A SP D   + A +V +      DR  
Sbjct  235   FNT----------ITTTVEEHSCYEANT---YRAISPKDVTASEAGSVEKD-----DRKD  276

Query  1123  GAGSAVMEKLPIGAsgergkgevegegksvTSTVKEKLAPFYDKVAGAGSTLMSKVKGPG  1302
                +  +E+ P         G     GK++  ++ +KLAP YDKVAG GS + SKV G  
Sbjct  277   NVET--IEEQPKSGDASNMAGSTAEYGKNIAHSLTQKLAPVYDKVAGVGSAVKSKVSGTS  334

Query  1303  TGQAVVVEGYEEGNDVRT-DKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEETVV  1479
             TG      G E  N+V+  DKGVS+K++LAEKL+PGEEDKALS++IS  L  R+      
Sbjct  335   TGGV----GTERKNEVKEEDKGVSVKDYLAEKLRPGEEDKALSEVISEALHKRK------  384

Query  1480  EGKPVGKVTESEEVARRLGRIGDSPREGSEEKGMVDMLKGAVNSWL  1617
                        EE  +     GD        KG+VD LKG V SW 
Sbjct  385   -----------EEPVKNEHHGGDEKMRDDPGKGVVDKLKGVVGSWF  419



>ref|XP_003535616.2| PREDICTED: low-temperature-induced 65 kDa protein-like [Glycine 
max]
 gb|KHN21740.1| Low-temperature-induced 65 kDa protein [Glycine soja]
Length=515

 Score =   102 bits (255),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 129/420 (31%), Positives = 181/420 (43%), Gaps = 76/420 (18%)
 Frame = +1

Query  436   SANPTYPDKDYHG-SGLKDRGVFRRGEEDDTRQTTGGISRVQPL-HNRPPPFVSETHHQT  609
             +A PT    +Y G SG+   G    GEE       GGIS    +  N    F  E   + 
Sbjct  109   TAIPTSEQLEYLGKSGIDFGGTAVMGEEPRHDALLGGISSATEIDQNIAKTFSVEEKAEI  168

Query  610   SGHGRGDFLQPGGLEEDPHAP--SDRPRPPSNYESKTFDPTGAGGEEAR-ISPLVQSFEK  780
                 + +  +  GLEE PHAP  +     P NYE+K  DP+  G +E   I+P+ +SF K
Sbjct  169   P---KENLERSIGLEEAPHAPGSTIEAYTPPNYETKITDPSVIGKDEIEEITPVEESFAK  225

Query  781   MEVRGDEAKPQQNIRPQAGTHHKLYTG-------------SHD-QFAPEPMATNVYTSSK  918
             M V   E    + I P A  H +  +              SHD QF  E  +TN+  + +
Sbjct  226   MNVH--EKPTPEPIVPLAEKHDQFVSHLSAATQTRYPSSESHDDQFKQETTSTNINRNLE  283

Query  919   DTESIPKSFDPTNPENLPRDPIDGKPQQEGSYAGKMQGEHEAASPVDYAKTAAMAVAEKL  1098
             +      +F      N     ++ +P  E +         E  SP D             
Sbjct  284   NPTETGITF------NTITTTVEEQPHYEANID-------EVVSPKD-------------  317

Query  1099  APVYDRVAGAGSAVMEKLPIGAsgergkge-----vegegksvTSTVKEKLAPFYDKVAG  1263
               V D  AG+G  V  K  +  + E+G            GK++  ++ EKLAP YDKVA 
Sbjct  318   --VIDSEAGSGEKVEIKDKVVTNEEQGDASNMPDSTAQHGKNIAHSLSEKLAPVYDKVAE  375

Query  1264  AGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEFLAEKLKPGEEDKALSDMISG  1443
              G  + SKV    TG          G    T   VS+K++L+EKLKPGEEDK+LS++IS 
Sbjct  376   VGGAVKSKVTRTSTG----------GVGTETKNEVSVKDYLSEKLKPGEEDKSLSEVISE  425

Query  1444  TLLSRQKEETVVEGKPVGKVTESEEVARRLGRIGDSPREGSEEKGMVDMLKGAVNSWLGR  1623
              L  R++E       PV K  E E +     ++ +     S  KG+V  LKG V SW G+
Sbjct  426   ALHKRKEE-------PVKK--EDENLNGGDDKMCEESSVKSPGKGVVGKLKGVVGSWFGK  476



>ref|XP_008376575.1| PREDICTED: low-temperature-induced 65 kDa protein isoform X1 
[Malus domestica]
Length=757

 Score =   103 bits (257),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 91/221 (41%), Positives = 119/221 (54%), Gaps = 24/221 (11%)
 Frame = +1

Query  994   PQQEGSYAGKMQGEHEAASPVDYAKTAAMAVAEKLAPVYDRVAGAGSAVMEKLPIG-Asg  1170
             P  +GSY GK+     A S    A +A   VA KL        G G A  ++ P   A+ 
Sbjct  510   PSNQGSYTGKISSATNAISGT--AVSAKNVVASKL--------GYGGATDQQQPGDHAAV  559

Query  1171  ergkgevegegksvTSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDV  1350
               G    E +GK +T+ V EK    Y+KVAGAGSTLMS + G  TG A   E ++     
Sbjct  560   RSGSAAPEQQGKGITAPVTEKPTTVYEKVAGAGSTLMSMLPG-STGTAGKEEIHQGTATT  618

Query  1351  RTDKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEETVVEGKPVGKVTESEEVARR  1530
             R +   + K++L+EKLKPGEED+ALS++IS      + E+     +PVGKVTESEEV+RR
Sbjct  619   RGEYDKAGKDYLSEKLKPGEEDRALSEVISENSHEGKAEQPRSGARPVGKVTESEEVSRR  678

Query  1531  LGRIGDSPREGSEE-------KGMVDMLKGAVNSWLGRDSQ  1632
             LG     P  G+EE       K M D L+GAV S  G+  Q
Sbjct  679   LG-----PDYGAEEVQQSGYGKVMADTLRGAVGSLFGKADQ  714



>ref|XP_008376576.1| PREDICTED: low-temperature-induced 65 kDa protein isoform X2 
[Malus domestica]
Length=755

 Score =   103 bits (256),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 91/221 (41%), Positives = 119/221 (54%), Gaps = 24/221 (11%)
 Frame = +1

Query  994   PQQEGSYAGKMQGEHEAASPVDYAKTAAMAVAEKLAPVYDRVAGAGSAVMEKLPIG-Asg  1170
             P  +GSY GK+     A S    A +A   VA KL        G G A  ++ P   A+ 
Sbjct  508   PSNQGSYTGKISSATNAISGT--AVSAKNVVASKL--------GYGGATDQQQPGDHAAV  557

Query  1171  ergkgevegegksvTSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDV  1350
               G    E +GK +T+ V EK    Y+KVAGAGSTLMS + G  TG A   E ++     
Sbjct  558   RSGSAAPEQQGKGITAPVTEKPTTVYEKVAGAGSTLMSMLPG-STGTAGKEEIHQGTATT  616

Query  1351  RTDKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEETVVEGKPVGKVTESEEVARR  1530
             R +   + K++L+EKLKPGEED+ALS++IS      + E+     +PVGKVTESEEV+RR
Sbjct  617   RGEYDKAGKDYLSEKLKPGEEDRALSEVISENSHEGKAEQPRSGARPVGKVTESEEVSRR  676

Query  1531  LGRIGDSPREGSEE-------KGMVDMLKGAVNSWLGRDSQ  1632
             LG     P  G+EE       K M D L+GAV S  G+  Q
Sbjct  677   LG-----PDYGAEEVQQSGYGKVMADTLRGAVGSLFGKADQ  712



>emb|CBI22749.3| unnamed protein product [Vitis vinifera]
Length=361

 Score = 99.4 bits (246),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 74/186 (40%), Positives = 100/186 (54%), Gaps = 28/186 (15%)
 Frame = +1

Query  646   GLEEDPHAPSDRPRP--PSNYESKTFDPTGAGGEEARISPLVQSFEKMEVRGDEAKPQQN  819
             GLEE+PHAP DRP    P NY++K  DPTG GGEE  I+P++ SF+K+ V+    KP+Q 
Sbjct  103   GLEENPHAPKDRPEAVDPPNYQTKVADPTGDGGEEVVIAPIISSFDKISVQD---KPEQP  159

Query  820   IRPQAGTHHKLYTGSHDQFAPEPMATNVYTSS--KDTESIPK-SFDPTNPENLPRDPIDG  990
                +        TGSHDQF+PEP+     T+   +DT +  K S + T  E +    I  
Sbjct  160   FATR--------TGSHDQFSPEPLPAETKTTEDPQDTNNAEKPSNEKTYTEKISTAAISA  211

Query  991   KPQ--QEGSYAGKMQGE--HE--------AASPVDYAKTAAMAVAEKLAPVYDRVAGAGS  1134
             K     +  Y G  +GE  HE         +S  +Y K  A  + E L+PVY +VA AGS
Sbjct  212   KNTVASKLGYGGTDKGEETHEGGDQTAKKTSSVTEYGKKIANTLTETLSPVYGKVAEAGS  271

Query  1135  AVMEKL  1152
             AV  K+
Sbjct  272   AVKSKV  277



>ref|XP_007143405.1| hypothetical protein PHAVU_007G069800g [Phaseolus vulgaris]
 gb|ESW15399.1| hypothetical protein PHAVU_007G069800g [Phaseolus vulgaris]
Length=462

 Score =   100 bits (248),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 107/346 (31%), Positives = 156/346 (45%), Gaps = 71/346 (21%)
 Frame = +1

Query  649   LEEDPHAPSDRPRP--PSNYESKTFDPTGAGGEEARISPLVQSFEKMEVRGDEAK--PQQ  816
             LEE+P++P  RP    P  Y +K   P     EE +   + +SF +M V+ DE K  P+ 
Sbjct  121   LEEEPYSPG-RPEAYTPPIYHTKVTHPI----EEVK-DEMEESFARMNVQ-DEPKSIPEL  173

Query  817   NIRPQ----------------AGTHHKLY--TGSHDQFAPEPMATNVYTSSKDTESIPKS  942
             N++P                 +      Y  + SH+QF  E M+ N+  + ++     ++
Sbjct  174   NLQPTVVDSEYPHVDQFLPHLSAAMQTQYPSSESHEQFTQETMSPNINKNLQNVTDSRQT  233

Query  943   FDPTNPENLPRDPIDGKPQQEGSYAGKMQGEHEAASPVDYAKTAAMAVAEKLAPVYDRVA  1122
             F+           I    ++   Y       + A SP D   + A +V +      DR  
Sbjct  234   FNT----------ITTTVEEHSCYEANT---YRAISPKDVTASEAGSVEKD-----DRKD  275

Query  1123  GAGSAVMEKLPIGAsgergkgevegegksvTSTVKEKLAPFYDKVAGAGSTLMSKVKGPG  1302
                +  +E+ P         G     GK++  ++ +KLAP YDKVAG GS + SKV G  
Sbjct  276   NVET--IEEQPKSGDASNMAGSTAEYGKNIAHSLTQKLAPVYDKVAGVGSAVKSKVSGTS  333

Query  1303  TGQAVVVEGYEEGNDVRT-DKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEETVV  1479
             TG      G E  N+V+  DKGVS+K++LAEKL+PGEEDKALS++IS  L  R+      
Sbjct  334   TGGV----GTERKNEVKEEDKGVSVKDYLAEKLRPGEEDKALSEVISEALHKRK------  383

Query  1480  EGKPVGKVTESEEVARRLGRIGDSPREGSEEKGMVDMLKGAVNSWL  1617
                        EE  +     GD        KG+VD LKG V SW 
Sbjct  384   -----------EEPVKNEHHGGDEKMRDDPGKGVVDKLKGVVGSWF  418



>gb|KHN26655.1| Low-temperature-induced 65 kDa protein [Glycine soja]
Length=515

 Score =   100 bits (249),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 101/288 (35%), Positives = 141/288 (49%), Gaps = 30/288 (10%)
 Frame = +1

Query  649   LEEDPHAPSDRPR--PPSNYESKTFDPTGAGGEEAR-ISPLVQSFEKMEVRGDEAKPQQN  819
             LEE+PHAP  RP   PP+NY++K  DP+  G +E   I+P+ +SF KM +  DE KP   
Sbjct  188   LEEEPHAPGSRPEAYPPTNYQTKITDPSVIGKDEIEEITPVEESFAKMNMH-DEPKPTPE  246

Query  820   IRPQAGTHHKLY--TGSHDQFAPEPMATNVYTSSKDTESIPKSFDPTNPENLPRDPIDGK  993
                QA      Y   G+HDQF P  ++    T     ES  +    T   N+ R+ ++  
Sbjct  247   PNIQATVVDSEYPPVGNHDQFVPH-LSAATQTQYPSAESHDQFNQETTSTNINRNLVN--  303

Query  994   PQQEGSYAGKMQGEHEAASPVDYAKTAAMAVAEKLAPVYDRVAGAGSAVMEKL-------  1152
             P + G     +    E   P+  AKT  + ++ K     +  +G   A+ +K+       
Sbjct  304   PTETGQTFNTITTTIEE-KPLYEAKTDEV-ISPKDVIASEAGSGEKDAIKDKVVTNKEQQ  361

Query  1153  PIGAsgergkgevegegksvTSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGY  1332
              IG +        +       S + EKLAP YDKVA  GS + SKV G  TG        
Sbjct  362   KIGDASNMSGSTAQHGKNIAHS-LTEKLAPVYDKVAVVGSAVKSKVTGTSTGGVGT----  416

Query  1333  EEGNDVRTDKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEETV  1476
                    T   VS+K++LAEKLKPGEEDKALS++IS   L ++KEE V
Sbjct  417   ------ETKNEVSVKDYLAEKLKPGEEDKALSELIS-EALHKKKEEPV  457



>ref|XP_010061041.1| PREDICTED: low-temperature-induced 65 kDa protein-like [Eucalyptus 
grandis]
 gb|KCW90704.1| hypothetical protein EUGRSUZ_A02790 [Eucalyptus grandis]
Length=651

 Score = 99.8 bits (247),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 98/173 (57%), Gaps = 23/173 (13%)
 Frame = +1

Query  1213  TSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEFLAE  1392
             T+TV EKL+P   KV G   T+  + + PG          E       DKGVS++E+LAE
Sbjct  491   TATVTEKLSPVISKVTGL--TMGQRTEAPG----------EVAGAQNQDKGVSVREYLAE  538

Query  1393  KLKPGEEDKALSDMISGTLLSRQKEETVVEGKPVGKVTESEEVARRLGRIGDSPREGSEE  1572
             KLKPGEEDKALS++IS + L ++K     E     KVTESEEV ++LG   D  +  +  
Sbjct  539   KLKPGEEDKALSEVIS-SALHKKKTAPGAEAATAVKVTESEEVKKQLGEE-DEGKLSTPG  596

Query  1573  KGMVDMLKGAVNSWLGR--DSQPQTTDTTNVRNEEVGHQSAV-----GERRLE  1710
             K +VD L+G VNSWLG+  DS+ Q     +  +E V   SA      GERRL+
Sbjct  597   KAIVDQLRGTVNSWLGKTDDSKAQQQPARHDESEAV--SSAADEHYGGERRLQ  647


 Score = 94.0 bits (232),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 88/172 (51%), Gaps = 29/172 (17%)
 Frame = +1

Query  628   DFLQPGGLEEDPHAPSDRPRPPSNYESKTFDPTGAGGEEARISPLVQSFEKMEVRGDEAK  807
             +  +PGGLE DP +P  R R PSNY++K  DPT +GGEEA +SP++ S  KM V  DE  
Sbjct  193   NLARPGGLEVDPQSPGSR-REPSNYQTKVTDPTASGGEEADVSPVILSIGKMTVH-DETG  250

Query  808   PQQNIRPQ--AGTHHKLY-----TGSHDQFAPEPMATNVYTSSKDTESIPKSFDPTNPEN  966
             P+        A TH  +      TGSH QF+PEP       +S +T++     D T PE+
Sbjct  251   PKSGTGQSLPAETHAYISNVPAGTGSHGQFSPEP-------TSMETDTTSMGVDVTKPED  303

Query  967   LPRDPIDGKPQQEGSYAGKMQGEHEAASPVDYAKTAAMAVAEKLAPVYDRVA  1122
              PRD  + KP   GSY  K+              +A  A+AEK     + VA
Sbjct  304   HPRDQTEHKPSSPGSYTEKLS-------------SATSAIAEKAVSAKNLVA  342



>ref|XP_006600079.1| PREDICTED: low-temperature-induced 65 kDa protein-like [Glycine 
max]
Length=383

 Score = 96.3 bits (238),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 78/205 (38%), Positives = 108/205 (53%), Gaps = 54/205 (26%)
 Frame = +1

Query  1219  TVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEFLAEKL  1398
             ++ EKLAP   KVAGAGS + SKV G  T       G E+      DKGVS+K++L +KL
Sbjct  188   SLTEKLAPVSGKVAGAGSGVKSKVSGTQTSSM----GVEQ------DKGVSVKDYLVDKL  237

Query  1399  KPGEEDKALSDMISGTLLSRQKE----ETVVEG-----------------------KPVG  1497
             +PG+ED+ALS++IS TL   +KE    E   EG                       + +G
Sbjct  238   RPGDEDRALSEVISETL--HKKELPPVEVTEEGVRKVVSDAVHKREDDPERRMEHQRILG  295

Query  1498  KVTESEEVARRLGRIGDSPREGSEE-------KGMVDMLKGAVNSWLGRDSQPQTTDTTN  1656
             KVTESEEV RRLG       + ++E       KG+VD LKG V +W    ++ Q++  ++
Sbjct  296   KVTESEEVKRRLGGESVVTEKKNQEMYVNSPGKGVVDKLKGVVGTWFTNPAENQSSQDSS  355

Query  1657  VRNEEVG-------HQSAVGERRLE  1710
             + N E G       +Q A GERRL+
Sbjct  356   M-NYEAGRAEVEQVNQGAAGERRLQ  379



>gb|KEH26136.1| seed maturation protein PM39, putative [Medicago truncatula]
Length=1109

 Score = 99.0 bits (245),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 85/246 (35%), Positives = 122/246 (50%), Gaps = 47/246 (19%)
 Frame = +1

Query  1084  VAEKLAPVYDRVAGAGSAVMEKLPIGAsgergkgevegegksvTSTVKEKLAPFYDKVAG  1263
             ++   + + D+ A A +AV  KL  G  G      +    ++ +       A +   +A 
Sbjct  870   ISSATSAIADKAASAKNAVASKLGFGEKGATETERMTTYEENNSGVSP---AEYGKNIAA  926

Query  1264  AGSTLMSKVKGP--GTGQAVVVEGYEEGNDVRTDKGVSIKEFLAEKLKPGEEDKALSDMI  1437
             + +  +S V G   GTG   V  G E+      DKGVS+K++ +EKL+PGEED+ALS++I
Sbjct  927   SLTEKLSPVTGKVIGTGTERVTAGVEQ------DKGVSMKDYFSEKLRPGEEDRALSEVI  980

Query  1438  SGTLLSRQKEETVV------EGK-----------------------PVGKVTESEEVARR  1530
             S  L  +  +E V       EG+                       P GKVTESEEV RR
Sbjct  981   SEKLYKKNVDEAVEDVYDEGEGRNARKVVSNAVHKRGGDDGKEVHRPRGKVTESEEVKRR  1040

Query  1531  LGRIGDSPREGSEEKGMVDMLKGAVNSWLGRDSQPQTTDTTN--VRN--EEVG--HQSAV  1692
             LG   D  ++G   KGMVDM+K  V SW G+  + ++T  +    RN   EVG  HQ+A 
Sbjct  1041  LGGWDDEIKDGEFGKGMVDMVKETVGSWFGKPGENESTQGSEGMPRNTGAEVGQVHQTA-  1099

Query  1693  GERRLE  1710
             GERRL+
Sbjct  1100  GERRLQ  1105


 Score = 57.0 bits (136),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 44/82 (54%), Gaps = 3/82 (4%)
 Frame = +1

Query  649  LEEDPHAPSDR--PRPPSNYESKTFDPTGAGGEEARISPLVQSFEKMEVRGDEAKPQQ-N  819
            L EDPHAP  R     P+NY++K  DPTGAG  E  I+P+ +S ++M V  +     Q +
Sbjct  155  LVEDPHAPGSRFDAHAPANYQTKVTDPTGAGAAEMDITPIAKSIDRMTVHNEPIPSHQPH  214

Query  820  IRPQAGTHHKLYTGSHDQFAPE  885
              P          G H+QF+PE
Sbjct  215  TLPTIAETQTPSLGIHNQFSPE  236



>ref|XP_004515723.1| PREDICTED: putative uncharacterized protein DDB_G0282133-like 
[Cicer arietinum]
Length=899

 Score = 98.6 bits (244),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 78/122 (64%), Gaps = 8/122 (7%)
 Frame = +1

Query  1348  VRTDKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEETVVEGKPVGKVTESEEVAR  1527
             V  DKGVS+K++LAEKL+PG E+KALSD+IS +L    + E     +P GKV ESEEV +
Sbjct  779   VEQDKGVSMKDYLAEKLRPGVEEKALSDVISESLYEDDEREGSDVVRPKGKVIESEEVKK  838

Query  1528  RLGRIGDSPREGSEE--KGMVDMLKGAVNSWLGRDSQPQTTDTTNVRNEEVGHQSAVGER  1701
             RLG   D   +  EE  K MVDM+K  V SW G+  + Q    TN  + EV HQ+A GER
Sbjct  839   RLGSWDDEKEKDHEESNKAMVDMVKDVVGSWFGKPGENQ----TNQGSGEV-HQTA-GER  892

Query  1702  RL  1707
             RL
Sbjct  893   RL  894


 Score = 53.9 bits (128),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 44/77 (57%), Gaps = 9/77 (12%)
 Frame = +1

Query  646  GLEEDPHAPSDR--PRPPSNYESKTFDPTGAGGEEARISPLVQSFEKMEVRGDEAKPQQN  819
             LEEDPHAP  R      SNY++K  DPT AGG E  I+P+ +S E+M V+ +EAK    
Sbjct  152  NLEEDPHAPGSRLEAYAISNYQTKLTDPTRAGGAEIDITPIKKSIERMSVQ-NEAKTLPT  210

Query  820  I------RPQAGTHHKL  852
            I      +P  G HH+ 
Sbjct  211  IDETQYPKPSIGIHHQF  227



>ref|XP_003533194.1| PREDICTED: low-temperature-induced 65 kDa protein isoform X1 
[Glycine max]
 gb|KHN31814.1| Low-temperature-induced 65 kDa protein [Glycine soja]
Length=950

 Score = 98.2 bits (243),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 81/252 (32%), Positives = 121/252 (48%), Gaps = 52/252 (21%)
 Frame = +1

Query  1084  VAEKLAPVYDRVAGAGSAVMEKLPIGAsgergkgevegegksvT-------STVKEKLAP  1242
             ++ + + + D+ A A ++V  KL  G +    + +      + T        ++ EKLAP
Sbjct  704   ISSETSALADKDASAKNSVASKLGFGDTARTHEEKRTNHAAAPTEYGKSVAQSLTEKLAP  763

Query  1243  FYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEFLAEKLKPGEEDKA  1422
                KV+GAGS + SKV G      V VE          DKGVS+K++L +KL+PG+ED+A
Sbjct  764   VSGKVSGAGSGVKSKVSGTEKISNVGVE---------QDKGVSVKDYLVDKLRPGDEDRA  814

Query  1423  LSDMISGTLLSR-------------------------QKEETVVEGKPVGKVTESEEVAR  1527
             LS +IS TL  +                         + E  V   K +GKVTESEEV R
Sbjct  815   LSKVISETLHKKEVHPVEVTEEGVRKMVSDAVHKREDEPERKVEHQKILGKVTESEEVKR  874

Query  1528  RLGRIGDSPREGSEE-------KGMVDMLKGAVNSWLGRDSQPQTTDTTNVRNE----EV  1674
             RLG       +  +E        G+VD L G V +W    ++ Q++  +++ +E    EV
Sbjct  875   RLGGEDVETEKKYQEMYVNSPGTGVVDKLTGMVGTWFTNPAENQSSQDSSMNHEASRAEV  934

Query  1675  GHQSAVGERRLE  1710
              HQ A G RRL+
Sbjct  935   EHQGAAGARRLQ  946


 Score = 66.2 bits (160),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 51/160 (32%), Positives = 72/160 (45%), Gaps = 30/160 (19%)
 Frame = +1

Query  493  GVFRRGEEDDTRQTTGGISRVQPLHNRPPPFVSETHHQTSGHGRGDFLQPGGLEEDPHAP  672
            G+ +RG  D TR    G   V P                    + +  +P  LEEDPHAP
Sbjct  150  GINQRGSTDPTRTFVEGAKAVHP--------------------KVNLERPMHLEEDPHAP  189

Query  673  --SDRPRPPSNYESKTFDPTGAGGEEARISPLVQSFEKMEVRGD-EAKPQQNIRPQAGTH  843
              + +   P NY++K  DPTGAGG E  I+ + +SF +M V  + +  P+  + P     
Sbjct  190  RRTSQAYAPPNYQTKVTDPTGAGGAEIDITTVEKSFSRMAVLNEPKPYPEPKLFPTIAQT  249

Query  844  HKLYTGSHDQFAPEPMATNVYTSSKDTESIPKSFDPTNPE  963
            H   + SH QFAPE      Y S+       +S+D   PE
Sbjct  250  HYPSSVSHSQFAPEHSTAMNYPSA-------QSYDHCMPE  282



>ref|XP_006587319.1| PREDICTED: low-temperature-induced 65 kDa protein isoform X2 
[Glycine max]
Length=933

 Score = 97.8 bits (242),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 81/252 (32%), Positives = 121/252 (48%), Gaps = 52/252 (21%)
 Frame = +1

Query  1084  VAEKLAPVYDRVAGAGSAVMEKLPIGAsgergkgevegegksvT-------STVKEKLAP  1242
             ++ + + + D+ A A ++V  KL  G +    + +      + T        ++ EKLAP
Sbjct  687   ISSETSALADKDASAKNSVASKLGFGDTARTHEEKRTNHAAAPTEYGKSVAQSLTEKLAP  746

Query  1243  FYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEFLAEKLKPGEEDKA  1422
                KV+GAGS + SKV G      V VE          DKGVS+K++L +KL+PG+ED+A
Sbjct  747   VSGKVSGAGSGVKSKVSGTEKISNVGVE---------QDKGVSVKDYLVDKLRPGDEDRA  797

Query  1423  LSDMISGTLLSR-------------------------QKEETVVEGKPVGKVTESEEVAR  1527
             LS +IS TL  +                         + E  V   K +GKVTESEEV R
Sbjct  798   LSKVISETLHKKEVHPVEVTEEGVRKMVSDAVHKREDEPERKVEHQKILGKVTESEEVKR  857

Query  1528  RLGRIGDSPREGSEE-------KGMVDMLKGAVNSWLGRDSQPQTTDTTNVRNE----EV  1674
             RLG       +  +E        G+VD L G V +W    ++ Q++  +++ +E    EV
Sbjct  858   RLGGEDVETEKKYQEMYVNSPGTGVVDKLTGMVGTWFTNPAENQSSQDSSMNHEASRAEV  917

Query  1675  GHQSAVGERRLE  1710
              HQ A G RRL+
Sbjct  918   EHQGAAGARRLQ  929


 Score = 66.2 bits (160),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 51/160 (32%), Positives = 72/160 (45%), Gaps = 30/160 (19%)
 Frame = +1

Query  493  GVFRRGEEDDTRQTTGGISRVQPLHNRPPPFVSETHHQTSGHGRGDFLQPGGLEEDPHAP  672
            G+ +RG  D TR    G   V P                    + +  +P  LEEDPHAP
Sbjct  133  GINQRGSTDPTRTFVEGAKAVHP--------------------KVNLERPMHLEEDPHAP  172

Query  673  --SDRPRPPSNYESKTFDPTGAGGEEARISPLVQSFEKMEVRGD-EAKPQQNIRPQAGTH  843
              + +   P NY++K  DPTGAGG E  I+ + +SF +M V  + +  P+  + P     
Sbjct  173  RRTSQAYAPPNYQTKVTDPTGAGGAEIDITTVEKSFSRMAVLNEPKPYPEPKLFPTIAQT  232

Query  844  HKLYTGSHDQFAPEPMATNVYTSSKDTESIPKSFDPTNPE  963
            H   + SH QFAPE      Y S+       +S+D   PE
Sbjct  233  HYPSSVSHSQFAPEHSTAMNYPSA-------QSYDHCMPE  265



>gb|AAD51627.1| seed maturation protein PM39 [Glycine max]
Length=441

 Score = 95.1 bits (235),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 73/200 (37%), Positives = 101/200 (51%), Gaps = 45/200 (23%)
 Frame = +1

Query  1219  TVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEFLAEKL  1398
             ++ EKLAP   KV+GAGS + SKV G      V VE          DKGVS+K++L +KL
Sbjct  247   SLTEKLAPVSGKVSGAGSGVKSKVSGTEKISNVGVE---------QDKGVSVKDYLVDKL  297

Query  1399  KPGEEDKALSDMISGTLLSRQK-------------------------EETVVEGKPVGKV  1503
             +PG+ED+ALS +IS TL  ++                          E  V   K +GKV
Sbjct  298   RPGDEDRALSKVISETLHKKEVHPVEVTEEGVRKMVSDAVHKREDEPERKVEHQKILGKV  357

Query  1504  TESEEVARRLGRIGDSPREGSEE-------KGMVDMLKGAVNSWLGRDSQPQTTDTTNVR  1662
             TESEEV RRLG       +  +E        G+VD L G V +W    ++ Q++  +++ 
Sbjct  358   TESEEVKRRLGGEDVETEKKYQEMYVNSPGTGVVDKLTGMVGTWFTNPAENQSSQDSSMN  417

Query  1663  NE----EVGHQSAVGERRLE  1710
             +E    EV HQ A G RRL+
Sbjct  418   HEASRAEVEHQGAAGARRLQ  437



>ref|XP_010438860.1| PREDICTED: low-temperature-induced 65 kDa protein-like isoform 
X1 [Camelina sativa]
Length=570

 Score = 93.2 bits (230),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 122/406 (30%), Positives = 165/406 (41%), Gaps = 85/406 (21%)
 Frame = +1

Query  526   RQTTGGISRVQPLHNRPPPFVSETHHQTSGHGRG----------DFLQPGGLEEDPHAPS  675
             R+ +GG S + P HN P    S T   T     G          +  +P GLE+DP AP 
Sbjct  149   REESGGASTLTP-HNTPVSLPSATEDVTRTFVPGGDKSRDQRKVNIERPRGLEQDPAAPG  207

Query  676   DRPRPPSNYESKTFDPT-GAGGEEARISPLVQSFEKMEVRGDEAKPQQNI----RPQAGT  840
                   SNY+SK  DPT G    E   +  V +  ++ +  D  K          P+ GT
Sbjct  208   SHGGGMSNYQSKVTDPTHGKASGETGPATTVSALGRLGLGTDFGKKSHGFDTKSEPEMGT  267

Query  841   HHKLYTGSHDQFAPEPMATNVYTSSKDTESIPKSFDPTNPENLP--------RDPIDGKP  996
             H               ++   Y S    ES  +S +     +LP        R+  D K 
Sbjct  268   H---------------LSAGNYGSGLRKESPERSDELDLGRDLPTRAQGIQNREGEDSKS  312

Query  997   QQ---------EGSYAGKMQGEHEAASPVDYAKTAAMAVAEKLAPVYDRVAGAGSAVMEK  1149
             Q+         +GSY  K+      ++  D A  A   VA KL       +G G  V E 
Sbjct  313   QERGDEMYQSNQGSYTDKIA--SATSAVADKAVAAKNTVASKLG-----YSGEGGGVHEN  365

Query  1150  LPIGAsgergkgevegegksvTSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEG  1329
                G                  STV   + P Y+KV   G+++M+K+   GTG       
Sbjct  366   RIEGEETHSSGVGYG-------STVAGMVTPVYEKVKETGASVMTKLPFSGTG-------  411

Query  1330  YEEGNDVRTDKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEETVVEGKPVGKVTE  1509
                G +   DKGVS KE+L EKL PGEEDK LS++++  L     E    +    G VT+
Sbjct  412   ---GTETGQDKGVSAKEYLTEKLSPGEEDKVLSEVVAEKLHLGGGETGPAK---KGIVTQ  465

Query  1510  SEEVARRLGRIGDSPREGSE----------EKGMVDMLKGAVNSWL  1617
             SEEV +RLG   D   E +           E GMV+ L GAV SWL
Sbjct  466   SEEVEKRLGGFKDPSSEAAMKHGKAYADEGEGGMVEKLSGAVTSWL  511



>gb|KEH43710.1| hypothetical protein MTR_1g100627 [Medicago truncatula]
Length=521

 Score = 92.8 bits (229),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 120/364 (33%), Positives = 178/364 (49%), Gaps = 68/364 (19%)
 Frame = +1

Query  622   RGDFLQPGGLEEDPHAPSDRPRPPS--NYESKTFDPTGAG-GEEARISPLVQSFEKMEVR  792
             + +   P  LEED      R    +  NY++K  DP+GAG GE    + L +S E+M V 
Sbjct  170   KANLETPTVLEEDSQEQGSRTEEYTLPNYQTKETDPSGAGSGEVKETTALEESLERMNVH  229

Query  793   GDEAKP--QQNIRPQAG--THHKLYTGSHD--QFAPE-----------PMAT---NVYTS  912
              DE KP  +  I+P     T +   +GS D  QF P            P  T   N+  +
Sbjct  230   -DEPKPTTEPKIQPPVADSTEYPPSSGSRDIDQFVPHLSDATETPNEYPQVTVSKNINRN  288

Query  913   SKDTESIPKSFDP-TN---PENLPRDPIDGKPQQEGSYAGKMQGEHEAASPVDYAKTAAM  1080
              ++   I ++FD  TN    ++   +P++ +P+Q+G Y  ++    E +S  +  KT   
Sbjct  289   QENPLEIRENFDTITNTVEKQSGYEEPVETQPKQKG-YTDEI----EISSAEEADKT---  340

Query  1081  AVAEKLAPVYDRVAGAGSAVMEKLPIGAsgergkgevegegksvTSTVKEKLAPFYDKVA  1260
                  L P  D  +  G+   EK+         + +    G +V  ++ EKLAP Y KVA
Sbjct  341   -----LPPENDEASKLGND--EKV---------EHQKSENGNNVGYSLTEKLAPVYGKVA  384

Query  1261  GAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEFLAEKLKPGEEDKALSDMIS  1440
               GS + SKV G         +G E  N    DKGV++K++LAEKLKP EEDKALS++IS
Sbjct  385   EVGSAVKSKVYGTN-------DGTETKN---GDKGVTVKDYLAEKLKPSEEDKALSEVIS  434

Query  1441  GTLLSRQKEETVVEGKPVGKVTESEEVARRLGRIGDSPREGSEEKGMVDMLKGAVNSWLG  1620
              T L++ KEE +   K  GK+ +SE    +  ++ +     S  KGMVD +K AV SW  
Sbjct  435   ET-LNKGKEEPL--KKEDGKL-DSE--VEKSDKVFEESNVNSPGKGMVDKVKDAVGSWFV  488

Query  1621  RDSQ  1632
             +  Q
Sbjct  489   KSPQ  492



>ref|NP_001032061.1| protein LOW-TEMPERATURE-INDUCED 65 [Arabidopsis thaliana]
 gb|AED96198.1| low-temperature-induced 65 [Arabidopsis thaliana]
Length=618

 Score = 93.2 bits (230),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 110/389 (28%), Positives = 166/389 (43%), Gaps = 104/389 (27%)
 Frame = +1

Query  640   PGGLEEDPHAP---SDRPRPPSNYESKTFDPTGAGGEEARISPLVQSFEKMEVRGDEAKP  810
             P  LEEDP AP   SD     SNY+SK  DPT  GGE A +  + +S  +M+V  DE+  
Sbjct  225   PKRLEEDPAAPGGGSDYLSGVSNYQSKVTDPTHKGGE-AGVPEIAESLGRMKVT-DESPD  282

Query  811   QQ------------------------------------------------NIRPQAGTHH  846
             Q+                                                +++ ++G   
Sbjct  283   QKSRQGREEDFPTRSHEFDLKKESDINKNSPARFGGESKAGMEEDFPTRGDVKVESGLGR  342

Query  847   KLYTGSHDQFAPEPMATNVYTSSKDTESIPKSFDPTNPENLPRDPIDGKPQQEGSYAGK-  1023
              L TG+HDQF+PE       +  K+ +   ++ D +  E  P    +       +   K 
Sbjct  343   DLPTGTHDQFSPE------LSRPKERDDSEETKDESTHETKPSTYTEQLASATSAITNKA  396

Query  1024  MQGEHEAASPVDYAKTAAMAVAEKLAPVYDRVAGAGSAVMEKLPIGAsgergkgevegeg  1203
             +  ++  AS + Y  T      +  +PV D    + +A  +K+                 
Sbjct  397   IAAKNVVASKLGY--TGENGGGQSESPVKDETPRSVTAYGQKV-----------------  437

Query  1204  ksvTSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEF  1383
                  TV EKL P Y+KV   GST+M+K+  P +G    V+  ++G +    KGV+ K +
Sbjct  438   ---AGTVAEKLTPVYEKVKETGSTVMTKL--PLSGGGSGVKETQQGEE----KGVTAKNY  488

Query  1384  LAEKLKPGEEDKALSDMISGTL----------LSRQKEETVVEGKPVGKVTESEEVARRL  1533
             ++EKLKPGEEDKALS+MI+  L           + ++ E  VE  P      S+++A   
Sbjct  489   ISEKLKPGEEDKALSEMIAEKLHFGGGGEKKTTATKEVEVTVEKIP------SDQIAEGK  542

Query  1534  GRIGDSPREGSEEKGMVDMLKGAVNSWLG  1620
             G       EG   +GMV  +KGAV SWLG
Sbjct  543   GHGEAVAEEGKGGEGMVGKVKGAVTSWLG  571



>ref|NP_200043.2| protein LOW-TEMPERATURE-INDUCED 65 [Arabidopsis thaliana]
 sp|Q04980.2|LTI65_ARATH RecName: Full=Low-temperature-induced 65 kDa protein; AltName: 
Full=Desiccation-responsive protein 29B [Arabidopsis thaliana]
 gb|AAL91171.1| low-temperature-induced 65 kD protein [Arabidopsis thaliana]
 gb|AAM91131.1| low-temperature-induced 65 kD protein [Arabidopsis thaliana]
 gb|AED96197.1| low-temperature-induced 65 [Arabidopsis thaliana]
Length=619

 Score = 93.2 bits (230),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 110/389 (28%), Positives = 166/389 (43%), Gaps = 104/389 (27%)
 Frame = +1

Query  640   PGGLEEDPHAP---SDRPRPPSNYESKTFDPTGAGGEEARISPLVQSFEKMEVRGDEAKP  810
             P  LEEDP AP   SD     SNY+SK  DPT  GGE A +  + +S  +M+V  DE+  
Sbjct  226   PKRLEEDPAAPGGGSDYLSGVSNYQSKVTDPTHKGGE-AGVPEIAESLGRMKVT-DESPD  283

Query  811   QQ------------------------------------------------NIRPQAGTHH  846
             Q+                                                +++ ++G   
Sbjct  284   QKSRQGREEDFPTRSHEFDLKKESDINKNSPARFGGESKAGMEEDFPTRGDVKVESGLGR  343

Query  847   KLYTGSHDQFAPEPMATNVYTSSKDTESIPKSFDPTNPENLPRDPIDGKPQQEGSYAGK-  1023
              L TG+HDQF+PE       +  K+ +   ++ D +  E  P    +       +   K 
Sbjct  344   DLPTGTHDQFSPE------LSRPKERDDSEETKDESTHETKPSTYTEQLASATSAITNKA  397

Query  1024  MQGEHEAASPVDYAKTAAMAVAEKLAPVYDRVAGAGSAVMEKLPIGAsgergkgevegeg  1203
             +  ++  AS + Y  T      +  +PV D    + +A  +K+                 
Sbjct  398   IAAKNVVASKLGY--TGENGGGQSESPVKDETPRSVTAYGQKV-----------------  438

Query  1204  ksvTSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEF  1383
                  TV EKL P Y+KV   GST+M+K+  P +G    V+  ++G +    KGV+ K +
Sbjct  439   ---AGTVAEKLTPVYEKVKETGSTVMTKL--PLSGGGSGVKETQQGEE----KGVTAKNY  489

Query  1384  LAEKLKPGEEDKALSDMISGTL----------LSRQKEETVVEGKPVGKVTESEEVARRL  1533
             ++EKLKPGEEDKALS+MI+  L           + ++ E  VE  P      S+++A   
Sbjct  490   ISEKLKPGEEDKALSEMIAEKLHFGGGGEKKTTATKEVEVTVEKIP------SDQIAEGK  543

Query  1534  GRIGDSPREGSEEKGMVDMLKGAVNSWLG  1620
             G       EG   +GMV  +KGAV SWLG
Sbjct  544   GHGEAVAEEGKGGEGMVGKVKGAVTSWLG  572



>ref|XP_006600062.1| PREDICTED: uncharacterized protein LOC100790856 [Glycine max]
Length=435

 Score = 90.1 bits (222),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 71/200 (36%), Positives = 101/200 (51%), Gaps = 48/200 (24%)
 Frame = +1

Query  1219  TVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEFLAEKL  1398
             ++ EKLAP   KVAG GS + SKV G  T       G E+      DKGVS+K++L +KL
Sbjct  240   SLTEKLAPVSGKVAGVGSGVKSKVSGTQTSSV----GVEQ------DKGVSVKDYLVDKL  289

Query  1399  KPGEEDKALSDMISGTLLSRQK-------------------------EETVVEGKPVGKV  1503
             +PG+ED+ALS++IS TL  ++                          E  +   + +GKV
Sbjct  290   RPGDEDRALSEVISETLHKKELPPVEVTEEGVRKVVSDAVHKRDDDPERRMEHQRILGKV  349

Query  1504  TESEEVARRLGRIGDSPREGSEE-------KGMVDMLKGAVNSWLGRDSQPQTTDTTNVR  1662
             TESEEV RRLG       +  +E       KG+VD LKG V +W    ++ Q++  +++ 
Sbjct  350   TESEEVKRRLGGESVVTEKKYQEMYVNSPGKGVVDKLKGMVGTWFTNPAENQSSQDSSMN  409

Query  1663  NE------EVGHQSAVGERR  1704
              E      E  +Q A GERR
Sbjct  410   YEAGRAEVEQVNQGAAGERR  429



>ref|XP_010521328.1| PREDICTED: low-temperature-induced 65 kDa protein-like isoform 
X2 [Tarenaya hassleriana]
Length=509

 Score = 89.4 bits (220),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 104/341 (30%), Positives = 134/341 (39%), Gaps = 87/341 (26%)
 Frame = +1

Query  565   HNRPPPFVSETH-----------HQTSGHGRGDFLQPGGLEEDPHAPSDRPRPPS---NY  702
             HN P P +S T                G  R +   P GLEEDP AP           NY
Sbjct  169   HNTPVPLLSGTEDVIRMFVLPEEQDPLGQRRVNLYIPEGLEEDPTAPGGGFGSSGVVSNY  228

Query  703   ESKTFDPTGAGGEEARISPLVQSFEKMEV------------RGDEAK-----------PQ  813
             ++K  DPTG  GEE  ++ +++S  KM V            RGDE             P 
Sbjct  229   QTKVTDPTGKNGEEIEVTSIIESLGKMSVISGHGSERESPMRGDEHNVKSGHEAGKDLPI  288

Query  814   QNIRPQAGTHHKLY----TGSHDQFA-----PEPMATNVYTSSKDTESIPKSFDPTNPEN  966
             +         H+L     TGSHDQF+     P+P+     T   +TE         + E+
Sbjct  289   KRHELDVKLGHELVKDLPTGSHDQFSPELSPPKPLENPTAT---ETEVFSTQAMAADDED  345

Query  967   LPRDPIDGKPQQEGSYAGKMQGEHEAASPVDYAKTAAMAVAEKLAPVYDRVAGAGSAVME  1146
             +P+  I         YA K+            A  A    A           G      E
Sbjct  346   MPKQSI---------YAEKIVS----------ATLAIADKAAAAKNALASKLGYSGREEE  386

Query  1147  KLPIGAsgergkgevegegksvTSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVE  1326
             + P  A     K           STV EKL P Y+KV   G+ +M+K    G G A    
Sbjct  387   ETPRSAMEYGKKM---------ASTVTEKLTPIYEKVKETGTRVMTKTPLSGDGDA----  433

Query  1327  GYEEGNDVRTDKGVSIKEFLAEKLKPGEEDKALSDMISGTL  1449
                +G D    KGVS +E+LAEKLKPGEED+ LSD+IS  L
Sbjct  434   --RKGQD----KGVSAREYLAEKLKPGEEDRVLSDVISEKL  468



>ref|XP_010521329.1| PREDICTED: low-temperature-induced 65 kDa protein-like isoform 
X3 [Tarenaya hassleriana]
 ref|XP_010521330.1| PREDICTED: low-temperature-induced 65 kDa protein-like isoform 
X3 [Tarenaya hassleriana]
Length=498

 Score = 89.4 bits (220),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 104/341 (30%), Positives = 134/341 (39%), Gaps = 87/341 (26%)
 Frame = +1

Query  565   HNRPPPFVSETH-----------HQTSGHGRGDFLQPGGLEEDPHAPSDRPRPPS---NY  702
             HN P P +S T                G  R +   P GLEEDP AP           NY
Sbjct  169   HNTPVPLLSGTEDVIRMFVLPEEQDPLGQRRVNLYIPEGLEEDPTAPGGGFGSSGVVSNY  228

Query  703   ESKTFDPTGAGGEEARISPLVQSFEKMEV------------RGDEAK-----------PQ  813
             ++K  DPTG  GEE  ++ +++S  KM V            RGDE             P 
Sbjct  229   QTKVTDPTGKNGEEIEVTSIIESLGKMSVISGHGSERESPMRGDEHNVKSGHEAGKDLPI  288

Query  814   QNIRPQAGTHHKLY----TGSHDQFA-----PEPMATNVYTSSKDTESIPKSFDPTNPEN  966
             +         H+L     TGSHDQF+     P+P+     T   +TE         + E+
Sbjct  289   KRHELDVKLGHELVKDLPTGSHDQFSPELSPPKPLENPTAT---ETEVFSTQAMAADDED  345

Query  967   LPRDPIDGKPQQEGSYAGKMQGEHEAASPVDYAKTAAMAVAEKLAPVYDRVAGAGSAVME  1146
             +P+  I         YA K+            A  A    A           G      E
Sbjct  346   MPKQSI---------YAEKIVS----------ATLAIADKAAAAKNALASKLGYSGREEE  386

Query  1147  KLPIGAsgergkgevegegksvTSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVE  1326
             + P  A     K           STV EKL P Y+KV   G+ +M+K    G G A    
Sbjct  387   ETPRSAMEYGKKM---------ASTVTEKLTPIYEKVKETGTRVMTKTPLSGDGDA----  433

Query  1327  GYEEGNDVRTDKGVSIKEFLAEKLKPGEEDKALSDMISGTL  1449
                +G D    KGVS +E+LAEKLKPGEED+ LSD+IS  L
Sbjct  434   --RKGQD----KGVSAREYLAEKLKPGEEDRVLSDVISEKL  468



>dbj|BAA02375.1| RD29B [Arabidopsis thaliana]
Length=584

 Score = 89.7 bits (221),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 107/389 (28%), Positives = 166/389 (43%), Gaps = 106/389 (27%)
 Frame = +1

Query  640   PGGLEEDPHAP---SDRPRPPSNYESKTFDPTGAGGEEARISPLVQSFEKMEVRGDEAKP  810
             P  LEEDP AP   SD     SNY+SK  DPT    +EA +  + +S  +M+V  DE+  
Sbjct  199   PKRLEEDPAAPGGGSDYLSGVSNYQSKVTDPTH---KEAGVPEIAESLGRMKVT-DESPD  254

Query  811   QQ------------------------------------------------NIRPQAGTHH  846
             Q+                                                +++ ++G   
Sbjct  255   QKSRQGREEDFPTRSHEFDLKKESDINKNSPARFGGESKAGMEEDFPTRGDVKVESGLGR  314

Query  847   KLYTGSHDQFAPEPMATNVYTSSKDTESIPKSFDPTNPENLPRDPIDGKPQQEGSYAGK-  1023
              L TG+HDQF+PE       +  K+ +   ++ D +  E  P    +       +   K 
Sbjct  315   DLPTGTHDQFSPE------LSRPKERDDSEETKDESTHETKPSTYTEQLASATSAITNKA  368

Query  1024  MQGEHEAASPVDYAKTAAMAVAEKLAPVYDRVAGAGSAVMEKLPIGAsgergkgevegeg  1203
             +  ++  AS + Y  T  +   +  +P+ D    + +A  +K+                 
Sbjct  369   IAAKNVVASKLGY--TGELGGGQSESPLKDETPRSVTAYGQKV-----------------  409

Query  1204  ksvTSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEF  1383
                  TV EKL P Y+KV   GST+M+K+  P +G    V+  ++G +    KGV+ K +
Sbjct  410   ---AGTVAEKLTPVYEKVKETGSTVMTKL--PLSGGGSGVKETQQGEE----KGVTAKNY  460

Query  1384  LAEKLKPGEEDKALSDMISGTL----------LSRQKEETVVEGKPVGKVTESEEVARRL  1533
             ++EKLKPGEEDKALS+MI+  L           + ++ E  VE  P      S+++A   
Sbjct  461   ISEKLKPGEEDKALSEMIAEKLHFGGGGEKKTTATKEVEVTVEKIP------SDQIAEGK  514

Query  1534  GRIGDSPREGSEEKGMVDMLKGAVNSWLG  1620
             G       EG   +GMV  +KGAV SWLG
Sbjct  515   GHGEAVAEEGKGGEGMVGKVKGAVTSWLG  543



>gb|AAB25482.1| RD29B=responsive-to-dessication protein [Arabidopsis thaliana, 
Columbia ecotype, Peptide, 604 aa]
 prf||1908381B rd29B gene
Length=604

 Score = 89.4 bits (220),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 107/389 (28%), Positives = 166/389 (43%), Gaps = 106/389 (27%)
 Frame = +1

Query  640   PGGLEEDPHAP---SDRPRPPSNYESKTFDPTGAGGEEARISPLVQSFEKMEVRGDEAKP  810
             P  LEEDP AP   SD     SNY+SK  DPT    +EA +  + +S  +M+V  DE+  
Sbjct  219   PKRLEEDPAAPGGGSDYLSGVSNYQSKVTDPTH---KEAGVPEIAESLGRMKVT-DESPD  274

Query  811   QQ------------------------------------------------NIRPQAGTHH  846
             Q+                                                +++ ++G   
Sbjct  275   QKSRQGREEDFPTRSHEFDLKKESDINKNSPARFGGESKAGMEEDFPTRGDVKVESGLGR  334

Query  847   KLYTGSHDQFAPEPMATNVYTSSKDTESIPKSFDPTNPENLPRDPIDGKPQQEGSYAGK-  1023
              L TG+HDQF+PE       +  K+ +   ++ D +  E  P    +       +   K 
Sbjct  335   DLPTGTHDQFSPE------LSRPKERDDSEETKDESTHETKPSTYTEQLASATSAITNKA  388

Query  1024  MQGEHEAASPVDYAKTAAMAVAEKLAPVYDRVAGAGSAVMEKLPIGAsgergkgevegeg  1203
             +  ++  AS + Y  T  +   +  +P+ D    + +A  +K+                 
Sbjct  389   IAAKNVVASKLGY--TGELGGGQSESPLKDETPRSVTAYGQKV-----------------  429

Query  1204  ksvTSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEF  1383
                  TV EKL P Y+KV   GST+M+K+  P +G    V+  ++G +    KGV+ K +
Sbjct  430   ---AGTVAEKLTPVYEKVKETGSTVMTKL--PLSGGGSGVKETQQGEE----KGVTAKNY  480

Query  1384  LAEKLKPGEEDKALSDMISGTL----------LSRQKEETVVEGKPVGKVTESEEVARRL  1533
             ++EKLKPGEEDKALS+MI+  L           + ++ E  VE  P      S+++A   
Sbjct  481   ISEKLKPGEEDKALSEMIAEKLHFGGGGEKKTTATKEVEVTVEKIP------SDQIAEGK  534

Query  1534  GRIGDSPREGSEEKGMVDMLKGAVNSWLG  1620
             G       EG   +GMV  +KGAV SWLG
Sbjct  535   GHGEAVAEEGKGGEGMVGKVKGAVTSWLG  563



>ref|XP_010521327.1| PREDICTED: low-temperature-induced 65 kDa protein-like isoform 
X1 [Tarenaya hassleriana]
Length=519

 Score = 89.0 bits (219),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 104/341 (30%), Positives = 134/341 (39%), Gaps = 87/341 (26%)
 Frame = +1

Query  565   HNRPPPFVSETH-----------HQTSGHGRGDFLQPGGLEEDPHAPSDRPRPPS---NY  702
             HN P P +S T                G  R +   P GLEEDP AP           NY
Sbjct  169   HNTPVPLLSGTEDVIRMFVLPEEQDPLGQRRVNLYIPEGLEEDPTAPGGGFGSSGVVSNY  228

Query  703   ESKTFDPTGAGGEEARISPLVQSFEKMEV------------RGDEAK-----------PQ  813
             ++K  DPTG  GEE  ++ +++S  KM V            RGDE             P 
Sbjct  229   QTKVTDPTGKNGEEIEVTSIIESLGKMSVISGHGSERESPMRGDEHNVKSGHEAGKDLPI  288

Query  814   QNIRPQAGTHHKLY----TGSHDQFA-----PEPMATNVYTSSKDTESIPKSFDPTNPEN  966
             +         H+L     TGSHDQF+     P+P+     T   +TE         + E+
Sbjct  289   KRHELDVKLGHELVKDLPTGSHDQFSPELSPPKPLENPTAT---ETEVFSTQAMAADDED  345

Query  967   LPRDPIDGKPQQEGSYAGKMQGEHEAASPVDYAKTAAMAVAEKLAPVYDRVAGAGSAVME  1146
             +P+  I         YA K+            A  A    A           G      E
Sbjct  346   MPKQSI---------YAEKIVS----------ATLAIADKAAAAKNALASKLGYSGREEE  386

Query  1147  KLPIGAsgergkgevegegksvTSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVE  1326
             + P  A     K           STV EKL P Y+KV   G+ +M+K    G G A    
Sbjct  387   ETPRSAMEYGKKM---------ASTVTEKLTPIYEKVKETGTRVMTKTPLSGDGDA----  433

Query  1327  GYEEGNDVRTDKGVSIKEFLAEKLKPGEEDKALSDMISGTL  1449
                +G D    KGVS +E+LAEKLKPGEED+ LSD+IS  L
Sbjct  434   --RKGQD----KGVSAREYLAEKLKPGEEDRVLSDVISEKL  468



>emb|CAA47902.1| lti65 [Arabidopsis thaliana]
Length=600

 Score = 88.6 bits (218),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 108/389 (28%), Positives = 165/389 (42%), Gaps = 106/389 (27%)
 Frame = +1

Query  640   PGGLEEDPHAP---SDRPRPPSNYESKTFDPTGAGGEEARISPLVQSFEKMEVRGDEAKP  810
             P  LEEDP AP   SD     SNY+SK  DPT    +EA +  + +S  +M+V  DE+  
Sbjct  226   PKRLEEDPAAPGGGSDYLSGVSNYQSKVTDPTH---KEAGVPEIAESLGRMKVT-DESPD  281

Query  811   QQ------------------------------------------------NIRPQAGTHH  846
             Q+                                                +++ ++G   
Sbjct  282   QKSRQGREEDFPTRSHEFDLKKESDINKNSPARFGGESKAGMEEDFPTRGDVKVESGLGR  341

Query  847   KLYTGSHDQFAPEPMATNVYTSSKDTESIPKSFDPTNPENLPRDPIDGKPQQEGSYAGK-  1023
              L TG+HDQF+PE       +  K+ +   ++ D +  E  P    +       +   K 
Sbjct  342   DLPTGTHDQFSPE------LSRPKERDDSEETKDESTHETKPSTYTEQLASATSAITNKA  395

Query  1024  MQGEHEAASPVDYAKTAAMAVAEKLAPVYDRVAGAGSAVMEKLPIGAsgergkgevegeg  1203
             +  ++  AS + Y  T      +  +PV D    + +A  +K+                 
Sbjct  396   IAAKNVVASKLGY--TGENGGGQSESPVKDETPRSVTAYGQKV-----------------  436

Query  1204  ksvTSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEF  1383
                  TV EKL P Y+KV   GST+M+K+  P +G    V+  ++G +    KGV+ K +
Sbjct  437   ---AGTVAEKLTPVYEKVKETGSTVMTKL--PLSGGGSGVKETQQGEE----KGVTAKNY  487

Query  1384  LAEKLKPGEEDKALSDMISGTL----------LSRQKEETVVEGKPVGKVTESEEVARRL  1533
             ++EKLKPGEEDKALS+MI+  L           + ++ E  VE  P      S+++A   
Sbjct  488   ISEKLKPGEEDKALSEMIAEKLHFGGGGEKKTTATKEVEVTVEKIP------SDQIAEGK  541

Query  1534  GRIGDSPREGSEEKGMVDMLKGAVNSWLG  1620
             G       EG   +GMV  +KGAV SWLG
Sbjct  542   GHGEAVAEEGKGGEGMVGKVKGAVTSWLG  570



>dbj|BAB10527.1| low-temperature-induced 65 kD protein [Arabidopsis thaliana]
Length=617

 Score = 88.6 bits (218),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 108/389 (28%), Positives = 165/389 (42%), Gaps = 106/389 (27%)
 Frame = +1

Query  640   PGGLEEDPHAP---SDRPRPPSNYESKTFDPTGAGGEEARISPLVQSFEKMEVRGDEAKP  810
             P  LEEDP AP   SD     SNY+SK  DPT    +EA +  + +S  +M+V  DE+  
Sbjct  226   PKRLEEDPAAPGGGSDYLSGVSNYQSKVTDPTH---KEAGVPEIAESLGRMKVT-DESPD  281

Query  811   QQ------------------------------------------------NIRPQAGTHH  846
             Q+                                                +++ ++G   
Sbjct  282   QKSRQGREEDFPTRSHEFDLKKESDINKNSPARFGGESKAGMEEDFPTRGDVKVESGLGR  341

Query  847   KLYTGSHDQFAPEPMATNVYTSSKDTESIPKSFDPTNPENLPRDPIDGKPQQEGSYAGK-  1023
              L TG+HDQF+PE       +  K+ +   ++ D +  E  P    +       +   K 
Sbjct  342   DLPTGTHDQFSPE------LSRPKERDDSEETKDESTHETKPSTYTEQLASATSAITNKA  395

Query  1024  MQGEHEAASPVDYAKTAAMAVAEKLAPVYDRVAGAGSAVMEKLPIGAsgergkgevegeg  1203
             +  ++  AS + Y  T      +  +PV D    + +A  +K+                 
Sbjct  396   IAAKNVVASKLGY--TGENGGGQSESPVKDETPRSVTAYGQKV-----------------  436

Query  1204  ksvTSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEF  1383
                  TV EKL P Y+KV   GST+M+K+  P +G    V+  ++G +    KGV+ K +
Sbjct  437   ---AGTVAEKLTPVYEKVKETGSTVMTKL--PLSGGGSGVKETQQGEE----KGVTAKNY  487

Query  1384  LAEKLKPGEEDKALSDMISGTL----------LSRQKEETVVEGKPVGKVTESEEVARRL  1533
             ++EKLKPGEEDKALS+MI+  L           + ++ E  VE  P      S+++A   
Sbjct  488   ISEKLKPGEEDKALSEMIAEKLHFGGGGEKKTTATKEVEVTVEKIP------SDQIAEGK  541

Query  1534  GRIGDSPREGSEEKGMVDMLKGAVNSWLG  1620
             G       EG   +GMV  +KGAV SWLG
Sbjct  542   GHGEAVAEEGKGGEGMVGKVKGAVTSWLG  570



>ref|XP_002864162.1| hypothetical protein ARALYDRAFT_495299 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40421.1| hypothetical protein ARALYDRAFT_495299 [Arabidopsis lyrata subsp. 
lyrata]
Length=530

 Score = 88.2 bits (217),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 109/380 (29%), Positives = 166/380 (44%), Gaps = 105/380 (28%)
 Frame = +1

Query  661   PHAPSDRPRPPSNYESKTFDPTGAGGEEARISPLVQSFEKMEVRGDEAKPQQ--------  816
             P   SD     SNY+SK  DPT  GGE A +  + +S  +M+V  DE+  Q+        
Sbjct  149   PGGGSDYLSGVSNYQSKVTDPTHKGGE-AGVPEIAESLSRMKVT-DESPDQKSRQGFGED  206

Query  817   -----------------------------------------NIRPQAGTHHKLYTGSHDQ  873
                                                      +++ + G    L TG+HDQ
Sbjct  207   LPTRSQEFGLKNESDISKDSPARLGGESRAGLGEDFQRRSDDVKAETGLGRDLPTGTHDQ  266

Query  874   FAPEPMATNVYTSSKDTESIPKSFDPTNPENLPRDPIDGKPQQEGSYAGKMQGEHEAASP  1053
             F+PE       +  K+ +   ++ D T  E  P            +Y  ++     A + 
Sbjct  267   FSPE------LSRPKERDDFEETRDETKQERKPS-----------TYTEQLASATSAIT-  308

Query  1054  VDYAKTAAMAVAEKLAPVYDRVAGAG--SAVMEKLPIGAsgergkgevegegksvTSTVK  1227
              + A  A   VA KL   Y    G    SA  ++ P  A+G   K  V         TV 
Sbjct  309   -NKAIAAKNVVASKLG--YGESGGGQYESAEKDETPRSATGYGQKVAV---------TVA  356

Query  1228  EKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEFLAEKLKPG  1407
             EKL P Y+KV   GST+M+K+  P +G    V+  ++G +    KGVS +++L+EKL+PG
Sbjct  357   EKLTPVYEKVKETGSTVMTKL--PLSGGGSGVKETQQGEE----KGVSTRDYLSEKLRPG  410

Query  1408  EEDKALSDMISGTL---------LSRQKEETVVEGKPVGKVTESEEVARRLGRIGDSPRE  1560
             EEDKALS++I+  L          + ++ E  VE  P  ++++ +E        G++  E
Sbjct  411   EEDKALSEVIAEKLHFGGGQKKSTATKEVEVTVEKIPSDQISKGKE-------HGEAVTE  463

Query  1561  GSEEKGMVDMLKGAVNSWLG  1620
               +E+GMV  +KGAV SWLG
Sbjct  464   EGKEEGMVGKVKGAVTSWLG  483



>ref|XP_009127250.1| PREDICTED: low-temperature-induced 65 kDa protein-like [Brassica 
rapa]
Length=572

 Score = 87.8 bits (216),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 128/430 (30%), Positives = 180/430 (42%), Gaps = 97/430 (23%)
 Frame = +1

Query  613   GHGRGDFLQPGGLEEDPHAP---SDRPRPPSNYESKTFDPTGAGGEEARISPLVQSFEKM  783
             G G+ +  +P  LEEDP  P   S      SNY+SK  DPT AGG EA +  +V+S  +M
Sbjct  193   GQGKVNVERPKELEEDPAGPGGGSSYLSGVSNYQSKVTDPTHAGGGEAGVPEIVESLGRM  252

Query  784   EV------RGDEA----------------------KPQQNIRPQAGTHHKLYTGSHDQFA  879
             +V      RG E+                          +++ ++     L TG+HDQF+
Sbjct  253   KVTDEKPGRGFESDFPTRSHEFGLKNESETGKDIPARSDDVKVESELGSDLPTGTHDQFS  312

Query  880   PE---PMATNVYTSSKDTESIPKSFDPTNPENLPRDPIDGKPQQEGSYAGKMQGEHEAAS  1050
             PE   P   +V   S  TE I                        GS    +        
Sbjct  313   PELSPPKEAHVAKPSTYTEKI------------------------GSATSFV--------  340

Query  1051  PVDYAKTAAMAVAEKLAPVYDRVAGAGSAVMEKLPIGAsgergkgevegegksvTSTVKE  1230
               D A  A  AVA KL    +      SA  E  P  A+G   K            TV +
Sbjct  341   -TDKAIAAKNAVASKLGYAGESGKNQSSAGDEATPRSATGYGQKV---------AGTVAD  390

Query  1231  KLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEFLAEKLKPGE  1410
             KL P Y+KV   GST+M+K+   G G      G EE   V   KGV  +++LAEKL PGE
Sbjct  391   KLTPVYEKVKETGSTVMTKLPLSGGGS-----GAEEKQPVE-GKGVLTRDYLAEKLTPGE  444

Query  1411  EDKALSDMISGTL----------LSRQKEETVVEGKPVGKVTESEEVARRLGRIGDSPRE  1560
             EDKAL+++I+  L          +S ++ E  VE     +    +E              
Sbjct  445   EDKALAEVIAEKLHLGGGEKKKTMSTKEVEVTVEKILADQTLVEKEHGEAEEGKVGGGGG  504

Query  1561  GSEEKGMVDMLKGAVNSWLG---RDSQPQTTDTTNVRNEEVGHQSAVGERRLEHQDAMAE  1731
             G   +GMV  LKGAV SWLG    + +P+++D+ +  ++ +G  S VG            
Sbjct  505   GGGGEGMVGKLKGAVTSWLGGTTEEVKPKSSDSVDQSSQSLG--STVGTTGFPDSGGALT  562

Query  1732  GRSRLQESGH  1761
             G+  LQ+SG+
Sbjct  563   GQRGLQDSGN  572



>ref|XP_010433614.1| PREDICTED: low-temperature-induced 65 kDa protein-like isoform 
X1 [Camelina sativa]
Length=570

 Score = 87.4 bits (215),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 104/364 (29%), Positives = 145/364 (40%), Gaps = 74/364 (20%)
 Frame = +1

Query  622   RGDFLQPGGLEEDPHAPSDRPRPPSNYESKTFDPT-GAGGEEARISPLVQSFEKMEVRGD  798
             +G+  +P GLE+DP AP       SNY+SK  DPT G    E   +  V +  ++ +  D
Sbjct  190   KGNTERPRGLEQDPAAPGSHGGGMSNYQSKVTDPTHGKASGETGAATTVSALGRLGLGTD  249

Query  799   EAKPQQNI----RPQAGTHHKLYTGSHDQFAPEPMATNVYTSSKDTESIPKS--FD----  948
               K          P+ G H               +    Y S    ES  +S  FD    
Sbjct  250   FGKKSHGFDTKSEPEMGKH---------------LPAGNYGSGLRKESPERSDEFDLGRD  294

Query  949   -PTNPENLP-RDPIDGKPQQEGSYAGKMQGEHEAASPVDYAKTAAMAVAEKLAPVYDR--  1116
              PT  + +  R+ +D K  + G        E   ++   Y    A+A +           
Sbjct  295   LPTRTQGIQNREGVDLKSHERGD-------EMHQSNQSSYTDKIALATSAVADKAVAAKN  347

Query  1117  -------VAGAGSAVMEKLPIGAsgergkgevegegksvTSTVKEKLAPFYDKVAGAGST  1275
                     +G G  V +    G                  STV   + P Y+KV   G++
Sbjct  348   AVASKLGYSGEGGGVHQNRLEGEETPSSGVGYG-------STVAGMVTPVYEKVKETGAS  400

Query  1276  LMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEFLAEKLKPGEEDKALSDMISGTLLS  1455
             +M+K    GTG          G +   DKGVS KE+L EKL PGEEDK LS++++  L  
Sbjct  401   VMTKFPFSGTG----------GTETGQDKGVSAKEYLTEKLSPGEEDKVLSEVVAEKLHL  450

Query  1456  RQKEETVVEGKPVGKVTESEEVARRLGRIGDSPREGSE----------EKGMVDMLKGAV  1605
                E    +    G VT+SEEV +RLG   D   E +           E GMV+ L GAV
Sbjct  451   GGGETGPAK---KGIVTQSEEVEKRLGGFKDPSSEAAMKHGKAYADEGEGGMVEKLSGAV  507

Query  1606  NSWL  1617
              SWL
Sbjct  508   TSWL  511



>emb|CDX91632.1| BnaC02g15280D [Brassica napus]
Length=575

 Score = 87.4 bits (215),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 117/411 (28%), Positives = 189/411 (46%), Gaps = 72/411 (18%)
 Frame = +1

Query  637   QPGGLEEDPHAP---SDRPRPPSNYESKTFDPTGAGGEEARISPLVQSFEKMEV------  789
             +P GLE+DP  P   S      +NY+SK  DPT AGG EA +  +V+S  +M+V      
Sbjct  201   RPKGLEDDPAGPGGESSYLSGVTNYQSKVTDPTHAGGGEAGVPEIVESLGRMKVTDEKPG  260

Query  790   RGDEAK-PQQN----IRPQAGTHHKLYTGSHDQFAPEPMATNVYTSSKDTESIPKSFDPT  954
             RG E+  P ++    ++ ++GT   +   S D      + +++ T + D  S        
Sbjct  261   RGFESDFPTRSHEFGLKNESGTGKDIPARSDDVKVESELGSDLPTGTHDQFS--------  312

Query  955   NPENLPRDPIDGKPQQEGSYAGKMQGEHEAASPVDYAKTAAMAVAEKLAPVYDRVAGAGS  1134
              PE  P       P++   +  K +  H  A P  Y +    A +     V D+   A +
Sbjct  313   -PELSP-------PKERDDFYSKGEEAH-VAKPSTYTEKIGSATSF----VTDKAIAAKN  359

Query  1135  AVMEKLPIGAsgergkgevegegksvTST---------VKEKLAPFYDKVAGAGSTLMSK  1287
             AV  KL      E+ +  V  E    ++T         V +KL P Y+KV   GST+++K
Sbjct  360   AVASKLGYAGESEKNQSSVGDEATPRSATGYGQKVAGTVADKLTPVYEKVKETGSTVLTK  419

Query  1288  VKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEFLAEKLKPGEEDKALSDMISGTL------  1449
             +   G G   V +   EG      KGV  +++LAEKL+PGEEDKAL+++I+  L      
Sbjct  420   LPLSGGGSGAVEKQPVEG------KGVLTRDYLAEKLRPGEEDKALAEVIAEKLQLGGGE  473

Query  1450  ----LSRQKEETVVEGKPVGKVTESEEVARRLGRIGDSPREGSEEKGMVDMLKGAVNSWL  1617
                 ++ ++ E  VE     K+   + +  +    G++        GMV  L+GAV SWL
Sbjct  474   KKKTMTTKEVEVTVE-----KILADQTLVEK--EHGEAEEAKVGGGGMVGKLRGAVTSWL  526

Query  1618  G---RDSQPQTTDTTNVRNEEVGHQSAVGERRLEHQDAMAEGRSRLQESGH  1761
             G    + +P ++D+ +  ++ +G  S VG            G+  LQ+SG+
Sbjct  527   GGTTEEVKPNSSDSVDQSSQSLG--STVGTTGFPDSGGALTGQRGLQDSGN  575



>ref|XP_010448411.1| PREDICTED: low-temperature-induced 65 kDa protein-like [Camelina 
sativa]
Length=568

 Score = 86.3 bits (212),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 117/399 (29%), Positives = 165/399 (41%), Gaps = 72/399 (18%)
 Frame = +1

Query  526   RQTTGGISRVQPLHNRPPPFVSETHHQTSGHGRG----------DFLQPGGLEEDPHAPS  675
             R+ +GG S + P HN P   ++ T   T     G          +  +P GL++DP AP 
Sbjct  148   REESGGASTLTP-HNTPVSLLTATEDVTRTFVPGGDKSRDQRKVNIDRPRGLDQDPAAPG  206

Query  676   DRPRPPSNYESKTFDPT-GAGGEEARISPLVQSFEKMEVRGDEAKPQQNIRPQAGTHHKL  852
                   SNY+SK  DPT G    E   +  V +  ++ +  D  K            H  
Sbjct  207   SHG-GMSNYQSKVTDPTHGKASGETGPATTVSALGRLGLGTDFGKKS----------HGF  255

Query  853   YTGSHDQFAPEPMATNVYTSSKDTESIPKSFDPTNPENLP--------RDPIDGKPQQEG  1008
              T S  +      A N Y S    ES  +S +     +LP        R+ +D K  + G
Sbjct  256   ATKSEPEMGKHLPAGN-YGSGLRKESPERSDELDLGRDLPTRTQGIQNRENLDSKSHERG  314

Query  1009  SYAGKMQGEHEAASPVDYAKTAAMAVAEKLAPVYDR------VAGAGSAVMEKLPIGAsg  1170
                 +MQ +   +S  D   +A   VA+K     +        +G G  V +    G   
Sbjct  315   D---EMQ-QSNQSSYTDKIASATSVVADKAVAAKNAVASKLGYSGEGGGVHQNRLEGEET  370

Query  1171  ergkgevegegksvTSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDV  1350
                            STV   + P Y+KV   G+++M+K+   GTG          G + 
Sbjct  371   PSSGVGYG-------STVAGMVTPVYEKVKETGASVMTKLPFSGTG----------GTET  413

Query  1351  RTDKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEETVVEGKPVGKVTESEEVARR  1530
               DKGVS KE+L EKL PGEEDK LS++++  L     E    +    G VT+SEEV +R
Sbjct  414   GQDKGVSAKEYLTEKLSPGEEDKVLSEVVTEKLHLGGGETGPAK---KGIVTQSEEVEKR  470

Query  1531  LGRIGDSPREGSE----------EKGMVDMLKGAVNSWL  1617
             LG   D   E +           E GMV+ L GAV SWL
Sbjct  471   LGGFKDPSSEAAMQHGKAYADEGEGGMVEKLSGAVTSWL  509



>emb|CDY27078.1| BnaA02g10980D [Brassica napus]
Length=558

 Score = 85.9 bits (211),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 123/418 (29%), Positives = 180/418 (43%), Gaps = 87/418 (21%)
 Frame = +1

Query  619   GRGDFLQPGGLEEDPHAP---SDRPRPPSNYESKTFDPTGAGGEEARISPLVQSFEKMEV  789
             G+ +  +P GLEEDP AP   S      SNY+SK  DPT  G  EA +  +V+S  +M+V
Sbjct  191   GKVNIERPKGLEEDPAAPGGGSSYLSGVSNYQSKVTDPTHEGSGEAGVPEIVESLGRMKV  250

Query  790   RGDEAKPQQN---------------------IRPQAGTHHKLYTGSHDQFAPEPMATNVY  906
               DE  P +N                     ++ ++     L TG+HDQF+PE       
Sbjct  251   T-DEV-PTRNHEFGLKNESETGKDIPARSDDVKVESELGSDLPTGTHDQFSPE-------  301

Query  907   TSSKDTESIPKSFDPTNPENLPRDPIDGKPQQEGSYAGKMQGEHEAASPVDYAKTAAMAV  1086
                           P         P +    ++ +Y  K+       +  D A  A  AV
Sbjct  302   ------------LSP---------PKEAHEAKQSTYTEKIGSATSFVT--DKAIAAKNAV  338

Query  1087  AEKLAPVYDRVAGAGSAVMEKLPIGAsgergkgevegegksvTSTVKEKLAPFYDKVAGA  1266
             A KL    +      S   E  P  A+G   K            TV +KL P Y+KV   
Sbjct  339   ASKLGYAGESGKHQSSVGDEATPRSATGYGQKV---------AGTVADKLTPVYEKVKET  389

Query  1267  GSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEFLAEKLKPGEEDKALSDMISGT  1446
             GST+M+K+   G G     +   EG      KGV  +++LAEKL+PGEEDKAL+++I+  
Sbjct  390   GSTVMTKLPLSGGGSGAEEKQPAEG------KGVLTRDYLAEKLRPGEEDKALAEVIAEK  443

Query  1447  L----------LSRQKEETVVEGKPVGKVTESEEVARRLGRIGDSPREGSEEKGMVDMLK  1596
             L          +S ++ E  VE K +   T  E+              G   +GMV  LK
Sbjct  444   LHLGGGEKKKTMSTKEVEVTVE-KILADQTLVEKEHGEAEEGKVGGGGGGGGEGMVGKLK  502

Query  1597  GAVNSWLG---RDSQPQTTDTTNVRNEEVGHQSAVGERRLEHQDAMAEGRSRLQESGH  1761
             GAV SWLG    + +P+++D+ +  ++ +G  S VG            G+  LQ+SG+
Sbjct  503   GAVTSWLGGTTEEVKPKSSDSVDQSSQSLG--STVGTTGFPDSGGALTGQRGLQDSGN  558



>dbj|BAH20238.1| AT5G52300 [Arabidopsis thaliana]
Length=380

 Score = 84.3 bits (207),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 102/375 (27%), Positives = 158/375 (42%), Gaps = 101/375 (27%)
 Frame = +1

Query  673   SDRPRPPSNYESKTFDPTGAGGEEARISPLVQSFEKMEVRGDEAKPQQ------------  816
             SD     SNY+SK  DPT  GGE A +  + +S  +M+V  DE+  Q+            
Sbjct  1     SDYLSGVSNYQSKVTDPTHKGGE-AGVPEIAESLGRMKVT-DESPDQKSRQGREEDFPTR  58

Query  817   ------------------------------------NIRPQAGTHHKLYTGSHDQFAPEP  888
                                                 +++ ++G    L TG+HDQF+PE 
Sbjct  59    SHEFDLKKESDINKNSPARFGGESKAGMEEDFPTRGDVKVESGLGRDLPTGTHDQFSPE-  117

Query  889   MATNVYTSSKDTESIPKSFDPTNPENLPRDPIDGKPQQEGSYAGK-MQGEHEAASPVDYA  1065
                   +  K+ +   ++ D +  E  P    +       +   K +  ++  AS + Y 
Sbjct  118   -----LSRPKERDDSEETKDESTHETKPSTYTEQLASATSAITNKAIAAKNVVASKLGY-  171

Query  1066  KTAAMAVAEKLAPVYDRVAGAGSAVMEKLPIGAsgergkgevegegksvTSTVKEKLAPF  1245
              T      +  +PV D    + +A  +K+                      TV EKL P 
Sbjct  172   -TGENGGGQSESPVKDETPRSVTAYGQKV--------------------AGTVAEKLTPV  210

Query  1246  YDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEFLAEKLKPGEEDKAL  1425
             Y+KV   GST+M+K+  P +G    V+  ++G +    KGV+ K +++EKLKPGEEDKAL
Sbjct  211   YEKVKETGSTVMTKL--PLSGGGSGVKETQQGEE----KGVTAKNYISEKLKPGEEDKAL  264

Query  1426  SDMISGTL----------LSRQKEETVVEGKPVGKVTESEEVARRLGRIGDSPREGSEEK  1575
             S+MI+  L           + ++ E  VE  P      S+++A   G       EG   +
Sbjct  265   SEMIAEKLHFGGGGEKKTTATKEVEVTVEKIP------SDQIAEGKGHGEAVAEEGKGGE  318

Query  1576  GMVDMLKGAVNSWLG  1620
             GMV  +KGAV SWLG
Sbjct  319   GMVGKVKGAVTSWLG  333



>gb|AEX92028.1| CDeT11-24 isoform [Craterostigma plantagineum]
Length=428

 Score = 84.0 bits (206),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 97/325 (30%), Positives = 141/325 (43%), Gaps = 59/325 (18%)
 Frame = +1

Query  727   GAGGEEARISPLVQSFEKMEVRGDEAKPQQNIRPQAGTHHKLYTGSHDQFAPEPMATNVY  906
             G G +E+ + PL +  + +   GD++       P AG  H+  +     F  +    ++ 
Sbjct  136   GQGAKESDVDPLTRGLKGVNYGGDDS------NPLAGQEHQAISDEPKSFPGQ--ENDLP  187

Query  907   TSSKDTESIPKSFDPTN--PENLPRDPIDGKPQQEGSYAGKMQGEHEAASPVDYAKTAAM  1080
              S   +E  PK FD  N  P+++P+D I GK                 A  VD A  A  
Sbjct  188   QSHPSSEDEPKKFDAANDQPQSMPQDTITGKIS------------SVPAVIVDKAAAAKN  235

Query  1081  AVAEKLAPVYDRV---AGAGSAVMEKLPIGAsgergkgevegegksvTSTVKEKLAPFYD  1251
              VA KL    ++    A AG A  +K P+                   + V EKL P Y+
Sbjct  236   VVASKLGYGGNQAQQPADAG-ATQQKKPL-----------TETAAEYKNMVAEKLTPVYE  283

Query  1252  KVAGAGSTLMSKVKGPGTG----QAVVVEGYEEGNDVRTDKGVSIKEFLAEKLKPGEEDK  1419
             KVAGAGST+ SKV G G      QA   EG  +G     +KGV  K++L+EKLKPG+EDK
Sbjct  284   KVAGAGSTVTSKVWGSGGTTAGEQAQGGEGTVDGGAAAPNKGVFTKDYLSEKLKPGDEDK  343

Query  1420  ALSDMISGTLLSRQKEETVVEGKPVGKVTESEEVARRLGRIGDSPREGSEEKGMVDMLKG  1599
             ALS  I                  + K+  S++ A   G   D  +      G+V  +KG
Sbjct  344   ALSQAI------------------MEKLQLSKKPAAGEGGAVDETKANESSPGVVGSIKG  385

Query  1600  AVNSWLGRDSQPQTTDTTNVRNEEV  1674
              V S +G  ++   T++    NE+ 
Sbjct  386   VVGSLIGGGNKINATESAAAANEQT  410



>gb|KFK29057.1| hypothetical protein AALP_AA7G083100 [Arabis alpina]
Length=423

 Score = 84.0 bits (206),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 66/176 (38%), Positives = 89/176 (51%), Gaps = 39/176 (22%)
 Frame = +1

Query  1213  TSTVKEKLAPFYDKVAGAGSTLMSKVKGPGT---GQAVVVEGYEEGNDVRTDKGVSIKEF  1383
             T+ + EKL P YDKV   G+ +M+K+    T   GQ               DKGVS +E+
Sbjct  245   TTVLTEKLTPIYDKVKETGANVMTKLPLSSTETQGQ---------------DKGVSAREY  289

Query  1384  LAEKLKPGEEDKALSDMISGTL-LSRQKEETVVEGKPVGKVTESEEVARRLGRIGDSPRE  1560
             L EKL PGEEDKALS++++  L LS    E        G VT+SEEV +RLG   D P  
Sbjct  290   LTEKLSPGEEDKALSEVVTEKLHLSENAREK------KGIVTQSEEVEKRLGGFSD-PSS  342

Query  1561  GSEEK-----------GMVDMLKGAVNSWLGRDSQPQTTDTTNVRNEEVGHQSAVG  1695
               E K           GMV+ L+ AVNSW+   ++     +T   ++ +G  S VG
Sbjct  343   KEERKHGEAFAEEGEGGMVEKLRDAVNSWIAGTTEEVVQKSTESSSQTLG--STVG  396



>ref|XP_009770362.1| PREDICTED: low-temperature-induced 78 kDa protein-like [Nicotiana 
sylvestris]
 ref|XP_009770370.1| PREDICTED: low-temperature-induced 78 kDa protein-like [Nicotiana 
sylvestris]
 ref|XP_009770378.1| PREDICTED: low-temperature-induced 78 kDa protein-like [Nicotiana 
sylvestris]
Length=239

 Score = 81.3 bits (199),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 63/97 (65%), Gaps = 7/97 (7%)
 Frame = +1

Query  1354  TDKGVSIKEFLAEKLKPGEEDKALSDMISGTLLS-RQKEETVVEGKPVGKVTESEEVARR  1530
             TDKGVS+K++LAEK KPGEEDKALS++I+GTL   + K E   E KP GKV ESEEV ++
Sbjct  127   TDKGVSMKKYLAEKFKPGEEDKALSEVIAGTLSKHKDKPEGTEEEKPTGKVKESEEVTKQ  186

Query  1531  LGRIGDSPREGSEEKG------MVDMLKGAVNSWLGR  1623
              G   +    G+   G      +V  +KGA +SW G+
Sbjct  187   TGPKDEHGVAGAATHGEGSGKSIVGRIKGAASSWFGK  223


 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 49/92 (53%), Gaps = 19/92 (21%)
 Frame = +1

Query  592  ETHHQTSGHGRGDFLQPGG----------LEEDPHAPSDRP--RPPSNYESKTFDPTGAG  735
            E H Q   HG+G     G           L++DP+AP DRP  +  SNY+SK  DPTG  
Sbjct  25   ERHGQNPVHGQGKVEDEGAQGTKIGLPTVLDDDPNAPKDRPEDKASSNYQSKVTDPTGDN  84

Query  736  GEEARISPLVQSFEKMEVRGDEAKPQQNIRPQ  831
             E A I+PLVQSFEKM V        + IRP+
Sbjct  85   KEAAGITPLVQSFEKMSVN-------EGIRPE  109



>ref|XP_003638371.1| Low-temperature-induced 65 kDa protein [Medicago truncatula]
Length=460

 Score = 83.6 bits (205),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 101/320 (32%), Positives = 148/320 (46%), Gaps = 61/320 (19%)
 Frame = +1

Query  697   NYESKTFDPTGAG-GEEARISPLVQSFEKMEVRGDEAKP--QQNIRPQAG--THHKLYTG  861
             NY++K  D +G G GE    + L +S E+M V  DE KP  +  I+P     T +   +G
Sbjct  165   NYQTKDADSSGKGSGEVKETTALEESLERMNVH-DEPKPTTEPKIQPPVADSTEYPPSSG  223

Query  862   SHD--QFAPEPMATNVYTSSKDTESIPKSFDPTNPENLPRDPIDGKPQQEGSYAGKMQGE  1035
             S D  QF P            D    P  +                PQ++  Y   ++ +
Sbjct  224   SRDIDQFVPH---------LSDATETPNEY----------------PQKQSGYEEPVETQ  258

Query  1036  HEAASPVDYAKTAAMAVAEK-LAPVYDRVAGAGSAVMEKLPIGAsgergkgevegegksv  1212
              +     D  + ++   A+K L P  D  +  G+   EK+         + +    G +V
Sbjct  259   PKQKGYTDEIEISSAEEADKTLPPENDEASKLGND--EKV---------EHQKSENGNNV  307

Query  1213  TSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEFLAE  1392
               ++ EKLAP Y KVA  GS + SKV G   G                DKGV++K++LAE
Sbjct  308   GYSLTEKLAPVYGKVAEVGSAVKSKVYGTNDGTETK----------NGDKGVTVKDYLAE  357

Query  1393  KLKPGEEDKALSDMISGTLLSRQKEETVVEGKPVGKVTESEEVARRLGRIGDSPREGSEE  1572
             KLKP EEDKALS++IS T L++ KEE +   K  GK+ +SE    +  ++ +     S  
Sbjct  358   KLKPSEEDKALSEVISET-LNKGKEEPL--KKEDGKL-DSE--VEKSDKVFEESNVNSPG  411

Query  1573  KGMVDMLKGAVNSWLGRDSQ  1632
             KGMVD +K AV SW  +  Q
Sbjct  412   KGMVDKVKDAVGSWFVKSPQ  431



>ref|XP_010255439.1| PREDICTED: low-temperature-induced 65 kDa protein [Nelumbo nucifera]
Length=403

 Score = 82.4 bits (202),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 95/302 (31%), Positives = 137/302 (45%), Gaps = 56/302 (19%)
 Frame = +1

Query  649   LEED-PHAPSDR---PRPPSNYESKTFDPTGAGGEEARISPLVQSFEKMEVRGDEAKPQQ  816
             LE+D P  P DR     P  NY++   DP  AGG+E  + P++ S   M       K  +
Sbjct  141   LEKDSPAPPKDRDVASHPAPNYQNNATDPIAAGGQETGVEPILGSVGNM-------KDSK  193

Query  817   NIRPQAGTHHKLYTGS-HDQFAPEPMATNVYTSSKDTESIPKSFDPTNPENLPRDPID-G  990
              + PQA +    Y G+ H Q + +   +++ T+S + +S+P +      E +    ++ G
Sbjct  194   QVEPQAWS----YKGNEHHQSSRDLPPSHIDTASGNLQSVPDT------EAVVHSQVEEG  243

Query  991   KPQQEGSYAGKMQGEHEAASPVDYAKTAAMAVAEKLAPVYDRVAGAGSAVMEKLPIGAsg  1170
             KP  + S+  K+     A +  + A +A   VA KL        G    V+ + P G   
Sbjct  244   KPTNQPSHTEKISSATSAIA--EKAISAKNVVASKLG-----YGGNEGEVVHETPEGGDS  296

Query  1171  ergkgevegegksvTSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDV  1350
              +     E   K   + V E LAP YDKVA AGS ++SK++G GT         E G   
Sbjct  297   TKSTPVGEYSKKI-AAAVTETLAPVYDKVAEAGSVVVSKMQGMGTES-------EGGGVS  348

Query  1351  RTDKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEETVVEGKPVGKVTESEEVARR  1530
               DKGVS+KE L  + +PGE                  EE      P G+VTESEEV  R
Sbjct  349   SADKGVSMKEDLTVQSRPGE------------------EEAEKASPPRGRVTESEEVKTR  390

Query  1531  LG  1536
             LG
Sbjct  391   LG  392



>ref|XP_002869666.1| hypothetical protein ARALYDRAFT_492269 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45925.1| hypothetical protein ARALYDRAFT_492269 [Arabidopsis lyrata subsp. 
lyrata]
Length=597

 Score = 82.8 bits (203),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 84/157 (54%), Gaps = 27/157 (17%)
 Frame = +1

Query  1216  STVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEFLAEK  1395
             STV   + P Y+KV   G+++M+K+   GTG        E+G D    KGVS KE+L EK
Sbjct  412   STVAGMVTPVYEKVKETGASVMTKLPFSGTG-------TEQGQD----KGVSAKEYLTEK  460

Query  1396  LKPGEEDKALSDMISGTL-LSRQKEETVVEGKPVGKVTESEEVARRLGRIGDSPREGSEE  1572
             L PGEEDKALS++++  L L     E        G VT+SEEV +RLGR  D   E + +
Sbjct  461   LSPGEEDKALSEVVAEKLHLGGGGGE-----PKKGIVTQSEEVEKRLGRFKDPSSEAATK  515

Query  1573  ----------KGMVDMLKGAVNSWLGRDSQPQTTDTT  1653
                        GM + L+GAV SWL   ++  T  +T
Sbjct  516   HGEEYAEEGEGGMAEKLRGAVTSWLAGTTEEVTQKST  552



>emb|CAB81368.1| putative protein [Arabidopsis thaliana]
Length=626

 Score = 82.4 bits (202),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 61/157 (39%), Positives = 85/157 (54%), Gaps = 24/157 (15%)
 Frame = +1

Query  1216  STVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEFLAEK  1395
             STV   + P Y+KV   G+++M+K+   GTG        E+G D    +GVS KEFL EK
Sbjct  438   STVASMVTPVYEKVKETGASVMTKLPFTGTG-------TEQGQD----RGVSAKEFLTEK  486

Query  1396  LKPGEEDKALSDMISGTL-LSRQKEETVVEGKPVGKVTESEEVARRLGRIGDSPREGSE-  1569
             L PGEEDKALS++++  L L     ET    +  G VT+SEEV +RLG   D   E +  
Sbjct  487   LSPGEEDKALSEVVTEKLHLGGGGGETAPPKR--GIVTQSEEVEKRLGGFKDPSSEAATK  544

Query  1570  ---------EKGMVDMLKGAVNSWLGRDSQPQTTDTT  1653
                      E G+ + L+GAV SW+   ++  T  +T
Sbjct  545   QGEAYAEKGEGGIAEKLRGAVTSWIAGTTEEVTQKST  581



>emb|CAA18168.1| putative protein [Arabidopsis thaliana]
Length=627

 Score = 82.0 bits (201),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 61/157 (39%), Positives = 85/157 (54%), Gaps = 24/157 (15%)
 Frame = +1

Query  1216  STVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEFLAEK  1395
             STV   + P Y+KV   G+++M+K+   GTG        E+G D    +GVS KEFL EK
Sbjct  439   STVASMVTPVYEKVKETGASVMTKLPFTGTG-------TEQGQD----RGVSAKEFLTEK  487

Query  1396  LKPGEEDKALSDMISGTL-LSRQKEETVVEGKPVGKVTESEEVARRLGRIGDSPREGSE-  1569
             L PGEEDKALS++++  L L     ET    +  G VT+SEEV +RLG   D   E +  
Sbjct  488   LSPGEEDKALSEVVTEKLHLGGGGGETAPPKR--GIVTQSEEVEKRLGGFKDPSSEAATK  545

Query  1570  ---------EKGMVDMLKGAVNSWLGRDSQPQTTDTT  1653
                      E G+ + L+GAV SW+   ++  T  +T
Sbjct  546   QGEAYAEKGEGGIAEKLRGAVTSWIAGTTEEVTQKST  582



>ref|NP_194288.2| CAP160 protein [Arabidopsis thaliana]
 gb|AAL84961.1| At4g25580/M7J2_50 [Arabidopsis thaliana]
 gb|AAN46822.1| At4g25580/M7J2_50 [Arabidopsis thaliana]
 dbj|BAF00717.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE85079.1| ARM repeat superfamily protein [Arabidopsis thaliana]
Length=626

 Score = 82.0 bits (201),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 61/157 (39%), Positives = 85/157 (54%), Gaps = 24/157 (15%)
 Frame = +1

Query  1216  STVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEFLAEK  1395
             STV   + P Y+KV   G+++M+K+   GTG        E+G D    +GVS KEFL EK
Sbjct  438   STVASMVTPVYEKVKETGASVMTKLPFTGTG-------TEQGQD----RGVSAKEFLTEK  486

Query  1396  LKPGEEDKALSDMISGTL-LSRQKEETVVEGKPVGKVTESEEVARRLGRIGDSPREGSE-  1569
             L PGEEDKALS++++  L L     ET    +  G VT+SEEV +RLG   D   E +  
Sbjct  487   LSPGEEDKALSEVVTEKLHLGGGGGETAPPKR--GIVTQSEEVEKRLGGFKDPSSEAATK  544

Query  1570  ---------EKGMVDMLKGAVNSWLGRDSQPQTTDTT  1653
                      E G+ + L+GAV SW+   ++  T  +T
Sbjct  545   QGEAYAEKGEGGIAEKLRGAVTSWIAGTTEEVTQKST  581



>emb|CAA05780.1| CDet11-24 [Craterostigma plantagineum]
Length=422

 Score = 80.9 bits (198),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 94/312 (30%), Positives = 132/312 (42%), Gaps = 70/312 (22%)
 Frame = +1

Query  727   GAGGEEARISPLVQSFEKMEVRGDEAKPQQNIRPQAGTHHKLYTGSHDQFAPEPMA----  894
             G G +E+ +  L Q  + +   GD++ P             L    H   + EP +    
Sbjct  144   GQGVKESDVDSLTQGLKGVNYGGDDSNP-------------LSGQEHQTISDEPKSLPGQ  190

Query  895   -TNVYTSSKDTESIPKSFDPTN-PENLPRDPIDGKPQQEGSYAGKMQGEHEAASPVDYAK  1068
               ++  S   +E  PK FD  + P+++P+D I GK                 A  +D A 
Sbjct  191   GNDLPQSHPSSEDEPKKFDANDQPQSMPQDTITGKL------------SSVPAVIIDRAA  238

Query  1069  TAAMAVAEKL----APVYDRVAGAGSAVMEKLPIGAsgergkgevegegksvTSTVKEKL  1236
              A   VA KL    +   +  A AG+A  +K P+                   + V EKL
Sbjct  239   AAKNVVASKLGYGGSQAQESAADAGAA-QQKKPL-----------TETAAEYKNLVAEKL  286

Query  1237  APFYDKVAGAGSTLMSKVKGPGTG----QAVVVEGYEEGNDVRTDKGVSIKEFLAEKLKP  1404
              P Y+KVAGAGST+ SKV G G      Q    EG  +G    ++KGV  K++L+EKLKP
Sbjct  287   TPVYEKVAGAGSTVTSKVWGSGGTTAGEQTQGGEGVVDGGGAASNKGVFTKDYLSEKLKP  346

Query  1405  GEEDKALSDMISGTLLSRQKEETVVEGKPVGKVTESEEVARRLGRIGDSPREGSEEKGMV  1584
             G+EDKALS  I   L   +K    VE                 G  GD  +      G+V
Sbjct  347   GDEDKALSQAIMEKLQLSKK--PAVE-----------------GGAGDETKASESSPGVV  387

Query  1585  DMLKGAVNSWLG  1620
               +KGAV S +G
Sbjct  388   GTIKGAVGSLIG  399



>ref|XP_007220235.1| hypothetical protein PRUPE_ppa001989mg [Prunus persica]
 gb|EMJ21434.1| hypothetical protein PRUPE_ppa001989mg [Prunus persica]
Length=732

 Score = 80.9 bits (198),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 62/91 (68%), Gaps = 5/91 (5%)
 Frame = +1

Query  1357  DKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEETVVEGKPVGKVTESEEVARRLG  1536
             DKGVS+K++ AEKLKPGEED+ALS++IS  L   + E++    +PVGKVTESEEV RRLG
Sbjct  606   DKGVSVKDYFAEKLKPGEEDRALSEVISEALHKPKAEDSA---RPVGKVTESEEVTRRLG  662

Query  1537  RIGDSPR--EGSEEKGMVDMLKGAVNSWLGR  1623
                   R  + S  K + D +KGAV S  G+
Sbjct  663   PDCGIERVEQSSYGKIVSDAVKGAVGSLFGK  693


 Score = 58.2 bits (139),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 59/140 (42%), Gaps = 52/140 (37%)
 Frame = +1

Query  613  GHGRGDFLQPGGLEEDPHAPSDRPRPPSNYESKTFDPTGAGGEEARISPLVQSFEKMEVR  792
            G  R +  +P GLEEDP+    +   PSNY++K  DPT AGGEE  I+P++ S +KM + 
Sbjct  396  GQSRVNLERPRGLEEDPNP---QAYTPSNYQNKVTDPTNAGGEEVGITPILHSLDKMNIH  452

Query  793  -------------------GDEAKPQQN-----------------IRPQAGT--------  840
                                D+A   +N                 I PQA T        
Sbjct  453  DGTEQSSYTDKIPSAPSAIADKAISAKNVVGSKLGYGGNNDQHGDIEPQACTASSNAGGG  512

Query  841  -----HHKLYTGSHDQFAPE  885
                 H  L TGSHDQF+ E
Sbjct  513  DEQKPHQNLSTGSHDQFSAE  532



>ref|XP_009599625.1| PREDICTED: low-temperature-induced 65 kDa protein-like [Nicotiana 
tomentosiformis]
Length=232

 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 74/124 (60%), Gaps = 13/124 (10%)
 Frame = +1

Query  1327  GYEEGNDVRTD--KGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEET-----VVEG  1485
             G EEG    TD  KGVS+K++LAEK KPGEEDKALS++I+GT LS+ K++T       E 
Sbjct  109   GEEEGKSKATDNYKGVSMKKYLAEKFKPGEEDKALSEVIAGT-LSKHKDKTEGTDQEEEA  167

Query  1486  KPVGKVTESEEVARRLG----RIGDSPREGSEEKGMVDMLKGAVNSWLGRDSQPQTTDTT  1653
             KP GKV  SEEV ++        G +  EGS  K +V  +KG  +SW G+ +      T+
Sbjct  168   KPTGKVKVSEEVTKQTAGPTDEHGIAAAEGS-GKSIVGRIKGVASSWFGKGTGKPAAQTS  226

Query  1654  NVRN  1665
              V +
Sbjct  227   TVSD  230


 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 35/49 (71%), Gaps = 2/49 (4%)
 Frame = +1

Query  649  LEEDPHAPSDRP--RPPSNYESKTFDPTGAGGEEARISPLVQSFEKMEV  789
            L++DP+AP DRP  +  SNY+SK  DPTG   EEA   PLVQSFEKM V
Sbjct  50   LDDDPNAPKDRPEDKSSSNYQSKVTDPTGTNREEAGTIPLVQSFEKMSV  98



>ref|XP_006827687.1| hypothetical protein AMTR_s00009p00256730 [Amborella trichopoda]
 gb|ERM95103.1| hypothetical protein AMTR_s00009p00256730 [Amborella trichopoda]
Length=481

 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 107/354 (30%), Positives = 160/354 (45%), Gaps = 87/354 (25%)
 Frame = +1

Query  643   GGLEEDPHAPSDRPRPPS--NYESKTFDPTGAGGEEARISPLVQSFEKMEVR-GDEAKPQ  813
             G   EDP AP D P   S  NY+SK  DPT AGGEE   + +++S   M++  G ++K +
Sbjct  147   GPFLEDPDAPKDGPGKVSSGNYQSKVKDPTNAGGEEIGGTTVLESLSAMKLSDGTDSKRR  206

Query  814   QNIRPQAGTHHKLYTGSHDQFAPEPMATNVYTSSKDTESIPKSFDPTNPENLPRDPIDGK  993
             Q +           +G+H+QFAPE                PK   P+N    P       
Sbjct  207   QEVS----------SGTHNQFAPEN---------------PKRTRPSNTTTKPN------  235

Query  994   PQQEGSYAGKMQGEHEAASPVDYAKTAAMAVAEKLAPVYDRVAGAGSAVMEKLPIGAsge  1173
             P+ + +   + + + +AA P   + T+          +YD+   A + +  KL    +  
Sbjct  236   PEPDNTVTEQSRND-QAAHPQPQSYTSL---------IYDKATSAKNLLASKLGYAQNPS  285

Query  1174  rgkge--------vegegksvTSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVV--V  1323
               +           E   +SVT TVKEK       + GA +  + + K PG  +  +   
Sbjct  286   ESEATTPESDVTMSESGNRSVTGTVKEK-------ITGAKNGCLPQ-KLPGVSEKSLGES  337

Query  1324  EGYEEGNDVR---TDKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEETVVEGKPV  1494
             E     +D R   TDKGVSIK+++ EKLKPG+ED+ALS++I+         E + +G   
Sbjct  338   ENLSAESDKREKGTDKGVSIKDYVMEKLKPGDEDRALSEVIT---------EVIHKGDGS  388

Query  1495  GK-VTESEEVARRLGRIGDSPREGSEEKGMVDMLKGAVNSWLGRDSQPQTTDTT  1653
             G+ VT S       G  GD+   GS   GMV  +KGAV S  G      + +TT
Sbjct  389   GRNVTVS-------GNSGDN--RGS---GMVGKVKGAVTSLFGSRDMKSSKETT  430



>ref|XP_006285597.1| hypothetical protein CARUB_v10007046mg [Capsella rubella]
 gb|EOA18495.1| hypothetical protein CARUB_v10007046mg [Capsella rubella]
Length=573

 Score = 76.6 bits (187),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 110/385 (29%), Positives = 165/385 (43%), Gaps = 57/385 (15%)
 Frame = +1

Query  622   RGDFLQPGGLEEDPHAPSDRPRPPSNYESKTFDPTGAGGEEARISPLVQSFEKMEVRGDE  801
             R +  +P GLE++P AP       SNY+SK  DPTG    E   +  V +  ++ +  D 
Sbjct  189   RVNIERPRGLEQNPAAPGSHG-GMSNYQSKVTDPTGKPSGETGAATTVSALGRLGLGTDL  247

Query  802   AKPQQNIRPQAGTHHKLYTGSHDQFAPEPMATNVYTSSKDTESIPKSFDPTNPENLP---  972
              K       ++G   + ++         P   N Y S    ES  +S +    ++LP   
Sbjct  248   GKKSHGFDMKSGPEMEKHS---------PTTGN-YGSRLRKESPERSGELDLGKDLPTRT  297

Query  973   ---RDP--IDGKPQQEGSYAGKMQGEHEAASPVDYAKTAAMAVAEKLAPVYDRVAGAGSA  1137
                R+P   D K +  G        E + ++   Y    A+A +     V D+   A +A
Sbjct  298   QGVRNPEGFDSKAEGRGD-------EMQQSNQSSYTDKIALATS----VVADKAVAAKNA  346

Query  1138  VMEKLPI------GAsgergkgevegegksvTSTVKEKLAPFYDKVAGAGSTLMSKVKGP  1299
             V  KL        G        E    G    STV   + P Y+KV   G+++M+K+   
Sbjct  347   VASKLGYSGEGGEGHESRVKGDETLSSGGGYGSTVAGMVTPVYEKVKETGASVMTKLP--  404

Query  1300  GTGQAVVVEGYEEGNDVRTDKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEETVV  1479
                          G +   DKGVS KE+L EKL PGEEDK LS++++  L      +T  
Sbjct  405   ------FSGTAGTGTETGQDKGVSAKEYLTEKLSPGEEDKVLSEVVTEKLHLGGGGDTAP  458

Query  1480  EGKPVGKVTESEEVARRLGRIGDSPREGSE----------EKGMVDMLKGAVNSWLGRDS  1629
               K  G VT+SEEV +RLG   D   E +           + GM + L GAV SWL   +
Sbjct  459   AKK--GIVTQSEEVEKRLGGFKDPSSEAAMKHGEAYAEEGQGGMAEKLTGAVTSWLAGTT  516

Query  1630  QPQTTDTT-NVRNEEVGHQSAVGER  1701
             +  T  +T +V++      S VG++
Sbjct  517   EEVTQKSTESVQDSSQSLGSTVGKK  541



>ref|XP_009137538.1| PREDICTED: low-temperature-induced 65 kDa protein [Brassica rapa]
Length=559

 Score = 76.6 bits (187),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 83/154 (54%), Gaps = 25/154 (16%)
 Frame = +1

Query  1222  VKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEFLAEKLK  1401
             V   + P Y+KV   G+ +M+K+  P +G      G EE    + DKGVS KE++AEKL 
Sbjct  374   VASVVTPVYEKVKETGANVMTKL--PFSG------GTEETQQGQ-DKGVSAKEYVAEKLT  424

Query  1402  PGEEDKALSDMISGTLLSRQKEETVVEGKPVGKVTESEEVARRLGRIGDSPREGS-----  1566
             PGEEDKALS++++      +K     +    G VT+S+EV  RLG   D   EG+     
Sbjct  425   PGEEDKALSEVVA------EKLHLGGDTPKKGTVTQSKEVEERLGGFPDPKSEGAIKHGE  478

Query  1567  -----EEKGMVDMLKGAVNSWLGRDSQPQTTDTT  1653
                   E GMVD L+GAV SW+   ++  T  +T
Sbjct  479   RYAEEGEGGMVDKLRGAVTSWISGTTEEVTQKST  512



>ref|XP_006599753.1| PREDICTED: receptor-like protein 12-like [Glycine max]
Length=976

 Score = 77.0 bits (188),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 65/176 (37%), Positives = 89/176 (51%), Gaps = 46/176 (26%)
 Frame = +1

Query  1219  TVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEFLAEKL  1398
             ++ EKLAP   K AG GS + SKV G  T       G E+      DKGVS+K++L +KL
Sbjct  810   SLTEKLAPVSGKDAGVGSGVKSKVSGTQTSSM----GVEQ------DKGVSVKDYLVDKL  859

Query  1399  KPGEEDKALSDMISGTLLSRQKE----ETVVEG-----------------------KPVG  1497
             +PG+ED+ALS++I  TL   +KE    E   EG                       + +G
Sbjct  860   RPGDEDRALSEVIPETL--HKKELPPVEVTEEGVRKVVSDAVHKREDDPERRMEHQRILG  917

Query  1498  KVTESEEVARRLGRIGDSPREGSEE-------KGMVDMLKGAVNSWLGRDSQPQTT  1644
             KVTESEEV RRLG       +  +E       KG+VD LKG V +W    ++ Q++
Sbjct  918   KVTESEEVKRRLGGESVVTEKKYQEMYVNSPGKGVVDKLKGVVGTWFTDPAENQSS  973



>ref|XP_006607076.1| PREDICTED: low-temperature-induced 65 kDa protein-like [Glycine 
max]
Length=206

 Score = 73.2 bits (178),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 60/158 (38%), Positives = 84/158 (53%), Gaps = 40/158 (25%)
 Frame = +1

Query  1348  VRTDKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQ------KEETVV----------  1479
             V  DKGVS+K++L +KL+PG+ED+ALS++IS TL  ++       EE V           
Sbjct  44    VEQDKGVSVKDYLVDKLRPGDEDRALSEVISETLHKKELPPVEVTEEGVRKVVSDAVHKR  103

Query  1480  ----EGK-----PVGKVTESEEVARRLGRIGDSPREGSEE-------KGMVDMLKGAVNS  1611
                 EGK      +GKVTESEEV RRLG       +  +E       KG+VD LKG V +
Sbjct  104   DDDPEGKMEHQRILGKVTESEEVKRRLGGESVVTEKKYQEMYVNSPGKGVVDKLKGMVGT  163

Query  1612  WLGRDSQPQTTDTTNVRNEEVG-------HQSAVGERR  1704
             W    ++ Q++  +++ N E G       +Q A GERR
Sbjct  164   WFTNPAENQSSQDSSM-NYEAGRAEVEQVNQGAAGERR  200



>emb|CDX92720.1| BnaC07g39780D [Brassica napus]
Length=551

 Score = 75.5 bits (184),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 61/154 (40%), Positives = 83/154 (54%), Gaps = 22/154 (14%)
 Frame = +1

Query  1222  VKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEFLAEKLK  1401
             V   + P Y+KV   G+ +M+K   P +G      G EE +  + DKGVS KE++AEKL 
Sbjct  363   VASVVTPVYEKVKETGANVMTKR--PFSG------GTEETHQGQ-DKGVSAKEYVAEKLS  413

Query  1402  PGEEDKALSDMISGTLLSRQKEETVVEGKPVGKVTESEEVARRLGRIGDSPREGS-----  1566
             PGEEDKALS++++  L      +T  E K  G VT+S+ V  RLG   D   EG+     
Sbjct  414   PGEEDKALSEVVAEKL--HLGGDTTAEPKK-GTVTQSKAVEERLGGFPDPKSEGAIKHGE  470

Query  1567  -----EEKGMVDMLKGAVNSWLGRDSQPQTTDTT  1653
                   E GMVD L GAV SW+   ++  T  +T
Sbjct  471   RYAEEGEGGMVDKLTGAVTSWISGTTEEVTQKST  504



>ref|XP_006401839.1| hypothetical protein EUTSA_v10013021mg [Eutrema salsugineum]
 gb|ESQ43292.1| hypothetical protein EUTSA_v10013021mg [Eutrema salsugineum]
Length=602

 Score = 75.1 bits (183),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 140/500 (28%), Positives = 197/500 (39%), Gaps = 164/500 (33%)
 Frame = +1

Query  565   HNRPPPFVSETHHQT-----------SGHGRGDFLQPGGLEEDPHAP---SDRPRPPSNY  702
             HN P   +S T   T            G  R +  +P GLE+DP +P   SD      NY
Sbjct  166   HNTPASLLSSTEDVTRTFAPGEDEYLGGQRRVNVERPKGLEKDPSSPGGGSDYLSGVPNY  225

Query  703   ESKTFDPTGAGGEEARISPLVQSFEKMEV------RG-----------DEAKPQQ-----  816
             +SK  DPT  GGE A +  +  S  +M+V      RG           +E+K  +     
Sbjct  226   QSKVTDPTHKGGE-AGVPEIADSLGRMKVTDEKPGRGFERDLPTRSHENESKCGEGFPAG  284

Query  817   ------------------NIRPQAGTHHKLYTGSHDQFAPE---PMATNVYTSSKDTESI  933
                               +++ + G    L TG+HDQF+PE   P   N +  SKD ES 
Sbjct  285   FGGESGAGVGKDFPTRSDDVKAETGLGKNLPTGTHDQFSPELSRPKERNDF-DSKD-ESK  342

Query  934   PKSFDP---------TNPENLPRDPIDGKPQQEGSYAG-------------KMQ--GEHE  1041
             P ++           T      ++ +  K    G   G             KM+  G+HE
Sbjct  343   PSTYTEKIGSATSFVTGKAIAAKNAVASKLGYSGETTGGGGQHESPLGGDEKMRSSGQHE  402

Query  1042  AA-------SPVDYAKTAAMAVAEKLAPVYDRVAGAGSAVMEKLPIGAsgergkgevege  1200
                      S   Y +  A  VAEKL PVY++V   GSAVM KLP+              
Sbjct  403   TPVGEETPRSATGYGQKMAGTVAEKLTPVYEKVKETGSAVMTKLPL--------------  448

Query  1201  gksvTSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKE  1380
                                +G GS                  G EE   V  DKGV+ K 
Sbjct  449   -------------------SGGGS------------------GAEEKQQV-GDKGVAGKG  470

Query  1381  FLAEKLKPGEEDKALSDMISGTL---------LSRQKEETVVEGKPVGKVTESEEVARRL  1533
             +LAEK  PGE+DKALS++I+  L          + ++ E  VE  P  K++E     R  
Sbjct  471   YLAEKFSPGEDDKALSEVIAEKLHLGGGEKKTTTTKEVEVTVEKIPSDKISEE----RVH  526

Query  1534  GRIGDSPREGSEEKGMVDMLKGAVNSWLG----RDSQPQTTDTTNVRNEEVGHQSAVGER  1701
             G +  +  EG    GMV  +KGAV SWLG    ++ +P++ D+    ++ +G  S VG  
Sbjct  527   GDV--TAEEGKGGGGMVGKVKGAVTSWLGGSTEKEVKPKSVDSGEESSQSLG--STVGTM  582

Query  1702  RLEHQDAMAEGRSRLQESGH  1761
                        +  LQESG+
Sbjct  583   GFSDSSGAVPAQRGLQESGN  602



>ref|XP_010920779.1| PREDICTED: low-temperature-induced 65 kDa protein [Elaeis guineensis]
Length=405

 Score = 74.3 bits (181),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 64/115 (56%), Gaps = 8/115 (7%)
 Frame = +1

Query  1213  TSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEFLAE  1392
             T TV E LAP Y  ++ A  T+ SK++ PG+G+      YE G     DKG+S+KE+L  
Sbjct  218   TETVTEMLAPAYTMLSEAAQTIASKIQSPGSGR------YELGAKQIWDKGISVKEYLMH  271

Query  1393  KLKPGEEDKALSDMISGTLLSRQKEETVVEGKPVGKVTESEEVARRLGRIGDSPR  1557
             KL+PGEED+AL  +I+  +  R   E   +G+ V  +   EE+      +  +PR
Sbjct  272   KLEPGEEDRALCQVITKAVSPRNAGE--AQGEAVSSLRSREELRETQTPVSTNPR  324



>ref|XP_006599602.1| PREDICTED: low-temperature-induced 65 kDa protein-like [Glycine 
max]
Length=214

 Score = 70.9 bits (172),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 54/158 (34%), Positives = 80/158 (51%), Gaps = 40/158 (25%)
 Frame = +1

Query  1348  VRTDKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQK---------------------  1464
             V  DKGVS+K++L +KL+PG+ED+ALS++IS TL  ++                      
Sbjct  52    VEQDKGVSVKDYLVDKLRPGDEDRALSEVISETLHKKELPPVEVTEEGVRKVVSDAVHKR  111

Query  1465  ----EETVVEGKPVGKVTESEEVARRLGRIGDSPREGSEE-------KGMVDMLKGAVNS  1611
                 E  +   + +GKVTESEEV RRLG       +  +E       KG+VD  KG V +
Sbjct  112   DDDPERRMEHQRILGKVTESEEVKRRLGGESVVTEKKYQEMYVNSPGKGVVDKFKGMVGT  171

Query  1612  WLGRDSQPQTTDTTNVRNEEVG-------HQSAVGERR  1704
             W    ++ Q++  +++ N E G       +Q A GERR
Sbjct  172   WFTNPAENQSSQDSSM-NYEAGRAEVEQVNQGAAGERR  208



>ref|XP_010937576.1| PREDICTED: low-temperature-induced 65 kDa protein-like [Elaeis 
guineensis]
Length=379

 Score = 72.8 bits (177),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 61/107 (57%), Gaps = 9/107 (8%)
 Frame = +1

Query  1219  TVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEFLAEKL  1398
             TV E LAP Y+ V+ A   + SK++ PGTGQ       E G     DKG+S+KE+L  KL
Sbjct  184   TVTEMLAPAYNMVSEATQMIASKIQSPGTGQ-------ELGAKQMWDKGISVKEYLMHKL  236

Query  1399  KPGEEDKALSDMISGTLLSRQKEETVVEGKPVGKVTESEEVARRLGR  1539
             +PGEED+AL  +I+  +  R   E   E   V KV E+  V+  LGR
Sbjct  237   EPGEEDRALCQVITEAVSPRNTGEAQGEAGIVEKVKEA--VSSLLGR  281



>ref|XP_006281549.1| hypothetical protein CARUB_v10027650mg [Capsella rubella]
 gb|EOA14447.1| hypothetical protein CARUB_v10027650mg [Capsella rubella]
Length=634

 Score = 73.6 bits (179),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 111/412 (27%), Positives = 159/412 (39%), Gaps = 145/412 (35%)
 Frame = +1

Query  640   PGGLEEDPHAP---SDRPRPPSNYESKTFDPTGAGGEEARISPLVQSFEKMEVRGDEAKP  810
             P GLE DP  P   SD     SNY+SK  DPT  GGE A +  +V+S  +M+V  DE+  
Sbjct  235   PKGLEVDPAGPGGGSDYLSGASNYQSKVTDPTKEGGE-AGVPKIVESLGRMKVT-DESPS  292

Query  811   QQ-------------------------------------------------NIRPQAGTH  843
             Q+                                                 +++ + G  
Sbjct  293   QKTEQGFERDSPTKSQEFGLKNEPGITKDSPARFGGESGGGLEESFPARNDDVKVEIGLG  352

Query  844   HKLYTGSHDQFAPE---PMATNVYTSSKDTESIPKSFDPTNPENLPRDPI---DGKPQQE  1005
               L TG+HDQF+PE   P   + +  ++D E+ P++   T  E L        +     +
Sbjct  353   RDLPTGTHDQFSPELSRPKERSDFEETRD-ETTPETKPSTYTEQLASATTAVTNKAIAAK  411

Query  1006  GSYAGKM-----QGEHEAASPVD---------YAKTAAMAVAEKLAPVYDRVAGAGSAVM  1143
              + A K+      G  +  SPV          Y +  A  VAEKL PVY++V   GS VM
Sbjct  412   NAMASKLGYTGGSGSEQYESPVKDETPRSATGYGQKVAGTVAEKLTPVYEKVKETGSTVM  471

Query  1144  EKLPIGAsgergkgevegegksvTSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVV  1323
              KLP+                                 +G GS +    +G         
Sbjct  472   TKLPL---------------------------------SGGGSGVKETQQG---------  489

Query  1324  EGYEEGNDVRTDKGV-SIKEFLAEKLKPGEEDKALSDMISGTL------------LSRQK  1464
                        +KGV S +++L+EKLKPGEEDKALS++I+  L             + ++
Sbjct  490   ----------EEKGVSSARDYLSEKLKPGEEDKALSEVIAEKLHFGGGGEEKKKTTATKE  539

Query  1465  EETVVEGKPVGKVTESEEVARRLGRIGDSPREGSEEKGMVDMLKGAVNSWLG  1620
              E  VE  P  K+ E +E      +            GMV  +KGAV SWLG
Sbjct  540   VEVTVEKIPTEKILEDKEHGEAFAK-----EGNGGGGGMVGKVKGAVTSWLG  586



>ref|XP_006401838.1| hypothetical protein EUTSA_v10013021mg [Eutrema salsugineum]
 gb|ESQ43291.1| hypothetical protein EUTSA_v10013021mg [Eutrema salsugineum]
Length=584

 Score = 73.6 bits (179),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 108/383 (28%), Positives = 146/383 (38%), Gaps = 143/383 (37%)
 Frame = +1

Query  565   HNRPPPFVSETHHQT-----------SGHGRGDFLQPGGLEEDPHAP---SDRPRPPSNY  702
             HN P   +S T   T            G  R +  +P GLE+DP +P   SD      NY
Sbjct  166   HNTPASLLSSTEDVTRTFAPGEDEYLGGQRRVNVERPKGLEKDPSSPGGGSDYLSGVPNY  225

Query  703   ESKTFDPTGAGGEEARISPLVQSFEKMEV------RG-----------DEAKPQQ-----  816
             +SK  DPT  GGE A +  +  S  +M+V      RG           +E+K  +     
Sbjct  226   QSKVTDPTHKGGE-AGVPEIADSLGRMKVTDEKPGRGFERDLPTRSHENESKCGEGFPAG  284

Query  817   ------------------NIRPQAGTHHKLYTGSHDQFAPE---PMATNVYTSSKDTESI  933
                               +++ + G    L TG+HDQF+PE   P   N +  SKD ES 
Sbjct  285   FGGESGAGVGKDFPTRSDDVKAETGLGKNLPTGTHDQFSPELSRPKERNDF-DSKD-ESK  342

Query  934   PKSFDP---------TNPENLPRDPIDGKPQQEGSYAG-------------KMQ--GEHE  1041
             P ++           T      ++ +  K    G   G             KM+  G+HE
Sbjct  343   PSTYTEKIGSATSFVTGKAIAAKNAVASKLGYSGETTGGGGQHESPLGGDEKMRSSGQHE  402

Query  1042  AA-------SPVDYAKTAAMAVAEKLAPVYDRVAGAGSAVMEKLPIGAsgergkgevege  1200
                      S   Y +  A  VAEKL PVY++V   GSAVM KLP+              
Sbjct  403   TPVGEETPRSATGYGQKMAGTVAEKLTPVYEKVKETGSAVMTKLPL--------------  448

Query  1201  gksvTSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKE  1380
                                +G GS                  G EE   V  DKGV+ K 
Sbjct  449   -------------------SGGGS------------------GAEEKQQV-GDKGVAGKG  470

Query  1381  FLAEKLKPGEEDKALSDMISGTL  1449
             +LAEK  PGE+DKALS++I+  L
Sbjct  471   YLAEKFSPGEDDKALSEVIAEKL  493



>emb|CDY50195.1| BnaA03g47530D [Brassica napus]
Length=552

 Score = 73.2 bits (178),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 58/154 (38%), Positives = 81/154 (53%), Gaps = 25/154 (16%)
 Frame = +1

Query  1222  VKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEFLAEKLK  1401
             V   + P Y+KV   G+ +M+K+  P +G      G EE    + DKGVS KE++AEKL 
Sbjct  367   VASVVTPVYEKVKETGANVMTKL--PFSG------GTEETQQGQ-DKGVSAKEYVAEKLT  417

Query  1402  PGEEDKALSDMISGTLLSRQKEETVVEGKPVGKVTESEEVARRLGRIGDSPREGS-----  1566
             PG EDKALS++++      +K     +    G VT+S+EV  RLG   D   EG+     
Sbjct  418   PGVEDKALSEVVA------EKLHLGGDTPKKGTVTQSKEVEERLGGFPDPKSEGAIKHGE  471

Query  1567  -----EEKGMVDMLKGAVNSWLGRDSQPQTTDTT  1653
                   E GMVD L GAV SW+   ++  T  +T
Sbjct  472   RYAEEGEGGMVDKLSGAVTSWISGTTEEVTQKST  505



>ref|XP_007152289.1| hypothetical protein PHAVU_004G117100g [Phaseolus vulgaris]
 gb|ESW24283.1| hypothetical protein PHAVU_004G117100g [Phaseolus vulgaris]
Length=1299

 Score = 73.9 bits (180),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 56/157 (36%), Positives = 76/157 (48%), Gaps = 36/157 (23%)
 Frame = +1

Query  1348  VRTDKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEETVVEGK-------------  1488
             V  DKGVS+K++LA+KL+P  ED ALS++IS TL  ++  +   EG              
Sbjct  1139  VEQDKGVSMKDYLADKLRPTPEDSALSEVISETLHRKEPVKFTEEGNKGGKKVISDAVHE  1198

Query  1489  -------------PVGKVTESEEVARRLGRIGDSPREGSEE-------KGMVDMLKGAVN  1608
                          P+ KVTESEEV RRLG          +E        G+VD LKG V 
Sbjct  1199  REDEAERRVDQQIPLWKVTESEEVKRRLGSEDIETERRYQEMYVKTPGTGVVDKLKGMVG  1258

Query  1609  SWLGRDSQPQTTDTTNVRN--EEVGH-QSAVGERRLE  1710
             SW+    + Q++  ++  N   EV H     GERRL+
Sbjct  1259  SWITNPMENQSSQDSSTTNYGTEVEHLNQGGGERRLQ  1295


 Score = 63.9 bits (154),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 53/93 (57%), Gaps = 4/93 (4%)
 Frame = +1

Query  616  HGRGDFLQPGGLEEDPHAP--SDRPRPPSNYESKTFDPTGAGGEEARISPLVQSFEKMEV  789
            H + +  +P  LEEDPHAP  + +   P+NYE+K  DP+G GG E  ++P+ +SF  + +
Sbjct  161  HAKVNLERPIHLEEDPHAPRSAHQAYAPANYETKVKDPSGLGGAEIDVTPVEKSFSMLTI  220

Query  790  RGDEAKPQQNIRPQA-GTHHKLYTGSHDQFAPE  885
               E   + N+ P    THH    GSH QF PE
Sbjct  221  LY-EPNQEPNLFPTVPETHHHPSAGSHSQFTPE  252



>ref|XP_003549082.1| PREDICTED: low-temperature-induced 65 kDa protein-like [Glycine 
max]
Length=889

 Score = 72.4 bits (176),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 70/210 (33%), Positives = 97/210 (46%), Gaps = 64/210 (30%)
 Frame = +1

Query  1219  TVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEFLAEKL  1398
             ++ EKLAP   K AG GS + SKV G  T              V  DKGVS+K++L +KL
Sbjct  694   SLTEKLAPVSGKDAGVGSGVKSKVSGTQTSSM----------GVEQDKGVSVKDYLVDKL  743

Query  1399  KPGEEDKALSDMISGTLLSRQ--KEETVVEG-----------------------KPVGKV  1503
             + G+ED+ALS++IS TL  ++    E   EG                       + +GKV
Sbjct  744   RRGDEDRALSEVISETLHKKELPSVEVTEEGVRKVVSDAVHKREDDPERRMEHQRILGKV  803

Query  1504  TESEEVARRLGRIGDSPREGSEEKGMVDMLKGAVNS---------------WLGRDSQPQ  1638
             TESEEV RRLG  G+S      EK   +M    VNS               W    ++ Q
Sbjct  804   TESEEVKRRLG--GES---VVTEKKYQEMY---VNSPGKGVVDKVKGVVGTWFTNPAENQ  855

Query  1639  TTDTTNVRNE------EVGHQSAVGERRLE  1710
             ++  +++  E      E  +Q A GERRL+
Sbjct  856   SSQDSSMNYEAGRAEVEQANQGAAGERRLQ  885


 Score = 65.9 bits (159),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 55/100 (55%), Gaps = 3/100 (3%)
 Frame = +1

Query  616  HGRGDFLQPGGLEEDPHAP--SDRPRPPSNYESKTFDPTGAGGEEARISPLVQSFEKMEV  789
            H + +  +P  LEEDPHAP  + +   P+NY++K  DPTGAGG E  I+P+ +SF +M V
Sbjct  171  HRKVNLERPMYLEEDPHAPRSTSQAYAPANYQTKVTDPTGAGGAEIDITPVEKSFSRMAV  230

Query  790  RGD-EAKPQQNIRPQAGTHHKLYTGSHDQFAPEPMATNVY  906
              + +  P+  +       H    GSH Q APE  +   Y
Sbjct  231  HNEPKPYPEPKLFSTVPETHYPSAGSHSQLAPELSSATNY  270



>ref|XP_006413293.1| hypothetical protein EUTSA_v10024860mg [Eutrema salsugineum]
 gb|ESQ54746.1| hypothetical protein EUTSA_v10024860mg [Eutrema salsugineum]
Length=542

 Score = 71.6 bits (174),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 66/112 (59%), Gaps = 17/112 (15%)
 Frame = +1

Query  1315  VVVEGYEEGNDVRTDKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEETVVEGKPV  1494
             V VE  ++G D    KGVS +E+L+EKL PGEEDKALS++++   L    E T    K  
Sbjct  376   VKVEQTQQGQD----KGVSAREYLSEKLSPGEEDKALSEVVA-EKLHLGGENTTAPAKK-  429

Query  1495  GKVTESEEVARRLGRIGDSPREGS-----------EEKGMVDMLKGAVNSWL  1617
             G VT+SEEV +RLG   D   EG+            E GMV+ML+GAV SW+
Sbjct  430   GIVTQSEEVEKRLGGFSDPKSEGAMKHGEEAVAEEGEGGMVEMLRGAVTSWI  481



>ref|XP_010262567.1| PREDICTED: low-temperature-induced 65 kDa protein isoform X1 
[Nelumbo nucifera]
Length=424

 Score = 70.9 bits (172),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 62/211 (29%), Positives = 90/211 (43%), Gaps = 56/211 (27%)
 Frame = +1

Query  952   TNPENLPRDPIDGKPQQEGSYAGKMQGEHEAASPVDYAKTAAMAVAEKLAPVYDRVAGAG  1131
             +NP    R P+    +   +Y   +  +         +KT    V EKLAP Y +V    
Sbjct  226   SNPVAADRKPVAANSEPVAAYTNPVAAD---------SKTITETVTEKLAPAYAKV----  272

Query  1132  SAVMEKLPIGAsgergkgevegegksvTSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTG-  1308
                                        T TV E LAP Y  V  A + + SK+ G  T  
Sbjct  273   ---------------------------TETVSETLAPAYAAVTQATNIIASKIHGSPTSA  305

Query  1309  -----QAVVVEGYEEGNDVRTDKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEET  1473
                  Q++ +   E+    + DKGVS+KEFL +KL+PGEE++ALS MIS  +  R+    
Sbjct  306   SETGPQSIAISSSEQ----KWDKGVSVKEFLMQKLEPGEEERALSQMISEAMSPRK----  357

Query  1474  VVEGKPVGKVTESEEVARRLGRIGDSPREGS  1566
              V G+ +G V +  E    L  + +SP   S
Sbjct  358   -VPGE-MGVVEKVREAVSSLLNVEESPSLSS  386



>ref|XP_010262568.1| PREDICTED: low-temperature-induced 65 kDa protein isoform X2 
[Nelumbo nucifera]
Length=423

 Score = 70.9 bits (172),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 62/211 (29%), Positives = 90/211 (43%), Gaps = 56/211 (27%)
 Frame = +1

Query  952   TNPENLPRDPIDGKPQQEGSYAGKMQGEHEAASPVDYAKTAAMAVAEKLAPVYDRVAGAG  1131
             +NP    R P+    +   +Y   +  +         +KT    V EKLAP Y +V    
Sbjct  226   SNPVAADRKPVAANSEPVAAYTNPVAAD---------SKTITETVTEKLAPAYAKV----  272

Query  1132  SAVMEKLPIGAsgergkgevegegksvTSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTG-  1308
                                        T TV E LAP Y  V  A + + SK+ G  T  
Sbjct  273   ---------------------------TETVSETLAPAYAAVTQATNIIASKIHGSPTSA  305

Query  1309  -----QAVVVEGYEEGNDVRTDKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEET  1473
                  Q++ +   E+    + DKGVS+KEFL +KL+PGEE++ALS MIS  +  R+    
Sbjct  306   SETGPQSIAISSSEQ----KWDKGVSVKEFLMQKLEPGEEERALSQMISEAMSPRK----  357

Query  1474  VVEGKPVGKVTESEEVARRLGRIGDSPREGS  1566
              V G+ +G V +  E    L  + +SP   S
Sbjct  358   -VPGE-MGVVEKVREAVSSLLNVEESPSLSS  386



>ref|XP_008803155.1| PREDICTED: uncharacterized protein LOC103716775 [Phoenix dactylifera]
Length=387

 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 72/143 (50%), Gaps = 9/143 (6%)
 Frame = +1

Query  1219  TVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEFLAEKL  1398
             TV   LAP Y  V+GA   + SK++ PGTG       YE G     DKG+S++E+L  KL
Sbjct  197   TVTGMLAPAYTMVSGATQMIASKIQSPGTG-------YESGAKQMYDKGISVREYLMHKL  249

Query  1399  KPGEEDKALSDMISGTLLSRQKEETVVEGKPVGKVTESEEVARRLGRIGDSPREGSEEKG  1578
             +PGEED+AL  +I+  +  R   +   E     KV E+  V+  LGR   S  E +    
Sbjct  250   EPGEEDRALCQVITEAVSPRNAGQAQREVGVAEKVKEA--VSSLLGREEVSRTETNPRAH  307

Query  1579  MVDMLKGAVNSWLGRDSQPQTTD  1647
                +   A+N  +   S P +T+
Sbjct  308   QRPIQVPAINPCVQEASAPLSTN  330



>ref|XP_010442755.1| PREDICTED: low-temperature-induced 65 kDa protein-like [Camelina 
sativa]
Length=623

 Score = 70.5 bits (171),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 90/333 (27%), Positives = 126/333 (38%), Gaps = 115/333 (35%)
 Frame = +1

Query  640   PGGLEEDPHAP---SDRPRPPSNYESKTFDPTGAGGEEARISPLVQSFEKMEVRGD---E  801
             P  LEEDP  P   SD     SNY+SK  DPT  GG  A I  + +S  +M+V  +   +
Sbjct  224   PKRLEEDPAGPGGGSDYLSGVSNYQSKVTDPTKEGGV-AGIPEIAESLGRMKVTDESPGQ  282

Query  802   AKPQQNIRPQ-------------------------------------AGTHHKLYTGSHD  870
                Q+++R Q                                      G    L TG+HD
Sbjct  283   TTGQRDLRSQEFGLKNESGIGKDSPARFGGESGGLEESFPTRSDDVKVGLGRDLPTGTHD  342

Query  871   QFAPEPMATNVYTSSKDT------ESIPKSFDP---------TNPENLPRDPIDGKPQQE  1005
             QF+PE         S++T      E+ P ++           TN     ++ +  K    
Sbjct  343   QFSPELSRPKERGDSEETREEATHETKPSTYTEQFASATSAITNKAIAAKNALASKLGYS  402

Query  1006  GSYAGKMQGEHEAA-----SPVDYAKTAAMAVAEKLAPVYDRVAGAGSAVMEKLPIGAsg  1170
             G   G +Q +         S   Y +T A  VAEKL PVY++V   GS VM KLP+    
Sbjct  403   GESGGGVQYDSTVKDETPRSATGYGQTVAGTVAEKLTPVYEKVKETGSTVMTKLPL----  458

Query  1171  ergkgevegegksvTSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDV  1350
                                                      G G+G     +G E+G   
Sbjct  459   ----------------------------------------SGGGSGVKETQQGEEKGV--  476

Query  1351  RTDKGVSIKEFLAEKLKPGEEDKALSDMISGTL  1449
                   S +++L+EKLKPGEEDKALS++I+  L
Sbjct  477   -----TSARDYLSEKLKPGEEDKALSEVIAEKL  504



>ref|XP_008801611.1| PREDICTED: uncharacterized protein LOC103715672 isoform X2 [Phoenix 
dactylifera]
Length=403

 Score = 69.3 bits (168),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 51/87 (59%), Gaps = 7/87 (8%)
 Frame = +1

Query  1213  TSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEFLAE  1392
             T TV E LAP Y  V+ A   + SK++ PGTG       YE G     DKG+S+KE+L  
Sbjct  217   TETVTEMLAPAYTMVSEATQMMASKIQSPGTG-------YELGAKQVWDKGISVKEYLLH  269

Query  1393  KLKPGEEDKALSDMISGTLLSRQKEET  1473
             KL+PGEED+AL  +I+  +  R+  E 
Sbjct  270   KLEPGEEDRALCQVITEAVSPRKAGEV  296



>ref|XP_008801609.1| PREDICTED: uncharacterized protein LOC103715672 isoform X1 [Phoenix 
dactylifera]
Length=404

 Score = 69.3 bits (168),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 50/83 (60%), Gaps = 7/83 (8%)
 Frame = +1

Query  1213  TSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEFLAE  1392
             T TV E LAP Y  V+ A   + SK++ PGTG       YE G     DKG+S+KE+L  
Sbjct  217   TETVTEMLAPAYTMVSEATQMMASKIQSPGTG-------YELGAKQVWDKGISVKEYLLH  269

Query  1393  KLKPGEEDKALSDMISGTLLSRQ  1461
             KL+PGEED+AL  +I+  +  R+
Sbjct  270   KLEPGEEDRALCQVITEAVSPRK  292



>emb|CDY32583.1| BnaC03g15510D [Brassica napus]
Length=555

 Score = 68.2 bits (165),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 94/303 (31%), Positives = 135/303 (45%), Gaps = 48/303 (16%)
 Frame = +1

Query  613   GHGRGDFLQPGGLEEDPHAPSDRPRPPSNYESKTFDPTGAGGEEARISPLVQSFEKMEVR  792
             G  R +  +P GLEEDP AP       SNY++K  DPT  GG EA +  +V+S  KM+V 
Sbjct  213   GQRRVNIGRPRGLEEDPGAPGGESV--SNYQTKVTDPTHQGGGEAGVPAIVESLGKMKVT  270

Query  793   GDEAKPQQNIRPQAGTHHKLYTGSHDQFAPEPMATNVYTSSKDTESIPKSF------DPT  954
              DE+   ++ R       ++ T SH+       A      S+D   + K F      D  
Sbjct  271   -DESPVHKSGRE---FEREIPTRSHEFGLKNEHAIGFGGESED--GMGKYFRTRSHDDDV  324

Query  955   NPEN-LPRDPIDGKPQQEGSYAGKMQGEHE-----AASPVDYAKTAAMAVAEKLAPVYDR  1116
               EN L RD   G   Q      + +  H+      + P  Y++    A +     V D+
Sbjct  325   KVENVLVRDLPTGTHDQFSPDLSRPKERHDFEETHESKPTTYSEKIGSATSF----VTDK  380

Query  1117  VAGAGSAVMEKLPIGAsgergkgevegegksvTSTVKEKLAPFYDKVAGAGSTLMSKVKG  1296
                A +AV  KL                        +E+     +KV   GS +++K+  
Sbjct  381   AVAARNAVASKLGYSGESG-----------------QEQSRVGDEKVKETGSNVVTKLPL  423

Query  1297  PGTGQAVVVEGYEEGNDVRTDKGVSIKEFLAEKLKPGEEDKALSDMISGTL-LSRQKEET  1473
              G G      G EE   V  +KGVS K++LAEKL+PGEEDKALS++I+  L L   K+ T
Sbjct  424   SGGGS-----GAEEKQQV-GEKGVSTKDYLAEKLRPGEEDKALSEVIAEKLHLGGDKKRT  477

Query  1474  VVE  1482
              V+
Sbjct  478   TVK  480



>ref|XP_006607103.1| PREDICTED: uncharacterized protein LOC102665694 [Glycine max]
Length=205

 Score = 64.3 bits (155),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 67/131 (51%), Gaps = 32/131 (24%)
 Frame = +1

Query  1348  VRTDKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQK---------------------  1464
             V  DKGVS+K++L +KL+PG+ED+ALS++IS TL  ++                      
Sbjct  72    VEQDKGVSVKDYLVDKLRPGDEDRALSEVISETLHKKELPPVEVTEEGVRKVVSDAVHKR  131

Query  1465  ----EETVVEGKPVGKVTESEEVARRLGRIGDSPREGSEE-------KGMVDMLKGAVNS  1611
                 E  +   + +GKVTESEEV RRLG       +  +E       KG+VD  KG V +
Sbjct  132   DDDPERRMEHQRILGKVTESEEVKRRLGGESVVTEKKYQEMYVNSPGKGVVDKFKGMVGT  191

Query  1612  WLGRDSQPQTT  1644
             W    ++ Q++
Sbjct  192   WFTNPAENQSS  202



>ref|XP_004496835.1| PREDICTED: low-temperature-induced 65 kDa protein-like [Cicer 
arietinum]
Length=684

 Score = 66.6 bits (161),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 56/89 (63%), Gaps = 14/89 (16%)
 Frame = +1

Query  1219  TVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTD--KGVSIKEFLAE  1392
             +V EKLAP Y KVA  GS + SKV G  T            N+V+ D  KG ++K+ L E
Sbjct  384   SVTEKLAPVYGKVAEVGSAVKSKVYGTETK-----------NEVQEDHEKGFTVKDNLVE  432

Query  1393  KLKPGEEDKALSDMISGTLL-SRQKEETV  1476
             KL+P EEDKALS++IS  LL ++ KEET+
Sbjct  433   KLRPSEEDKALSEVISEALLRNKGKEETL  461


 Score = 66.6 bits (161),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 56/89 (63%), Gaps = 14/89 (16%)
 Frame = +1

Query  1219  TVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTD--KGVSIKEFLAE  1392
             +V EKLAP Y KVA  GS + SKV G  T            N+V+ D  KG ++K+ L E
Sbjct  536   SVTEKLAPVYGKVAEVGSAVKSKVYGTETK-----------NEVQEDHEKGFTVKDNLVE  584

Query  1393  KLKPGEEDKALSDMISGTLL-SRQKEETV  1476
             KL+P EEDKALS++IS  LL ++ KEET+
Sbjct  585   KLRPSEEDKALSEVISEALLRNKGKEETL  613



>ref|XP_010433615.1| PREDICTED: low-temperature-induced 65 kDa protein-like isoform 
X2 [Camelina sativa]
Length=541

 Score = 66.2 bits (160),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 54/97 (56%), Gaps = 13/97 (13%)
 Frame = +1

Query  1357  DKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEETVVEGKPVGKVTESEEVARRLG  1536
             DKGVS KE+L EKL PGEEDK LS++++  L     E    +    G VT+SEEV +RLG
Sbjct  389   DKGVSAKEYLTEKLSPGEEDKVLSEVVAEKLHLGGGETGPAK---KGIVTQSEEVEKRLG  445

Query  1537  RIGDSPREGSE----------EKGMVDMLKGAVNSWL  1617
                D   E +           E GMV+ L GAV SWL
Sbjct  446   GFKDPSSEAAMKHGKAYADEGEGGMVEKLSGAVTSWL  482



>ref|XP_010438861.1| PREDICTED: low-temperature-induced 65 kDa protein-like isoform 
X2 [Camelina sativa]
Length=541

 Score = 66.2 bits (160),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 54/97 (56%), Gaps = 13/97 (13%)
 Frame = +1

Query  1357  DKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEETVVEGKPVGKVTESEEVARRLG  1536
             DKGVS KE+L EKL PGEEDK LS++++  L     E    +    G VT+SEEV +RLG
Sbjct  389   DKGVSAKEYLTEKLSPGEEDKVLSEVVAEKLHLGGGETGPAK---KGIVTQSEEVEKRLG  445

Query  1537  RIGDSPREGSE----------EKGMVDMLKGAVNSWL  1617
                D   E +           E GMV+ L GAV SWL
Sbjct  446   GFKDPSSEAAMKHGKAYADEGEGGMVEKLSGAVTSWL  482



>gb|KFK26849.1| hypothetical protein AALP_AA8G301300 [Arabis alpina]
Length=718

 Score = 66.2 bits (160),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 68/213 (32%), Positives = 96/213 (45%), Gaps = 39/213 (18%)
 Frame = +1

Query  814   QNIRPQAGTHHKLYTGSHDQFAPEPMATNVYTSSKDTESIPKSFDPTNPENLPRDPIDGK  993
             ++++   G    L TG+H QF+PE              S PK  D ++      +  +GK
Sbjct  431   EDVKVTTGLKRDLPTGTHHQFSPEL-------------SRPKERDDSDST---LETHEGK  474

Query  994   PQQEGSYAGKMQGEHEAASPV-DYAKTAAMAVAEKLAPVYDRVAGAGSAVMEKLPIGAsg  1170
             P    +Y  K+     A S + D A  A  AVA KL    +     G    E  P  A+G
Sbjct  475   PS---TYTDKIA---SATSVITDKAIAAKNAVASKLGYSSETTGAGGGVQHETTPRSATG  528

Query  1171  ergkgevegegksvTSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDV  1350
                K            TV   LAP Y+KV   GS +M+K+   G G+    +  E     
Sbjct  529   YGQKV---------AGTVAGTLAPVYEKVKETGSNVMTKLPLSGGGRGAETQQGE-----  574

Query  1351  RTDKGVSIKEFLAEKLKPGEEDKALSDMISGTL  1449
               DKGVS +++  EKL+PGEEDKALS++I+  L
Sbjct  575   --DKGVSTRDYFTEKLRPGEEDKALSEVIAEKL  605



>gb|ACV60548.1| responsive to dessication 29B [Eucalyptus globulus]
Length=235

 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 52/93 (56%), Gaps = 8/93 (9%)
 Frame = +1

Query  628  DFLQPGGLEEDPHAPSDRPRPPSNYESKTFDPTGAGGEEARISPLVQSFEKMEVRGDEAK  807
            +  +PGGLE DP +P  R R PSNY++K  DPT +GGEEA +SP++ S  KM V  DE  
Sbjct  149  NLARPGGLEVDPQSPGSR-REPSNYQTKATDPTASGGEEADVSPVILSIGKMTVH-DETG  206

Query  808  PQQNIRPQAGTHHKLYTGSHDQFAPEPMATNVY  906
                  P++GT   L   +H   +  P  T  +
Sbjct  207  ------PKSGTGQSLPAETHAYVSNVPAGTGSH  233



>ref|XP_006374623.1| hypothetical protein POPTR_0015s13130g, partial [Populus trichocarpa]
 gb|ERP52420.1| hypothetical protein POPTR_0015s13130g, partial [Populus trichocarpa]
Length=356

 Score = 64.3 bits (155),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 45/71 (63%), Gaps = 3/71 (4%)
 Frame = +1

Query  1216  STVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVR-TDKGVSIKEFLAE  1392
             +TV EKL P Y+KV G GST+MSKV G            E  N ++  DKGVS+K++  E
Sbjct  285   ATVTEKLTPVYEKVVGLGSTVMSKVYG--NTNTSTNTSNEADNMIKGKDKGVSVKDYFVE  342

Query  1393  KLKPGEEDKAL  1425
             KL PGEED+AL
Sbjct  343   KLSPGEEDRAL  353



>ref|XP_010473734.1| PREDICTED: low-temperature-induced 65 kDa protein-like, partial 
[Camelina sativa]
Length=576

 Score = 63.5 bits (153),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 92/325 (28%), Positives = 128/325 (39%), Gaps = 109/325 (34%)
 Frame = +1

Query  640   PGGLEEDPHAP---SDRPRPPSNYESKTFDPTGAGGEEARISPLVQSFEKMEVRGDEAKP  810
             P GLEEDP  P   SD     SNY+SK  DPT  GG  A +  + +S  +M+V  DE+  
Sbjct  224   PKGLEEDPAGPGGGSDYLSGVSNYQSKVTDPTREGGV-AGVPEIAESLGRMKVT-DESPG  281

Query  811   QQ-------NIRPQ------------------------AGTHHKLYTGSHDQFAPEPMAT  897
             Q+       ++R Q                              L TG+H+QF+PE    
Sbjct  282   QRTGQGFERDLRSQEFGLKNESGIGKDSPARFGGESGGGLEGRDLPTGTHEQFSPELSRP  341

Query  898   NVYTSSKDT------ESIPKSFDP---------TNPENLPRDPIDGKPQQEGSYAGKMQG  1032
                  S++T      E+ P ++           TN     ++ +  K    G   G  Q 
Sbjct  342   KERGGSEETREEATHETKPSTYTEQFASATSAITNKAIAAKNAVASKLGYSGESGGGGQY  401

Query  1033  EHEAA-----SPVDYAKTAAMAVAEKLAPVYDRVAGAGSAVMEKLPIGAsgergkgeveg  1197
             E         S   Y +T A  VAEKL PVY++V   GS VM KLP+             
Sbjct  402   ESHVKDETPRSATGYGQTVAGTVAEKLTPVYEKVKETGSNVMTKLPL-------------  448

Query  1198  egksvTSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGV-SI  1374
                                 +G GS +    +G                    +KGV S 
Sbjct  449   --------------------SGGGSGVKETQQG-------------------EEKGVSSA  469

Query  1375  KEFLAEKLKPGEEDKALSDMISGTL  1449
             +++L+EKL+PGEEDKALS++IS  L
Sbjct  470   RDYLSEKLRPGEEDKALSEVISEKL  494



>ref|XP_010482580.1| PREDICTED: low-temperature-induced 65 kDa protein-like [Camelina 
sativa]
Length=615

 Score = 63.5 bits (153),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 92/317 (29%), Positives = 132/317 (42%), Gaps = 73/317 (23%)
 Frame = +1

Query  613   GHGRGDFLQPGGLEEDPHAPS---DRPRPPSNYESKTFDPTGAGGEEARISPLVQSFEKM  783
             G  + +   P  LEEDP  P    D     SNY+SK  DPT  GG  A I  + +S  +M
Sbjct  215   GQRKVNIETPKRLEEDPAGPGGGLDYLSGVSNYQSKVTDPTKEGGV-AGIPEIAESLGRM  273

Query  784   EVRGDEAKPQQ-------NIRPQ------------------------AGTHHKLYTGSHD  870
             +V  DE+  Q+       ++R Q                              L TG+HD
Sbjct  274   KVT-DESSGQKTGQGFERDLRSQEFGLKNESGIGKESPARYGGESGGGLEGRDLPTGTHD  332

Query  871   QFAPEPMATNVYTSSKDTESIPKSFDPTNPENLPRDPIDGKPQQEGSYAGKMQGEHEAAS  1050
             QF+PE       +  K+     ++ D    E  P            +Y  +      A +
Sbjct  333   QFSPE------LSRPKERGDTEETRDEATHETKPS-----------TYTEQFASATSAIT  375

Query  1051  PVDYAKTAAMAVAEKLAPVYDRVAGAG--SAVMEKLPIGAsgergkgevegegksvTSTV  1224
               + A  A  AVA KL    +   G    S V ++ P  A+G                TV
Sbjct  376   --NKAIAAKNAVASKLGYYGESGGGGQYESPVKDETPRSATGYGQTVAE---------TV  424

Query  1225  KEKLAPFYDKVAGAGSTLMSKV--KGPGTGQAVVVEGYEEGNDVRTDKGVSIKEFLAEKL  1398
              EKL P Y+KV   GST+M+K+   G G+G     +G E+G         S +++L+EKL
Sbjct  425   AEKLTPVYEKVKETGSTVMTKLPLSGGGSGVKETQQGEEKGVS-----SPSARDYLSEKL  479

Query  1399  KPGEEDKALSDMISGTL  1449
             +PGEEDK LS++I+  L
Sbjct  480   RPGEEDKVLSEVIAEKL  496



>ref|XP_009132533.1| PREDICTED: low-temperature-induced 65 kDa protein-like [Brassica 
rapa]
Length=678

 Score = 63.5 bits (153),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 75/143 (52%), Gaps = 18/143 (13%)
 Frame = +1

Query  1219  TVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEFLAEKL  1398
             TV +KL P Y+KV   GS +M+K+   G G      G EE   V  +KG S +++LAEKL
Sbjct  496   TVADKLTPVYEKVKETGSNVMTKLPLSGGGS-----GAEEKQHV-GEKGASTRDYLAEKL  549

Query  1399  KPGEEDKALSDMISGTL---------LSRQKEETVVEGKPVGKVTESEEVARRLGRIGDS  1551
             +PGEEDKALS++I+  L          + ++ E  VE  P  ++ E  E         D 
Sbjct  550   RPGEEDKALSEVIAEKLHLGGGDKKRTTVKEVEVTVEKIPTDQILEGREQGVSF---TDE  606

Query  1552  PREGSEEKGMVDMLKGAVNSWLG  1620
              +      GMV  +KGAV SWLG
Sbjct  607   GKAVGGGGGMVGKVKGAVTSWLG  629



>ref|XP_006361910.1| PREDICTED: low-temperature-induced 78 kDa protein-like [Solanum 
tuberosum]
Length=207

 Score = 60.1 bits (144),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 77/155 (50%), Gaps = 31/155 (20%)
 Frame = +1

Query  1237  APFYDKVAGAGSTLMSKVKGPG------TGQAVVVEGYEEGN---DVRTDKGVSIKEFLA  1389
             AP  DK A   S   +KV  P        G   +VE +E+ +   + + +KG S+K +LA
Sbjct  35    APKQDKSA---SNYQTKVTDPTGANSEEVGTTPLVESFEKMSVKEETKPEKGASMKNYLA  91

Query  1390  EKLKPGEEDKALSDMISGTLLSRQ-KEETVVEGKPVGKVTES--------EEVARRLG--  1536
             EK KP +EDKALS++ISG L  R+ K E   + KP  KV E+        E VA + G  
Sbjct  92    EKFKPRDEDKALSEVISGKLAGRKDKTEGTEQAKPTEKVKENSTEKMEKPEGVATQKGST  151

Query  1537  ---RIGDSPREGSEE-----KGMVDMLKGAVNSWL  1617
                R+  +    +       K M++ LKG  +SWL
Sbjct  152   DEQRVAPAAAAATTHVEGGGKSMINRLKGVASSWL  186


 Score = 57.4 bits (137),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 46/79 (58%), Gaps = 10/79 (13%)
 Frame = +1

Query  646  GLEEDPHAPSDRPRPPSNYESKTFDPTGAGGEEARISPLVQSFEKMEVRGDEAKPQQNIR  825
             LE+DP+AP  + +  SNY++K  DPTGA  EE   +PLV+SFEKM V+       +  +
Sbjct  28   ALEDDPNAPK-QDKSASNYQTKVTDPTGANSEEVGTTPLVESFEKMSVK-------EETK  79

Query  826  PQAGTHHKLYTGSHDQFAP  882
            P+ G   K Y    ++F P
Sbjct  80   PEKGASMKNYLA--EKFKP  96



>ref|XP_002270855.1| PREDICTED: low-temperature-induced 65 kDa protein [Vitis vinifera]
 emb|CAN62428.1| hypothetical protein VITISV_034842 [Vitis vinifera]
 emb|CBI17084.3| unnamed protein product [Vitis vinifera]
Length=394

 Score = 61.6 bits (148),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 50/88 (57%), Gaps = 6/88 (7%)
 Frame = +1

Query  1213  TSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVV-----EGYEEGNDVRTDKGVSIK  1377
             T TV EKLAP Y  VA A  T+ SK++G     A         G      +  DKGVS+K
Sbjct  167   TETVTEKLAPAYATVAEATQTIASKIQGLTVAAATSTPTTGGNGSSSEQQIW-DKGVSVK  225

Query  1378  EFLAEKLKPGEEDKALSDMISGTLLSRQ  1461
             E+L  KL+PGE+++ALS +IS  +  R+
Sbjct  226   EYLMNKLEPGEDERALSQVISDAISPRK  253



>emb|CDY52364.1| BnaA08g30990D [Brassica napus]
Length=222

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 44/72 (61%), Gaps = 5/72 (7%)
 Frame = +1

Query  1234  LAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEFLAEKLKPGEE  1413
             + P Y+KV G G+ +M K+   G G    +E     N    DKG+S KE+L EKL PGEE
Sbjct  139   VTPVYEKVKGTGAIVMKKLPFSGHGTGTKME-----NQQGQDKGISAKEYLKEKLSPGEE  193

Query  1414  DKALSDMISGTL  1449
             DKALS++++  L
Sbjct  194   DKALSEVVTEKL  205



>gb|ACA49510.1| desiccation-related protein LbLEA-like_11-24 [Lindernia brevidens]
Length=164

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 68/136 (50%), Gaps = 33/136 (24%)
 Frame = +1

Query  1222  VKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEFLAEKLK  1401
             V EKLAP Y KV+GAG+ ++S+V+G G G+        +G D    KG     +L+EKLK
Sbjct  27    VAEKLAPVYGKVSGAGTGVISRVRGTGAGEQT------QGGD-EAAKG----SYLSEKLK  75

Query  1402  PGEEDKALSDMISGTLLSRQKEETVVEGKPVGKVTESEEVARRLGRIGDSPREGSEEKGM  1581
             PG+EDKALS  I+  L     + T  E K     TE+            SP       G+
Sbjct  76    PGDEDKALSKAITEKLQLTGNKPTADESKA---ATEA------------SP-------GV  113

Query  1582  VDMLKGAVNSWLGRDS  1629
             V  +KG V S LG  S
Sbjct  114   VGSIKGVVGSLLGGKS  129



>gb|KDO39281.1| hypothetical protein CISIN_1g016497mg [Citrus sinensis]
Length=388

 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/172 (28%), Positives = 71/172 (41%), Gaps = 59/172 (34%)
 Frame = +1

Query  1213  TSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGN-----------DVRT-  1356
             T TV EKLAP Y  V+ A   + SK++G         E  E+ N           D +T 
Sbjct  214   TETVTEKLAPAYATVSDATHAIASKIQGLTVSTPTASESNEQDNLATLKQATSETDTKTN  273

Query  1357  --------------DKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEETVVEGKPV  1494
                           DKGVS+KE++  K +PGEE++ALS +I+  +               
Sbjct  274   PETEKQGSPTGQKWDKGVSVKEYIKHKFEPGEEERALSKVITDVM---------------  318

Query  1495  GKVTESEEVARRLGRIGDSPREGSEEKGMVDMLKGAVNSWLGRDSQPQTTDT  1650
                               SP+    E G+V  +K AV S+L ++  PQ++ T
Sbjct  319   ------------------SPKRSPREVGVVGKMKEAVTSFLWQEESPQSSVT  352



>emb|CDP09099.1| unnamed protein product [Coffea canephora]
Length=643

 Score = 62.0 bits (149),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 50/169 (30%), Positives = 71/169 (42%), Gaps = 59/169 (35%)
 Frame = +1

Query  1213  TSTVKEKLAPFYDKVAGAGSTLMSKVKG--------------PGTGQ--AVVVEGYEEGN  1344
             T TV EKLAP Y KV+ A   + SK+ G              P T    A  V+  +  +
Sbjct  227   TETVSEKLAPAYAKVSDATQLIASKIAGLTISSPEDQEKHANPDTEHLPADDVKNIDRSS  286

Query  1345  DVR----------TDKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEETVVEGKPV  1494
             ++R           DKGVS+KE+   KL+PGE+D+ALS  IS  +               
Sbjct  287   EIREHLGNLSPQQWDKGVSVKEYFMNKLEPGEDDRALSQAISEAI---------------  331

Query  1495  GKVTESEEVARRLGRIGDSPREGSEEKGMVDMLKGAVNSWLGRDSQPQT  1641
                               SPR+   + GMV+ ++ AV S+L  D  P +
Sbjct  332   ------------------SPRKSPRDMGMVEKVREAVTSFLRHDEHPHS  362



>ref|XP_008465872.1| PREDICTED: low-temperature-induced 65 kDa protein [Cucumis melo]
Length=346

 Score = 60.8 bits (146),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 60/105 (57%), Gaps = 22/105 (21%)
 Frame = +1

Query  1363  GVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEETVVEGKPV-------GKVTESEEV  1521
             G  I   + EKLKPGEED+ALS++IS   L+R+K+E V  G+         G VTESEE+
Sbjct  198   GKKIALTVTEKLKPGEEDRALSEVIS-EALNRRKDEVVKVGESAFGRPPSKGVVTESEEL  256

Query  1522  ARRLGRIGDSPREGSEE-----------KGMVDMLKGAVNSWLGR  1623
              RRL   G+  +E +E+           + +V M+K  V SWLG+
Sbjct  257   TRRL---GEEDKEATEKSSVASAAAATGRSVVGMVKDTVGSWLGK  298


 Score = 53.9 bits (128),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 70/158 (44%), Gaps = 19/158 (12%)
 Frame = +1

Query  634   LQPGGLEEDPHAPSDRPRPPSNYESKTFDPTGAGGEEAR-ISPLVQSFEKMEVRGDEAKP  810
             L P  LEEDPH P D PR P   E K  DP+  G EEA   S +  SF KM+V  D+ KP
Sbjct  72    LSPWKLEEDPHGPKD-PRAPHISEVKVHDPSNRGSEEAAGKSQVFDSFAKMKV--DDKKP  128

Query  811   QQNIRPQAGTHHKLYTGSHDQFAPEPMATNVYTSSKDTESIPKSFDPTNPENLPRDPIDG  990
              +   P  G   +     H  +A +  A     S K   +          ++     +  
Sbjct  129   NRTGSPH-GLDQEHGGEDHINYAQKISAVGSAVSGKAVAA----------KDFVASKLGY  177

Query  991   KPQQEGSYAGKMQGEHEAASPVDYAKTAAMAVAEKLAP  1104
                +EG+ A K      ++SP++Y K  A+ V EKL P
Sbjct  178   GETKEGTTADKSS----SSSPLEYGKKIALTVTEKLKP  211



>gb|KGN60472.1| hypothetical protein Csa_3G914030 [Cucumis sativus]
Length=345

 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 74/151 (49%), Gaps = 20/151 (13%)
 Frame = +1

Query  1363  GVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEETVVEGKPV-------GKVTESEEV  1521
             G  I   + EKLKPGEED+ALS++IS    +R+K+E V  G+         G+VTESEE+
Sbjct  197   GKKIALTVTEKLKPGEEDRALSEVIS-EAWTRRKDEVVKVGESAFGRPPSKGEVTESEEL  255

Query  1522  ARRLGRIGDSPREGSEE--------KGMVDMLKGAVNSWLGR---DSQPQTTDTTNVRNE  1668
              RRLG+      E S          + +V M+K  V SWLG     S P        +  
Sbjct  256   TRRLGKEDKEATEKSSVARAAAATGRSVVGMVKDTVGSWLGNAGEQSVPSQQSLGTSQGV  315

Query  1669  EVGHQSAVGERRLEHQDAMAEGRSRLQESGH  1761
             E    S+   R+ EH    AE R RLQ S +
Sbjct  316   EGFVDSSSSRRQAEHGGKGAEVR-RLQGSAN  345



>ref|XP_004162420.1| PREDICTED: uncharacterized LOC101214579 [Cucumis sativus]
Length=442

 Score = 60.1 bits (144),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 74/151 (49%), Gaps = 20/151 (13%)
 Frame = +1

Query  1363  GVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEETVVEGKPV-------GKVTESEEV  1521
             G  I   + EKLKPGEED+ALS++IS    +R+K+E V  G+         G+VTESEE+
Sbjct  294   GKKIALTVTEKLKPGEEDRALSEVIS-EAWTRRKDEVVKVGESAFGRPPSKGEVTESEEL  352

Query  1522  ARRLGRIGDSPREGSEE--------KGMVDMLKGAVNSWLGR---DSQPQTTDTTNVRNE  1668
              RRLG+      E S          + +V M+K  V SWLG     S P        +  
Sbjct  353   TRRLGKEDKEATEKSSVARAAAATGRSVVGMVKDTVGSWLGNAGEQSVPSQQSLGTSQGV  412

Query  1669  EVGHQSAVGERRLEHQDAMAEGRSRLQESGH  1761
             E    S+   R+ EH    AE R RLQ S +
Sbjct  413   EGFVDSSSSRRQAEHGGKGAEVR-RLQGSAN  442



>ref|XP_010326296.1| PREDICTED: low-temperature-induced 78 kDa protein-like isoform 
X2 [Solanum lycopersicum]
Length=190

 Score = 57.4 bits (137),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 56/159 (35%), Positives = 81/159 (51%), Gaps = 27/159 (17%)
 Frame = +1

Query  1237  APFYDKVAGAGSTLMSKVKGPGTGQAV----VVEGYEEGN---DVRTDKGVSIKEFLAEK  1395
             AP  DK A   S   +KV  P   + V    +VE +E+ +   + +  KGVS+K +LAEK
Sbjct  35    APKEDKSA---SNYQTKVTDPTDSEEVGATPLVESFEKMSVKEETKPVKGVSMKNYLAEK  91

Query  1396  LKPGEEDKALSDMISGTLLSRQKEETVVEGKPVGKVTESEE---VARRLGRIGDSPREGS  1566
              KP +EDKALS+MIS  L  R+ +    EG    + TE+E+   VA + G   D  R+ +
Sbjct  92    FKPRDEDKALSEMISVKLSGRKDK---TEGSEQVEPTETEKPEGVATQKGST-DEQRDAA  147

Query  1567  EE----------KGMVDMLKGAVNSWLGRDSQPQTTDTT  1653
                         K M++ LKG  +SWL +    QT  +T
Sbjct  148   AVPATTHVEGAGKSMINRLKGVASSWLHKAPPAQTPTST  186



>emb|CDY54087.1| BnaC08g47270D [Brassica napus]
Length=224

 Score = 57.8 bits (138),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 43/72 (60%), Gaps = 5/72 (7%)
 Frame = +1

Query  1234  LAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEFLAEKLKPGEE  1413
             + P Y+KV G G+ +M K+   G G    +E     N    DKG+S KE+L EKL PGE 
Sbjct  137   VTPVYEKVKGTGAIVMKKLPFSGHGTGTKME-----NQQGQDKGISAKEYLTEKLSPGEG  191

Query  1414  DKALSDMISGTL  1449
             DKALS++++  L
Sbjct  192   DKALSEVVTQKL  203



>ref|XP_008794540.1| PREDICTED: low-temperature-induced 65 kDa protein-like isoform 
X1 [Phoenix dactylifera]
Length=406

 Score = 59.3 bits (142),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 70/129 (54%), Gaps = 26/129 (20%)
 Frame = +1

Query  1243  FYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGN-DVRTDKG--VSIKEFLAEKLKPGEE  1413
              Y+KVA AG+ +  KV+   +G      G E G+     DKG  VS++E+LAEKL+PGEE
Sbjct  261   VYEKVAEAGTAVKGKVQQKPSGTT----GTEGGDPTAAQDKGMGVSVREYLAEKLRPGEE  316

Query  1414  DKALSDMISGTLLSRQKEETVVEGKPVGKVTESEEVARRLGRIGDSPREGSEEKGMVDML  1593
             DKALS++ISG    R++E    EG P  +VT S                     G+V+ +
Sbjct  317   DKALSEVISGVFHKREEE---AEGGP--EVTGSGARGGG--------------AGVVEKI  357

Query  1594  KGAVNSWLG  1620
             +GAV S +G
Sbjct  358   RGAVTSLVG  366



>gb|KGN65746.1| hypothetical protein Csa_1G524680 [Cucumis sativus]
Length=550

 Score = 59.7 bits (143),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 63/140 (45%), Gaps = 30/140 (21%)
 Frame = +1

Query  1213  TSTVKEKLAPFYDKVAGAGSTLMSKVKG-----------PGTGQAVVVEG----------  1329
             T TV EKLAP Y  V  A   + SK++            P    +  ++           
Sbjct  206   TETVTEKLAPVYSTVTDATHAIASKIQSLTISAPSDSSTPKKASSPTIQSSDPIATQAPS  265

Query  1330  YEEGNDVRTDKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEETVVEGKP-VGKVT  1506
               +G +   DKGVS+KE+L  K +PGE+++ALS ++S  L  R         KP VG V 
Sbjct  266   LNKGTEQVWDKGVSVKEYLMHKFEPGEDERALSQVLSDALSPR--------AKPGVGVVE  317

Query  1507  ESEEVARRLGRIGDSPREGS  1566
             +  E    + R GD P+  S
Sbjct  318   KVREAVNSMLRAGDEPQPKS  337



>ref|XP_008794541.1| PREDICTED: low-temperature-induced 65 kDa protein-like isoform 
X2 [Phoenix dactylifera]
Length=403

 Score = 59.3 bits (142),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 70/129 (54%), Gaps = 26/129 (20%)
 Frame = +1

Query  1243  FYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGN-DVRTDKG--VSIKEFLAEKLKPGEE  1413
              Y+KVA AG+ +  KV+   +G      G E G+     DKG  VS++E+LAEKL+PGEE
Sbjct  258   VYEKVAEAGTAVKGKVQQKPSG----TTGTEGGDPTAAQDKGMGVSVREYLAEKLRPGEE  313

Query  1414  DKALSDMISGTLLSRQKEETVVEGKPVGKVTESEEVARRLGRIGDSPREGSEEKGMVDML  1593
             DKALS++ISG    R++E    EG P  +VT S                     G+V+ +
Sbjct  314   DKALSEVISGVFHKREEE---AEGGP--EVTGSGARGGG--------------AGVVEKI  354

Query  1594  KGAVNSWLG  1620
             +GAV S +G
Sbjct  355   RGAVTSLVG  363



>ref|XP_004145331.1| PREDICTED: uncharacterized protein LOC101208083 [Cucumis sativus]
Length=571

 Score = 59.3 bits (142),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 63/140 (45%), Gaps = 30/140 (21%)
 Frame = +1

Query  1213  TSTVKEKLAPFYDKVAGAGSTLMSKVKG-----------PGTGQAVVVEG----------  1329
             T TV EKLAP Y  V  A   + SK++            P    +  ++           
Sbjct  206   TETVTEKLAPVYSTVTDATHAIASKIQSLTISAPSDSSTPKKASSPTIQSSDPIATQAPS  265

Query  1330  YEEGNDVRTDKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEETVVEGKP-VGKVT  1506
               +G +   DKGVS+KE+L  K +PGE+++ALS ++S  L  R         KP VG V 
Sbjct  266   LNKGTEQVWDKGVSVKEYLMHKFEPGEDERALSQVLSDALSPR--------AKPGVGVVE  317

Query  1507  ESEEVARRLGRIGDSPREGS  1566
             +  E    + R GD P+  S
Sbjct  318   KVREAVNSMLRAGDEPQPKS  337



>ref|XP_006846301.1| hypothetical protein AMTR_s00012p00252930 [Amborella trichopoda]
 gb|ERN07976.1| hypothetical protein AMTR_s00012p00252930 [Amborella trichopoda]
Length=282

 Score = 57.8 bits (138),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 49/141 (35%), Positives = 68/141 (48%), Gaps = 36/141 (26%)
 Frame = +1

Query  1213  TSTVKEKLAPFYDKVAGAGSTLM-SKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEFLA  1389
             T TV + LAP Y KV+ A S L+ S +  P      V    E G   + DKGVS+KE+L 
Sbjct  151   TETVTDMLAPAYAKVSEAASNLVASTINSP----RAVNTSQELGGKQKWDKGVSMKEYLR  206

Query  1390  EKLKPGEEDKALSDMISGTLLSRQKEETVVEGKPVGKVTESEEVARRLGRIGDSPREGSE  1569
              KL+PG+E++ALS +I+  +             P           RR+ R GD       
Sbjct  207   HKLEPGQEERALSQVITEAI------------SP-----------RRVARDGD-------  236

Query  1570  EKGMVDMLKGAVNSWLGRDSQ  1632
              KG+V+ +K AV S L  + Q
Sbjct  237   -KGVVEKVKEAVTSLLWVEEQ  256



>ref|XP_004173885.1| PREDICTED: uncharacterized LOC101208083, partial [Cucumis sativus]
Length=378

 Score = 58.5 bits (140),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 62/137 (45%), Gaps = 30/137 (22%)
 Frame = +1

Query  1213  TSTVKEKLAPFYDKVAGAGSTLMSKVKG-----------PGTGQAVVVEG----------  1329
             T TV EKLAP Y  V  A   + SK++            P    +  ++           
Sbjct  206   TETVTEKLAPVYSTVTDATHAIASKIQSLTISAPSDSSTPKKASSPTIQSSDPIATQAPS  265

Query  1330  YEEGNDVRTDKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEETVVEGKP-VGKVT  1506
               +G +   DKGVS+KE+L  K +PGE+++ALS ++S  L  R         KP VG V 
Sbjct  266   LNKGTEQVWDKGVSVKEYLMHKFEPGEDERALSQVLSDALSPR--------AKPGVGVVE  317

Query  1507  ESEEVARRLGRIGDSPR  1557
             +  E    + R GD P+
Sbjct  318   KVREAVNSMLRAGDEPQ  334



>ref|XP_004148379.1| PREDICTED: uncharacterized protein LOC101214579 [Cucumis sativus]
Length=533

 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 74/151 (49%), Gaps = 20/151 (13%)
 Frame = +1

Query  1363  GVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEETVVEGKPV-------GKVTESEEV  1521
             G  I   + EKLKPGEED+ALS++IS    +R+K+E V  G+         G+VTESEE+
Sbjct  385   GKKIALTVTEKLKPGEEDRALSEVIS-EAWTRRKDEVVKVGESAFGRPPSKGEVTESEEL  443

Query  1522  ARRLGRIGDSPREGSEE--------KGMVDMLKGAVNSWLGR---DSQPQTTDTTNVRNE  1668
              RRLG+      E S          + +V M+K  V SWLG     S P        +  
Sbjct  444   TRRLGKEDKEATEKSSVARAAAATGRSVVGMVKDTVGSWLGNAGEQSVPSQQSLGTSQGV  503

Query  1669  EVGHQSAVGERRLEHQDAMAEGRSRLQESGH  1761
             E    S+   R+ EH    AE R RLQ S +
Sbjct  504   EGFVDSSSSRRQAEHGGKGAEVR-RLQGSAN  533



>ref|XP_009385275.1| PREDICTED: uncharacterized protein LOC103972656, partial [Musa 
acuminata subsp. malaccensis]
Length=351

 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 45/80 (56%), Gaps = 7/80 (9%)
 Frame = +1

Query  1219  TVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEFLAEKL  1398
             TV E LAP Y  ++ A   L SK++  G         YE       DKGVS+KE+L +KL
Sbjct  230   TVTETLAPVYTMISKATQALSSKIQESG-------PRYETTAKQVWDKGVSMKEYLMQKL  282

Query  1399  KPGEEDKALSDMISGTLLSR  1458
             +P EEDKAL D+I+  +  R
Sbjct  283   EPREEDKALRDVITDAVTPR  302



>ref|XP_009779629.1| PREDICTED: uncharacterized protein LOC104228788 [Nicotiana sylvestris]
 ref|XP_009779630.1| PREDICTED: uncharacterized protein LOC104228788 [Nicotiana sylvestris]
Length=412

 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 48/172 (28%), Positives = 70/172 (41%), Gaps = 60/172 (35%)
 Frame = +1

Query  1213  TSTVKEKLAPFYDKVAGAGSTLMSKVKG-----------------PGTGQAVVVEGYEEG  1341
             T TV EKLAP Y  V+ A   + SK  G                 P TG        + G
Sbjct  172   TETVTEKLAPAYAAVSDATHAIASKFSGLTLTNSNEQESGNQHAAPKTGHFAESNASKLG  231

Query  1342  NDV-----------RTDKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEETVVEGK  1488
              +V           + DKGVS+KE+  EK +PGE +++LS +I+  +  RQ         
Sbjct  232   QNVEQNASGISSPGKWDKGVSVKEYFVEKFEPGEGERSLSQIITEAMSPRQA--------  283

Query  1489  PVGKVTESEEVARRLGRIGDSPREGSEEKGMVDMLKGAVNSWLGRDSQPQTT  1644
                                      S +KG+V+ +KGAV S++  D  P++T
Sbjct  284   ------------------------ASGDKGIVEKMKGAVTSFIRPDDSPKST  311



>emb|CDY38913.1| BnaA03g12660D [Brassica napus]
Length=591

 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 52/138 (38%), Positives = 71/138 (51%), Gaps = 18/138 (13%)
 Frame = +1

Query  1234  LAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEFLAEKLKPGEE  1413
             L P Y+KV   GS +M+K+   G G      G EE   V  +KG S +++LAEKL+PGEE
Sbjct  414   LTPVYEKVKETGSNVMTKLPLSGGGS-----GAEEKQHV-GEKGASTRDYLAEKLRPGEE  467

Query  1414  DKALSDMISGTL---------LSRQKEETVVEGKPVGKVTESEEVARRLGRIGDSPREGS  1566
             DKALS++I+  L          + ++ E  VE  P  ++ E  E         D  +   
Sbjct  468   DKALSEVIAEKLHLGGGDKKRTTVKEVEVTVEKIPTDQILEGREQGVSF---TDEGKAVG  524

Query  1567  EEKGMVDMLKGAVNSWLG  1620
                GMV  +KGAV SWLG
Sbjct  525   GGGGMVGKVKGAVTSWLG  542



>ref|XP_010326274.1| PREDICTED: low-temperature-induced 65 kDa protein-like isoform 
X1 [Solanum lycopersicum]
Length=192

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 41/58 (71%), Gaps = 2/58 (3%)
 Frame = +1

Query  649  LEEDPHAPSDRPRPPSNYESKTFDPTGAGGEEARISPLVQSFEKMEVRGDEAKPQQNI  822
            LE+DP+AP +  +  SNY++K  DPTGA  EE   +PLV+SFEKM V+ +E KP + +
Sbjct  29   LEDDPNAPKED-KSASNYQTKVTDPTGANSEEVGATPLVESFEKMSVK-EETKPVKGV  84


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 54/158 (34%), Positives = 80/158 (51%), Gaps = 23/158 (15%)
 Frame = +1

Query  1237  APFYDKVAGAGSTLMSKVKGPGT---GQAVVVEGYEEGN---DVRTDKGVSIKEFLAEKL  1398
             AP  DK A    T ++   G  +   G   +VE +E+ +   + +  KGVS+K +LAEK 
Sbjct  35    APKEDKSASNYQTKVTDPTGANSEEVGATPLVESFEKMSVKEETKPVKGVSMKNYLAEKF  94

Query  1399  KPGEEDKALSDMISGTLLSRQKEETVVEGKPVGKVTESEE---VARRLGRIGDSPREGSE  1569
             KP +EDKALS+MIS  L  R+ +    EG    + TE+E+   VA + G   D  R+ + 
Sbjct  95    KPRDEDKALSEMISVKLSGRKDK---TEGSEQVEPTETEKPEGVATQKGST-DEQRDAAA  150

Query  1570  E----------KGMVDMLKGAVNSWLGRDSQPQTTDTT  1653
                        K M++ LKG  +SWL +    QT  +T
Sbjct  151   VPATTHVEGAGKSMINRLKGVASSWLHKAPPAQTPTST  188



>ref|XP_006424892.1| hypothetical protein CICLE_v10029821mg, partial [Citrus clementina]
 gb|ESR38132.1| hypothetical protein CICLE_v10029821mg, partial [Citrus clementina]
Length=342

 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 70/172 (41%), Gaps = 59/172 (34%)
 Frame = +1

Query  1213  TSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGN-----------DVRT-  1356
             T TV EKLAP Y  ++ A   + SK++G         E  E+ N           D +T 
Sbjct  182   TETVTEKLAPAYATLSDATHAIASKIQGLTVSTPTASESNEQDNLATLKQATSETDKKTN  241

Query  1357  --------------DKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEETVVEGKPV  1494
                           DKGVS+KE++  K +PGEE++ALS +I+  +               
Sbjct  242   PETEKQGSPTGQKWDKGVSVKEYIKHKFEPGEEERALSKVITDVM---------------  286

Query  1495  GKVTESEEVARRLGRIGDSPREGSEEKGMVDMLKGAVNSWLGRDSQPQTTDT  1650
                               SP+    E G+V  +K AV S+L ++  PQ+  T
Sbjct  287   ------------------SPKRSPREVGVVGKMKEAVTSFLWQEESPQSLVT  320



>ref|XP_003638372.1| Low-temperature-induced 65 kDa protein [Medicago truncatula]
Length=808

 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 61/106 (58%), Gaps = 7/106 (7%)
 Frame = +1

Query  1327  GYEEGNDVRT-DKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEETVVEGKPVGKV  1503
             G  EG + +  DKG S+K++LAEKL+P EEDKALS+++S   L + KEE +   K  G +
Sbjct  675   GSNEGTETKNGDKGASVKDYLAEKLRPSEEDKALSEVVS-EALHKGKEEPL--KKEDGIL  731

Query  1504  TESEEVARRLGRIGDSPREGSEEKGMVDMLKGAVNSWLGRDSQPQT  1641
                +E + ++    ++   G   KGMVD +K    SW  +  + Q+
Sbjct  732   ASEDEKSEKVLEESNANSSG---KGMVDRVKDYYGSWFAKPEENQS  774



>ref|XP_009411251.1| PREDICTED: uncharacterized protein LOC103993050 [Musa acuminata 
subsp. malaccensis]
Length=333

 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 56/116 (48%), Gaps = 12/116 (10%)
 Frame = +1

Query  1219  TVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEFLAEKL  1398
             TV E L P Y  V+ A   + SK +G      +V +          DKGVS+KE+L +KL
Sbjct  218   TVTEMLTPAYAAVSEATQAIASKFQGSSPRYEMVAKQV-------WDKGVSMKEYLMQKL  270

Query  1399  KPGEEDKALSDMISGTLLSRQKEETVVEGKPVGKVTESEEVARRLGRIGDSPREGS  1566
             +PGEED+AL ++I+G +  R       E    G V   EE    L   G    EGS
Sbjct  271   EPGEEDRALCEVITGAVSPRNVSHGCAEA---GAVKTREEAVSSL--TGKEESEGS  321



>ref|XP_003638373.1| Low-temperature-induced 65 kDa protein [Medicago truncatula]
Length=595

 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 58/100 (58%), Gaps = 7/100 (7%)
 Frame = +1

Query  1327  GYEEGNDVRT-DKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEETVVEGKPVGKV  1503
             G  EG + +  DKG S+K++LAEKL+P EEDKALS+++S   L + KEE +   K  G +
Sbjct  462   GSNEGTETKNGDKGASVKDYLAEKLRPSEEDKALSEVVSE-ALHKGKEEPL--KKEDGIL  518

Query  1504  TESEEVARRLGRIGDSPREGSEEKGMVDMLKGAVNSWLGR  1623
                +E + ++    ++   G   KGMVD +K    SW  +
Sbjct  519   ASEDEKSEKVLEESNANSSG---KGMVDRVKDYYGSWFAK  555



>ref|XP_009622243.1| PREDICTED: uncharacterized protein LOC104113696 [Nicotiana tomentosiformis]
Length=401

 Score = 58.2 bits (139),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 71/171 (42%), Gaps = 56/171 (33%)
 Frame = +1

Query  1213  TSTVKEKLAPFYDKVAGAGSTLMSKVKG-----------------PGTGQAVVVEGYEEG  1341
             T TV EKLAP Y  V+ A   + SK  G                 P TG        + G
Sbjct  170   TETVTEKLAPAYAAVSDATHAIASKFSGLTLTNSNEQESGNQHAAPKTGHFAESNVNKLG  229

Query  1342  NDV-------RTDKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEETVVEGKPVGK  1500
              +        + DKGVS+KE+  EK +PGE +++LS +I+  +  RQ             
Sbjct  230   QNASGISSPGKWDKGVSVKEYFVEKFEPGEGERSLSQIITEAMSPRQA------------  277

Query  1501  VTESEEVARRLGRIGDSPREGSEEKGMVDMLKGAVNSWLGRDSQPQTTDTT  1653
                                  S +KG+V+ +KGAV S++  D  P++T+ +
Sbjct  278   --------------------ASGDKGIVEKMKGAVTSFIRTDDSPKSTENS  308



>gb|KEH43709.1| hypothetical protein MTR_1g100623 [Medicago truncatula]
Length=829

 Score = 58.5 bits (140),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 61/106 (58%), Gaps = 7/106 (7%)
 Frame = +1

Query  1327  GYEEGNDVRT-DKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEETVVEGKPVGKV  1503
             G  EG + +  DKG S+K++LAEKL+P EEDKALS+++S   L + KEE +   K  G +
Sbjct  696   GSNEGTETKNGDKGASVKDYLAEKLRPSEEDKALSEVVSE-ALHKGKEEPL--KKEDGIL  752

Query  1504  TESEEVARRLGRIGDSPREGSEEKGMVDMLKGAVNSWLGRDSQPQT  1641
                +E + ++    ++   G   KGMVD +K    SW  +  + Q+
Sbjct  753   ASEDEKSEKVLEESNANSSG---KGMVDRVKDYYGSWFAKPEENQS  795



>gb|KEH43708.1| hypothetical protein MTR_1g100623 [Medicago truncatula]
Length=781

 Score = 58.5 bits (140),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 61/106 (58%), Gaps = 7/106 (7%)
 Frame = +1

Query  1327  GYEEGNDVRT-DKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEETVVEGKPVGKV  1503
             G  EG + +  DKG S+K++LAEKL+P EEDKALS+++S   L + KEE +   K  G +
Sbjct  648   GSNEGTETKNGDKGASVKDYLAEKLRPSEEDKALSEVVSE-ALHKGKEEPL--KKEDGIL  704

Query  1504  TESEEVARRLGRIGDSPREGSEEKGMVDMLKGAVNSWLGRDSQPQT  1641
                +E + ++    ++   G   KGMVD +K    SW  +  + Q+
Sbjct  705   ASEDEKSEKVLEESNANSSG---KGMVDRVKDYYGSWFAKPEENQS  747



>ref|XP_006488670.1| PREDICTED: muscle M-line assembly protein unc-89-like [Citrus 
sinensis]
Length=394

 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 70/172 (41%), Gaps = 59/172 (34%)
 Frame = +1

Query  1213  TSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGN-----------DVRT-  1356
             T TV EKLAP Y  ++ A   + SK++G         E  E+ N           D +T 
Sbjct  214   TETVTEKLAPAYATLSDATHAIASKIQGLTVSTPTASESNEQDNLATLKQATSETDKKTN  273

Query  1357  --------------DKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEETVVEGKPV  1494
                           DKGVS+KE++  K +PGEE++ALS +I+  +               
Sbjct  274   PETEKQGSPTGQKWDKGVSVKEYIKHKFEPGEEERALSKVITDVM---------------  318

Query  1495  GKVTESEEVARRLGRIGDSPREGSEEKGMVDMLKGAVNSWLGRDSQPQTTDT  1650
                               SP+    E G+V  +K AV S+L ++  PQ+  T
Sbjct  319   ------------------SPKRSPREVGVVGKMKEAVTSFLWQEESPQSLVT  352



>ref|XP_008457449.1| PREDICTED: low-temperature-induced 65 kDa protein isoform X1 
[Cucumis melo]
Length=567

 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 82/187 (44%), Gaps = 34/187 (18%)
 Frame = +1

Query  1021  KMQGEHEAASPVDYAKTAAMAVAEKLAPVYDRVAGAGSAV---MEKLPIGAsgergkgev  1191
             K+  E E A P    KT    + EKLAPVY  V  A  A+   ++ L I +         
Sbjct  188   KIIQEKEVAKPSSPNKTLTETMTEKLAPVYSTVTDATHAIASKIQSLTISSPSNSSTRSS  247

Query  1192  egegksvTS-TVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGV  1368
                 K  +S T+K   +   D +A    +L                   +G +   DKGV
Sbjct  248   PSTPKKASSLTIKTTCS---DPIATQSPSL------------------SKGTEQIWDKGV  286

Query  1369  SIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEETVVEGKP-VGKVTESEEVARRLGRIG  1545
             S+KE+L  K +PGE+++ALS ++S  L  R         KP +G V +  E    + R G
Sbjct  287   SVKEYLMHKFEPGEDERALSQVLSDALSPR--------AKPGIGVVEKVREAVNSMLRAG  338

Query  1546  DSPREGS  1566
             D+P++ S
Sbjct  339   DAPQQKS  345



>gb|AAC49998.1| cold acclimation protein [Spinacia oleracea]
 gb|AAC49999.1| cold acclimation protein [Spinacia oleracea]
Length=780

 Score = 57.8 bits (138),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 55/90 (61%), Gaps = 10/90 (11%)
 Frame = +1

Query  1357  DKGVSIKEFLAEKLKPGEEDKALSDMISGTL---LSRQKEETVVEGKPVGKVTESEEVAR  1527
             DKGV++KE+L EKLKPGE+DKALS++I+  L   L + KEE V     +G+V E +EV +
Sbjct  604   DKGVAVKEYLVEKLKPGEDDKALSEVITEALPSPLHKPKEEGVT---IIGRVAEPKEVVQ  660

Query  1528  RLGRI----GDSPREGSEEKGMVDMLKGAV  1605
              +  I     D    G ++K + + + G V
Sbjct  661   MIDHIEEKNDDGIVMGEDDKAVFEAVVGKV  690



>ref|XP_008457450.1| PREDICTED: low-temperature-induced 65 kDa protein isoform X2 
[Cucumis melo]
Length=556

 Score = 57.4 bits (137),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 82/187 (44%), Gaps = 34/187 (18%)
 Frame = +1

Query  1021  KMQGEHEAASPVDYAKTAAMAVAEKLAPVYDRVAGAGSAV---MEKLPIGAsgergkgev  1191
             K+  E E A P    KT    + EKLAPVY  V  A  A+   ++ L I +         
Sbjct  188   KIIQEKEVAKPSSPNKTLTETMTEKLAPVYSTVTDATHAIASKIQSLTISSPSNSSTRSS  247

Query  1192  egegksvTS-TVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGV  1368
                 K  +S T+K   +   D +A    +L                   +G +   DKGV
Sbjct  248   PSTPKKASSLTIKTTCS---DPIATQSPSL------------------SKGTEQIWDKGV  286

Query  1369  SIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEETVVEGKP-VGKVTESEEVARRLGRIG  1545
             S+KE+L  K +PGE+++ALS ++S  L  R         KP +G V +  E    + R G
Sbjct  287   SVKEYLMHKFEPGEDERALSQVLSDALSPR--------AKPGIGVVEKVREAVNSMLRAG  338

Query  1546  DSPREGS  1566
             D+P++ S
Sbjct  339   DAPQQKS  345



>ref|XP_009398835.1| PREDICTED: low-temperature-induced 65 kDa protein-like [Musa 
acuminata subsp. malaccensis]
Length=290

 Score = 56.2 bits (134),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 63/125 (50%), Gaps = 28/125 (22%)
 Frame = +1

Query  1246  YDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEFLAEKLKPGEEDKAL  1425
             Y+ VA AG+ ++ KV+          +   EG  VR   GV +K  LAEKLKPGEEDKAL
Sbjct  158   YEAVAEAGACVIEKVQQG--------DSSTEGGSVRVGSGVRVK--LAEKLKPGEEDKAL  207

Query  1426  SDMISGTLLSRQKEETVVEGKPVGKVTESEEVARRLGRIGDSPREGSEEKGMVDMLKGAV  1605
              ++IS  +  R++       +    VT+S   + +L              GM+  L+GAV
Sbjct  208   CEVISDAIRKRREGAE----EAAAAVTDSNAKSGKL--------------GMMGRLRGAV  249

Query  1606  NSWLG  1620
              SW+G
Sbjct  250   PSWVG  254



>ref|XP_002314161.2| hypothetical protein POPTR_0009s04010g [Populus trichocarpa]
 gb|EEE88116.2| hypothetical protein POPTR_0009s04010g [Populus trichocarpa]
Length=367

 Score = 55.8 bits (133),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 84/202 (42%), Gaps = 54/202 (27%)
 Frame = +1

Query  1057  DYAKTAAMAVAEKLAPVYDRVAGAGSAVMEK---LPIG---AsgergkgevegegksvTS  1218
             +++KT +  +AEKLAP Y  V+ A  A+  K   L I    AS   G         S + 
Sbjct  176   NFSKTLSEIMAEKLAPAYATVSDATHAITSKIQSLEISTPEASDATGLDPAGKGKASSSV  235

Query  1219  TVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYE-EGNDVRTDKGVSIKEFLAEK  1395
              V  K+AP  D+VA            P         GY     + + DKGVS+KE++  K
Sbjct  236   AVPTKVAP--DQVAS----------DPARAPTDAASGYHFRTGEQKWDKGVSVKEYIIHK  283

Query  1396  LKPGEEDKALSDMISGTLLSRQKEETVVEGKPVGKVTESEEVARRLGRIGDSPREGSEEK  1575
              +PGE+D+ALS +IS  +                                 SPR+ +   
Sbjct  284   FEPGEDDRALSQVISQAI---------------------------------SPRKAAGNV  310

Query  1576  GMVDMLKGAVNSWL--GRDSQP  1635
              MVD +K AVNS L     SQP
Sbjct  311   SMVDKVKDAVNSLLRGSESSQP  332



>ref|XP_006418865.1| hypothetical protein EUTSA_v10002567mg [Eutrema salsugineum]
 gb|ESQ37301.1| hypothetical protein EUTSA_v10002567mg [Eutrema salsugineum]
Length=381

 Score = 55.8 bits (133),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 52/99 (53%), Gaps = 17/99 (17%)
 Frame = +1

Query  1213  TSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVE----------------GYEEGN  1344
             T TV EKLAP Y KV+ A   +  K++     ++   E                G+   N
Sbjct  237   TETVTEKLAPAYAKVSDATQAITKKIQDIAFSESTEPELNDVSEINTAGTNQPSGFNTKN  296

Query  1345  DVRTDKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQ  1461
              V  DKGVS+KE++ +K +PGE+D+ALS +IS  +  R+
Sbjct  297   QV-WDKGVSMKEYIIQKFEPGEDDRALSRVISKAISPRK  334



>ref|XP_011016353.1| PREDICTED: uncharacterized protein LOC105119857 [Populus euphratica]
Length=415

 Score = 55.8 bits (133),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 58/214 (27%), Positives = 84/214 (39%), Gaps = 60/214 (28%)
 Frame = +1

Query  1057  DYAKTAAMAVAEKLAPVYDRVAGAGSAVMEKLPIGAsgergkgevegegksvTSTVKEKL  1236
             +++KT +  +AEKLAP    V+ A  A+  K+                     ST +   
Sbjct  224   NFSKTLSEIMAEKLAPACATVSDATHAITSKI----------------HSLANSTPEASD  267

Query  1237  APFYDKVA--GAGSTLMSKVKG--------PGTGQAVVVEGYE-EGNDVRTDKGVSIKEF  1383
             A   D V    A S++    KG        P         GY     + + DKGVS+KE+
Sbjct  268   AAGLDPVGEGKASSSVAVPTKGAPDQVASDPARAPTDAASGYHFRTGEQKWDKGVSVKEY  327

Query  1384  LAEKLKPGEEDKALSDMISGTLLSRQKEETVVEGKPVGKVTESEEVARRLGRIGDSPREG  1563
             +  K +PGE+D+ALS +IS  +                                 SPR+ 
Sbjct  328   IIHKFEPGEDDRALSQVISQAI---------------------------------SPRKA  354

Query  1564  SEEKGMVDMLKGAVNSWLGRDSQPQTTDTTNVRN  1665
             S +  MVD +K AVNS L     PQ T   + +N
Sbjct  355   SGDMSMVDKVKDAVNSLLRGSESPQPTVYHSAKN  388



>ref|XP_010685703.1| PREDICTED: uncharacterized protein LOC104900067 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=422

 Score = 55.8 bits (133),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 57/135 (42%), Gaps = 38/135 (28%)
 Frame = +1

Query  1213  TSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEFLAE  1392
             T  V +KLAP Y  V+ A   L SK+    T      +   + N     KGVS+KEF   
Sbjct  298   TEAVSQKLAPAYTTVSEATYKLTSKLPKLSTTNLPCTQQEHKWN-----KGVSVKEFFKN  352

Query  1393  KLKPGEEDKALSDMISGTLLSRQKEETVVEGKPVGKVTESEEVARRLGRIGDSPREGSEE  1572
             KL+PGE++KALS +I+  +                                 SPR    E
Sbjct  353   KLEPGEDEKALSQVITEVI---------------------------------SPRRSPNE  379

Query  1573  KGMVDMLKGAVNSWL  1617
             KG+V+ +K AV   L
Sbjct  380   KGVVEKVKAAVTMLL  394



>ref|XP_010685702.1| PREDICTED: uncharacterized protein LOC104900067 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=431

 Score = 55.8 bits (133),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 57/135 (42%), Gaps = 38/135 (28%)
 Frame = +1

Query  1213  TSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEFLAE  1392
             T  V +KLAP Y  V+ A   L SK+    T      +   + N     KGVS+KEF   
Sbjct  298   TEAVSQKLAPAYTTVSEATYKLTSKLPKLSTTNLPCTQQEHKWN-----KGVSVKEFFKN  352

Query  1393  KLKPGEEDKALSDMISGTLLSRQKEETVVEGKPVGKVTESEEVARRLGRIGDSPREGSEE  1572
             KL+PGE++KALS +I+  +                                 SPR    E
Sbjct  353   KLEPGEDEKALSQVITEVI---------------------------------SPRRSPNE  379

Query  1573  KGMVDMLKGAVNSWL  1617
             KG+V+ +K AV   L
Sbjct  380   KGVVEKVKAAVTMLL  394



>ref|XP_010473741.1| PREDICTED: low-temperature-induced 65 kDa protein-like, partial 
[Camelina sativa]
Length=360

 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 57/134 (43%), Gaps = 51/134 (38%)
 Frame = +1

Query  1048  SPVDYAKTAAMAVAEKLAPVYDRVAGAGSAVMEKLPIGAsgergkgevegegksvTSTVK  1227
             S   Y +T A  VAEKL PVY++V   GS VM KLP+                       
Sbjct  161   SATGYGQTVAGTVAEKLTPVYEKVKETGSNVMTKLPL-----------------------  197

Query  1228  EKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEFLAEKLKPG  1407
                                   G G+G     +G E+G         S +++L+EKL+PG
Sbjct  198   ---------------------SGGGSGVKETQQGEEKGVS-------SARDYLSEKLRPG  229

Query  1408  EEDKALSDMISGTL  1449
             EEDKALS++IS  L
Sbjct  230   EEDKALSEVISEKL  243



>gb|ACI87805.1| putative low-temperature-induced protein [Cupressus sempervirens]
Length=162

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 73/145 (50%), Gaps = 21/145 (14%)
 Frame = +1

Query  1216  STVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEFLAEK  1395
             +TV EKL P YD    AGST+M+ +   G G  V+     E   V  + GV+    ++EK
Sbjct  35    ATVAEKLTPVYDVT--AGSTVMTSLPLSGGGSGVI-----ETQQVE-EIGVTASS-ISEK  85

Query  1396  LKPGEEDKALSDMISGTLLSRQKEETVVEGKPVGKVTESEEVARRLGRIGDSPREGSEEK  1575
             L PGEED A+SDMI+ TL     E++      +  VT    V + L +I D   E   E+
Sbjct  86    LIPGEED-AVSDMIAETLHGGGVEQSTTATDVL--VT----VEKILDQIADRHGEAVAEQ  138

Query  1576  ----GMVDMLKGAVNSWLGRDSQPQ  1638
                 GMV    GAV SWLG    P+
Sbjct  139   RGGDGMV-AATGAVTSWLGGTKSPR  162



>ref|XP_004982668.1| PREDICTED: retinitis pigmentosa 1-like 1 protein-like [Setaria 
italica]
Length=420

 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 53/85 (62%), Gaps = 4/85 (5%)
 Frame = +1

Query  1225  KEKLAPFYDKVAGAGSTLMSKV----KGPGTGQAVVVEGYEEGNDVRTDKGVSIKEFLAE  1392
             K+  +  Y+KVAGAG+ +  KV    +  GT    V    ++ +    DKGV++  ++A+
Sbjct  264   KQLASTVYEKVAGAGTAVAGKVQQATRSAGTATPGVGAQQQDASAGGQDKGVTVTGYIAK  323

Query  1393  KLKPGEEDKALSDMISGTLLSRQKE  1467
             KL+PG+ED+ALS+ ISG +  R+++
Sbjct  324   KLQPGDEDRALSEAISGAVQRRKED  348



>gb|AGY78336.1| hypothetical protein, partial [Setaria italica]
Length=526

 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 53/85 (62%), Gaps = 4/85 (5%)
 Frame = +1

Query  1225  KEKLAPFYDKVAGAGSTLMSKV----KGPGTGQAVVVEGYEEGNDVRTDKGVSIKEFLAE  1392
             K+  +  Y+KVAGAG+ +  KV    +  GT    V    ++ +    DKGV++  ++A+
Sbjct  400   KQLASTVYEKVAGAGTAVAGKVQQATRSAGTATPGVGAQQQDASAGGQDKGVTVTGYIAK  459

Query  1393  KLKPGEEDKALSDMISGTLLSRQKE  1467
             KL+PG+ED+ALS+ ISG +  R+++
Sbjct  460   KLQPGDEDRALSEAISGAVQRRKED  484



>ref|XP_011032251.1| PREDICTED: uncharacterized protein LOC105131131 [Populus euphratica]
Length=415

 Score = 54.7 bits (130),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 61/221 (28%), Positives = 89/221 (40%), Gaps = 55/221 (25%)
 Frame = +1

Query  1024  MQGEHEAASPVDYAKTAAMAVAEKLAPVYDRVAGAGSAVMEKLPIGAsgergkgeve---  1194
             + G+HE     + +KT +  +AEKLAP    V+ A  A+  K+   A+      +     
Sbjct  216   VNGKHENE---NLSKTLSEIMAEKLAPACATVSDATHAITSKIQSLANSTPEASDAAGLD  272

Query  1195  ---gegksvTSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYE-EGNDVRTDK  1362
                    S +  V  K AP  D+VA            P         GY     + + DK
Sbjct  273   PAGEGKASSSVAVPTKGAP--DQVAS----------DPARAPTDAASGYHFRTGEQKWDK  320

Query  1363  GVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQKEETVVEGKPVGKVTESEEVARRLGRI  1542
             GVS+KE++  K +PGE+D+ALS +IS  +                               
Sbjct  321   GVSVKEYIIHKFEPGEDDRALSQVISQAI-------------------------------  349

Query  1543  GDSPREGSEEKGMVDMLKGAVNSWLGRDSQPQTTDTTNVRN  1665
               SPR+ S +  MVD +K AVNS L     PQ T   + +N
Sbjct  350   --SPRKASGDMSMVDKVKDAVNSLLRGSESPQPTVYHSAKN  388



>ref|XP_010426121.1| PREDICTED: low-temperature-induced 65 kDa protein-like [Camelina 
sativa]
Length=387

 Score = 54.3 bits (129),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 53/100 (53%), Gaps = 19/100 (19%)
 Frame = +1

Query  1213  TSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRT------------  1356
             T TV EKLAP Y KV+ A + +  K++     ++   E  EE NDV              
Sbjct  243   TETVTEKLAPAYAKVSDATNAITKKIQDMAFPESTETE--EEINDVSEINTAGTNQTTGL  300

Query  1357  -----DKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQ  1461
                  DKGVS+KE++++K +P E+D+ LS +IS  +  R+
Sbjct  301   NTKVWDKGVSMKEYISQKFEPSEDDRELSRVISKAISPRK  340



>ref|XP_010520258.1| PREDICTED: low-temperature-induced 65 kDa protein [Tarenaya hassleriana]
 ref|XP_010520259.1| PREDICTED: low-temperature-induced 65 kDa protein [Tarenaya hassleriana]
 ref|XP_010520260.1| PREDICTED: low-temperature-induced 65 kDa protein [Tarenaya hassleriana]
 ref|XP_010520261.1| PREDICTED: low-temperature-induced 65 kDa protein [Tarenaya hassleriana]
 ref|XP_010520262.1| PREDICTED: low-temperature-induced 65 kDa protein [Tarenaya hassleriana]
 ref|XP_010520263.1| PREDICTED: low-temperature-induced 65 kDa protein [Tarenaya hassleriana]
Length=348

 Score = 53.9 bits (128),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 53/100 (53%), Gaps = 20/100 (20%)
 Frame = +1

Query  1219  TVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDK------------  1362
             TV EKLAP Y KV+     + +K++G     A +V+  E G+   TDK            
Sbjct  201   TVTEKLAPAYAKVSDVTQAIGAKIQGLAVS-ASMVQNTERGDVSGTDKPITIGTDNPVDS  259

Query  1363  -------GVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQ  1461
                    GVS+KE++ +K +PGE+D+ALS +IS  +  R+
Sbjct  260   ESKVWDKGVSVKEYIMQKFEPGEDDRALSRVISEAISPRK  299



>ref|XP_009109201.1| PREDICTED: low-temperature-induced 65 kDa protein-like [Brassica 
rapa]
Length=220

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 42/72 (58%), Gaps = 5/72 (7%)
 Frame = +1

Query  1234  LAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRTDKGVSIKEFLAEKLKPGEE  1413
             + P Y+KV G G+ +M K+     G        E  N    DKG+S KE+L +KL+PGE 
Sbjct  137   VTPVYEKVKGTGAIVMKKLPFSSGGTHT-----ERENKQGQDKGISAKEYLTKKLRPGEG  191

Query  1414  DKALSDMISGTL  1449
             DKALS++++  L
Sbjct  192   DKALSEVVTEKL  203



>ref|XP_010905104.1| PREDICTED: LOW QUALITY PROTEIN: low-temperature-induced 65 kDa 
protein [Elaeis guineensis]
Length=404

 Score = 52.8 bits (125),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 49/77 (64%), Gaps = 7/77 (9%)
 Frame = +1

Query  1243  FYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVRT-DKG--VSIKEFLAEKLKPGEE  1413
              Y+K+A AG+ + +KV+    G      G + G+   T DKG  VS++E+L EKL+PGEE
Sbjct  259   VYEKMAEAGTAVKAKVQQKPRG----TTGMDGGDATATQDKGKVVSVREYLVEKLRPGEE  314

Query  1414  DKALSDMISGTLLSRQK  1464
             DKALS++IS     R++
Sbjct  315   DKALSEVISEAFQXRKE  331



>ref|XP_010503295.1| PREDICTED: low-temperature-induced 65 kDa protein-like [Camelina 
sativa]
Length=392

 Score = 52.4 bits (124),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 54/100 (54%), Gaps = 17/100 (17%)
 Frame = +1

Query  1213  TSTVKEKLAPFYDKVAGAGSTLMSKVKGPGTGQAVVVEGYEEGNDVR-------------  1353
             T TV EKLAP Y KV+ A + +  K++     ++   E  EE NDV              
Sbjct  246   TETVTEKLAPAYAKVSDATNAITKKIQDMAFPESTETETEEEINDVSEINTAGTNQPTGF  305

Query  1354  ----TDKGVSIKEFLAEKLKPGEEDKALSDMISGTLLSRQ  1461
                  DKGVS+KE++++K +PGE+D+ LS +IS  +  R+
Sbjct  306   NTKVWDKGVSMKEYISQKFEPGEDDRELSRVISKAISPRK  345



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5810760867264