BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7573_g1_i1 len=2026 path=[2004:0-1833 3838:1834-2025]

Length=2026
                                                                      Score     E

ref|XP_009785160.1|  PREDICTED: chaperone protein dnaJ 10-like          703   0.0      
ref|XP_009607660.1|  PREDICTED: chaperone protein dnaJ 10 isoform X1    702   0.0      
emb|CDP07233.1|  unnamed protein product                                700   0.0      
ref|XP_009607661.1|  PREDICTED: chaperone protein dnaJ 10 isoform X2    696   0.0      
ref|XP_006342520.1|  PREDICTED: chaperone protein dnaJ 10-like          695   0.0      
ref|XP_004253109.1|  PREDICTED: chaperone protein dnaJ 10               694   0.0      
ref|XP_010664055.1|  PREDICTED: chaperone protein dnaJ 10 isoform X2    692   0.0      
ref|XP_002278176.1|  PREDICTED: chaperone protein dnaJ 10 isoform X1    688   0.0      Vitis vinifera
ref|XP_011074038.1|  PREDICTED: chaperone protein dnaJ 10-like          676   0.0      
ref|XP_007018601.1|  DNAJ heat shock N-terminal domain-containing...    675   0.0      
ref|XP_009340779.1|  PREDICTED: chaperone protein dnaJ 10-like          675   0.0      
ref|XP_008387278.1|  PREDICTED: chaperone protein dnaJ 10-like          672   0.0      
gb|KDP36705.1|  hypothetical protein JCGZ_07996                         672   0.0      
ref|XP_009340155.1|  PREDICTED: chaperone protein dnaJ 10-like          667   0.0      
ref|XP_010094476.1|  Chaperone protein dnaJ 10                          666   0.0      
ref|XP_002510765.1|  Chaperone protein dnaJ, putative                   663   0.0      Ricinus communis
ref|XP_002300601.2|  hypothetical protein POPTR_0002s00230g             663   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_007202175.1|  hypothetical protein PRUPE_ppa006574mg             662   0.0      
ref|XP_009334974.1|  PREDICTED: chaperone protein dnaJ 10-like          662   0.0      
ref|XP_011034733.1|  PREDICTED: chaperone protein dnaJ 10 isoform X1    661   0.0      
ref|XP_002307837.2|  DNAJ heat shock N-terminal domain-containing...    660   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011041091.1|  PREDICTED: chaperone protein dnaJ 10-like          655   0.0      
gb|KGN55561.1|  hypothetical protein Csa_4G665650                       654   0.0      
ref|XP_008240863.1|  PREDICTED: chaperone protein dnaJ 10-like          653   0.0      
ref|XP_008453046.1|  PREDICTED: chaperone protein dnaJ 10 isoform X2    653   0.0      
ref|XP_006435520.1|  hypothetical protein CICLE_v10001330mg             649   0.0      
ref|XP_006435521.1|  hypothetical protein CICLE_v10001330mg             650   0.0      
ref|XP_008453045.1|  PREDICTED: chaperone protein dnaJ 10 isoform X1    646   0.0      
ref|XP_004511274.1|  PREDICTED: chaperone protein dnaJ 10-like          646   0.0      
ref|XP_010932194.1|  PREDICTED: chaperone protein dnaJ 10-like is...    643   0.0      
ref|XP_010270671.1|  PREDICTED: chaperone protein dnaJ 10-like          640   0.0      
gb|EYU36613.1|  hypothetical protein MIMGU_mgv1a007809mg                637   0.0      
ref|XP_003517610.1|  PREDICTED: chaperone protein dnaJ 10-like          636   0.0      
ref|XP_009415440.1|  PREDICTED: chaperone protein dnaJ 10-like          629   0.0      
ref|XP_011083375.1|  PREDICTED: chaperone protein dnaJ 10-like          627   0.0      
ref|XP_010927493.1|  PREDICTED: chaperone protein dnaJ 10-like          618   0.0      
ref|XP_004300062.1|  PREDICTED: chaperone protein dnaJ 10-like          617   0.0      
ref|XP_008796637.1|  PREDICTED: chaperone protein dnaJ 10-like          615   0.0      
ref|XP_008796463.1|  PREDICTED: chaperone protein dnaJ 10-like          614   0.0      
ref|XP_010684702.1|  PREDICTED: chaperone protein dnaJ 10-like          614   0.0      
ref|XP_010061362.1|  PREDICTED: LOW QUALITY PROTEIN: chaperone pr...    613   0.0      
ref|XP_011034734.1|  PREDICTED: chaperone protein dnaJ 10 isoform X2    607   0.0      
gb|EYU41228.1|  hypothetical protein MIMGU_mgv1a008087mg                607   0.0      
ref|XP_006849900.1|  hypothetical protein AMTR_s00022p00097490          607   0.0      
ref|XP_010932193.1|  PREDICTED: chaperone protein dnaJ 10-like is...    601   0.0      
ref|XP_010537260.1|  PREDICTED: chaperone protein dnaJ 10 isoform X1    600   0.0      
gb|EYU36611.1|  hypothetical protein MIMGU_mgv1a007809mg                598   0.0      
ref|XP_006390162.1|  hypothetical protein EUTSA_v10018664mg             587   0.0      
ref|XP_009110197.1|  PREDICTED: chaperone protein dnaJ 10-like          585   0.0      
ref|XP_003578350.2|  PREDICTED: chaperone protein dnaJ 10-like          587   0.0      
ref|XP_006416333.1|  hypothetical protein EUTSA_v10007857mg             583   0.0      
gb|KFK42079.1|  hypothetical protein AALP_AA2G208500                    583   0.0      
ref|XP_004957235.1|  PREDICTED: chaperone protein dnaJ 10-like          583   0.0      
ref|XP_002893150.1|  DNAJ heat shock N-terminal domain-containing...    583   0.0      
ref|XP_010477369.1|  PREDICTED: chaperone protein dnaJ 10-like is...    583   0.0      
ref|NP_001063548.1|  Os09g0493800                                       581   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|KHN12125.1|  Chaperone protein dnaJ 10                               580   0.0      
ref|XP_006416332.1|  hypothetical protein EUTSA_v10007857mg             580   0.0      
ref|XP_010498561.1|  PREDICTED: chaperone protein dnaJ 10-like          580   0.0      
ref|NP_001062282.1|  Os08g0522600                                       579   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010477368.1|  PREDICTED: chaperone protein dnaJ 10-like is...    579   0.0      
ref|NP_564134.1|  DNAJ heat shock N-terminal domain-containing pr...    578   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006305020.1|  hypothetical protein CARUB_v10009386mg             577   0.0      
gb|AAW50121.1|  DnaJ-like protein                                       576   0.0      Brassica juncea [brown mustard]
ref|NP_001185052.1|  DNAJ heat shock N-terminal domain-containing...    576   0.0      
ref|XP_010459811.1|  PREDICTED: chaperone protein dnaJ 10-like          575   0.0      
emb|CDX96605.1|  BnaA08g21480D                                          572   0.0      
ref|XP_004973911.1|  PREDICTED: chaperone protein dnaJ 10-like          570   0.0      
ref|XP_009106341.1|  PREDICTED: chaperone protein dnaJ 10               569   0.0      
ref|XP_006660786.1|  PREDICTED: chaperone protein dnaJ 10-like          568   0.0      
ref|XP_009149588.1|  PREDICTED: chaperone protein dnaJ 10-like          566   0.0      
ref|XP_006660299.1|  PREDICTED: chaperone protein dnaJ 10-like          566   0.0      
emb|CDY33667.1|  BnaC08g19670D                                          566   0.0      
gb|EEE69016.1|  hypothetical protein OsJ_27983                          577   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010428734.1|  PREDICTED: chaperone protein dnaJ 10 isoform X1    564   0.0      
ref|XP_002889096.1|  DNAJ heat shock N-terminal domain-containing...    563   0.0      
emb|CDY29479.1|  BnaA06g14910D                                          561   0.0      
gb|KHG07261.1|  Chaperone dnaJ 10 -like protein                         560   0.0      
ref|XP_010416594.1|  PREDICTED: chaperone protein dnaJ 10-like          561   0.0      
ref|NP_177796.1|  chaperone protein dnaJ 10                             561   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CDX87572.1|  BnaA07g33010D                                          560   0.0      
ref|XP_010471827.1|  PREDICTED: chaperone protein dnaJ 10-like          560   0.0      
ref|XP_006302354.1|  hypothetical protein CARUB_v10020414mg             559   0.0      
dbj|BAC41997.1|  putative DnaJ protein                                  558   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|EMT24229.1|  Chaperone protein dnaJ 10                               559   0.0      
ref|XP_003574771.1|  PREDICTED: chaperone protein dnaJ 10-like          555   0.0      
emb|CDX88309.1|  BnaC06g37530D                                          552   0.0      
ref|XP_002462599.1|  hypothetical protein SORBIDRAFT_02g028760          549   0.0      Sorghum bicolor [broomcorn]
ref|XP_010477370.1|  PREDICTED: chaperone protein dnaJ 10-like is...    541   0.0      
gb|EMS53118.1|  Chaperone protein dnaJ 10                               548   0.0      
ref|NP_001149115.1|  chaperone protein dnaJ 10                          539   0.0      Zea mays [maize]
tpg|DAA48044.1|  TPA: chaperone protein dnaJ 10                         537   0.0      
ref|NP_001150421.1|  LOC100284051                                       536   0.0      Zea mays [maize]
emb|CDY04595.1|  BnaC05g16330D                                          536   0.0      
emb|CAA72705.1|  dnaJ-like protein                                      531   5e-180   Arabidopsis thaliana [mouse-ear cress]
emb|CAN67266.1|  hypothetical protein VITISV_028729                     546   3e-178   Vitis vinifera
gb|EMT21103.1|  Chaperone protein dnaJ 10                               524   2e-177   
ref|XP_006390163.1|  hypothetical protein EUTSA_v10019530mg             490   4e-165   
gb|EYU36612.1|  hypothetical protein MIMGU_mgv1a007809mg                469   1e-157   
ref|XP_010537262.1|  PREDICTED: chaperone protein dnaJ 10 isoform X3    460   2e-153   
ref|XP_007018602.1|  DNAJ heat shock N-terminal domain-containing...    457   3e-153   
ref|XP_006851416.1|  hypothetical protein AMTR_s00040p00080520          454   1e-149   
ref|XP_010270365.1|  PREDICTED: chaperone protein dnaJ 10               441   2e-145   
ref|XP_008808481.1|  PREDICTED: chaperone protein dnaJ 10               434   5e-143   
gb|KEH27297.1|  DnaJ heat shock amino-terminal domain protein           427   4e-142   
ref|XP_007019291.1|  DNAJ heat shock N-terminal domain-containing...    431   2e-141   
ref|XP_010930653.1|  PREDICTED: chaperone protein dnaJ 10-like          429   6e-141   
ref|XP_006472897.1|  PREDICTED: chaperone protein dnaJ 10-like          429   1e-140   
ref|XP_009404318.1|  PREDICTED: chaperone protein dnaJ 10               428   1e-140   
ref|XP_002279104.1|  PREDICTED: chaperone protein dnaJ 10 isoform X1    427   3e-140   Vitis vinifera
ref|XP_010912597.1|  PREDICTED: chaperone protein dnaJ 10-like is...    424   2e-139   
ref|XP_006434336.1|  hypothetical protein CICLE_v10003893mg             424   6e-139   
gb|KDP43082.1|  hypothetical protein JCGZ_25268                         424   6e-139   
ref|XP_010912593.1|  PREDICTED: chaperone protein dnaJ 10-like is...    424   7e-139   
ref|XP_011074793.1|  PREDICTED: chaperone protein dnaJ 10               423   1e-138   
ref|XP_010912591.1|  PREDICTED: chaperone protein dnaJ 10-like is...    424   1e-138   
ref|NP_001154353.1|  DNAJ heat shock N-terminal domain-containing...    419   4e-138   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011027402.1|  PREDICTED: chaperone protein dnaJ 10-like is...    422   4e-138   
ref|XP_004290570.1|  PREDICTED: chaperone protein dnaJ 10-like          422   4e-138   
ref|XP_004237709.1|  PREDICTED: chaperone protein dnaJ 10               422   5e-138   
ref|XP_008237723.1|  PREDICTED: chaperone protein dnaJ 10               421   8e-138   
ref|XP_002307468.2|  hypothetical protein POPTR_0005s20810g             421   9e-138   Populus trichocarpa [western balsam poplar]
ref|XP_011027401.1|  PREDICTED: chaperone protein dnaJ 10-like is...    421   1e-137   
ref|XP_009771904.1|  PREDICTED: chaperone protein dnaJ 10               421   1e-137   
ref|XP_010063904.1|  PREDICTED: chaperone protein dnaJ 10 isoform X2    420   3e-137   
ref|XP_010999850.1|  PREDICTED: chaperone protein dnaJ 10-like is...    419   3e-137   
ref|XP_010063903.1|  PREDICTED: chaperone protein dnaJ 10 isoform X1    419   6e-137   
ref|XP_002520257.1|  Chaperone protein dnaJ, putative                   418   1e-136   Ricinus communis
ref|XP_006356328.1|  PREDICTED: chaperone protein dnaJ 10-like          418   2e-136   
gb|EPS70343.1|  hypothetical protein M569_04418                         412   2e-136   
ref|XP_009588758.1|  PREDICTED: chaperone protein dnaJ 10               417   2e-136   
ref|XP_011027400.1|  PREDICTED: chaperone protein dnaJ 10-like is...    417   3e-136   
ref|XP_007161391.1|  hypothetical protein PHAVU_001G064900g             417   3e-136   
ref|XP_008348728.1|  PREDICTED: chaperone protein dnaJ 10-like          417   5e-136   
ref|XP_008373287.1|  PREDICTED: chaperone protein dnaJ 10               416   6e-136   
ref|XP_009342837.1|  PREDICTED: chaperone protein dnaJ 10-like          416   7e-136   
ref|XP_010999849.1|  PREDICTED: chaperone protein dnaJ 10-like is...    416   1e-135   
ref|XP_009368402.1|  PREDICTED: chaperone protein dnaJ 10-like          415   2e-135   
ref|XP_008643951.1|  PREDICTED: uncharacterized protein LOC100381...    415   2e-135   
ref|XP_006390129.1|  hypothetical protein EUTSA_v10018713mg             415   2e-135   
ref|XP_010999848.1|  PREDICTED: chaperone protein dnaJ 10-like is...    415   2e-135   
ref|XP_003544725.1|  PREDICTED: chaperone protein dnaJ 10-like          415   2e-135   
emb|CBI19931.3|  unnamed protein product                                416   3e-135   
emb|CDP11984.1|  unnamed protein product                                415   3e-135   
ref|XP_009360683.1|  PREDICTED: chaperone protein dnaJ 10-like          414   4e-135   
ref|XP_008441572.1|  PREDICTED: chaperone protein dnaJ 10 isoform X1    416   4e-135   
ref|XP_002453982.1|  hypothetical protein SORBIDRAFT_04g022680          414   4e-135   Sorghum bicolor [broomcorn]
ref|XP_008441573.1|  PREDICTED: chaperone protein dnaJ 10 isoform X2    415   9e-135   
ref|XP_004952804.1|  PREDICTED: chaperone protein dnaJ 10-like is...    413   1e-134   
ref|XP_003541870.1|  PREDICTED: chaperone protein dnaJ 10-like          413   1e-134   
ref|XP_004952803.1|  PREDICTED: chaperone protein dnaJ 10-like is...    413   1e-134   
gb|KFK42106.1|  hypothetical protein AALP_AA2G211800                    413   1e-134   
ref|XP_010664862.1|  PREDICTED: chaperone protein dnaJ 10 isoform X2    412   2e-134   
ref|XP_006647373.1|  PREDICTED: chaperone protein dnaJ 10-like          411   4e-134   
ref|XP_006300507.1|  hypothetical protein CARUB_v10020466mg             411   5e-134   
ref|XP_010416627.1|  PREDICTED: chaperone protein dnaJ 10-like is...    411   6e-134   
ref|XP_002300954.1|  DNAJ heat shock N-terminal domain-containing...    410   9e-134   Populus trichocarpa [western balsam poplar]
gb|KGN47498.1|  hypothetical protein Csa_6G344270                       410   2e-133   
ref|NP_001047124.1|  Os02g0555700                                       409   4e-133   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010692860.1|  PREDICTED: chaperone protein dnaJ 10               409   4e-133   
gb|EEC73395.1|  hypothetical protein OsI_07645                          409   4e-133   Oryza sativa Indica Group [Indian rice]
ref|XP_010428770.1|  PREDICTED: chaperone protein dnaJ 10-like          409   5e-133   
ref|XP_002968059.1|  hypothetical protein SELMODRAFT_89685              407   9e-133   
ref|XP_010471871.1|  PREDICTED: chaperone protein dnaJ 10-like          407   1e-132   
ref|XP_008441574.1|  PREDICTED: chaperone protein dnaJ 10 isoform X3    407   7e-132   
ref|XP_002965580.1|  hypothetical protein SELMODRAFT_84969              405   8e-132   
ref|XP_009106370.1|  PREDICTED: chaperone protein dnaJ 10               405   1e-131   
gb|EEE57186.1|  hypothetical protein OsJ_07128                          406   2e-131   Oryza sativa Japonica Group [Japonica rice]
ref|NP_177828.2|  DNAJ heat shock N-terminal domain-containing pr...    405   2e-131   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002889116.1|  DNAJ heat shock N-terminal domain-containing...    405   2e-131   
gb|KHN24356.1|  Chaperone protein dnaJ 10                               405   2e-131   
gb|KEH40477.1|  DnaJ heat shock amino-terminal domain protein           404   5e-131   
ref|XP_006405095.1|  hypothetical protein EUTSA_v10000200mg             403   8e-131   
ref|XP_004144254.1|  PREDICTED: chaperone protein dnaJ 10-like          403   9e-131   
ref|XP_003575139.1|  PREDICTED: chaperone protein dnaJ 10               402   1e-130   
ref|XP_010537322.1|  PREDICTED: chaperone protein dnaJ 10               402   2e-130   
ref|XP_001757800.1|  predicted protein                                  398   8e-130   
gb|ADE75731.1|  unknown                                                 398   2e-129   
ref|XP_004498370.1|  PREDICTED: chaperone protein dnaJ 10-like          397   2e-128   
gb|EMT15423.1|  Chaperone protein dnaJ 10                               394   4e-128   
ref|XP_008791145.1|  PREDICTED: chaperone protein dnaJ 10-like          393   1e-127   
ref|XP_001782078.1|  predicted protein                                  392   2e-127   
gb|EMS64829.1|  Chaperone protein dnaJ 10                               397   2e-127   
ref|XP_001784549.1|  predicted protein                                  390   7e-127   
ref|XP_004165569.1|  PREDICTED: chaperone protein dnaJ 10-like          392   7e-127   
ref|XP_004961342.1|  PREDICTED: chaperone protein dnaJ 10-like is...    389   5e-126   
ref|XP_010922833.1|  PREDICTED: chaperone protein dnaJ 10-like          389   5e-126   
ref|XP_004150069.1|  PREDICTED: chaperone protein dnaJ 10-like          386   6e-125   
gb|KDO47878.1|  hypothetical protein CISIN_1g017985mg                   387   7e-125   
ref|XP_008460969.1|  PREDICTED: chaperone protein dnaJ 10-like          385   1e-124   
ref|XP_010231083.1|  PREDICTED: chaperone protein dnaJ 10-like          385   2e-124   
ref|XP_010645323.1|  PREDICTED: chaperone protein dnaJ 10               384   4e-124   
ref|XP_009106281.1|  PREDICTED: chaperone protein dnaJ 10               384   5e-124   
ref|XP_006847639.1|  hypothetical protein AMTR_s00014p00255630          384   7e-124   
ref|NP_001131263.1|  uncharacterized protein LOC100192576               384   7e-124   Zea mays [maize]
ref|XP_006423369.1|  hypothetical protein CICLE_v10028792mg             383   9e-124   
ref|XP_010912599.1|  PREDICTED: chaperone protein dnaJ 10-like is...    384   1e-123   
ref|XP_010912596.1|  PREDICTED: chaperone protein dnaJ 10-like is...    383   3e-123   
ref|XP_010275568.1|  PREDICTED: chaperone protein dnaJ 10-like is...    382   5e-123   
gb|ACG33020.1|  chaperone protein dnaJ 10                               381   7e-123   Zea mays [maize]
ref|XP_004511002.1|  PREDICTED: chaperone protein dnaJ 10-like is...    380   1e-122   
ref|XP_004511003.1|  PREDICTED: chaperone protein dnaJ 10-like is...    379   1e-122   
ref|XP_010275569.1|  PREDICTED: chaperone protein dnaJ 10-like is...    380   2e-122   
ref|XP_010531447.1|  PREDICTED: chaperone protein dnaJ 10-like is...    380   2e-122   
emb|CDY42612.1|  BnaC01g00240D                                          380   3e-122   
ref|XP_008647541.1|  PREDICTED: hypothetical protein isoform X1         379   4e-122   
ref|XP_007201378.1|  hypothetical protein PRUPE_ppa007841mg             379   6e-122   
ref|XP_001772874.1|  predicted protein                                  378   6e-122   
gb|KHG09283.1|  Chaperone dnaJ 10 -like protein                         378   8e-122   
ref|XP_008236939.1|  PREDICTED: chaperone protein dnaJ 10               378   8e-122   
ref|XP_009388085.1|  PREDICTED: chaperone protein dnaJ 10-like          378   1e-121   
gb|ACG25809.1|  chaperone protein dnaJ 10                               378   1e-121   Zea mays [maize]
ref|XP_009385388.1|  PREDICTED: chaperone protein dnaJ 10-like          377   1e-121   
ref|XP_009348238.1|  PREDICTED: chaperone protein dnaJ 10-like          377   1e-121   
ref|XP_010690838.1|  PREDICTED: chaperone protein dnaJ 10               378   1e-121   
ref|XP_006282656.1|  hypothetical protein CARUB_v10005169mg             378   2e-121   
ref|XP_010912595.1|  PREDICTED: chaperone protein dnaJ 10-like is...    379   2e-121   
ref|XP_010446434.1|  PREDICTED: chaperone protein dnaJ 10-like          376   6e-121   
ref|XP_009372977.1|  PREDICTED: chaperone protein dnaJ 10-like          375   9e-121   
ref|XP_003627750.1|  Chaperone protein dnaJ                             375   1e-120   
ref|XP_009386456.1|  PREDICTED: chaperone protein dnaJ 10-like          375   1e-120   
ref|XP_007042114.1|  DNAJ heat shock N-terminal domain-containing...    375   2e-120   
ref|XP_006654734.1|  PREDICTED: chaperone protein dnaJ 10-like          374   2e-120   
ref|XP_010531445.1|  PREDICTED: chaperone protein dnaJ 10-like is...    374   4e-120   
ref|XP_010431873.1|  PREDICTED: chaperone protein dnaJ 10-like          374   5e-120   
ref|XP_007042113.1|  DNAJ heat shock N-terminal domain-containing...    374   6e-120   
ref|XP_010416628.1|  PREDICTED: chaperone protein dnaJ 10-like is...    372   6e-120   
emb|CDX88337.1|  BnaC06g37810D                                          374   7e-120   
ref|XP_010437018.1|  PREDICTED: chaperone protein dnaJ 10-like          373   1e-119   
ref|XP_008377257.1|  PREDICTED: chaperone protein dnaJ 10-like          372   1e-119   
ref|XP_010089337.1|  Chaperone protein dnaJ 10                          372   2e-119   
ref|XP_009353397.1|  PREDICTED: chaperone protein dnaJ 10-like          372   2e-119   
gb|KDP41758.1|  hypothetical protein JCGZ_26776                         371   4e-119   
ref|XP_007133797.1|  hypothetical protein PHAVU_011G210000g             371   4e-119   
emb|CDX87548.1|  BnaA07g33250D                                          372   5e-119   
ref|XP_006411715.1|  hypothetical protein EUTSA_v10025633mg             371   6e-119   
gb|AFK46259.1|  unknown                                                 371   6e-119   
ref|XP_007133798.1|  hypothetical protein PHAVU_011G210000g             370   8e-119   
ref|XP_010066148.1|  PREDICTED: chaperone protein dnaJ 10-like          370   9e-119   
ref|XP_008385913.1|  PREDICTED: chaperone protein dnaJ 10-like          370   9e-119   
dbj|BAK03712.1|  predicted protein                                      368   3e-118   
ref|NP_001242400.1|  uncharacterized protein LOC100787075               368   5e-118   
ref|XP_007201379.1|  hypothetical protein PRUPE_ppa007841mg             369   6e-118   
ref|XP_011047951.1|  PREDICTED: chaperone protein dnaJ 10               368   7e-118   
ref|XP_011037476.1|  PREDICTED: chaperone protein dnaJ 10-like is...    367   1e-117   
ref|XP_011037471.1|  PREDICTED: chaperone protein dnaJ 10-like is...    367   1e-117   
ref|XP_003540519.1|  PREDICTED: chaperone protein dnaJ 10-like is...    367   1e-117   
ref|XP_006593418.1|  PREDICTED: uncharacterized protein LOC100787...    367   2e-117   
ref|XP_002512946.1|  Chaperone protein dnaJ, putative                   367   2e-117   Ricinus communis
ref|XP_004969670.1|  PREDICTED: chaperone protein dnaJ 10-like is...    367   2e-117   
ref|XP_010254722.1|  PREDICTED: chaperone protein dnaJ 10-like          367   2e-117   
ref|NP_195626.1|  DNAJ heat shock N-terminal domain-containing pr...    367   3e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002313780.2|  DNAJ heat shock N-terminal domain-containing...    367   3e-117   Populus trichocarpa [western balsam poplar]
ref|NP_001056206.1|  Os05g0543700                                       366   3e-117   Oryza sativa Japonica Group [Japonica rice]
emb|CDM83672.1|  unnamed protein product                                366   4e-117   
ref|XP_002456215.1|  hypothetical protein SORBIDRAFT_03g032250          366   5e-117   Sorghum bicolor [broomcorn]
ref|XP_006294333.1|  hypothetical protein CARUB_v10023340mg             368   6e-117   
ref|NP_179746.1|  DNAJ heat shock N-terminal domain-containing pr...    365   1e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006294332.1|  hypothetical protein CARUB_v10023340mg             367   2e-116   
ref|XP_006404601.1|  hypothetical protein EUTSA_v10000223mg             365   2e-116   
ref|XP_002880388.1|  DNAJ heat shock N-terminal domain-containing...    364   2e-116   
ref|XP_006404600.1|  hypothetical protein EUTSA_v10000223mg             363   4e-116   
gb|KCW71187.1|  hypothetical protein EUGRSUZ_F04280                     364   7e-116   
ref|XP_002305443.2|  DNAJ heat shock N-terminal domain-containing...    362   1e-115   Populus trichocarpa [western balsam poplar]
emb|CDP20071.1|  unnamed protein product                                362   2e-115   
ref|XP_006384517.1|  hypothetical protein POPTR_0004s16570g             362   2e-115   
ref|XP_008656789.1|  PREDICTED: chaperone protein dnaJ 10-like          361   3e-115   
gb|ABK95027.1|  unknown                                                 361   3e-115   Populus trichocarpa [western balsam poplar]
gb|KCW63966.1|  hypothetical protein EUGRSUZ_G01646                     363   3e-115   
ref|XP_009117394.1|  PREDICTED: chaperone protein dnaJ 10 isoform X1    361   4e-115   
ref|XP_010416901.1|  PREDICTED: chaperone protein dnaJ 10-like is...    361   4e-115   
ref|XP_010429066.1|  PREDICTED: chaperone protein dnaJ 10-like is...    360   8e-115   
ref|XP_004289642.1|  PREDICTED: chaperone protein dnaJ 10-like          360   9e-115   
ref|XP_010429069.1|  PREDICTED: chaperone protein dnaJ 10-like is...    360   9e-115   
gb|AAC00633.1|  Similar to dnaj-like protein, gp|Y11969|2230757         360   1e-114   Arabidopsis thaliana [mouse-ear cress]
emb|CDX82039.1|  BnaC08g35620D                                          360   1e-114   
ref|XP_010416903.1|  PREDICTED: chaperone protein dnaJ 10-like is...    360   2e-114   
ref|XP_010472146.1|  PREDICTED: chaperone protein dnaJ 10-like is...    359   3e-114   
ref|XP_009117396.1|  PREDICTED: chaperone protein dnaJ 10 isoform X2    358   4e-114   
ref|XP_010472147.1|  PREDICTED: chaperone protein dnaJ 10-like is...    358   5e-114   
gb|KEH40476.1|  DnaJ heat shock amino-terminal domain protein           358   2e-113   
gb|EYU23848.1|  hypothetical protein MIMGU_mgv1a008798mg                357   3e-113   
ref|XP_009134005.1|  PREDICTED: chaperone protein dnaJ 10-like is...    357   4e-113   
gb|EEE64562.1|  hypothetical protein OsJ_19414                          367   5e-113   
gb|EEC79631.1|  hypothetical protein OsI_20846                          366   7e-113   
ref|XP_003567032.1|  PREDICTED: chaperone protein dnaJ 10-like          355   1e-112   
ref|XP_009134007.1|  PREDICTED: chaperone protein dnaJ 10-like is...    355   2e-112   
ref|XP_006646246.1|  PREDICTED: chaperone protein dnaJ 10-like          353   3e-112   
gb|EEE55258.1|  hypothetical protein OsJ_03161                          361   3e-111   
gb|EEC71347.1|  hypothetical protein OsI_03416                          360   9e-111   
emb|CDX83193.1|  BnaA03g23130D                                          347   1e-109   
emb|CDY65816.1|  BnaCnng48790D                                          347   2e-109   
ref|XP_007042115.1|  DNAJ heat shock N-terminal domain-containing...    344   4e-109   
ref|XP_001784375.1|  predicted protein                                  342   3e-108   
emb|CAN76186.1|  hypothetical protein VITISV_037187                     342   4e-108   
gb|KHG26298.1|  Chaperone dnaJ 10 -like protein                         342   6e-108   
ref|XP_009591577.1|  PREDICTED: chaperone protein dnaJ 10-like          342   1e-107   
ref|XP_006362034.1|  PREDICTED: chaperone protein dnaJ 10-like is...    338   2e-106   
ref|XP_004230892.1|  PREDICTED: chaperone protein dnaJ 10               337   5e-106   
ref|XP_004151552.1|  PREDICTED: chaperone protein dnaJ 10-like          331   3e-105   
gb|KDO85330.1|  hypothetical protein CISIN_1g0137322mg                  331   5e-105   
ref|XP_009802822.1|  PREDICTED: chaperone protein dnaJ 10-like          335   6e-105   
gb|KDO85329.1|  hypothetical protein CISIN_1g0137322mg                  331   6e-105   
tpg|DAA48042.1|  TPA: hypothetical protein ZEAMMB73_517322              328   1e-103   
gb|KDO85338.1|  hypothetical protein CISIN_1g0137321mg                  320   5e-102   
gb|EMS67060.1|  Chaperone protein dnaJ 10                               329   1e-101   
ref|XP_004969671.1|  PREDICTED: chaperone protein dnaJ 10-like is...    322   2e-100   
ref|XP_004145614.1|  PREDICTED: chaperone protein dnaJ 10-like          316   4e-100   
ref|XP_004157112.1|  PREDICTED: chaperone protein dnaJ 10-like          315   8e-100   
ref|XP_002868890.1|  DNAJ heat shock N-terminal domain-containing...    319   2e-99    
ref|NP_001172526.1|  Os01g0702450                                       319   2e-99    
gb|KDO85335.1|  hypothetical protein CISIN_1g0137322mg                  313   7e-98    
gb|KDO47882.1|  hypothetical protein CISIN_1g017985mg                   302   8e-94    
ref|XP_005647132.1|  DnaJ-domain-containing protein                     294   3e-89    
ref|XP_011088442.1|  PREDICTED: chaperone protein dnaJ 10               293   4e-89    
ref|NP_001141125.1|  hypothetical protein                               288   7e-89    
gb|EYU37821.1|  hypothetical protein MIMGU_mgv1a009877mg                291   3e-88    
ref|XP_007157249.1|  hypothetical protein PHAVU_002G055000g             286   3e-86    
tpg|DAA48043.1|  TPA: hypothetical protein ZEAMMB73_517322              278   9e-86    
gb|AAD27555.1|AF111710_1  putative dnaJ-like protein                    290   5e-84    
gb|KDO85344.1|  hypothetical protein CISIN_1g0137321mg                  269   2e-82    
gb|AFW78972.1|  hypothetical protein ZEAMMB73_108744                    273   2e-82    
gb|KDO85337.1|  hypothetical protein CISIN_1g0137321mg                  265   5e-81    
gb|KDO47881.1|  hypothetical protein CISIN_1g017985mg                   266   1e-79    
gb|KCW68297.1|  hypothetical protein EUGRSUZ_F01962                     257   3e-77    
ref|XP_007157250.1|  hypothetical protein PHAVU_002G055100g             252   2e-76    
gb|KFM27248.1|  Chaperone protein dnaJ 10                               263   6e-76    
ref|XP_006592952.1|  PREDICTED: chaperone protein dnaJ 10-like is...    254   1e-74    
ref|XP_006593419.1|  PREDICTED: uncharacterized protein LOC100787...    254   1e-74    
gb|ACJ84787.1|  unknown                                                 239   1e-70    
gb|KCW68298.1|  hypothetical protein EUGRSUZ_F01963                     233   4e-69    
ref|XP_007201915.1|  hypothetical protein PRUPE_ppa020596m1g            232   3e-68    
emb|CAN63215.1|  hypothetical protein VITISV_042970                     230   3e-67    
gb|KDO85336.1|  hypothetical protein CISIN_1g0137322mg                  218   2e-63    
gb|AFG46645.1|  hypothetical protein 0_6505_01                          217   4e-63    
gb|AEW07602.1|  hypothetical protein 0_6505_01                          217   5e-63    
gb|KEH27298.1|  chaperone protein dnaJ, putative                        218   5e-63    
ref|XP_002862302.1|  predicted protein                                  218   1e-62    
gb|AFG46648.1|  hypothetical protein 0_6505_01                          214   5e-62    
ref|XP_005845199.1|  hypothetical protein CHLNCDRAFT_137425             223   2e-60    
ref|XP_008230958.1|  PREDICTED: chaperone protein dnaJ 10-like          211   3e-60    
ref|XP_007199291.1|  hypothetical protein PRUPE_ppa023024mg             211   2e-58    
gb|EYU37820.1|  hypothetical protein MIMGU_mgv1a009877mg                209   3e-58    
gb|AFK36666.1|  unknown                                                 198   1e-55    
gb|EPS65723.1|  hypothetical protein M569_09054                         193   4e-54    
ref|XP_002502754.1|  predicted protein                                  204   1e-53    
ref|XP_001421562.1|  predicted protein                                  197   2e-53    
ref|XP_004292010.1|  PREDICTED: chaperone protein dnaJ 10-like          197   4e-53    
ref|XP_010041280.1|  PREDICTED: chaperone protein dnaJ 10-like          187   1e-51    
ref|XP_005764001.1|  hypothetical protein EMIHUDRAFT_67329              192   2e-51    
gb|KHN21063.1|  Chaperone protein dnaJ 10                               185   4e-50    
gb|EJK63480.1|  hypothetical protein THAOC_15858                        184   7e-47    
ref|XP_002183103.1|  predicted protein                                  177   4e-46    
ref|XP_010105349.1|  Chaperone protein dnaJ 10                          172   4e-46    
ref|XP_003567971.1|  PREDICTED: chaperone protein dnaJ 10-like is...    168   2e-45    
gb|ACN27252.1|  unknown                                                 169   2e-45    
ref|XP_010231081.1|  PREDICTED: chaperone protein dnaJ 10-like is...    167   7e-45    
ref|XP_010231076.1|  PREDICTED: chaperone protein dnaJ 10-like is...    167   8e-45    
ref|XP_010231082.1|  PREDICTED: chaperone protein dnaJ 10-like is...    166   2e-44    
gb|AFK44348.1|  unknown                                                 162   2e-43    
ref|XP_010231079.1|  PREDICTED: chaperone protein dnaJ 10-like is...    162   2e-43    
ref|XP_008873641.1|  hypothetical protein H310_09364                    174   2e-43    
ref|XP_010231078.1|  PREDICTED: chaperone protein dnaJ 10-like is...    162   3e-43    
gb|KDO19323.1|  hypothetical protein SPRG_15525                         173   4e-43    
ref|XP_003283516.1|  hypothetical protein DICPUDRAFT_147183             169   2e-42    
gb|ESA21531.1|  hypothetical protein GLOINDRAFT_343114                  169   2e-42    
ref|XP_008619369.1|  hypothetical protein SDRG_14985                    171   2e-42    
ref|XP_001696332.1|  DnaJ-like protein                                  171   4e-42    
gb|KGG50797.1|  hypothetical protein DI09_55p140                        164   1e-41    
ref|XP_007512005.1|  predicted protein                                  170   1e-41    
emb|CEG72777.1|  Putative DnaJ like subfamily A member 2                167   1e-41    
ref|XP_005711069.1|  unnamed protein product                            171   1e-41    
ref|XP_003885265.1|  putative DnaJ domain-containing protein            169   2e-41    
emb|CCF75875.1|  unnamed protein product                                167   4e-41    
emb|CDR97229.1|  dnaJ domain containing protein, putative               169   4e-41    
ref|XP_008883588.1|  DnaJ domain-containing protein                     167   5e-41    
ref|XP_004342310.1|  DnaJ domain containing protein                     163   5e-41    
emb|CEI96844.1|  Putative DnaJ like subfamily A member 2                164   6e-41    
ref|XP_002364542.1|  DnaJ domain-containing protein                     166   1e-40    
emb|CDI80066.1|  DnaJ domain-containing protein, putative               166   2e-40    
emb|CEI89435.1|  Putative DnaJ like subfamily A member 2                160   1e-39    
emb|CAN82852.1|  hypothetical protein VITISV_041720                     155   2e-39    
ref|XP_002294987.1|  predicted protein                                  157   3e-39    
ref|XP_459458.2|  DEHA2E02970p                                          160   3e-39    
ref|XP_005767795.1|  DnaJ, heat shock 40 kDa protein                    162   3e-39    
ref|XP_005760738.1|  DnaJ, heat shock 40 kDa protein                    162   4e-39    
gb|EJK57655.1|  hypothetical protein THAOC_22280                        159   1e-38    
tpg|DAA58191.1|  TPA: hypothetical protein ZEAMMB73_458241              150   1e-38    
ref|XP_005717225.1|  unnamed protein product                            158   1e-38    
ref|XP_009829959.1|  hypothetical protein H257_06446                    159   3e-38    
gb|EPB90461.1|  DnaJ like subfamily A member 2                          157   3e-38    
ref|XP_005768655.1|  hypothetical protein EMIHUDRAFT_425024             156   5e-38    
emb|CEG63932.1|  Putative DnaJ protein, subfamily B, member 4           155   5e-38    
gb|EMG47048.1|  hypothetical protein G210_2680                          155   7e-38    
emb|CEG76925.1|  Putative DnaJ protein, subfamily B, member 4           155   7e-38    
ref|XP_002493650.1|  Nuclear type II J heat shock protein of the ...    155   8e-38    
emb|CDR47904.1|  CYFA0S39e00364g1_1                                     154   2e-37    
gb|EPB81499.1|  hypothetical protein HMPREF1544_11792                   153   4e-37    
emb|CDH55090.1|  -domain-containing protein                             153   4e-37    
emb|CDS14045.1|  hypothetical protein LRAMOSA06216                      152   8e-37    
gb|KFH69564.1|  hypothetical protein MVEG_04375                         152   1e-36    
emb|CDY00359.1|  BnaC07g14670D                                          146   1e-36    
ref|XP_448815.1|  hypothetical protein                                  150   2e-36    
ref|XP_002139725.1|  DnaJ domain-containing protein                     154   2e-36    
ref|XP_003330690.1|  DnaJ subfamily A member 2                          152   2e-36    
ref|XP_002772941.1|  conserved hypothetical protein                     155   3e-36    
ref|XP_001611513.1|  dnaJ domain containing protein                     154   4e-36    
ref|XP_627223.1|  DNAJ'DNAJ protein'                                    153   4e-36    
ref|XP_009690234.1|  molecular chaperone DnaJ                           152   6e-36    
ref|XP_004368307.1|  DnaJ domain containing protein                     152   6e-36    
ref|XP_007772175.1|  DnaJ-domain-containing protein                     150   1e-35    
ref|XP_668519.1|  hypothetical protein                                  152   1e-35    
gb|EIE88611.1|  hypothetical protein RO3G_13322                         149   2e-35    
gb|KCW64545.1|  hypothetical protein EUGRSUZ_G02152                     142   3e-35    
ref|XP_002173255.2|  DNAJ protein Caj1/Djp1-type                        147   3e-35    
ref|XP_764787.1|  hypothetical protein                                  149   5e-35    
ref|XP_447824.1|  hypothetical protein                                  146   5e-35    
ref|XP_006680249.1|  hypothetical protein BATDEDRAFT_12615              146   9e-35    
gb|EPY53873.1|  DNAJ protein Caj1/Djp1-type                             144   2e-34    
ref|XP_006678361.1|  hypothetical protein BATDEDRAFT_11241              145   2e-34    
ref|XP_006678336.1|  hypothetical protein BATDEDRAFT_11044              145   2e-34    
gb|EMT28787.1|  Chaperone protein dnaJ 10                               145   3e-34    
gb|EJK65219.1|  hypothetical protein THAOC_13951                        149   3e-34    
ref|XP_006689745.1|  DnaJ-domain-containing protein                     145   3e-34    
ref|XP_002497143.1|  ZYRO0D16390p                                       144   4e-34    
gb|EPX74070.1|  DNAJ protein Caj1/Djp1-type                             143   4e-34    
ref|XP_007878305.1|  hypothetical protein PFL1_02598                    146   5e-34    
emb|CDK26340.1|  unnamed protein product                                144   5e-34    
ref|XP_006681886.1|  hypothetical protein BATDEDRAFT_14188              143   6e-34    
ref|XP_006683166.1|  hypothetical protein BATDEDRAFT_14991              143   7e-34    
ref|XP_005714199.1|  unnamed protein product                            145   7e-34    
ref|XP_952494.1|  DnaJ protein                                          146   7e-34    
gb|KDN48460.1|  DnaJ-domain-containing protein                          146   7e-34    
ref|XP_647470.1|  DNAJ heat shock N-terminal domain-containing pr...    144   7e-34    
ref|XP_002259577.1|  DnaJ protein                                       145   1e-33    
ref|XP_008815205.1|  hypothetical protein C922_01377                    145   1e-33    
emb|CCE43839.1|  hypothetical protein CPAR2_500650                      143   1e-33    
ref|XP_003959816.1|  hypothetical protein KAFR_0L00740                  142   1e-33    
emb|CCK72753.1|  hypothetical protein KNAG_0L01330                      142   2e-33    
ref|XP_002183019.1|  3R-hydroxyacyl-[acyl carrier protein] dehydrase    144   2e-33    
gb|ESW98350.1|  Molecular chaperone (DnaJ superfamily)                  143   2e-33    
ref|XP_007366332.1|  DnaJ-domain-containing protein                     144   2e-33    
ref|XP_004828750.1|  DNAj/HSP40, putative                               144   2e-33    
ref|XP_004222780.1|  DnaJ protein                                       144   2e-33    
gb|ETW56329.1|  hypothetical protein PFUGPA_01694                       146   2e-33    
gb|ETW60568.1|  hypothetical protein PFMC_03563                         146   3e-33    
gb|ETW41856.1|  hypothetical protein PFNF135_03784                      146   3e-33    
gb|ETW48441.1|  hypothetical protein PFMALIP_03526                      146   3e-33    
ref|XP_001613724.1|  hypothetical protein                               144   3e-33    
gb|AFW83337.1|  hypothetical protein ZEAMMB73_852374                    140   3e-33    
gb|KDE09682.1|  hypothetical protein MVLG_00086                         143   3e-33    
ref|XP_003670516.1|  hypothetical protein NDAI_0E04560                  141   4e-33    
ref|XP_001643997.1|  hypothetical protein Kpol_1070p22                  141   4e-33    
gb|ETW30246.1|  hypothetical protein PFFCH_02329                        144   5e-33    
ref|XP_005642707.1|  DnaJ-domain-containing protein                     143   6e-33    
ref|XP_006676474.1|  hypothetical protein BATDEDRAFT_4191               140   7e-33    
emb|CAY79217.1|  Caj1p                                                  140   7e-33    
ref|XP_008044426.1|  DnaJ-domain-containing protein                     142   7e-33    
gb|EGA79185.1|  Caj1p                                                   140   7e-33    
ref|NP_010967.3|  Caj1p                                                 140   8e-33    
ref|XP_004361612.1|  DNAJ heat shock N-terminal domain-containing...    141   1e-32    
gb|ETW17849.1|  hypothetical protein PFFVO_03243                        144   1e-32    
gb|ETW35674.1|  hypothetical protein PFTANZ_03627                       144   1e-32    
gb|EWC75632.1|  hypothetical protein C923_03703                         144   1e-32    
gb|EHN07573.1|  Caj1p                                                   140   1e-32    
gb|EST05800.1|  molecular chaperone                                     141   1e-32    
emb|CDH14397.1|  probable protein CAJ1                                  139   2e-32    
gb|KDQ22743.1|  hypothetical protein PLEOSDRAFT_174970                  140   3e-32    
ref|XP_001840170.2|  chaperone regulator                                140   3e-32    
ref|XP_003683391.1|  hypothetical protein TDEL_0H03210                  139   3e-32    
ref|XP_004200499.1|  Piso0_003086                                       139   3e-32    
gb|EUR69659.1|  hypothetical protein PFBG_03683                         142   3e-32    
gb|KFM28276.1|  Chaperone protein dnaJ 10                               139   4e-32    
emb|CDH09089.1|  probable protein CAJ1                                  139   4e-32    
ref|XP_003683299.1|  hypothetical protein TDEL_0H02290                  138   4e-32    
ref|XP_007400365.1|  hypothetical protein PHACADRAFT_263235             139   4e-32    
ref|XP_007408128.1|  hypothetical protein MELLADRAFT_61850              140   4e-32    
ref|XP_007310137.1|  DnaJ-domain-containing protein                     139   5e-32    
emb|CDF88081.1|  BN860_01882g1_1                                        138   6e-32    
ref|XP_006958579.1|  DnaJ-domain-containing protein                     137   1e-31    
gb|EUT83211.1|  hypothetical protein PFAG_03628                         141   1e-31    
emb|CCF51731.1|  related to DnaJ-like protein                           139   1e-31    
emb|CDJ49878.1|  DnaJ domain-containing protein, putative               141   1e-31    
ref|XP_006679360.1|  hypothetical protein BATDEDRAFT_12013              137   1e-31    
gb|EGA62606.1|  Caj1p                                                   137   1e-31    
gb|EPB82732.1|  molecular chaperone DnaJ                                136   1e-31    
dbj|GAC98795.1|  hypothetical protein PHSY_006390                       138   1e-31    
gb|EJT98184.1|  DnaJ-domain-containing protein                          137   2e-31    
ref|XP_006457067.1|  hypothetical protein AGABI2DRAFT_195948            138   2e-31    
ref|XP_001348169.2|  DNAJ protein, putative                             140   2e-31    
ref|XP_002288806.1|  predicted protein                                  140   2e-31    
ref|XP_004829087.1|  hypothetical protein BEWA_022690                   137   2e-31    
emb|CDJ41417.1|  DnaJ domain-containing protein, putative               140   2e-31    
gb|EWC87679.1|  hypothetical protein PFNF54_03527                       140   2e-31    
ref|XP_002492123.1|  Cytosolic J-domain-containing protein              137   2e-31    
ref|XP_003674259.1|  hypothetical protein NCAS_0A13210                  137   2e-31    
gb|EHN02722.1|  Caj1p                                                   136   2e-31    
ref|XP_007842452.1|  chaperone regulator                                137   2e-31    
ref|XP_003002731.1|  CAJ1                                               135   3e-31    
emb|CDO65288.1|  DnaJ protein, putative                                 140   3e-31    



>ref|XP_009785160.1| PREDICTED: chaperone protein dnaJ 10-like [Nicotiana sylvestris]
Length=395

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/398 (86%), Positives = 369/398 (93%), Gaps = 3/398 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYD+LGVSP AT+++IKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD
Sbjct  1     MVKETEYYDILGVSPTATDSEIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             PAQRQAYDA+GKSGIST+AIIDPAAIFAMLFGSELFE+YIGQLAMASMASLDIFT+GE+F
Sbjct  61    PAQRQAYDAHGKSGISTDAIIDPAAIFAMLFGSELFEEYIGQLAMASMASLDIFTEGEDF  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             DAKKLQEKMRVVQREREEKLAE LK+RLN+YVQG+KE+F  HAEAEVSRLSNAAYGVDML
Sbjct  121   DAKKLQEKMRVVQREREEKLAETLKDRLNLYVQGNKEDFVRHAEAEVSRLSNAAYGVDML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQAAKELGKKA+YLGVPFIAEWFRNKGHFIKSQVTAATGA ALIQLQEDMKR
Sbjct  181   NTIGYIYARQAAKELGKKALYLGVPFIAEWFRNKGHFIKSQVTAATGAIALIQLQEDMKR  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLS EGNYTEEELEEYMQSHKK+MIDSLWKLNVADIE TLSRVCQMVLQDNNVKKEELRA
Sbjct  241   QLSTEGNYTEEELEEYMQSHKKLMIDSLWKLNVADIEATLSRVCQMVLQDNNVKKEELRA  300

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RAKGLKTLGK+FQ+VK  NGNETET+ N  V KLDG++PSYDS S   S +S N +E P 
Sbjct  301   RAKGLKTLGKIFQKVK--NGNETETTVNGQVHKLDGNDPSYDSRSSTASVQSSNKEEVPS  358

Query  696   TAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPGAERHA  583
             T FA QSPY+E PQF  GQF SY+FPMPTAPPGA+RHA
Sbjct  359   TVFASQSPYVEAPQFAGGQF-SYNFPMPTAPPGAQRHA  395



>ref|XP_009607660.1| PREDICTED: chaperone protein dnaJ 10 isoform X1 [Nicotiana tomentosiformis]
Length=395

 Score =   702 bits (1811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/398 (86%), Positives = 368/398 (92%), Gaps = 3/398 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYD+LGVSP ATE++IKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD
Sbjct  1     MVKETEYYDILGVSPTATESEIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             PAQRQAYDA+GKSGISTEAIIDPAAIFAMLFGSELFE+YIGQLAMASMASLDIFT+GE+F
Sbjct  61    PAQRQAYDAHGKSGISTEAIIDPAAIFAMLFGSELFEEYIGQLAMASMASLDIFTEGEDF  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             DAKKLQEKMRVVQREREEKLAE LK+RLN+YVQG+KE+F  HAEAEVS+LSNAAYGVDML
Sbjct  121   DAKKLQEKMRVVQREREEKLAETLKDRLNLYVQGNKEDFVRHAEAEVSKLSNAAYGVDML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQAAKELGKKA+YLGVPFIAEWFRNKGHFIKSQVTAATGA ALIQLQEDMKR
Sbjct  181   NTIGYIYARQAAKELGKKALYLGVPFIAEWFRNKGHFIKSQVTAATGAIALIQLQEDMKR  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLSAEGNYTEEELEEYMQSHKK+MIDSLWKLNVADIE TLSRVCQMVLQDNNVKKEELRA
Sbjct  241   QLSAEGNYTEEELEEYMQSHKKLMIDSLWKLNVADIEATLSRVCQMVLQDNNVKKEELRA  300

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RAKGLKTLGK+FQ+VK  NGNETET+ N  V KLDG++PS DS S   S +S N +E P 
Sbjct  301   RAKGLKTLGKIFQKVK--NGNETETTVNGQVHKLDGNDPSCDSRSSTASVQSSNKEEVPS  358

Query  696   TAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPGAERHA  583
             T F  QSPY+E PQF  GQF SY+FPMPTAPPGA+RHA
Sbjct  359   TVFVSQSPYVEAPQFAGGQF-SYNFPMPTAPPGAQRHA  395



>emb|CDP07233.1| unnamed protein product [Coffea canephora]
Length=397

 Score =   700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/397 (85%), Positives = 366/397 (92%), Gaps = 1/397 (0%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGVSP ATEA+IKKAYYIKARQVHPDKNPNDP AAQNFQVLGEAYQVLSD
Sbjct  1     MVKETEYYDVLGVSPAATEAEIKKAYYIKARQVHPDKNPNDPQAAQNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             PAQRQAYD YGKSGISTEAIIDPAAIFAMLFGSELFE+YIGQLAMASMASLDIFT+GE+F
Sbjct  61    PAQRQAYDNYGKSGISTEAIIDPAAIFAMLFGSELFEEYIGQLAMASMASLDIFTEGEDF  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             DAKKLQEKMRVVQ+EREEKLAEILK+RLN+YVQG+KE+F  HAE EVSRLSNAAYGVDML
Sbjct  121   DAKKLQEKMRVVQKEREEKLAEILKDRLNLYVQGNKEDFVCHAEGEVSRLSNAAYGVDML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQ+AKELGKKAIYLGVPF+AEWFRNKGHFIKSQVTAATGA ALIQLQEDMKR
Sbjct  181   NTIGYIYARQSAKELGKKAIYLGVPFVAEWFRNKGHFIKSQVTAATGAIALIQLQEDMKR  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLSAEGNYTEEELEEYMQSHKK+MIDSLWKLNVADIE TLSRVCQMVLQDNNVKKEELRA
Sbjct  241   QLSAEGNYTEEELEEYMQSHKKLMIDSLWKLNVADIEATLSRVCQMVLQDNNVKKEELRA  300

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RAKGLKTLGK+FQR KS N NETE +  +P+ KL+G +P YD+ S+N S+RS N D+ P 
Sbjct  301   RAKGLKTLGKIFQRAKSANENETEMATKSPLHKLNGGDPVYDAFSVNTSARSSNTDDLPA  360

Query  696   TAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPGAERH  586
             T F  QSPY+E PQF  GQ+ +Y+FPMPTAPPGA+RH
Sbjct  361   TPFVQQSPYVEAPQFSGGQY-TYNFPMPTAPPGAQRH  396



>ref|XP_009607661.1| PREDICTED: chaperone protein dnaJ 10 isoform X2 [Nicotiana tomentosiformis]
Length=394

 Score =   696 bits (1797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/398 (86%), Positives = 367/398 (92%), Gaps = 4/398 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYD+LGVSP ATE++IKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD
Sbjct  1     MVKETEYYDILGVSPTATESEIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             PAQRQAYDA+GKSGISTEAIIDPAAIFAMLFGSELFE+YIGQLAMASMASLDIFT+GE+F
Sbjct  61    PAQRQAYDAHGKSGISTEAIIDPAAIFAMLFGSELFEEYIGQLAMASMASLDIFTEGEDF  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             DAKKLQEKMRVVQREREEKLAE LK+RLN+YVQG+KE+F  HAEAEVS+LSNAAYGVDML
Sbjct  121   DAKKLQEKMRVVQREREEKLAETLKDRLNLYVQGNKEDFVRHAEAEVSKLSNAAYGVDML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQAAKELGKKA+YLGVPFIAEWFRNKGHFIKSQVTAATGA ALIQLQEDMKR
Sbjct  181   NTIGYIYARQAAKELGKKALYLGVPFIAEWFRNKGHFIKSQVTAATGAIALIQLQEDMKR  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLSAEGNYTEEELEEYMQSHKK+MIDSLWKLNVADIE TLSRVCQMVLQDNNVKKEELRA
Sbjct  241   QLSAEGNYTEEELEEYMQSHKKLMIDSLWKLNVADIEATLSRVCQMVLQDNNVKKEELRA  300

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RAKGLKTLGK+FQ VK  NGNETET+ N  V KLDG++PS DS S   S +S N +E P 
Sbjct  301   RAKGLKTLGKIFQ-VK--NGNETETTVNGQVHKLDGNDPSCDSRSSTASVQSSNKEEVPS  357

Query  696   TAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPGAERHA  583
             T F  QSPY+E PQF  GQF SY+FPMPTAPPGA+RHA
Sbjct  358   TVFVSQSPYVEAPQFAGGQF-SYNFPMPTAPPGAQRHA  394



>ref|XP_006342520.1| PREDICTED: chaperone protein dnaJ 10-like [Solanum tuberosum]
Length=394

 Score =   695 bits (1794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/397 (86%), Positives = 370/397 (93%), Gaps = 4/397 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYD+LGVSP ATE++IKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD
Sbjct  1     MVKETEYYDILGVSPTATESEIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P+QRQAYD +GKSGIST+AIIDPAAIFAMLFGSELFE+YIGQLAMASMASLDIFT+GE+F
Sbjct  61    PSQRQAYDVHGKSGISTDAIIDPAAIFAMLFGSELFEEYIGQLAMASMASLDIFTEGEDF  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             DA+KLQEKM+VVQREREEKLAE LK+RLN+YVQG+KE+F  HAEAEVSRLSNAAYGVDML
Sbjct  121   DARKLQEKMKVVQREREEKLAETLKDRLNLYVQGNKEDFVRHAEAEVSRLSNAAYGVDML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQ+AKELGKKA+YLGVPFIAEWFRNKGHFIKSQVTAATGA ALIQLQED+KR
Sbjct  181   NTIGYIYARQSAKELGKKALYLGVPFIAEWFRNKGHFIKSQVTAATGAIALIQLQEDLKR  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLSAEGNYTEEELEEYMQSHKK+MIDSLWKLNVADIE TLSRVCQMVLQDNNVKKEELRA
Sbjct  241   QLSAEGNYTEEELEEYMQSHKKLMIDSLWKLNVADIEATLSRVCQMVLQDNNVKKEELRA  300

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RAKGLKTLGK+FQ+VKSV  NETET+ N  V KLDG+EPSYDS S   S  SQN +E PY
Sbjct  301   RAKGLKTLGKIFQKVKSV--NETETTENG-VHKLDGNEPSYDSRSSTASVPSQNKEEVPY  357

Query  696   TAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPGAERH  586
             T FA QSPY+E PQF SGQ +SY+FPMPTAPPGA+RH
Sbjct  358   TVFASQSPYVEAPQFTSGQ-SSYNFPMPTAPPGAQRH  393



>ref|XP_004253109.1| PREDICTED: chaperone protein dnaJ 10 [Solanum lycopersicum]
Length=394

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/397 (86%), Positives = 368/397 (93%), Gaps = 4/397 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYD+LGVSP ATE++IKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD
Sbjct  1     MVKETEYYDILGVSPTATESEIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P+QRQAYDA+GKSGIST+AIIDPAAIFAMLFGSELFE+YIGQLAMASMASLDIFT+GE+F
Sbjct  61    PSQRQAYDAHGKSGISTDAIIDPAAIFAMLFGSELFEEYIGQLAMASMASLDIFTEGEDF  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             DA+KLQEKMRVVQREREEKLAE LK+RLNVYVQG+KE+F  HAEAEVSRLSNAAYGVDML
Sbjct  121   DARKLQEKMRVVQREREEKLAETLKDRLNVYVQGNKEDFVRHAEAEVSRLSNAAYGVDML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQ+AKELGKKA+YLGVPFIAEWFRNKGHFIKSQVTAATGA ALIQLQEDMKR
Sbjct  181   NTIGYIYARQSAKELGKKALYLGVPFIAEWFRNKGHFIKSQVTAATGAIALIQLQEDMKR  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLSAEGNYTEEELEEYMQSHKK+MIDSLWKLNVADIE TLSRVCQMVLQDNNVKKEELRA
Sbjct  241   QLSAEGNYTEEELEEYMQSHKKLMIDSLWKLNVADIEATLSRVCQMVLQDNNVKKEELRA  300

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RAKGLKTLGK+FQ+VK V  NE ET+ N  V KLDG+EPSYDS S   S  SQN +E PY
Sbjct  301   RAKGLKTLGKIFQKVKPV--NEVETTENG-VHKLDGNEPSYDSRSSTASVPSQNKEEVPY  357

Query  696   TAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPGAERH  586
             T FA QSPY+E PQF  GQ +SY+FPMPTAPPGA+RH
Sbjct  358   TVFASQSPYVEAPQFTGGQ-SSYNFPMPTAPPGAQRH  393



>ref|XP_010664055.1| PREDICTED: chaperone protein dnaJ 10 isoform X2 [Vitis vinifera]
Length=403

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/400 (84%), Positives = 368/400 (92%), Gaps = 0/400 (0%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLG+SP ATEA+IKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD
Sbjct  1     MVKETEYYDVLGISPSATEAEIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P+QRQAYDA+GKSGIST++II+PAAIFAMLFGSELFE+YIGQLAMASMASLDIFT+GE+F
Sbjct  61    PSQRQAYDAHGKSGISTDSIIEPAAIFAMLFGSELFEEYIGQLAMASMASLDIFTEGEQF  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             DAKKLQEKMRVVQ+EREEKLA+ILK+RLN YVQG+KE+F  HAEAE+SRLSNAAYGVDML
Sbjct  121   DAKKLQEKMRVVQKEREEKLADILKDRLNQYVQGNKEDFVNHAEAELSRLSNAAYGVDML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGA ALIQLQEDMK+
Sbjct  181   NTIGYIYARQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAIALIQLQEDMKK  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLSAEGNYTEEELEEYMQSHKK+MIDSLWKLNVADIE TLSRVCQMVLQDNN KKEELRA
Sbjct  241   QLSAEGNYTEEELEEYMQSHKKLMIDSLWKLNVADIEATLSRVCQMVLQDNNCKKEELRA  300

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RAKGLKTLGK+FQRVKS NGNE E   N+ V KL+GSEPS+D+ S + S +S N +E  Y
Sbjct  301   RAKGLKTLGKIFQRVKSSNGNEDEAMLNSAVHKLNGSEPSHDACSPSTSPKSSNLEEQSY  360

Query  696   TAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPGAERHA*T  577
             TAFA QSPY+E PQF   Q+N  +FPMPTAPPGA+R + T
Sbjct  361   TAFASQSPYVEAPQFAGAQYNYSNFPMPTAPPGAQRDSST  400



>ref|XP_002278176.1| PREDICTED: chaperone protein dnaJ 10 isoform X1 [Vitis vinifera]
 ref|XP_010664052.1| PREDICTED: chaperone protein dnaJ 10 isoform X1 [Vitis vinifera]
 ref|XP_010664053.1| PREDICTED: chaperone protein dnaJ 10 isoform X1 [Vitis vinifera]
 ref|XP_010664054.1| PREDICTED: chaperone protein dnaJ 10 isoform X1 [Vitis vinifera]
 emb|CBI40809.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   688 bits (1775),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/402 (84%), Positives = 368/402 (92%), Gaps = 2/402 (0%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLG+SP ATEA+IKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD
Sbjct  1     MVKETEYYDVLGISPSATEAEIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P+QRQAYDA+GKSGIST++II+PAAIFAMLFGSELFE+YIGQLAMASMASLDIFT+GE+F
Sbjct  61    PSQRQAYDAHGKSGISTDSIIEPAAIFAMLFGSELFEEYIGQLAMASMASLDIFTEGEQF  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             DAKKLQEKMRVVQ+EREEKLA+ILK+RLN YVQG+KE+F  HAEAE+SRLSNAAYGVDML
Sbjct  121   DAKKLQEKMRVVQKEREEKLADILKDRLNQYVQGNKEDFVNHAEAELSRLSNAAYGVDML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGA ALIQLQEDMK+
Sbjct  181   NTIGYIYARQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAIALIQLQEDMKK  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLSAEGNYTEEELEEYMQSHKK+MIDSLWKLNVADIE TLSRVCQMVLQDNN KKEELRA
Sbjct  241   QLSAEGNYTEEELEEYMQSHKKLMIDSLWKLNVADIEATLSRVCQMVLQDNNCKKEELRA  300

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RAKGLKTLGK+FQRVKS NGNE E   N+ V KL+GSEPS+D+ S + S +S N +E  Y
Sbjct  301   RAKGLKTLGKIFQRVKSSNGNEDEAMLNSAVHKLNGSEPSHDACSPSTSPKSSNLEEQSY  360

Query  696   TAFA--VQSPYIETPQFGSGQFNSYDFPMPTAPPGAERHA*T  577
             TAFA   QSPY+E PQF   Q+N  +FPMPTAPPGA+R + T
Sbjct  361   TAFASQFQSPYVEAPQFAGAQYNYSNFPMPTAPPGAQRDSST  402



>ref|XP_011074038.1| PREDICTED: chaperone protein dnaJ 10-like [Sesamum indicum]
 ref|XP_011074039.1| PREDICTED: chaperone protein dnaJ 10-like [Sesamum indicum]
Length=396

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/397 (83%), Positives = 359/397 (90%), Gaps = 2/397 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGVSP ATEA+IKKAYY+KARQVHPDKNPNDPLAAQNFQ+LGEAYQVLSD
Sbjct  1     MVKETEYYDVLGVSPTATEAEIKKAYYVKARQVHPDKNPNDPLAAQNFQILGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             PAQRQAYDAYGKSGISTE+IIDPAAIFAMLFGSELFE+YIGQLAMASMASLD+FT+GEEF
Sbjct  61    PAQRQAYDAYGKSGISTESIIDPAAIFAMLFGSELFEEYIGQLAMASMASLDVFTEGEEF  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D KKLQEKMR VQREREEKLA ILK+RLN+YVQG+KEEF   AEAEV+RLSNAAYGVDML
Sbjct  121   DTKKLQEKMRTVQREREEKLAGILKDRLNLYVQGNKEEFIHQAEAEVARLSNAAYGVDML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             +TIGYIY RQAAKELGKK I+LG+PF+AEWFRNKGHFIKSQVTAATGA ALIQLQEDMKR
Sbjct  181   STIGYIYARQAAKELGKKVIFLGMPFVAEWFRNKGHFIKSQVTAATGAIALIQLQEDMKR  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLSAEGNYTEEELEEYMQSHKK+MIDSLWKLNVADIE TLSRVCQMVLQDN  KKEELR 
Sbjct  241   QLSAEGNYTEEELEEYMQSHKKLMIDSLWKLNVADIEATLSRVCQMVLQDNTAKKEELRL  300

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RAKGLKTLGK+FQRVKSVNGN++E+  + P+ KL+ SEPS  S + N S+RS + +E PY
Sbjct  301   RAKGLKTLGKIFQRVKSVNGNDSESMLSDPIHKLNKSEPSNTSATSNTSARSLSNEEGPY  360

Query  696   TAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPGAERH  586
              A   QSPY+E+PQF   QFN  +FPMPTAPPGA R 
Sbjct  361   IASGAQSPYVESPQFAGAQFN--NFPMPTAPPGAHRQ  395



>ref|XP_007018601.1| DNAJ heat shock N-terminal domain-containing protein isoform 
1 [Theobroma cacao]
 gb|EOY15826.1| DNAJ heat shock N-terminal domain-containing protein isoform 
1 [Theobroma cacao]
Length=401

 Score =   675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/401 (83%), Positives = 363/401 (91%), Gaps = 5/401 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGVSP ATEA+IKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD
Sbjct  1     MVKETEYYDVLGVSPSATEAEIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             PAQRQAYDAYGKSGISTEAIIDPAA+FAMLFGSELFE+YIGQLAMASMASLDIFT+GE+F
Sbjct  61    PAQRQAYDAYGKSGISTEAIIDPAAVFAMLFGSELFEEYIGQLAMASMASLDIFTEGEQF  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             DAKKLQEKMR+VQ+EREEKLAEIL +RLN YVQG+KEEF  HA+AEVSRLSNAAYGVDML
Sbjct  121   DAKKLQEKMRIVQKEREEKLAEILIDRLNQYVQGNKEEFVNHAKAEVSRLSNAAYGVDML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTA TGA AL+QLQEDMK+
Sbjct  181   NTIGYIYVRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAVTGALALLQLQEDMKK  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLSAEGNYTEEELEEYMQSHKK+MIDSLWKLNVADIE TLSRVCQMVLQDNN KKEELRA
Sbjct  241   QLSAEGNYTEEELEEYMQSHKKLMIDSLWKLNVADIEATLSRVCQMVLQDNNSKKEELRA  300

Query  876   RAKGLKTLGKVFQRVKSVNGNETET----SANTPVQKLDGSEPSYDSHSLNPSSRSQNAD  709
             RAKGLKTLGK+FQR KS NG+E+E+    + ++ V  L+GSEPSYD  S N S +S N +
Sbjct  301   RAKGLKTLGKIFQRAKSANGSESESVLTDTVHSTVYTLNGSEPSYDGSSPNASPKSLNQE  360

Query  708   EAPYTAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPGAERH  586
             ++  + FA QSPY+E P F   QF +Y+FP PTAPPGA+R+
Sbjct  361   DSSCSTFAAQSPYVEAPNFADAQF-TYNFPRPTAPPGAQRN  400



>ref|XP_009340779.1| PREDICTED: chaperone protein dnaJ 10-like [Pyrus x bretschneideri]
 ref|XP_009345028.1| PREDICTED: chaperone protein dnaJ 10-like [Pyrus x bretschneideri]
Length=402

 Score =   675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/398 (83%), Positives = 358/398 (90%), Gaps = 1/398 (0%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGVSP ATEA+IKKAYY+KARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD
Sbjct  1     MVKETEYYDVLGVSPAATEAEIKKAYYMKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P+QRQAYDAYGKSGIST+AIIDPAAIFAMLFGSELFE+YIGQLAMASMASLDIFT+GE+F
Sbjct  61    PSQRQAYDAYGKSGISTDAIIDPAAIFAMLFGSELFEEYIGQLAMASMASLDIFTEGEQF  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             DAKKLQEKMRVVQ+EREEKLAE LKNRLN YVQG+KEEF +HAEAEV+RLSNAAYGVDML
Sbjct  121   DAKKLQEKMRVVQKEREEKLAETLKNRLNQYVQGNKEEFVSHAEAEVARLSNAAYGVDML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQ+AKELGKKA+YLGVPF+AEWFRNKGHFIKSQVTAATGA ALIQLQEDMK+
Sbjct  181   NTIGYIYARQSAKELGKKAMYLGVPFVAEWFRNKGHFIKSQVTAATGAIALIQLQEDMKK  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLSAEGNYTEEELEEYMQSHKK+MIDSLWKLNVADIE TLSRVCQMVLQDNN KKEELRA
Sbjct  241   QLSAEGNYTEEELEEYMQSHKKVMIDSLWKLNVADIEATLSRVCQMVLQDNNAKKEELRA  300

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RAKGLKTLGK+FQR KS  GNE ET  N+ V KL+GSE  YD  S   + +S   +E  Y
Sbjct  301   RAKGLKTLGKIFQRTKSTGGNEGETPQNSRVHKLNGSELRYDPSSPITTPKSLKPEEPSY  360

Query  696   TAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPGAERHA  583
             TAF  QSPY+E PQ    Q + Y FP PTAPPGA+RH+
Sbjct  361   TAFEPQSPYVEAPQIAGAQLD-YHFPRPTAPPGAQRHS  397



>ref|XP_008387278.1| PREDICTED: chaperone protein dnaJ 10-like [Malus domestica]
Length=402

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/398 (83%), Positives = 357/398 (90%), Gaps = 1/398 (0%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGVSP ATEA+IKKAYY+KARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD
Sbjct  1     MVKETEYYDVLGVSPAATEAEIKKAYYMKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P+QRQAYDAYGKSGIST+AIIDPAAIFAMLFGSELFE+YIGQLAMASMASLDIFT+GE+F
Sbjct  61    PSQRQAYDAYGKSGISTDAIIDPAAIFAMLFGSELFEEYIGQLAMASMASLDIFTEGEQF  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             DAKKLQ+KMRVVQ+EREEKLAE LKNRLN YVQG+KEEF +HAEAEV+RLSNAAYGVDML
Sbjct  121   DAKKLQDKMRVVQKEREEKLAETLKNRLNQYVQGNKEEFVSHAEAEVARLSNAAYGVDML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQ+AKELGKKA+YLGVPF+AEWFRNKGHFIKSQVTAATGA ALIQLQEDMK+
Sbjct  181   NTIGYIYARQSAKELGKKAMYLGVPFVAEWFRNKGHFIKSQVTAATGAIALIQLQEDMKK  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLSAEGNYTEEELEEYMQSHKK+MIDSLWKLNVADIE TLSRVCQMVLQDNN KKEELRA
Sbjct  241   QLSAEGNYTEEELEEYMQSHKKVMIDSLWKLNVADIEATLSRVCQMVLQDNNAKKEELRA  300

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RAKGLKTLGK+FQR KS  GNE ET  N+ V KL+GSE  YD  S   + +S   +E  Y
Sbjct  301   RAKGLKTLGKIFQRTKSTGGNEGETPQNSRVHKLNGSELRYDPSSPITTPKSSKPEEPSY  360

Query  696   TAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPGAERHA  583
              AF  QSPY+E PQ    Q + Y FP PTAPPGA+RH+
Sbjct  361   AAFEPQSPYVEAPQIAGAQLD-YHFPRPTAPPGAQRHS  397



>gb|KDP36705.1| hypothetical protein JCGZ_07996 [Jatropha curcas]
Length=401

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/400 (83%), Positives = 360/400 (90%), Gaps = 2/400 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGVSP ATEA+IKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD
Sbjct  1     MVKETEYYDVLGVSPTATEAEIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFT+GE+F
Sbjct  61    PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTEGEQF  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D KKLQEKMRVVQ+EREEKLA+ILK+RLN YVQG+ +EF  HAEAEV+RLSNAAYGVDML
Sbjct  121   DTKKLQEKMRVVQKEREEKLAQILKDRLNQYVQGNTKEFSCHAEAEVTRLSNAAYGVDML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQAAKELGKKA+YLGVPFIAEWFRNKGHFIKSQVTAATGA ALIQLQEDMK+
Sbjct  181   NTIGYIYARQAAKELGKKALYLGVPFIAEWFRNKGHFIKSQVTAATGAIALIQLQEDMKK  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLSAEGNYTEEELEEYMQSHKK+MIDSLWKLNVADIE TLSRVCQMVLQDN VKKEELRA
Sbjct  241   QLSAEGNYTEEELEEYMQSHKKLMIDSLWKLNVADIEATLSRVCQMVLQDNTVKKEELRA  300

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RAKGLKTLGK+FQRVKS NG+E++   +  + KL+GSE S+D    + S +S+N +E  Y
Sbjct  301   RAKGLKTLGKIFQRVKSSNGSESDPVLDGTLHKLNGSEVSHDISCPSTSPKSRNLEEPSY  360

Query  696   TAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPGAERHA*T  577
             +  A QSPY+E P F   QF+  +FP PTAPPGA +H+ T
Sbjct  361   STLASQSPYVEAPNFAGAQFD--NFPRPTAPPGASKHSST  398



>ref|XP_009340155.1| PREDICTED: chaperone protein dnaJ 10-like [Pyrus x bretschneideri]
Length=405

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/401 (82%), Positives = 358/401 (89%), Gaps = 4/401 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGVSP ATEA+IKKAYY+KARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD
Sbjct  1     MVKETEYYDVLGVSPSATEAEIKKAYYVKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P+QRQAYDA GKSGIST+AIIDPAAIFAMLFGSELFE+YIGQLAMASMASLDIFT+GE+F
Sbjct  61    PSQRQAYDANGKSGISTDAIIDPAAIFAMLFGSELFEEYIGQLAMASMASLDIFTEGEQF  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D KKLQEKMRVVQ+EREEKLAE LKNRLN YVQG+KEEF +HAEAEV+RLSNAAYGVDML
Sbjct  121   DPKKLQEKMRVVQKEREEKLAETLKNRLNQYVQGNKEEFVSHAEAEVARLSNAAYGVDML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQ+AKELGKKAIYLGVPF+AEWFRNKGHFIKSQVTAATGA AL+QLQEDMK+
Sbjct  181   NTIGYIYARQSAKELGKKAIYLGVPFVAEWFRNKGHFIKSQVTAATGAIALLQLQEDMKK  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLSAEGNYTEEELEEYMQSHKK+MIDSLWKLNVADIE TLSRVCQMVLQD+N KKEELRA
Sbjct  241   QLSAEGNYTEEELEEYMQSHKKLMIDSLWKLNVADIEATLSRVCQMVLQDSNAKKEELRA  300

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RAKGLKTLG++FQR KS  GN+ E + N+ V KL+GSE S D+ S   + +S N DE  Y
Sbjct  301   RAKGLKTLGRIFQRTKSTGGNDGEPAQNSRVHKLNGSESSNDTSSPITTPKSSNLDEPSY  360

Query  696   TAF---AVQSPYIETPQFGSGQFNSYDFPMPTAPPGAERHA  583
             TAF     QSPY+E PQ    Q N Y FP PTAPPGA+RH+
Sbjct  361   TAFEPQVSQSPYVEAPQIAGAQLN-YHFPRPTAPPGAQRHS  400



>ref|XP_010094476.1| Chaperone protein dnaJ 10 [Morus notabilis]
 gb|EXB56230.1| Chaperone protein dnaJ 10 [Morus notabilis]
Length=409

 Score =   666 bits (1719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/405 (83%), Positives = 359/405 (89%), Gaps = 10/405 (2%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGVSP ATEA+IKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD
Sbjct  1     MVKETEYYDVLGVSPSATEAEIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P+QRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFE+YIGQLAMASMASLDIFT+GE+F
Sbjct  61    PSQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEEYIGQLAMASMASLDIFTEGEQF  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D KKLQ+KMRVVQ+EREEKLA+ILK+RLN YVQG+K++F  HA AEV+RLSNAAYGVDML
Sbjct  121   DTKKLQDKMRVVQKEREEKLAQILKDRLNQYVQGNKDDFINHAIAEVTRLSNAAYGVDML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQAAKELGKKAIYLGVPF+AEWFRNKGHFIKSQVTAATGA ALIQLQEDMK+
Sbjct  181   NTIGYIYARQAAKELGKKAIYLGVPFVAEWFRNKGHFIKSQVTAATGAIALIQLQEDMKK  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLSAEGNYTEEELEEYMQSHKK+MIDSLWKLNVADIE T SRVCQMVLQDN VKKEELRA
Sbjct  241   QLSAEGNYTEEELEEYMQSHKKLMIDSLWKLNVADIEATFSRVCQMVLQDNTVKKEELRA  300

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSS----RSQNAD  709
             RAKGLKTLGK+FQ VKS NGNE ET  N  V KL+GSE SYD  S  P S     S N +
Sbjct  301   RAKGLKTLGKIFQGVKSTNGNEGETVLNAEVHKLNGSESSYDPCS--PVSVATPTSSNLE  358

Query  708   EAPYTAFA---VQSPYIETPQFGSGQFNSYDFPMPTAPPGAERHA  583
                YT FA    QSPY+E PQF  GQF  Y+FP PTAPPGA+RH+
Sbjct  359   GQSYTTFASQPSQSPYVEAPQFPGGQFE-YNFPKPTAPPGAQRHS  402



>ref|XP_002510765.1| Chaperone protein dnaJ, putative [Ricinus communis]
 gb|EEF52952.1| Chaperone protein dnaJ, putative [Ricinus communis]
Length=400

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/400 (83%), Positives = 359/400 (90%), Gaps = 3/400 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGVSP ATEA+IKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD
Sbjct  1     MVKETEYYDVLGVSPTATEAEIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFT+GE+F
Sbjct  61    PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTEGEQF  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D KKLQEKMRVVQ+EREEKLA ILKNRLN YVQ +KEEF  HAEAEV+RLSNAAYGVDML
Sbjct  121   DTKKLQEKMRVVQKEREEKLARILKNRLNQYVQ-NKEEFINHAEAEVTRLSNAAYGVDML  179

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGA ALIQLQEDMK+
Sbjct  180   NTIGYIYVRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAIALIQLQEDMKK  239

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLSAEGNYTEEELEEYMQSHKK+MIDSLWKLNVADIE TLSRVCQMVLQDN+VKKEELRA
Sbjct  240   QLSAEGNYTEEELEEYMQSHKKLMIDSLWKLNVADIEATLSRVCQMVLQDNSVKKEELRA  299

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RAKGLKTLGK+FQRVKS NG+E++T     + KL+GS P +D+ S + S +S+N +E  Y
Sbjct  300   RAKGLKTLGKIFQRVKSSNGSESDTMLGGALHKLNGSAPGHDTSSPSTSPKSRNLEEPSY  359

Query  696   TAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPGAERHA*T  577
                  QSPY+E P F   QF+  +FP PTAPPGA +H+ T
Sbjct  360   RTLTSQSPYVEAPHFAGTQFD--NFPRPTAPPGAPKHSST  397



>ref|XP_002300601.2| hypothetical protein POPTR_0002s00230g [Populus trichocarpa]
 ref|XP_006386116.1| hypothetical protein POPTR_0002s00230g [Populus trichocarpa]
 gb|EEE79874.2| hypothetical protein POPTR_0002s00230g [Populus trichocarpa]
 gb|ERP63913.1| hypothetical protein POPTR_0002s00230g [Populus trichocarpa]
Length=402

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/402 (82%), Positives = 355/402 (88%), Gaps = 1/402 (0%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGVSP ATEA+IKKAYYIKARQVHPDKNPNDPLAA NFQVLGEAYQVLSD
Sbjct  1     MVKETEYYDVLGVSPTATEAEIKKAYYIKARQVHPDKNPNDPLAALNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             PAQRQAYDA GKSGISTEAII+PAAIFAMLFGSELFE YIGQLAMASMASLDIFT+GE+ 
Sbjct  61    PAQRQAYDANGKSGISTEAIIEPAAIFAMLFGSELFEVYIGQLAMASMASLDIFTEGEQL  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D KKLQEKMRVVQREREEKLAEILK+RLN YVQG+KEEF  HAEAEV+RLSNAAYGVDML
Sbjct  121   DTKKLQEKMRVVQREREEKLAEILKDRLNQYVQGNKEEFINHAEAEVARLSNAAYGVDML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQAAKELGKK IYLGVPFIAEWFRNKGHFIKSQVTAATGA ALIQLQE+MK+
Sbjct  181   NTIGYIYARQAAKELGKKVIYLGVPFIAEWFRNKGHFIKSQVTAATGAIALIQLQEEMKK  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLSAEGNYTEEELE Y+ SHKK+M DSLWKLNVADIE TLSRVCQMVLQDN+VKKEELRA
Sbjct  241   QLSAEGNYTEEELEAYILSHKKLMTDSLWKLNVADIEATLSRVCQMVLQDNSVKKEELRA  300

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RAKGLKTLG +FQRVK  NG E ET     + +L+G EPS D+ S N S +S++ +EA Y
Sbjct  301   RAKGLKTLGTIFQRVKLANGGEGETVLGGSLHQLNGREPSSDAFSPNTSPKSKSPEEASY  360

Query  696   TAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPGAERHA*TCS  571
             +  A QSPY+E P F   QFN ++FP PTAPPGA+RH+ T S
Sbjct  361   STLASQSPYVEAPHFDGAQFN-HNFPRPTAPPGAQRHSSTGS  401



>ref|XP_007202175.1| hypothetical protein PRUPE_ppa006574mg [Prunus persica]
 gb|EMJ03374.1| hypothetical protein PRUPE_ppa006574mg [Prunus persica]
Length=405

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/401 (81%), Positives = 359/401 (90%), Gaps = 4/401 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGVSP ATEA+IKKAYY+KARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD
Sbjct  1     MVKETEYYDVLGVSPTATEAEIKKAYYMKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QRQAYDA+GKSGIST++IIDPAAIFAMLFGSELFE+YIGQLAMASMASLDIF++GE+F
Sbjct  61    PGQRQAYDAFGKSGISTDSIIDPAAIFAMLFGSELFEEYIGQLAMASMASLDIFSEGEQF  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D KKLQEKMRVVQREREEKLAE LKNRLN YVQG+KE+F +HAEAEV+RLSNAAYGVDML
Sbjct  121   DPKKLQEKMRVVQREREEKLAETLKNRLNQYVQGNKEDFVSHAEAEVARLSNAAYGVDML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQ+AKELGKKA+YLGVPFIAEWFRNKGHFIKSQVTAATGA ALIQLQEDMK+
Sbjct  181   NTIGYIYARQSAKELGKKALYLGVPFIAEWFRNKGHFIKSQVTAATGAIALIQLQEDMKK  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLSAEGNYTEEELEEYM S+KK+MIDSLWKLNVADIE TLSRVCQMVLQDNN KKEELRA
Sbjct  241   QLSAEGNYTEEELEEYMSSNKKLMIDSLWKLNVADIEATLSRVCQMVLQDNNAKKEELRA  300

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RAKGLKTLGK+FQR KS +G+E ET+ N+ V  L+GSE  YD+ S   + ++ N +E  Y
Sbjct  301   RAKGLKTLGKIFQRTKSTSGSEGETAQNSGVHILNGSESRYDACSPITTPKASNPEEPSY  360

Query  696   TAFA---VQSPYIETPQFGSGQFNSYDFPMPTAPPGAERHA  583
             T FA    QSPY+E PQ    QF+ Y FP PTAPPGA+RH+
Sbjct  361   TVFASQVSQSPYVEAPQIAGAQFD-YHFPRPTAPPGAQRHS  400



>ref|XP_009334974.1| PREDICTED: chaperone protein dnaJ 10-like [Pyrus x bretschneideri]
Length=427

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/408 (80%), Positives = 359/408 (88%), Gaps = 4/408 (1%)
 Frame = -2

Query  1797  IRGNSRSMVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGE  1618
             +R + R    ETEYYDVLGVSP ATEA+IKKAYY+KARQVHPDKNPNDPLAAQNFQVLGE
Sbjct  16    LRRSRRQPGGETEYYDVLGVSPSATEAEIKKAYYVKARQVHPDKNPNDPLAAQNFQVLGE  75

Query  1617  AYQVLSDPAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDI  1438
             AYQVLSDP+QRQAYDA GKSGIST+AIIDPAAIFAMLFGSELFE+YIGQLAMASMASLDI
Sbjct  76    AYQVLSDPSQRQAYDANGKSGISTDAIIDPAAIFAMLFGSELFEEYIGQLAMASMASLDI  135

Query  1437  FTDGEEFDAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNA  1258
             FT+GE+FD KKLQEKMRVVQ+EREEKLAE LKNRLN YVQG+KEEF +HAEAEV+RLSNA
Sbjct  136   FTEGEQFDPKKLQEKMRVVQKEREEKLAETLKNRLNQYVQGNKEEFVSHAEAEVARLSNA  195

Query  1257  AYGVDMLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQ  1078
             AYGVDMLNTIGYIY RQ+AKELGKKAIYLGVPF+AEWFRNKGHFIKSQVTAATGA AL+Q
Sbjct  196   AYGVDMLNTIGYIYARQSAKELGKKAIYLGVPFVAEWFRNKGHFIKSQVTAATGAIALLQ  255

Query  1077  LQEDMKRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNV  898
             LQEDMK+QLSAEGNYTEEELEEYMQSHKK+MIDSLWKLNVADIE TLSRVCQMVLQD+N 
Sbjct  256   LQEDMKKQLSAEGNYTEEELEEYMQSHKKLMIDSLWKLNVADIEATLSRVCQMVLQDSNA  315

Query  897   KKEELRARAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQ  718
             KKEELRARAKGLKTLG++FQR KS  GN+ E + N+ V KL+GSE S D+ S   + +S 
Sbjct  316   KKEELRARAKGLKTLGRIFQRTKSTGGNDGEPAQNSRVHKLNGSESSNDTSSPITTPKSS  375

Query  717   NADEAPYTAF---AVQSPYIETPQFGSGQFNSYDFPMPTAPPGAERHA  583
             N DE  YTAF     QSPY+E PQ    Q N Y FP PTAPPGA+RH+
Sbjct  376   NLDEPSYTAFEPQVSQSPYVEAPQIAGAQLN-YHFPRPTAPPGAQRHS  422



>ref|XP_011034733.1| PREDICTED: chaperone protein dnaJ 10 isoform X1 [Populus euphratica]
Length=402

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/402 (81%), Positives = 356/402 (89%), Gaps = 1/402 (0%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGV+P ATE +IKKAYYIKAR+VHPDKNPNDPLAAQNFQVLGEAYQVLSD
Sbjct  1     MVKETEYYDVLGVNPTATEGEIKKAYYIKARRVHPDKNPNDPLAAQNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             PAQRQAYDA+GKSGISTEAII+PAAIFAMLFGSELFE YIGQLAMASMASLDIFT+GE+ 
Sbjct  61    PAQRQAYDAHGKSGISTEAIIEPAAIFAMLFGSELFEVYIGQLAMASMASLDIFTEGEQL  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D KKLQEKMRVVQREREEKLAEILK+RLN YVQG+KEEF  HAEAEV+RLSNAAYGVDML
Sbjct  121   DTKKLQEKMRVVQREREEKLAEILKDRLNQYVQGNKEEFINHAEAEVARLSNAAYGVDML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQAAKELGKK IYLGVPFIAEWFRNKGHFIKSQVTAATGA ALIQLQE+MK+
Sbjct  181   NTIGYIYARQAAKELGKKVIYLGVPFIAEWFRNKGHFIKSQVTAATGAIALIQLQEEMKK  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLSAEGNYTEEELE Y+ SHK++M DSLWKLNVADIE TLSRVCQMVLQDN+VKKEELRA
Sbjct  241   QLSAEGNYTEEELEAYILSHKQLMTDSLWKLNVADIEATLSRVCQMVLQDNSVKKEELRA  300

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RAKGLKTLGK+FQRVK  NG E ET     + +L+G  PS D+ S N S +S++ +EA Y
Sbjct  301   RAKGLKTLGKIFQRVKLANGGEGETVLGGSLHQLNGRVPSSDAFSPNTSPKSKSLEEASY  360

Query  696   TAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPGAERHA*TCS  571
             +  A QSPY+E P F   QFN Y+FP PTAPPGA+RH+ T S
Sbjct  361   STLASQSPYVEAPHFDGAQFN-YNFPRPTAPPGAQRHSSTGS  401



>ref|XP_002307837.2| DNAJ heat shock N-terminal domain-containing family protein [Populus 
trichocarpa]
 gb|EEE94833.2| DNAJ heat shock N-terminal domain-containing family protein [Populus 
trichocarpa]
Length=402

 Score =   660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/402 (82%), Positives = 359/402 (89%), Gaps = 1/402 (0%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGVSP ATEA+IKKAYYI+ARQVHPDKNPNDPLAA+NFQ LGEAYQVLSD
Sbjct  1     MVKETEYYDVLGVSPTATEAEIKKAYYIRARQVHPDKNPNDPLAAKNFQTLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             PAQRQAYDAYGKSGISTEAII+PAAIFAMLFGSELF DYIGQLAMASMASLDIFT+GE+ 
Sbjct  61    PAQRQAYDAYGKSGISTEAIIEPAAIFAMLFGSELFVDYIGQLAMASMASLDIFTEGEQL  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D KKLQEKMRVVQ+EREEKLAEILK+RLN YVQG+KEEF  HAEAEV+RLSNAAYG DML
Sbjct  121   DTKKLQEKMRVVQKEREEKLAEILKDRLNQYVQGNKEEFIKHAEAEVARLSNAAYGADML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQAAKELGKKAIYLGVPFIAEWFRNKGH IKSQVTAATGA ALIQLQED+K+
Sbjct  181   NTIGYIYARQAAKELGKKAIYLGVPFIAEWFRNKGHSIKSQVTAATGAIALIQLQEDIKK  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLSAEGNYTEEELE YMQSHKK+M DSLWKLNVADIE TLSRVCQMVLQDN+VKKEELRA
Sbjct  241   QLSAEGNYTEEELEAYMQSHKKLMTDSLWKLNVADIEATLSRVCQMVLQDNSVKKEELRA  300

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RAKGLKTLGK+FQ +KSV+G E E      + KL+G EPS+D+ S + S +S++ +EA Y
Sbjct  301   RAKGLKTLGKIFQSMKSVDGGEGEPVLGGSLHKLNGREPSFDACSPSTSPKSKSPEEASY  360

Query  696   TAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPGAERHA*TCS  571
             +  A QSPY+E PQF   QFN Y+FP PTAPPGA+RH+ T S
Sbjct  361   STLASQSPYVEAPQFNGAQFN-YNFPRPTAPPGAQRHSSTGS  401



>ref|XP_011041091.1| PREDICTED: chaperone protein dnaJ 10-like [Populus euphratica]
Length=402

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/402 (81%), Positives = 357/402 (89%), Gaps = 1/402 (0%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGVSP ATEA+IKKAYYI+ARQVHPDKNPNDPLAA+NFQ LGEAYQVLSD
Sbjct  1     MVKETEYYDVLGVSPTATEAEIKKAYYIRARQVHPDKNPNDPLAAKNFQTLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             PAQRQAYDAYGKSGISTEAII+PAAIFAMLFGSELF DYIGQLAMASMASLDIF +GE+ 
Sbjct  61    PAQRQAYDAYGKSGISTEAIIEPAAIFAMLFGSELFGDYIGQLAMASMASLDIFPEGEQL  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D KKLQEKMRVVQ+EREEKLAEILK+RLN YVQG+KEEF  HAEAEV+RLSNAAYG DML
Sbjct  121   DTKKLQEKMRVVQKEREEKLAEILKDRLNQYVQGNKEEFIKHAEAEVARLSNAAYGADML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQAAKELGKKAIYLGVPFIAEWFRNKGH IKSQVTAATGA ALIQLQED+K+
Sbjct  181   NTIGYIYARQAAKELGKKAIYLGVPFIAEWFRNKGHSIKSQVTAATGAIALIQLQEDIKK  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLSAEGNYTEEELE YMQSHKK+M DSLWKLNVADIE TLSRVCQMVLQDN+VKKEELRA
Sbjct  241   QLSAEGNYTEEELEAYMQSHKKLMTDSLWKLNVADIEATLSRVCQMVLQDNSVKKEELRA  300

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RAKGLKTLGK+FQ +KSV+G E E      + KL+G EPS+D+ S + S +S++ +EA Y
Sbjct  301   RAKGLKTLGKIFQSMKSVDGGEGEPVLGGSLHKLNGREPSFDACSPSTSPKSKSPEEASY  360

Query  696   TAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPGAERHA*TCS  571
             +  A QSPY+E PQF   QFN Y+FP P APPGA+RH+ T S
Sbjct  361   STLASQSPYVEAPQFNGAQFN-YNFPRPMAPPGAQRHSSTGS  401



>gb|KGN55561.1| hypothetical protein Csa_4G665650 [Cucumis sativus]
Length=398

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/397 (81%), Positives = 357/397 (90%), Gaps = 5/397 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGVSP ATEA+IKKAYYIKARQVHPDKNP+DPLAAQ FQVLGEAYQVLSD
Sbjct  1     MVKETEYYDVLGVSPAATEAEIKKAYYIKARQVHPDKNPSDPLAAQKFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             PAQRQAYDA+GKSGIST+AIIDPAAIFAMLFGSELFE+YIG+LAMASMASLDIFT+GE+F
Sbjct  61    PAQRQAYDAHGKSGISTDAIIDPAAIFAMLFGSELFEEYIGELAMASMASLDIFTEGEQF  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             DAK+LQEKMR+VQ+EREEKL+EILK RLN YVQG+K++F  HAEAEV+RLSNAAYGVDML
Sbjct  121   DAKRLQEKMRIVQKEREEKLSEILKGRLNQYVQGNKDDFVNHAEAEVARLSNAAYGVDML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQAAKELGKKAIYLGVPF+AEWFRNKGHFIKSQVTAATGA ALIQLQEDMK+
Sbjct  181   NTIGYIYARQAAKELGKKAIYLGVPFVAEWFRNKGHFIKSQVTAATGAIALIQLQEDMKK  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLSAEGNYTEEELEEY+QSHKK+MIDSLWKLNVADIE TLSRVCQ VLQDNNVKKEELRA
Sbjct  241   QLSAEGNYTEEELEEYVQSHKKLMIDSLWKLNVADIEATLSRVCQQVLQDNNVKKEELRA  300

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RAKGLKTLGK+FQRVKS NGNE E +    V KL+GSE S+D+  ++ + +S   +E   
Sbjct  301   RAKGLKTLGKIFQRVKSTNGNEGEPAVKGSVDKLNGSESSHDASPIS-TLKSSGYEE---  356

Query  696   TAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPGAERH  586
             T+FA QSPY+E P F     N+Y FP PT PPGA+RH
Sbjct  357   TSFATQSPYVEAPNFAGAHLNNY-FPRPTPPPGAQRH  392



>ref|XP_008240863.1| PREDICTED: chaperone protein dnaJ 10-like [Prunus mume]
Length=405

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/401 (80%), Positives = 354/401 (88%), Gaps = 4/401 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGVSP ATEA+IKKAYY+KARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD
Sbjct  1     MVKETEYYDVLGVSPTATEAEIKKAYYMKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QRQAYDA+GKSGIST++IIDPAAIFAMLFGSELFE+YIGQLAMASMASLDIF++GE+F
Sbjct  61    PGQRQAYDAFGKSGISTDSIIDPAAIFAMLFGSELFEEYIGQLAMASMASLDIFSEGEQF  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D KKLQEKMRVV   REEKLAE LKNRLN YVQG+KE+F +HAEAEV+RLSNAAYGVDML
Sbjct  121   DPKKLQEKMRVVXXXREEKLAETLKNRLNQYVQGNKEDFVSHAEAEVARLSNAAYGVDML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQ+AKELGKKA+YLGVPFIAEWFRNKGHFIKSQVTAATGA ALIQLQEDMK+
Sbjct  181   NTIGYIYARQSAKELGKKALYLGVPFIAEWFRNKGHFIKSQVTAATGALALIQLQEDMKK  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLSAEGNYT+EELEEYM S+KK+MIDSLWKLNVADIE TLSRVCQMVLQDNN KKEELRA
Sbjct  241   QLSAEGNYTDEELEEYMSSNKKLMIDSLWKLNVADIEATLSRVCQMVLQDNNAKKEELRA  300

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RAKGLKTLGK+FQR KS  GNE E++ N+ V  L+GSE  YD+ S   + ++ N +E  Y
Sbjct  301   RAKGLKTLGKIFQRTKSTGGNEVESAQNSGVHILNGSESRYDACSPITTPKASNPEEPSY  360

Query  696   TAFAV---QSPYIETPQFGSGQFNSYDFPMPTAPPGAERHA  583
               FA    QSPY+E PQ    QF+ Y FP PTAPPGA+RH+
Sbjct  361   AVFASQVPQSPYVEAPQIAGAQFD-YHFPRPTAPPGAQRHS  400



>ref|XP_008453046.1| PREDICTED: chaperone protein dnaJ 10 isoform X2 [Cucumis melo]
Length=406

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/403 (80%), Positives = 360/403 (89%), Gaps = 6/403 (1%)
 Frame = -2

Query  1791  GNSRS-MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEA  1615
             G+ +S MVKETEYYDVLGVSP ATEA+IKKAYYIKARQVHPDKNP+DPLAAQ FQVLGEA
Sbjct  3     GDRKSQMVKETEYYDVLGVSPAATEAEIKKAYYIKARQVHPDKNPSDPLAAQKFQVLGEA  62

Query  1614  YQVLSDPAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIF  1435
             YQVLSDPAQRQAYDA+GKSGIST+AIIDPAAIFAMLFGSELFE+YIG+LAMASMASLDIF
Sbjct  63    YQVLSDPAQRQAYDAHGKSGISTDAIIDPAAIFAMLFGSELFEEYIGELAMASMASLDIF  122

Query  1434  TDGEEFDAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAA  1255
             T+GE+FDAK+LQEKMR VQ+EREEKL+EILK RLN YVQG+K++F +HAEAEV+RLSNAA
Sbjct  123   TEGEQFDAKRLQEKMRTVQKEREEKLSEILKGRLNQYVQGNKDDFVSHAEAEVARLSNAA  182

Query  1254  YGVDMLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQL  1075
             YGVDMLNTIGYIY RQAAKELGKKAIYLGVPF+AEWFRNKGHFIKSQVTAATGA ALIQL
Sbjct  183   YGVDMLNTIGYIYARQAAKELGKKAIYLGVPFVAEWFRNKGHFIKSQVTAATGAIALIQL  242

Query  1074  QEDMKRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVK  895
             QEDMK+QLSAEGNYTEEELEEY+QSHKK+MIDSLWKLNVADIE TLSRVCQ VLQDNNVK
Sbjct  243   QEDMKKQLSAEGNYTEEELEEYVQSHKKLMIDSLWKLNVADIEATLSRVCQQVLQDNNVK  302

Query  894   KEELRARAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQN  715
             KEELRARAKGLKTLGK+FQRVKS NGNE E +    V KL+GSE S+D+  ++ + +S  
Sbjct  303   KEELRARAKGLKTLGKIFQRVKSTNGNEGEPAVKGSVDKLNGSESSHDASPIS-TLKSSG  361

Query  714   ADEAPYTAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPGAERH  586
              +E   T+F  QSPY+E P F     N+Y FP PT PPGA+RH
Sbjct  362   YEE---TSFPTQSPYVEAPNFAGAHLNNY-FPRPTPPPGAQRH  400



>ref|XP_006435520.1| hypothetical protein CICLE_v10001330mg [Citrus clementina]
 gb|ESR48760.1| hypothetical protein CICLE_v10001330mg [Citrus clementina]
Length=402

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/400 (82%), Positives = 357/400 (89%), Gaps = 1/400 (0%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGVSP A+EA+IKKAYYIKAR+VHPDKNPNDPLAAQNFQVLGEAYQVLSD
Sbjct  1     MVKETEYYDVLGVSPTASEAEIKKAYYIKARKVHPDKNPNDPLAAQNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMAS+ASLDIFT+GEEF
Sbjct  61    PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASVASLDIFTEGEEF  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             DAKKLQ+KM+VVQ+EREEKLA+IL+ RLN YVQG+KE+F  +AEAEVSRLSNAAYGVDML
Sbjct  121   DAKKLQDKMKVVQKEREEKLADILRGRLNQYVQGNKEDFINYAEAEVSRLSNAAYGVDML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGA ALIQLQEDMK+
Sbjct  181   NTIGYIYARQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAIALIQLQEDMKK  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLSAEGNYTEEELEEYMQSHKK+MIDSLWKLNVADIE TLSRVCQMVLQDNN KKEELRA
Sbjct  241   QLSAEGNYTEEELEEYMQSHKKLMIDSLWKLNVADIEATLSRVCQMVLQDNNAKKEELRA  300

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RAK LKTLGK+FQR KS NG+E ET  +  V KL+GS+  YD+ S   S +S    E+  
Sbjct  301   RAKALKTLGKIFQRAKSNNGSEGETVLSGGVHKLNGSDSCYDASSPITSPKSTEHQESSQ  360

Query  696   TAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPGAERHA*T  577
             +AFA QSPY+E P     QF   DFP+PTAPPGA+ H+ T
Sbjct  361   SAFASQSPYVEAPNLSDAQFGR-DFPIPTAPPGAQGHSST  399



>ref|XP_006435521.1| hypothetical protein CICLE_v10001330mg [Citrus clementina]
 ref|XP_006494420.1| PREDICTED: chaperone protein dnaJ 10-like isoform X1 [Citrus 
sinensis]
 ref|XP_006494421.1| PREDICTED: chaperone protein dnaJ 10-like isoform X2 [Citrus 
sinensis]
 ref|XP_006494422.1| PREDICTED: chaperone protein dnaJ 10-like isoform X3 [Citrus 
sinensis]
 gb|ESR48761.1| hypothetical protein CICLE_v10001330mg [Citrus clementina]
Length=410

 Score =   650 bits (1676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/401 (82%), Positives = 357/401 (89%), Gaps = 1/401 (0%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGVSP A+EA+IKKAYYIKAR+VHPDKNPNDPLAAQNFQVLGEAYQVLSD
Sbjct  1     MVKETEYYDVLGVSPTASEAEIKKAYYIKARKVHPDKNPNDPLAAQNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMAS+ASLDIFT+GEEF
Sbjct  61    PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASVASLDIFTEGEEF  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             DAKKLQ+KM+VVQ+EREEKLA+IL+ RLN YVQG+KE+F  +AEAEVSRLSNAAYGVDML
Sbjct  121   DAKKLQDKMKVVQKEREEKLADILRGRLNQYVQGNKEDFINYAEAEVSRLSNAAYGVDML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGA ALIQLQEDMK+
Sbjct  181   NTIGYIYARQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAIALIQLQEDMKK  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLSAEGNYTEEELEEYMQSHKK+MIDSLWKLNVADIE TLSRVCQMVLQDNN KKEELRA
Sbjct  241   QLSAEGNYTEEELEEYMQSHKKLMIDSLWKLNVADIEATLSRVCQMVLQDNNAKKEELRA  300

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RAK LKTLGK+FQR KS NG+E ET  +  V KL+GS+  YD+ S   S +S    E+  
Sbjct  301   RAKALKTLGKIFQRAKSNNGSEGETVLSGGVHKLNGSDSCYDASSPITSPKSTEHQESSQ  360

Query  696   TAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPGAERHA*TC  574
             +AFA QSPY+E P     QF   DFP+PTAPPGA+ H+ T 
Sbjct  361   SAFASQSPYVEAPNLSDAQFGR-DFPIPTAPPGAQGHSSTV  400



>ref|XP_008453045.1| PREDICTED: chaperone protein dnaJ 10 isoform X1 [Cucumis melo]
Length=411

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/408 (79%), Positives = 360/408 (88%), Gaps = 11/408 (3%)
 Frame = -2

Query  1791  GNSRS-MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEA  1615
             G+ +S MVKETEYYDVLGVSP ATEA+IKKAYYIKARQVHPDKNP+DPLAAQ FQVLGEA
Sbjct  3     GDRKSQMVKETEYYDVLGVSPAATEAEIKKAYYIKARQVHPDKNPSDPLAAQKFQVLGEA  62

Query  1614  YQVLSDPAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIF  1435
             YQVLSDPAQRQAYDA+GKSGIST+AIIDPAAIFAMLFGSELFE+YIG+LAMASMASLDIF
Sbjct  63    YQVLSDPAQRQAYDAHGKSGISTDAIIDPAAIFAMLFGSELFEEYIGELAMASMASLDIF  122

Query  1434  TDGEEFDAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAA  1255
             T+GE+FDAK+LQEKMR VQ+EREEKL+EILK RLN YVQG+K++F +HAEAEV+RLSNAA
Sbjct  123   TEGEQFDAKRLQEKMRTVQKEREEKLSEILKGRLNQYVQGNKDDFVSHAEAEVARLSNAA  182

Query  1254  YGVDMLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQL  1075
             YGVDMLNTIGYIY RQAAKELGKKAIYLGVPF+AEWFRNKGHFIKSQVTAATGA ALIQL
Sbjct  183   YGVDMLNTIGYIYARQAAKELGKKAIYLGVPFVAEWFRNKGHFIKSQVTAATGAIALIQL  242

Query  1074  QEDMKRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQM-----VLQ  910
             QEDMK+QLSAEGNYTEEELEEY+QSHKK+MIDSLWKLNVADIE TLSRVCQ      VLQ
Sbjct  243   QEDMKKQLSAEGNYTEEELEEYVQSHKKLMIDSLWKLNVADIEATLSRVCQQVVLIHVLQ  302

Query  909   DNNVKKEELRARAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPS  730
             DNNVKKEELRARAKGLKTLGK+FQRVKS NGNE E +    V KL+GSE S+D+  ++ +
Sbjct  303   DNNVKKEELRARAKGLKTLGKIFQRVKSTNGNEGEPAVKGSVDKLNGSESSHDASPIS-T  361

Query  729   SRSQNADEAPYTAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPGAERH  586
              +S   +E   T+F  QSPY+E P F     N+Y FP PT PPGA+RH
Sbjct  362   LKSSGYEE---TSFPTQSPYVEAPNFAGAHLNNY-FPRPTPPPGAQRH  405



>ref|XP_004511274.1| PREDICTED: chaperone protein dnaJ 10-like [Cicer arietinum]
Length=412

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/410 (80%), Positives = 360/410 (88%), Gaps = 11/410 (3%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGVSP A+EA+IKKAYY+KARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD
Sbjct  1     MVKETEYYDVLGVSPTASEAEIKKAYYMKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR AYDA+GKSGISTEAIIDPAAIFAMLFGSELFE+YIGQLAMASMAS+DIFT+GE+F
Sbjct  61    PTQRHAYDAHGKSGISTEAIIDPAAIFAMLFGSELFEEYIGQLAMASMASMDIFTEGEQF  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D KKLQEKMRVVQ+EREE+LAEILK+RLN YVQG+KE+F  HAEAEV+RLSNAAYGVDML
Sbjct  121   DTKKLQEKMRVVQKEREERLAEILKSRLNQYVQGNKEDFVGHAEAEVARLSNAAYGVDML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGA ALIQLQEDMKR
Sbjct  181   NTIGYIYARQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAIALIQLQEDMKR  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRV----------CQMVLQD  907
             QLS+EGNYTEEELEEYMQSHKK+MIDSLWKLNVADIE TLSRV          CQ+VLQD
Sbjct  241   QLSSEGNYTEEELEEYMQSHKKLMIDSLWKLNVADIEATLSRVCHKYLFLLLQCQIVLQD  300

Query  906   NNVKKEELRARAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSS  727
             +++KKEELRARAKGLKTLGK+FQRVK+ NG+E E   N  V KL+GSE S D+ S + S 
Sbjct  301   SSIKKEELRARAKGLKTLGKIFQRVKTANGSENENILNKAVHKLNGSENSNDACSPSTSP  360

Query  726   RSQNADEAPYTAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPGAERHA*T  577
             +S + D + + AFA QSPY+E P F   QF+ Y+FP PTAPPGA R A T
Sbjct  361   KSSSPDSSTHAAFASQSPYVEAPHFAGMQFD-YNFPRPTAPPGAHRPAPT  409



>ref|XP_010932194.1| PREDICTED: chaperone protein dnaJ 10-like isoform X2 [Elaeis 
guineensis]
Length=397

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/399 (80%), Positives = 355/399 (89%), Gaps = 5/399 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLG+SP ATEA+IKKAYY+KARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD
Sbjct  1     MVKETEYYDVLGISPTATEAEIKKAYYVKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             PAQRQAYD YGKSGISTE IIDPAAIFAMLFGSELFEDYIGQLAMASMASLDI T+GE+ 
Sbjct  61    PAQRQAYDTYGKSGISTEQIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDILTEGEQV  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             DAKKLQEKMRVVQ+EREEKLA+ILK+RLN+YVQG K+EF  HA+ EV RLSNAAYGVDML
Sbjct  121   DAKKLQEKMRVVQKEREEKLAQILKDRLNLYVQGHKDEFINHAKGEVVRLSNAAYGVDML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGA AL+QLQED+K+
Sbjct  181   NTIGYIYARQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAIALMQLQEDLKK  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLSAEGN+TEEELE+YMQ+HKK+M+DSLWKLNVADIE TLSRVCQMVLQDN+VK+EELRA
Sbjct  241   QLSAEGNFTEEELEDYMQTHKKLMVDSLWKLNVADIEATLSRVCQMVLQDNSVKREELRA  300

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPV-QKLDGSEPSYDSHSLNPSSRSQNADEAP  700
             RAKGLKTLGKVFQRVKS N +E+E S  + V  +L G++ S D  S   +S     ++ P
Sbjct  301   RAKGLKTLGKVFQRVKSANASESEASLTSGVPNQLSGNDGSNDGSS--DTSPKAPMEQPP  358

Query  699   YTA-FAVQSPYIETPQFGSGQFNSYDFPMPTAPPGAERH  586
             YT   A QSPY+E PQF   Q+ +Y+FPMPTAPPGA+RH
Sbjct  359   YTTPPAPQSPYVEAPQFAGAQY-TYNFPMPTAPPGAQRH  396



>ref|XP_010270671.1| PREDICTED: chaperone protein dnaJ 10-like [Nelumbo nucifera]
 ref|XP_010270672.1| PREDICTED: chaperone protein dnaJ 10-like [Nelumbo nucifera]
 ref|XP_010270673.1| PREDICTED: chaperone protein dnaJ 10-like [Nelumbo nucifera]
Length=395

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/399 (80%), Positives = 351/399 (88%), Gaps = 7/399 (2%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYD+LG+SP ATEA+IKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD
Sbjct  1     MVKETEYYDILGISPTATEAEIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             PAQRQAYDA+GKSGISTE IIDPAAIFAMLFGSELFE+YIGQLAMASMASLDIFT+GEEF
Sbjct  61    PAQRQAYDAHGKSGISTEGIIDPAAIFAMLFGSELFEEYIGQLAMASMASLDIFTEGEEF  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             DAKKLQEKMRVVQ+ERE+KLAE LK+RLN YVQG KE+F  +AEAEVSRLSNAAYGVDML
Sbjct  121   DAKKLQEKMRVVQKEREDKLAEKLKDRLNRYVQGHKEDFICYAEAEVSRLSNAAYGVDML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQAAKELGKK +YLGVPFIAEWFRNKGHFIKSQVTAATGA ALIQLQEDMKR
Sbjct  181   NTIGYIYARQAAKELGKKVMYLGVPFIAEWFRNKGHFIKSQVTAATGAIALIQLQEDMKR  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLS+EGNYTEEELE Y+QSHKK+MIDSLWKLNVADIE TLSRVCQMVLQD+++KKEELRA
Sbjct  241   QLSSEGNYTEEELEAYLQSHKKLMIDSLWKLNVADIEATLSRVCQMVLQDSSIKKEELRA  300

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAP-  700
             RAKGLKTLGK+FQR KS NG E E   N+ V KL+ S+ ++D+ S  P S  +   + P 
Sbjct  301   RAKGLKTLGKIFQRAKSANGCENEPMPNSSVHKLNESQQNHDASS--PDSSPKFPPQYPS  358

Query  699   YTAFAVQSPYIETPQF-GSGQFNSYDFPMPTAPPGAERH  586
             Y   A QSPY+E P   G   FN   FPMPTAPPGA+R+
Sbjct  359   YATNAAQSPYVEAPNIAGVPHFN---FPMPTAPPGAQRY  394



>gb|EYU36613.1| hypothetical protein MIMGU_mgv1a007809mg [Erythranthe guttata]
 gb|EYU36614.1| hypothetical protein MIMGU_mgv1a007809mg [Erythranthe guttata]
Length=394

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/396 (80%), Positives = 349/396 (88%), Gaps = 4/396 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKET YYDVLGVSP ATEA+IKKAYY+KARQVHPDKNPNDPLAAQNFQ+LGEAYQVL D
Sbjct  1     MVKETGYYDVLGVSPTATEAEIKKAYYVKARQVHPDKNPNDPLAAQNFQILGEAYQVLGD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             PAQRQ YDAYGKSGISTE+IIDPAAIFAMLFGSELFE+YIGQLAMASMASLD+ T+ E+F
Sbjct  61    PAQRQTYDAYGKSGISTESIIDPAAIFAMLFGSELFEEYIGQLAMASMASLDVSTE-EDF  119

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             DAKKLQEKMR VQ+EREEKLA  LK+RLN+YVQG+KEEF   AEAEVSRLSNAAYGVDML
Sbjct  120   DAKKLQEKMRTVQKEREEKLALSLKDRLNLYVQGNKEEFIRQAEAEVSRLSNAAYGVDML  179

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             +TIGYIY RQ+AKELGKK I+LGVPF+AEWFRNKGHFIKSQVTAATGA ALIQLQEDMKR
Sbjct  180   STIGYIYARQSAKELGKKVIFLGVPFVAEWFRNKGHFIKSQVTAATGAIALIQLQEDMKR  239

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QL+AEGNYTEEELE YMQSHKKIM DSLWKLNVADIE TLSRVCQMVLQDN+ KKEELR 
Sbjct  240   QLNAEGNYTEEELEAYMQSHKKIMTDSLWKLNVADIEATLSRVCQMVLQDNSSKKEELRL  299

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RAKGLKTLGK+FQRVKS N N +E ++  P  KLDGS+ S ++   + +SRS N D+   
Sbjct  300   RAKGLKTLGKIFQRVKSANENNSENTSKDPTHKLDGSQSSSNTAPSSTTSRSFNNDQLSN  359

Query  696   TAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPGAER  589
             T FA QSPY+ETPQF   +FN+Y  PMPTAPPGA +
Sbjct  360   T-FAPQSPYVETPQFPGAEFNNY--PMPTAPPGAHK  392



>ref|XP_003517610.1| PREDICTED: chaperone protein dnaJ 10-like [Glycine max]
Length=395

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/396 (82%), Positives = 349/396 (88%), Gaps = 8/396 (2%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGVSP A+EA+IKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD
Sbjct  1     MVKETEYYDVLGVSPTASEAEIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             PAQRQAYDA+GKSGISTEAIIDPAAIFAMLFGSELFE+YIGQLAMASMAS+DIFT+GE+F
Sbjct  61    PAQRQAYDAHGKSGISTEAIIDPAAIFAMLFGSELFEEYIGQLAMASMASMDIFTEGEQF  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D+KKLQEKMRVVQ+EREEKLAEILKNRLN YVQG+KE F   AEAEV+RLSNAAYGVDML
Sbjct  121   DSKKLQEKMRVVQKEREEKLAEILKNRLNQYVQGNKEGFVNDAEAEVARLSNAAYGVDML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQAAKELGKKAIYLGVPFIAEWFRNKGH IKSQVTAATGA ALIQLQEDMK+
Sbjct  181   NTIGYIYARQAAKELGKKAIYLGVPFIAEWFRNKGHSIKSQVTAATGAIALIQLQEDMKK  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLS+EG+YTEEELEEYMQ+HKK+MIDSLWKLNVADIE TLSRVCQMVLQDN  KKEELRA
Sbjct  241   QLSSEGDYTEEELEEYMQNHKKLMIDSLWKLNVADIEATLSRVCQMVLQDNGAKKEELRA  300

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RAKGLKTLGK+FQRVKS NGNE E+  N  V KL+GSE   D+        S        
Sbjct  301   RAKGLKTLGKIFQRVKSANGNENESVPNKAVHKLNGSETGNDTSPSTSPKSSS-------  353

Query  696   TAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPGAER  589
               F+ QSPY+E P+F   QF+ Y+FP PTAPPGA+R
Sbjct  354   PDFSSQSPYVEAPRFAGMQFD-YNFPRPTAPPGAQR  388



>ref|XP_009415440.1| PREDICTED: chaperone protein dnaJ 10-like [Musa acuminata subsp. 
malaccensis]
Length=396

 Score =   629 bits (1622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/399 (79%), Positives = 350/399 (88%), Gaps = 4/399 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKET+YYDVLGVSP ATEA+IKKAYY KARQVHPDKNPNDP AAQNFQVLGEAYQVLSD
Sbjct  1     MVKETDYYDVLGVSPSATEAEIKKAYYTKARQVHPDKNPNDPRAAQNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR+AYDA GKSGIS EAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLD FT+GE+ 
Sbjct  61    PTQREAYDANGKSGISREAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDNFTEGEQV  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             DA+KLQEKMRV+Q+EREEKLAEILK+RL+ YVQG+ +EF  HAEAEV+RLSNAAYGVD+L
Sbjct  121   DARKLQEKMRVIQKEREEKLAEILKDRLHQYVQGNNDEFIRHAEAEVTRLSNAAYGVDIL  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGA AL+QLQED+K+
Sbjct  181   NTIGYIYVRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAIALMQLQEDLKK  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLSAEGNYTEEELEEYMQ+HKK+MIDSLWKLNVADIE TLSRVCQMVLQDNNV++EELRA
Sbjct  241   QLSAEGNYTEEELEEYMQNHKKVMIDSLWKLNVADIEATLSRVCQMVLQDNNVRREELRA  300

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQ-KLDGSEPSYDSHSLNPSSRSQNADEAP  700
             RAKGLK LGK+FQRVK  NG+E+ETS  +  Q KL G++   D  S + S +S     + 
Sbjct  301   RAKGLKALGKIFQRVKLGNGSESETSFASGAQNKLSGNDECNDGSSPDASPKSPVEHLSY  360

Query  699   YTAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPGAERHA  583
              +  A QSPY+E P FG     +YDFPMPTAPPGA+RHA
Sbjct  361   ASLAATQSPYVEAPPFGD---VNYDFPMPTAPPGAQRHA  396



>ref|XP_011083375.1| PREDICTED: chaperone protein dnaJ 10-like [Sesamum indicum]
Length=394

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/397 (77%), Positives = 343/397 (86%), Gaps = 4/397 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGV+P ATEA+IKKAYY+KARQVHPDKNPNDPLAAQ FQ+LGEAYQVLSD
Sbjct  1     MVKETEYYDVLGVNPTATEAEIKKAYYVKARQVHPDKNPNDPLAAQKFQILGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QRQAYD+YGKSGIS E+IIDPAAIFAMLFGSELFE+YIGQLAMAS ASLD+F +GE+F
Sbjct  61    PTQRQAYDSYGKSGISKESIIDPAAIFAMLFGSELFEEYIGQLAMASFASLDVFAEGEQF  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             DAKKLQEK++ VQREREE+LA +L++RLN+YVQG+KEEF +HAEAEVSRLS AAYGVDML
Sbjct  121   DAKKLQEKLQTVQREREERLAGVLRDRLNLYVQGNKEEFVSHAEAEVSRLSKAAYGVDML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             +TIGYIY RQAAKELGKK IYLGVPF+AEWFRNKGHFIKSQVTAATGA ALIQLQEDMKR
Sbjct  181   STIGYIYARQAAKELGKKVIYLGVPFVAEWFRNKGHFIKSQVTAATGALALIQLQEDMKR  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLSAEG YTE ELEEYMQSHKK+MIDSLWKLNVADIE TL+ VC MVLQDNN KKEELR 
Sbjct  241   QLSAEGTYTEAELEEYMQSHKKLMIDSLWKLNVADIEATLTHVCHMVLQDNNAKKEELRL  300

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RA+GLKTLGK+FQ +KS NGN+ E     P+ +L GSE + +    N S R  N +EA  
Sbjct  301   RARGLKTLGKIFQSMKS-NGNDVENMPTDPLLRLSGSEATNNISPSNTSERFSNKEEA-N  358

Query  696   TAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPGAERH  586
              AFA QSPY+E PQ    Q N  +FPMPTAPPGA++ 
Sbjct  359   NAFASQSPYVEAPQIAGSQLN--NFPMPTAPPGAQKQ  393



>ref|XP_010927493.1| PREDICTED: chaperone protein dnaJ 10-like [Elaeis guineensis]
Length=393

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/394 (79%), Positives = 346/394 (88%), Gaps = 5/394 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLG+SP ATEA+IKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD
Sbjct  1     MVKETEYYDVLGISPTATEAEIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             PAQR AYD YGKSGISTE IIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFT+GE+ 
Sbjct  61    PAQRLAYDNYGKSGISTETIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTEGEQI  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             DAKKLQE M+ VQ+EREEKLA+ILK+RLN+YVQG K+EF + AEAEV+RLS+AAYGVDML
Sbjct  121   DAKKLQEMMKAVQKEREEKLAQILKDRLNLYVQGHKDEFISQAEAEVARLSSAAYGVDML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGA AL+QLQED+K+
Sbjct  181   NTIGYIYARQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAIALMQLQEDLKK  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLSAEGNYTEEELEEYM++HKK+++DSLWKLNVADIE TLSRVCQMVLQDNNVK+EELRA
Sbjct  241   QLSAEGNYTEEELEEYMKNHKKLLVDSLWKLNVADIEATLSRVCQMVLQDNNVKREELRA  300

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPV-QKLDGSEPSYDSHSLNPSSRSQNADEAP  700
             RAKGLKTLGK+FQRVK VN +E+ETS    V  +L G++   D  S + S RS   D+  
Sbjct  301   RAKGLKTLGKIFQRVKPVNASESETSLKNGVPNQLSGNDRPNDCSSPDTSPRSP-IDQPS  359

Query  699   YTAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPG  598
             Y      SPY+E PQF    + + +FPMP+APPG
Sbjct  360   YA--TPLSPYVEVPQFAGAPY-AQNFPMPSAPPG  390



>ref|XP_004300062.1| PREDICTED: chaperone protein dnaJ 10-like [Fragaria vesca subsp. 
vesca]
Length=385

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/398 (79%), Positives = 342/398 (86%), Gaps = 15/398 (4%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGV P ATEA+IKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD
Sbjct  1     MVKETEYYDVLGVKPTATEAEIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             PAQRQAYDA+GKSGIST+ IIDPAAIFAMLFGSELFE+YIGQLAMASMASLDIFT+GE+F
Sbjct  61    PAQRQAYDAHGKSGISTDGIIDPAAIFAMLFGSELFEEYIGQLAMASMASLDIFTEGEQF  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             DAKKLQEKMRVVQREREEKL E LKNRLN YVQG+KE F   AEAEV+RLSNAAYGVDML
Sbjct  121   DAKKLQEKMRVVQREREEKLVEQLKNRLNQYVQGNKEGFIRDAEAEVARLSNAAYGVDML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQ+AKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGA ALIQLQEDMK+
Sbjct  181   NTIGYIYARQSAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAIALIQLQEDMKK  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QL+AEGNYTEEELEEYMQS+KK+MIDSLWKLNVADIE TLSRVCQMVLQD+N KKEELRA
Sbjct  241   QLNAEGNYTEEELEEYMQSNKKLMIDSLWKLNVADIEATLSRVCQMVLQDSNAKKEELRA  300

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RAKGLKTLGK+FQR KS NG + E  +N  ++    + PS        SS SQ A + P 
Sbjct  301   RAKGLKTLGKIFQRTKSTNGVDGENPSNGQIESSRDASPSTTPR----SSISQYAPQVP-  355

Query  696   TAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPGAERHA  583
                  Q PY+E       QF+  +FP PTAPPGA+RH+
Sbjct  356   -----QIPYVE---LAGVQFD--NFPRPTAPPGAQRHS  383



>ref|XP_008796637.1| PREDICTED: chaperone protein dnaJ 10-like [Phoenix dactylifera]
Length=393

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/395 (78%), Positives = 348/395 (88%), Gaps = 7/395 (2%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLG+SP ATEA+IKKAYYI+ARQVHPDKNPNDP AAQNFQVLGEAYQVLSD
Sbjct  1     MVKETEYYDVLGISPTATEAEIKKAYYIQARQVHPDKNPNDPQAAQNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             PAQRQAYD YGKSGISTE IIDPAAIFAMLFGSELFEDYIGQLA+ASMASLDIFT+GE+ 
Sbjct  61    PAQRQAYDNYGKSGISTETIIDPAAIFAMLFGSELFEDYIGQLALASMASLDIFTEGEQI  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             DAKKLQE M+VVQ EREEKLA+ILK+RLN+YVQG K+EF +H+EAEV+RLS+AAYGVDML
Sbjct  121   DAKKLQEMMKVVQNEREEKLAQILKDRLNLYVQGHKDEFISHSEAEVARLSSAAYGVDML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQAAKELGKKAIYLG+PFIAEWFRNKGHFIKSQVTAATGA AL+QLQED+K+
Sbjct  181   NTIGYIYARQAAKELGKKAIYLGLPFIAEWFRNKGHFIKSQVTAATGAIALMQLQEDLKK  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QL+AEGNYTEEELEEYM++HKK+++DSLWKLNVADIE TLSRVCQMVLQDN+VK+EELRA
Sbjct  241   QLNAEGNYTEEELEEYMKNHKKLLVDSLWKLNVADIEATLSRVCQMVLQDNSVKREELRA  300

Query  876   RAKGLKTLGKVFQRVKSVNGNETETS--ANTPVQKLDGSEPSYDSHSLNPSSRSQNADEA  703
             RAKGLKTLGK+FQRVK  N +E+ETS  +  P Q  +   P+ D  S + S RS   D+ 
Sbjct  301   RAKGLKTLGKIFQRVKPANASESETSLKSGVPNQLSENDRPN-DGSSPDTSPRSP-IDQP  358

Query  702   PYTAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPG  598
              Y      SPY+E PQF   ++N ++FPMPTAPPG
Sbjct  359   SYA--TPLSPYVEVPQFAGARYN-HNFPMPTAPPG  390



>ref|XP_008796463.1| PREDICTED: chaperone protein dnaJ 10-like [Phoenix dactylifera]
Length=397

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/399 (78%), Positives = 354/399 (89%), Gaps = 5/399 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKET+YYDVLG+SP ATEA+IKKAYY+KARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD
Sbjct  1     MVKETDYYDVLGISPTATEAEIKKAYYVKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             PAQRQAYD YGKSGISTE IIDPAAIFAMLFGSELFEDYIGQLAMASMASLD+FT+GE+ 
Sbjct  61    PAQRQAYDTYGKSGISTEKIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDMFTEGEQV  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             DAK LQEKMRVVQ+ERE+KLA+ILK+RLN+YVQG K+EF +HAEAE  RLSNAAYG DML
Sbjct  121   DAKMLQEKMRVVQKEREDKLAQILKDRLNLYVQGHKDEFISHAEAEAVRLSNAAYGADML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             +TIGYIY RQAAKELGKKAIYLGVPF+AEWFRNKGHFIKSQVTA TGA AL+QLQED+K+
Sbjct  181   STIGYIYARQAAKELGKKAIYLGVPFVAEWFRNKGHFIKSQVTAVTGAIALMQLQEDLKK  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLSAEGN+TEEELE+YMQ+HKK+M+DSLWKLNVADIE TLSRVCQMVLQDN+VK+EELRA
Sbjct  241   QLSAEGNFTEEELEDYMQTHKKLMVDSLWKLNVADIEATLSRVCQMVLQDNSVKREELRA  300

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPV-QKLDGSEPSYDSHSLNPSSRSQNADEAP  700
             RAKGLKTLGK+FQRVKSV+ +E+E S  + V  +L+G++ S    S   +S     ++ P
Sbjct  301   RAKGLKTLGKIFQRVKSVSASESEASLRSGVPNQLNGNDQSNGGSS--DASPKAPIEQLP  358

Query  699   Y-TAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPGAERH  586
             Y T  A QSPY+E PQF   ++ +Y+FPMPTAPPGA RH
Sbjct  359   YATPPAPQSPYVEAPQFAGARY-TYNFPMPTAPPGAHRH  396



>ref|XP_010684702.1| PREDICTED: chaperone protein dnaJ 10-like [Beta vulgaris subsp. 
vulgaris]
Length=402

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/396 (75%), Positives = 332/396 (84%), Gaps = 0/396 (0%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLG+SP ATE QIKKAYYIKARQVHPDKNP+DPLAAQNFQVLGEAYQVLSD
Sbjct  1     MVKETEYYDVLGISPTATEDQIKKAYYIKARQVHPDKNPDDPLAAQNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QRQAYDAYGKSGISTE IIDPAAIFAMLFGSELFE+YIGQ AMASM S+D   DGEE 
Sbjct  61    PTQRQAYDAYGKSGISTEGIIDPAAIFAMLFGSELFEEYIGQPAMASMVSMDFSADGEEL  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             DA+KLQEKM+V+Q++RE+KLAE LK+RLN YV GSKE F+ +AEAEVSRLS+AAYGVDML
Sbjct  121   DARKLQEKMKVIQKDREDKLAEKLKDRLNQYVHGSKESFKCNAEAEVSRLSSAAYGVDML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY+RQAAKELGKK +YLGVPF+AEWFRNKGH IKSQVTAATGA AL QLQEDMKR
Sbjct  181   NTIGYIYSRQAAKELGKKVMYLGVPFVAEWFRNKGHSIKSQVTAATGAVALFQLQEDMKR  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
              LSAEGNYTEEELE YM+SHKK+MIDSLWKLNV DIE TLSRVCQMVLQDNN K+EELRA
Sbjct  241   HLSAEGNYTEEELENYMESHKKVMIDSLWKLNVVDIEATLSRVCQMVLQDNNAKREELRA  300

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RAKGLKTLGK+FQR+KS + NE + +  T + KL+G E S D  + N S +S   ++  Y
Sbjct  301   RAKGLKTLGKIFQRMKSSDANEADIAVGTELTKLNGKESSNDPFASNTSPKSPKTEDQSY  360

Query  696   TAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPGAER  589
                  Q PY+  PQF         +PMP APPG +R
Sbjct  361   NGVRSQIPYVVAPQFADASDCHISYPMPIAPPGVQR  396



>ref|XP_010061362.1| PREDICTED: LOW QUALITY PROTEIN: chaperone protein dnaJ 10 [Eucalyptus 
grandis]
Length=400

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/398 (77%), Positives = 346/398 (87%), Gaps = 5/398 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGVSP ATE++IKKAYYIKARQVHPDKNPNDP AA  FQVLGEAYQVLSD
Sbjct  1     MVKETEYYDVLGVSPSATESEIKKAYYIKARQVHPDKNPNDPNAAHKFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
              AQRQAYDA+GK+G+ST++IIDPAAIFAMLFGSELFE+YIGQLAMASMASLDIFT+GE+F
Sbjct  61    SAQRQAYDAHGKAGVSTDSIIDPAAIFAMLFGSELFEEYIGQLAMASMASLDIFTEGEQF  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             DA+K QEKMR+VQ+EREEKLA+ L +RLN YVQG+KE+F  HAEAEV+RLS+AAYGVDML
Sbjct  121   DARKXQEKMRIVQKEREEKLAQTLIDRLNQYVQGNKEDFVRHAEAEVARLSSAAYGVDML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             +TIGYIY RQAAKELGKK I LG+PFIAEWFRNKGHFIKSQVTAATGA ALIQLQEDMK+
Sbjct  181   STIGYIYVRQAAKELGKKIILLGMPFIAEWFRNKGHFIKSQVTAATGAIALIQLQEDMKK  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLS +GNYT+EELE YMQSHKK+MIDSLWKLNVADIE TLS VCQMVLQD NVKKEELRA
Sbjct  241   QLSQQGNYTDEELEAYMQSHKKLMIDSLWKLNVADIENTLSHVCQMVLQDPNVKKEELRA  300

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQN-ADEAP  700
             RAKGLKTLGK+FQRVKSVNGN+ ++      +K++GS+ S DS S N SS  ++  +E  
Sbjct  301   RAKGLKTLGKIFQRVKSVNGNDPDSLL---TEKMNGSDSSNDSRSPNTSSTPKSFFEEQS  357

Query  699   YTAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPGAERH  586
             Y +   QSPY+E P   SG   + DFP PTAPPGA RH
Sbjct  358   YASREPQSPYVEAPNI-SGTTYTCDFPRPTAPPGALRH  394



>ref|XP_011034734.1| PREDICTED: chaperone protein dnaJ 10 isoform X2 [Populus euphratica]
Length=382

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/402 (76%), Positives = 336/402 (84%), Gaps = 21/402 (5%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGV+P ATE +IKKAYYIK                    VLGEAYQVLSD
Sbjct  1     MVKETEYYDVLGVNPTATEGEIKKAYYIK--------------------VLGEAYQVLSD  40

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             PAQRQAYDA+GKSGISTEAII+PAAIFAMLFGSELFE YIGQLAMASMASLDIFT+GE+ 
Sbjct  41    PAQRQAYDAHGKSGISTEAIIEPAAIFAMLFGSELFEVYIGQLAMASMASLDIFTEGEQL  100

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D KKLQEKMRVVQREREEKLAEILK+RLN YVQG+KEEF  HAEAEV+RLSNAAYGVDML
Sbjct  101   DTKKLQEKMRVVQREREEKLAEILKDRLNQYVQGNKEEFINHAEAEVARLSNAAYGVDML  160

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQAAKELGKK IYLGVPFIAEWFRNKGHFIKSQVTAATGA ALIQLQE+MK+
Sbjct  161   NTIGYIYARQAAKELGKKVIYLGVPFIAEWFRNKGHFIKSQVTAATGAIALIQLQEEMKK  220

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLSAEGNYTEEELE Y+ SHK++M DSLWKLNVADIE TLSRVCQMVLQDN+VKKEELRA
Sbjct  221   QLSAEGNYTEEELEAYILSHKQLMTDSLWKLNVADIEATLSRVCQMVLQDNSVKKEELRA  280

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RAKGLKTLGK+FQRVK  NG E ET     + +L+G  PS D+ S N S +S++ +EA Y
Sbjct  281   RAKGLKTLGKIFQRVKLANGGEGETVLGGSLHQLNGRVPSSDAFSPNTSPKSKSLEEASY  340

Query  696   TAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPGAERHA*TCS  571
             +  A QSPY+E P F   QFN Y+FP PTAPPGA+RH+ T S
Sbjct  341   STLASQSPYVEAPHFDGAQFN-YNFPRPTAPPGAQRHSSTGS  381



>gb|EYU41228.1| hypothetical protein MIMGU_mgv1a008087mg [Erythranthe guttata]
Length=385

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/396 (78%), Positives = 336/396 (85%), Gaps = 13/396 (3%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGVSP ATEA IKKAYYIKARQVHPDKNPNDPLAAQNFQ+LGEAYQVLSD
Sbjct  1     MVKETEYYDVLGVSPTATEADIKKAYYIKARQVHPDKNPNDPLAAQNFQILGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             PAQRQAYDA+GKSGIST+AIIDPAAIFAMLFGSELFE+YIGQLAMASMASLD+F +GEE 
Sbjct  61    PAQRQAYDAHGKSGISTDAIIDPAAIFAMLFGSELFEEYIGQLAMASMASLDVFAEGEEL  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D KKLQ+KMR VQ+EREEKLA ILK+RLN+Y+QG K+EF  HAEAEVSRLSNAAYGVDML
Sbjct  121   DIKKLQDKMRSVQKEREEKLAGILKDRLNLYIQGDKDEFVRHAEAEVSRLSNAAYGVDML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             +TIGYIY RQAAKELGKK I+LGVPF+AEWFRNKGHFIKSQVTAATGA ALIQLQEDMKR
Sbjct  181   STIGYIYARQAAKELGKKVIFLGVPFVAEWFRNKGHFIKSQVTAATGAIALIQLQEDMKR  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLSAEGNYTE ELEEYMQSHKK+MIDSLWKLNVADIE TLSRVCQMVLQDNN KKEEL  
Sbjct  241   QLSAEGNYTEAELEEYMQSHKKLMIDSLWKLNVADIEATLSRVCQMVLQDNNAKKEELHL  300

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RA+GLKTLGK+FQ VKSVNG   E   N P+ KL G+  +  + +    S S N D + +
Sbjct  301   RARGLKTLGKIFQSVKSVNG--VENVQNDPILKLSGTHEATTNTAAAARSSSNNDDVSSH  358

Query  696   TAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPGAER  589
                  QSPY++ P        S  FPMP APPGA +
Sbjct  359   -----QSPYVDAP------LQSNSFPMPAAPPGAHK  383



>ref|XP_006849900.1| hypothetical protein AMTR_s00022p00097490 [Amborella trichopoda]
 gb|ERN11481.1| hypothetical protein AMTR_s00022p00097490 [Amborella trichopoda]
Length=397

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/401 (76%), Positives = 342/401 (85%), Gaps = 12/401 (3%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLG+SP ATEA IKKAYYIKARQVHPDKNPNDPL+AQNFQVLGEAYQVLSD
Sbjct  1     MVKETEYYDVLGISPTATEADIKKAYYIKARQVHPDKNPNDPLSAQNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR AYDAYGKSGIS EAIIDPAA+FAMLFGSELFEDYIGQLAMASMASLD+F +GE+ 
Sbjct  61    PNQRVAYDAYGKSGISQEAIIDPAAVFAMLFGSELFEDYIGQLAMASMASLDLFVEGEQV  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             DAKK+QEKMRVVQ+EREEKLA+ILK+RLN YVQG K+ F +HA++EV+RLSNAAYG DML
Sbjct  121   DAKKIQEKMRVVQKEREEKLAQILKDRLNQYVQGDKDGFISHAQSEVTRLSNAAYGGDML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQAAKELGKKAIYLGVPF+AEWFRNKGHFIKSQVTAATGAFAL+QLQEDMKR
Sbjct  181   NTIGYIYVRQAAKELGKKAIYLGVPFVAEWFRNKGHFIKSQVTAATGAFALLQLQEDMKR  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLSAEGNYTEEELE Y+QS+KK+MIDSLWKLNVADIE TLSRVCQMVLQDN+VKKE+LRA
Sbjct  241   QLSAEGNYTEEELEAYLQSNKKLMIDSLWKLNVADIEATLSRVCQMVLQDNSVKKEDLRA  300

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RAKGLKTLGK+FQ  KS +G++ + + +  V KL+G       H+ N  S    + ++P 
Sbjct  301   RAKGLKTLGKIFQGAKSASGSDGDATLSNSVPKLNG-------HT-NEGSSPDTSPKSPP  352

Query  696   TAFA----VQSPYIETPQFGSGQFNSYDFPMPTAPPGAERH  586
               FA     QSPY+E PQF S      +FP P AP GA+R 
Sbjct  353   GTFASPLTSQSPYVEVPQFTSMPNEFPNFPRPVAPHGAQRQ  393



>ref|XP_010932193.1| PREDICTED: chaperone protein dnaJ 10-like isoform X1 [Elaeis 
guineensis]
Length=398

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/377 (80%), Positives = 333/377 (88%), Gaps = 10/377 (3%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLG+SP ATEA+IKKAYY+KARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD
Sbjct  1     MVKETEYYDVLGISPTATEAEIKKAYYVKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             PAQRQAYD YGKSGISTE IIDPAAIFAMLFGSELFEDYIGQLAMASMASLDI T+GE+ 
Sbjct  61    PAQRQAYDTYGKSGISTEQIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDILTEGEQV  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             DAKKLQEKMRVVQ+EREEKLA+ILK+RLN+YVQG K+EF  HA+ EV RLSNAAYGVDML
Sbjct  121   DAKKLQEKMRVVQKEREEKLAQILKDRLNLYVQGHKDEFINHAKGEVVRLSNAAYGVDML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGA AL+QLQED+K+
Sbjct  181   NTIGYIYARQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAIALMQLQEDLKK  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLSAEGN+TEEELE+YMQ+HKK+M+DSLWKLNVADIE TLSRVCQMVLQDN+VK+EELRA
Sbjct  241   QLSAEGNFTEEELEDYMQTHKKLMVDSLWKLNVADIEATLSRVCQMVLQDNSVKREELRA  300

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPV-QKLDGSEPSYDSHSLNPSSRSQNADEAP  700
             RAKGLKTLGKVFQRVKS N +E+E S  + V  +L G++ S D  S   +S     ++ P
Sbjct  301   RAKGLKTLGKVFQRVKSANASESEASLTSGVPNQLSGNDGSNDGSS--DTSPKAPMEQPP  358

Query  699   YTAFAVQSPYIETPQFG  649
             YT     +P    PQFG
Sbjct  359   YT-----TP--PAPQFG  368



>ref|XP_010537260.1| PREDICTED: chaperone protein dnaJ 10 isoform X1 [Tarenaya hassleriana]
 ref|XP_010537261.1| PREDICTED: chaperone protein dnaJ 10 isoform X2 [Tarenaya hassleriana]
Length=398

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/401 (76%), Positives = 343/401 (86%), Gaps = 6/401 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGVSP ATEA+IKKAYYIKARQVHPDKNPNDP AA NFQ LGEAYQVLSD
Sbjct  1     MVKETEYYDVLGVSPNATEAEIKKAYYIKARQVHPDKNPNDPQAAHNFQDLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             PAQRQAYDA+GKSGIST+AIIDPAAIFAMLFGSELFE+YIGQLAMASMASLDIFT+GE+ 
Sbjct  61    PAQRQAYDAHGKSGISTDAIIDPAAIFAMLFGSELFEEYIGQLAMASMASLDIFTEGEQL  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D +KLQEKMR VQ+EREEKLA+ILK+RLN YVQG+K+EF +HAEAEVSRLSNAAYGVDML
Sbjct  121   DTRKLQEKMRAVQKEREEKLAQILKDRLNQYVQGNKDEFVSHAEAEVSRLSNAAYGVDML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY R AA ELGKKA  L VPF+AEWFR KGHFIKSQVTAATGA+AL QLQE+MKR
Sbjct  181   NTIGYIYVRTAAIELGKKAYLLMVPFLAEWFRKKGHFIKSQVTAATGAYALFQLQEEMKR  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLSA+GNYTEEELEEY+QSHKK+MIDSLWKLNVADIE TLSRVCQ+VLQD NVKKEELR 
Sbjct  241   QLSAQGNYTEEELEEYLQSHKKVMIDSLWKLNVADIEATLSRVCQLVLQDPNVKKEELRT  300

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RAKGLK+LGK+FQR K  +G E +    T   K++G++  +D  S   S +S  +DEA +
Sbjct  301   RAKGLKSLGKIFQRAKLASGAENDPLLRTETHKINGNDGDHDDASS--SPKSSKSDEASH  358

Query  696   TAFA---VQSPYIETPQFGSGQFNSYDFPMPTAPPGAERHA  583
             + F     QSPY+E P+FG  +FN + FP P  PPGA+R +
Sbjct  359   STFGPQEPQSPYVEAPRFGDQEFN-FQFPRPAPPPGAQRRS  398



>gb|EYU36611.1| hypothetical protein MIMGU_mgv1a007809mg [Erythranthe guttata]
Length=369

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/366 (81%), Positives = 325/366 (89%), Gaps = 2/366 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKET YYDVLGVSP ATEA+IKKAYY+KARQVHPDKNPNDPLAAQNFQ+LGEAYQVL D
Sbjct  1     MVKETGYYDVLGVSPTATEAEIKKAYYVKARQVHPDKNPNDPLAAQNFQILGEAYQVLGD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             PAQRQ YDAYGKSGISTE+IIDPAAIFAMLFGSELFE+YIGQLAMASMASLD+ T+ E+F
Sbjct  61    PAQRQTYDAYGKSGISTESIIDPAAIFAMLFGSELFEEYIGQLAMASMASLDVSTE-EDF  119

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             DAKKLQEKMR VQ+EREEKLA  LK+RLN+YVQG+KEEF   AEAEVSRLSNAAYGVDML
Sbjct  120   DAKKLQEKMRTVQKEREEKLALSLKDRLNLYVQGNKEEFIRQAEAEVSRLSNAAYGVDML  179

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             +TIGYIY RQ+AKELGKK I+LGVPF+AEWFRNKGHFIKSQVTAATGA ALIQLQEDMKR
Sbjct  180   STIGYIYARQSAKELGKKVIFLGVPFVAEWFRNKGHFIKSQVTAATGAIALIQLQEDMKR  239

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QL+AEGNYTEEELE YMQSHKKIM DSLWKLNVADIE TLSRVCQMVLQDN+ KKEELR 
Sbjct  240   QLNAEGNYTEEELEAYMQSHKKIMTDSLWKLNVADIEATLSRVCQMVLQDNSSKKEELRL  299

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RAKGLKTLGK+FQRVKS N N +E ++  P  KLDGS+ S ++   + +SRS N D+   
Sbjct  300   RAKGLKTLGKIFQRVKSANENNSENTSKDPTHKLDGSQSSSNTAPSSTTSRSFNNDQLSN  359

Query  696   TAFAVQ  679
             T FA Q
Sbjct  360   T-FAPQ  364



>ref|XP_006390162.1| hypothetical protein EUTSA_v10018664mg [Eutrema salsugineum]
 gb|ESQ27448.1| hypothetical protein EUTSA_v10018664mg [Eutrema salsugineum]
Length=398

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/403 (74%), Positives = 341/403 (85%), Gaps = 11/403 (3%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGVSP ATEA+IKKAYYIKARQVHPDKNPNDP AA NFQVLGEAYQVLSD
Sbjct  1     MVKETEYYDVLGVSPTATEAEIKKAYYIKARQVHPDKNPNDPHAAHNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
              AQRQAYDA GK+GIS ++IIDPAAIFAMLFGSELFE YIGQLAMASMASLDIF++G++F
Sbjct  61    SAQRQAYDACGKAGISVDSIIDPAAIFAMLFGSELFEGYIGQLAMASMASLDIFSEGDQF  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D KK+QEKMR VQ+ERE+KLA+ILK+RLN YV  +K+EF  +AEAE+ RLSNAAYGVDML
Sbjct  121   DTKKIQEKMRTVQKEREDKLAQILKDRLNEYVV-NKDEFVCNAEAEMVRLSNAAYGVDML  179

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQ+TAATGAFAL QLQE+MKR
Sbjct  180   NTIGYIYVRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQLTAATGAFALFQLQEEMKR  239

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLSAEGNYTEEELEEY+QSHK++MIDSLWKLNVADIE TLSRVCQ+VLQD   K+EELRA
Sbjct  240   QLSAEGNYTEEELEEYLQSHKRVMIDSLWKLNVADIEATLSRVCQLVLQDPEAKREELRA  299

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RA+GLKTLG++FQR K+   +E++  A T  QKL+ +   YD    + +S S  ++EA +
Sbjct  300   RARGLKTLGRIFQRAKT--ASESDPLARTEPQKLNENVKEYD----DVASTSPKSNEASH  353

Query  696   TAFAVQ---SPYIETPQFGSGQFNSYDFPMPTAPPGAERHA*T  577
             +    Q   SPY+E P+ G  QFN Y FP P  PPG E+H  T
Sbjct  354   STSGSQEPKSPYVEEPKLGEQQFNYY-FPRPAPPPGVEKHTST  395



>ref|XP_009110197.1| PREDICTED: chaperone protein dnaJ 10-like [Brassica rapa]
Length=391

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/401 (74%), Positives = 340/401 (85%), Gaps = 13/401 (3%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGVSP ATEAQIKKAYYIKARQVHPDKNPNDP AA NFQVLGEAYQVLSD
Sbjct  1     MVKETEYYDVLGVSPTATEAQIKKAYYIKARQVHPDKNPNDPQAAHNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QRQAYD  GK+GISTE IIDPAAIFAMLFGSELFE+YIGQLAMASMASLDI ++G++ 
Sbjct  61    PGQRQAYDTIGKAGISTE-IIDPAAIFAMLFGSELFEEYIGQLAMASMASLDILSEGDQI  119

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D KK+ EKMR VQ++RE+KLA+ILK+RLN+YV  +K+EF ++AEAEV+RLSNAAYGV+ML
Sbjct  120   DTKKIIEKMRAVQKDREDKLAQILKDRLNLYVT-NKDEFISNAEAEVTRLSNAAYGVEML  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQAAKELGKKAIYLGVPF+AEWFR KGHFIKSQVTAATGA+AL QLQE+MKR
Sbjct  179   NTIGYIYVRQAAKELGKKAIYLGVPFVAEWFRTKGHFIKSQVTAATGAYALFQLQEEMKR  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLSAEGNYTE+ELEEYMQSHKK+MIDSLWKLNVADIE TLSRVC++VLQD   K+EELRA
Sbjct  239   QLSAEGNYTEKELEEYMQSHKKVMIDSLWKLNVADIENTLSRVCELVLQDPTAKREELRA  298

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RAKGLKTLGK+FQ++K        TS + P+ + +  + + +    + SS S N+DEA Y
Sbjct  299   RAKGLKTLGKIFQKIKL-------TSESDPLVRAELHKINENGQDRDASSTSPNSDEASY  351

Query  696   TAFA---VQSPYIETPQFGSGQFNSYDFPMPTAPPGAERHA  583
             + F     QSPY+E P+ G  QF+ Y FP P  PPGA+RH+
Sbjct  352   STFGPQEPQSPYVEAPRVGVEQFDHY-FPRPAPPPGAQRHS  391



>ref|XP_003578350.2| PREDICTED: chaperone protein dnaJ 10-like [Brachypodium distachyon]
Length=460

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/398 (74%), Positives = 338/398 (85%), Gaps = 7/398 (2%)
 Frame = -2

Query  1779  SMVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLS  1600
             SMV+ETEYYDVLGVSP ATE +IKKAYY+KARQVHPDKNPNDPLAA+ FQ LG+AYQVLS
Sbjct  65    SMVRETEYYDVLGVSPSATETEIKKAYYVKARQVHPDKNPNDPLAAEKFQELGKAYQVLS  124

Query  1599  DPAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEE  1420
             DP QR+ Y++YGKSGIST+ +IDPAAIFAMLFGSE+FEDYIGQLAMASMASLDIF++ EE
Sbjct  125   DPTQREMYNSYGKSGISTDTMIDPAAIFAMLFGSEIFEDYIGQLAMASMASLDIFSEDEE  184

Query  1419  FDAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDM  1240
              DA+KLQEKMRVVQ+EREEKLA+ LKNRLN+YVQG+KEEF   AEAEVSRLSNAAYGVDM
Sbjct  185   IDARKLQEKMRVVQKEREEKLAQKLKNRLNIYVQGNKEEFIELAEAEVSRLSNAAYGVDM  244

Query  1239  LNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMK  1060
             L+TIGY+Y+RQAAKELGKKAI LGVPFIAEWFRNKGHFIKSQVTAATGA AL+QLQED+K
Sbjct  245   LSTIGYMYSRQAAKELGKKAILLGVPFIAEWFRNKGHFIKSQVTAATGAIALMQLQEDLK  304

Query  1059  RQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELR  880
             + LS+E NYTEEELE YMQSHK +++DSLWKLNVADIE TLS VCQMVLQD +V++EELR
Sbjct  305   KHLSSECNYTEEELEAYMQSHKSVLVDSLWKLNVADIEATLSHVCQMVLQDGSVRREELR  364

Query  879   ARAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNAD-EA  703
             ARAKGLKTLGK+FQRVK +NG+E E +A   +             S   S R Q  D   
Sbjct  365   ARAKGLKTLGKIFQRVK-LNGSEEEPAAMKNMIHNSDDNAGSSPGSSPKSPREQPFDANP  423

Query  702   PYTAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPGAER  589
             PY+    QSPY+E PQF  G + S++FPMPTAPPGA+R
Sbjct  424   PYS----QSPYVEAPQF-DGAYYSFNFPMPTAPPGAQR  456



>ref|XP_006416333.1| hypothetical protein EUTSA_v10007857mg [Eutrema salsugineum]
 gb|ESQ34686.1| hypothetical protein EUTSA_v10007857mg [Eutrema salsugineum]
Length=391

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/401 (74%), Positives = 340/401 (85%), Gaps = 13/401 (3%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETE+YDVLGVSP ATEAQIKKAYYIKARQVHPDKNPNDP AA NFQVLGEAYQVLSD
Sbjct  1     MVKETEFYDVLGVSPTATEAQIKKAYYIKARQVHPDKNPNDPQAAHNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QRQAYD  GKSGISTE IIDPAAIFAMLFGSELFE+YIGQLAMASMASLDI ++G++ 
Sbjct  61    PGQRQAYDTCGKSGISTE-IIDPAAIFAMLFGSELFEEYIGQLAMASMASLDILSEGDQI  119

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D KK+ EKMR VQ+ERE+KLA+ILK+RLN+YV  +K+EF ++AEAEV+RLSNAAYGV+ML
Sbjct  120   DTKKIIEKMRAVQKEREDKLAQILKDRLNLYVT-NKDEFISNAEAEVTRLSNAAYGVEML  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQAAKELGKKAIYLGVPF+AEWFR KGHFIKSQVTAATGA+AL QLQE+MKR
Sbjct  179   NTIGYIYVRQAAKELGKKAIYLGVPFVAEWFRTKGHFIKSQVTAATGAYALFQLQEEMKR  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLSAEGNYTE+ELEEYM++HKK+MIDSLWKLNVADIE+TLSRVC++VLQD  VK+EELRA
Sbjct  239   QLSAEGNYTEKELEEYMKTHKKVMIDSLWKLNVADIESTLSRVCELVLQDPTVKREELRA  298

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RAKGLKTLGK+FQ+ K    +E++      + KL+G+    D  S +P S     DEA +
Sbjct  299   RAKGLKTLGKIFQKNKI--ASESDPLVRAELHKLNGNGQDRDYASTSPKS-----DEASH  351

Query  696   TAFA---VQSPYIETPQFGSGQFNSYDFPMPTAPPGAERHA  583
             + F     QSPY+E P+ G  QFN Y FP P  PPGA+RH+
Sbjct  352   STFGPQEPQSPYVEAPKLGDEQFNYY-FPRPAPPPGAQRHS  391



>gb|KFK42079.1| hypothetical protein AALP_AA2G208500 [Arabis alpina]
Length=397

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/401 (75%), Positives = 343/401 (86%), Gaps = 13/401 (3%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGV P ATE++IKKAYYIKARQVHPDKNPNDP AA NFQVLGEAYQVLSD
Sbjct  1     MVKETEYYDVLGVIPTATESEIKKAYYIKARQVHPDKNPNDPQAAHNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
              AQRQAYDA GKSGIST+AIIDPAAIFAMLFGSELFE YIGQLAMASMAS+DIF++G++ 
Sbjct  61    SAQRQAYDACGKSGISTDAIIDPAAIFAMLFGSELFEGYIGQLAMASMASIDIFSEGDQI  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D KK+QEKMRVVQ+ERE++LA+ILK+RLN YV  +K+EF ++AEAEV+RLSNAAYGVDML
Sbjct  121   DPKKIQEKMRVVQKEREDRLAQILKDRLNEYVL-NKDEFSSNAEAEVARLSNAAYGVDML  179

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFAL QLQE+MKR
Sbjct  180   NTIGYIYVRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALFQLQEEMKR  239

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLS+EGNYTEEELEEY+Q+HK++MIDSLWKLNVADIE TL RVCQ+VLQD   K+EELRA
Sbjct  240   QLSSEGNYTEEELEEYLQTHKRVMIDSLWKLNVADIEATLCRVCQLVLQDPEAKREELRA  299

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RA+GLKTLGK+FQR K+   +E +  A T  QK++G+E    +H  +PS+ S   D+A +
Sbjct  300   RARGLKTLGKIFQRAKT--ASEIDPVAET--QKINGNE---KNHGDDPST-SPKFDKASH  351

Query  696   TAFAVQ---SPYIETPQFGSGQFNSYDFPMPTAPPGAERHA  583
             +    Q   SPY+E P  G  QFN Y FP P  PPGAE+H+
Sbjct  352   STSGPQEPKSPYMEEPNLGDQQFNYY-FPRPAPPPGAEKHS  391



>ref|XP_004957235.1| PREDICTED: chaperone protein dnaJ 10-like [Setaria italica]
Length=394

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/396 (74%), Positives = 334/396 (84%), Gaps = 6/396 (2%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MV+ET YYDVLGV+P ATEA+IKKAYYIKARQVHPDKNPNDPLAA  FQ LGEAYQVLSD
Sbjct  1     MVRETGYYDVLGVTPAATEAEIKKAYYIKARQVHPDKNPNDPLAAARFQELGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QRQ+YD+YGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLD F++ E+ 
Sbjct  61    PTQRQSYDSYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDGFSEDEQI  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             + ++LQE+MRVVQ+EREEKLAE LKNRL++YVQG+KEEF  HAEAEV+RLSNAAYGVDML
Sbjct  121   NERRLQEQMRVVQKEREEKLAEALKNRLHLYVQGNKEEFIQHAEAEVTRLSNAAYGVDML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             +TIGY+Y+RQAAKELGKKA+YLGVPFIAEWFRNKGHFIKSQVTAATGA AL+QLQED+K+
Sbjct  181   STIGYVYSRQAAKELGKKALYLGVPFIAEWFRNKGHFIKSQVTAATGAIALMQLQEDLKK  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
              LSAE +YTEEELE YMQ+HK +M+DSLWKLNVADIE TLS VCQMVLQD++++KEELRA
Sbjct  241   HLSAECHYTEEELEAYMQTHKSVMVDSLWKLNVADIEATLSHVCQMVLQDSSIRKEELRA  300

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RAKGLKTLGK+FQRVK +N  + E +A                 S   S R Q  D  P 
Sbjct  301   RAKGLKTLGKIFQRVK-LNATDGEPAAVKNTINNSDDNDGSSPDSSPKSPRDQIFDANPP  359

Query  696   TAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPGAER  589
              A   QSPY+E PQFG   + SY+FPMP APPGA+R
Sbjct  360   YA---QSPYVEAPQFGG--YCSYNFPMPAAPPGAQR  390



>ref|XP_002893150.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH69409.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
Length=391

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/401 (74%), Positives = 340/401 (85%), Gaps = 13/401 (3%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETE+YDVLGVSP ATEA+IKKAYYIKARQVHPDKNPNDP AA NFQVLGEAYQVLSD
Sbjct  1     MVKETEFYDVLGVSPTATEAEIKKAYYIKARQVHPDKNPNDPQAAHNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QRQAYD  GKSGISTE IIDPAAIFAMLFGSELFE+YIGQLAMASMASLDIFT+G++ 
Sbjct  61    PGQRQAYDTCGKSGISTE-IIDPAAIFAMLFGSELFEEYIGQLAMASMASLDIFTEGDQI  119

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D KK+ EKMR VQ+ERE+KLA+ILK+RLN+Y+  +K+EF ++AEAEV+RLSNAAYGV+ML
Sbjct  120   DTKKIIEKMRAVQKEREDKLAQILKDRLNLYMT-NKDEFISNAEAEVTRLSNAAYGVEML  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQAAKELGKKAIYLGVPF+AEWFR KGHFIKSQVTAATGA+AL QLQE+MKR
Sbjct  179   NTIGYIYVRQAAKELGKKAIYLGVPFVAEWFRTKGHFIKSQVTAATGAYALFQLQEEMKR  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLS EGNYTE+ELEEYM++HKK+MIDSLWKLNVADIE+T+SRVC++VLQD   KKEELRA
Sbjct  239   QLSVEGNYTEKELEEYMKTHKKVMIDSLWKLNVADIESTISRVCELVLQDPIAKKEELRA  298

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RAKGLKTLGK+FQ+ K    +E++      + KL+G+   +D  S +P S     DEA  
Sbjct  299   RAKGLKTLGKIFQKNKI--ASESDPLVRAELHKLNGNGQEHDHASTSPKS-----DEASR  351

Query  696   TAFA---VQSPYIETPQFGSGQFNSYDFPMPTAPPGAERHA  583
             + F     QSPY+ETP+ G  QFN Y FP P  PPGA+RH+
Sbjct  352   STFGPQEPQSPYVETPKLGEEQFNHY-FPRPAPPPGAQRHS  391



>ref|XP_010477369.1| PREDICTED: chaperone protein dnaJ 10-like isoform X2 [Camelina 
sativa]
Length=388

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/398 (73%), Positives = 338/398 (85%), Gaps = 10/398 (3%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETE+YDVLGVSP ATEAQIKKAYYIKARQVHPDKNPNDP AA NFQVLGEAYQVLSD
Sbjct  1     MVKETEFYDVLGVSPTATEAQIKKAYYIKARQVHPDKNPNDPQAAHNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QRQAYD  GKSGISTE IIDPAAIFAMLFGSELFE+YIGQLAMASMASLDI T+G++ 
Sbjct  61    PGQRQAYDTCGKSGISTE-IIDPAAIFAMLFGSELFEEYIGQLAMASMASLDIVTEGDQI  119

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D KK+ +KMR VQ+EREEKLA+ILK+RLN+Y+  +K+EF ++AEAEV+RLSNAAYGV+ML
Sbjct  120   DTKKIIDKMRAVQKEREEKLAQILKDRLNLYMT-NKDEFVSNAEAEVTRLSNAAYGVEML  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQAAKELGKKAIYLGVPF+AEWFR KGHFIKSQVTAATGA+AL QLQE+MKR
Sbjct  179   NTIGYIYVRQAAKELGKKAIYLGVPFVAEWFRTKGHFIKSQVTAATGAYALFQLQEEMKR  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLSAEGNYTE+ELEEYM++HKK+MIDSLWKLNVADIE T+SRVC++VLQD   K+EELR 
Sbjct  239   QLSAEGNYTEKELEEYMKTHKKVMIDSLWKLNVADIENTISRVCELVLQDPIAKREELRG  298

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RAKGLKTLGK+FQ+ K    +E++      + KL+G+   +D+ S +P S     DEA  
Sbjct  299   RAKGLKTLGKIFQKNKI--ASESDPLVRAELHKLNGNGQDHDNASTSPKS-----DEASR  351

Query  696   TAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPGAERHA  583
             +    QSPY+ETP+ G  QFN + FP P  PPGA+RH+
Sbjct  352   STVGPQSPYVETPKLGEEQFNQF-FPRPAPPPGAQRHS  388



>ref|NP_001063548.1| Os09g0493800 [Oryza sativa Japonica Group]
 dbj|BAF25462.1| Os09g0493800 [Oryza sativa Japonica Group]
 dbj|BAG97230.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC84814.1| hypothetical protein OsI_31884 [Oryza sativa Indica Group]
 gb|EEE69976.1| hypothetical protein OsJ_29869 [Oryza sativa Japonica Group]
Length=395

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/398 (74%), Positives = 333/398 (84%), Gaps = 9/398 (2%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MV+ET YYDVLGVSP ATE +IKKAYY+KAR+VHPDKNPNDPLAA  FQ LGEAYQVLSD
Sbjct  1     MVRETGYYDVLGVSPTATEVEIKKAYYMKARKVHPDKNPNDPLAAAKFQELGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QRQAYD+YGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIF D EE 
Sbjct  61    PTQRQAYDSYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFGDEEEI  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             DA+ LQEKMRVVQ+EREEKLAE LKN+L++YVQG+KEEF   AEAEVSRLSNAAYGVDML
Sbjct  121   DARMLQEKMRVVQKEREEKLAETLKNKLHLYVQGNKEEFVQFAEAEVSRLSNAAYGVDML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             +TIGY+Y+RQAAKELGKKAIYLGVPFIAEWFRNKGH+IKSQVTAATGA AL+QLQED+K+
Sbjct  181   STIGYVYSRQAAKELGKKAIYLGVPFIAEWFRNKGHYIKSQVTAATGAIALMQLQEDLKK  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
              LSAE +YTEEELE YM++HK +M+DSLWKLNVADIE TLS VCQMVLQD+ +++EELRA
Sbjct  241   HLSAECHYTEEELEAYMETHKSVMVDSLWKLNVADIEGTLSHVCQMVLQDSTIRREELRA  300

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RAKGLKTLGK+FQRVK  +     T+ N  +   D      D+   +P S   +  E PY
Sbjct  301   RAKGLKTLGKIFQRVKLGSSEGEVTTINNTINNSD------DNDGSSPDSSPMSPREHPY  354

Query  696   TAFA--VQSPYIETPQFGSGQFNSYDFPMPTAPPGAER  589
                    QSPY+E PQF  G + S +FPMPTAPPGA+R
Sbjct  355   DPNPPYYQSPYVEAPQFVGG-YPSLNFPMPTAPPGAQR  391



>gb|KHN12125.1| Chaperone protein dnaJ 10 [Glycine soja]
Length=375

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/396 (77%), Positives = 329/396 (83%), Gaps = 28/396 (7%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGVSP A+EA+IKKAYYIK                    VLGEAYQVLSD
Sbjct  1     MVKETEYYDVLGVSPTASEAEIKKAYYIK--------------------VLGEAYQVLSD  40

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             PAQRQAYDA+GKSGISTEAIIDPAAIFAMLFGSELFE+YIGQLAMASMAS+DIFT+GE+F
Sbjct  41    PAQRQAYDAHGKSGISTEAIIDPAAIFAMLFGSELFEEYIGQLAMASMASMDIFTEGEQF  100

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D+KKLQEKMRVVQ+EREEKLAEILKNRLN YVQG+KE F   AEAEV+RLSNAAYGVDML
Sbjct  101   DSKKLQEKMRVVQKEREEKLAEILKNRLNQYVQGNKEGFVNDAEAEVARLSNAAYGVDML  160

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQAAKELGKKAIYLGVPFIAEWFRNKGH IKSQVTAATGA ALIQLQEDMK+
Sbjct  161   NTIGYIYARQAAKELGKKAIYLGVPFIAEWFRNKGHSIKSQVTAATGAIALIQLQEDMKK  220

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLS+EG+YTEEELEEYMQ+HKK+MIDSLWKLNVADIE TLSRVCQMVLQDN  KKEELRA
Sbjct  221   QLSSEGDYTEEELEEYMQNHKKLMIDSLWKLNVADIEATLSRVCQMVLQDNGAKKEELRA  280

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RAKGLKTLGK+FQRVKS NGNE E+  N  V KL+GSE   D+        S        
Sbjct  281   RAKGLKTLGKIFQRVKSANGNENESVPNKAVHKLNGSETGNDTSPSTSPKSSS-------  333

Query  696   TAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPGAER  589
               F+ QSPY+E P+F   QF+ Y+FP PTAPPGA+R
Sbjct  334   PDFSSQSPYVEAPRFAGMQFD-YNFPRPTAPPGAQR  368



>ref|XP_006416332.1| hypothetical protein EUTSA_v10007857mg [Eutrema salsugineum]
 gb|ESQ34685.1| hypothetical protein EUTSA_v10007857mg [Eutrema salsugineum]
Length=390

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/401 (74%), Positives = 339/401 (85%), Gaps = 14/401 (3%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETE+YDVLGVSP ATEAQIKKAYYIKARQVHPDKNPNDP AA NFQVLGEAYQVLSD
Sbjct  1     MVKETEFYDVLGVSPTATEAQIKKAYYIKARQVHPDKNPNDPQAAHNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QRQAYD  GKSGISTE IIDPAAIFAMLFGSELFE+YIGQLAMASMASLDI ++G++ 
Sbjct  61    PGQRQAYDTCGKSGISTE-IIDPAAIFAMLFGSELFEEYIGQLAMASMASLDILSEGDQI  119

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D KK+ EKMR VQ+ERE+KLA+ILK+RLN+YV  +K+EF ++AEAEV+RLSNAAYGV+ML
Sbjct  120   DTKKIIEKMRAVQKEREDKLAQILKDRLNLYVT-NKDEFISNAEAEVTRLSNAAYGVEML  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQAAKELGKKAIYLGVPF+AEWFR KGHFIKSQVTAATGA+AL QLQE+MKR
Sbjct  179   NTIGYIYVRQAAKELGKKAIYLGVPFVAEWFRTKGHFIKSQVTAATGAYALFQLQEEMKR  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLSAEGNYTE+ELEEYM++HKK+MIDSLWKLNVADIE+TLSRVC++VLQD  VK+EELRA
Sbjct  239   QLSAEGNYTEKELEEYMKTHKKVMIDSLWKLNVADIESTLSRVCELVLQDPTVKREELRA  298

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RAKGLKTLGK+FQ   +   +E++      + KL+G+    D  S +P S     DEA +
Sbjct  299   RAKGLKTLGKIFQ---NKIASESDPLVRAELHKLNGNGQDRDYASTSPKS-----DEASH  350

Query  696   TAFA---VQSPYIETPQFGSGQFNSYDFPMPTAPPGAERHA  583
             + F     QSPY+E P+ G  QFN Y FP P  PPGA+RH+
Sbjct  351   STFGPQEPQSPYVEAPKLGDEQFNYY-FPRPAPPPGAQRHS  390



>ref|XP_010498561.1| PREDICTED: chaperone protein dnaJ 10-like [Camelina sativa]
Length=391

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/402 (73%), Positives = 340/402 (85%), Gaps = 15/402 (4%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETE+YDVLGVSP ATEAQIKKAYYIKARQVHPDKNPNDP AA NFQVLGEAYQVLSD
Sbjct  1     MVKETEFYDVLGVSPTATEAQIKKAYYIKARQVHPDKNPNDPQAAHNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QRQAYD  GKSGISTE IIDPAAIFAMLFGSELFE+YIGQLAMASMASLDI T+G++ 
Sbjct  61    PGQRQAYDTCGKSGISTE-IIDPAAIFAMLFGSELFEEYIGQLAMASMASLDIVTEGDQI  119

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D KKL +KMR VQ+ERE+KLA+ILK+RLN+Y+  +K+EF ++AEAEV+RLSNAAYGV+ML
Sbjct  120   DTKKLIDKMRAVQKEREDKLAQILKDRLNLYMT-NKDEFVSNAEAEVTRLSNAAYGVEML  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQAAKELGKKAIYLGVPF+AEWFR KGHFIKSQVTAATGA+AL QLQE+MKR
Sbjct  179   NTIGYIYVRQAAKELGKKAIYLGVPFVAEWFRTKGHFIKSQVTAATGAYALFQLQEEMKR  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLSAEGNYTE+ELEEYM++HKK+MIDSLWKLNVADIE T+SRVC++VLQD N K+EELR 
Sbjct  239   QLSAEGNYTEKELEEYMKTHKKVMIDSLWKLNVADIENTISRVCELVLQDPNAKREELRG  298

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNP----SSRSQNAD  709
             RAKGLKTLGK+FQ+ K    +E++      + KL+G+   +++ S +P    +SRS+   
Sbjct  299   RAKGLKTLGKIFQKNKI--ASESDPLVRAELHKLNGNGQDHENASTSPKSDEASRSKVGP  356

Query  708   EAPYTAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPGAERHA  583
             + P      QSPY+ETP  G  QFN Y FP P  PPGA+RH+
Sbjct  357   QEP------QSPYVETPTLGEEQFNQY-FPRPAPPPGAQRHS  391



>ref|NP_001062282.1| Os08g0522600 [Oryza sativa Japonica Group]
 dbj|BAD08769.1| DnaJ protein family-like [Oryza sativa Japonica Group]
 dbj|BAD08872.1| DnaJ protein family-like [Oryza sativa Japonica Group]
 dbj|BAF24196.1| Os08g0522600 [Oryza sativa Japonica Group]
 dbj|BAG97212.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC83904.1| hypothetical protein OsI_29937 [Oryza sativa Indica Group]
Length=394

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/396 (72%), Positives = 332/396 (84%), Gaps = 6/396 (2%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKET YYDVLGVSP ATE++IKKAYY+KARQVHPDKNPNDP AA+NFQ LGEAYQVLSD
Sbjct  1     MVKETGYYDVLGVSPTATESEIKKAYYMKARQVHPDKNPNDPKAAENFQALGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QRQAYDA+GKSGISTE IIDPAAIFAMLFGSELFEDYIGQLAMASMASLD F + E  
Sbjct  61    PTQRQAYDAHGKSGISTEGIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDNFGEDEHI  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D ++L E+M+ VQ+EREEKLAE LKNRL++YVQG+KEEF   A+AEV+RLSNAAYG  ML
Sbjct  121   DTRRLHERMQAVQKEREEKLAETLKNRLHIYVQGNKEEFVQLAQAEVTRLSNAAYGTVML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGY+Y+RQAAKELGKKAI+LGVPF+AEWFR+KGHFIKSQVTAA GA AL+QLQED+K+
Sbjct  181   NTIGYVYSRQAAKELGKKAIFLGVPFVAEWFRDKGHFIKSQVTAAAGAIALMQLQEDLKK  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
              LSAEG+YTEEELE +MQ+HKK+M+DSLWKLNVADIE TLSRVCQMVLQD +V++EELRA
Sbjct  241   YLSAEGHYTEEELEMFMQNHKKVMVDSLWKLNVADIEATLSRVCQMVLQDGSVRREELRA  300

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RAKGLKTLGK+FQRVK +N +E E S    +  +D +    D  S + S R +       
Sbjct  301   RAKGLKTLGKIFQRVK-LNNDEGEASDMRNIDNMDDN----DGSSPDTSPRREPPYNPIP  355

Query  696   TAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPGAER  589
                  QSPY+E PQFG G +  ++FPMPTAPPGA+R
Sbjct  356   NPPHAQSPYVEAPQFG-GTYYPFNFPMPTAPPGAQR  390



>ref|XP_010477368.1| PREDICTED: chaperone protein dnaJ 10-like isoform X1 [Camelina 
sativa]
Length=391

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/402 (73%), Positives = 339/402 (84%), Gaps = 15/402 (4%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETE+YDVLGVSP ATEAQIKKAYYIKARQVHPDKNPNDP AA NFQVLGEAYQVLSD
Sbjct  1     MVKETEFYDVLGVSPTATEAQIKKAYYIKARQVHPDKNPNDPQAAHNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QRQAYD  GKSGISTE IIDPAAIFAMLFGSELFE+YIGQLAMASMASLDI T+G++ 
Sbjct  61    PGQRQAYDTCGKSGISTE-IIDPAAIFAMLFGSELFEEYIGQLAMASMASLDIVTEGDQI  119

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D KK+ +KMR VQ+EREEKLA+ILK+RLN+Y+  +K+EF ++AEAEV+RLSNAAYGV+ML
Sbjct  120   DTKKIIDKMRAVQKEREEKLAQILKDRLNLYMT-NKDEFVSNAEAEVTRLSNAAYGVEML  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQAAKELGKKAIYLGVPF+AEWFR KGHFIKSQVTAATGA+AL QLQE+MKR
Sbjct  179   NTIGYIYVRQAAKELGKKAIYLGVPFVAEWFRTKGHFIKSQVTAATGAYALFQLQEEMKR  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLSAEGNYTE+ELEEYM++HKK+MIDSLWKLNVADIE T+SRVC++VLQD   K+EELR 
Sbjct  239   QLSAEGNYTEKELEEYMKTHKKVMIDSLWKLNVADIENTISRVCELVLQDPIAKREELRG  298

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNP----SSRSQNAD  709
             RAKGLKTLGK+FQ+ K    +E++      + KL+G+   +D+ S +P    +SRS    
Sbjct  299   RAKGLKTLGKIFQKNKI--ASESDPLVRAELHKLNGNGQDHDNASTSPKSDEASRSTVGP  356

Query  708   EAPYTAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPGAERHA  583
             + P      QSPY+ETP+ G  QFN Y FP P  PPGA+RH+
Sbjct  357   QEP------QSPYVETPKLGEEQFNHY-FPRPAPPPGAQRHS  391



>ref|NP_564134.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
thaliana]
 gb|AAF80653.1|AC012190_9 Similar to a dnaJ-like protein from Arabidopsis thaliana gb|Y11969. 
It contains a DnaJ domain PF|00226. EST gb|H37613 comes 
from this gene [Arabidopsis thaliana]
 gb|AAK76724.1| unknown protein [Arabidopsis thaliana]
 gb|AEE30060.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
thaliana]
Length=391

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/402 (73%), Positives = 338/402 (84%), Gaps = 15/402 (4%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETE+YDVLGVSP ATEA+IKKAYYIKARQVHPDKNPNDP AA NFQVLGEAYQVLSD
Sbjct  1     MVKETEFYDVLGVSPTATEAEIKKAYYIKARQVHPDKNPNDPQAAHNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QRQAYD  GKSGISTE IIDPAAIFAMLFGSELFE+YIGQLAMASMASLDIFT+G++ 
Sbjct  61    PGQRQAYDTSGKSGISTE-IIDPAAIFAMLFGSELFEEYIGQLAMASMASLDIFTEGDQI  119

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D KK+ EKMR VQ+ERE+KLA+ILK+RLN+Y+  +K+EF ++AEAEV+RLSNAAYGV+ML
Sbjct  120   DTKKIIEKMRAVQKEREDKLAQILKDRLNLYMT-NKDEFTSNAEAEVTRLSNAAYGVEML  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQAAKELGKKAIYLGVPF+AEWFR KGHFIKSQVTAATGA+AL QLQE+MKR
Sbjct  179   NTIGYIYVRQAAKELGKKAIYLGVPFVAEWFRTKGHFIKSQVTAATGAYALFQLQEEMKR  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLSAEGNYTE+ELEEYM++HKK+MIDSLWKLNVADIE+T+SRVC+ VLQD   K+EELRA
Sbjct  239   QLSAEGNYTEKELEEYMKTHKKVMIDSLWKLNVADIESTISRVCEQVLQDPTAKREELRA  298

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNP----SSRSQNAD  709
             RAKGLKTLGK+FQ+ K    +E++      + KL+G+   +D  S +P    +SRS    
Sbjct  299   RAKGLKTLGKIFQKNKI--ASESDPLVRAELHKLNGNGQEHDHSSTSPKSDEASRSTVGP  356

Query  708   EAPYTAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPGAERHA  583
             + P      QSPY+E P+ G  Q N Y FP P  PPGA+RH+
Sbjct  357   QEP------QSPYVEAPKLGEEQINYY-FPRPAPPPGAQRHS  391



>ref|XP_006305020.1| hypothetical protein CARUB_v10009386mg [Capsella rubella]
 gb|EOA37918.1| hypothetical protein CARUB_v10009386mg [Capsella rubella]
Length=391

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/402 (73%), Positives = 338/402 (84%), Gaps = 15/402 (4%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETE+YDVLGVSP ATEAQIKKAYYIKARQVHPDKNPNDP AA NFQVLGEAYQVLSD
Sbjct  1     MVKETEFYDVLGVSPTATEAQIKKAYYIKARQVHPDKNPNDPQAAHNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QRQAYD  GKSGISTE IIDPAAIFAMLFGSELFE+YIGQLAMASMASLDIFT+GE+ 
Sbjct  61    PGQRQAYDTCGKSGISTE-IIDPAAIFAMLFGSELFEEYIGQLAMASMASLDIFTEGEQI  119

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D KK+ EKMR VQ+ERE+KLA+ILK+RLN+Y+  +K+EF ++AEAEV+RLSNAAYGV+ML
Sbjct  120   DTKKIIEKMRAVQKEREDKLAQILKDRLNLYMT-NKDEFISNAEAEVTRLSNAAYGVEML  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQAAKELGKKAIYLGVPF+AEWFR KGHFIKSQVTAA+GA+AL QLQE+MKR
Sbjct  179   NTIGYIYVRQAAKELGKKAIYLGVPFVAEWFRTKGHFIKSQVTAASGAYALFQLQEEMKR  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLSAEGNYTE+ELEEYM++HKK+MIDSLWKLNVADIE T+SRVC++VLQD   K+EELR 
Sbjct  239   QLSAEGNYTEKELEEYMKTHKKVMIDSLWKLNVADIENTISRVCELVLQDPTAKREELRL  298

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNP----SSRSQNAD  709
             RAKGLKTLGK+FQ+ K    +E++      +  L+G+   + + S +P    +SRS    
Sbjct  299   RAKGLKTLGKIFQKNKI--ASESDPLVGAKLHTLNGNGQDHGNASTSPKSDEASRSTVGP  356

Query  708   EAPYTAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPGAERHA  583
             + P      QSPY+ETP+ G  QFN Y FP P  PPGA+RH+
Sbjct  357   QEP------QSPYVETPKLGEEQFNQY-FPRPAPPPGAQRHS  391



>gb|AAW50121.1| DnaJ-like protein [Brassica juncea]
Length=390

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/401 (73%), Positives = 338/401 (84%), Gaps = 14/401 (3%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGVSP ATEAQIKKAYYIKARQVHPDKNPNDP AA NFQVLGEAYQVLSD
Sbjct  1     MVKETEYYDVLGVSPTATEAQIKKAYYIKARQVHPDKNPNDPQAAHNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QRQAYD  GK+GISTE IIDPAAIFAMLFGSE FE+YIGQLAMASMASLDI ++G++ 
Sbjct  61    PGQRQAYDTIGKAGISTE-IIDPAAIFAMLFGSEFFEEYIGQLAMASMASLDILSEGDQI  119

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D KK+ EKMR VQ++RE+KLA+ILK+RLN+YV  +K+EF ++AEAEV+RLSNAAYGV+ML
Sbjct  120   DTKKIIEKMRAVQKDREDKLAQILKDRLNLYVT-NKDEFISNAEAEVTRLSNAAYGVEML  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQAAKELGKKAIYLGVPF+AEWFR KGHFIKSQVTAATGA+AL QLQE+MKR
Sbjct  179   NTIGYIYVRQAAKELGKKAIYLGVPFVAEWFRTKGHFIKSQVTAATGAYALFQLQEEMKR  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLSAEGNYTE+ELEEYM+SHKK+MIDSLWKLNVADIE TLSRVC++VLQD   K+EELRA
Sbjct  239   QLSAEGNYTEKELEEYMRSHKKVMIDSLWKLNVADIENTLSRVCELVLQDPTAKREELRA  298

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RAKGLKTLGK+FQ+ K    +E++      + K++G+    D      +S S N+DEA +
Sbjct  299   RAKGLKTLGKIFQKNKLT--SESDPLVRAELHKINGNGQDRD------ASTSPNSDEASH  350

Query  696   TAFA---VQSPYIETPQFGSGQFNSYDFPMPTAPPGAERHA  583
             + F     QSPY+E P+ G  QF+ Y FP P  PPGA+RH+
Sbjct  351   STFGPQEPQSPYVEAPRVGVEQFDHY-FPRPAPPPGAQRHS  390



>ref|NP_001185052.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
thaliana]
 gb|AEE30062.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
thaliana]
Length=400

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/405 (72%), Positives = 339/405 (84%), Gaps = 12/405 (3%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETE+YDVLGVSP ATEA+IKKAYYIKARQVHPDKNPNDP AA NFQVLGEAYQVLSD
Sbjct  1     MVKETEFYDVLGVSPTATEAEIKKAYYIKARQVHPDKNPNDPQAAHNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QRQAYD  GKSGISTE IIDPAAIFAMLFGSELFE+YIGQLAMASMASLDIFT+G++ 
Sbjct  61    PGQRQAYDTSGKSGISTE-IIDPAAIFAMLFGSELFEEYIGQLAMASMASLDIFTEGDQI  119

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D KK+ EKMR VQ+ERE+KLA+ILK+RLN+Y+  +K+EF ++AEAEV+RLSNAAYGV+ML
Sbjct  120   DTKKIIEKMRAVQKEREDKLAQILKDRLNLYMT-NKDEFTSNAEAEVTRLSNAAYGVEML  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQAAKELGKKAIYLGVPF+AEWFR KGHFIKSQVTAATGA+AL QLQE+MKR
Sbjct  179   NTIGYIYVRQAAKELGKKAIYLGVPFVAEWFRTKGHFIKSQVTAATGAYALFQLQEEMKR  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLSAEGNYTE+ELEEYM++HKK+MIDSLWKLNVADIE+T+SRVC+ VLQD   K+EELRA
Sbjct  239   QLSAEGNYTEKELEEYMKTHKKVMIDSLWKLNVADIESTISRVCEQVLQDPTAKREELRA  298

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNP----SSRSQNAD  709
             RAKGLKTLGK+FQ+ K    +E++      + KL+G+   +D  S +P    +SRS    
Sbjct  299   RAKGLKTLGKIFQKNKI--ASESDPLVRAELHKLNGNGQEHDHSSTSPKSDEASRSTVGP  356

Query  708   EAPYTAFAV---QSPYIETPQFGSGQFNSYDFPMPTAPPGAERHA  583
             +      ++   QSPY+E P+ G  Q N Y FP P  PPGA+RH+
Sbjct  357   QPEVETVSLVEPQSPYVEAPKLGEEQINYY-FPRPAPPPGAQRHS  400



>ref|XP_010459811.1| PREDICTED: chaperone protein dnaJ 10-like [Camelina sativa]
Length=391

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/402 (72%), Positives = 338/402 (84%), Gaps = 15/402 (4%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETE+YDVLGVSP ATEAQIKKAYYIKARQVHPDKNPNDP AA NFQVLGEAYQVLSD
Sbjct  1     MVKETEFYDVLGVSPTATEAQIKKAYYIKARQVHPDKNPNDPQAAHNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QRQAYD  GKSGISTE IIDPAAIFAMLFGSELFE+YIGQLAMASMASLDI T+G++ 
Sbjct  61    PGQRQAYDTCGKSGISTE-IIDPAAIFAMLFGSELFEEYIGQLAMASMASLDIVTEGDQI  119

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D KK+ EKMR VQ+ERE+KLA+ILK+RLN+Y+  +K+EF ++AE EV+RLSNAAYGV+ML
Sbjct  120   DTKKIIEKMRAVQKEREDKLAQILKDRLNLYMT-NKDEFVSNAETEVTRLSNAAYGVEML  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQAAKELGKKAIYLGVPF+AEWFR KGHFIKSQVTAATGA+AL QLQE+MKR
Sbjct  179   NTIGYIYVRQAAKELGKKAIYLGVPFVAEWFRTKGHFIKSQVTAATGAYALFQLQEEMKR  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLSAEGNYTE+ELEEYM++HKK+MIDSLWKLNVADIE T+SRVC++VLQD   K+EELR 
Sbjct  239   QLSAEGNYTEKELEEYMKTHKKVMIDSLWKLNVADIENTISRVCELVLQDPIAKREELRG  298

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNP----SSRSQNAD  709
             RAKGLKTLGK+FQ+ K    +E++      + KL+G+   +++ S +P    +SRS    
Sbjct  299   RAKGLKTLGKIFQKNKI--ASESDPLVRAELHKLNGNGQDHENASTSPKSDEASRSTVGP  356

Query  708   EAPYTAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPGAERHA  583
             + P      QSPY+ETP+ G  QFN Y FP P  PPGA+RH+
Sbjct  357   QEP------QSPYVETPKLGEEQFNHY-FPRPAPPPGAQRHS  391



>emb|CDX96605.1| BnaA08g21480D [Brassica napus]
Length=399

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/410 (72%), Positives = 339/410 (83%), Gaps = 23/410 (6%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQ---------VL  1624
             MVKETEYYDVLGVSP ATEAQIKKAYYIKARQVHPDKNPNDP AA NFQ         VL
Sbjct  1     MVKETEYYDVLGVSPTATEAQIKKAYYIKARQVHPDKNPNDPQAAHNFQANFNIEDDDVL  60

Query  1623  GEAYQVLSDPAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASL  1444
             GEAYQVLSDP QRQAYD  GK+GISTE IIDPAAIFAMLFGSELFE+YIGQLAMASMASL
Sbjct  61    GEAYQVLSDPGQRQAYDTIGKAGISTE-IIDPAAIFAMLFGSELFEEYIGQLAMASMASL  119

Query  1443  DIFTDGEEFDAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLS  1264
             DI ++G++ D KK+ EKMR VQ++RE+KLA+ILK+RLN+YV  +K+EF ++AEAEV+RLS
Sbjct  120   DILSEGDQIDTKKIIEKMRAVQKDREDKLAQILKDRLNLYVT-NKDEFISNAEAEVTRLS  178

Query  1263  NAAYGVDMLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFAL  1084
             NAAYGV+MLNTIGYIY RQAAKELGKKAIYLGVPF+AEWFR KGHFIKSQVTAATGA+AL
Sbjct  179   NAAYGVEMLNTIGYIYVRQAAKELGKKAIYLGVPFVAEWFRTKGHFIKSQVTAATGAYAL  238

Query  1083  IQLQEDMKRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDN  904
              QLQE+MKRQLSAEGNYTE+ELEEYMQSHKK+MIDSLWKLNVADIE TLSRVC++VLQD 
Sbjct  239   FQLQEEMKRQLSAEGNYTEKELEEYMQSHKKVMIDSLWKLNVADIENTLSRVCELVLQDP  298

Query  903   NVKKEELRARAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSR  724
               K+EELRARAKGLKTLGK+FQ+ K    +E++      + K++G+    D      +S 
Sbjct  299   TAKREELRARAKGLKTLGKIFQKNKLT--SESDPLVRAELHKINGNGQDRD------AST  350

Query  723   SQNADEAPYTAFA---VQSPYIETPQFGSGQFNSYDFPMPTAPPGAERHA  583
             S N+DEA ++ F     QSPY+E P+ G  QF+ Y FP P  PPGA+RH+
Sbjct  351   SPNSDEASHSTFGPQEPQSPYVEAPRVGVEQFDHY-FPRPAPPPGAQRHS  399



>ref|XP_004973911.1| PREDICTED: chaperone protein dnaJ 10-like [Setaria italica]
Length=392

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/399 (72%), Positives = 336/399 (84%), Gaps = 14/399 (4%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVK+T+YYDVLGV P ATE++IKKAYYIKARQVHPDKNPNDP AA NFQ LGEAYQVLSD
Sbjct  1     MVKDTDYYDVLGVDPSATESEIKKAYYIKARQVHPDKNPNDPDAAANFQALGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QRQAYD +GKSGISTE IIDPAAIFAMLFGSELFEDYIGQLAMASMASLD F + +  
Sbjct  61    PTQRQAYDLHGKSGISTEGIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDNFGEDDHI  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D +KLQE+M+ VQ+EREEKLAEILKNRL++YVQG+KEEF   AEAEVS+LSNAAYGV ML
Sbjct  121   DPRKLQERMQTVQKEREEKLAEILKNRLHIYVQGNKEEFIQLAEAEVSKLSNAAYGVVML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGY+Y+RQAAKELGKKAI+LGVPF+AEWFR+KGHFIKSQVTAATGA AL+QLQED+++
Sbjct  181   NTIGYVYSRQAAKELGKKAIFLGVPFVAEWFRDKGHFIKSQVTAATGAIALMQLQEDLRK  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
              +SAEG YTEEELE YM++HKK+M+DSLWKLNVADIE TLSRVCQMVLQD++ +KEELR 
Sbjct  241   YMSAEGLYTEEELEMYMENHKKVMVDSLWKLNVADIEATLSRVCQMVLQDSSARKEELRL  300

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKL---DGSEPSYDSHSLNPSSRSQNADE  706
             RAKGLKTLGK+FQRVK +N +E E S    +  +   DGS P  DS   +P+   Q    
Sbjct  301   RAKGLKTLGKIFQRVK-LNPSEGEASQVRNIDNMDEDDGSSP--DS---SPNREPQFTPN  354

Query  705   APYTAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPGAER  589
              P+    + SPY+E PQ  +G + S++FPMPTAPPGA+R
Sbjct  355   QPH----IPSPYVEAPQV-NGTYCSFNFPMPTAPPGAQR  388



>ref|XP_009106341.1| PREDICTED: chaperone protein dnaJ 10 [Brassica rapa]
Length=401

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/402 (72%), Positives = 337/402 (84%), Gaps = 13/402 (3%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGVSP ATE++IKKAYYIKARQVHPDKNPNDP AA NFQVLGEAYQVLSD
Sbjct  1     MVKETEYYDVLGVSPTATESEIKKAYYIKARQVHPDKNPNDPQAAHNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEE-  1420
              AQRQAYDA+GKSGIST+AIIDPA IFAMLFGSELFE YIGQLAMASMASLDIFT+GE  
Sbjct  61    SAQRQAYDAFGKSGISTDAIIDPAEIFAMLFGSELFERYIGQLAMASMASLDIFTEGEND  120

Query  1419  -FDAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVD  1243
              FD KK+QEKMR VQ+ERE+KLA+ILK+RLN YV  +++EF A+AEAE+ RLS AAYGV+
Sbjct  121   MFDTKKIQEKMRTVQKEREDKLAQILKDRLNDYVV-NRDEFVANAEAEMVRLSKAAYGVE  179

Query  1242  MLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDM  1063
             MLNTIGYIY RQA+KELGKKA+ LGVPF+AEW RNKGH+IKSQ+TAATGAFAL QLQE+M
Sbjct  180   MLNTIGYIYVRQASKELGKKALLLGVPFVAEWVRNKGHYIKSQLTAATGAFALFQLQEEM  239

Query  1062  KRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEEL  883
             K+QL+ E NYTEEELEEY+QSHK++M+DSLWKLNVADIE TLSRVCQ+VLQD + K+EEL
Sbjct  240   KKQLNGEVNYTEEELEEYLQSHKRVMVDSLWKLNVADIEATLSRVCQLVLQDPDAKREEL  299

Query  882   RARAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEA  703
             RARA+GLKTLGK+FQR K+   +E+E  A T  +KL+  E  YD    + +S S  ++EA
Sbjct  300   RARARGLKTLGKIFQRAKT--ASESEPIARTEPEKLNEDERDYD----DDASTSPKSNEA  353

Query  702   PYTAFAVQ---SPYIETPQFGSGQFNSYDFPMPTAPPGAERH  586
              ++ +  Q   SPY+E P+ G  QF  Y FP P  PPG E+H
Sbjct  354   SHSTYGTQEQKSPYVEEPKLGDEQFKHY-FPRPAPPPGVEKH  394



>ref|XP_006660786.1| PREDICTED: chaperone protein dnaJ 10-like [Oryza brachyantha]
Length=394

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/398 (72%), Positives = 331/398 (83%), Gaps = 10/398 (3%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MV+ET YYDVLGVSP ATEA+IK+AYY+KA+QVHPDKN NDPLAA NFQ LGEAYQVLSD
Sbjct  1     MVRETGYYDVLGVSPTATEAEIKRAYYMKAKQVHPDKNQNDPLAAANFQELGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QRQAYD+YGKSGIS EAIIDPAAIFAMLFGSELFEDYIGQLA+ASMASLD+  D E  
Sbjct  61    PTQRQAYDSYGKSGISAEAIIDPAAIFAMLFGSELFEDYIGQLAIASMASLDVL-DVEHI  119

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D ++LQE M+VVQ+EREEKLAE+LKNRL++YVQG+KEEF   AEAEVSRLSNAAYGVDML
Sbjct  120   DERRLQEHMQVVQKEREEKLAEMLKNRLHIYVQGNKEEFVQRAEAEVSRLSNAAYGVDML  179

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             +TIGY+Y+RQAAKELGKKAIYLGVPFIAEWFRNKGHFI SQVTAATGA AL+QLQED+K+
Sbjct  180   STIGYVYSRQAAKELGKKAIYLGVPFIAEWFRNKGHFIISQVTAATGAIALMQLQEDLKK  239

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
              LSAE  YTEEELE YM++HK +M+DSLWKLNVADIE TLS VCQMVLQD+ V++EELR 
Sbjct  240   HLSAECKYTEEELEAYMETHKSVMVDSLWKLNVADIEATLSHVCQMVLQDSTVRREELRV  299

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RAKGLKTLGK+F+RVK  +     T+ N  +   D      D+   +P S  ++  E PY
Sbjct  300   RAKGLKTLGKIFERVKLSSSEGGVTAMNNTINNSD------DNDGSSPDSSPKSPREHPY  353

Query  696   TAFA--VQSPYIETPQFGSGQFNSYDFPMPTAPPGAER  589
                    QSPY+E PQFG G + S++FPMPTAPPGA+R
Sbjct  354   DPNPPYYQSPYVEAPQFGEGYY-SFNFPMPTAPPGAQR  390



>ref|XP_009149588.1| PREDICTED: chaperone protein dnaJ 10-like [Brassica rapa]
Length=387

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/398 (72%), Positives = 334/398 (84%), Gaps = 11/398 (3%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGVSP ATEAQIKKAYYIKARQVHPDKNPNDP AA NFQVLGEAYQVLSD
Sbjct  1     MVKETEYYDVLGVSPTATEAQIKKAYYIKARQVHPDKNPNDPQAAHNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QRQAYD YGKSG+STE IIDPAAIFAMLFGSELFE+YIGQLAMASMASLDI ++G++ 
Sbjct  61    PGQRQAYDTYGKSGVSTE-IIDPAAIFAMLFGSELFEEYIGQLAMASMASLDILSEGDQI  119

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D KK+ +KMR VQ+ERE+KLA+ILK+RL +YV  +K+EF ++AEAEV++LSNAAYGV+ML
Sbjct  120   DTKKIIDKMRAVQKEREDKLAQILKDRLYLYVT-NKDEFISNAEAEVTKLSNAAYGVEML  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQAAKELGKKAIYLGVPF+AEWFR KGH IKSQVTAATGA+AL QLQE+MKR
Sbjct  179   NTIGYIYVRQAAKELGKKAIYLGVPFVAEWFRTKGHLIKSQVTAATGAYALFQLQEEMKR  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLSAEGNYTE+ELEEYM+SHKK+MIDSLWKLNVADIE+T+SRVC++VLQD   K+EELRA
Sbjct  239   QLSAEGNYTEKELEEYMKSHKKVMIDSLWKLNVADIESTISRVCELVLQDPIAKREELRA  298

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RAKGLKTLGK+FQ+ K    +E++      + K++G+    D+   + +S S    + P 
Sbjct  299   RAKGLKTLGKIFQKNKI--ASESDPLVRAELHKINGNGQDRDAPKSDEASHSTFGPQEP-  355

Query  696   TAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPGAERHA  583
                  QSPY+E P+ G  QFN Y FP P  PPGA+R +
Sbjct  356   -----QSPYVEAPKLGEEQFNYY-FPRPAPPPGAQRRS  387



>ref|XP_006660299.1| PREDICTED: chaperone protein dnaJ 10-like [Oryza brachyantha]
Length=392

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/394 (73%), Positives = 327/394 (83%), Gaps = 9/394 (2%)
 Frame = -2

Query  1767  ETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSDPAQ  1588
             +T YYDVLGVSP ATE++IKKAYY+KARQVHPDKNPNDP AA  FQ LGEAYQVLSDP Q
Sbjct  3     KTAYYDVLGVSPTATESEIKKAYYVKARQVHPDKNPNDPQAAAKFQELGEAYQVLSDPTQ  62

Query  1587  RQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEFDAK  1408
             RQAYDA+G+SGISTE IIDPAAIFAMLFGSELFEDYIGQLAMASMASLD F + E+ D +
Sbjct  63    RQAYDAHGRSGISTEGIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDNFGEDEQIDTR  122

Query  1407  KLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDMLNTI  1228
             KLQEKM+ VQ+EREEKLAEILKNRL++YVQG+KEEF   A+AEVSRL NAAYG  MLNTI
Sbjct  123   KLQEKMQAVQKEREEKLAEILKNRLHIYVQGNKEEFIQLAQAEVSRLRNAAYGTVMLNTI  182

Query  1227  GYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKRQLS  1048
             GY+Y+RQAAKELGKKAI+LGVPF+AEWFR+KGHFIKSQVTAA GA AL+QLQED+K+ LS
Sbjct  183   GYVYSRQAAKELGKKAIFLGVPFVAEWFRDKGHFIKSQVTAAAGAIALMQLQEDLKKYLS  242

Query  1047  AEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRARAK  868
             AEG+YTEEELE YMQ+HKK+M+DSLWKLNVADIE TLS VCQMVLQD +VK+EELRARAK
Sbjct  243   AEGHYTEEELEMYMQNHKKVMVDSLWKLNVADIEATLSHVCQMVLQDGSVKREELRARAK  302

Query  867   GLKTLGKVFQRVKSVNGNETETSANTP-VQKLDGSEPSYDSHSLNPSSRSQNADEAPYTA  691
             GLKTLGK+FQRV+  NG    +  N   +   DGS P  DS      S +   +  P   
Sbjct  303   GLKTLGKIFQRVELNNGEGAASQMNIDNLDDNDGSSP--DSSPRREPSYNPIPNPPP---  357

Query  690   FAVQSPYIETPQFGSGQFNSYDFPMPTAPPGAER  589
                QSPY+E PQFG G +  ++FPMPTAPPGA+R
Sbjct  358   --AQSPYVEAPQFG-GAYYPFNFPMPTAPPGAQR  388



>emb|CDY33667.1| BnaC08g19670D [Brassica napus]
Length=417

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/428 (69%), Positives = 340/428 (79%), Gaps = 41/428 (10%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQ-----------  1630
             MVKETEYYDVLGVSP ATEAQIKKAYYIKARQVHPDKNPNDP AA NFQ           
Sbjct  1     MVKETEYYDVLGVSPTATEAQIKKAYYIKARQVHPDKNPNDPQAAHNFQASLDFEYWSGD  60

Query  1629  ---------VLGEAYQVLSDPAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYI  1477
                      VLGEAYQVLSDP QRQAYD  GK+GISTE IIDPAAIFAMLFGSELFE+YI
Sbjct  61    LEDFNIEDDVLGEAYQVLSDPGQRQAYDTSGKAGISTE-IIDPAAIFAMLFGSELFEEYI  119

Query  1476  GQLAMASMASLDIFTDGEEFDAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFR  1297
             GQLAMASMASLDI ++G++ D KK+ EKMR VQ++RE+KLA+ILK+RLN+YV  +K+EF 
Sbjct  120   GQLAMASMASLDILSEGDQIDTKKIIEKMRAVQKDREDKLAQILKDRLNLYVT-NKDEFI  178

Query  1296  AHAEAEVSRLSNAAYGVDMLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKS  1117
             ++AEAEV+RLSNAAYGV+MLNTIGYIY RQAAKELGKKAIYLGVPF+AEWFR KGHFIKS
Sbjct  179   SNAEAEVTRLSNAAYGVEMLNTIGYIYVRQAAKELGKKAIYLGVPFVAEWFRTKGHFIKS  238

Query  1116  QVTAATGAFALIQLQEDMKRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTL  937
             QVTAATGA+AL QLQE+MKRQLSAEGNYTE+ELEEYMQSHKK+MIDSLWKLNVADIE TL
Sbjct  239   QVTAATGAYALFQLQEEMKRQLSAEGNYTEKELEEYMQSHKKVMIDSLWKLNVADIENTL  298

Query  936   SRVCQMVLQDNNVKKEELRARAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPS  757
             SRVC++VLQD   K+EELRARAKGLKTLGK+FQ++K    +E++      + K++G+   
Sbjct  299   SRVCELVLQDPTAKREELRARAKGLKTLGKIFQKIKLT--SESDPLVRAELHKINGNGQD  356

Query  756   YDSHSLNPSSRSQNADEAPYTAFA----------VQSPYIETPQFGSGQFNSYDFPMPTA  607
              D      +S S N+DEA ++ F            QSPY+E P+ G  QF+ Y FP P  
Sbjct  357   RD------ASTSPNSDEASHSTFGPQKQLHVCIEPQSPYVEAPRVGVEQFDHY-FPRPAP  409

Query  606   PPGAERHA  583
             PPGA+RH+
Sbjct  410   PPGAQRHS  417



>gb|EEE69016.1| hypothetical protein OsJ_27983 [Oryza sativa Japonica Group]
Length=689

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/392 (72%), Positives = 328/392 (84%), Gaps = 6/392 (2%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKET YYDVLGVSP ATE++IKKAYY+KARQVHPDKNPNDP AA+NFQ LGEAYQVLSD
Sbjct  1     MVKETGYYDVLGVSPTATESEIKKAYYMKARQVHPDKNPNDPKAAENFQALGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QRQAYDA+GKSGISTE IIDPAAIFAMLFGSELFEDYIGQLAMASMASLD F + E  
Sbjct  61    PTQRQAYDAHGKSGISTEGIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDNFGEDEHI  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D ++L E+M+ VQ+EREEKLAE LKNRL++YVQG+KEEF   A+AEV+RLSNAAYG  ML
Sbjct  121   DTRRLHERMQAVQKEREEKLAETLKNRLHIYVQGNKEEFVQLAQAEVTRLSNAAYGTVML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGY+Y+RQAAKELGKKAI+LGVPF+AEWFR+KGHFIKSQVTAA GA AL+QLQED+K+
Sbjct  181   NTIGYVYSRQAAKELGKKAIFLGVPFVAEWFRDKGHFIKSQVTAAAGAIALMQLQEDLKK  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
              LSAEG+YTEEELE +MQ+HKK+M+DSLWKLNVADIE TLSRVCQMVLQD +V++EELRA
Sbjct  241   YLSAEGHYTEEELEMFMQNHKKVMVDSLWKLNVADIEATLSRVCQMVLQDGSVRREELRA  300

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RAKGLKTLGK+FQRVK +N +E E S    +  +D +    D  S + S R +       
Sbjct  301   RAKGLKTLGKIFQRVK-LNNDEGEASDMRNIDNMDDN----DGSSPDTSPRREPPYNPIP  355

Query  696   TAFAVQSPYIETPQFGSGQFNSYDFPMPTAPP  601
                  QSPY+E PQFG G +  ++FPMPTAPP
Sbjct  356   NPPHAQSPYVEAPQFG-GTYYPFNFPMPTAPP  386



>ref|XP_010428734.1| PREDICTED: chaperone protein dnaJ 10 isoform X1 [Camelina sativa]
 ref|XP_010428735.1| PREDICTED: chaperone protein dnaJ 10 isoform X2 [Camelina sativa]
Length=398

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/383 (74%), Positives = 325/383 (85%), Gaps = 4/383 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGVSP ATEA+IKKAYYIKARQVHPDKNP+DP AAQNFQVLGEAYQVLSD
Sbjct  1     MVKETEYYDVLGVSPTATEAEIKKAYYIKARQVHPDKNPDDPQAAQNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
               QRQAYDA GKSGIST+AIIDPAAIFAMLFGSELFE YIGQLAMASMASLDIFT+G+EF
Sbjct  61    SGQRQAYDACGKSGISTDAIIDPAAIFAMLFGSELFEGYIGQLAMASMASLDIFTEGDEF  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D KK+QEKMR+VQ+ERE+KL+E+LK+RL  YV  +K+EF + AEAEV+RLSNAAYGVDML
Sbjct  121   DTKKIQEKMRIVQKEREDKLSEVLKDRLYEYVI-NKDEFVSKAEAEVARLSNAAYGVDML  179

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQAAKELGKKAIYLGVPF+AEWFRNKGHFIKSQ+TAATGA+AL QLQE+MKR
Sbjct  180   NTIGYIYVRQAAKELGKKAIYLGVPFVAEWFRNKGHFIKSQITAATGAYALFQLQEEMKR  239

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QL+ EGNYTEEELEEY+Q+HK++MIDSLWKLNVADIE TL RVCQ+VLQD   K+EELR 
Sbjct  240   QLNTEGNYTEEELEEYLQTHKRVMIDSLWKLNVADIEATLCRVCQLVLQDPEAKREELRT  299

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RA+GLKTLG++FQR K+   +E++   N   QKL+G+   +D H  + S +S  A  +  
Sbjct  300   RARGLKTLGRIFQRAKT--ASESDPLENNEPQKLNGNGRGHD-HDTSTSPKSSEASHSTS  356

Query  696   TAFAVQSPYIETPQFGSGQFNSY  628
                   SPY+E  + G  QFN Y
Sbjct  357   GPQEPHSPYVEEIKLGDEQFNYY  379



>ref|XP_002889096.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH65355.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
Length=398

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/388 (73%), Positives = 331/388 (85%), Gaps = 14/388 (4%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGVSP ATEA+IKKAYYIKARQVHPDKNPNDP AA NFQVLGEAYQVLSD
Sbjct  1     MVKETEYYDVLGVSPTATEAEIKKAYYIKARQVHPDKNPNDPQAAHNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
               QRQAYDA GKSGIST+AIIDPAAIFAMLFGSELFE+YIGQLAMASMASLDIFT+G++F
Sbjct  61    SGQRQAYDACGKSGISTDAIIDPAAIFAMLFGSELFEEYIGQLAMASMASLDIFTEGDQF  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D KK+QEKMR+VQ+ERE+KLA++LK+RLN YV  ++++F ++AEAEV+RLSNAAYGVDML
Sbjct  121   DTKKIQEKMRIVQKEREDKLAQVLKDRLNEYVI-NRDKFISNAEAEVARLSNAAYGVDML  179

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQ+TAATGA+AL QLQE+MKR
Sbjct  180   NTIGYIYVRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQLTAATGAYALFQLQEEMKR  239

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QL+ EGNYTEEELEEY+Q+HK++MIDSLWKLNVADIE TL RVCQ+VLQD   K+EELR 
Sbjct  240   QLNTEGNYTEEELEEYLQAHKRVMIDSLWKLNVADIEATLCRVCQLVLQDPEAKREELRT  299

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGS-EPSYDSHSLNPSS----RSQNA  712
             RA+GLKTLG++FQR K+   +E++  AN   QKL+G+    +D+ S +P S     S + 
Sbjct  300   RARGLKTLGRIFQRAKT--ASESDPLANNEPQKLNGNGRDDHDNTSTSPKSNEAFHSTSG  357

Query  711   DEAPYTAFAVQSPYIETPQFGSGQFNSY  628
              + P      QSPY+E  + G  QFN Y
Sbjct  358   PQEP------QSPYVEEFKIGDEQFNYY  379



>emb|CDY29479.1| BnaA06g14910D [Brassica napus]
Length=398

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/403 (71%), Positives = 336/403 (83%), Gaps = 10/403 (2%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQ---VLGEAYQV  1606
             MVKETEYYDVLGVSP ATEAQIKKAYYIKARQVHPDKNPNDP AA NFQ   VLGEAYQV
Sbjct  1     MVKETEYYDVLGVSPTATEAQIKKAYYIKARQVHPDKNPNDPQAAHNFQASSVLGEAYQV  60

Query  1605  LSDPAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDG  1426
             LSDP QRQAYD YGKSG+STE IIDPAAIFAMLFGSELFE+YIGQLAMASMASLDI ++G
Sbjct  61    LSDPGQRQAYDTYGKSGVSTE-IIDPAAIFAMLFGSELFEEYIGQLAMASMASLDILSEG  119

Query  1425  EEFDAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGV  1246
             ++ D KK+ +KMR VQ+ERE+KLA+ILK+RL +YV  +K+EF ++AEAEV+RLSNAAYGV
Sbjct  120   DQIDTKKIIDKMRAVQKEREDKLAQILKDRLYLYVT-NKDEFISNAEAEVTRLSNAAYGV  178

Query  1245  DMLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQED  1066
             +MLNTIGYIY RQAAKELGKKAIYLGVPF+AEWFR KGH IKSQVTAATGA+AL QLQE+
Sbjct  179   EMLNTIGYIYVRQAAKELGKKAIYLGVPFVAEWFRTKGHLIKSQVTAATGAYALFQLQEE  238

Query  1065  MKRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEE  886
             MKRQLSAEGNYTE+ELEEYM+SHKK+MIDSLWKLNVADIE+T+SRVC++VLQD   K+E+
Sbjct  239   MKRQLSAEGNYTEKELEEYMKSHKKVMIDSLWKLNVADIESTISRVCELVLQDPIAKRED  298

Query  885   LRARAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADE  706
             LRARAKGLKTLGK+FQ+ K    +E++      + K++G+    D+   + +S S    +
Sbjct  299   LRARAKGLKTLGKIFQKNKI--ASESDPFVRAELHKINGNGQDRDAPKSDEASHSTFRPQ  356

Query  705   APYTAFAV--QSPYIETPQFGSGQFNSYDFPMPTAPPGAERHA  583
               +T   +  QSPY+E P+ G  QFN Y FP P  PPGA+R +
Sbjct  357   TEHTVGVIEPQSPYVEAPKLGEEQFNYY-FPRPAPPPGAQRRS  398



>gb|KHG07261.1| Chaperone dnaJ 10 -like protein [Gossypium arboreum]
Length=352

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/396 (73%), Positives = 313/396 (79%), Gaps = 48/396 (12%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKE EYYDVLGVSP ATEA+IKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD
Sbjct  1     MVKEMEYYDVLGVSPSATEAEIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QRQAYDAYGKSGIS EAIIDPAAIFAMLFGSELFE+YIGQLAMASMASLDIFT+GE+ 
Sbjct  61    PTQRQAYDAYGKSGISAEAIIDPAAIFAMLFGSELFEEYIGQLAMASMASLDIFTEGEQV  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D KKLQEKM+VVQ+EREEKLA+ILK+RLN YVQGSKE+F  HAEAEVSRLSNAAYGVDML
Sbjct  121   DPKKLQEKMKVVQKEREEKLAQILKDRLNQYVQGSKEDFANHAEAEVSRLSNAAYGVDML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQAAKELGKKAIYLGVPFIAEWFR+KGH+IKSQVTA T              
Sbjct  181   NTIGYIYARQAAKELGKKAIYLGVPFIAEWFRDKGHYIKSQVTATT--------------  226

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
                                              ADIE TLSRVCQMVLQD N K+EELRA
Sbjct  227   ---------------------------------ADIEATLSRVCQMVLQDGNCKREELRA  253

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RAKGLKTLG++FQR KS NG+E+ET  ++ V  LDGSEPSYDS SLN SSRS N +E  +
Sbjct  254   RAKGLKTLGRIFQRAKSANGSESETVESSTVHTLDGSEPSYDSSSLNASSRSLNQEELSH  313

Query  696   TAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPGAER  589
             + FA QSPY+E P F   QF +Y+FP PTAPPGA+R
Sbjct  314   STFASQSPYVEAPNFVDTQF-TYNFPRPTAPPGAQR  348



>ref|XP_010416594.1| PREDICTED: chaperone protein dnaJ 10-like [Camelina sativa]
 ref|XP_010416595.1| PREDICTED: chaperone protein dnaJ 10-like [Camelina sativa]
Length=398

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/383 (73%), Positives = 325/383 (85%), Gaps = 4/383 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGVSP ATEA+IKKAYYIKARQVHPDKNP+DP AAQNFQVLGEAYQVLSD
Sbjct  1     MVKETEYYDVLGVSPTATEAEIKKAYYIKARQVHPDKNPDDPQAAQNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
               QRQAYDA GKSGIST+AIIDPAAIFAMLFGSELFE YIGQLAMA MASLDIFT+G+EF
Sbjct  61    SGQRQAYDACGKSGISTDAIIDPAAIFAMLFGSELFEGYIGQLAMALMASLDIFTEGDEF  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D KK+QEKMR+VQ+ERE+KL+E+LK+RL  YV  +K+EF   AEAEV++LSNAAYGVDML
Sbjct  121   DTKKIQEKMRIVQKEREDKLSEVLKDRLYEYVI-NKDEFVCKAEAEVAKLSNAAYGVDML  179

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQAAKELGKKAIYLGVPF+AEWFRNKGHFIKSQ+TAATGA+AL QLQE+MKR
Sbjct  180   NTIGYIYVRQAAKELGKKAIYLGVPFVAEWFRNKGHFIKSQLTAATGAYALFQLQEEMKR  239

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QL+ EGNYTEEELEEY+Q+HK++M+DSLWKLNVADIE TL RVCQ+VLQD   K+EELR 
Sbjct  240   QLNTEGNYTEEELEEYLQTHKRVMVDSLWKLNVADIEATLCRVCQLVLQDPEAKREELRT  299

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RA+GLKTLG++FQR K+   +E++   N+  QKL+G+   +D H  + S +S  A  +  
Sbjct  300   RARGLKTLGRIFQRAKT--ASESDPLENSEPQKLNGNGRGHD-HDTSTSPKSSEASHSTS  356

Query  696   TAFAVQSPYIETPQFGSGQFNSY  628
                  QSPY+E  + G  QFN Y
Sbjct  357   GPQEPQSPYVEEIKLGDEQFNYY  379



>ref|NP_177796.1| chaperone protein dnaJ 10 [Arabidopsis thaliana]
 sp|Q8GYX8.2|DNJ10_ARATH RecName: Full=Chaperone protein dnaJ 10; Short=AtDjC10; Short=AtJ10 
[Arabidopsis thaliana]
 gb|AAF04450.1|AC010718_19 putative DnaJ protein; 19794-17391 [Arabidopsis thaliana]
 gb|AEE35877.1| chaperone protein dnaJ 10 [Arabidopsis thaliana]
Length=398

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/383 (74%), Positives = 328/383 (86%), Gaps = 4/383 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGVSP ATE++IKKAYYIKARQVHPDKNPNDP AA NFQVLGEAYQVLSD
Sbjct  1     MVKETEYYDVLGVSPTATESEIKKAYYIKARQVHPDKNPNDPQAAHNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
               QRQAYDA GKSGIST+AIIDPAAIFAMLFGSELFE YIGQLAMASMASLDIFT+G++F
Sbjct  61    SGQRQAYDACGKSGISTDAIIDPAAIFAMLFGSELFEGYIGQLAMASMASLDIFTEGDQF  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D KK+QEK+R+VQ+ERE+KLA+ILK+RLN YV  +K+EF ++AEAEV+RLSNAAYGVDML
Sbjct  121   DTKKIQEKLRIVQKEREDKLAQILKDRLNEYVI-NKDEFISNAEAEVARLSNAAYGVDML  179

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQ+TAATGA+AL QLQE+MKR
Sbjct  180   NTIGYIYVRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQLTAATGAYALFQLQEEMKR  239

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QL+ EGNYTEEELEEY+Q+HK++MIDSLWKLNVADIE TL RVCQ+VLQD   K+EELR 
Sbjct  240   QLNTEGNYTEEELEEYLQAHKRVMIDSLWKLNVADIEATLCRVCQLVLQDPEAKREELRT  299

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RA+GLK LG++FQR K+   +E++   N+  QKL+G+  ++D  + + S +S  A  +  
Sbjct  300   RARGLKALGRIFQRAKT--ASESDPLENSEPQKLNGNGKNHDEDT-STSPKSSEASHSTS  356

Query  696   TAFAVQSPYIETPQFGSGQFNSY  628
                  QSPY+E  + G  QFN Y
Sbjct  357   GPQEPQSPYVEEFKLGDEQFNYY  379



>emb|CDX87572.1| BnaA07g33010D [Brassica napus]
Length=411

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/412 (70%), Positives = 336/412 (82%), Gaps = 23/412 (6%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQ----------V  1627
             MVKETEYYDVLGVSP ATE++IKKAYYIKARQVHPDKNPNDP AA NFQ          V
Sbjct  1     MVKETEYYDVLGVSPTATESEIKKAYYIKARQVHPDKNPNDPQAAHNFQASFVSLFDIKV  60

Query  1626  LGEAYQVLSDPAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMAS  1447
             LGEAYQVLSD AQRQAYDA+GKSGIST+AIIDPA IFAMLFGSELFE YIGQLAMASMAS
Sbjct  61    LGEAYQVLSDSAQRQAYDAFGKSGISTDAIIDPAEIFAMLFGSELFERYIGQLAMASMAS  120

Query  1446  LDIFTDGEE--FDAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVS  1273
             LDIFT+GE   FD KK+QEKMR VQ+ERE+KLA+ILK+RLN YV  +++EF A+AE E+ 
Sbjct  121   LDIFTEGENDMFDTKKIQEKMRTVQKEREDKLAQILKDRLNDYVV-NRDEFVANAEGEMV  179

Query  1272  RLSNAAYGVDMLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGA  1093
             RLS AAYGV+MLNTIGYIY RQA+KELGKKA+ LGVPF+AEW RNKGH+IKSQ+TAATGA
Sbjct  180   RLSKAAYGVEMLNTIGYIYVRQASKELGKKALLLGVPFVAEWVRNKGHYIKSQLTAATGA  239

Query  1092  FALIQLQEDMKRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVL  913
             FAL QLQE+MK+QL+ E NYT+EELEEY+QSHK++M+DSLWKLNVADIE TLSRVCQ+VL
Sbjct  240   FALFQLQEEMKKQLNGEVNYTDEELEEYLQSHKRVMVDSLWKLNVADIEATLSRVCQLVL  299

Query  912   QDNNVKKEELRARAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNP  733
             QD + K+EELRARA+GLKTLGK+FQR K+   +E+E  A T  +KL+  E  YD    + 
Sbjct  300   QDPDAKREELRARARGLKTLGKIFQRAKT--ASESEPIARTEPEKLNEDERDYD----DD  353

Query  732   SSRSQNADEAPYTAFAVQ---SPYIETPQFGSGQFNSYDFPMPTAPPGAERH  586
             +S S  ++EA ++ +  Q   SPY+E P+ G  QF  Y FP P  PPG E+H
Sbjct  354   ASTSPKSNEASHSTYGTQEQKSPYVEEPKLGDEQFKHY-FPRPAPPPGVEKH  404



>ref|XP_010471827.1| PREDICTED: chaperone protein dnaJ 10-like [Camelina sativa]
Length=398

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/383 (73%), Positives = 325/383 (85%), Gaps = 4/383 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGVSP ATEA+IKKAYYIKARQVHPDKNP+DP AAQNFQVLGEAYQVLSD
Sbjct  1     MVKETEYYDVLGVSPTATEAEIKKAYYIKARQVHPDKNPDDPQAAQNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
               QRQAYDA GKSGIST+AII+PAAIFAMLFGSELFE YIGQLAMASMASLDIFT+G+EF
Sbjct  61    SGQRQAYDACGKSGISTDAIINPAAIFAMLFGSELFEGYIGQLAMASMASLDIFTEGDEF  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D KK+QEKMR+VQ+ERE+KL+E+LK+RL  YV  +K+EF + AEAEV+RLSNAAYGVDML
Sbjct  121   DTKKIQEKMRIVQKEREDKLSEVLKDRLYEYVI-NKDEFVSKAEAEVARLSNAAYGVDML  179

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQAAKELGKKAIYLGVPF+AEWFRNKGHFIKSQ+TAATGA+AL QLQE+MKR
Sbjct  180   NTIGYIYVRQAAKELGKKAIYLGVPFVAEWFRNKGHFIKSQLTAATGAYALFQLQEEMKR  239

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QL+ EGNYTEEELEEY+Q+HK++M+DSLWKLNVADIE TL RVCQ+VLQD   K+EELR 
Sbjct  240   QLNTEGNYTEEELEEYLQTHKRVMVDSLWKLNVADIEATLCRVCQLVLQDPEAKREELRT  299

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RA+GLKTLG++FQR K+   +E++   N   QKL+G+    D H  + S +S  A  +  
Sbjct  300   RARGLKTLGRIFQRAKT--ASESDPLENNEPQKLNGNGRG-DDHDTSTSPKSSEASHSTS  356

Query  696   TAFAVQSPYIETPQFGSGQFNSY  628
                  QSPY+E  + G  +FN Y
Sbjct  357   GPQEPQSPYVEEIKLGDERFNYY  379



>ref|XP_006302354.1| hypothetical protein CARUB_v10020414mg [Capsella rubella]
 gb|EOA35252.1| hypothetical protein CARUB_v10020414mg [Capsella rubella]
Length=398

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/388 (73%), Positives = 328/388 (85%), Gaps = 14/388 (4%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGVSP ATE +IKKAYYIKARQVHPDKNP+DP AAQNFQVLGEAYQVLSD
Sbjct  1     MVKETEYYDVLGVSPTATETEIKKAYYIKARQVHPDKNPDDPQAAQNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
               QR AYDA GKSGIST+AIIDPAAIFAMLFGSELFE YIGQLAMASMASLDIFT+G++ 
Sbjct  61    SGQRLAYDACGKSGISTDAIIDPAAIFAMLFGSELFEGYIGQLAMASMASLDIFTEGDQL  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D KK+QEKMR+VQ+ERE+KL+E+LK+RLN YV  +K+EF + AEAEV+RLSNAAYGVDML
Sbjct  121   DTKKIQEKMRIVQKEREDKLSEVLKDRLNEYVI-NKDEFVSKAEAEVARLSNAAYGVDML  179

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQAAKELGKKAIYLGVPF+AEWFRNKGHFIKSQ+TAATGA+AL QLQE+MKR
Sbjct  180   NTIGYIYVRQAAKELGKKAIYLGVPFVAEWFRNKGHFIKSQLTAATGAYALFQLQEEMKR  239

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QL+ EGNYTEEELEEY+Q+HK++MIDSLWKLNVADIE TL RVCQ+VLQD   K+EELR 
Sbjct  240   QLNTEGNYTEEELEEYLQTHKRVMIDSLWKLNVADIEATLCRVCQLVLQDPEAKREELRT  299

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSH-SLNP----SSRSQNA  712
             RA+GLKTLG++FQR K+   NE+E  AN   QKL+G+  ++D   S +P    +S S + 
Sbjct  300   RARGLKTLGRIFQRAKT--ANESEHIANNEPQKLNGNGKNHDDDTSTSPKYSEASHSTSG  357

Query  711   DEAPYTAFAVQSPYIETPQFGSGQFNSY  628
              + P      QSPY+E  + G  ++N Y
Sbjct  358   PQEP------QSPYVEEIKVGDEKYNYY  379



>dbj|BAC41997.1| putative DnaJ protein [Arabidopsis thaliana]
 gb|AAO63414.1| At1g76700 [Arabidopsis thaliana]
Length=398

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/383 (73%), Positives = 327/383 (85%), Gaps = 4/383 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEY DVLGVSP ATE++IKKAYYIKARQVHPDKNPNDP AA NFQVLGEAYQVLSD
Sbjct  1     MVKETEYCDVLGVSPTATESEIKKAYYIKARQVHPDKNPNDPQAAHNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
               QRQAYDA GKSGIST+AIIDPAAIFAMLFGSELFE YIGQLAMASMASLDIFT+G++F
Sbjct  61    SGQRQAYDACGKSGISTDAIIDPAAIFAMLFGSELFEGYIGQLAMASMASLDIFTEGDQF  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D KK+QEK+R+VQ+ERE+KLA+ILK+RLN YV  +K+EF ++AEAEV+RLSNAAYGVDML
Sbjct  121   DTKKIQEKLRIVQKEREDKLAQILKDRLNEYVI-NKDEFISNAEAEVARLSNAAYGVDML  179

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQ+TAATGA+AL QLQE+MKR
Sbjct  180   NTIGYIYVRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQLTAATGAYALFQLQEEMKR  239

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QL+ EGNYTEEELEEY+Q+HK++MIDSLWKLNVADIE TL RVCQ+VLQD   K+EELR 
Sbjct  240   QLNTEGNYTEEELEEYLQAHKRVMIDSLWKLNVADIEATLCRVCQLVLQDPEAKREELRT  299

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RA+GLK LG++FQR K+   +E++   N+  QKL+G+  ++D  + + S +S  A  +  
Sbjct  300   RARGLKALGRIFQRAKT--ASESDPLENSEPQKLNGNGKNHDEDT-STSPKSSEASHSTS  356

Query  696   TAFAVQSPYIETPQFGSGQFNSY  628
                  QSPY+E  + G  QFN Y
Sbjct  357   GPQEPQSPYVEEFKLGDEQFNYY  379



>gb|EMT24229.1| Chaperone protein dnaJ 10 [Aegilops tauschii]
Length=445

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/401 (72%), Positives = 325/401 (81%), Gaps = 18/401 (4%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKET YYDVLGV P A+E++IKKAYYIKARQVHPDKNPNDP AA  FQ LGEAYQVLSD
Sbjct  1     MVKETGYYDVLGVIPTASESEIKKAYYIKARQVHPDKNPNDPQAAGKFQELGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QRQAYDA+GKSGIST+ IIDPAAIFAMLFGSELFEDYIGQLAMASMASLD F D E+ 
Sbjct  61    PTQRQAYDAHGKSGISTDGIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDNFDDDEQI  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D KKLQ+KM+ VQ+EREEKLAEILKNRL++YVQG+KEEF   AEAEVSRLS+AAYG+ ML
Sbjct  121   DTKKLQDKMQAVQKEREEKLAEILKNRLHLYVQGNKEEFVRLAEAEVSRLSDAAYGLVML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGY+Y+RQAAKELGKKAIYLGVPF+AEWFR+KGHFIKSQVTAA GA AL+QLQED+K+
Sbjct  181   NTIGYVYSRQAAKELGKKAIYLGVPFVAEWFRDKGHFIKSQVTAAAGAIALMQLQEDLKK  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             Q+ AEG  TEEELE YMQ+HKK+M+DSLWKLNVADIE T+S VCQMVLQD   +K++LR 
Sbjct  241   QMGAEGQTTEEELEVYMQNHKKVMVDSLWKLNVADIEATISHVCQMVLQDPLARKDDLRL  300

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLD---GSEPSYDSH---SLNPSSRSQN  715
             RAKGLKTLGK+FQ VK +N  E E S    +  +D   GS P        S NP      
Sbjct  301   RAKGLKTLGKIFQGVK-LNSGEGEGSHMKNIDNMDDNAGSSPDSSPKREPSFNPIPNP--  357

Query  714   ADEAPYTAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPGAE  592
                 P T    QSPY+E PQFG G + S++FPMPTAPPG +
Sbjct  358   ----PLT----QSPYVEAPQFG-GTYCSFNFPMPTAPPGTQ  389



>ref|XP_003574771.1| PREDICTED: chaperone protein dnaJ 10-like [Brachypodium distachyon]
Length=395

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/399 (72%), Positives = 325/399 (81%), Gaps = 11/399 (3%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MV +T YYDVLGVSP ATE++IKKAYYIKARQVHPDKNPNDP AA  FQ LGEAYQVLSD
Sbjct  1     MVVDTAYYDVLGVSPSATESEIKKAYYIKARQVHPDKNPNDPEAAGKFQELGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P+QR+ YD+ GK+GIST+ IIDPAAIFAMLFGSELFE+YIGQLAMASMASLD F + E  
Sbjct  61    PSQRKDYDSKGKAGISTDGIIDPAAIFAMLFGSELFEEYIGQLAMASMASLDNFGEDEHI  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D KKLQEKM+ VQ+EREEKLAEILKNRL++YVQG+K+EF   AEAEVS+LS+AAYG+ ML
Sbjct  121   DTKKLQEKMQAVQKEREEKLAEILKNRLHLYVQGNKQEFVRLAEAEVSKLSDAAYGLVML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGY+Y+RQAAKELGKKAIYLGVPF+AEWFR+KGHFIKSQVTAA GA AL+QLQED+K+
Sbjct  181   NTIGYVYSRQAAKELGKKAIYLGVPFVAEWFRDKGHFIKSQVTAAAGAIALMQLQEDLKK  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QL AEG  TEEELE YMQ+HKK+M+DSLWKLNVADIE T+S VCQMVLQD   KKE+LR 
Sbjct  241   QLGAEGQTTEEELEMYMQNHKKVMVDSLWKLNVADIEATISHVCQMVLQDGTAKKEDLRL  300

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKL---DGSEPSYDSHSLNPSSRSQNADE  706
             RAKGLKTLGK+FQ VK  NG E E S    +      DGS P  DS      S +     
Sbjct  301   RAKGLKTLGKIFQGVKLNNG-EGEVSQMRNIDNTDDNDGSSP--DSSPRREPSYNPAIPN  357

Query  705   APYTAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPGAER  589
              P T    QSPY+E PQFG G + S++FPMPTAPPGA+R
Sbjct  358   PPLT----QSPYVEAPQFG-GTYCSFNFPMPTAPPGAQR  391



>emb|CDX88309.1| BnaC06g37530D [Brassica napus]
Length=394

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/400 (71%), Positives = 331/400 (83%), Gaps = 16/400 (4%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGVS  ATE++IKKAYYIKARQVHPDKNPNDP AA NFQ   +AYQVLSD
Sbjct  1     MVKETEYYDVLGVSSTATESEIKKAYYIKARQVHPDKNPNDPQAAHNFQ--AKAYQVLSD  58

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
              AQRQAYDA+GKSGIST+AIIDPA IFAMLFGSELFE YIGQLAMASMASLDIFT+GE  
Sbjct  59    SAQRQAYDAFGKSGISTDAIIDPAEIFAMLFGSELFERYIGQLAMASMASLDIFTEGEN-  117

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D KK+QEKMR VQ+ERE+KLA+ILK+RLNV    +++EF  +AEAE+ RLS AAYGV+ML
Sbjct  118   DTKKIQEKMRTVQKEREDKLAQILKDRLNVV---NRDEFITNAEAEMVRLSKAAYGVEML  174

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQA+KELGKKA+ LGVPF+AEW RNKGH+IKSQ+TAATGAFAL QLQE+MK+
Sbjct  175   NTIGYIYVRQASKELGKKALLLGVPFVAEWVRNKGHYIKSQLTAATGAFALFQLQEEMKK  234

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QL+ E NYTEEELEEY+QSHK++M+DSLWKLNVADIE TL+RVCQ+VLQD+  K+EELRA
Sbjct  235   QLNGEVNYTEEELEEYLQSHKRVMVDSLWKLNVADIEATLTRVCQLVLQDSEAKREELRA  294

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RA+GLKTLGK+FQR K+   +E+E  A T  QKL+  E   D    + +S S  ++EA +
Sbjct  295   RARGLKTLGKIFQRAKT--ASESEPIARTETQKLNEDERDCD----DDASTSPKSNEASH  348

Query  696   TAFAVQ---SPYIETPQFGSGQFNSYDFPMPTAPPGAERH  586
             + +  Q   SPY+E P+ G  QFN Y FP P  PPGAE+H
Sbjct  349   STYGTQEQKSPYVEEPKLGDEQFNYY-FPRPAPPPGAEKH  387



>ref|XP_002462599.1| hypothetical protein SORBIDRAFT_02g028760 [Sorghum bicolor]
 gb|EER99120.1| hypothetical protein SORBIDRAFT_02g028760 [Sorghum bicolor]
Length=392

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/396 (70%), Positives = 323/396 (82%), Gaps = 8/396 (2%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MV++T YYDVL VSP ATEA+IKKAYY+KARQVHPDKNPNDP AA  FQ LGEAYQVLSD
Sbjct  1     MVRDTAYYDVLEVSPTATEAEIKKAYYVKARQVHPDKNPNDPFAAARFQELGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR+AYD+YG+SGIS EAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLD F   E+ 
Sbjct  61    PTQREAYDSYGRSGISREAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDDFN--EDI  118

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             DA++ QE+MRVVQ+EREEKLAE+LK+RL++Y+QG+KEEF  +AEAEV+RLSNAAYGVDML
Sbjct  119   DARRFQEQMRVVQKEREEKLAELLKDRLHLYLQGNKEEFIQYAEAEVTRLSNAAYGVDML  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             +TIGY+Y+RQAAKELGKKA YLGVPFIAEWFRNKGH IKSQ+TAAT A AL+QLQED+++
Sbjct  179   STIGYVYSRQAAKELGKKAKYLGVPFIAEWFRNKGHSIKSQLTAATCAIALMQLQEDLRK  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
              LSAE +Y+EEELE YM  H+ +M+DSLWKLNVADIE TLS VCQMVLQD+  +KEELRA
Sbjct  239   HLSAECHYSEEELEAYMLEHRSVMVDSLWKLNVADIEATLSHVCQMVLQDSTARKEELRA  298

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RAKGLKTLGK+FQ+VK         + N  +  LD ++ S    S             PY
Sbjct  299   RAKGLKTLGKIFQQVKLSTTEGDPAAMNNTINNLDENDGSSPESSPRSPRDQMFHANPPY  358

Query  696   TAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPGAER  589
             +    QSPY+E PQFG G F S+DFPMP APPGA+R
Sbjct  359   S----QSPYVEAPQFG-GYF-SFDFPMPIAPPGAQR  388



>ref|XP_010477370.1| PREDICTED: chaperone protein dnaJ 10-like isoform X3 [Camelina 
sativa]
Length=359

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/350 (77%), Positives = 309/350 (88%), Gaps = 4/350 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETE+YDVLGVSP ATEAQIKKAYYIKARQVHPDKNPNDP AA NFQVLGEAYQVLSD
Sbjct  1     MVKETEFYDVLGVSPTATEAQIKKAYYIKARQVHPDKNPNDPQAAHNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QRQAYD  GKSGISTE IIDPAAIFAMLFGSELFE+YIGQLAMASMASLDI T+G++ 
Sbjct  61    PGQRQAYDTCGKSGISTE-IIDPAAIFAMLFGSELFEEYIGQLAMASMASLDIVTEGDQI  119

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D KK+ +KMR VQ+EREEKLA+ILK+RLN+Y+  +K+EF ++AEAEV+RLSNAAYGV+ML
Sbjct  120   DTKKIIDKMRAVQKEREEKLAQILKDRLNLYMT-NKDEFVSNAEAEVTRLSNAAYGVEML  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQAAKELGKKAIYLGVPF+AEWFR KGHFIKSQVTAATGA+AL QLQE+MKR
Sbjct  179   NTIGYIYVRQAAKELGKKAIYLGVPFVAEWFRTKGHFIKSQVTAATGAYALFQLQEEMKR  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLSAEGNYTE+ELEEYM++HKK+MIDSLWKLNVADIE T+SRVC++VLQD   K+EELR 
Sbjct  239   QLSAEGNYTEKELEEYMKTHKKVMIDSLWKLNVADIENTISRVCELVLQDPIAKREELRG  298

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSS  727
             RAKGLKTLGK+FQ+ K    +E++      + KL+G+   +D+ S +P S
Sbjct  299   RAKGLKTLGKIFQKNKI--ASESDPLVRAELHKLNGNGQDHDNASTSPKS  346



>gb|EMS53118.1| Chaperone protein dnaJ 10 [Triticum urartu]
Length=572

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/418 (69%), Positives = 326/418 (78%), Gaps = 36/418 (9%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKET YYDVLGV P A+E++IKKAYYIKARQVHPDKNPNDP AA  FQ LGEAYQVLSD
Sbjct  1     MVKETGYYDVLGVIPTASESEIKKAYYIKARQVHPDKNPNDPQAAGKFQELGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             PAQRQAYDA+GKSGIST+ IIDPAAIFAMLFGSELFEDYIGQLAMASMASLD F + E+ 
Sbjct  61    PAQRQAYDAHGKSGISTDGIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDNFDEDEQI  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNA-------  1258
             D KKLQ+KM+ VQ+EREEKLAEILKNRL++YVQG+KEEF   AEAEVSRLS+A       
Sbjct  121   DTKKLQDKMQAVQKEREEKLAEILKNRLHLYVQGNKEEFVRLAEAEVSRLSDAGDDILRI  180

Query  1257  -----------AYGVDMLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQV  1111
                        AYG+ MLNTIGY+Y+RQAAKELGKKAIYLGVPF+AEWFR+KGHFIKSQV
Sbjct  181   VWKKQLLFFRRAYGLVMLNTIGYVYSRQAAKELGKKAIYLGVPFVAEWFRDKGHFIKSQV  240

Query  1110  TAATGAFALIQLQEDMKRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSR  931
             TAA GA AL+QLQED+K+Q+ AEG  TEEELE YMQ+HKK+M+DSLWKLNVADIE T+S 
Sbjct  241   TAAAGAIALMQLQEDLKKQMGAEGQTTEEELEVYMQNHKKVMVDSLWKLNVADIEATISH  300

Query  930   VCQMVLQDNNVKKEELRARAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLD---GSEP  760
             VCQMVLQD   +K++LR RAKGLKTLGK+FQ VK +N  E E S    +  +D   GS P
Sbjct  301   VCQMVLQDPLARKDDLRLRAKGLKTLGKIFQGVK-LNSGEGEGSHMKNIDNMDDNTGSSP  359

Query  759   SYDSH---SLNPSSRSQNADEAPYTAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPGA  595
                     S NP          P T    QSPY+E PQFG G + S++FPMPTAPPG+
Sbjct  360   DSSPKREPSFNP------IPNPPLT----QSPYVEAPQFG-GTYCSFNFPMPTAPPGS  406



>ref|NP_001149115.1| chaperone protein dnaJ 10 [Zea mays]
 gb|ACG34245.1| chaperone protein dnaJ 10 [Zea mays]
Length=390

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/396 (69%), Positives = 323/396 (82%), Gaps = 10/396 (3%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVK+T YYDVLGV P ATE++IKKAYY+KAR VHPDKNPNDP AA+ FQ LGEAYQVLSD
Sbjct  1     MVKDTRYYDVLGVDPSATESEIKKAYYVKARLVHPDKNPNDPQAAEKFQELGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QRQAYD++GK GISTE IIDPA IFA+LFGSELFE+YIGQLAMASMASLD F + E+ 
Sbjct  61    PTQRQAYDSHGKDGISTEGIIDPATIFAILFGSELFEEYIGQLAMASMASLDNFGEDEQI  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             DA+KLQE+M+ VQ++REEKLAE LKNRL++YVQG+K EF  HAEAEVS+L NAAYGV ML
Sbjct  121   DARKLQERMQAVQKDREEKLAETLKNRLHIYVQGNKAEFIQHAEAEVSKLRNAAYGVVML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGY+Y+RQAAKELGKK ++LGVPFIAEWFR+KGHFIKSQVTAATGA AL+QLQ+++ +
Sbjct  181   NTIGYVYSRQAAKELGKKVMFLGVPFIAEWFRDKGHFIKSQVTAATGAIALMQLQDNLTK  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
              +SAEG YTEEELE YM++HKK+M+DSLWKLNVADIE TLS VCQMVLQD++ +KEELR 
Sbjct  241   YMSAEGQYTEEELEMYMENHKKVMVDSLWKLNVADIEATLSHVCQMVLQDSSARKEELRL  300

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RAKGLKTLG++FQ  K VN +E ETS    +  +DG++ S  S   +P+  +Q     P 
Sbjct  301   RAKGLKTLGRIFQGAK-VNPSEGETSQTKNIDNMDGNDGS--SPDSSPNREAQFTPNQP-  356

Query  696   TAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPGAER  589
                 V SPY+E P   +G +    FPMP APPGA R
Sbjct  357   ---PVPSPYVEAPHV-NGVYCP--FPMPAAPPGARR  386



>tpg|DAA48044.1| TPA: chaperone protein dnaJ 10 [Zea mays]
Length=390

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/396 (68%), Positives = 322/396 (81%), Gaps = 10/396 (3%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVK+T YYDVLGV P ATE++IKKAYY+KAR VHPDKNPNDP AA+ FQ LGEAYQVLSD
Sbjct  1     MVKDTRYYDVLGVDPSATESEIKKAYYVKARLVHPDKNPNDPQAAEKFQELGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QRQAYD++GK GISTE IIDPA IFA+LFGSELFE+YIGQLAMASMASLD F + E+ 
Sbjct  61    PTQRQAYDSHGKDGISTEGIIDPATIFAILFGSELFEEYIGQLAMASMASLDNFGEDEQI  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             DA+KLQE+M+ VQ++REEKLAE LKNRL++YVQG+K EF  HAEAEVS+L NAAYGV ML
Sbjct  121   DARKLQERMQAVQKDREEKLAETLKNRLHIYVQGNKAEFIQHAEAEVSKLRNAAYGVVML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGY+Y+RQAAKEL KK ++LGVPFIAEWFR+KGHFIKSQVTAATGA AL+QLQ+++ +
Sbjct  181   NTIGYVYSRQAAKELAKKVMFLGVPFIAEWFRDKGHFIKSQVTAATGAIALMQLQDNLTK  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
              +SAEG YTEEELE YM++HKK+M+DSLWKLNVADIE TLS VCQMVLQD++ +KEELR 
Sbjct  241   YMSAEGQYTEEELEMYMENHKKVMVDSLWKLNVADIEATLSHVCQMVLQDSSARKEELRL  300

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RAKGLKTLG++FQ  K VN +E ETS    +  +DG++ S  S   +P+  +Q     P 
Sbjct  301   RAKGLKTLGRIFQGAK-VNPSEGETSQTKNIDNMDGNDGS--SPDSSPNREAQFTPNQP-  356

Query  696   TAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPGAER  589
                 V SPY+E P   +G +    FPMP APPGA R
Sbjct  357   ---PVPSPYVEAPHV-NGVYCP--FPMPAAPPGARR  386



>ref|NP_001150421.1| LOC100284051 [Zea mays]
 gb|ACF88054.1| unknown [Zea mays]
 gb|ACG39034.1| chaperone protein dnaJ 10 [Zea mays]
 tpg|DAA62093.1| TPA: chaperone protein dnaJ 10 [Zea mays]
Length=394

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/396 (68%), Positives = 318/396 (80%), Gaps = 6/396 (2%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MV+ET YYDVL VSP A+EA+IKKAYY+KARQVHPDKNP+DPLAA  FQ LGEAYQVLS+
Sbjct  1     MVRETGYYDVLEVSPTASEAEIKKAYYVKARQVHPDKNPDDPLAAARFQELGEAYQVLSN  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR+ YD +GK GISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLD FT+ E+ 
Sbjct  61    PKQREDYDLHGKPGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDGFTENEQI  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D ++LQE+MRVVQ+EREEKLAE LK+RL++YVQG+KEEF  +A+AEV+RLSNAAYGVDML
Sbjct  121   DPRRLQEQMRVVQKEREEKLAEALKDRLHLYVQGNKEEFIQYADAEVTRLSNAAYGVDML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             +TIGY+Y+RQA+KELGK+A YLGVPFIAEWFRNKGH IKSQ+TAATGA AL+QLQED ++
Sbjct  181   STIGYVYSRQASKELGKQAKYLGVPFIAEWFRNKGHSIKSQITAATGALALMQLQEDWRK  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
              LS E +Y EEELE YM +HK +M+DSLWKLNVADIE TLS VCQMVL D++ +KEELR 
Sbjct  241   HLSDECHYNEEELEAYMLTHKSVMVDSLWKLNVADIEETLSHVCQMVLHDSSARKEELRV  300

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPY  697
             RAKGLKTLGK+F + K         + N  +  LD ++ S    S             PY
Sbjct  301   RAKGLKTLGKIFHQAKLSTAEGDPAAMNNTINNLDENDDSSPESSPRSPRDQMFDTNPPY  360

Query  696   TAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPGAER  589
             +    QSPY+E P+ G G F S+DFPMP APPGA+R
Sbjct  361   S----QSPYVEAPELG-GYF-SFDFPMPIAPPGAQR  390



>emb|CDY04595.1| BnaC05g16330D [Brassica napus]
Length=426

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/416 (67%), Positives = 326/416 (78%), Gaps = 37/416 (9%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQ-----------  1630
             MVKETEYYDVLGVSP ATE QIKKAYYIKARQVHPDKNPNDP +A NFQ           
Sbjct  1     MVKETEYYDVLGVSPTATETQIKKAYYIKARQVHPDKNPNDPQSAHNFQAIVHQHQGCSF  60

Query  1629  --------------------VLGEAYQVLSDPAQRQAYDAYGKSGISTEAIIDPAAIFAM  1510
                                 VLGEAYQVLSDP QRQAYD YGKSG+STE IIDPAAIFAM
Sbjct  61    ISLFVERIGELKSGGGIFFAVLGEAYQVLSDPGQRQAYDTYGKSGVSTE-IIDPAAIFAM  119

Query  1509  LFGSELFEDYIGQLAMASMASLDIFTDGEEFDAKKLQEKMRVVQREREEKLAEILKNRLN  1330
             LFGSELFE+YIGQLAMASMASLDI ++G++ D KK+ +KMR VQ+ERE+KLA+ILK+RL 
Sbjct  120   LFGSELFEEYIGQLAMASMASLDILSEGDQIDTKKIIDKMRAVQKEREDKLAQILKDRLY  179

Query  1329  VYVQGSKEEFRAHAEAEVSRLSNAAYGVDMLNTIGYIYTRQAAKELGKKAIYLGVPFIAE  1150
             +YV  +K+EF ++AEAEV+RLSNAAYGV+MLNTIGYIY RQAAKELGKKAIYLGVPF+AE
Sbjct  180   LYVT-NKDEFISNAEAEVTRLSNAAYGVEMLNTIGYIYVRQAAKELGKKAIYLGVPFVAE  238

Query  1149  WFRNKGHFIKSQVTAATGAFALIQLQEDMKRQLSAEGNYTeeeleEYMQSHKKIMIDSLW  970
             WFR KGH IKSQVTAATGA+AL QLQE+MKRQLSAEGNYTE+ELEEYM+SHKK+MIDSLW
Sbjct  239   WFRTKGHLIKSQVTAATGAYALFQLQEEMKRQLSAEGNYTEKELEEYMKSHKKVMIDSLW  298

Query  969   KLNVADIETTLSRVCQMVLQDNNVKKEELRARAKGLKTLGKVFQRVKSVNGNETETSANT  790
             KLNVADIE+T+SRVC++VLQD   K+EELRARAKGLKTLGK+FQ+ K    +E++     
Sbjct  299   KLNVADIESTISRVCELVLQDPTAKREELRARAKGLKTLGKIFQKNKI--ASESDPLVRA  356

Query  789   PVQKLDGSEPSYDSHSLNPSSRSQNADEAPYTAFAV--QSPYIETPQFGSGQFNSY  628
              + K++G+    D+ + + +S S    +  +T   +  QSPY+E P+ G  QFN Y
Sbjct  357   ELHKINGNGQDRDAPNSDEASHSSFGPQTEHTVRLIEPQSPYVEAPKLGEEQFNYY  412



>emb|CAA72705.1| dnaJ-like protein [Arabidopsis thaliana]
Length=426

 Score =   531 bits (1367),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 272/395 (69%), Positives = 322/395 (82%), Gaps = 9/395 (2%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGVSP ATE++IKKAYYIKARQVHPDKNPNDP AA NFQVLGEAYQVLSD
Sbjct  1     MVKETEYYDVLGVSPTATESEIKKAYYIKARQVHPDKNPNDPQAAHNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
               QRQA+DA GKSGIST+AIIDPA IF MLFGSELF  YIGQLAMASMASLDIFT+G++F
Sbjct  61    SGQRQAFDACGKSGISTDAIIDPATIFTMLFGSELFVGYIGQLAMASMASLDIFTEGDQF  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D KK+QEK+ +VQ+ERE+KL +ILK+RLN YV  +K+EF ++AEAEV+RLSN +     +
Sbjct  121   DTKKIQEKLGIVQKEREDKLTQILKDRLNEYVI-NKDEFISNAEAEVARLSNGSLWCGYV  179

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
               IGYIY RQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQ+TAATGA+AL QLQE+MKR
Sbjct  180   EYIGYIYVRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQLTAATGAYALFQLQEEMKR  239

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QL+ EGNYTEEELEEY+Q+HK++MIDSLWKLNVADIE TL RVCQ+VLQD   K+EELR 
Sbjct  240   QLNTEGNYTEEELEEYLQAHKRVMIDSLWKLNVADIEATLCRVCQLVLQDPEAKREELRT  299

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSH-SLNP-SSRSQNADEA  703
             RA+GLK LG++FQR K+   +E++   N+  QKL+G+  ++D   S +P SS   ++   
Sbjct  300   RARGLKALGRIFQRAKTA--SESDPLENSEPQKLNGNGKNHDEDTSTSPKSSEGSHSTSG  357

Query  702   PYTAFAVQSPYIETPQFGSGQFNSYDFPMPTAPPG  598
             P      Q+PY++  + G  QFN Y FP P  PPG
Sbjct  358   PQEP---QNPYVKEFKLGDEQFNYY-FPRPAPPPG  388



>emb|CAN67266.1| hypothetical protein VITISV_028729 [Vitis vinifera]
Length=996

 Score =   546 bits (1407),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 271/318 (85%), Positives = 295/318 (93%), Gaps = 0/318 (0%)
 Frame = -2

Query  1632  QVLGEAYQVLSDPAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASM  1453
             +VLGEAYQVLSDP+QRQAYDA+GKSGIST+AII+PAAIFAMLFGSELFE+YIGQLAMASM
Sbjct  9     KVLGEAYQVLSDPSQRQAYDAHGKSGISTDAIIEPAAIFAMLFGSELFEEYIGQLAMASM  68

Query  1452  ASLDIFTDGEEFDAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVS  1273
             ASLDIFT+GE+FDAKKLQEKMRVVQ+EREEKLA+ILK+RLN YVQG+KE+F  HAEAE+S
Sbjct  69    ASLDIFTEGEQFDAKKLQEKMRVVQKEREEKLADILKDRLNQYVQGNKEDFVNHAEAELS  128

Query  1272  RLSNAAYGVDMLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGA  1093
             RLSNAAYGVDMLNTIGYIY RQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGA
Sbjct  129   RLSNAAYGVDMLNTIGYIYARQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGA  188

Query  1092  FALIQLQEDMKRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVL  913
              ALIQLQEDMK+QLSAEGNYTEEELEEYMQSHKK+MIDSLWKLNVADIE TLSRVCQMVL
Sbjct  189   IALIQLQEDMKKQLSAEGNYTEEELEEYMQSHKKLMIDSLWKLNVADIEATLSRVCQMVL  248

Query  912   QDNNVKKEELRARAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNP  733
             QDNN KKEELRARAKGLKTLGK+FQRVKS NGNE E   N+ V KL+GSEPS+D+ S + 
Sbjct  249   QDNNCKKEELRARAKGLKTLGKIFQRVKSSNGNEDEAMLNSAVHKLNGSEPSHDACSPST  308

Query  732   SSRSQNADEAPYTAFAVQ  679
             S +S N +E  YTAFA Q
Sbjct  309   SPKSSNLEEQSYTAFASQ  326



>gb|EMT21103.1| Chaperone protein dnaJ 10 [Aegilops tauschii]
Length=426

 Score =   524 bits (1350),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 281/436 (64%), Positives = 318/436 (73%), Gaps = 76/436 (17%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQV----------  1627
             M +ET YYDVLGVSP ATEA IKKAYY+KARQVHPDKN NDPLAA+ FQ           
Sbjct  1     MARETGYYDVLGVSPAATEADIKKAYYVKARQVHPDKNRNDPLAAEKFQASAPSAMLLFA  60

Query  1626  --------------------------------LGEAYQVLSDPAQRQAYDAYGKSGISTE  1543
                                             LGEAYQVLSDPAQRQAYD+YGKSGISTE
Sbjct  61    SPLPQPLFVLAIAAEVLLCSASCHFKILSGFELGEAYQVLSDPAQRQAYDSYGKSGISTE  120

Query  1542  AIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEFDAKKLQEKMR--------  1387
             A+IDPAAIFAMLFGSE+FEDYIGQLAMASMASLDIF + E+ DA+KLQEKMR        
Sbjct  121   AMIDPAAIFAMLFGSEIFEDYIGQLAMASMASLDIFGEDEKIDARKLQEKMRHDTSHAEY  180

Query  1386  ----------VVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
                        VQ+EREEKLAE LKNRL++YVQG+K+EF   AEAEV+RLS+AAYG+DML
Sbjct  181   QSLHFSVSTQAVQKEREEKLAEKLKNRLHIYVQGNKKEFIQVAEAEVARLSDAAYGIDML  240

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             +TIGY+Y+RQAAKELGKKAI LGVPFIAEWFRNKGHFIKSQVTAATGA AL+QLQED+K+
Sbjct  241   STIGYMYSRQAAKELGKKAILLGVPFIAEWFRNKGHFIKSQVTAATGAIALMQLQEDLKK  300

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
              LS+E NYT+E+LE YMQSHKK+M+DSLWKLNVADIE TLSRVCQMVLQ++NVK+EELRA
Sbjct  301   HLSSECNYTDEQLEAYMQSHKKVMVDSLWKLNVADIEATLSRVCQMVLQESNVKREELRA  360

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLD---GSEPSYDSHSLNPSSRSQNADE  706
             RAKGLKTLGK+FQRVK  N  E  T  +T +  LD   G+ P  DS   +P  R Q  D 
Sbjct  361   RAKGLKTLGKIFQRVKLNNEGEAATMKHT-INNLDDNVGTSP--DSSPTSP--RVQPFDA  415

Query  705   APYTAFAVQSPYIETP  658
              P        PY + P
Sbjct  416   NP--------PYSQVP  423



>ref|XP_006390163.1| hypothetical protein EUTSA_v10019530mg, partial [Eutrema salsugineum]
 gb|ESQ27449.1| hypothetical protein EUTSA_v10019530mg, partial [Eutrema salsugineum]
Length=350

 Score =   490 bits (1261),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 252/351 (72%), Positives = 289/351 (82%), Gaps = 5/351 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGVSP ATEA+IKKAYYIKARQVHPDKNPNDP AA NFQVLGEAYQVLSD
Sbjct  1     MVKETEYYDVLGVSPAATEAEIKKAYYIKARQVHPDKNPNDPQAAHNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
              AQRQAYDA GK+GIS   II+PAAIFAMLFGSELFE YIG LAMASM   D+F + + F
Sbjct  61    SAQRQAYDACGKAGISLVTIINPAAIFAMLFGSELFEGYIGHLAMASMTKFDLFGERDRF  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D KK  EKMR VQ+ER +KLA+ILK+RLN YV  +K+EF  +AEAE+ RLSNAAYGV++L
Sbjct  121   DTKKYLEKMRTVQKERVDKLAQILKDRLNEYVV-NKDEFVCNAEAEMVRLSNAAYGVELL  179

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGYIY RQAAKELGK+AIYLGVPFIAEW RN+GH IKSQ++AATGAFA +QLQ +M R
Sbjct  180   NTIGYIYERQAAKELGKEAIYLGVPFIAEWCRNRGHLIKSQLSAATGAFAFLQLQREMIR  239

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QLSA  N+T+ ELEEY+QSHK I IDSLWKLNVADIE  LSRVCQ+VLQD   K+EELRA
Sbjct  240   QLSAGVNFTQGELEEYLQSHKGI-IDSLWKLNVADIEAILSRVCQLVLQDPEAKREELRA  298

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDS-HSLNPSS  727
             RA+GL+TLG++FQR K+   +E++    T  QKL+  E  YD   S +P S
Sbjct  299   RARGLQTLGRIFQRAKT--ASESDPLTRTEPQKLNEIEKEYDDVASTSPKS  347



>gb|EYU36612.1| hypothetical protein MIMGU_mgv1a007809mg [Erythranthe guttata]
Length=306

 Score =   469 bits (1207),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 237/308 (77%), Positives = 265/308 (86%), Gaps = 4/308 (1%)
 Frame = -2

Query  1512  MLFGSELFEDYIGQLAMASMASLDIFTDGEEFDAKKLQEKMRVVQREREEKLAEILKNRL  1333
             MLFGSELFE+YIGQLAMASMASLD+ T+ E+FDAKKLQEKMR VQ+EREEKLA  LK+RL
Sbjct  1     MLFGSELFEEYIGQLAMASMASLDVSTE-EDFDAKKLQEKMRTVQKEREEKLALSLKDRL  59

Query  1332  NVYVQGSKEEFRAHAEAEVSRLSNAAYGVDMLNTIGYIYTRQAAKELGKKAIYLGVPFIA  1153
             N+YVQG+KEEF   AEAEVSRLSNAAYGVDML+TIGYIY RQ+AKELGKK I+LGVPF+A
Sbjct  60    NLYVQGNKEEFIRQAEAEVSRLSNAAYGVDMLSTIGYIYARQSAKELGKKVIFLGVPFVA  119

Query  1152  EWFRNKGHFIKSQVTAATGAFALIQLQEDMKRQLSAEGNYTeeeleEYMQSHKKIMIDSL  973
             EWFRNKGHFIKSQVTAATGA ALIQLQEDMKRQL+AEGNYTEEELE YMQSHKKIM DSL
Sbjct  120   EWFRNKGHFIKSQVTAATGAIALIQLQEDMKRQLNAEGNYTEEELEAYMQSHKKIMTDSL  179

Query  972   WKLNVADIETTLSRVCQMVLQDNNVKKEELRARAKGLKTLGKVFQRVKSVNGNETETSAN  793
             WKLNVADIE TLSRVCQMVLQDN+ KKEELR RAKGLKTLGK+FQRVKS N N +E ++ 
Sbjct  180   WKLNVADIEATLSRVCQMVLQDNSSKKEELRLRAKGLKTLGKIFQRVKSANENNSENTSK  239

Query  792   TPVQKLDGSEPSYDSHSLNPSSRSQNADEAPYTAFAVQSPYIETPQFGSGQFNSYDFPMP  613
              P  KLDGS+ S ++   + +SRS N D+   T FA QSPY+ETPQF   +FN+Y  PMP
Sbjct  240   DPTHKLDGSQSSSNTAPSSTTSRSFNNDQLSNT-FAPQSPYVETPQFPGAEFNNY--PMP  296

Query  612   TAPPGAER  589
             TAPPGA +
Sbjct  297   TAPPGAHK  304



>ref|XP_010537262.1| PREDICTED: chaperone protein dnaJ 10 isoform X3 [Tarenaya hassleriana]
Length=355

 Score =   460 bits (1184),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 235/327 (72%), Positives = 273/327 (83%), Gaps = 6/327 (2%)
 Frame = -2

Query  1554  ISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEFDAKKLQEKMRVVQR  1375
             IS++AIIDPAAIFAMLFGSELFE+YIGQLAMASMASLDIFT+GE+ D +KLQEKMR VQ+
Sbjct  32    ISSDAIIDPAAIFAMLFGSELFEEYIGQLAMASMASLDIFTEGEQLDTRKLQEKMRAVQK  91

Query  1374  EREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDMLNTIGYIYTRQAAKE  1195
             EREEKLA+ILK+RLN YVQG+K+EF +HAEAEVSRLSNAAYGVDMLNTIGYIY R AA E
Sbjct  92    EREEKLAQILKDRLNQYVQGNKDEFVSHAEAEVSRLSNAAYGVDMLNTIGYIYVRTAAIE  151

Query  1194  LGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKRQLSAEGNYTeeele  1015
             LGKKA  L VPF+AEWFR KGHFIKSQVTAATGA+AL QLQE+MKRQLSA+GNYTEEELE
Sbjct  152   LGKKAYLLMVPFLAEWFRKKGHFIKSQVTAATGAYALFQLQEEMKRQLSAQGNYTEEELE  211

Query  1014  EYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRARAKGLKTLGKVFQR  835
             EY+QSHKK+MIDSLWKLNVADIE TLSRVCQ+VLQD NVKKEELR RAKGLK+LGK+FQR
Sbjct  212   EYLQSHKKVMIDSLWKLNVADIEATLSRVCQLVLQDPNVKKEELRTRAKGLKSLGKIFQR  271

Query  834   VKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPYTAFA---VQSPYIE  664
              K  +G E +    T   K++G++  +D  S   S +S  +DEA ++ F     QSPY+E
Sbjct  272   AKLASGAENDPLLRTETHKINGNDGDHDDASS--SPKSSKSDEASHSTFGPQEPQSPYVE  329

Query  663   TPQFGSGQFNSYDFPMPTAPPGAERHA  583
              P+FG  +FN + FP P  PPGA+R +
Sbjct  330   APRFGDQEFN-FQFPRPAPPPGAQRRS  355



>ref|XP_007018602.1| DNAJ heat shock N-terminal domain-containing protein isoform 
2 [Theobroma cacao]
 gb|EOY15827.1| DNAJ heat shock N-terminal domain-containing protein isoform 
2 [Theobroma cacao]
Length=302

 Score =   457 bits (1177),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 228/282 (81%), Positives = 252/282 (89%), Gaps = 4/282 (1%)
 Frame = -2

Query  1512  MLFGSELFEDYIGQLAMASMASLDIFTDGEEFDAKKLQEKMRVVQREREEKLAEILKNRL  1333
             MLFGSELFE+YIGQLAMASMASLDIFT+GE+FDAKKLQEKMR+VQ+EREEKLAEIL +RL
Sbjct  1     MLFGSELFEEYIGQLAMASMASLDIFTEGEQFDAKKLQEKMRIVQKEREEKLAEILIDRL  60

Query  1332  NVYVQGSKEEFRAHAEAEVSRLSNAAYGVDMLNTIGYIYTRQAAKELGKKAIYLGVPFIA  1153
             N YVQG+KEEF  HA+AEVSRLSNAAYGVDMLNTIGYIY RQAAKELGKKAIYLGVPFIA
Sbjct  61    NQYVQGNKEEFVNHAKAEVSRLSNAAYGVDMLNTIGYIYVRQAAKELGKKAIYLGVPFIA  120

Query  1152  EWFRNKGHFIKSQVTAATGAFALIQLQEDMKRQLSAEGNYTeeeleEYMQSHKKIMIDSL  973
             EWFRNKGHFIKSQVTA TGA AL+QLQEDMK+QLSAEGNYTEEELEEYMQSHKK+MIDSL
Sbjct  121   EWFRNKGHFIKSQVTAVTGALALLQLQEDMKKQLSAEGNYTEEELEEYMQSHKKLMIDSL  180

Query  972   WKLNVADIETTLSRVCQMVLQDNNVKKEELRARAKGLKTLGKVFQRVKSVNGNETET---  802
             WKLNVADIE TLSRVCQMVLQDNN KKEELRARAKGLKTLGK+FQR KS NG+E+E+   
Sbjct  181   WKLNVADIEATLSRVCQMVLQDNNSKKEELRARAKGLKTLGKIFQRAKSANGSESESVLT  240

Query  801   -SANTPVQKLDGSEPSYDSHSLNPSSRSQNADEAPYTAFAVQ  679
              + ++ V  L+GSEPSYD  S N S +S N +++  + FA Q
Sbjct  241   DTVHSTVYTLNGSEPSYDGSSPNASPKSLNQEDSSCSTFAAQ  282



>ref|XP_006851416.1| hypothetical protein AMTR_s00040p00080520 [Amborella trichopoda]
 gb|ERN12997.1| hypothetical protein AMTR_s00040p00080520 [Amborella trichopoda]
Length=446

 Score =   454 bits (1168),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 247/440 (56%), Positives = 301/440 (68%), Gaps = 34/440 (8%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MV+E +YY+VL VSP ATEA+IKKAYY+KARQVHPDKNPNDP AA  FQ LGEAYQ+LSD
Sbjct  1     MVRELDYYNVLEVSPSATEAEIKKAYYLKARQVHPDKNPNDPQAATKFQELGEAYQILSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             PA+R AYD  GK+ IS E ++DPA IF MLFG+ELFEDYIGQ AMASMAS DI  + E  
Sbjct  61    PAKRDAYDTLGKASISKEGMLDPATIFTMLFGNELFEDYIGQFAMASMASCDISNEEEGL  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             + KKLQE+M+V+Q EREEKLA ILK+ L+ YV+G  E F  HAE+EV RL NAA+G++ML
Sbjct  121   NFKKLQEQMKVIQSEREEKLARILKDILSQYVRGDSEAFIIHAESEVKRLINAAFGLEML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             +TIGYIY RQAAKELGKKAIYLG+PF+AEWFRNKGH +KSQVTAA+GAFAL +LQED+KR
Sbjct  181   HTIGYIYVRQAAKELGKKAIYLGLPFLAEWFRNKGHSLKSQVTAASGAFALFKLQEDIKR  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
              L AE  Y+E+++E ++ S K +MI SLWKLN+ DIE TL+ VC+MVLQDN++ KEE RA
Sbjct  241   HLGAEKEYSEDDIETFLLSKKGVMISSLWKLNIIDIEATLTHVCEMVLQDNSIPKEESRA  300

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSE------PSYDSHSLNPSSRSQN  715
             RAK LK  GK+FQ     N N    S +    K DG +      PS     +  SS  QN
Sbjct  301   RAKALKIWGKIFQSASLSNRN--IVSNDEGRIKYDGQDFTTDQTPSRTPPRMGTSSSGQN  358

Query  714   ADEAPYTAF-------AVQSPYIETPQFGS---GQFNSYDFPMPTAPPGAERHA*TCS*I  565
                +PY  F          SPY +   F S   G+F     P  +  P +          
Sbjct  359   ---SPYFEFDNTSKSPGYASPYQDGLDFFSRSPGEFQGKQTPEASPKPSS----------  405

Query  564   LPTV*IPGIIKWG-IVGAVC  508
              P++  P I K G  +G  C
Sbjct  406   -PSI-FPPIQKLGKTLGCFC  423



>ref|XP_010270365.1| PREDICTED: chaperone protein dnaJ 10 [Nelumbo nucifera]
Length=384

 Score =   441 bits (1133),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 220/352 (63%), Positives = 271/352 (77%), Gaps = 4/352 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVK+TEYYDVLGVSP A+E +I+KAYY+KARQVHPDKNPNDP AA+ FQVLGEAYQVLSD
Sbjct  1     MVKDTEYYDVLGVSPSASEEEIRKAYYLKARQVHPDKNPNDPQAAERFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR+AYD  GK  IS E ++DP A+FA+LFGSELFEDY+G LA+ASMAS ++ T+ +  
Sbjct  61    PVQREAYDQNGKYCISRETMLDPTAVFALLFGSELFEDYVGHLAVASMASSELATECD--  118

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             + +KL ++++ VQ+EREEKLA ILK+ LN YV G KE F  HA +E  RLS+AA+G D+L
Sbjct  119   NPEKLHDRLKAVQKEREEKLARILKDFLNRYVHGDKEGFIHHAASEAKRLSDAAFGADIL  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             +TIGYIY RQAA++LGKKAIYLGVPF+AEW RNKGHF KSQ+TAA GAF L+QLQED++R
Sbjct  179   HTIGYIYERQAAQQLGKKAIYLGVPFLAEWVRNKGHFWKSQITAAKGAFQLLQLQEDVRR  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             Q   +G+  E  LE +MQ +K  +++SLWKLNV DIE TL  VCQMVLQ+ N+KKEEL+A
Sbjct  239   QFKMDGSGPENNLESHMQLNKDTLMNSLWKLNVVDIEVTLLHVCQMVLQETNIKKEELKA  298

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRS  721
             RA  LK LGK+FQR K+          N      DGS  S DS S+  S R+
Sbjct  299   RALALKILGKIFQREKNSQNGGVSKKKNVSDAYEDGS--SSDSTSVEDSPRT  348



>ref|XP_008808481.1| PREDICTED: chaperone protein dnaJ 10 [Phoenix dactylifera]
Length=382

 Score =   434 bits (1117),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 214/351 (61%), Positives = 272/351 (77%), Gaps = 6/351 (2%)
 Frame = -2

Query  1773  VKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSDP  1594
              KETEYYDVLGVSP ATE +I+KAYY+KARQVHPDKNPNDP AA+ FQ LGEAYQVLSDP
Sbjct  3     TKETEYYDVLGVSPYATEEEIRKAYYLKARQVHPDKNPNDPQAAERFQELGEAYQVLSDP  62

Query  1593  AQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEFD  1414
              QR+AYD +GK+ IS E ++D  A+F +LFGSELFEDYIG LA+ASMAS ++ ++ +  +
Sbjct  63    VQRRAYDGFGKNSISRENMLDATAVFTLLFGSELFEDYIGHLAVASMASTELTSEND--N  120

Query  1413  AKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDMLN  1234
               KLQ++++ +QREREEKLA+ L++ LN+YV G+KE F  HAEAE  RLSN A+GVD+L+
Sbjct  121   PLKLQDRLKAIQREREEKLAKFLRDFLNLYVHGNKEGFFHHAEAEAKRLSNTAFGVDILH  180

Query  1233  TIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKRQ  1054
             TIGY+Y RQAAKELGKK +YLGVPF+ EW RNKGHF KSQ+TAA GA  L+QLQED+ RQ
Sbjct  181   TIGYVYARQAAKELGKKVMYLGVPFLTEWVRNKGHFWKSQITAAKGALQLLQLQEDICRQ  240

Query  1053  LSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRAR  874
             ++ +G+  E+++E +++ +K +M++SLWKLNV DIE TL  VCQMVLQ++NVKKEELRAR
Sbjct  241   INKDGSGAEKDIELHIRMNKDLMMNSLWKLNVVDIEVTLLHVCQMVLQESNVKKEELRAR  300

Query  873   AKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRS  721
             A  LK LGKVFQ  +    + T    N P    D  E S D+ S+    R+
Sbjct  301   ALALKILGKVFQGERHALPSGTSKQKNIP----DDGESSSDASSVEDLPRT  347



>gb|KEH27297.1| DnaJ heat shock amino-terminal domain protein [Medicago truncatula]
Length=247

 Score =   427 bits (1098),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 202/228 (89%), Positives = 219/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKE+EYYDVLGVSP A+EA+IKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD
Sbjct  1     MVKESEYYDVLGVSPTASEAEIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QRQAYDA+GKSGIST+AIIDPAAIFAMLFGSELFE+YIGQLAMASMAS+DIFT+GE+F
Sbjct  61    PTQRQAYDAHGKSGISTDAIIDPAAIFAMLFGSELFEEYIGQLAMASMASMDIFTEGEQF  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D KKLQ+KMR+VQ+EREE+L EILK RLN YVQG+KE+F  HAEAEV+RLSNAAYGVDML
Sbjct  121   DTKKLQDKMRIVQKEREERLVEILKGRLNQYVQGNKEDFVNHAEAEVARLSNAAYGVDML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGA  1093
             NTIGYIY RQAAKELGKKAI+LGVPFIAEWFRNKGHFIKSQVTAATGA
Sbjct  181   NTIGYIYARQAAKELGKKAIFLGVPFIAEWFRNKGHFIKSQVTAATGA  228



>ref|XP_007019291.1| DNAJ heat shock N-terminal domain-containing protein [Theobroma 
cacao]
 gb|EOY16516.1| DNAJ heat shock N-terminal domain-containing protein [Theobroma 
cacao]
Length=388

 Score =   431 bits (1107),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 212/336 (63%), Positives = 266/336 (79%), Gaps = 5/336 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGVSP A+E +I+KAYY+KARQVHPDKNPNDP AA+ FQVLGEAYQVLSD
Sbjct  1     MVKETEYYDVLGVSPSASEEEIRKAYYLKARQVHPDKNPNDPHAAERFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR  YD  GK  IS E ++DP A+FA+LFGSELFEDYIG LA+ASMAS ++ ++ +  
Sbjct  61    PVQRDTYDRNGKYSISRETMLDPTAVFALLFGSELFEDYIGHLAVASMASSELASETDT-  119

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
              ++KL +K++ VQ+EREEKLA  LK+ LN YV+G K+ F   AE+E  RLS+ A GVD+L
Sbjct  120   -SEKLHDKLKAVQKEREEKLARSLKDFLNQYVRGDKDGFLQRAESEARRLSDTAIGVDIL  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             +TIGYIY+RQAA+ELGKKAIYLGVPF+AEW R+KGHF KSQ+TAA GAF L+QLQEDM+R
Sbjct  179   HTIGYIYSRQAAQELGKKAIYLGVPFLAEWVRHKGHFWKSQITAAKGAFQLLQLQEDMRR  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             Q   +G+  E ++E +++ +K+ ++ SLWKLNV DIE TL  VCQMVL++NNVKKEEL+A
Sbjct  239   QFKKDGSGPENDVESHVRLNKETLVSSLWKLNVVDIEVTLVHVCQMVLRENNVKKEELKA  298

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDG  769
             RA  LK LGK+FQ  ++ NG    TS    V ++D 
Sbjct  299   RALALKVLGKIFQEQRAQNGG---TSRRKNVAEIDA  331



>ref|XP_010930653.1| PREDICTED: chaperone protein dnaJ 10-like [Elaeis guineensis]
Length=382

 Score =   429 bits (1103),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 212/351 (60%), Positives = 271/351 (77%), Gaps = 6/351 (2%)
 Frame = -2

Query  1773  VKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSDP  1594
              KETEYYDVLGVSP ATE +I+KAYY+KARQVHPDKNPNDP AA+ FQ LGEAYQVLSDP
Sbjct  3     TKETEYYDVLGVSPSATEEEIRKAYYLKARQVHPDKNPNDPQAAERFQELGEAYQVLSDP  62

Query  1593  AQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEFD  1414
              QR+AYD +GK+ IS E ++D  A+F +LFGSELFEDYIG LA+ASMAS ++ ++ +  +
Sbjct  63    VQRRAYDGFGKNIISRENMLDATAVFTLLFGSELFEDYIGHLAVASMASTELTSEND--N  120

Query  1413  AKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDMLN  1234
               KLQ++++ +QREREEKLA+ L++ LN+YV G KE F   AEAE  RLSN A+GVD+L+
Sbjct  121   PLKLQDRLKAIQREREEKLAKFLRDFLNLYVHGDKEGFFHRAEAEAKRLSNTAFGVDILH  180

Query  1233  TIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKRQ  1054
             TIGY+Y RQAAKELGKK +YLGVPF+ EW RNKGHF KSQ+TAA GA  L+QLQED+ RQ
Sbjct  181   TIGYVYARQAAKELGKKVMYLGVPFLTEWVRNKGHFWKSQITAAKGALQLLQLQEDICRQ  240

Query  1053  LSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRAR  874
             ++ +G+ TE+++E +++ +K +M++SLWKLNV DIE TL  VCQMVLQ++NVKKEEL+AR
Sbjct  241   INKDGSGTEKDIELHIRMNKDLMMNSLWKLNVVDIEVTLLHVCQMVLQESNVKKEELKAR  300

Query  873   AKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSLNPSSRS  721
             A  LK LGKVFQ  +    + T    N P    D  + S D+ S+    R+
Sbjct  301   ALALKILGKVFQGERHALPSGTSKQKNIP----DDGDVSSDASSVEDLPRT  347



>ref|XP_006472897.1| PREDICTED: chaperone protein dnaJ 10-like [Citrus sinensis]
Length=383

 Score =   429 bits (1102),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 205/320 (64%), Positives = 264/320 (83%), Gaps = 2/320 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYD+LGV+P A+E +I+KAYY+KARQVHPDKNPNDP AA+ FQVLGEAYQVLSD
Sbjct  1     MVKETEYYDILGVNPSASEEEIRKAYYLKARQVHPDKNPNDPQAAERFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR+AYD  GK  IS E ++DP A+FA+LFGSELFEDYIG LA+ASMAS ++  + +  
Sbjct  61    PFQREAYDKNGKYSISRETMLDPTAVFALLFGSELFEDYIGHLAVASMASTELARESD--  118

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             + +KL +K++VVQREREE+LA +LK+ LN YV+G K+ F   AE+E  R+S  A+GVD+L
Sbjct  119   NPEKLNDKLKVVQREREERLARLLKDFLNQYVRGDKDGFLQRAESEGKRMSAVAFGVDIL  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             +TIGYIY+RQAA+ELGKKA+YLGVPF+AEW RNKGHF KSQ+TAA GAF L+QLQED++R
Sbjct  179   HTIGYIYSRQAAQELGKKALYLGVPFVAEWVRNKGHFWKSQITAAKGAFQLLQLQEDIRR  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             Q   +G+  E ++E +++ +K+ +++SLWKLNV DIE TL  VCQMVL++NNV+KEEL+A
Sbjct  239   QFKVDGSGPENDVETHIRLNKETLMNSLWKLNVVDIEVTLLHVCQMVLKENNVRKEELKA  298

Query  876   RAKGLKTLGKVFQRVKSVNG  817
             RA  LKTLGK+FQ  ++ N 
Sbjct  299   RAVALKTLGKIFQDKQTENA  318



>ref|XP_009404318.1| PREDICTED: chaperone protein dnaJ 10 [Musa acuminata subsp. malaccensis]
Length=385

 Score =   428 bits (1101),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 202/313 (65%), Positives = 256/313 (82%), Gaps = 2/313 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             M KETEYYDVLG++P A+E +I++AYY+KARQVHPDKNP+DP AA+ FQ LGEAYQVLSD
Sbjct  1     MAKETEYYDVLGLTPSASEEEIRRAYYLKARQVHPDKNPDDPQAAEKFQALGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR+AYD +GK G+S E ++D  AIF +LFGSELFEDYIG LA+ASMAS ++ ++ +  
Sbjct  61    PVQRRAYDGFGKDGVSRENMVDGTAIFTLLFGSELFEDYIGHLAVASMASTELTSEND--  118

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
               +KLQ++M+ VQREREEKLA  LK+ LN Y  G KE F  HAEAE  RL+N A+GV++L
Sbjct  119   SPEKLQDRMKAVQREREEKLARFLKDFLNQYASGDKEGFFHHAEAEAKRLANTAFGVEIL  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
              TIGY+Y RQAAKELGKK +YLGVPF+AEW RNKGHF +SQ++AA GAF L+Q+QED+ R
Sbjct  179   QTIGYVYARQAAKELGKKVMYLGVPFVAEWVRNKGHFWRSQISAAKGAFQLLQIQEDICR  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             QL+ +G  TE+++E +M+ +K +M++SLWKLNV DIE TL  VCQMVLQ+N+VKKEEL+A
Sbjct  239   QLNKDGTITEKDVELHMRMNKDLMVESLWKLNVVDIEVTLLHVCQMVLQENSVKKEELKA  298

Query  876   RAKGLKTLGKVFQ  838
             RA  LK LGK+FQ
Sbjct  299   RAVALKILGKIFQ  311



>ref|XP_002279104.1| PREDICTED: chaperone protein dnaJ 10 isoform X1 [Vitis vinifera]
Length=384

 Score =   427 bits (1099),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 210/330 (64%), Positives = 260/330 (79%), Gaps = 4/330 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGVSP A+E +I+KAYY+KA+QVHPDKNP+DPLAA+ FQVLGEAYQVLSD
Sbjct  1     MVKETEYYDVLGVSPTASEEEIRKAYYLKAKQVHPDKNPSDPLAAERFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR AYD  GK  IS E ++DP A+FA+LFGSELFE+YIG LA+ASMAS ++    EE 
Sbjct  61    PMQRDAYDRNGKYCISKETMLDPTAVFALLFGSELFENYIGHLAVASMASSEL---AEES  117

Query  1416  D-AKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDM  1240
             D  +KL +K++ VQ+EREE+LA +LK+ LN YVQG K  F   AE+E  RLS+A +G D+
Sbjct  118   DNPEKLHDKLKAVQKEREERLARLLKDFLNQYVQGDKRGFLHCAESEAKRLSDAVFGADI  177

Query  1239  LNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMK  1060
             L+TIGY+Y RQAA+ELGKK IYLGVPF+AEW RNKGHF KSQ+TAA GAF L+QLQED++
Sbjct  178   LHTIGYVYARQAAQELGKKVIYLGVPFLAEWVRNKGHFWKSQITAAKGAFQLLQLQEDIR  237

Query  1059  RQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELR  880
             RQ   +G+  E ++E +++ +K  +++SLWKLNV DIE TL  VCQ+VLQ+NNVKKEEL+
Sbjct  238   RQFKMDGSGPENDVESHIRMNKDTLMNSLWKLNVVDIEVTLIHVCQLVLQENNVKKEELK  297

Query  879   ARAKGLKTLGKVFQRVKSVNGNETETSANT  790
             ARA  LK LGK+FQR K      T  S N 
Sbjct  298   ARALALKLLGKIFQREKLARSGGTSKSRNV  327



>ref|XP_010912597.1| PREDICTED: chaperone protein dnaJ 10-like isoform X5 [Elaeis 
guineensis]
Length=364

 Score =   424 bits (1091),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 206/344 (60%), Positives = 267/344 (78%), Gaps = 6/344 (2%)
 Frame = -2

Query  1770  KETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSDPA  1591
             KETEYYDVLGVSP ATE +I+KAY+ KARQVHPDKNPNDP AA+ FQ LGEAYQVLSDP 
Sbjct  4     KETEYYDVLGVSPSATEEEIRKAYFFKARQVHPDKNPNDPQAAERFQELGEAYQVLSDPV  63

Query  1590  QRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEFDA  1411
             QR+AYD +GK+ +S E ++D  A+F +LFGSE+FEDY+G LA+ASM S ++ +  E+ + 
Sbjct  64    QRRAYDGFGKNSVSRENMLDATAVFTLLFGSEIFEDYVGHLAVASMTSSELTS--EDDNP  121

Query  1410  KKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDMLNT  1231
             +KLQ++++ VQREREEKLA+ L++ LN YV G KE F  HAEAE  RLSN A+GV++L+T
Sbjct  122   EKLQDRLKAVQREREEKLAKFLRDFLNQYVHGDKEGFFHHAEAEAKRLSNTAFGVNILHT  181

Query  1230  IGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKRQL  1051
             IGY+Y RQAAKELGKK IYLGVPF+ EW R KGHF KSQ+TAA GA  L+QLQED+ RQ+
Sbjct  182   IGYVYARQAAKELGKKVIYLGVPFLTEWVRTKGHFWKSQITAAKGALELLQLQEDICRQI  241

Query  1050  SAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRARA  871
             + +G+ TE++++ +++ +K +M+DSLWKLNV DIE TL  VCQMVL ++NVK+EEL+ARA
Sbjct  242   NKDGSGTEKDVDLHIRMNKDLMMDSLWKLNVVDIEVTLLHVCQMVLHESNVKREELKARA  301

Query  870   KGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSL  739
               LK LGK+FQ  +    + T    N P    D +E S D+ S+
Sbjct  302   LALKILGKIFQGERHALPSGTPKKKNIP----DDNESSSDASSV  341



>ref|XP_006434336.1| hypothetical protein CICLE_v10003893mg [Citrus clementina]
 gb|ESR47576.1| hypothetical protein CICLE_v10003893mg [Citrus clementina]
 gb|KDO83550.1| hypothetical protein CISIN_1g048612mg [Citrus sinensis]
Length=385

 Score =   424 bits (1090),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 205/322 (64%), Positives = 264/322 (82%), Gaps = 4/322 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYD+LGV+P A+E +I+KAYY+KARQVHPDKNPNDP AA+ FQVLGEAYQVLSD
Sbjct  1     MVKETEYYDILGVNPSASEEEIRKAYYLKARQVHPDKNPNDPQAAERFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR+AYD  GK  IS E ++DP A+FA+LFGSELFEDYIG LA+ASMAS ++  + +  
Sbjct  61    PFQREAYDKNGKYSISRETMLDPTAVFALLFGSELFEDYIGHLAVASMASTELARESD--  118

Query  1416  DAKKLQEKMR--VVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVD  1243
             + +KL +K++  VVQREREE+LA +LK+ LN YV+G K+ F   AE+E  R+S  A+GVD
Sbjct  119   NPEKLNDKLKASVVQREREERLARLLKDFLNQYVRGDKDGFLQRAESEGKRMSAVAFGVD  178

Query  1242  MLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDM  1063
             +L+TIGYIY+RQAA+ELGKKA+YLGVPF+AEW RNKGHF KSQ+TAA GAF L+QLQED+
Sbjct  179   ILHTIGYIYSRQAAQELGKKALYLGVPFVAEWVRNKGHFWKSQITAAKGAFQLLQLQEDI  238

Query  1062  KRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEEL  883
             +RQ   +G+  E ++E +++ +K+ +++SLWKLNV DIE TL  VCQMVL++NNV+KEEL
Sbjct  239   RRQFKVDGSGPENDVETHIRLNKETLMNSLWKLNVVDIEVTLLHVCQMVLKENNVRKEEL  298

Query  882   RARAKGLKTLGKVFQRVKSVNG  817
             +ARA  LKTLGK+FQ  ++ N 
Sbjct  299   KARAVALKTLGKIFQDKQTENA  320



>gb|KDP43082.1| hypothetical protein JCGZ_25268 [Jatropha curcas]
Length=388

 Score =   424 bits (1090),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 204/316 (65%), Positives = 257/316 (81%), Gaps = 2/316 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGVSP A+E +I+KAYY+KARQVHPDKNPNDP AA+ FQ LGEAYQ+LSD
Sbjct  1     MVKETEYYDVLGVSPSASEEEIRKAYYLKARQVHPDKNPNDPQAAERFQALGEAYQILSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR AYD  GK  IS E ++DP A+FA+LFGSELFEDYIG L++ASMAS ++ T+ +  
Sbjct  61    PVQRDAYDRNGKCSISRETMLDPTAVFALLFGSELFEDYIGHLSVASMASSELATEIDNP  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D  K+ +K++ VQ+EREEKLA +LK+ LN YV G K  F   AE+E  RLS+AA+G D+L
Sbjct  121   D--KIHDKLKAVQKEREEKLARLLKDFLNQYVHGDKIGFLKRAESEAKRLSDAAFGADIL  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
              TIGY Y+RQAA+ELGKKAIYLG+PF+AEW RNKGHF KSQ+TAA GAF L+QLQED+++
Sbjct  179   QTIGYTYSRQAAQELGKKAIYLGMPFLAEWVRNKGHFWKSQITAAKGAFQLLQLQEDIRK  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             Q   +G+  E ++E +++S+K+I++ SLWKLNV DIE TL  VCQMVL++NNVKK+EL+A
Sbjct  239   QFKMDGSGPENDVEAHLRSNKEILMSSLWKLNVVDIEVTLVHVCQMVLRENNVKKDELKA  298

Query  876   RAKGLKTLGKVFQRVK  829
             RA  LK LGK+FQ+ K
Sbjct  299   RALALKLLGKIFQQGK  314



>ref|XP_010912593.1| PREDICTED: chaperone protein dnaJ 10-like isoform X2 [Elaeis 
guineensis]
 ref|XP_010912594.1| PREDICTED: chaperone protein dnaJ 10-like isoform X2 [Elaeis 
guineensis]
Length=382

 Score =   424 bits (1089),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 206/344 (60%), Positives = 267/344 (78%), Gaps = 6/344 (2%)
 Frame = -2

Query  1770  KETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSDPA  1591
             KETEYYDVLGVSP ATE +I+KAY+ KARQVHPDKNPNDP AA+ FQ LGEAYQVLSDP 
Sbjct  4     KETEYYDVLGVSPSATEEEIRKAYFFKARQVHPDKNPNDPQAAERFQELGEAYQVLSDPV  63

Query  1590  QRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEFDA  1411
             QR+AYD +GK+ +S E ++D  A+F +LFGSE+FEDY+G LA+ASM S ++ +  E+ + 
Sbjct  64    QRRAYDGFGKNSVSRENMLDATAVFTLLFGSEIFEDYVGHLAVASMTSSELTS--EDDNP  121

Query  1410  KKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDMLNT  1231
             +KLQ++++ VQREREEKLA+ L++ LN YV G KE F  HAEAE  RLSN A+GV++L+T
Sbjct  122   EKLQDRLKAVQREREEKLAKFLRDFLNQYVHGDKEGFFHHAEAEAKRLSNTAFGVNILHT  181

Query  1230  IGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKRQL  1051
             IGY+Y RQAAKELGKK IYLGVPF+ EW R KGHF KSQ+TAA GA  L+QLQED+ RQ+
Sbjct  182   IGYVYARQAAKELGKKVIYLGVPFLTEWVRTKGHFWKSQITAAKGALELLQLQEDICRQI  241

Query  1050  SAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRARA  871
             + +G+ TE++++ +++ +K +M+DSLWKLNV DIE TL  VCQMVL ++NVK+EEL+ARA
Sbjct  242   NKDGSGTEKDVDLHIRMNKDLMMDSLWKLNVVDIEVTLLHVCQMVLHESNVKREELKARA  301

Query  870   KGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSL  739
               LK LGK+FQ  +    + T    N P    D +E S D+ S+
Sbjct  302   LALKILGKIFQGERHALPSGTPKKKNIP----DDNESSSDASSV  341



>ref|XP_011074793.1| PREDICTED: chaperone protein dnaJ 10 [Sesamum indicum]
Length=383

 Score =   423 bits (1088),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 207/318 (65%), Positives = 255/318 (80%), Gaps = 2/318 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYD+LGVSP A+E +I+KAYY+KARQVHPDKNPNDP AA+ FQVLGEAYQVLSD
Sbjct  1     MVKETEYYDILGVSPSASEEEIRKAYYLKARQVHPDKNPNDPQAAERFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR  YD  GK  IS E ++DP A+FA+LFGSELFEDYIG LA+ASMAS +    GE  
Sbjct  61    PVQRDTYDRNGKYCISKETMLDPTAVFALLFGSELFEDYIGHLAVASMASTEF--AGESD  118

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             +  K+ ++++VVQREREEKLA  L++ L+ YV+G KE F   AE+E  RLS+AA+G ++L
Sbjct  119   NPDKVHDRLKVVQREREEKLARKLRDFLHHYVRGDKEGFLKQAESEAERLSHAAFGAEIL  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             +TIGYIYTRQAA +LGKKAIYLGVPF+AEW RNKGHF KSQ TAA GAF L+QLQED++R
Sbjct  179   HTIGYIYTRQAALQLGKKAIYLGVPFVAEWVRNKGHFWKSQFTAAKGAFQLLQLQEDIRR  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             Q   +G+  E ++E +++ +K  +++SLWKLNV DIE TL  VCQMVLQDN+V+KEELR 
Sbjct  239   QFKMDGSSPENDMESHLRLNKDTLMNSLWKLNVVDIEITLLHVCQMVLQDNSVRKEELRL  298

Query  876   RAKGLKTLGKVFQRVKSV  823
             RA  LK LGKVFQ  K++
Sbjct  299   RAVALKILGKVFQSQKNM  316



>ref|XP_010912591.1| PREDICTED: chaperone protein dnaJ 10-like isoform X1 [Elaeis 
guineensis]
 ref|XP_010912592.1| PREDICTED: chaperone protein dnaJ 10-like isoform X1 [Elaeis 
guineensis]
Length=405

 Score =   424 bits (1089),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 206/344 (60%), Positives = 267/344 (78%), Gaps = 6/344 (2%)
 Frame = -2

Query  1770  KETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSDPA  1591
             KETEYYDVLGVSP ATE +I+KAY+ KARQVHPDKNPNDP AA+ FQ LGEAYQVLSDP 
Sbjct  4     KETEYYDVLGVSPSATEEEIRKAYFFKARQVHPDKNPNDPQAAERFQELGEAYQVLSDPV  63

Query  1590  QRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEFDA  1411
             QR+AYD +GK+ +S E ++D  A+F +LFGSE+FEDY+G LA+ASM S ++ +  E+ + 
Sbjct  64    QRRAYDGFGKNSVSRENMLDATAVFTLLFGSEIFEDYVGHLAVASMTSSELTS--EDDNP  121

Query  1410  KKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDMLNT  1231
             +KLQ++++ VQREREEKLA+ L++ LN YV G KE F  HAEAE  RLSN A+GV++L+T
Sbjct  122   EKLQDRLKAVQREREEKLAKFLRDFLNQYVHGDKEGFFHHAEAEAKRLSNTAFGVNILHT  181

Query  1230  IGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKRQL  1051
             IGY+Y RQAAKELGKK IYLGVPF+ EW R KGHF KSQ+TAA GA  L+QLQED+ RQ+
Sbjct  182   IGYVYARQAAKELGKKVIYLGVPFLTEWVRTKGHFWKSQITAAKGALELLQLQEDICRQI  241

Query  1050  SAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRARA  871
             + +G+ TE++++ +++ +K +M+DSLWKLNV DIE TL  VCQMVL ++NVK+EEL+ARA
Sbjct  242   NKDGSGTEKDVDLHIRMNKDLMMDSLWKLNVVDIEVTLLHVCQMVLHESNVKREELKARA  301

Query  870   KGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSL  739
               LK LGK+FQ  +    + T    N P    D +E S D+ S+
Sbjct  302   LALKILGKIFQGERHALPSGTPKKKNIP----DDNESSSDASSV  341



>ref|NP_001154353.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
thaliana]
 gb|AAL09771.1| At1g21080/T22I11_9 [Arabidopsis thaliana]
 gb|AEE30061.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
thaliana]
Length=304

 Score =   419 bits (1077),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 213/314 (68%), Positives = 257/314 (82%), Gaps = 14/314 (4%)
 Frame = -2

Query  1512  MLFGSELFEDYIGQLAMASMASLDIFTDGEEFDAKKLQEKMRVVQREREEKLAEILKNRL  1333
             MLFGSELFE+YIGQLAMASMASLDIFT+G++ D KK+ EKMR VQ+ERE+KLA+ILK+RL
Sbjct  1     MLFGSELFEEYIGQLAMASMASLDIFTEGDQIDTKKIIEKMRAVQKEREDKLAQILKDRL  60

Query  1332  NVYVQGSKEEFRAHAEAEVSRLSNAAYGVDMLNTIGYIYTRQAAKELGKKAIYLGVPFIA  1153
             N+Y+  +K+EF ++AEAEV+RLSNAAYGV+MLNTIGYIY RQAAKELGKKAIYLGVPF+A
Sbjct  61    NLYMT-NKDEFTSNAEAEVTRLSNAAYGVEMLNTIGYIYVRQAAKELGKKAIYLGVPFVA  119

Query  1152  EWFRNKGHFIKSQVTAATGAFALIQLQEDMKRQLSAEGNYTeeeleEYMQSHKKIMIDSL  973
             EWFR KGHFIKSQVTAATGA+AL QLQE+MKRQLSAEGNYTE+ELEEYM++HKK+MIDSL
Sbjct  120   EWFRTKGHFIKSQVTAATGAYALFQLQEEMKRQLSAEGNYTEKELEEYMKTHKKVMIDSL  179

Query  972   WKLNVADIETTLSRVCQMVLQDNNVKKEELRARAKGLKTLGKVFQRVKSVNGNETETSAN  793
             WKLNVADIE+T+SRVC+ VLQD   K+EELRARAKGLKTLGK+FQ+ K    +E++    
Sbjct  180   WKLNVADIESTISRVCEQVLQDPTAKREELRARAKGLKTLGKIFQKNKI--ASESDPLVR  237

Query  792   TPVQKLDGSEPSYDSHSLNP----SSRSQNADEAPYTAFAVQSPYIETPQFGSGQFNSYD  625
               + KL+G+   +D  S +P    +SRS    + P      QSPY+E P+ G  Q N Y 
Sbjct  238   AELHKLNGNGQEHDHSSTSPKSDEASRSTVGPQEP------QSPYVEAPKLGEEQINYY-  290

Query  624   FPMPTAPPGAERHA  583
             FP P  PPGA+RH+
Sbjct  291   FPRPAPPPGAQRHS  304



>ref|XP_011027402.1| PREDICTED: chaperone protein dnaJ 10-like isoform X3 [Populus 
euphratica]
Length=382

 Score =   422 bits (1084),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 203/328 (62%), Positives = 256/328 (78%), Gaps = 2/328 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKE+EYYDVLGVSP A+E +I+KAYY+KARQVHPDKNP+DP AA+ FQVLGEAYQVLSD
Sbjct  1     MVKESEYYDVLGVSPSASEEEIRKAYYLKARQVHPDKNPDDPQAAERFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR AYD  GK  IS E ++DP A+FA+LFGSELFEDY+G L++ SMAS ++ +  E  
Sbjct  61    PVQRDAYDRNGKYSISRETMLDPTAVFALLFGSELFEDYVGHLSVTSMASSELAS--ESG  118

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             +  K+ EK++ VQ+EREEKLA  LK+ LN Y QG +  F   AE+E  RLS+AA+GVD+L
Sbjct  119   NPDKVHEKLKAVQKEREEKLARFLKDFLNQYAQGDRIGFLRRAESEAKRLSDAAFGVDIL  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             +TIGYIY+RQAA+ELGKKAIYLGVPF+AEW RNKGHF KSQ+TAA GAF L+QLQEDM+R
Sbjct  179   HTIGYIYSRQAAQELGKKAIYLGVPFLAEWVRNKGHFWKSQITAAKGAFQLLQLQEDMRR  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             Q   +G+    ++E ++ S+K  +++SLWKLNV DIE T+  VCQMVL++NNV+KEEL+A
Sbjct  239   QFKMDGSGPGSDVESHLLSNKDTLMNSLWKLNVVDIEITVIHVCQMVLKENNVRKEELKA  298

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSAN  793
             RA  LK LG++FQ  +      T    N
Sbjct  299   RALALKILGRIFQHERQSRNGATSKGKN  326



>ref|XP_004290570.1| PREDICTED: chaperone protein dnaJ 10-like [Fragaria vesca subsp. 
vesca]
Length=385

 Score =   422 bits (1084),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 203/313 (65%), Positives = 253/313 (81%), Gaps = 2/313 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYD L VSP A+E +I+KAYY+KARQVHPDKNPNDP AA+ FQVLGEAYQVLSD
Sbjct  1     MVKETEYYDALNVSPSASEEEIRKAYYLKARQVHPDKNPNDPQAAERFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR AYD  GK  I  E ++DP A+FA LFGSELFEDYIG LA+ASMAS  +  +G+  
Sbjct  61    PVQRDAYDRNGKHCIPRETMLDPTAVFAFLFGSELFEDYIGHLAVASMASSQLAGEGD--  118

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             + +K+ +K++ VQ+EREEKLA+ LK+ LN YV+G KE F  HAE+E  RLS+AA+GVDML
Sbjct  119   NPEKVHDKLKAVQKEREEKLAKALKDLLNQYVRGDKEGFLHHAESEARRLSDAAFGVDML  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             +TIGY+Y+RQAA+ELGKK IYLGVPF+AEW RNKGHF KSQ+TAA GAF L+QLQE+++R
Sbjct  179   HTIGYVYSRQAAQELGKKTIYLGVPFLAEWVRNKGHFWKSQMTAAKGAFQLMQLQEEIRR  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             Q   +G+  E ++E ++  +K  +++SLWKLNV DIE TL  VCQMVL++ NV+K+ELRA
Sbjct  239   QFKVDGSGPEHDVESHISLNKDTLLNSLWKLNVVDIEVTLVHVCQMVLRETNVRKDELRA  298

Query  876   RAKGLKTLGKVFQ  838
             RA  LK LGK+FQ
Sbjct  299   RALALKLLGKIFQ  311



>ref|XP_004237709.1| PREDICTED: chaperone protein dnaJ 10 [Solanum lycopersicum]
Length=382

 Score =   422 bits (1084),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 203/325 (62%), Positives = 261/325 (80%), Gaps = 2/325 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGVSP+A+E +I+KAYY+KARQVHPDKNP+DPLAAQ FQ LGEAYQVLSD
Sbjct  1     MVKETEYYDVLGVSPLASEDEIRKAYYLKARQVHPDKNPDDPLAAQRFQELGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR  YD  GKS +S E ++DP A+FA+LFGSELFEDYIG L++ASMAS ++ T+ +  
Sbjct  61    PVQRNVYDQNGKSCVSRETMLDPTAVFALLFGSELFEDYIGHLSVASMASSELVTEND--  118

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             + ++L ++++ VQ+EREEKLA ILK+ L  YV+G +  F    E+E  RLS AA+G ++L
Sbjct  119   NPERLHDRLKGVQKEREEKLARILKDFLQQYVRGDRVGFIHRVESEAERLSQAAFGAEIL  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
              TIGYIYTRQAA+ELGKKAIYLGVPF+AEW RNKGHF KSQ+TAA GAF L+QLQED++R
Sbjct  179   QTIGYIYTRQAAQELGKKAIYLGVPFMAEWVRNKGHFWKSQLTAAKGAFQLLQLQEDVRR  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             Q   +G+  E ++E +++ +++ +++SLWKLNV DIE TL  VCQ+VLQ+ NVKKEEL+ 
Sbjct  239   QFKMDGSGPENDVESHLRLNRETLMNSLWKLNVVDIEVTLLHVCQLVLQEGNVKKEELKK  298

Query  876   RAKGLKTLGKVFQRVKSVNGNETET  802
             RA  LK LGKVF+R K V  ++ +T
Sbjct  299   RAMALKILGKVFEREKCVGTSKKKT  323



>ref|XP_008237723.1| PREDICTED: chaperone protein dnaJ 10 [Prunus mume]
Length=384

 Score =   421 bits (1082),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 203/323 (63%), Positives = 257/323 (80%), Gaps = 2/323 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETE+YDVL VSP A+E +I+KAYYIKARQVHPDKNPNDP AA+ FQVLGEAYQVLSD
Sbjct  1     MVKETEFYDVLSVSPSASEEEIRKAYYIKARQVHPDKNPNDPQAAERFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR AYD  GK  IS E ++DP A+FA LFGSELFEDYIG LA+ASMAS  +  +G+  
Sbjct  61    PVQRDAYDRNGKYCISRETMLDPTAVFAFLFGSELFEDYIGHLAVASMASSQLAGEGD--  118

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
               +K+ +K++ VQ+EREEKLA+ LK+ LN YVQG KE F  HAE+E  RLS+AA+G++ML
Sbjct  119   SPEKVHDKLKAVQKEREEKLAKSLKDFLNQYVQGDKEGFLQHAESEARRLSDAAFGIEML  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             +TIGY+Y+RQAA+ELGKK I+LGVPF+AEW RNKGHF KSQ+TAA GAF L+QLQE+++R
Sbjct  179   HTIGYVYSRQAAQELGKKTIFLGVPFLAEWVRNKGHFWKSQMTAAKGAFQLLQLQEEIRR  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             Q   +G+  E  +E +++ +K  +++SLWKLNV DIE TL  VCQMVL++NN++K+EL+A
Sbjct  239   QFKMDGSGPENNVESHIRLNKDTLLNSLWKLNVVDIEVTLMHVCQMVLRENNLRKDELKA  298

Query  876   RAKGLKTLGKVFQRVKSVNGNET  808
             RA  LK LG++FQ  K      T
Sbjct  299   RALALKHLGRIFQEEKQTRNGGT  321



>ref|XP_002307468.2| hypothetical protein POPTR_0005s20810g [Populus trichocarpa]
 gb|EEE94464.2| hypothetical protein POPTR_0005s20810g [Populus trichocarpa]
Length=384

 Score =   421 bits (1082),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 205/328 (63%), Positives = 256/328 (78%), Gaps = 2/328 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGVSP A+E +I+KAYY+KARQVHPDKN +DPLAA+ FQVLGEAYQVLSD
Sbjct  1     MVKETEYYDVLGVSPSASEEEIRKAYYLKARQVHPDKNQDDPLAAERFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR AYD  GK  IS E ++DP A+FA+LFGSELFEDY+G L++ SMAS ++   GE  
Sbjct  61    PVQRDAYDRNGKYCISRETMLDPTAVFALLFGSELFEDYVGHLSVTSMASSELA--GESD  118

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             +  K+ EK++ VQ+EREEKLA  LK+ LN Y QG +  F  HAE+E  RLS+AA+GVD+L
Sbjct  119   NPDKVHEKLKAVQKEREEKLARFLKDFLNQYAQGDRIGFLRHAESEAKRLSDAAFGVDIL  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             +TIG+IY+RQAA+ELGKKAIYLGVPF+AEW RNKGHF KSQ+TAA GAF L+QLQEDM+R
Sbjct  179   HTIGHIYSRQAAQELGKKAIYLGVPFLAEWARNKGHFWKSQITAAKGAFQLLQLQEDMRR  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             Q   + +    ++E ++ S+K  +++SLWKLNV DIE T+  VCQ VL++N+V+KEELRA
Sbjct  239   QFKMDRSDPGNDVESHLLSNKDTLMNSLWKLNVVDIEITVIHVCQTVLKENDVRKEELRA  298

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSAN  793
             RA  LK LGK+FQ+ K      T    N
Sbjct  299   RALALKILGKIFQQEKQAQNGATSKGKN  326



>ref|XP_011027401.1| PREDICTED: chaperone protein dnaJ 10-like isoform X2 [Populus 
euphratica]
Length=383

 Score =   421 bits (1081),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 204/322 (63%), Positives = 257/322 (80%), Gaps = 4/322 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKE+EYYDVLGVSP A+E +I+KAYY+KARQVHPDKNP+DP AA+ FQVLGEAYQVLSD
Sbjct  1     MVKESEYYDVLGVSPSASEEEIRKAYYLKARQVHPDKNPDDPQAAERFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR AYD  GK  IS E ++DP A+FA+LFGSELFEDY+G L++ SMAS ++ +  E  
Sbjct  61    PVQRDAYDRNGKYSISRETMLDPTAVFALLFGSELFEDYVGHLSVTSMASSELAS--ESG  118

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNA--AYGVD  1243
             +  K+ EK++ VQ+EREEKLA  LK+ LN Y QG +  F   AE+E  RLS+A  A+GVD
Sbjct  119   NPDKVHEKLKAVQKEREEKLARFLKDFLNQYAQGDRIGFLRRAESEAKRLSDADTAFGVD  178

Query  1242  MLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDM  1063
             +L+TIGYIY+RQAA+ELGKKAIYLGVPF+AEW RNKGHF KSQ+TAA GAF L+QLQEDM
Sbjct  179   ILHTIGYIYSRQAAQELGKKAIYLGVPFLAEWVRNKGHFWKSQITAAKGAFQLLQLQEDM  238

Query  1062  KRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEEL  883
             +RQ   +G+    ++E ++ S+K  +++SLWKLNV DIE T+  VCQMVL++NNV+KEEL
Sbjct  239   RRQFKMDGSGPGSDVESHLLSNKDTLMNSLWKLNVVDIEITVIHVCQMVLKENNVRKEEL  298

Query  882   RARAKGLKTLGKVFQRVKSVNG  817
             +ARA  LK LG++FQ  +S NG
Sbjct  299   KARALALKILGRIFQERQSRNG  320



>ref|XP_009771904.1| PREDICTED: chaperone protein dnaJ 10 [Nicotiana sylvestris]
Length=385

 Score =   421 bits (1081),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 204/320 (64%), Positives = 256/320 (80%), Gaps = 2/320 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGVSP A+E +I+KAYY+KARQVHPDKNP+DPLAAQ FQ LGEAYQVLSD
Sbjct  1     MVKETEYYDVLGVSPSASEEEIRKAYYLKARQVHPDKNPDDPLAAQRFQELGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR  YD  GKS +S E ++DP A+FA+LFGSELFEDY+G L++ASMAS ++   GE  
Sbjct  61    PVQRNVYDQNGKSCVSRETMLDPTAVFALLFGSELFEDYVGHLSVASMASSELV--GEND  118

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D +K+ ++++ VQ+EREEKLA ILK+ L  YV+G +  F   AE+E  RLS AA+G ++L
Sbjct  119   DPEKIHDRLKGVQKEREEKLARILKDFLQQYVRGDRVGFLRRAESEAERLSQAAFGAEIL  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
              TIGYIYTRQAA+ELGKKAIYLGVPF+AEW RNKGHF KSQ+TAA GAF L+QLQED++R
Sbjct  179   QTIGYIYTRQAAQELGKKAIYLGVPFMAEWVRNKGHFWKSQLTAAKGAFQLLQLQEDVRR  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             Q   +G+  E ++E +++ +++ +++SLWKLNV DIE TL  VCQ+VLQ+ NVKKEEL+ 
Sbjct  239   QFKMDGSGPENDVESHLRLNRETLMNSLWKLNVVDIEVTLLHVCQLVLQEGNVKKEELKK  298

Query  876   RAKGLKTLGKVFQRVKSVNG  817
             RA  LK LGKVF+R K   G
Sbjct  299   RAMALKILGKVFEREKCGQG  318



>ref|XP_010063904.1| PREDICTED: chaperone protein dnaJ 10 isoform X2 [Eucalyptus grandis]
Length=383

 Score =   420 bits (1079),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 202/331 (61%), Positives = 260/331 (79%), Gaps = 2/331 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGVSP A++ +I+KAYY+KARQVHPDKNP+DP AA+ FQVLGEAYQ+LSD
Sbjct  1     MVKETEYYDVLGVSPSASDDEIRKAYYLKARQVHPDKNPDDPHAAERFQVLGEAYQILSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR+AYD  GK  IS + ++DP A+FA+LFGSELFEDYIG LA+ASMAS +  TD +  
Sbjct  61    PVQREAYDRNGKYSISRDTMLDPMAVFALLFGSELFEDYIGHLAVASMASSEFATDSDNP  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D  KL ++++ VQ+EREEKLA  LK+ LN YV G K  F  HAEAE  RLS AA+GVD+L
Sbjct  121   D--KLHDRLKAVQKEREEKLARFLKDVLNEYVYGDKGRFIQHAEAEAKRLSGAAFGVDIL  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGY Y+RQAA+ELGKKA+YLG+PF+AEW R+KGHF KSQVTAA GAF L+Q+Q+D++R
Sbjct  179   NTIGYTYSRQAAQELGKKAMYLGMPFLAEWVRSKGHFWKSQVTAAKGAFQLLQMQDDVRR  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             Q   +G+    ++E +++ +K+ +++SLWKLNV DIE TL  VC +VL++ NVKKEEL+A
Sbjct  239   QFKMDGSGPGNDVESHIRLNKETLMNSLWKLNVVDIEVTLMHVCHLVLREYNVKKEELKA  298

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPV  784
             RA  LK LGK+FQ   + NG  +   ++  +
Sbjct  299   RAIALKILGKIFQGKNAKNGGTSRKKSDHQI  329



>ref|XP_010999850.1| PREDICTED: chaperone protein dnaJ 10-like isoform X3 [Populus 
euphratica]
Length=384

 Score =   419 bits (1078),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 205/328 (63%), Positives = 255/328 (78%), Gaps = 2/328 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGVSP A+E +I+KAYY+KARQVHPDKN +DPLAA+ FQVLGEAYQVLSD
Sbjct  1     MVKETEYYDVLGVSPSASEEEIRKAYYLKARQVHPDKNQDDPLAAERFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR AYD  GK  IS E ++DP A+FA+LFGSELFEDY+G L++ SMAS ++   GE  
Sbjct  61    PVQRDAYDRNGKYCISRETMLDPTAVFALLFGSELFEDYVGHLSVTSMASSEL--AGESD  118

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             +  K+ EK++ VQ+EREEKLA  LK+ LN Y +G +  F  HAE+E  RLS AA+GVD+L
Sbjct  119   NPDKVHEKLKAVQKEREEKLARFLKDFLNQYAKGDRIGFLRHAESEAKRLSVAAFGVDIL  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             +TIG IY+RQAA+ELGKKAIYLGVPF+AEW RNKGHF KSQ+TAA GAF L+QLQEDM+R
Sbjct  179   HTIGNIYSRQAAQELGKKAIYLGVPFVAEWARNKGHFWKSQITAAKGAFQLLQLQEDMRR  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             Q   + +    ++E ++ S+K  +++SLWKLNV DIE T+  VCQMVL++NN++KEELRA
Sbjct  239   QFKMDRSDPGNDVESHLLSNKDTLMNSLWKLNVVDIEITVIHVCQMVLKENNIRKEELRA  298

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSAN  793
             RA  LK LGK+FQ+ K      T    N
Sbjct  299   RALALKILGKIFQQEKQAQNGATSKGKN  326



>ref|XP_010063903.1| PREDICTED: chaperone protein dnaJ 10 isoform X1 [Eucalyptus grandis]
Length=384

 Score =   419 bits (1076),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 203/332 (61%), Positives = 262/332 (79%), Gaps = 3/332 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGVSP A++ +I+KAYY+KARQVHPDKNP+DP AA+ FQVLGEAYQ+LSD
Sbjct  1     MVKETEYYDVLGVSPSASDDEIRKAYYLKARQVHPDKNPDDPHAAERFQVLGEAYQILSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR+AYD  GK  IS + ++DP A+FA+LFGSELFEDYIG LA+ASMAS +  TD +  
Sbjct  61    PVQREAYDRNGKYSISRDTMLDPMAVFALLFGSELFEDYIGHLAVASMASSEFATDSDNP  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D  KL ++++ VQ+EREEKLA  LK+ LN YV G K  F  HAEAE  RLS AA+GVD+L
Sbjct  121   D--KLHDRLKAVQKEREEKLARFLKDVLNEYVYGDKGRFIQHAEAEAKRLSGAAFGVDIL  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGY Y+RQAA+ELGKKA+YLG+PF+AEW R+KGHF KSQVTAA GAF L+Q+Q+D++R
Sbjct  179   NTIGYTYSRQAAQELGKKAMYLGMPFLAEWVRSKGHFWKSQVTAAKGAFQLLQMQDDVRR  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             Q   +G+    ++E +++ +K+ +++SLWKLNV DIE TL  VC +VL++ NVKKEEL+A
Sbjct  239   QFKMDGSGPGNDVESHIRLNKETLMNSLWKLNVVDIEVTLMHVCHLVLREYNVKKEELKA  298

Query  876   RAKGLKTLGKVFQRVKSV-NGNETETSANTPV  784
             RA  LK LGK+FQ+ K+  NG  +   ++  +
Sbjct  299   RAIALKILGKIFQQGKNAKNGGTSRKKSDHQI  330



>ref|XP_002520257.1| Chaperone protein dnaJ, putative [Ricinus communis]
 gb|EEF42043.1| Chaperone protein dnaJ, putative [Ricinus communis]
Length=383

 Score =   418 bits (1075),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/323 (63%), Positives = 255/323 (79%), Gaps = 2/323 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGV+P A+E +I++AYY+KARQVHPDKNPNDP AA+ FQVLGEAYQ+LSD
Sbjct  1     MVKETEYYDVLGVNPSASEDEIRRAYYLKARQVHPDKNPNDPQAAERFQVLGEAYQILSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR AYD  GK  IS E ++DP A+FA+LFGSELFEDY+G L++ASMAS ++  + +  
Sbjct  61    PVQRDAYDKNGKYCISRETMLDPTAVFALLFGSELFEDYVGHLSVASMASSELAAEIDNP  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D  K+ EK++ VQ+EREEKLA  L + LN YV G K  F   AE+E  RLS+AA+G D+L
Sbjct  121   D--KVHEKLKAVQKEREEKLARFLIDFLNQYVHGDKIGFLKRAESEAKRLSDAAFGNDIL  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
              TIGYIY+RQAA+ELGKKAIYLGVPF+AEW RNKGHF +SQ+TAA GAF L+QLQEDM++
Sbjct  179   QTIGYIYSRQAAQELGKKAIYLGVPFVAEWVRNKGHFWRSQLTAAKGAFQLLQLQEDMRK  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             Q   +G+  E ++E +++S+K I++ SLWKLNV DIE TL  VCQMVL++ NV+KEELRA
Sbjct  239   QFKMDGSGPENDVESHLRSNKDILMSSLWKLNVVDIEVTLVHVCQMVLKEINVRKEELRA  298

Query  876   RAKGLKTLGKVFQRVKSVNGNET  808
             RA  LK LGK+FQ+ K      T
Sbjct  299   RALALKILGKIFQQEKQAQNGAT  321



>ref|XP_006356328.1| PREDICTED: chaperone protein dnaJ 10-like [Solanum tuberosum]
Length=382

 Score =   418 bits (1074),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 201/325 (62%), Positives = 260/325 (80%), Gaps = 2/325 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLG+SP+A+E +I+KAYY+KARQVHPDKNP+DPLAAQ FQ LGEAYQVLSD
Sbjct  1     MVKETEYYDVLGLSPLASEEEIRKAYYLKARQVHPDKNPDDPLAAQKFQELGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR  YD  GKS +S E ++DP A+FA+LFGSELFEDYIG L++ASMAS ++ ++ +  
Sbjct  61    PVQRNVYDQNGKSCVSRETMLDPTAVFALLFGSELFEDYIGHLSVASMASSELVSEND--  118

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             + +KL ++++ VQ+EREEKLA ILK+ L  YV+G +  F    E+E   LS AA+G ++L
Sbjct  119   NPEKLHDRLKGVQKEREEKLARILKDFLQQYVRGDRMGFIRRVESEAEHLSQAAFGAEIL  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
              TIGYIYTRQAA+ELGKKAIYLGVPF+AEW RNKGHF KSQ+TAA GAF L+QLQED++R
Sbjct  179   QTIGYIYTRQAAQELGKKAIYLGVPFMAEWVRNKGHFWKSQLTAAKGAFQLLQLQEDVRR  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             Q   +G+  E ++E +++ +++ +++SLWKLNV DIE TL  VCQ+VLQ+ NVKKEEL+ 
Sbjct  239   QFKMDGSGPENDVESHLRLNRETLMNSLWKLNVVDIEVTLLHVCQLVLQEGNVKKEELKK  298

Query  876   RAKGLKTLGKVFQRVKSVNGNETET  802
             RA  LK LGKVF+R K V  ++ +T
Sbjct  299   RAMALKILGKVFEREKCVGTSKKKT  323



>gb|EPS70343.1| hypothetical protein M569_04418 [Genlisea aurea]
Length=227

 Score =   412 bits (1058),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 192/227 (85%), Positives = 215/227 (95%), Gaps = 0/227 (0%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGVSP ATEA+IKKAYYIKAR+VHPDKNPNDPLAAQNFQ+LGEAYQVLSD
Sbjct  1     MVKETEYYDVLGVSPTATEAEIKKAYYIKARKVHPDKNPNDPLAAQNFQILGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
              +QRQAYD YGK+GIS ++IIDP+AIFAMLFGSELFEDYIGQLAMASMASLD+F++GEEF
Sbjct  61    SSQRQAYDTYGKTGISKDSIIDPSAIFAMLFGSELFEDYIGQLAMASMASLDVFSEGEEF  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D KKLQEKMR VQ+EREEKLA IL+++L++YVQG++EEF  HAE EV+RLSNAAYGVDML
Sbjct  121   DPKKLQEKMRTVQKEREEKLAGILRDKLHLYVQGNREEFIHHAELEVTRLSNAAYGVDML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATG  1096
             +TIGYIY RQAAKELGKK +YLGVPF+AEWFRNKGHFIKSQVTAATG
Sbjct  181   STIGYIYARQAAKELGKKVMYLGVPFVAEWFRNKGHFIKSQVTAATG  227



>ref|XP_009588758.1| PREDICTED: chaperone protein dnaJ 10 [Nicotiana tomentosiformis]
Length=385

 Score =   417 bits (1073),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 203/320 (63%), Positives = 256/320 (80%), Gaps = 2/320 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGVSP A+E +I+KAYY+KARQVHPDKNP+DPLAAQ FQ LGEAYQVLSD
Sbjct  1     MVKETEYYDVLGVSPSASEEEIRKAYYLKARQVHPDKNPDDPLAAQRFQELGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR  YD  GKS +S E ++DP A+FA+LFGSELFEDYIG L++ASMAS ++   GE  
Sbjct  61    PVQRNVYDQNGKSCVSRETMLDPTAVFALLFGSELFEDYIGHLSVASMASSELV--GEND  118

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             + +K+ ++++ VQ+EREEKLA +LK+ L  YV+G +  F   AE+E  RLS AA+G ++L
Sbjct  119   NPEKIHDRLKGVQKEREEKLAWLLKDFLQQYVRGDRVGFLRRAESEAERLSQAAFGAEIL  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
              TIGYIYTRQAA+ELGKKAIYLGVPF+AEW RNKGHF KSQ+TAA GAF L+QLQED++R
Sbjct  179   QTIGYIYTRQAAQELGKKAIYLGVPFMAEWVRNKGHFWKSQLTAAKGAFQLLQLQEDVRR  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             Q   +G+  E ++E +++ +++ +++SLWKLNV DIE TL  VCQ+VLQ+ NVKKEEL+ 
Sbjct  239   QFKMDGSGPENDVESHLRLNRETLMNSLWKLNVVDIEVTLLHVCQLVLQEGNVKKEELKK  298

Query  876   RAKGLKTLGKVFQRVKSVNG  817
             RA  LK LGKVF+R K   G
Sbjct  299   RAMALKILGKVFEREKCGQG  318



>ref|XP_011027400.1| PREDICTED: chaperone protein dnaJ 10-like isoform X1 [Populus 
euphratica]
Length=384

 Score =   417 bits (1072),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 203/330 (62%), Positives = 256/330 (78%), Gaps = 4/330 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKE+EYYDVLGVSP A+E +I+KAYY+KARQVHPDKNP+DP AA+ FQVLGEAYQVLSD
Sbjct  1     MVKESEYYDVLGVSPSASEEEIRKAYYLKARQVHPDKNPDDPQAAERFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR AYD  GK  IS E ++DP A+FA+LFGSELFEDY+G L++ SMAS ++ +  E  
Sbjct  61    PVQRDAYDRNGKYSISRETMLDPTAVFALLFGSELFEDYVGHLSVTSMASSELAS--ESG  118

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNA--AYGVD  1243
             +  K+ EK++ VQ+EREEKLA  LK+ LN Y QG +  F   AE+E  RLS+A  A+GVD
Sbjct  119   NPDKVHEKLKAVQKEREEKLARFLKDFLNQYAQGDRIGFLRRAESEAKRLSDADTAFGVD  178

Query  1242  MLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDM  1063
             +L+TIGYIY+RQAA+ELGKKAIYLGVPF+AEW RNKGHF KSQ+TAA GAF L+QLQEDM
Sbjct  179   ILHTIGYIYSRQAAQELGKKAIYLGVPFLAEWVRNKGHFWKSQITAAKGAFQLLQLQEDM  238

Query  1062  KRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEEL  883
             +RQ   +G+    ++E ++ S+K  +++SLWKLNV DIE T+  VCQMVL++NNV+KEEL
Sbjct  239   RRQFKMDGSGPGSDVESHLLSNKDTLMNSLWKLNVVDIEITVIHVCQMVLKENNVRKEEL  298

Query  882   RARAKGLKTLGKVFQRVKSVNGNETETSAN  793
             +ARA  LK LG++FQ  +      T    N
Sbjct  299   KARALALKILGRIFQHERQSRNGATSKGKN  328



>ref|XP_007161391.1| hypothetical protein PHAVU_001G064900g [Phaseolus vulgaris]
 gb|ESW33385.1| hypothetical protein PHAVU_001G064900g [Phaseolus vulgaris]
Length=382

 Score =   417 bits (1071),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 204/314 (65%), Positives = 251/314 (80%), Gaps = 3/314 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYD+LG++P A+E QI+KAYY KA +VHPDKNPNDP AA+NFQ+LGEAYQVLSD
Sbjct  1     MVKETEYYDILGITPSASEDQIRKAYYHKAMRVHPDKNPNDPRAAENFQILGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR AY+  GK  +S E ++DP A+FA+LFGSELFEDYIG LA+ASMAS ++  + E  
Sbjct  61    PVQRIAYNQNGKHSVSRETMLDPMAVFALLFGSELFEDYIGHLAVASMASSELADETE--  118

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D  KL EK++ VQREREEKL  ILK+ L  YV+G K+ F   AE+E  RLS AA+GVDML
Sbjct  119   DPDKLNEKLKAVQREREEKLVRILKDYLAQYVRGDKKGFFLRAESEARRLSRAAFGVDML  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             +TIGYIY+RQAA+ELGKKAIYLGVPF+AEW RNKGHF KSQ TAA GA+ LIQLQED+++
Sbjct  179   HTIGYIYSRQAAQELGKKAIYLGVPFLAEWVRNKGHFWKSQFTAAKGAYQLIQLQEDIRK  238

Query  1056  QLSAEGNYT-eeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELR  880
             Q   +G+   E +++ +++ +K  +I SLWKLNV DIE TL  VCQMVL++NNVKKEEL+
Sbjct  239   QFKMDGSSVPENDVDSHIRLNKDTLISSLWKLNVVDIEVTLVHVCQMVLRENNVKKEELK  298

Query  879   ARAKGLKTLGKVFQ  838
              RA  LK LGK+FQ
Sbjct  299   VRATALKILGKIFQ  312



>ref|XP_008348728.1| PREDICTED: chaperone protein dnaJ 10-like [Malus domestica]
Length=385

 Score =   417 bits (1071),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 202/323 (63%), Positives = 253/323 (78%), Gaps = 2/323 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVL V+P A+E +I+KAYY+KA+QVHPDKNPNDP AA+ FQVLGEAYQVLSD
Sbjct  1     MVKETEYYDVLSVTPSASEEEIRKAYYLKAKQVHPDKNPNDPQAAERFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR AYD  GK  IS + ++DP A+FA LFGSELFEDY G +A+ASMAS  +  +G+  
Sbjct  61    PVQRDAYDRNGKHCISRDTMLDPTAVFAFLFGSELFEDYXGHVAVASMASSQLAGEGD--  118

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
               +K+ +K++ VQ+EREEKLA  LK  LN YV G KE F  HAE+E  RLS+AA+GVDML
Sbjct  119   STEKVHDKLKAVQKEREEKLANSLKGFLNQYVLGDKEGFLEHAESEAKRLSDAAFGVDML  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             +TIGYIY+RQAA+ELGKK I+LGVPF+AEW RNKGHF KSQ+TAA GAF L+QLQE+++R
Sbjct  179   HTIGYIYSRQAAQELGKKTIFLGVPFVAEWVRNKGHFWKSQMTAAKGAFQLLQLQEEIRR  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             Q   +G+  E + E +++ +K  +++SLWKLNV DIE TL  VCQMVL++NNV+KEEL+A
Sbjct  239   QFKMDGSGPENDAESHIRLNKDTLLNSLWKLNVVDIEVTLLHVCQMVLRENNVRKEELKA  298

Query  876   RAKGLKTLGKVFQRVKSVNGNET  808
             RA  LK LG++FQ  K      T
Sbjct  299   RALALKHLGRIFQEEKQTRNGGT  321



>ref|XP_008373287.1| PREDICTED: chaperone protein dnaJ 10 [Malus domestica]
Length=384

 Score =   416 bits (1070),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 203/323 (63%), Positives = 253/323 (78%), Gaps = 2/323 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVL V+P A+E +I+KAYY+KARQVHPDKNPNDP AA+ FQVLGEAYQVLSD
Sbjct  1     MVKETEYYDVLXVTPSASEEEIRKAYYLKARQVHPDKNPNDPQAAERFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR AYD  GK  IS E ++DP A+FA LFGSELFEDYIG LA+ASMAS  +  +G+  
Sbjct  61    PVQRDAYDRNGKYCISRETMLDPTAVFAFLFGSELFEDYIGHLAVASMASSQLAGEGD--  118

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
               +K+ +K++ VQ+EREEKLA  LK  LN YV G KE F  HAE+E  RLS+AA+GVDML
Sbjct  119   SPEKVHDKLKXVQKEREEKLANSLKXFLNQYVLGDKEGFLQHAESEAKRLSDAAFGVDML  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             +TIGY+Y+RQAA+ELGKK I+LGVPF+AEW RNKGHF KSQ+TAA GAF L+QLQE+ +R
Sbjct  179   HTIGYVYSRQAAQELGKKTIFLGVPFVAEWVRNKGHFWKSQMTAAKGAFQLLQLQEETRR  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             Q   +G+  E ++E +++ +K  +++SLWKLNV DIE TL  VCQMVL++ NV++EEL+A
Sbjct  239   QFKKDGSGPENDVESHIRLNKDTLLNSLWKLNVVDIEVTLLHVCQMVLRETNVRREELKA  298

Query  876   RAKGLKTLGKVFQRVKSVNGNET  808
             RA  LK LG++FQ  K      T
Sbjct  299   RALALKHLGRIFQEEKQTRNGGT  321



>ref|XP_009342837.1| PREDICTED: chaperone protein dnaJ 10-like [Pyrus x bretschneideri]
Length=385

 Score =   416 bits (1069),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 201/323 (62%), Positives = 254/323 (79%), Gaps = 2/323 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVL V+P A+E +I+KAYY+KA+QVHPDKNPNDP AA+ FQVLGEAYQVLSD
Sbjct  1     MVKETEYYDVLSVTPSASEEEIRKAYYLKAKQVHPDKNPNDPQAAERFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR AYD  GK  IS E ++DP A+FA LFGSELFEDYIG +A+ASMAS  +  +G+  
Sbjct  61    PVQRDAYDRNGKHCISRETMLDPTAVFAFLFGSELFEDYIGHVAVASMASSQLAGEGD--  118

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
               +K+ +K++ VQ+EREEKLA  LK  LN YV G K  F  HAE+E  RLS+AA+GVDML
Sbjct  119   STEKVHDKLKAVQKEREEKLASSLKGLLNQYVLGDKAGFLEHAESEAKRLSDAAFGVDML  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             +TIGY+Y+RQAA+ELGKK I+LGVPF+AEW RNKGHF KSQ+TAA GA+ L+QLQE+++R
Sbjct  179   HTIGYVYSRQAAQELGKKTIFLGVPFVAEWVRNKGHFWKSQMTAAKGAYQLLQLQEEIRR  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             Q   +G+  E ++E +++ +K  +++SLWKLNV DIE TL  VCQMVL++NNV+KEEL+A
Sbjct  239   QFKMDGSGPENDVESHIRLNKDTLLNSLWKLNVVDIEVTLLHVCQMVLRENNVRKEELKA  298

Query  876   RAKGLKTLGKVFQRVKSVNGNET  808
             RA  LK LG++FQ  K      T
Sbjct  299   RALALKHLGRIFQEEKQTRNGGT  321



>ref|XP_010999849.1| PREDICTED: chaperone protein dnaJ 10-like isoform X2 [Populus 
euphratica]
Length=385

 Score =   416 bits (1068),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 203/322 (63%), Positives = 255/322 (79%), Gaps = 4/322 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGVSP A+E +I+KAYY+KARQVHPDKN +DPLAA+ FQVLGEAYQVLSD
Sbjct  1     MVKETEYYDVLGVSPSASEEEIRKAYYLKARQVHPDKNQDDPLAAERFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR AYD  GK  IS E ++DP A+FA+LFGSELFEDY+G L++ SMAS ++   GE  
Sbjct  61    PVQRDAYDRNGKYCISRETMLDPTAVFALLFGSELFEDYVGHLSVTSMASSEL--AGESD  118

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLS--NAAYGVD  1243
             +  K+ EK++ VQ+EREEKLA  LK+ LN Y +G +  F  HAE+E  RLS  + A+GVD
Sbjct  119   NPDKVHEKLKAVQKEREEKLARFLKDFLNQYAKGDRIGFLRHAESEAKRLSVADTAFGVD  178

Query  1242  MLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDM  1063
             +L+TIG IY+RQAA+ELGKKAIYLGVPF+AEW RNKGHF KSQ+TAA GAF L+QLQEDM
Sbjct  179   ILHTIGNIYSRQAAQELGKKAIYLGVPFVAEWARNKGHFWKSQITAAKGAFQLLQLQEDM  238

Query  1062  KRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEEL  883
             +RQ   + +    ++E ++ S+K  +++SLWKLNV DIE T+  VCQMVL++NN++KEEL
Sbjct  239   RRQFKMDRSDPGNDVESHLLSNKDTLMNSLWKLNVVDIEITVIHVCQMVLKENNIRKEEL  298

Query  882   RARAKGLKTLGKVFQRVKSVNG  817
             RARA  LK LGK+FQ  ++ NG
Sbjct  299   RARALALKILGKIFQEKQAQNG  320



>ref|XP_009368402.1| PREDICTED: chaperone protein dnaJ 10-like [Pyrus x bretschneideri]
Length=384

 Score =   415 bits (1067),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 202/323 (63%), Positives = 251/323 (78%), Gaps = 2/323 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVL V+P A+E +I+KAYY+KARQVHPDKNPNDP AA+ FQVLGEAYQVLSD
Sbjct  1     MVKETEYYDVLSVTPSASEEEIRKAYYLKARQVHPDKNPNDPQAAERFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR AYD  GK  IS E ++DP A+FA+LFGSELFEDYIG LA+ASMAS  +  +GE  
Sbjct  61    PVQRDAYDRKGKYCISRETMLDPTAVFALLFGSELFEDYIGDLAVASMASSQL--EGEGD  118

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
               +K+ +K++ VQ+EREEKLA  LK  LN Y  G KE F  HAE+E  RLS+AA+GV ML
Sbjct  119   SPEKVHDKLKAVQKEREEKLANSLKGFLNQYALGDKEGFLQHAESEAKRLSDAAFGVHML  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             +TIGY+Y+RQAA+ELGKK I+LGVPF+AEW RNKGHF KS +TAA GAF L+QLQE+ +R
Sbjct  179   HTIGYVYSRQAAQELGKKTIFLGVPFVAEWVRNKGHFWKSHMTAAKGAFQLLQLQEETRR  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             Q   +G+  E ++  +++ +K  +++SLWKLNV DIE TL  VCQMVL++NNV+KEEL+A
Sbjct  239   QFKMDGSGPENDVASHIRLNKDTLLNSLWKLNVVDIEVTLLHVCQMVLRENNVRKEELKA  298

Query  876   RAKGLKTLGKVFQRVKSVNGNET  808
             RA  LK LG++FQ  K      T
Sbjct  299   RALALKHLGRIFQEEKQTRNGGT  321



>ref|XP_008643951.1| PREDICTED: uncharacterized protein LOC100381679 isoform X1 [Zea 
mays]
 gb|ACR37587.1| unknown [Zea mays]
 gb|AFW71793.1| hypothetical protein ZEAMMB73_340797 [Zea mays]
Length=386

 Score =   415 bits (1067),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 201/316 (64%), Positives = 250/316 (79%), Gaps = 2/316 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             M KETEYYDVLGV P A++ +I+KAYYIKARQVHPDKNPNDP AA+NFQ LGEAYQVLSD
Sbjct  1     MAKETEYYDVLGVCPAASDEEIRKAYYIKARQVHPDKNPNDPHAAENFQALGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR+AYD YGK+ +S E I+D   +F +LFGSELFEDYIG LAMA+MAS ++ +D +  
Sbjct  61    PLQRKAYDGYGKNSVSRENILDGTVVFTLLFGSELFEDYIGHLAMATMASSELTSDNDT-  119

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
               +KLQ++++ VQREREEKLA  LK  L+ YV+G KE F   AEAE  +LS  + G+D+L
Sbjct  120   -PEKLQDRLKNVQREREEKLARFLKEFLSQYVRGDKEGFANRAEAEAKKLSCTSSGLDIL  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
              TIGY+Y+RQAAKELGKKA+YLGVPF+AEW RNKGH  KSQ+TAA GA  L+QLQE+  R
Sbjct  179   RTIGYVYSRQAAKELGKKAMYLGVPFVAEWVRNKGHLWKSQITAAKGALQLLQLQEEACR  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             Q S +GN TE++++  M+ +K +M+ SLWKLNV DIE TL  VC+MVL +NNVKK++L+A
Sbjct  239   QSSKDGNATEQDVDLQMRMNKDLMMSSLWKLNVVDIEMTLLHVCEMVLSENNVKKDDLKA  298

Query  876   RAKGLKTLGKVFQRVK  829
             RA  LK LGK+F R K
Sbjct  299   RATALKFLGKIFMREK  314



>ref|XP_006390129.1| hypothetical protein EUTSA_v10018713mg [Eutrema salsugineum]
 gb|ESQ27415.1| hypothetical protein EUTSA_v10018713mg [Eutrema salsugineum]
Length=380

 Score =   415 bits (1066),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 202/321 (63%), Positives = 253/321 (79%), Gaps = 3/321 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKET YYDVLG++P A+E +I+KAYYIKARQVHPDKNP DPLAA+ FQVLGEAYQVLSD
Sbjct  1     MVKETVYYDVLGITPSASEEEIRKAYYIKARQVHPDKNPGDPLAAEKFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P  R+AYD  GK     E ++DP A+FA+LFGSELFEDYIG LA+ASMAS  + ++ E  
Sbjct  61    PVHREAYDRTGKFSAPKETMVDPTAVFALLFGSELFEDYIGHLAVASMASTQMASEIENP  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D  ++ EK++ VQREREE LA  LK+ LN YV G KE FR  AE+E  RLS+AA+G DML
Sbjct  121   D--QIHEKLKAVQREREENLARFLKDFLNQYVHGDKEGFRHRAESEAKRLSDAAFGADML  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             +TIGY+YTRQAA+ELGK+ +YLGVPF+AEW RNKGH  KSQ++AA GAF L+QLQE+  R
Sbjct  179   HTIGYVYTRQAAQELGKRVLYLGVPFVAEWVRNKGHSWKSQISAAKGAFQLLQLQEESNR  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             +L  +G     +LE ++Q++K+ ++ SLWKLNV DIE TL  VCQMVL++NN++KEEL++
Sbjct  239   RLKRDGTGPANDLESHIQTNKETLMGSLWKLNVVDIEVTLLHVCQMVLRENNLRKEELKS  298

Query  876   RAKGLKTLGKVFQRVK-SVNG  817
             RA  LK LGK+FQ+ K S NG
Sbjct  299   RAVALKILGKIFQQEKQSRNG  319



>ref|XP_010999848.1| PREDICTED: chaperone protein dnaJ 10-like isoform X1 [Populus 
euphratica]
Length=386

 Score =   415 bits (1067),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 204/330 (62%), Positives = 255/330 (77%), Gaps = 4/330 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGVSP A+E +I+KAYY+KARQVHPDKN +DPLAA+ FQVLGEAYQVLSD
Sbjct  1     MVKETEYYDVLGVSPSASEEEIRKAYYLKARQVHPDKNQDDPLAAERFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR AYD  GK  IS E ++DP A+FA+LFGSELFEDY+G L++ SMAS ++   GE  
Sbjct  61    PVQRDAYDRNGKYCISRETMLDPTAVFALLFGSELFEDYVGHLSVTSMASSEL--AGESD  118

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLS--NAAYGVD  1243
             +  K+ EK++ VQ+EREEKLA  LK+ LN Y +G +  F  HAE+E  RLS  + A+GVD
Sbjct  119   NPDKVHEKLKAVQKEREEKLARFLKDFLNQYAKGDRIGFLRHAESEAKRLSVADTAFGVD  178

Query  1242  MLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDM  1063
             +L+TIG IY+RQAA+ELGKKAIYLGVPF+AEW RNKGHF KSQ+TAA GAF L+QLQEDM
Sbjct  179   ILHTIGNIYSRQAAQELGKKAIYLGVPFVAEWARNKGHFWKSQITAAKGAFQLLQLQEDM  238

Query  1062  KRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEEL  883
             +RQ   + +    ++E ++ S+K  +++SLWKLNV DIE T+  VCQMVL++NN++KEEL
Sbjct  239   RRQFKMDRSDPGNDVESHLLSNKDTLMNSLWKLNVVDIEITVIHVCQMVLKENNIRKEEL  298

Query  882   RARAKGLKTLGKVFQRVKSVNGNETETSAN  793
             RARA  LK LGK+FQ+ K      T    N
Sbjct  299   RARALALKILGKIFQQEKQAQNGATSKGKN  328



>ref|XP_003544725.1| PREDICTED: chaperone protein dnaJ 10-like [Glycine max]
Length=382

 Score =   415 bits (1066),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 204/314 (65%), Positives = 253/314 (81%), Gaps = 3/314 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYD+LGVSP A+  QI+KAYY KA QVHPDKNPNDP AA+ FQ+LGEAYQVLSD
Sbjct  1     MVKETEYYDILGVSPSASYDQIRKAYYHKAMQVHPDKNPNDPHAAEKFQILGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR AY+  GK  +S E ++DP A+FA+LFGSELFEDYIG LA+ASMAS ++  DG E 
Sbjct  61    PVQRNAYNQNGKHSVSRETMLDPMAVFALLFGSELFEDYIGHLAVASMASSEL-ADGTE-  118

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D  KL EK++ VQ+EREEKLA+IL++ L  YV+G K+ F   AE+E  RLS AA+GVDML
Sbjct  119   DPDKLNEKLKAVQKEREEKLAKILRDYLGQYVRGDKKGFFQRAESEARRLSRAAFGVDML  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             +TIGYIY+RQAA+ELGKKAIYLGVPF+AEW RNKGHF KSQ TAA GA+ L+QLQ+D+++
Sbjct  179   HTIGYIYSRQAAQELGKKAIYLGVPFLAEWVRNKGHFWKSQFTAAKGAYQLLQLQDDIRK  238

Query  1056  QLSAEGNYT-eeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELR  880
             Q   +G+   E +++ +++ +K  +++SLWKLNV DIE TL  VCQMVL++NNVKKEELR
Sbjct  239   QFKMDGSSVPENDVDSHIRLNKDTLMNSLWKLNVVDIEVTLVHVCQMVLKENNVKKEELR  298

Query  879   ARAKGLKTLGKVFQ  838
              RA  LK LGK+FQ
Sbjct  299   LRATALKILGKIFQ  312



>emb|CBI19931.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   416 bits (1068),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 210/351 (60%), Positives = 260/351 (74%), Gaps = 25/351 (7%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGVSP A+E +I+KAYY+KA+QVHPDKNP+DPLAA+ FQVLGEAYQVLSD
Sbjct  1     MVKETEYYDVLGVSPTASEEEIRKAYYLKAKQVHPDKNPSDPLAAERFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR AYD  GK  IS E ++DP A+FA+LFGSELFE+YIG LA+ASMAS ++    EE 
Sbjct  61    PMQRDAYDRNGKYCISKETMLDPTAVFALLFGSELFENYIGHLAVASMASSEL---AEES  117

Query  1416  D-AKKLQEKMRV---------------------VQREREEKLAEILKNRLNVYVQGSKEE  1303
             D  +KL +K++                      VQ+EREE+LA +LK+ LN YVQG K  
Sbjct  118   DNPEKLHDKLKACLLGFCALTVCINLLLCIREAVQKEREERLARLLKDFLNQYVQGDKRG  177

Query  1302  FRAHAEAEVSRLSNAAYGVDMLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFI  1123
             F   AE+E  RLS+A +G D+L+TIGY+Y RQAA+ELGKK IYLGVPF+AEW RNKGHF 
Sbjct  178   FLHCAESEAKRLSDAVFGADILHTIGYVYARQAAQELGKKVIYLGVPFLAEWVRNKGHFW  237

Query  1122  KSQVTAATGAFALIQLQEDMKRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIET  943
             KSQ+TAA GAF L+QLQED++RQ   +G+  E ++E +++ +K  +++SLWKLNV DIE 
Sbjct  238   KSQITAAKGAFQLLQLQEDIRRQFKMDGSGPENDVESHIRMNKDTLMNSLWKLNVVDIEV  297

Query  942   TLSRVCQMVLQDNNVKKEELRARAKGLKTLGKVFQRVKSVNGNETETSANT  790
             TL  VCQ+VLQ+NNVKKEEL+ARA  LK LGK+FQR K      T  S N 
Sbjct  298   TLIHVCQLVLQENNVKKEELKARALALKLLGKIFQREKLARSGGTSKSRNV  348



>emb|CDP11984.1| unnamed protein product [Coffea canephora]
Length=399

 Score =   415 bits (1067),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 201/331 (61%), Positives = 257/331 (78%), Gaps = 17/331 (5%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQV----------  1627
             MVKETEYYDVLGV P A+E +I+KAYY+KARQVHPDKNPNDP AA+ FQ           
Sbjct  1     MVKETEYYDVLGVGPSASEQEIRKAYYLKARQVHPDKNPNDPQAAERFQARAFSNLIIYL  60

Query  1626  --LGEAYQVLSDPAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASM  1453
               LGEAYQ+LSDP QR AYD +GK+ +S E ++DP A+FA+LFGSELFEDYIG L++ASM
Sbjct  61    QELGEAYQILSDPVQRDAYDHHGKNCVSRETMLDPTAVFALLFGSELFEDYIGHLSVASM  120

Query  1452  ASLDIFTDGEEFDAKKLQEK---MRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEA  1282
             AS ++   GE  +++++  +   M+ VQREREEKLA  LK+ L  YV+G KE F  HAE+
Sbjct  121   ASFEL--AGENDNSEQVHNRLKAMKTVQREREEKLARTLKDLLYQYVRGDKEGFLRHAES  178

Query  1281  EVSRLSNAAYGVDMLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAA  1102
             E  RLS AA+G D+L+TIGY+YTRQAA+ELGKKAIYLG+PF+AEWFR+KGHF KSQ+TAA
Sbjct  179   EADRLSRAAFGADILDTIGYVYTRQAAQELGKKAIYLGMPFVAEWFRHKGHFWKSQITAA  238

Query  1101  TGAFALIQLQEDMKRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQ  922
              GAF L+QLQED++RQ   +G+  E ++E +++ +K ++++S+WKLNV DIE TL  VCQ
Sbjct  239   KGAFQLLQLQEDVRRQFKMDGSGPENDIESHLKHNKSVLMNSIWKLNVVDIEVTLLHVCQ  298

Query  921   MVLQDNNVKKEELRARAKGLKTLGKVFQRVK  829
             MVLQ+ NV+KEEL+ RA  LK LGK+FQ  K
Sbjct  299   MVLQETNVRKEELKTRAVALKILGKIFQNAK  329



>ref|XP_009360683.1| PREDICTED: chaperone protein dnaJ 10-like [Pyrus x bretschneideri]
Length=385

 Score =   414 bits (1065),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 201/323 (62%), Positives = 254/323 (79%), Gaps = 2/323 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVL V+P A+E +I+KAYY+KA+QVHPDKNPNDP AA+ FQVLGEAYQVLSD
Sbjct  1     MVKETEYYDVLSVTPSASEEEIRKAYYLKAKQVHPDKNPNDPQAAERFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR AYD  GK  IS E ++DP A+FA LFGSELFEDYIG +A+ASMAS     +G+  
Sbjct  61    PVQRAAYDRNGKHCISRETMLDPTAVFAFLFGSELFEDYIGHVAVASMASSQFAGEGD--  118

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
               +K+ +K++ VQ+EREEKLA  LK  LN YV G KE F  HAE+E  RLS+AA+GVDML
Sbjct  119   STEKVHDKLKAVQKEREEKLANSLKGFLNQYVLGDKEGFLEHAESEAKRLSDAAFGVDML  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             +TIGY+Y+RQAA+ELGKK I+LGVPF+AEW RNKGHF KSQ+TAA GA+ L+QLQE+++R
Sbjct  179   HTIGYVYSRQAAQELGKKTIFLGVPFVAEWVRNKGHFWKSQMTAAKGAYQLLQLQEEIRR  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             Q   + +  E ++E +++ +K  +++SLWKLNV DIE TL  VCQMVL++NNV+KEEL+A
Sbjct  239   QFKMDRSGPENDVESHIRLNKDTLLNSLWKLNVVDIEVTLLHVCQMVLRENNVRKEELKA  298

Query  876   RAKGLKTLGKVFQRVKSVNGNET  808
             RA  LK LG++FQ  K +    T
Sbjct  299   RALALKHLGRIFQEEKQMRNGGT  321



>ref|XP_008441572.1| PREDICTED: chaperone protein dnaJ 10 isoform X1 [Cucumis melo]
Length=425

 Score =   416 bits (1068),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 200/331 (60%), Positives = 255/331 (77%), Gaps = 2/331 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MV +TEYYDVLGV P A+E +I+KAYY KA+QVHPDKN NDP AA+ FQ LGEAYQVLSD
Sbjct  41    MVNDTEYYDVLGVRPSASEEEIRKAYYHKAKQVHPDKNLNDPQAAERFQALGEAYQVLSD  100

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
               QR AYD  GK  ++ E+++DP A+FA+LFGSELFE+YIG LA+ASMAS ++  + E  
Sbjct  101   AIQRDAYDRNGKHSVTRESMLDPTAVFALLFGSELFENYIGHLAVASMASFEL--ESESG  158

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             + ++L +K++ +QREREEKLA IL+  LN YVQG K+ F  HAE+E  RLS+AA+GV++L
Sbjct  159   NPERLHDKLKAIQREREEKLARILEGFLNQYVQGDKDGFLQHAESEAKRLSDAAFGVNIL  218

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             +TIGYIY+RQAA+ELGK+AIYLGVPF+AEWFRNKGHF KSQ+TAA GAF L+QLQ+D+ R
Sbjct  219   HTIGYIYSRQAAQELGKRAIYLGVPFVAEWFRNKGHFWKSQITAAKGAFQLLQLQDDISR  278

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             Q   +G     ++E ++Q++K   ++SLWKLNV DIE TL  VCQMVL DN +KKEEL+A
Sbjct  279   QFKMDGTGPGTDIESHIQANKDTFLNSLWKLNVVDIELTLINVCQMVLHDNTIKKEELKA  338

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPV  784
             RA  LK LGK+FQ+ K    + T       V
Sbjct  339   RALALKVLGKIFQQEKQAQDSGTSRKKGASV  369



>ref|XP_002453982.1| hypothetical protein SORBIDRAFT_04g022680 [Sorghum bicolor]
 gb|EES06958.1| hypothetical protein SORBIDRAFT_04g022680 [Sorghum bicolor]
Length=390

 Score =   414 bits (1065),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 202/316 (64%), Positives = 248/316 (78%), Gaps = 2/316 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             M KETEYYDVLGV P A++ +I+KAYYIKARQVHPDKNPNDP AA+ FQ LGEAYQVLSD
Sbjct  1     MAKETEYYDVLGVCPAASDDEIRKAYYIKARQVHPDKNPNDPHAAEKFQALGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR+AYD YGK+ IS E I+D   +F +LFGSELFEDYIG LAMA+MAS ++  D +  
Sbjct  61    PLQRKAYDGYGKNSISRENILDGTVVFTLLFGSELFEDYIGHLAMATMASSELTNDNDS-  119

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
               +KLQ++++ VQREREEKLA  LK  L+ YV+G KE F   AEAE  RLS+   G+D+L
Sbjct  120   -PEKLQDRLKNVQREREEKLARFLKEFLSQYVRGDKEGFANRAEAEAKRLSSTTSGLDIL  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
              TIGYIY+RQAAKELGKKA+YLGVPF+AEW RNKGH  KSQ+TAA GA  L+QLQE+  R
Sbjct  179   RTIGYIYSRQAAKELGKKAVYLGVPFVAEWVRNKGHLWKSQITAAKGALQLLQLQEEACR  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             Q + + N TE++++  M+ +K +M+ SLWKLNV DIE TL  VC+MVL +NNVKKE+L+A
Sbjct  239   QSNKDSNATEQDVDLQMRMNKDLMMSSLWKLNVVDIEMTLLHVCEMVLYENNVKKEDLKA  298

Query  876   RAKGLKTLGKVFQRVK  829
             RA  L+ LGK+FQR K
Sbjct  299   RATALRILGKIFQREK  314



>ref|XP_008441573.1| PREDICTED: chaperone protein dnaJ 10 isoform X2 [Cucumis melo]
Length=424

 Score =   415 bits (1066),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 197/313 (63%), Positives = 250/313 (80%), Gaps = 2/313 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MV +TEYYDVLGV P A+E +I+KAYY KA+QVHPDKN NDP AA+ FQ LGEAYQVLSD
Sbjct  41    MVNDTEYYDVLGVRPSASEEEIRKAYYHKAKQVHPDKNLNDPQAAERFQALGEAYQVLSD  100

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
               QR AYD  GK  ++ E+++DP A+FA+LFGSELFE+YIG LA+ASMAS ++  + E  
Sbjct  101   AIQRDAYDRNGKHSVTRESMLDPTAVFALLFGSELFENYIGHLAVASMASFEL--ESESG  158

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             + ++L +K++ +QREREEKLA IL+  LN YVQG K+ F  HAE+E  RLS+AA+GV++L
Sbjct  159   NPERLHDKLKAIQREREEKLARILEGFLNQYVQGDKDGFLQHAESEAKRLSDAAFGVNIL  218

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             +TIGYIY+RQAA+ELGK+AIYLGVPF+AEWFRNKGHF KSQ+TAA GAF L+QLQ+D+ R
Sbjct  219   HTIGYIYSRQAAQELGKRAIYLGVPFVAEWFRNKGHFWKSQITAAKGAFQLLQLQDDISR  278

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             Q   +G     ++E ++Q++K   ++SLWKLNV DIE TL  VCQMVL DN +KKEEL+A
Sbjct  279   QFKMDGTGPGTDIESHIQANKDTFLNSLWKLNVVDIELTLINVCQMVLHDNTIKKEELKA  338

Query  876   RAKGLKTLGKVFQ  838
             RA  LK LGK+FQ
Sbjct  339   RALALKVLGKIFQ  351



>ref|XP_004952804.1| PREDICTED: chaperone protein dnaJ 10-like isoform X2 [Setaria 
italica]
Length=386

 Score =   413 bits (1062),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 201/316 (64%), Positives = 249/316 (79%), Gaps = 2/316 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             M KE EYYDVLGV P A++ +I+KAYYIKARQVHPDKNPNDP AA+ FQ LGEAYQVLSD
Sbjct  1     MAKEMEYYDVLGVCPAASDDEIRKAYYIKARQVHPDKNPNDPQAAEKFQALGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR+AYD YGK+ IS + I+D   +F +LFGSELFEDY+G LAMA+MAS ++ +D +  
Sbjct  61    PLQRKAYDGYGKNSISRDNILDGTVVFTLLFGSELFEDYVGHLAMATMASTEMTSDND--  118

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             + +KLQ+++R VQREREEKLA  LK  L+ YV+G KE F   AEAE  RLS  + G+D+L
Sbjct  119   NPEKLQDRLRNVQREREEKLARFLKEFLSQYVRGDKEGFANRAEAEAKRLSTTSSGLDIL  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
              TIGY+Y+RQAAKELGKKA+YLGVPF+AEW RNKGH  KSQ+TAA GA  L+QLQE+  R
Sbjct  179   RTIGYVYSRQAAKELGKKAMYLGVPFVAEWVRNKGHLWKSQITAAKGALQLLQLQEEACR  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             Q S +G  TE++++  M+ +K +M+ SLWKLNV DIE TL  VC+MVL +NNVKKE+L+A
Sbjct  239   QSSKDGIATEQDVDLQMRMNKDLMMSSLWKLNVVDIEMTLLHVCEMVLYENNVKKEDLKA  298

Query  876   RAKGLKTLGKVFQRVK  829
             RA  LK LGK+FQR K
Sbjct  299   RATALKILGKIFQREK  314



>ref|XP_003541870.1| PREDICTED: chaperone protein dnaJ 10-like [Glycine max]
Length=382

 Score =   413 bits (1061),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 201/314 (64%), Positives = 252/314 (80%), Gaps = 3/314 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYD+LGVSP A++ QI+KAYY KA QVHPDKNPNDP AA+ FQ+LGEAYQ+LS 
Sbjct  1     MVKETEYYDILGVSPSASDDQIRKAYYHKAMQVHPDKNPNDPHAAEKFQILGEAYQILSV  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR AY+  GK  +S E ++DP A+FA+LFGSELFEDYIG LA+ASMAS ++  + E  
Sbjct  61    PVQRNAYNQNGKHSVSRETMLDPMAVFALLFGSELFEDYIGHLAVASMASSELADETE--  118

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D  KL EK++ VQ+EREEKLA IL++ L  YV+G+K+ F   AE+E  RLS AA+GVDML
Sbjct  119   DPDKLNEKLKAVQKEREEKLARILRDYLGQYVRGNKKGFFQRAESETRRLSRAAFGVDML  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             +TIGYIY+RQAA+ELGKKAIYLGVPF+AEW RNKGHF KSQ TAA GA+ L+QLQ+DM++
Sbjct  179   HTIGYIYSRQAAQELGKKAIYLGVPFLAEWVRNKGHFWKSQFTAAKGAYQLLQLQDDMRK  238

Query  1056  QLSAEGNYT-eeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELR  880
             Q   +G+   E +++ +++ +K  +++SLWKLNV DIE TL  VCQMVL++NNVKKEELR
Sbjct  239   QFKMDGSSVPENDVDSHIRLNKDTLMNSLWKLNVVDIEVTLVHVCQMVLRENNVKKEELR  298

Query  879   ARAKGLKTLGKVFQ  838
              RA  LK LGK+FQ
Sbjct  299   LRATALKILGKIFQ  312



>ref|XP_004952803.1| PREDICTED: chaperone protein dnaJ 10-like isoform X1 [Setaria 
italica]
Length=384

 Score =   413 bits (1061),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 201/316 (64%), Positives = 249/316 (79%), Gaps = 2/316 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             M KE EYYDVLGV P A++ +I+KAYYIKARQVHPDKNPNDP AA+ FQ LGEAYQVLSD
Sbjct  1     MAKEMEYYDVLGVCPAASDDEIRKAYYIKARQVHPDKNPNDPQAAEKFQALGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR+AYD YGK+ IS + I+D   +F +LFGSELFEDY+G LAMA+MAS ++ +D +  
Sbjct  61    PLQRKAYDGYGKNSISRDNILDGTVVFTLLFGSELFEDYVGHLAMATMASTEMTSDND--  118

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             + +KLQ+++R VQREREEKLA  LK  L+ YV+G KE F   AEAE  RLS  + G+D+L
Sbjct  119   NPEKLQDRLRNVQREREEKLARFLKEFLSQYVRGDKEGFANRAEAEAKRLSTTSSGLDIL  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
              TIGY+Y+RQAAKELGKKA+YLGVPF+AEW RNKGH  KSQ+TAA GA  L+QLQE+  R
Sbjct  179   RTIGYVYSRQAAKELGKKAMYLGVPFVAEWVRNKGHLWKSQITAAKGALQLLQLQEEACR  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             Q S +G  TE++++  M+ +K +M+ SLWKLNV DIE TL  VC+MVL +NNVKKE+L+A
Sbjct  239   QSSKDGIATEQDVDLQMRMNKDLMMSSLWKLNVVDIEMTLLHVCEMVLYENNVKKEDLKA  298

Query  876   RAKGLKTLGKVFQRVK  829
             RA  LK LGK+FQR K
Sbjct  299   RATALKILGKIFQREK  314



>gb|KFK42106.1| hypothetical protein AALP_AA2G211800 [Arabis alpina]
Length=380

 Score =   413 bits (1061),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 202/321 (63%), Positives = 250/321 (78%), Gaps = 3/321 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKET YYDVLGV+P A+E +I+KAYYIKARQVHPDKN  DPLAA+ FQVLGEAYQVLSD
Sbjct  1     MVKETVYYDVLGVTPSASEEEIRKAYYIKARQVHPDKNQCDPLAAEKFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P  R+AYD  GK   S E ++DP A+FA+LFGSELFEDYIG LA+ASMAS  I +D E  
Sbjct  61    PIHREAYDKTGKFSASKETMVDPTAVFALLFGSELFEDYIGHLAVASMASTQIASDIENS  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D  ++ +K++ VQREREE LA  LK+ LN YV G KE F   AE+E  RLS AA+G DML
Sbjct  121   D--QIHDKLKAVQREREENLARFLKDFLNQYVHGDKEGFIHRAESEAKRLSEAAFGADML  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
              TIGY+YTRQAA+ELGK+ +YLGVPF+AEW RNKGH  KSQ++AA GAF L+Q+QE+  R
Sbjct  179   RTIGYVYTRQAAQELGKRVLYLGVPFVAEWLRNKGHSWKSQISAAKGAFQLLQMQEESNR  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             +L  +GN    +LE ++Q++K  ++ SLWKLNV DIE TL  VCQMVL++NN++KE+L++
Sbjct  239   RLKKDGNGLSNDLESHIQTNKDTLMGSLWKLNVVDIEVTLLHVCQMVLRENNLRKEDLKS  298

Query  876   RAKGLKTLGKVFQRVK-SVNG  817
             RA  LK LGK+FQ+ K S NG
Sbjct  299   RATALKILGKIFQQEKQSRNG  319



>ref|XP_010664862.1| PREDICTED: chaperone protein dnaJ 10 isoform X2 [Vitis vinifera]
Length=380

 Score =   412 bits (1060),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 207/330 (63%), Positives = 256/330 (78%), Gaps = 8/330 (2%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGVSP A+E +I+KAYY+KA+QVHPDKNP+DPLAA+ FQVLGEAYQVLSD
Sbjct  1     MVKETEYYDVLGVSPTASEEEIRKAYYLKAKQVHPDKNPSDPLAAERFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR AYD  GK  IS E ++DP A+FA+LFGSELFE+YIG LA+ASMAS ++    EE 
Sbjct  61    PMQRDAYDRNGKYCISKETMLDPTAVFALLFGSELFENYIGHLAVASMASSEL---AEES  117

Query  1416  D-AKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDM  1240
             D  +KL +K++ VQ+EREE+LA +LK+ LN YVQG K  F   AE+E  RLS+A +G D+
Sbjct  118   DNPEKLHDKLKAVQKEREERLARLLKDFLNQYVQGDKRGFLHCAESEAKRLSDAVFGADI  177

Query  1239  LNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMK  1060
             L+TIGY+Y RQAA+ELGKK IYLGVPF+AEW RNKGHF KSQ+TAA GAF L+QLQED++
Sbjct  178   LHTIGYVYARQAAQELGKKVIYLGVPFLAEWVRNKGHFWKSQITAAKGAFQLLQLQEDIR  237

Query  1059  RQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELR  880
             RQ   +G+  E ++E +++ +K  +++SLWKLNV DIE TL      VLQ+NNVKKEEL+
Sbjct  238   RQFKMDGSGPENDVESHIRMNKDTLMNSLWKLNVVDIEVTLIH----VLQENNVKKEELK  293

Query  879   ARAKGLKTLGKVFQRVKSVNGNETETSANT  790
             ARA  LK LGK+FQR K      T  S N 
Sbjct  294   ARALALKLLGKIFQREKLARSGGTSKSRNV  323



>ref|XP_006647373.1| PREDICTED: chaperone protein dnaJ 10-like [Oryza brachyantha]
Length=377

 Score =   411 bits (1057),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 199/316 (63%), Positives = 249/316 (79%), Gaps = 2/316 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             M KETE+YDVLGV P A++  I+KAYYIKARQVHPDKNPNDP AA+ FQ LGEAYQVLSD
Sbjct  1     MAKETEFYDVLGVCPAASDDDIRKAYYIKARQVHPDKNPNDPQAAEKFQALGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR+AYD YGK+ IS E ++D   +FA+LFGSELFEDYIG LAMA+MAS ++ +D +  
Sbjct  61    PLQRKAYDGYGKTSISRENMLDGTVVFALLFGSELFEDYIGHLAMATMASSEMTSDND--  118

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             + +KLQ++++ VQREREEKLA  LK  L+ YV+G KE F   AE+E  RLSN + G+D+L
Sbjct  119   NPEKLQDRLKGVQREREEKLARFLKEFLSQYVRGDKEGFANRAESEAKRLSNTSSGLDIL  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
              TIGY+Y+RQAAKELGKKA+YLGVPF+AEW RNKGH  +SQ+TAA GA  L+QLQE+  R
Sbjct  179   RTIGYVYSRQAAKELGKKAMYLGVPFLAEWVRNKGHLWRSQITAAKGALQLLQLQEEACR  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             Q   +G  TE +++  M+ +K +M+ SLWKLN+ DIE TL  VC+MVL +NNVKKE+L+A
Sbjct  239   QGGKDGLATERDVDLQMRMNKDLMMSSLWKLNIVDIEVTLLHVCEMVLHENNVKKEDLKA  298

Query  876   RAKGLKTLGKVFQRVK  829
             RA  LK LGK+FQR K
Sbjct  299   RAMALKILGKIFQREK  314



>ref|XP_006300507.1| hypothetical protein CARUB_v10020466mg [Capsella rubella]
 gb|EOA33405.1| hypothetical protein CARUB_v10020466mg [Capsella rubella]
Length=380

 Score =   411 bits (1056),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 200/324 (62%), Positives = 255/324 (79%), Gaps = 3/324 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKET YYDVLGV+P A+E +I+KAYYIKARQVHPDKN  DPLAA+ FQVLGEAYQVLSD
Sbjct  1     MVKETVYYDVLGVTPSASEEEIRKAYYIKARQVHPDKNQGDPLAAEKFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P  R+AYD  GK     E ++DP A+FA+LFGSELFEDYIG LA+ASMAS  + ++ E  
Sbjct  61    PVHREAYDQTGKFSAPKETMVDPTAVFALLFGSELFEDYIGHLAVASMASTQMASETETP  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D  +  +K++ VQ+EREE LA+ LK+ L+ YV G KE F   AE+E  RLS+AA+G DML
Sbjct  121   D--QFHDKLKAVQKEREENLAKFLKDLLSQYVHGDKEGFIHRAESEAKRLSDAAFGADML  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             +TIGY+YTRQAA+ELGK+A+YLGVPF+AEW RNKGH  KSQ++AA GAF L+QLQE+  R
Sbjct  179   HTIGYVYTRQAAQELGKRALYLGVPFVAEWVRNKGHSWKSQISAAKGAFQLLQLQEESNR  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             +L  +G     +LE ++Q++K+ +I SLWKLNV DIE TL  VCQMVL+DNN++KEE+++
Sbjct  239   RLKKDGTSATNDLESHIQTNKETLIGSLWKLNVVDIEVTLLHVCQMVLRDNNLRKEEVKS  298

Query  876   RAKGLKTLGKVFQRVK-SVNGNET  808
             RA  LK LGK+FQ+ K S NG+++
Sbjct  299   RAMALKILGKIFQQEKQSRNGSKS  322



>ref|XP_010416627.1| PREDICTED: chaperone protein dnaJ 10-like isoform X1 [Camelina 
sativa]
Length=380

 Score =   411 bits (1056),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 202/325 (62%), Positives = 255/325 (78%), Gaps = 3/325 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKET YYDVLGV+P A+E +I+KAYYIKARQVHPDKN  DPLAA+ FQVLGEAYQVLSD
Sbjct  1     MVKETVYYDVLGVTPSASEEEIRKAYYIKARQVHPDKNQGDPLAAEKFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P  R+AYD  GK     E ++DP A+FA+LFGSELFEDYIG LA+ASMAS  + ++ E  
Sbjct  61    PVHREAYDRTGKFSAPKETMVDPTAVFALLFGSELFEDYIGHLAVASMASTQMASEIESP  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D  +  +K++ VQ+EREE LA  LK+ L+ YV G KE F   AE+E  RLS+AA+G DML
Sbjct  121   D--QFHDKLKAVQKEREENLARFLKDFLSQYVNGDKEGFIHRAESEAKRLSDAAFGADML  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             +TIGY+YTRQAA+ELGK+A+YLGVPF+AEW RNKGH  KSQ++AA GAF L+QLQE+  R
Sbjct  179   HTIGYVYTRQAAQELGKRALYLGVPFVAEWVRNKGHSWKSQISAAKGAFQLLQLQEESNR  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             +L  +G  T  +LE ++QS+K+ ++ SLWKLNV DIE TL  VCQMVL+DNN++KEEL++
Sbjct  239   RLKKDGTSTANDLESHIQSNKETLMGSLWKLNVVDIEVTLLHVCQMVLRDNNLRKEELKS  298

Query  876   RAKGLKTLGKVFQRVK-SVNGNETE  805
             RA  LK LGK+FQ+ K S NG+ ++
Sbjct  299   RAMALKILGKIFQQEKQSRNGSTSK  323



>ref|XP_002300954.1| DNAJ heat shock N-terminal domain-containing family protein [Populus 
trichocarpa]
 gb|EEE80227.1| DNAJ heat shock N-terminal domain-containing family protein [Populus 
trichocarpa]
Length=370

 Score =   410 bits (1054),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 205/335 (61%), Positives = 261/335 (78%), Gaps = 7/335 (2%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKE+EYYDVLGVSP A+E +I+KAYY+KARQVHPDKNP+DP AA+ FQ   EAYQVLSD
Sbjct  1     MVKESEYYDVLGVSPSASEEEIRKAYYLKARQVHPDKNPDDPQAAERFQA-SEAYQVLSD  59

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR AYD  GK  IS E ++DP A+FA+LFGSELFEDY+G L++ SMAS ++ +  E  
Sbjct  60    PVQRDAYDRNGKYCISRETMLDPTAVFALLFGSELFEDYVGHLSVTSMASSELAS--ESG  117

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             +  K+ EK++ VQ+EREEKLA  LK+ LN Y QG +  F   AE+E  RLS+AA+GVD+L
Sbjct  118   NPDKVHEKLKAVQKEREEKLARFLKDFLNQYAQGDRVGFLRRAESEAKRLSDAAFGVDIL  177

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             +TIGYIY+RQAA+ELGKKAIYLGVPF+AEW RNKGHF KSQ+TAA GAF L+QLQEDM+R
Sbjct  178   HTIGYIYSRQAAQELGKKAIYLGVPFLAEWVRNKGHFWKSQITAAKGAFQLLQLQEDMRR  237

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             Q   +G+    ++E ++ S+K  +++SLWKLNV DIE T+  VCQMVL++NNV+KEEL+A
Sbjct  238   QFKMDGSGPGNDVESHLLSNKDTLMNSLWKLNVVDIEITVIHVCQMVLKENNVRKEELKA  297

Query  876   RAKGLKTLGKVFQRVK-SVNGNETETSANTPVQKL  775
             RA  LK LG++FQ+ + S NG    TS    V+K+
Sbjct  298   RALALKNLGRIFQQERQSRNG---ATSKGKIVKKI  329



>gb|KGN47498.1| hypothetical protein Csa_6G344270 [Cucumis sativus]
Length=385

 Score =   410 bits (1053),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 195/323 (60%), Positives = 256/323 (79%), Gaps = 2/323 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MV +TEYYD+LGV P A+E +I+KAYY KA+QVHPDKN NDP AA+ FQ LGEAYQVLSD
Sbjct  1     MVNDTEYYDILGVRPSASEEEIRKAYYHKAKQVHPDKNLNDPQAAERFQALGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
               QR AYD  GK  ++ E+++DP A+FA+LFGSELFE+YIG LA+ASMAS ++  + E  
Sbjct  61    AVQRNAYDRNGKHSVTRESMLDPTAVFALLFGSELFENYIGHLAVASMASSEL--ESESG  118

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             + ++L +K++ VQ+EREEKLA IL++ LN YVQG K+ F  HAE+E  RLS+AA+GV++L
Sbjct  119   NPERLHDKLKAVQKEREEKLARILEDFLNQYVQGDKDGFLQHAESEAKRLSDAAFGVNIL  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             +TIGYIY+RQAA+ELGK+AIYLGVPF+AEWFRNKGHF KSQ+TAA GAF L+QLQ+D+ R
Sbjct  179   HTIGYIYSRQAAQELGKRAIYLGVPFVAEWFRNKGHFWKSQITAAKGAFQLLQLQDDISR  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             Q   +G+    ++E ++Q++K   ++SLW+LNV DIE TL  VCQMVL+D  V+KE+L+A
Sbjct  239   QFKMDGSGPGTDIESHIQANKDTFLNSLWRLNVVDIELTLINVCQMVLRDTTVRKEDLKA  298

Query  876   RAKGLKTLGKVFQRVKSVNGNET  808
             RA  LK LGK+FQ+ K    + T
Sbjct  299   RALALKVLGKIFQQEKQAQDSGT  321



>ref|NP_001047124.1| Os02g0555700 [Oryza sativa Japonica Group]
 dbj|BAD15456.1| putative DNA J domain protein [Oryza sativa Japonica Group]
 dbj|BAD33317.1| putative DNA J domain protein [Oryza sativa Japonica Group]
 dbj|BAF09038.1| Os02g0555700 [Oryza sativa Japonica Group]
Length=377

 Score =   409 bits (1051),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 196/316 (62%), Positives = 250/316 (79%), Gaps = 2/316 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             M KETE+YDVLGV P A++ +I+KAYYIKARQVHPDKNPNDP AA+ FQ LGEAYQVLSD
Sbjct  1     MAKETEFYDVLGVCPAASDDEIRKAYYIKARQVHPDKNPNDPQAAEKFQALGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR+AYD YGK+ IS E ++D   +F +LFGSELFEDYIG LAMA+MAS ++ +D +  
Sbjct  61    PLQRKAYDGYGKTSISKENMLDGTVVFTLLFGSELFEDYIGHLAMATMASSEMASDND--  118

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             + +KLQ++++ VQREREEKLA  LK  L+ YV+G +E F + AE+E  RLS+ + G+D+L
Sbjct  119   NPEKLQDRLKGVQREREEKLARFLKEFLSQYVRGDQEGFASRAESEAKRLSSTSSGLDIL  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
              TIGY+Y+RQAAKELGKKA+YLGVPF+AEW RNKGH  +SQ+TAA GA  L+QLQE+  R
Sbjct  179   RTIGYVYSRQAAKELGKKAMYLGVPFLAEWVRNKGHLWRSQITAAKGALQLLQLQEEACR  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             Q   +G  TE +++  M+ +K +M+ SLWKLN+ DIE TL  VC+MVL +NNVKKE+L+A
Sbjct  239   QSGKDGLATERDVDLQMRMNKDLMMSSLWKLNIVDIEVTLLHVCEMVLHENNVKKEDLKA  298

Query  876   RAKGLKTLGKVFQRVK  829
             RA  LK LGK+FQR K
Sbjct  299   RAMALKILGKIFQRDK  314



>ref|XP_010692860.1| PREDICTED: chaperone protein dnaJ 10 [Beta vulgaris subsp. vulgaris]
Length=382

 Score =   409 bits (1051),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 195/323 (60%), Positives = 254/323 (79%), Gaps = 2/323 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYD+LGVSP A+E +I+KAYY+KAR+VHPDKNPNDP AA+ FQ+LGEAYQ LSD
Sbjct  1     MVKETEYYDILGVSPCASEDEIRKAYYLKARKVHPDKNPNDPQAAEKFQILGEAYQALSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR AYD  GK  +  ++++DP A+FA+LFGSELFEDYIG LA+ASMAS ++ ++ +  
Sbjct  61    PVQRDAYDRNGKHSVLKDSMLDPTAVFALLFGSELFEDYIGHLAVASMASSELISEHD--  118

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
               +++ EK++ VQREREEKLA  LK+ LN YV+G K+ F   AE+EV RL++AA+G ++L
Sbjct  119   TPERINEKLKAVQREREEKLAGKLKHILNQYVRGDKKGFIQRAESEVKRLTDAAFGTEIL  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGY+Y+RQAA ELGKK +YLG+PF+AEW RNKGH  KSQ+TAA GAF L+QLQED++R
Sbjct  179   NTIGYVYSRQAALELGKKTMYLGMPFLAEWVRNKGHIWKSQITAAKGAFQLLQLQEDVRR  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             Q   +G+    + E +++ +K++++ SLWKLNV DIE TL  VCQ+VL + NVKKEEL+ 
Sbjct  239   QFKMDGSGPANDFESHIRQNKEMLMSSLWKLNVVDIEMTLLHVCQLVLLEKNVKKEELKD  298

Query  876   RAKGLKTLGKVFQRVKSVNGNET  808
             RA  LK LGK FQR K    +ET
Sbjct  299   RALALKLLGKTFQREKLTQESET  321



>gb|EEC73395.1| hypothetical protein OsI_07645 [Oryza sativa Indica Group]
Length=377

 Score =   409 bits (1050),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 196/316 (62%), Positives = 250/316 (79%), Gaps = 2/316 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             M KETE+YDVLGV P A++ +I+KAYYIKARQVHPDKNPNDP AA+ FQ LGEAYQVLSD
Sbjct  1     MAKETEFYDVLGVCPAASDDEIRKAYYIKARQVHPDKNPNDPQAAEKFQALGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR+AYD YGK+ IS E ++D   +F +LFGSELFEDYIG LAMA+MAS ++ +D +  
Sbjct  61    PLQRKAYDGYGKTSISKENMLDGTVVFTLLFGSELFEDYIGHLAMATMASSEMASDND--  118

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             + +KLQ++++ VQREREEKLA  LK  L+ YV+G +E F + AE+E  RLS+ + G+D+L
Sbjct  119   NPEKLQDRLKGVQREREEKLARFLKEFLSQYVRGDQEGFASRAESEAKRLSSTSSGLDIL  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
              TIGY+Y+RQAAKELGKKA+YLGVPF+AEW RNKGH  +SQ+TAA GA  L+QLQE+  R
Sbjct  179   RTIGYVYSRQAAKELGKKAMYLGVPFLAEWVRNKGHLWRSQITAAKGALQLLQLQEEACR  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             Q   +G  TE +++  M+ +K +M+ SLWKLN+ DIE TL  VC+MVL +NNVKKE+L+A
Sbjct  239   QSGKDGLATERDVDLQMRMNKDLMMSSLWKLNIVDIEVTLLHVCEMVLHENNVKKEDLKA  298

Query  876   RAKGLKTLGKVFQRVK  829
             RA  LK LGK+FQR K
Sbjct  299   RAMALKILGKIFQRDK  314



>ref|XP_010428770.1| PREDICTED: chaperone protein dnaJ 10-like [Camelina sativa]
Length=379

 Score =   409 bits (1050),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 200/325 (62%), Positives = 255/325 (78%), Gaps = 3/325 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKET YYDVLGV+P A+E +I+KAYYIKARQVHPDKN  DPLAA+ FQVLGEAYQVLSD
Sbjct  1     MVKETVYYDVLGVTPSASEEEIRKAYYIKARQVHPDKNQGDPLAAEKFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P  R+AYD  GK     E ++DP A+FA+LFGSELFEDYIG LA+ASMAS  + ++ E  
Sbjct  61    PVHREAYDRTGKFSAPRETMVDPTAVFALLFGSELFEDYIGHLAVASMASTQMASEIETP  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D  +  +K++ VQ+EREE LA  LK+ L+ YV G KE F   AE+E  RLS+AA+G DML
Sbjct  121   D--QFHDKLKAVQKEREENLARFLKDFLSQYVHGDKEGFIHRAESEAKRLSDAAFGADML  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             +TIGY+YTRQAA+ELGK+A+YLGVPF+AEW RNKGH  KSQ++AA GAF L+QLQE+  R
Sbjct  179   HTIGYVYTRQAAQELGKRALYLGVPFVAEWVRNKGHSWKSQISAAKGAFQLLQLQEESNR  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             ++  +G  T  +LE ++Q++K+ ++ SLWKLNV DIE TL  VCQMVL+DNN++KEEL++
Sbjct  239   RVKKDGTSTGNDLESHIQTNKETLMGSLWKLNVVDIEVTLLHVCQMVLRDNNLRKEELKS  298

Query  876   RAKGLKTLGKVFQRVK-SVNGNETE  805
             RA  LK LGK+FQ+ K S NG+ ++
Sbjct  299   RAMALKILGKIFQQEKQSRNGSTSK  323



>ref|XP_002968059.1| hypothetical protein SELMODRAFT_89685 [Selaginella moellendorffii]
 gb|EFJ30313.1| hypothetical protein SELMODRAFT_89685 [Selaginella moellendorffii]
Length=357

 Score =   407 bits (1046),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 209/359 (58%), Positives = 276/359 (77%), Gaps = 20/359 (6%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVK+TEYYDVLG++P A+ A +KKAYY+KA++VHPDKNPNDP AA+NFQ+LGEAYQ LSD
Sbjct  1     MVKDTEYYDVLGLTPDASAADVKKAYYVKAKKVHPDKNPNDPQAARNFQLLGEAYQTLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFT-DGEE  1420
             PA+++AYD +GK+G+ST+ ++DPAA+F MLFGSE+FEDY+GQLAMASMAS+D  + D + 
Sbjct  61    PAKKEAYDKFGKAGVSTDQMLDPAAVFGMLFGSEMFEDYVGQLAMASMASIDTSSGDNQA  120

Query  1419  FDAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDM  1240
              D +++QEK++V+Q+ERE+KL + L  RL  YV G K+ F   A++E   LSNAA+G  M
Sbjct  121   MDLRQVQEKLKVLQQEREDKLTKCLIARLQRYVDGDKDGFSEWAKSEAQHLSNAAFGEPM  180

Query  1239  LNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMK  1060
             L+TIGYIY RQAAKELGKK +++GVPF+AEW R+KGHFIKSQVTAA GA AL+Q+QEDMK
Sbjct  181   LHTIGYIYARQAAKELGKKMLFMGVPFLAEWVRDKGHFIKSQVTAAAGAIALMQMQEDMK  240

Query  1059  RQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELR  880
             R+L+A G+ +E  +E+Y++S +++MIDSLWKLNVADIE TLS +CQ VL D +  +E  R
Sbjct  241   RELAAGGDMSESAIEKYLESKQQVMIDSLWKLNVADIEVTLSHICQNVLHDASAGREVQR  300

Query  879   ARAKGLKTLGKVFQ-------RVKSVN-----GNETETSANTPVQKLDGSEPSYDSHSL  739
              RAK LK LG +FQ       R KS+      G ++ +S  TP       +PS  SH+ 
Sbjct  301   QRAKALKKLGNIFQGAKVPYRREKSLRHDAKLGQDSSSSTPTP-------QPSNSSHTF  352



>ref|XP_010471871.1| PREDICTED: chaperone protein dnaJ 10-like [Camelina sativa]
Length=380

 Score =   407 bits (1047),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 200/325 (62%), Positives = 254/325 (78%), Gaps = 3/325 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKET YYDVLGV+P A+E +I+KAYYIKARQVHPDKN  DPLAA+ FQVLGEAYQVLSD
Sbjct  1     MVKETVYYDVLGVTPSASEEEIRKAYYIKARQVHPDKNQGDPLAAEKFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P  R+AYD  GK     E I+DP A+FA+LFGSEL EDYIG LA+ASMAS  +  + E  
Sbjct  61    PVHREAYDRTGKFSAPKETIVDPTAVFALLFGSELLEDYIGHLAVASMASTQMAFEIETP  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D  +  +K++ VQ+EREE LA  LK+ L+ YV G KE F   AE+E  RLS+AA+G DML
Sbjct  121   D--QFHDKLKAVQKEREENLARFLKDFLSQYVHGDKEGFINRAESEAKRLSDAAFGADML  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             +TIGY+YTRQAA+ELGK+A+YLGVPF+AEW RNKGH  KSQ++AA GAF L+QLQE+  R
Sbjct  179   HTIGYVYTRQAAQELGKRALYLGVPFVAEWVRNKGHSWKSQISAAKGAFQLLQLQEESNR  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             +L  +G  +  +LE ++Q++K+ ++ SLWKLNV DIE TL  VCQMVL+DNN++KEEL++
Sbjct  239   RLKKDGTSSANDLESHIQTNKETLMGSLWKLNVVDIEVTLLHVCQMVLRDNNLRKEELKS  298

Query  876   RAKGLKTLGKVFQRVK-SVNGNETE  805
             RA  LK LGK+FQ+ K S+NG+ ++
Sbjct  299   RAMALKILGKIFQQEKQSMNGSTSK  323



>ref|XP_008441574.1| PREDICTED: chaperone protein dnaJ 10 isoform X3 [Cucumis melo]
Length=422

 Score =   407 bits (1047),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 199/331 (60%), Positives = 253/331 (76%), Gaps = 5/331 (2%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MV +TEYYDVLGV P A+E +I+KAYY KA+QVHPDKN NDP AA+ FQ LGEAYQVLSD
Sbjct  41    MVNDTEYYDVLGVRPSASEEEIRKAYYHKAKQVHPDKNLNDPQAAERFQALGEAYQVLSD  100

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
               QR AYD  GK  ++ E+++DP A+FA+LFGSELFE+YIG LA+ASMAS ++  + E  
Sbjct  101   AIQRDAYDRNGKHSVTRESMLDPTAVFALLFGSELFENYIGHLAVASMASFEL--ESESG  158

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             + ++L +K++   REREEKLA IL+  LN YVQG K+ F  HAE+E  RLS+AA+GV++L
Sbjct  159   NPERLHDKLK---REREEKLARILEGFLNQYVQGDKDGFLQHAESEAKRLSDAAFGVNIL  215

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             +TIGYIY+RQAA+ELGK+AIYLGVPF+AEWFRNKGHF KSQ+TAA GAF L+QLQ+D+ R
Sbjct  216   HTIGYIYSRQAAQELGKRAIYLGVPFVAEWFRNKGHFWKSQITAAKGAFQLLQLQDDISR  275

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             Q   +G     ++E ++Q++K   ++SLWKLNV DIE TL  VCQMVL DN +KKEEL+A
Sbjct  276   QFKMDGTGPGTDIESHIQANKDTFLNSLWKLNVVDIELTLINVCQMVLHDNTIKKEELKA  335

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPV  784
             RA  LK LGK+FQ+ K    + T       V
Sbjct  336   RALALKVLGKIFQQEKQAQDSGTSRKKGASV  366



>ref|XP_002965580.1| hypothetical protein SELMODRAFT_84969 [Selaginella moellendorffii]
 gb|EFJ33000.1| hypothetical protein SELMODRAFT_84969 [Selaginella moellendorffii]
Length=357

 Score =   405 bits (1040),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 206/343 (60%), Positives = 268/343 (78%), Gaps = 13/343 (4%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVK+TEYYDVLG++P A+ A +KKAYY+KA++VHPDKNPNDP AA+NFQ+LGEAYQ LSD
Sbjct  1     MVKDTEYYDVLGLTPDASAADVKKAYYVKAKKVHPDKNPNDPQAARNFQLLGEAYQTLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFT-DGEE  1420
             PA+++AYD +GK+G+ST+ ++DPAA+F MLFGSE+FEDY+GQLAMASMAS+D  + D + 
Sbjct  61    PAKKEAYDKFGKAGVSTDQMLDPAAVFGMLFGSEMFEDYVGQLAMASMASIDTSSGDNQA  120

Query  1419  FDAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDM  1240
              D +++QEK++V+Q+ERE+KL + L  RL  YV G K+ F   A+ E   LSNAA+G  M
Sbjct  121   MDLRQVQEKLKVLQQEREDKLTKCLIARLQRYVDGDKDGFSEWAKNEAQHLSNAAFGEPM  180

Query  1239  LNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMK  1060
             L+TIGYIY RQAAKELGKK +++GVPF+AEW R+KGHFIKSQVTAA GA AL+Q+QEDMK
Sbjct  181   LHTIGYIYARQAAKELGKKMLFMGVPFLAEWVRDKGHFIKSQVTAAAGAIALMQMQEDMK  240

Query  1059  RQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELR  880
             RQL+A G+ +E  +E+Y++S +++MIDSLWKLNVADIE TLS +CQ VL D    +E  R
Sbjct  241   RQLAAGGDMSESAIEKYLESKQQVMIDSLWKLNVADIEVTLSHICQNVLHDATAGREVQR  300

Query  879   ARAKGLKTLGKVFQ-------RVKSVN-----GNETETSANTP  787
              RAK LK LG +FQ       R KS+      G ++ +S  TP
Sbjct  301   QRAKALKKLGNIFQGAKVPYRREKSLRHDAKLGQDSSSSTPTP  343



>ref|XP_009106370.1| PREDICTED: chaperone protein dnaJ 10 [Brassica rapa]
Length=376

 Score =   405 bits (1041),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 201/321 (63%), Positives = 250/321 (78%), Gaps = 8/321 (2%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKET YYDVLGV+P A+E +I+KAYYIKARQVHPDKN  DPLAA+ FQVLGEAYQVLSD
Sbjct  1     MVKETVYYDVLGVTPSASEEEIRKAYYIKARQVHPDKNQGDPLAAEKFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P  R+AYD  GK     E ++DP A+FA+LFGSELFEDYIG LA+ASMAS       E  
Sbjct  61    PLLREAYDQTGKLSAPKETMVDPTAVFALLFGSELFEDYIGHLAVASMAS-------ETE  113

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             ++ ++ +K++ VQREREE LA  LK+ LN YV G K+ F   AE+E  RLS+AA+GVD+L
Sbjct  114   NSDQIHDKLKAVQREREENLARFLKDFLNQYVHGDKDGFIHRAESEAKRLSDAAFGVDIL  173

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGY+YTRQAA+ELGK+AIYLGVPF+AEW RNKGH  KSQ++AA GAF L+QLQE+  R
Sbjct  174   NTIGYVYTRQAAQELGKRAIYLGVPFVAEWVRNKGHSWKSQMSAAKGAFQLLQLQEESSR  233

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             +   +G     ELE ++Q++K+ ++ SLWKLNV DIE TL  VCQMVL++NN++KEEL++
Sbjct  234   RFKKDGTSPANELESHIQTNKETLMGSLWKLNVVDIEVTLLHVCQMVLRENNLRKEELKS  293

Query  876   RAKGLKTLGKVFQRVK-SVNG  817
             RA  LK LGK+FQ+ K S NG
Sbjct  294   RAMALKILGKIFQQGKQSRNG  314



>gb|EEE57186.1| hypothetical protein OsJ_07128 [Oryza sativa Japonica Group]
Length=425

 Score =   406 bits (1044),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 195/314 (62%), Positives = 249/314 (79%), Gaps = 2/314 (1%)
 Frame = -2

Query  1770  KETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSDPA  1591
             KETE+YDVLGV P A++ +I+KAYYIKARQVHPDKNPNDP AA+ FQ LGEAYQVLSDP 
Sbjct  51    KETEFYDVLGVCPAASDDEIRKAYYIKARQVHPDKNPNDPQAAEKFQALGEAYQVLSDPL  110

Query  1590  QRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEFDA  1411
             QR+AYD YGK+ IS E ++D   +F +LFGSELFEDYIG LAMA+MAS ++ +D +  + 
Sbjct  111   QRKAYDGYGKTSISKENMLDGTVVFTLLFGSELFEDYIGHLAMATMASSEMASDND--NP  168

Query  1410  KKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDMLNT  1231
             +KLQ++++ VQREREEKLA  LK  L+ YV+G +E F + AE+E  RLS+ + G+D+L T
Sbjct  169   EKLQDRLKGVQREREEKLARFLKEFLSQYVRGDQEGFASRAESEAKRLSSTSSGLDILRT  228

Query  1230  IGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKRQL  1051
             IGY+Y+RQAAKELGKKA+YLGVPF+AEW RNKGH  +SQ+TAA GA  L+QLQE+  RQ 
Sbjct  229   IGYVYSRQAAKELGKKAMYLGVPFLAEWVRNKGHLWRSQITAAKGALQLLQLQEEACRQS  288

Query  1050  SAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRARA  871
               +G  TE +++  M+ +K +M+ SLWKLN+ DIE TL  VC+MVL +NNVKKE+L+ARA
Sbjct  289   GKDGLATERDVDLQMRMNKDLMMSSLWKLNIVDIEVTLLHVCEMVLHENNVKKEDLKARA  348

Query  870   KGLKTLGKVFQRVK  829
               LK LGK+FQR K
Sbjct  349   MALKILGKIFQRDK  362



>ref|NP_177828.2| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
thaliana]
 gb|AEE35926.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
thaliana]
Length=379

 Score =   405 bits (1040),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 198/322 (61%), Positives = 251/322 (78%), Gaps = 3/322 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKET YYDVLGV+P A+E +I+KAYYIKARQVHPDKN  DPLAA+ FQVLGEAYQVLSD
Sbjct  1     MVKETVYYDVLGVTPSASEEEIRKAYYIKARQVHPDKNQGDPLAAEKFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P  R+AYD  GK     E ++DP A+FA+LFGSELFEDYIG LA+ASMAS  + ++ E  
Sbjct  61    PVHREAYDRTGKFSAPKETMVDPTAVFALLFGSELFEDYIGHLAVASMASTQMASEIENS  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D  + Q+K++ VQ+EREE L+  LK+ L+ YV G KE F + AE+E  RLS+AA+G DML
Sbjct  121   D--QFQDKLKAVQKEREENLSRFLKDFLSQYVHGDKEGFISRAESEAKRLSDAAFGADML  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             +TIGY+YTRQAA+ELGK+A+YLGVPF+AEW RNKGH  KSQ++AA GA  L+QLQE+  R
Sbjct  179   HTIGYVYTRQAAQELGKRALYLGVPFVAEWVRNKGHSWKSQISAAKGALQLLQLQEESNR  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             +L  +G     ELE ++Q++K+ ++ SLWKLNV DIE TL  VCQMV ++NN++KEEL++
Sbjct  239   RLKKDGTSPANELESHIQTNKETLMGSLWKLNVVDIEVTLLHVCQMVFRENNLRKEELKS  298

Query  876   RAKGLKTLGKVFQRVK-SVNGN  814
             RA  LK LGK+FQ+ K S NG 
Sbjct  299   RAMALKILGKIFQQEKQSKNGT  320



>ref|XP_002889116.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH65375.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
Length=379

 Score =   405 bits (1040),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 199/324 (61%), Positives = 253/324 (78%), Gaps = 3/324 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKET YYDVLGV+P A+E +I+KAYYIKARQVHPDKN  DPLAA+ FQVLGEAYQVLSD
Sbjct  1     MVKETVYYDVLGVTPSASEEEIRKAYYIKARQVHPDKNQGDPLAAEKFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P  R+AYD  GK     E ++DP A+FA+LFGSELF+DYIG LA+ASMAS  + ++ E  
Sbjct  61    PVHREAYDRTGKFSAPKETMVDPTAVFALLFGSELFKDYIGHLAVASMASTQMASEIETP  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D    Q+K++ VQ+EREE LA  LK+ L+ YV G KE F + A++E  RLS+AA+G DML
Sbjct  121   D--HFQDKLKAVQKEREENLARFLKDLLSQYVHGDKEGFISRAKSEAKRLSDAAFGADML  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             +TIGY+YTRQAA+ELGK+A+YLGVPF+AEW RNKGH  KSQ++AA GAF L+QLQE+  R
Sbjct  179   HTIGYVYTRQAAQELGKRALYLGVPFVAEWVRNKGHSWKSQISAAKGAFQLLQLQEESNR  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             +L  +G     ELE ++Q++K+ ++ SLWKLNV DIE TL  VCQMVL++NN++KEEL++
Sbjct  239   RLKKDGASPANELESHIQTNKETLMGSLWKLNVVDIEVTLLHVCQMVLRENNLRKEELKS  298

Query  876   RAKGLKTLGKVFQRVK-SVNGNET  808
             RA  LK LGK+FQ+ K S NG  +
Sbjct  299   RAMALKILGKIFQQEKQSRNGTTS  322



>gb|KHN24356.1| Chaperone protein dnaJ 10 [Glycine soja]
Length=391

 Score =   405 bits (1041),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 201/323 (62%), Positives = 252/323 (78%), Gaps = 12/323 (4%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYD+LGVSP A++ QI+KAYY KA QVHPDKNPNDP AA+ FQ+LGEAYQ+LS 
Sbjct  1     MVKETEYYDILGVSPSASDDQIRKAYYHKAMQVHPDKNPNDPHAAEKFQILGEAYQILSV  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR AY+  GK  +S E ++DP A+FA+LFGSELFEDYIG LA+ASMAS ++  + E  
Sbjct  61    PVQRNAYNQNGKHSVSRETMLDPMAVFALLFGSELFEDYIGHLAVASMASSELADETE--  118

Query  1416  DAKKLQEKMR---------VVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLS  1264
             D  KL EK++          VQ+EREEKLA IL++ L  YV+G+K+ F   AE+E  RLS
Sbjct  119   DPDKLNEKLKARMFYIHFSAVQKEREEKLARILRDYLGQYVRGNKKGFFQRAESETRRLS  178

Query  1263  NAAYGVDMLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFAL  1084
              AA+GVDML+TIGYIY+RQAA+ELGKKAIYLGVPF+AEW RNKGHF KSQ TAA GA+ L
Sbjct  179   RAAFGVDMLHTIGYIYSRQAAQELGKKAIYLGVPFLAEWVRNKGHFWKSQFTAAKGAYQL  238

Query  1083  IQLQEDMKRQLSAEGNYT-eeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQD  907
             +QLQ+DM++Q   +G+   E +++ +++ +K  +++SLWKLNV DIE TL  VCQMVL++
Sbjct  239   LQLQDDMRKQFKMDGSSVPENDVDSHIRLNKDTLMNSLWKLNVVDIEVTLVHVCQMVLRE  298

Query  906   NNVKKEELRARAKGLKTLGKVFQ  838
             NNVKKEELR RA  LK LGK+FQ
Sbjct  299   NNVKKEELRLRATALKILGKIFQ  321



>gb|KEH40477.1| DnaJ heat shock amino-terminal domain protein [Medicago truncatula]
Length=379

 Score =   404 bits (1037),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 193/313 (62%), Positives = 249/313 (80%), Gaps = 6/313 (2%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYD+LGVSP A++ QI+KAYY KA+QVHPD+N NDP AA  FQ+LGEAYQVLSD
Sbjct  1     MVKETEYYDILGVSPSASDDQIRKAYYHKAKQVHPDRNQNDPNAAHKFQILGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR  YD  GK  +S E ++DP A+FA+LFGSELFEDY+G LA+ASMAS ++  + E+ 
Sbjct  61    PVQRTGYDQNGKHSVSRETMLDPMAVFALLFGSELFEDYVGHLAVASMASSELGDESED-  119

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
                 LQEK++ VQ+ REEKLA  LK+ L+ YV+G ++ F   AE+E  RLS+AA+GVDML
Sbjct  120   ----LQEKLKEVQKGREEKLARFLKDFLSQYVRGDQKGFYQRAESEARRLSHAAFGVDML  175

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             +TIGYIY+RQAA+ELGKKA+YLGVPF+AEW RNKGHF KSQ+TAA GAF L+QLQE++ +
Sbjct  176   HTIGYIYSRQAAQELGKKALYLGVPFLAEWVRNKGHFWKSQLTAAKGAFQLLQLQEELSK  235

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             Q    G+   E ++ +++ +K  +++SLWKLNV DIE TL+ VCQMVL++NNV++EEL+ 
Sbjct  236   QFKTSGS-CPENVDSHIRLNKDTLLNSLWKLNVVDIEVTLAHVCQMVLKENNVRREELKV  294

Query  876   RAKGLKTLGKVFQ  838
             RA  LK LGK+FQ
Sbjct  295   RATALKILGKIFQ  307



>ref|XP_006405095.1| hypothetical protein EUTSA_v10000200mg [Eutrema salsugineum]
 gb|ESQ46548.1| hypothetical protein EUTSA_v10000200mg [Eutrema salsugineum]
Length=380

 Score =   403 bits (1035),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 200/321 (62%), Positives = 249/321 (78%), Gaps = 3/321 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKET YYDVLGV+P A+E +I+KAYYIKARQVHPDKN  DPLAA+ FQVLGEAYQVLSD
Sbjct  1     MVKETVYYDVLGVTPSASEEEIRKAYYIKARQVHPDKNQGDPLAAEKFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P  R+AYD  GK     E ++DP A+FA+LFGSELFEDYIG LA+AS+AS  + ++ E  
Sbjct  61    PVHREAYDRTGKFSAPKETMVDPTAVFALLFGSELFEDYIGHLAVASIASTQMASEIENP  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D  +  +K++ VQREREE LA  LK+ L+ YV G KE F   AE+E  RLS+AA+G DML
Sbjct  121   D--QFHDKLKAVQREREENLARFLKDFLSQYVHGDKEGFIHRAESEAKRLSDAAFGADML  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             +TIGY+YTRQAA+ELGK+A+YLGVPF+AEW RNKGH  KSQ++AA GAF L+QLQE   R
Sbjct  179   HTIGYVYTRQAAQELGKRALYLGVPFVAEWVRNKGHSWKSQISAAKGAFQLLQLQEMSNR  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             +   +G     ELE ++Q++K+ ++ SLWKLNV DIE TL  VCQMVL+DNN++KEEL++
Sbjct  239   RFKKDGTSPANELESHIQTNKETLMGSLWKLNVVDIEMTLLHVCQMVLRDNNLRKEELKS  298

Query  876   RAKGLKTLGKVFQRVK-SVNG  817
             RA  LK LGK+FQ+ K S NG
Sbjct  299   RALALKILGKIFQQEKQSRNG  319



>ref|XP_004144254.1| PREDICTED: chaperone protein dnaJ 10-like [Cucumis sativus]
Length=388

 Score =   403 bits (1036),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 194/326 (60%), Positives = 256/326 (79%), Gaps = 5/326 (2%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYI---KARQVHPDKNPNDPLAAQNFQVLGEAYQV  1606
             MV +TEYYD+LGV P A+E +I+KAY I   +A+QVHPDKN NDP AA+ FQ LGEAYQV
Sbjct  1     MVNDTEYYDILGVRPSASEEEIRKAYLIVLVQAKQVHPDKNLNDPQAAERFQALGEAYQV  60

Query  1605  LSDPAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDG  1426
             LSD  QR AYD  GK  ++ E+++DP A+FA+LFGSELFE+YIG LA+ASMAS ++  + 
Sbjct  61    LSDAVQRNAYDRNGKHSVTRESMLDPTAVFALLFGSELFENYIGHLAVASMASSEL--ES  118

Query  1425  EEFDAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGV  1246
             E  + ++L +K++ VQ+EREEKLA IL++ LN YVQG K+ F  HAE+E  RLS+AA+GV
Sbjct  119   ESGNPERLHDKLKAVQKEREEKLARILEDFLNQYVQGDKDGFLQHAESEAKRLSDAAFGV  178

Query  1245  DMLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQED  1066
             ++L+TIGYIY+RQAA+ELGK+AIYLGVPF+AEWFRNKGHF KSQ+TAA GAF L+QLQ+D
Sbjct  179   NILHTIGYIYSRQAAQELGKRAIYLGVPFVAEWFRNKGHFWKSQITAAKGAFQLLQLQDD  238

Query  1065  MKRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEE  886
             + RQ   +G+    ++E ++Q++K   ++SLW+LNV DIE TL  VCQMVL+D  V+KE+
Sbjct  239   ISRQFKMDGSGPGTDIESHIQANKDTFLNSLWRLNVVDIELTLINVCQMVLRDTTVRKED  298

Query  885   LRARAKGLKTLGKVFQRVKSVNGNET  808
             L+ARA  LK LGK+FQ+ K    + T
Sbjct  299   LKARALALKVLGKIFQQEKQAQDSGT  324



>ref|XP_003575139.1| PREDICTED: chaperone protein dnaJ 10 [Brachypodium distachyon]
Length=379

 Score =   402 bits (1034),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 196/317 (62%), Positives = 247/317 (78%), Gaps = 2/317 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             M KETEYYD LGVSP A+  +I+KAYY+KARQVHPDKNPNDP AA  FQ LGEAYQVLSD
Sbjct  1     MAKETEYYDALGVSPAASSDEIRKAYYVKARQVHPDKNPNDPQAADKFQALGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR+AYD YGK+ IS + I+D A +F +LFGSELFEDYIG LAMA+MAS ++  +G+  
Sbjct  61    PLQRKAYDGYGKNSISRDNILDGAVVFTLLFGSELFEDYIGHLAMATMASSEM-ANGDSD  119

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             + +KLQ++++ VQREREEKLA  LK+ L+ YV+G  E F   AE+E  RLS+ + G+D+L
Sbjct  120   NPEKLQDRLKGVQREREEKLARFLKDFLSQYVRGDTEGFTRRAESEAKRLSSTSSGLDIL  179

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
              TIGY+Y+RQAAKELGKKA+YLGVPF+ EW RNKGH  +SQ+TAA GA  L+QLQE+  R
Sbjct  180   RTIGYVYSRQAAKELGKKAMYLGVPFLTEWVRNKGHLWRSQITAAKGALQLLQLQEEACR  239

Query  1056  QLSAEGN-YTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELR  880
             Q + +G   TE +++  M+ +K +M+ S+WKLNV DIE TL  VC+MVL +NNVKKE+L+
Sbjct  240   QSAKDGCAATERDVDLQMRMNKDLMMSSIWKLNVVDIEVTLLHVCEMVLHENNVKKEDLK  299

Query  879   ARAKGLKTLGKVFQRVK  829
             ARA  LK LGK FQR K
Sbjct  300   ARAMALKNLGKAFQRDK  316



>ref|XP_010537322.1| PREDICTED: chaperone protein dnaJ 10 [Tarenaya hassleriana]
Length=378

 Score =   402 bits (1033),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 193/321 (60%), Positives = 250/321 (78%), Gaps = 6/321 (2%)
 Frame = -2

Query  1773  VKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSDP  1594
             +K+T YYDVLGV+P A+E +I+KAYY+KARQVHPDKNP DP AA+ FQVLGEAYQ+LSDP
Sbjct  1     MKDTAYYDVLGVTPSASEEEIRKAYYLKARQVHPDKNPGDPQAAEKFQVLGEAYQILSDP  60

Query  1593  AQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEFD  1414
               R+AYD  GK  ++ E ++DP A+FA+LFGSELFEDY+G LA+ASMAS ++ ++ +   
Sbjct  61    VHREAYDRNGKFSVTKETMLDPMAVFAILFGSELFEDYVGHLAVASMASTELASESD--S  118

Query  1413  AKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDMLN  1234
                + EK+R VQREREE LA  L+  LN YV G KE F  HAE+E  RLS AA+G D+L+
Sbjct  119   PFTIHEKLRGVQREREETLARFLRGFLNRYVHGDKEGFTRHAESEAKRLSGAAFGGDILH  178

Query  1233  TIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKRQ  1054
             TIGY+YTRQAA+ELGK+A+YLGVPF+AEW RNKGH  KSQ++AA GAF L+QLQE+  R+
Sbjct  179   TIGYVYTRQAAQELGKRALYLGVPFLAEWVRNKGHSWKSQISAAKGAFQLLQLQEESGRK  238

Query  1053  LSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRAR  874
                EG+    ++E ++QS+K  ++ S+WKLNV DIE TLS VCQMVL+++NV+KEEL++R
Sbjct  239   SRREGS----DIETHIQSNKDTLMSSMWKLNVVDIEVTLSHVCQMVLREHNVRKEELKSR  294

Query  873   AKGLKTLGKVFQRVKSVNGNE  811
             A  LK LGK+FQ+ K   G E
Sbjct  295   AIALKILGKIFQQEKESKGGE  315



>ref|XP_001757800.1| predicted protein [Physcomitrella patens]
 gb|EDQ77440.1| predicted protein [Physcomitrella patens]
Length=320

 Score =   398 bits (1023),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 189/313 (60%), Positives = 247/313 (79%), Gaps = 0/313 (0%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVK+T+YY+VL V P AT + IKKAYY KAR VHPDKNPNDP AA NFQVLGEAYQ+LSD
Sbjct  1     MVKDTQYYEVLEVRPDATASDIKKAYYFKARLVHPDKNPNDPEAAHNFQVLGEAYQILSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P +R+AYD YGK  +S +A++D AA+F MLFGS+ F+DY+GQLAMASMAS+D   DG+  
Sbjct  61    PQKREAYDKYGKQSVSQDAMVDAAAVFGMLFGSDAFQDYVGQLAMASMASMDTGADGQPV  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D K+ Q K +  Q++REE+LA +L++R+++YV+G K+ F + A+ E S+L+ AA+G +ML
Sbjct  121   DMKEAQAKFKKAQKDREEQLANLLRDRIDLYVKGDKQGFVSWAQEESSQLAEAAFGEEML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             +TIGYIY RQAAKE+GK    LGVPF+ EW R+KGHFIKSQVTAA GA  L+Q+QED+++
Sbjct  181   HTIGYIYARQAAKEMGKNIFLLGVPFLTEWVRDKGHFIKSQVTAAAGAIQLMQMQEDLRK  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
              + A  +  EE +E Y+Q+ +K+M+DSLWKLNVADIE TLS VCQ VL+++ VKK  LR 
Sbjct  241   AVEAGESNGEEAIESYLQAKQKVMLDSLWKLNVADIELTLSHVCQAVLRESGVKKNVLRQ  300

Query  876   RAKGLKTLGKVFQ  838
             RAK LK +G +FQ
Sbjct  301   RAKALKKMGGIFQ  313



>gb|ADE75731.1| unknown [Picea sitchensis]
Length=345

 Score =   398 bits (1022),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 192/318 (60%), Positives = 246/318 (77%), Gaps = 1/318 (0%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             M K+TEYYDVLGVS  A+ ++IKKAYYIKA+QVHPDKNPNDP A   FQVLGEAYQ+LSD
Sbjct  1     MAKDTEYYDVLGVSVDASASEIKKAYYIKAKQVHPDKNPNDPHAQHKFQVLGEAYQILSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR+ YD YGK+G+S E+++DPAA+F MLFGS+ FEDY+GQLA++SMAS+D+  DG++ 
Sbjct  61    PKQREDYDKYGKAGVSKESMLDPAAVFGMLFGSDYFEDYVGQLALSSMASVDMAEDGQQP  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             + + +  +M+ +Q+EREEKL + LK RL +YV+G K+EF   A AE  RLSNA++G  ML
Sbjct  121   NVQNIMYRMKALQKEREEKLVQTLKGRLQLYVEGQKKEFVDWANAEARRLSNASFGEAML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             +TIGYIYTRQAAK+LGK    +GVPF+AEW R+KGHF+KSQVTAA+GA AL+Q+QE +K+
Sbjct  181   HTIGYIYTRQAAKQLGKNMFLVGVPFLAEWVRDKGHFMKSQVTAASGAVALMQMQEGLKQ  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             +  + G   EE L  Y+  +K  MI SLWK+NVADIE+TL  VC  VL+D+ V K  L A
Sbjct  241   KFES-GPTDEEVLSTYLLENKDAMISSLWKINVADIESTLIHVCHAVLRDSTVPKHILNA  299

Query  876   RAKGLKTLGKVFQRVKSV  823
             RAK LK LG +FQ  K  
Sbjct  300   RAKALKKLGTIFQGAKEC  317



>ref|XP_004498370.1| PREDICTED: chaperone protein dnaJ 10-like [Cicer arietinum]
Length=378

 Score =   397 bits (1019),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 188/300 (63%), Positives = 247/300 (82%), Gaps = 6/300 (2%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYD+LGVSP A++ QI+KAYY KA+QVHPD+N NDP AAQ FQ+LGEAYQVLSD
Sbjct  1     MVKETEYYDILGVSPSASDGQIRKAYYHKAKQVHPDRNLNDPHAAQKFQILGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
               QR+AYD  GK  +S E ++DP A+FA+LFGSELFEDY+G LA+ASMAS ++  + E+ 
Sbjct  61    AVQRRAYDQNGKHSVSRETMLDPMAVFALLFGSELFEDYVGHLAVASMASSELANESED-  119

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
                 LQEK++VVQ+EREEKLA  LK+ L+ YV+G ++ F   AE+E  RLS AA+GVDML
Sbjct  120   ----LQEKLKVVQKEREEKLARFLKDFLSQYVRGDQKGFFHRAESEARRLSLAAFGVDML  175

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             +TIGYIY+RQAA+ELGKKA+YLGVPF+AEW RNKGHF+KSQ+TAA GA+ L+QLQED+ +
Sbjct  176   HTIGYIYSRQAAQELGKKALYLGVPFLAEWVRNKGHFLKSQLTAAKGAYQLLQLQEDIHK  235

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             Q   +G+++ E+++ +++ +K  +++SLWKLNV DIE TL+ VCQMVL++NNV+KEEL+ 
Sbjct  236   QFKLDGSFS-EDVDSHIRLNKDTLLNSLWKLNVVDIEVTLAHVCQMVLKENNVRKEELKV  294



>gb|EMT15423.1| Chaperone protein dnaJ 10 [Aegilops tauschii]
Length=337

 Score =   394 bits (1013),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 191/316 (60%), Positives = 245/316 (78%), Gaps = 2/316 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             M KETEYYD LGVSP A++ +I+KAYYIKARQVHPDKNP+DP A+  FQ LGEAYQVLSD
Sbjct  1     MAKETEYYDALGVSPAASDDEIRKAYYIKARQVHPDKNPDDPQASDKFQALGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR+AYD YGK+ IS + I+D A +F +LFGSELFEDYIG LAMA+MAS ++ + G+  
Sbjct  61    PLQRKAYDGYGKTSISRDNILDGALVFTLLFGSELFEDYIGHLAMATMASSEMAS-GDNG  119

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
              A+KLQ++++ VQREREEKLA  L   L+ YV G  E F   AE+E  RLS+ +Y +D+ 
Sbjct  120   SAEKLQDRLKGVQREREEKLARFLNKFLSRYVSGDTEGFAHRAESEAKRLSSTSYALDIR  179

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
              TIGY+Y+RQAAKELGKKA+YLGVPF+ EW RNKGH  +SQ+TAA GA  L+QLQE+  R
Sbjct  180   RTIGYVYSRQAAKELGKKAMYLGVPFLTEWVRNKGHLWRSQITAAKGALQLLQLQEEACR  239

Query  1056  QLSAEGN-YTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELR  880
             Q + +G   TE++++  M+ +K +M+ S+WKLNV DIE TL  VC+MVL +NNVKKE+L+
Sbjct  240   QSAKDGGAATEKDVDMQMRMNKDLMMSSIWKLNVVDIEVTLLHVCEMVLHENNVKKEDLK  299

Query  879   ARAKGLKTLGKVFQRV  832
             ARA  L+ LGK+FQ +
Sbjct  300   ARAMALRNLGKIFQGI  315



>ref|XP_008791145.1| PREDICTED: chaperone protein dnaJ 10-like [Phoenix dactylifera]
 ref|XP_008791146.1| PREDICTED: chaperone protein dnaJ 10-like [Phoenix dactylifera]
 ref|XP_008791147.1| PREDICTED: chaperone protein dnaJ 10-like [Phoenix dactylifera]
Length=342

 Score =   393 bits (1010),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 191/320 (60%), Positives = 247/320 (77%), Gaps = 4/320 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYD+LGV+  A+ A+IKKAYYIKAR VHPDKNP DP AA NFQVLGEAYQVLSD
Sbjct  1     MVKETEYYDILGVNVDASAAEIKKAYYIKARVVHPDKNPGDPKAAHNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGE--  1423
             PA+R+AYD +GK G+  ++++DP+A+F MLFGSE FEDY+GQLA+A++AS++I  + +  
Sbjct  61    PAKREAYDRHGKEGLPQDSMVDPSAVFGMLFGSEFFEDYVGQLALATIASVEIEEESQAP  120

Query  1422  EFDAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVD  1243
             E   +K QEK++ +Q+ERE+KL + LK+RL+ YVQG K+EF   A +E  RLS AA+G  
Sbjct  121   EVRRQKFQEKIKALQKEREQKLIQNLKDRLHPYVQGQKDEFVRWANSEARRLSQAAFGEA  180

Query  1242  MLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDM  1063
             ML+TIGYIY RQA++ELGK  +++GVPFIAEW R+KGH IKSQV AA GA +LIQLQE M
Sbjct  181   MLHTIGYIYARQASRELGKNILFMGVPFIAEWVRDKGHHIKSQVNAAAGAISLIQLQEGM  240

Query  1062  KRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEEL  883
             K+   +E    +      ++  K +M+ SLWK+NV DIE+TLS VCQ VL+DN+V K+ L
Sbjct  241   KKMDESENKQEDFLKS--IEEKKDVMLSSLWKINVVDIESTLSHVCQAVLKDNSVSKDVL  298

Query  882   RARAKGLKTLGKVFQRVKSV  823
             + RAK LK LG VFQ  KS+
Sbjct  299   KLRAKALKKLGTVFQGAKSL  318



>ref|XP_001782078.1| predicted protein [Physcomitrella patens]
 gb|EDQ53142.1| predicted protein [Physcomitrella patens]
Length=329

 Score =   392 bits (1008),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 186/313 (59%), Positives = 241/313 (77%), Gaps = 0/313 (0%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYY+VLGV P AT + IKKAYY+KAR VHPDKNPNDP AA NFQVLGEAYQ+LSD
Sbjct  1     MVKETEYYEVLGVQPEATASDIKKAYYMKARAVHPDKNPNDPEAAHNFQVLGEAYQILSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P +R+ YD +GK  +S +A++DPAA+F MLFGS+ F+DY+GQLAMASMAS+D   +G+  
Sbjct  61    PQKRETYDKFGKPTVSQDAMMDPAAVFGMLFGSDAFQDYVGQLAMASMASMDTDVNGQPV  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D ++ Q K +  QRERE +LA +L  R++ YV+G K+ F   A+ E  +L  A +G +ML
Sbjct  121   DMREAQAKFKEAQREREAQLAVLLLERIDRYVKGDKQGFTTWAQEEGLQLVEAVFGEEML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             +TIGYIY RQAAKE+GK   +LGVPF+ EW R+KGHFIKSQVTAA GA  L+Q+Q+D+K+
Sbjct  181   HTIGYIYARQAAKEMGKNLFFLGVPFLTEWVRDKGHFIKSQVTAAAGAIQLMQMQDDLKK  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
              + A     +E +E Y+++ +K+M+DSLWKLNVADIE TLS VCQ VL+ + VKK+ LR 
Sbjct  241   AMEASDRNGDEAVESYLEAKQKVMLDSLWKLNVADIELTLSHVCQAVLRQSGVKKDVLRQ  300

Query  876   RAKGLKTLGKVFQ  838
             RAK LK +G +FQ
Sbjct  301   RAKALKKMGAIFQ  313



>gb|EMS64829.1| Chaperone protein dnaJ 10 [Triticum urartu]
Length=444

 Score =   397 bits (1019),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 193/317 (61%), Positives = 245/317 (77%), Gaps = 2/317 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             M KETEYYD LGVSP A++ +I+KAYYIKARQVHPDKNP+DP A+  FQ LGEAYQVLSD
Sbjct  1     MAKETEYYDALGVSPAASDDEIRKAYYIKARQVHPDKNPDDPQASDKFQALGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR+AYD YGK+ IS + I+D A +F +LFGSELFEDYIG LAMA+MAS ++   G+  
Sbjct  61    PLQRKAYDGYGKTSISRDNILDGALVFTLLFGSELFEDYIGHLAMATMASSEM-ASGDNG  119

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
              A+KLQ++++ VQREREEKLA  L   L+ YV G  E F   AE+E  RLS+ +Y +D+ 
Sbjct  120   SAEKLQDRLKGVQREREEKLARFLNKFLSQYVSGDTEGFVHRAESEAKRLSSTSYALDIR  179

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
              TIGY+Y+RQAAKELGKKA+YLGVPF+ EW RNKGH  +SQ+TAA GA  L+QLQE+  R
Sbjct  180   RTIGYVYSRQAAKELGKKAMYLGVPFLTEWVRNKGHLWRSQITAAKGALQLLQLQEEACR  239

Query  1056  QLSAEGN-YTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELR  880
             Q + +G   TE++++  M+ +K +M+ S+WKLNV DIE TL  VC+MVL +NNVKKE+L+
Sbjct  240   QSAKDGGAATEKDVDMQMRMNKDLMMSSIWKLNVVDIEVTLLHVCEMVLHENNVKKEDLK  299

Query  879   ARAKGLKTLGKVFQRVK  829
             ARA  L+ LGK+FQR K
Sbjct  300   ARAMALRNLGKIFQREK  316



>ref|XP_001784549.1| predicted protein [Physcomitrella patens]
 gb|EDQ50614.1| predicted protein [Physcomitrella patens]
Length=317

 Score =   390 bits (1003),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 188/316 (59%), Positives = 243/316 (77%), Gaps = 1/316 (0%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MV E EYY+VLGV P AT A+IKKAYY+KAR VHPDKNPNDP AA NFQVLGEAYQ+LSD
Sbjct  1     MVSEMEYYNVLGVLPEATPAEIKKAYYMKARLVHPDKNPNDPEAANNFQVLGEAYQILSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P +R+AYD +GK G+S EA++DP+A+F MLFGS+ FEDYIGQLAMASMA +D   + +  
Sbjct  61    PQKREAYDKFGKPGVSQEAMVDPSAVFGMLFGSDAFEDYIGQLAMASMAGMDTGVEAQNI  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D  +++ +M+ VQ+EREEKLA++L +R+  YV G K++F   A  E   L +AA+G  ML
Sbjct  121   DLGQVRTEMKEVQKEREEKLAKLLLDRIAPYVTGDKDDFVNWARNERETLKDAAFGEPML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             +TIGYIY RQAAK+LGKK  +LGVPF+ EW R+KGH+IKSQV+AA G   ++Q+QED+K+
Sbjct  181   HTIGYIYQRQAAKQLGKKLCFLGVPFVTEWLRSKGHYIKSQVSAAVGVLQIMQMQEDLKK  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             Q+ A G   E+ +E Y+ S +++M+ +LWKLNVADIE TL+ VCQ +L D  V K+EL  
Sbjct  241   QIEA-GQVEEQGVEAYLASKQEMMLGNLWKLNVADIEFTLTNVCQRILNDPKVSKDELTT  299

Query  876   RAKGLKTLGKVFQRVK  829
             RAK LK LG+VFQ  K
Sbjct  300   RAKALKKLGQVFQVCK  315



>ref|XP_004165569.1| PREDICTED: chaperone protein dnaJ 10-like, partial [Cucumis sativus]
Length=375

 Score =   392 bits (1008),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 188/313 (60%), Positives = 247/313 (79%), Gaps = 2/313 (1%)
 Frame = -2

Query  1746  LGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSDPAQRQAYDAY  1567
             LGV P A+E +I+KAYY KA+QVHPDKN NDP AA+ FQ LGEAYQVLSD  QR AYD  
Sbjct  1     LGVRPSASEEEIRKAYYHKAKQVHPDKNLNDPQAAERFQALGEAYQVLSDAVQRNAYDRN  60

Query  1566  GKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEFDAKKLQEKMR  1387
             GK  ++ E+++DP A+FA+LFGSELFE+YIG LA+ASMAS ++  + E  + ++L +K++
Sbjct  61    GKHSVTRESMLDPTAVFALLFGSELFENYIGHLAVASMASSEL--ESESGNPERLHDKLK  118

Query  1386  VVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDMLNTIGYIYTRQ  1207
              VQ+EREEKLA IL++ LN YVQG K+ F  HAE+E  RLS+AA+GV++L+TIGYIY+RQ
Sbjct  119   AVQKEREEKLARILEDFLNQYVQGDKDGFLQHAESEAKRLSDAAFGVNILHTIGYIYSRQ  178

Query  1206  AAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKRQLSAEGNYTe  1027
             AA+ELGK+AIYLGVPF+AEWFRNKGHF KSQ+TAA GAF L+QLQ+D+ RQ   +G+   
Sbjct  179   AAQELGKRAIYLGVPFVAEWFRNKGHFWKSQITAAKGAFQLLQLQDDISRQFKMDGSGPG  238

Query  1026  eeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRARAKGLKTLGK  847
              ++E ++Q++K   ++SLW+LNV DIE TL  VCQMVL+D  V+KE+L+ARA  LK LGK
Sbjct  239   TDIESHIQANKDTFLNSLWRLNVVDIELTLINVCQMVLRDTTVRKEDLKARALALKVLGK  298

Query  846   VFQRVKSVNGNET  808
             +FQ+ K    + T
Sbjct  299   IFQQEKQAQDSGT  311



>ref|XP_004961342.1| PREDICTED: chaperone protein dnaJ 10-like isoform X1 [Setaria 
italica]
 ref|XP_004961343.1| PREDICTED: chaperone protein dnaJ 10-like isoform X2 [Setaria 
italica]
Length=338

 Score =   389 bits (999),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 202/340 (59%), Positives = 255/340 (75%), Gaps = 10/340 (3%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKE+ YYDVLGVS  A+ A+IKKAYY+KA+ VHPDKNP +P AAQ FQ LGEAYQVLSD
Sbjct  1     MVKESAYYDVLGVSVDASPAEIKKAYYLKAKLVHPDKNPGNPDAAQKFQELGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P +++AYD YGK GI  + +IDPAA+F MLFGS+ FEDY+GQLA+AS+AS++I  +    
Sbjct  61    PGKKEAYDKYGKEGIPQDNMIDPAAVFGMLFGSDYFEDYVGQLALASIASVEIEENANSQ  120

Query  1416  DAK-KLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDM  1240
             +A+ K+QEK++ +Q+ERE+KL + LK+RL  YV G K+EF + A AE  RLS AA+G  M
Sbjct  121   EARAKVQEKIKELQKEREQKLTQSLKDRLQPYVDGRKDEFVSWASAEARRLSQAAFGEAM  180

Query  1239  LNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMK  1060
             L+TIGYIY RQAA+ELGK  IY+GVPFIAEW R+KGH IKSQV AA+GA +LIQLQE MK
Sbjct  181   LHTIGYIYVRQAARELGKSRIYMGVPFIAEWVRDKGHHIKSQVNAASGAISLIQLQEGMK  240

Query  1059  RQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELR  880
             +   +E N  EE+L +  +  K+ M+ SLWK+NV DIE+TLS VCQ VL+DN V K+ L+
Sbjct  241   KMEGSEDN--EEQLMKSFEEKKEAMLGSLWKINVVDIESTLSHVCQAVLKDNTVSKDVLK  298

Query  879   ARAKGLKTLGKVFQRVKSV----NGNETETSAN---TPVQ  781
              RAK LK LG +FQ  KS+    N    ETS +   TP Q
Sbjct  299   LRAKALKKLGTIFQGAKSLYRRENSLRVETSTDQQATPSQ  338



>ref|XP_010922833.1| PREDICTED: chaperone protein dnaJ 10-like [Elaeis guineensis]
 ref|XP_010922841.1| PREDICTED: chaperone protein dnaJ 10-like [Elaeis guineensis]
 ref|XP_010922849.1| PREDICTED: chaperone protein dnaJ 10-like [Elaeis guineensis]
 ref|XP_010922856.1| PREDICTED: chaperone protein dnaJ 10-like [Elaeis guineensis]
 ref|XP_010922862.1| PREDICTED: chaperone protein dnaJ 10-like [Elaeis guineensis]
Length=342

 Score =   389 bits (1000),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 187/320 (58%), Positives = 250/320 (78%), Gaps = 4/320 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVK+TEYYD+LGVS  A+ A+IKKAYYIKAR VHPDKNP DP AA NFQVLGEAYQ+LSD
Sbjct  1     MVKDTEYYDILGVSVDASSAEIKKAYYIKARLVHPDKNPGDPKAAHNFQVLGEAYQILSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             PA+R+AYD +GK G+  ++++DP+A+F MLFGSE FEDY+GQLA+A++AS+++  + +  
Sbjct  61    PAKREAYDKHGKEGLLQDSMVDPSAVFGMLFGSEFFEDYVGQLALATIASVEVEEESQAL  120

Query  1416  DAK--KLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVD  1243
             + +  K+QEK++ +Q+ERE+KL + LK+RL+ YVQG K+EF   A +E  RLS AA+G  
Sbjct  121   EVRKQKVQEKIKALQKEREQKLIQNLKDRLHPYVQGQKDEFVRWANSEARRLSQAAFGEA  180

Query  1242  MLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDM  1063
             ML+TIGYIY RQAA+ELGK  +++GVPFIAEW R+KGH +KSQV AA GA +L+QLQE M
Sbjct  181   MLHTIGYIYARQAARELGKNILFMGVPFIAEWVRDKGHHVKSQVNAAAGAISLMQLQEGM  240

Query  1062  KRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEEL  883
              +   +E    EE+  + ++  K  M+ SLWK+NV DIE+TLS VCQ VL+DN+V K+ L
Sbjct  241   NKMEGSENR--EEDFLKSIEEKKDAMLSSLWKINVLDIESTLSHVCQAVLKDNSVSKDVL  298

Query  882   RARAKGLKTLGKVFQRVKSV  823
             ++RAK LK LG +FQ  KS+
Sbjct  299   KSRAKALKKLGTIFQGAKSL  318



>ref|XP_004150069.1| PREDICTED: chaperone protein dnaJ 10-like [Cucumis sativus]
 ref|XP_004168811.1| PREDICTED: chaperone protein dnaJ 10-like [Cucumis sativus]
 gb|KGN61821.1| hypothetical protein Csa_2G249270 [Cucumis sativus]
Length=339

 Score =   386 bits (992),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 194/325 (60%), Positives = 248/325 (76%), Gaps = 4/325 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKET YYDVLGVS  A+ A+IKKAYY+KAR VHPDKN  DP AA NFQVLGEAYQVLSD
Sbjct  1     MVKETGYYDVLGVSFDASSAEIKKAYYVKARLVHPDKNQGDPKAAANFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTD--GE  1423
             P +R AYD YGK+G+  +A++DPAA+F MLFGSE FE+Y+GQLA+A ++SL+I  D    
Sbjct  61    PEKRDAYDKYGKAGVQQDAMVDPAAVFGMLFGSEFFEEYVGQLALAVLSSLEIEDDTPDS  120

Query  1422  EFDAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVD  1243
             E   +K+QEK+R+ Q+ERE+KLA ILK+RL  YV G  +EF   A +E  RLS+AA+G  
Sbjct  121   ELRRQKIQEKIRLFQKEREDKLANILKDRLQPYVIGQVDEFVTWASSEARRLSSAAFGET  180

Query  1242  MLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDM  1063
             ML+TIGYIYTR+AAKELGK   Y+ VPF+AEW R+KGH IKSQV AA+GA +LIQLQE++
Sbjct  181   MLHTIGYIYTRKAAKELGKDRRYMNVPFLAEWVRDKGHQIKSQVMAASGAVSLIQLQEEL  240

Query  1062  KRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEEL  883
             KR    EG+  +E L + ++  K  +++SLW++NV DIE+TLSRVCQ+VL+D NV K+ L
Sbjct  241   KRL--NEGDNRDENLAKAIEEKKDAVLNSLWQINVVDIESTLSRVCQVVLRDPNVSKDVL  298

Query  882   RARAKGLKTLGKVFQRVKSVNGNET  808
             + RA+GL+  G +FQ  KS    E 
Sbjct  299   KLRARGLRKFGAIFQGAKSAYSREN  323



>gb|KDO47878.1| hypothetical protein CISIN_1g017985mg [Citrus sinensis]
Length=363

 Score =   387 bits (994),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 194/330 (59%), Positives = 249/330 (75%), Gaps = 4/330 (1%)
 Frame = -2

Query  1791  GNSRSMVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAY  1612
             G  ++MVK+T YYDVLGV+  A+ A+IKKAYY+KAR VHPDKNP DP AA+NFQVLGEAY
Sbjct  19    GEKKAMVKDTAYYDVLGVNVDASPAEIKKAYYLKARIVHPDKNPGDPKAAKNFQVLGEAY  78

Query  1611  QVLSDPAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFT  1432
             QVLSDP +R+AYD +GK GI  ++++D AA+F M+FGSE FEDYIGQLA+A+MAS+++  
Sbjct  79    QVLSDPEKREAYDKHGKEGIPQDSMVDAAAVFGMIFGSEYFEDYIGQLALATMASVEVEE  138

Query  1431  DGEEFDA--KKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNA  1258
             D ++ +    K+QEKMR +Q+EREEKL  ILKN L  +V G  +EF   A AE  RLS A
Sbjct  139   DKQDIEVYKHKIQEKMRAMQKEREEKLITILKNHLEPFVDGRADEFVKWANAEARRLSGA  198

Query  1257  AYGVDMLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQ  1078
             A+G  ML+TIGYIYTR+AAKELGK   Y+ VPF+AEW R+KGH IKSQV+AA+GA +LIQ
Sbjct  199   AFGEAMLHTIGYIYTRRAAKELGKDKRYMKVPFLAEWVRDKGHLIKSQVSAASGAVSLIQ  258

Query  1077  LQEDMKRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNV  898
             +QE++K+    E    EE L + +++ K  M+ SLW++NV DIETTLSRVCQ VL+D +V
Sbjct  259   IQEELKKLNQLENK--EENLMKAIEAKKDAMLQSLWQINVVDIETTLSRVCQAVLKDPSV  316

Query  897   KKEELRARAKGLKTLGKVFQRVKSVNGNET  808
              KE L+ RAK LK LG +FQ  K+    E 
Sbjct  317   SKETLKLRAKALKKLGTIFQGAKAAYSREN  346



>ref|XP_008460969.1| PREDICTED: chaperone protein dnaJ 10-like [Cucumis melo]
 ref|XP_008460970.1| PREDICTED: chaperone protein dnaJ 10-like [Cucumis melo]
Length=339

 Score =   385 bits (990),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 194/325 (60%), Positives = 246/325 (76%), Gaps = 4/325 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKET YYDVLGVS  A+ A+IKKAYY+KAR VHPDKN  DP AA+NFQVLGEAYQVLSD
Sbjct  1     MVKETGYYDVLGVSFDASSAEIKKAYYVKARLVHPDKNQGDPKAAENFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTD--GE  1423
             P +R+AYD YGK+G+  EA++DPAA+F MLFGSE FE+Y+GQLA+A ++SL+I  D    
Sbjct  61    PEKREAYDKYGKAGVQQEAMVDPAAVFGMLFGSEFFEEYVGQLALAVLSSLEIEDDTPDS  120

Query  1422  EFDAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVD  1243
             E   +K+QEK+R+ Q+ERE+KL  ILK RL  YV G  +EF   A  E  RLS AA+G  
Sbjct  121   ELRRQKIQEKLRLFQKEREDKLVNILKERLQPYVDGQVDEFVQWASLEARRLSCAAFGET  180

Query  1242  MLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDM  1063
             ML+TIGYIYTR+AAKELGK   Y+ VPF+AEW R+KGH IKSQV AA+GA +LIQLQE++
Sbjct  181   MLHTIGYIYTRKAAKELGKDRRYMNVPFLAEWVRDKGHQIKSQVMAASGAVSLIQLQEEL  240

Query  1062  KRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEEL  883
             KR    EG+  +E L + ++  K  +++SLW++NV DIE+TLSRVCQ+VL+D NV K+ L
Sbjct  241   KR--LNEGDNRDENLAKAIEEKKDAVLNSLWQINVVDIESTLSRVCQVVLRDPNVSKDVL  298

Query  882   RARAKGLKTLGKVFQRVKSVNGNET  808
             + RA+GL+  G +FQ  KS    E 
Sbjct  299   KLRARGLRKFGAIFQGAKSAYSREN  323



>ref|XP_010231083.1| PREDICTED: chaperone protein dnaJ 10-like [Brachypodium distachyon]
Length=338

 Score =   385 bits (989),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 197/338 (58%), Positives = 252/338 (75%), Gaps = 4/338 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKET YYD LGVS  A+ A+IKKAYY+KA+ VHPDKNP +P AA  FQ LGEAYQVLSD
Sbjct  1     MVKETVYYDTLGVSVDASPAEIKKAYYVKAKLVHPDKNPGNPDAAVKFQELGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             PA+++AYD +GK G++ + ++DPAA+F MLFGS+ FEDY+GQLA+AS+AS++I       
Sbjct  61    PAKKEAYDKHGKDGLAQDNMVDPAAVFGMLFGSDYFEDYVGQLALASIASVEIDEGSSNQ  120

Query  1416  DAK-KLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDM  1240
             +A+ K+QEK++ +Q+ERE+KL + LK+RL  YV G K+EF   A AE  RLS AA+G  M
Sbjct  121   EARAKVQEKIKELQKEREQKLIQSLKDRLQPYVDGRKDEFVEWANAEARRLSQAAFGEAM  180

Query  1239  LNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMK  1060
             L+T+GYIY RQA++ELGK  +Y+GVPFIAEW R+KGH IKSQV AA+GA ALIQLQE MK
Sbjct  181   LHTVGYIYVRQASRELGKNKLYMGVPFIAEWVRDKGHIIKSQVNAASGAIALIQLQEGMK  240

Query  1059  RQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELR  880
             +    EG   EE+L +  +  K  M++SLWK+NV DIE+TLSRVCQ VL+DN V K+ L+
Sbjct  241   KM--EEGANKEEQLMKSFEEKKDAMLNSLWKINVVDIESTLSRVCQAVLKDNTVSKDVLK  298

Query  879   ARAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGS  766
              RAK LK LG + Q VKS+   E      TP  K DG+
Sbjct  299   LRAKALKKLGTILQGVKSLYHRENSLRVETPT-KQDGT  335



>ref|XP_010645323.1| PREDICTED: chaperone protein dnaJ 10 [Vitis vinifera]
 emb|CBI37687.3| unnamed protein product [Vitis vinifera]
Length=336

 Score =   384 bits (986),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 191/340 (56%), Positives = 258/340 (76%), Gaps = 5/340 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYD+LGVS  A+ + IKKAYYIKAR VHPDKNP DP AAQNFQVLGEAYQVLSD
Sbjct  1     MVKETEYYDILGVSIDASASDIKKAYYIKARVVHPDKNPGDPRAAQNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P +R+AYD +GK+G+  ++++DP+A+F M+FGS+LFEDY+GQLA+AS+AS+++  + E+ 
Sbjct  61    PEKREAYDKHGKAGVQEDSMLDPSAVFGMVFGSDLFEDYVGQLALASLASVEVEENTED-  119

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
               +++++KMR +Q+EREEKL  ILKNRL +++ G  +EF   A++E  RLS AA+G  ML
Sbjct  120   RTQQIRDKMRALQKEREEKLITILKNRLELFIDGQTDEFVNWAKSEARRLSKAAFGEAML  179

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             +T+GYIYTR+AAKELGK   Y+ VPF+AEW RNKGH IKSQV AA+GA +LIQ+QE++K+
Sbjct  180   HTVGYIYTRKAAKELGKDIKYMKVPFLAEWVRNKGHQIKSQVMAASGAVSLIQIQEELKK  239

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
                 +G   EE + + +   K  M++SLW++NV DIE+TLS VCQ VL+D +V K+ L+ 
Sbjct  240   L--NQGENKEENIMKVIDDKKDAMLNSLWQINVVDIESTLSHVCQAVLKDPSVSKDVLKL  297

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPS  757
             RAK LK LG +FQ  K++     E S      K+ G+ PS
Sbjct  298   RAKALKKLGTIFQGAKALYSR--ENSLRHENDKIPGAGPS  335



>ref|XP_009106281.1| PREDICTED: chaperone protein dnaJ 10 [Brassica rapa]
 ref|XP_009106992.1| PREDICTED: chaperone protein dnaJ 10 [Brassica rapa]
 emb|CDY41966.1| BnaA01g05380D [Brassica napus]
Length=344

 Score =   384 bits (986),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 195/342 (57%), Positives = 251/342 (73%), Gaps = 4/342 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKE+EYYDVLGV   A+ A IKKAYYIKARQVHPDKNPNDP AA+NFQVLGEAYQVLSD
Sbjct  1     MVKESEYYDVLGVKTDASAADIKKAYYIKARQVHPDKNPNDPQAAKNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P +R AYD YGK G+  +A++DPAA+F MLFGSELFEDYIGQLA+AS+ASLD   +  E 
Sbjct  61    PEKRTAYDNYGKEGVQQDAMVDPAAVFGMLFGSELFEDYIGQLALASIASLDAEVESHEP  120

Query  1416  DAKK--LQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVD  1243
             + +K  LQ+K++ +Q+ERE+KL   LKN+L  +V+G  +EF   A AE  RLS A +G  
Sbjct  121   EIRKKLLQDKIKAMQKEREDKLVTTLKNKLEPFVEGQTDEFVNWATAEARRLSTAGFGEA  180

Query  1242  MLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDM  1063
             ML+T+GYIYTR+AAKELGK    + VPF+AEW R+KGH IKSQV AA+GA +L+ LQ+++
Sbjct  181   MLHTVGYIYTRKAAKELGKDKRLMKVPFLAEWVRDKGHQIKSQVMAASGAVSLLVLQDEV  240

Query  1062  KRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEEL  883
              +    +G   EE +++ +++ K  M+ SLW++NV DIE+TLSRVCQ VL+D +V K+ L
Sbjct  241   SK--LNQGENREEHIQKAIEAKKDAMLQSLWQINVLDIESTLSRVCQAVLKDPSVSKDVL  298

Query  882   RARAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPS  757
             RARA+GL+ LG +FQ  K     E          KLD  + S
Sbjct  299   RARARGLRKLGNIFQGSKKPYSRENSLRHEGAAVKLDAGDSS  340



>ref|XP_006847639.1| hypothetical protein AMTR_s00014p00255630 [Amborella trichopoda]
 gb|ERN09220.1| hypothetical protein AMTR_s00014p00255630 [Amborella trichopoda]
Length=343

 Score =   384 bits (985),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 186/320 (58%), Positives = 246/320 (77%), Gaps = 4/320 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYD+LGV+  A+ A+IKKAYY+KARQVHPDKNP+DP AA NFQVLGEAYQVLSD
Sbjct  1     MVKETEYYDILGVTLDASAAEIKKAYYLKARQVHPDKNPDDPQAAHNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGE--  1423
             P +R+AYD  GK+ ++ E+++DP+A+F MLFGSE+FEDY+GQ  +ASMA++++  + +  
Sbjct  61    PGKREAYDKNGKACVAQESMMDPSAVFGMLFGSEIFEDYVGQFTLASMATVELEEESQVP  120

Query  1422  EFDAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVD  1243
             E   +K+ EKM+ +Q +RE  L +ILK+RL  YV G K EF   A +E  RLS A++G  
Sbjct  121   EERRQKIHEKMKEIQNKREATLIQILKDRLQPYVDGRKNEFVKLANSEARRLSQASFGEA  180

Query  1242  MLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDM  1063
             ML+T+GYIYTRQAAK++GK  +++GVPFIAEW R+KGH IKSQVTAA+GA ALIQ+QE +
Sbjct  181   MLHTVGYIYTRQAAKQIGKNILFMGVPFIAEWVRDKGHHIKSQVTAASGAVALIQIQEGL  240

Query  1062  KRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEEL  883
             K+    E N  +E L ++++  K  M++SLWK+NV DIE+TLS VCQ VLQDN   K+ L
Sbjct  241   KKLEQGENN--QENLLKHIEEKKDAMVNSLWKINVVDIESTLSHVCQAVLQDNTAPKDIL  298

Query  882   RARAKGLKTLGKVFQRVKSV  823
             + RAK LK LG +FQ  K +
Sbjct  299   KLRAKALKKLGTIFQGAKDL  318



>ref|NP_001131263.1| uncharacterized protein LOC100192576 [Zea mays]
 ref|XP_008654300.1| PREDICTED: uncharacterized protein LOC100192576 isoform X1 [Zea 
mays]
 gb|ACF79597.1| unknown [Zea mays]
 gb|ACF85183.1| unknown [Zea mays]
 gb|AFW80965.1| chaperone protein dnaJ 10 isoform 1 [Zea mays]
 gb|AFW80966.1| chaperone protein dnaJ 10 isoform 2 [Zea mays]
 gb|AFW80967.1| chaperone protein dnaJ 10 isoform 3 [Zea mays]
Length=338

 Score =   384 bits (985),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 195/333 (59%), Positives = 250/333 (75%), Gaps = 7/333 (2%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVK++ YYDVLGVS  A+ A+IKKAYYIKA+ VHPDKNP +P AA  FQ LGEAYQVLSD
Sbjct  1     MVKDSAYYDVLGVSVDASSAEIKKAYYIKAKLVHPDKNPGNPDAALKFQELGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P +++AYD YGK GI  + ++DPAA+F M+FGS+ FEDY+GQLA+AS+AS+++  +    
Sbjct  61    PGKKEAYDKYGKEGIPQDNMVDPAAVFGMIFGSDYFEDYVGQLALASIASVEVDENSNSQ  120

Query  1416  DAK-KLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDM  1240
             +A+ K+QEK++ +QRERE+KL + LK+RL  YV   K+EF ++A  E  RLS AA+G  M
Sbjct  121   EARAKVQEKIKELQREREQKLTQSLKDRLQPYVDERKDEFVSYASTEARRLSEAAFGEAM  180

Query  1239  LNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMK  1060
             L+TIGYIY RQAA+ELGK  IY+GVPFIAEW R+KGH IKSQV AA+GA +LIQLQE MK
Sbjct  181   LHTIGYIYVRQAARELGKSRIYMGVPFIAEWVRDKGHHIKSQVNAASGAISLIQLQEGMK  240

Query  1059  RQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELR  880
             +   +E   +EE+L +  +  K  M+ SLWK+NV DIE+TLSRVCQ VL+DN V K+ L+
Sbjct  241   KMEGSEN--SEEQLMKSFEEKKDAMLSSLWKINVVDIESTLSRVCQAVLRDNTVSKDVLK  298

Query  879   ARAKGLKTLGKVFQRVKSV----NGNETETSAN  793
              RAK LK LG +FQ  KS+    N    ETS N
Sbjct  299   LRAKALKKLGTIFQGAKSMYRRENSLRVETSTN  331



>ref|XP_006423369.1| hypothetical protein CICLE_v10028792mg [Citrus clementina]
 ref|XP_006423370.1| hypothetical protein CICLE_v10028792mg [Citrus clementina]
 ref|XP_006487252.1| PREDICTED: chaperone protein dnaJ 10-like isoform X1 [Citrus 
sinensis]
 ref|XP_006487253.1| PREDICTED: chaperone protein dnaJ 10-like isoform X2 [Citrus 
sinensis]
 gb|ESR36609.1| hypothetical protein CICLE_v10028792mg [Citrus clementina]
 gb|ESR36610.1| hypothetical protein CICLE_v10028792mg [Citrus clementina]
 gb|KDO47879.1| hypothetical protein CISIN_1g017985mg [Citrus sinensis]
 gb|KDO47880.1| hypothetical protein CISIN_1g017985mg [Citrus sinensis]
Length=340

 Score =   383 bits (984),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 193/325 (59%), Positives = 246/325 (76%), Gaps = 4/325 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVK+T YYDVLGV+  A+ A+IKKAYY+KAR VHPDKNP DP AA+NFQVLGEAYQVLSD
Sbjct  1     MVKDTAYYDVLGVNVDASPAEIKKAYYLKARIVHPDKNPGDPKAAKNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P +R+AYD +GK GI  ++++D AA+F M+FGSE FEDYIGQLA+A+MAS+++  D ++ 
Sbjct  61    PEKREAYDKHGKEGIPQDSMVDAAAVFGMIFGSEYFEDYIGQLALATMASVEVEEDKQDI  120

Query  1416  DA--KKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVD  1243
             +    K+QEKMR +Q+EREEKL  ILKN L  +V G  +EF   A AE  RLS AA+G  
Sbjct  121   EVYKHKIQEKMRAMQKEREEKLITILKNHLEPFVDGRADEFVKWANAEARRLSGAAFGEA  180

Query  1242  MLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDM  1063
             ML+TIGYIYTR+AAKELGK   Y+ VPF+AEW R+KGH IKSQV+AA+GA +LIQ+QE++
Sbjct  181   MLHTIGYIYTRRAAKELGKDKRYMKVPFLAEWVRDKGHLIKSQVSAASGAVSLIQIQEEL  240

Query  1062  KRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEEL  883
             K+    E    EE L + +++ K  M+ SLW++NV DIETTLSRVCQ VL+D +V KE L
Sbjct  241   KKLNQLENK--EENLMKAIEAKKDAMLQSLWQINVVDIETTLSRVCQAVLKDPSVSKETL  298

Query  882   RARAKGLKTLGKVFQRVKSVNGNET  808
             + RAK LK LG +FQ  K+    E 
Sbjct  299   KLRAKALKKLGTIFQGAKAAYSREN  323



>ref|XP_010912599.1| PREDICTED: chaperone protein dnaJ 10-like isoform X6 [Elaeis 
guineensis]
Length=355

 Score =   384 bits (985),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 180/284 (63%), Positives = 231/284 (81%), Gaps = 2/284 (1%)
 Frame = -2

Query  1770  KETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSDPA  1591
             KETEYYDVLGVSP ATE +I+KAY+ KARQVHPDKNPNDP AA+ FQ LGEAYQVLSDP 
Sbjct  4     KETEYYDVLGVSPSATEEEIRKAYFFKARQVHPDKNPNDPQAAERFQELGEAYQVLSDPV  63

Query  1590  QRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEFDA  1411
             QR+AYD +GK+ +S E ++D  A+F +LFGSE+FEDY+G LA+ASM S ++ +  E+ + 
Sbjct  64    QRRAYDGFGKNSVSRENMLDATAVFTLLFGSEIFEDYVGHLAVASMTSSELTS--EDDNP  121

Query  1410  KKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDMLNT  1231
             +KLQ++++ VQREREEKLA+ L++ LN YV G KE F  HAEAE  RLSN A+GV++L+T
Sbjct  122   EKLQDRLKAVQREREEKLAKFLRDFLNQYVHGDKEGFFHHAEAEAKRLSNTAFGVNILHT  181

Query  1230  IGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKRQL  1051
             IGY+Y RQAAKELGKK IYLGVPF+ EW R KGHF KSQ+TAA GA  L+QLQED+ RQ+
Sbjct  182   IGYVYARQAAKELGKKVIYLGVPFLTEWVRTKGHFWKSQITAAKGALELLQLQEDICRQI  241

Query  1050  SAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQM  919
             + +G+ TE++++ +++ +K +M+DSLWKLNV DIE TL  VCQM
Sbjct  242   NKDGSGTEKDVDLHIRMNKDLMMDSLWKLNVVDIEVTLLHVCQM  285



>ref|XP_010912596.1| PREDICTED: chaperone protein dnaJ 10-like isoform X4 [Elaeis 
guineensis]
Length=378

 Score =   383 bits (984),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 180/284 (63%), Positives = 231/284 (81%), Gaps = 2/284 (1%)
 Frame = -2

Query  1770  KETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSDPA  1591
             KETEYYDVLGVSP ATE +I+KAY+ KARQVHPDKNPNDP AA+ FQ LGEAYQVLSDP 
Sbjct  4     KETEYYDVLGVSPSATEEEIRKAYFFKARQVHPDKNPNDPQAAERFQELGEAYQVLSDPV  63

Query  1590  QRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEFDA  1411
             QR+AYD +GK+ +S E ++D  A+F +LFGSE+FEDY+G LA+ASM S ++ +  E+ + 
Sbjct  64    QRRAYDGFGKNSVSRENMLDATAVFTLLFGSEIFEDYVGHLAVASMTSSELTS--EDDNP  121

Query  1410  KKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDMLNT  1231
             +KLQ++++ VQREREEKLA+ L++ LN YV G KE F  HAEAE  RLSN A+GV++L+T
Sbjct  122   EKLQDRLKAVQREREEKLAKFLRDFLNQYVHGDKEGFFHHAEAEAKRLSNTAFGVNILHT  181

Query  1230  IGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKRQL  1051
             IGY+Y RQAAKELGKK IYLGVPF+ EW R KGHF KSQ+TAA GA  L+QLQED+ RQ+
Sbjct  182   IGYVYARQAAKELGKKVIYLGVPFLTEWVRTKGHFWKSQITAAKGALELLQLQEDICRQI  241

Query  1050  SAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQM  919
             + +G+ TE++++ +++ +K +M+DSLWKLNV DIE TL  VCQM
Sbjct  242   NKDGSGTEKDVDLHIRMNKDLMMDSLWKLNVVDIEVTLLHVCQM  285



>ref|XP_010275568.1| PREDICTED: chaperone protein dnaJ 10-like isoform X1 [Nelumbo 
nucifera]
Length=346

 Score =   382 bits (980),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 189/322 (59%), Positives = 248/322 (77%), Gaps = 3/322 (1%)
 Frame = -2

Query  1785  SRSMVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQV  1606
             S +MVK+TEYYD+LGVS  A+ A+IKKAYY KAR VHPDKNP DP AA NFQVLGEAYQV
Sbjct  3     SEAMVKDTEYYDILGVSIDASPAEIKKAYYAKARLVHPDKNPGDPKAAHNFQVLGEAYQV  62

Query  1605  LSDPAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDG  1426
             LSDPA+R+AYD  GK G+S ++++DP+A+F MLFGSE+FEDYIGQLA+AS++S+D   + 
Sbjct  63    LSDPAKREAYDKNGKEGVSQDSMVDPSAVFGMLFGSEIFEDYIGQLALASLSSVDFEEES  122

Query  1425  EEFDAK-KLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYG  1249
             +  + + K+Q+K++ +Q+EREEKL +ILK+RL  Y+    +EF   A++E S LS AA+G
Sbjct  123   QTPEGRQKVQDKIKEMQKEREEKLIQILKHRLQPYIDNRMDEFVDWAKSEASHLSQAAFG  182

Query  1248  VDMLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQE  1069
               ML+TIGYIYTRQAAKELGK   Y+GVPF+AEW R+KGH IKSQVTAA GA +LIQ+QE
Sbjct  183   EAMLHTIGYIYTRQAAKELGKNMRYMGVPFLAEWVRDKGHHIKSQVTAAAGAVSLIQIQE  242

Query  1068  DMKRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKE  889
             ++++    +G   EE L + ++  K  MI+SLWK+NV DIE TLS VC  VL++ NV K+
Sbjct  243   ELRK--LEQGENKEENLMKQIEEKKDAMINSLWKINVVDIELTLSHVCHAVLKEPNVSKD  300

Query  888   ELRARAKGLKTLGKVFQRVKSV  823
              L+ RA  LK LG +FQ  K++
Sbjct  301   VLKHRANALKKLGTIFQGAKAI  322



>gb|ACG33020.1| chaperone protein dnaJ 10 [Zea mays]
Length=334

 Score =   381 bits (978),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 190/319 (60%), Positives = 245/319 (77%), Gaps = 3/319 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVK++ YYDVLGVS  A+ A+IKKAYYIKA+ VHPDKNP +P AA  FQ LGEAYQVLSD
Sbjct  1     MVKDSAYYDVLGVSVDASSAEIKKAYYIKAKLVHPDKNPGNPDAALKFQELGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P +++AYD YGK GI  + ++DPAA+F M+FGS+ FEDY+GQLA+AS+AS+++  +    
Sbjct  61    PGKKEAYDKYGKEGIPQDNMVDPAAVFGMIFGSDYFEDYVGQLALASIASVEVDENSNSQ  120

Query  1416  DAK-KLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDM  1240
             +A+ K+QEK++ +QRERE+KL + LK+RL  YV   K+EF ++A  E  RLS AA+G  M
Sbjct  121   EARAKVQEKIKELQREREQKLTQSLKDRLQPYVDERKDEFVSYASTEARRLSEAAFGEAM  180

Query  1239  LNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMK  1060
             L+TIGYIY RQAA+ELGK  IY+GVPFIAEW R+KGH IKSQV AA+GA +LIQLQE MK
Sbjct  181   LHTIGYIYVRQAARELGKSRIYMGVPFIAEWVRDKGHHIKSQVNAASGAISLIQLQEGMK  240

Query  1059  RQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELR  880
             +   +E   +EE+L +  +  K  M+ SLWK+NV DIE+TLSRVCQ VL+DN V K+ L+
Sbjct  241   KMEGSEN--SEEQLMKSFEEKKDAMLSSLWKINVVDIESTLSRVCQAVLRDNTVSKDVLK  298

Query  879   ARAKGLKTLGKVFQRVKSV  823
              RAK LK LG +FQ  KS+
Sbjct  299   LRAKALKKLGTIFQGAKSM  317



>ref|XP_004511002.1| PREDICTED: chaperone protein dnaJ 10-like isoform X1 [Cicer arietinum]
Length=339

 Score =   380 bits (977),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 191/318 (60%), Positives = 245/318 (77%), Gaps = 4/318 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKET YYD+LGVS  A  A IKKAYY+KAR VHPDKNP DP AAQNFQ+LGEAYQVLSD
Sbjct  1     MVKETLYYDILGVSSDAPAADIKKAYYVKARIVHPDKNPGDPKAAQNFQMLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P +R+AYD  GK+G+S ++++DP  +F MLFGSE FE+YIG+LA+AS+AS++I  D  E 
Sbjct  61    PEKREAYDKNGKAGVSEDSMMDPTTVFGMLFGSEFFEEYIGKLALASLASIEIEEDSLEP  120

Query  1416  DAK--KLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVD  1243
              A+  ++QEKM+  Q+ERE+KL  +LK+RL  +V G ++EF A A +E S LS AA+G  
Sbjct  121   QARMQRIQEKMKAWQKEREQKLISVLKDRLQPFVDGREDEFTAWANSEASNLSKAAFGEA  180

Query  1242  MLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDM  1063
             ML+TIGYIYTR+AAKELGK   ++ VPFIAEW R+KGH IKSQVTAA+GA +LIQ+QE++
Sbjct  181   MLHTIGYIYTRKAAKELGKDIRFMNVPFIAEWVRDKGHRIKSQVTAASGAVSLIQVQEEL  240

Query  1062  KRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEEL  883
             K+    +G   EE + + ++  K  MI+SLWK+NV DIE+TLS VCQ VL+D +V K+ L
Sbjct  241   KKL--NQGENKEENIIKALEDKKDAMINSLWKINVIDIESTLSHVCQAVLKDPSVSKDVL  298

Query  882   RARAKGLKTLGKVFQRVK  829
             R+RAK LK LG VFQ  K
Sbjct  299   RSRAKALKKLGTVFQGAK  316



>ref|XP_004511003.1| PREDICTED: chaperone protein dnaJ 10-like isoform X2 [Cicer arietinum]
Length=314

 Score =   379 bits (974),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 190/315 (60%), Positives = 244/315 (77%), Gaps = 4/315 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKET YYD+LGVS  A  A IKKAYY+KAR VHPDKNP DP AAQNFQ+LGEAYQVLSD
Sbjct  1     MVKETLYYDILGVSSDAPAADIKKAYYVKARIVHPDKNPGDPKAAQNFQMLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P +R+AYD  GK+G+S ++++DP  +F MLFGSE FE+YIG+LA+AS+AS++I  D  E 
Sbjct  61    PEKREAYDKNGKAGVSEDSMMDPTTVFGMLFGSEFFEEYIGKLALASLASIEIEEDSLEP  120

Query  1416  DAK--KLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVD  1243
              A+  ++QEKM+  Q+ERE+KL  +LK+RL  +V G ++EF A A +E S LS AA+G  
Sbjct  121   QARMQRIQEKMKAWQKEREQKLISVLKDRLQPFVDGREDEFTAWANSEASNLSKAAFGEA  180

Query  1242  MLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDM  1063
             ML+TIGYIYTR+AAKELGK   ++ VPFIAEW R+KGH IKSQVTAA+GA +LIQ+QE++
Sbjct  181   MLHTIGYIYTRKAAKELGKDIRFMNVPFIAEWVRDKGHRIKSQVTAASGAVSLIQVQEEL  240

Query  1062  KRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEEL  883
             K+    +G   EE + + ++  K  MI+SLWK+NV DIE+TLS VCQ VL+D +V K+ L
Sbjct  241   KKL--NQGENKEENIIKALEDKKDAMINSLWKINVIDIESTLSHVCQAVLKDPSVSKDVL  298

Query  882   RARAKGLKTLGKVFQ  838
             R+RAK LK LG VFQ
Sbjct  299   RSRAKALKKLGTVFQ  313



>ref|XP_010275569.1| PREDICTED: chaperone protein dnaJ 10-like isoform X2 [Nelumbo 
nucifera]
 ref|XP_010275570.1| PREDICTED: chaperone protein dnaJ 10-like isoform X2 [Nelumbo 
nucifera]
 ref|XP_010275571.1| PREDICTED: chaperone protein dnaJ 10-like isoform X2 [Nelumbo 
nucifera]
 ref|XP_010275572.1| PREDICTED: chaperone protein dnaJ 10-like isoform X2 [Nelumbo 
nucifera]
 ref|XP_010275573.1| PREDICTED: chaperone protein dnaJ 10-like isoform X2 [Nelumbo 
nucifera]
 ref|XP_010275574.1| PREDICTED: chaperone protein dnaJ 10-like isoform X2 [Nelumbo 
nucifera]
 ref|XP_010275576.1| PREDICTED: chaperone protein dnaJ 10-like isoform X2 [Nelumbo 
nucifera]
Length=341

 Score =   380 bits (975),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 190/319 (60%), Positives = 247/319 (77%), Gaps = 3/319 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVK+TEYYD+LGVS  A+ A+IKKAYY KAR VHPDKNP DP AA NFQVLGEAYQVLSD
Sbjct  1     MVKDTEYYDILGVSIDASPAEIKKAYYAKARLVHPDKNPGDPKAAHNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             PA+R+AYD  GK G+S ++++DP+A+F MLFGSE+FEDYIGQLA+AS++S+D   + +  
Sbjct  61    PAKREAYDKNGKEGVSQDSMVDPSAVFGMLFGSEIFEDYIGQLALASLSSVDFEEESQTP  120

Query  1416  DAK-KLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDM  1240
             + + K+Q+K++ +Q+EREEKL +ILK+RL  Y+    +EF   A++E S LS AA+G  M
Sbjct  121   EGRQKVQDKIKEMQKEREEKLIQILKHRLQPYIDNRMDEFVDWAKSEASHLSQAAFGEAM  180

Query  1239  LNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMK  1060
             L+TIGYIYTRQAAKELGK   Y+GVPF+AEW R+KGH IKSQVTAA GA +LIQ+QE++ 
Sbjct  181   LHTIGYIYTRQAAKELGKNMRYMGVPFLAEWVRDKGHHIKSQVTAAAGAVSLIQIQEEL-  239

Query  1059  RQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELR  880
             R+L  +G   EE L + ++  K  MI+SLWK+NV DIE TLS VC  VL++ NV K+ L+
Sbjct  240   RKLE-QGENKEENLMKQIEEKKDAMINSLWKINVVDIELTLSHVCHAVLKEPNVSKDVLK  298

Query  879   ARAKGLKTLGKVFQRVKSV  823
              RA  LK LG +FQ  K++
Sbjct  299   HRANALKKLGTIFQGAKAI  317



>ref|XP_010531447.1| PREDICTED: chaperone protein dnaJ 10-like isoform X2 [Tarenaya 
hassleriana]
Length=345

 Score =   380 bits (975),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 192/344 (56%), Positives = 255/344 (74%), Gaps = 4/344 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKE+EYYD+LGV   A+ A+IKKAYY KARQVHPDKNP DP AA+NFQVLGEAYQVLSD
Sbjct  1     MVKESEYYDILGVKTEASAAEIKKAYYFKARQVHPDKNPGDPQAAKNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P +R AYD YGK G+  +A++DPA++F MLFGSELFEDY+GQLA+A++AS++   +  E 
Sbjct  61    PEKRAAYDKYGKEGVVQDAMVDPASVFGMLFGSELFEDYVGQLALATLASIEADLESYEP  120

Query  1416  DAKK--LQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVD  1243
             + +K  LQEK++ +Q+ER++KL   LKN+L  +V+G  +EF   A  E +RLS+A +G  
Sbjct  121   EIRKQMLQEKIKALQKERQDKLVTTLKNKLEPFVEGQTDEFVNWANEEANRLSSAGFGEA  180

Query  1242  MLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDM  1063
             ML+TIGYIYTR+AAKELGK   Y+ VPFIAEW R+KGH IKSQV AA+GA +LIQLQ+++
Sbjct  181   MLHTIGYIYTRKAAKELGKDKRYMKVPFIAEWVRHKGHQIKSQVMAASGAVSLIQLQDEV  240

Query  1062  KRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEEL  883
              +    +    EE +++ +++  +  + SLW++NV DIE+TLSRVCQ VL+D +V K+ L
Sbjct  241   NKLNQHQAENREEHIQKAIEAKMEAFLQSLWQINVLDIESTLSRVCQGVLKDPSVSKDVL  300

Query  882   RARAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDG--SEPS  757
             RARA+GLK LG +FQ  KS    E      T V+   G  S+PS
Sbjct  301   RARARGLKKLGTIFQGAKSAYSRENSLRHETAVKVNTGNSSKPS  344



>emb|CDY42612.1| BnaC01g00240D [Brassica napus]
Length=344

 Score =   380 bits (975),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 192/342 (56%), Positives = 249/342 (73%), Gaps = 4/342 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKE+EYYDVLGV   A+ A IKKAYYIKARQVHPDKNPNDP AA+NFQ LGEAYQVLSD
Sbjct  1     MVKESEYYDVLGVKTDASAADIKKAYYIKARQVHPDKNPNDPQAAKNFQALGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P +R AYD YGK G+  +A++DPAA+F MLFGSELFEDYIGQLA+AS+ASLD   +  E 
Sbjct  61    PEKRTAYDNYGKEGVQQDAMVDPAAVFGMLFGSELFEDYIGQLALASIASLDAEVESHEP  120

Query  1416  DAKK--LQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVD  1243
             + +K  LQ+K++ +Q+ERE+KL   LKN+L  +V+G  +EF   A AE  RLS A +G  
Sbjct  121   EIRKKLLQDKIKAMQKEREDKLVTTLKNKLEPFVEGQTDEFVNWATAEARRLSTAGFGEA  180

Query  1242  MLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDM  1063
             ML+T+GYIYTR+AAKELGK    + VPF+AEW R+KGH IKSQV AA+GA +L+ LQ+++
Sbjct  181   MLHTVGYIYTRKAAKELGKDKRLMKVPFLAEWVRDKGHQIKSQVMAASGAVSLLVLQDEV  240

Query  1062  KRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEEL  883
              +    +G   EE +++ +++ K  M+ SLW++NV DIE+TLSRVCQ V++D +V K+ L
Sbjct  241   SK--LNQGENREEHIQKAIEAKKDAMLQSLWQINVLDIESTLSRVCQAVVKDPSVSKDVL  298

Query  882   RARAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPS  757
             R RA+GL+ LG +FQ  K     E          KLD  + S
Sbjct  299   RTRARGLRKLGNIFQGSKKPYSRENSLRHEDAAVKLDAGDSS  340



>ref|XP_008647541.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|AFW78973.1| chaperone protein dnaJ 10 isoform 1 [Zea mays]
 gb|AFW78974.1| chaperone protein dnaJ 10 isoform 2 [Zea mays]
Length=338

 Score =   379 bits (973),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 193/333 (58%), Positives = 251/333 (75%), Gaps = 7/333 (2%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVK++ YYDVLG+S  A+ A+IKKAYYIKA+ VHPDKNP +P AA  FQ LGEAYQVLSD
Sbjct  1     MVKDSAYYDVLGLSVDASPAEIKKAYYIKAKLVHPDKNPGNPDAALKFQELGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P +++AYD YGK GI  + ++DPAA+F MLFGS+ FEDY+GQLA+AS+AS+++  +    
Sbjct  61    PGKKEAYDNYGKEGIPQDNMVDPAAVFGMLFGSDYFEDYVGQLALASIASVEVEENSNSQ  120

Query  1416  DAK-KLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDM  1240
             +A+ K+QEK++ +QRERE+KL + LK+RL  YV G  +EF ++A AE  RLS AA+G  M
Sbjct  121   EARAKVQEKIKELQREREQKLTQSLKDRLQSYVDGRNDEFVSYASAEARRLSEAAFGEAM  180

Query  1239  LNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMK  1060
             L+TIGYIY RQAA+ELGK  IY+GVPFIAEW R+KGH IKSQV AA+GA +LIQLQE MK
Sbjct  181   LHTIGYIYVRQAARELGKSRIYMGVPFIAEWVRDKGHHIKSQVNAASGAISLIQLQEGMK  240

Query  1059  RQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELR  880
             +   +E   +EE+L +  +  K  M+ SLWK+NV DIE+TLSRVCQ VL+D+ V K+ L+
Sbjct  241   KMEGSED--SEEQLMKSFEEKKDAMLSSLWKINVVDIESTLSRVCQAVLRDSMVSKDVLK  298

Query  879   ARAKGLKTLGKVFQRVKSV----NGNETETSAN  793
              RAK LK LG +FQ  +S+    N    ETS +
Sbjct  299   LRAKALKKLGTIFQGAESMYRRENSLRVETSTD  331



>ref|XP_007201378.1| hypothetical protein PRUPE_ppa007841mg [Prunus persica]
 gb|EMJ02577.1| hypothetical protein PRUPE_ppa007841mg [Prunus persica]
Length=339

 Score =   379 bits (972),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 195/343 (57%), Positives = 253/343 (74%), Gaps = 7/343 (2%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVK+T YYDVLGV+  A+ A+IKKAYY+KAR VHPDKNP DP AA+NFQ LGEAYQVLSD
Sbjct  1     MVKDTTYYDVLGVNVEASYAEIKKAYYVKARIVHPDKNPGDPKAAENFQALGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDI--FTDGE  1423
             P +R+AYD +GK+GI  ++++DPAA+F MLFGSE FEDY+GQLA+AS++S++I   T   
Sbjct  61    PDKREAYDKHGKAGIQQDSMVDPAAVFGMLFGSEYFEDYVGQLALASLSSVEIEEETQDP  120

Query  1422  EFDAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVD  1243
             E   +++QEKMR +Q+ERE KL  ILK+RL  +V G  +EF   A +E  RLS AA+G  
Sbjct  121   EVHRQRVQEKMRALQKEREVKLITILKDRLQPFVDGRTDEFVKWANSEARRLSTAAFGEA  180

Query  1242  MLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDM  1063
             ML+TIGYIYTR+AA+E+GK   Y+ VPF+AEW R+KGH IKSQV+AA+GA ALIQLQED+
Sbjct  181   MLHTIGYIYTRKAAREIGKDKRYMKVPFLAEWVRDKGHQIKSQVSAASGAVALIQLQEDL  240

Query  1062  KRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEEL  883
             K+    +G   EE L + ++  K  +++SLW++NV DIE+TLSRVCQ VL+D  V ++ L
Sbjct  241   KK--LNQGENKEETLMKAIEDKKDQVLNSLWQINVVDIESTLSRVCQAVLKDPTVSRDVL  298

Query  882   RARAKGLKTLGKVFQRVKSVNGNETE-TSANTPVQKLDGSEPS  757
             R RAK LK LG VFQ  K+    E      N P  K+D +  S
Sbjct  299   RGRAKALKKLGTVFQGAKAAYSRENSLRHENDP--KIDSASSS  339



>ref|XP_001772874.1| predicted protein [Physcomitrella patens]
 gb|EDQ62276.1| predicted protein [Physcomitrella patens]
Length=319

 Score =   378 bits (970),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 185/313 (59%), Positives = 234/313 (75%), Gaps = 2/313 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVK+ EYY+VLGVSP AT A+IKKAYY+KAR VHPDKNPN+P AA+NFQ+LGEAYQ+LSD
Sbjct  1     MVKDKEYYNVLGVSPEATPAEIKKAYYVKARLVHPDKNPNNPEAAKNFQILGEAYQILSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P +R +YD  GK G+S EA++DPAAIF MLFGS+ FE+YIGQLA+A+M  +++    +  
Sbjct  61    PEKRASYDKLGKVGVSQEAMVDPAAIFGMLFGSDAFEEYIGQLAIAAMTGMEMGGGSQPV  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D  +LQ K + +Q+ERE+KL + L  RL  YV G K EF   A  E  RL   ++G  ML
Sbjct  121   DVGQLQAKFKGIQKEREDKLVQNLLQRLETYVSGDKLEFVERATKERERLKENSFGEPML  180

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
              TIGY+Y RQAAKELGK   +LGVPF+ EWFR+KGHFIKS VTAA+GA  L+QLQ ++KR
Sbjct  181   QTIGYVYQRQAAKELGKNVYFLGVPFLTEWFRSKGHFIKSHVTAASGAVHLMQLQTNLKR  240

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             Q+  E    E+ +E Y++S+K +M+D+LWKLNVADIE TL+RVCQ VL D  V +E    
Sbjct  241   QI--EEGKMEQGVEAYLESNKDVMVDNLWKLNVADIENTLTRVCQRVLHDPLVPREVALN  298

Query  876   RAKGLKTLGKVFQ  838
             RAK LK LG +FQ
Sbjct  299   RAKALKKLGAIFQ  311



>gb|KHG09283.1| Chaperone dnaJ 10 -like protein [Gossypium arboreum]
Length=342

 Score =   378 bits (971),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 188/327 (57%), Positives = 245/327 (75%), Gaps = 6/327 (2%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVK+T YYDVLGV+  A+ A+IKKAYY+KAR VHPDKNP DP AA+NFQ LGEAYQVLSD
Sbjct  1     MVKDTAYYDVLGVNVDASAAEIKKAYYLKARLVHPDKNPGDPKAAENFQALGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P +R+AYD +GK+G+  ++++DP+A+F MLFGSE FE+Y+GQLA+AS+A+++   D +  
Sbjct  61    PEKREAYDKHGKAGVQPDSMLDPSAVFGMLFGSEFFEEYVGQLALASLATVETEIDDDSL  120

Query  1416  DA----KKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYG  1249
             D     +KLQEKM+ VQ+EREEKL  +LKNRL  +V+G  +EF   A +E  RLS AA+G
Sbjct  121   DKDARMQKLQEKMKTVQKEREEKLITLLKNRLEPFVEGQTDEFINWANSEARRLSKAAFG  180

Query  1248  VDMLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQE  1069
               ML+TIGYIYTR+AAKELGK   Y+ VPF+AEW R+KGH IKSQV AA+GA +LIQ+QE
Sbjct  181   EAMLHTIGYIYTRKAAKELGKDKRYMKVPFLAEWVRDKGHRIKSQVMAASGAVSLIQIQE  240

Query  1068  DMKRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKE  889
             D+K+  + +G   EE + +  +  K  M+ SLW++NV DIE+TLSRVC  VL+D +V KE
Sbjct  241   DLKK--ANQGENREENIMKTFEDKKDAMLQSLWQINVVDIESTLSRVCLAVLKDPSVSKE  298

Query  888   ELRARAKGLKTLGKVFQRVKSVNGNET  808
              L  RAK LK LG +FQ  K+    E 
Sbjct  299   VLVLRAKALKKLGAIFQGAKAAYSREN  325



>ref|XP_008236939.1| PREDICTED: chaperone protein dnaJ 10 [Prunus mume]
Length=339

 Score =   378 bits (971),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 190/324 (59%), Positives = 246/324 (76%), Gaps = 4/324 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVK+T YYDVLGV+  A+ A+IKKAYY+KAR VHPDKNP DP AA+NFQ LGEAYQVLSD
Sbjct  1     MVKDTTYYDVLGVNVEASYAEIKKAYYVKARIVHPDKNPGDPKAAENFQALGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDI--FTDGE  1423
             P +R+AYD +GK+GI  ++++DPAA+F MLFGSE FEDY+GQLA+AS++S++I   T   
Sbjct  61    PDKREAYDKHGKAGIQQDSMVDPAAVFGMLFGSEYFEDYVGQLALASLSSVEIEEETQDP  120

Query  1422  EFDAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVD  1243
             E   +++QEKMR +Q+ERE KL  ILK+RL  +V G  +EF   A +E  RLS AA+G  
Sbjct  121   EVRRQRVQEKMRALQKEREVKLITILKDRLQPFVDGRTDEFVKWANSEARRLSTAAFGEA  180

Query  1242  MLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDM  1063
             ML+TIGYIYTR+AA+E+GK   Y+ VPF+AEW R+KGH IKSQV+AA+GA ALIQLQED+
Sbjct  181   MLHTIGYIYTRKAAREIGKDKRYMKVPFLAEWVRDKGHQIKSQVSAASGAVALIQLQEDL  240

Query  1062  KRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEEL  883
             K+    +G   EE L + ++  K  +++SLW++NV DIE+TLSRVCQ VL+D  V ++ L
Sbjct  241   KK--LNQGENKEETLMKAIEDKKDQVLNSLWQINVVDIESTLSRVCQAVLKDPTVSRDVL  298

Query  882   RARAKGLKTLGKVFQRVKSVNGNE  811
             R RAK LK LG VFQ  K+    E
Sbjct  299   RGRAKALKKLGTVFQGAKAAYSRE  322



>ref|XP_009388085.1| PREDICTED: chaperone protein dnaJ 10-like [Musa acuminata subsp. 
malaccensis]
Length=334

 Score =   378 bits (970),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 183/320 (57%), Positives = 249/320 (78%), Gaps = 6/320 (2%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVK+TEYYD+LG+S  A+ A+IKKAYY+KAR VHPDKN  DP AA NFQVLGEAYQVLSD
Sbjct  1     MVKDTEYYDILGISVDASAAEIKKAYYLKARLVHPDKNLGDPQAAHNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGE--  1423
             PA+R+ YD +GK G+  ++++DPAA+F MLFGSE FEDY+GQLA+A++A +++  + +  
Sbjct  61    PAKREEYDKHGKEGVPRDSMVDPAAVFGMLFGSEFFEDYVGQLALATIACVEVEEESQVP  120

Query  1422  EFDAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVD  1243
             E   +++QEK++ +Q+ERE+KL ++LK+RL++YV G KE+F A A +E  RLS AA+G  
Sbjct  121   ETRKQRVQEKIKELQKEREQKLIQVLKDRLHLYVSGQKEQFAAWASSEARRLSQAAFGEA  180

Query  1242  MLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDM  1063
             ML+TIGYIY RQ+A+E+GK   Y+G+PFIAEW R+KGH IKSQV AA+GA ALIQLQE M
Sbjct  181   MLHTIGYIYARQSAREIGKSRRYMGMPFIAEWVRDKGHHIKSQVNAASGAVALIQLQEGM  240

Query  1062  KRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEEL  883
             K+    EG+  E+ ++ + +  K  M+ SLWK+NV DIE+TLS VCQ VL+DN+V K+ L
Sbjct  241   KK---LEGSEEEDLMKNF-EEKKDAMLGSLWKINVLDIESTLSHVCQAVLKDNSVSKDVL  296

Query  882   RARAKGLKTLGKVFQRVKSV  823
             + RA+ LK +G +FQ  K +
Sbjct  297   KFRARALKKMGTIFQGAKGL  316



>gb|ACG25809.1| chaperone protein dnaJ 10 [Zea mays]
Length=338

 Score =   378 bits (970),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 192/333 (58%), Positives = 251/333 (75%), Gaps = 7/333 (2%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVK++ YYDVLG+S  A+ A+IKKAYYIKA+ VHPDKNP +P AA  FQ LGEAYQVLSD
Sbjct  1     MVKDSAYYDVLGLSVDASPAEIKKAYYIKAKLVHPDKNPGNPDAALKFQELGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P +++AYD YGK GI  + ++DPAA+F MLFGS+ FEDY+GQLA+AS+AS+++  +    
Sbjct  61    PGKKEAYDNYGKEGIPQDNMVDPAAVFGMLFGSDYFEDYVGQLALASIASVEVEENSNSQ  120

Query  1416  DAK-KLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDM  1240
             +A+ K+QEK++ +QRERE+KL + LK+RL  YV G  +EF ++A AE  RLS AA+G  M
Sbjct  121   EARAKVQEKIKELQREREQKLTQSLKDRLQSYVDGRNDEFVSYASAEARRLSEAAFGEAM  180

Query  1239  LNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMK  1060
             L+TIGYIY RQAA++LGK  IY+GVPFIAEW R+KGH IKSQV AA+GA +LIQLQE MK
Sbjct  181   LHTIGYIYVRQAARDLGKSRIYMGVPFIAEWVRDKGHHIKSQVNAASGAISLIQLQEGMK  240

Query  1059  RQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELR  880
             +   +E   +EE+L +  +  K  M+ SLWK+NV DIE+TLSRVCQ VL+D+ V K+ L+
Sbjct  241   KMEGSED--SEEQLMKSFEEKKDAMLSSLWKINVVDIESTLSRVCQAVLRDSMVSKDVLK  298

Query  879   ARAKGLKTLGKVFQRVKSV----NGNETETSAN  793
              RAK LK LG +FQ  +S+    N    ETS +
Sbjct  299   LRAKALKKLGTIFQGAESMYRRENSLRVETSTD  331



>ref|XP_009385388.1| PREDICTED: chaperone protein dnaJ 10-like [Musa acuminata subsp. 
malaccensis]
Length=333

 Score =   377 bits (969),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 187/320 (58%), Positives = 247/320 (77%), Gaps = 6/320 (2%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVK+TEYYD+LGVS  A+ A+IKKAYY+KAR VHPDKN  DP AA+NFQVLGEAYQVLSD
Sbjct  1     MVKDTEYYDILGVSVDASAAEIKKAYYLKARVVHPDKNLGDPQAARNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGE--  1423
             PA+R+ YD +GK G+  +++IDPA +F MLFGS+ FEDY+GQLA+A++AS++I  + +  
Sbjct  61    PAKREEYDKHGKEGVPQDSMIDPATVFGMLFGSDFFEDYVGQLALATIASVEIEEESQVP  120

Query  1422  EFDAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVD  1243
             E   +++QEK++ +Q+ERE+KL EILK+ L++YV G  EEF   A  E SRLS AA+G  
Sbjct  121   EIRKQRVQEKIKELQKEREQKLVEILKDHLHLYVSGQIEEFVNWANTEASRLSQAAFGEA  180

Query  1242  MLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDM  1063
             ML+TIGYIY RQAA+E+GK   Y+G+PFIAEW RNKGH IKSQV AA+GA ALIQLQ  M
Sbjct  181   MLHTIGYIYARQAAREIGKSKRYMGMPFIAEWVRNKGHHIKSQVNAASGAVALIQLQGGM  240

Query  1062  KRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEEL  883
             ++ L   G+   E++ ++ +  K  M++SLWK+NV DIE+TL  VCQ VL+DN+V K+ L
Sbjct  241   QK-LEVGGD---EDIMKHFEEKKDAMLNSLWKINVLDIESTLLHVCQAVLRDNSVSKDVL  296

Query  882   RARAKGLKTLGKVFQRVKSV  823
             + RAK LK LG +FQ  K++
Sbjct  297   KLRAKALKKLGTIFQGAKAI  316



>ref|XP_009348238.1| PREDICTED: chaperone protein dnaJ 10-like [Pyrus x bretschneideri]
Length=339

 Score =   377 bits (969),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 189/325 (58%), Positives = 247/325 (76%), Gaps = 4/325 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVK+T YY+VL V+  A+ A+IKKAYY+KAR+VHPDKNP DP AA+NFQ LGEAYQVLSD
Sbjct  1     MVKDTAYYEVLDVNVDASYAEIKKAYYLKARRVHPDKNPGDPKAAENFQALGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDI--FTDGE  1423
             P +R+AYD +GK+GI  ++++DPAA+F MLFGSE FEDY+GQLA+AS++S++I   T   
Sbjct  61    PEKREAYDKHGKAGIQQDSMVDPAAVFGMLFGSEFFEDYVGQLALASLSSVEIEEETQDP  120

Query  1422  EFDAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVD  1243
             E   +K+ EKMR +Q+ERE KL  ILK+RL  +V G  +EF   A +E  RLS+AA+G  
Sbjct  121   EVRRQKVTEKMRTLQKEREVKLITILKDRLQPFVDGRNDEFVKWANSEAQRLSSAAFGEA  180

Query  1242  MLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDM  1063
             ML+TIGYIYTRQAA+E+GK   Y+ VPF+AEW R+KGH IKSQV+AA+GA ALIQLQED+
Sbjct  181   MLHTIGYIYTRQAAREIGKDKRYMKVPFLAEWVRDKGHQIKSQVSAASGAVALIQLQEDL  240

Query  1062  KRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEEL  883
             K+    +G   EE L + ++  K  +++SLW++NV DIE+TLSRVCQ VL+D  V +++L
Sbjct  241   KK--LNQGENKEETLMKAIEERKDQVLNSLWQINVVDIESTLSRVCQAVLKDPTVSRDDL  298

Query  882   RARAKGLKTLGKVFQRVKSVNGNET  808
             R RAK LK LG VFQ  K+    E 
Sbjct  299   RDRAKALKKLGTVFQGAKAAYSREN  323



>ref|XP_010690838.1| PREDICTED: chaperone protein dnaJ 10 [Beta vulgaris subsp. vulgaris]
Length=342

 Score =   378 bits (970),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 196/342 (57%), Positives = 246/342 (72%), Gaps = 6/342 (2%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYD+LGV   AT   IKKAYY+KAR VHPDKNP DP AA  FQ LGEAYQVLSD
Sbjct  1     MVKETEYYDLLGVGVDATPTDIKKAYYVKARIVHPDKNPGDPQAAHRFQELGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDG---  1426
               +R+AYD YGK+G+  +A++DPAA+F MLFGS+ FEDYIGQLA+AS+A L+   D    
Sbjct  61    TEKREAYDKYGKTGVPQDAMVDPAAVFGMLFGSDFFEDYIGQLALASVAGLEFEEDSQLP  120

Query  1425  EEFDAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGV  1246
             EE   +K+QEKM+ +Q+ER+++L   LK+RL  YV+G  +EF   A+ E S LS A +G 
Sbjct  121   EELRRQKIQEKMKTMQQERQDRLIGNLKDRLQPYVEGRIDEFVDWAKTEASNLSKAVFGE  180

Query  1245  DMLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQED  1066
              ML+TIGYIYTRQ+AKE+GK   +L VPF+AEW R+KGH IKSQV AA+GA +LIQ+QED
Sbjct  181   AMLHTIGYIYTRQSAKEIGKDKKFLNVPFLAEWVRDKGHQIKSQVMAASGAVSLIQIQED  240

Query  1065  MKRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEE  886
             +KR   ++G   EE L + M+  K  M++SLW+LNV DIETTLSRVCQ VL+D+ V K+ 
Sbjct  241   IKR--LSQGENKEENLMKAMEEKKDAMLNSLWQLNVIDIETTLSRVCQAVLRDSTVSKDV  298

Query  885   LRARAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEP  760
             L++RAK LK LG +FQ  K     E         Q  D SEP
Sbjct  299   LKSRAKALKKLGTIFQGAKVPYKRENSLRCEVATQA-DTSEP  339



>ref|XP_006282656.1| hypothetical protein CARUB_v10005169mg [Capsella rubella]
 ref|XP_006282657.1| hypothetical protein CARUB_v10005169mg [Capsella rubella]
 gb|EOA15554.1| hypothetical protein CARUB_v10005169mg [Capsella rubella]
 gb|EOA15555.1| hypothetical protein CARUB_v10005169mg [Capsella rubella]
Length=344

 Score =   378 bits (970),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 193/345 (56%), Positives = 252/345 (73%), Gaps = 7/345 (2%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKE+EYYD+LGV   A  ++IKKAYY+KARQVHPDKNP DP AA+NFQVLGEAYQVLSD
Sbjct  1     MVKESEYYDILGVKIDAPGSEIKKAYYVKARQVHPDKNPGDPQAAKNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P +R AYD YGK G+  +A++DPAA+F MLFGSELFEDY+GQLA+AS+AS+D   +  E 
Sbjct  61    PEKRTAYDKYGKEGVQQDAMVDPAAVFGMLFGSELFEDYVGQLALASIASIDAELESYEP  120

Query  1416  DAKK--LQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVD  1243
             + +K  LQEK++ +Q+ RE+KLA  LK +L  +V+G  +EF   A AE  RLS A +G  
Sbjct  121   EIRKQMLQEKIKAMQKGREDKLASTLKIKLEPFVEGQTDEFVNWATAEAKRLSTAGFGEA  180

Query  1242  MLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDM  1063
             ML+TIGYIYTR+AAKELGK   Y+ VPF+AEW R+KGH +KSQV AA+GA +L+QLQ+++
Sbjct  181   MLHTIGYIYTRKAAKELGKDKRYMKVPFLAEWVRDKGHKVKSQVMAASGAVSLLQLQDEV  240

Query  1062  KRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEEL  883
              +     G   EE +++ +++ K  MI SLW++NV DIE+TLSRVCQ VL+D +V K+ L
Sbjct  241   SKM--NHGENKEENIQKAVEAKKDAMIQSLWQINVVDIESTLSRVCQAVLKDPSVSKDVL  298

Query  882   RARAKGLKTLGKVFQRVKSVNGNETETSANTPVQKL---DGSEPS  757
             RARA+GL+ LG +FQ  K     E          KL   D S+P+
Sbjct  299   RARARGLRKLGNIFQGSKKPYSRENSLRHEEAAVKLHAGDSSKPA  343



>ref|XP_010912595.1| PREDICTED: chaperone protein dnaJ 10-like isoform X3 [Elaeis 
guineensis]
Length=379

 Score =   379 bits (972),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 190/344 (55%), Positives = 247/344 (72%), Gaps = 32/344 (9%)
 Frame = -2

Query  1770  KETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSDPA  1591
             KETEYYDVLGVSP ATE +I+KAY+ KARQVHPDKNPNDP AA+ FQ LGEAYQVLSDP 
Sbjct  4     KETEYYDVLGVSPSATEEEIRKAYFFKARQVHPDKNPNDPQAAERFQELGEAYQVLSDPV  63

Query  1590  QRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEFDA  1411
             QR+AYD +GK+ +S E ++D  A+F +LFGSE+FEDY+G LA+ASM S ++ +  E+ + 
Sbjct  64    QRRAYDGFGKNSVSRENMLDATAVFTLLFGSEIFEDYVGHLAVASMTSSELTS--EDDNP  121

Query  1410  KKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDMLNT  1231
             +KLQ+++                          KE F  HAEAE  RLSN A+GV++L+T
Sbjct  122   EKLQDRL--------------------------KEGFFHHAEAEAKRLSNTAFGVNILHT  155

Query  1230  IGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKRQL  1051
             IGY+Y RQAAKELGKK IYLGVPF+ EW R KGHF KSQ+TAA GA  L+QLQED+ RQ+
Sbjct  156   IGYVYARQAAKELGKKVIYLGVPFLTEWVRTKGHFWKSQITAAKGALELLQLQEDICRQI  215

Query  1050  SAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRARA  871
             + +G+ TE++++ +++ +K +M+DSLWKLNV DIE TL  VCQMVL ++NVK+EEL+ARA
Sbjct  216   NKDGSGTEKDVDLHIRMNKDLMMDSLWKLNVVDIEVTLLHVCQMVLHESNVKREELKARA  275

Query  870   KGLKTLGKVFQRVKSVNGNETETSANTPVQKLDGSEPSYDSHSL  739
               LK LGK+FQ  +    + T    N P    D +E S D+ S+
Sbjct  276   LALKILGKIFQGERHALPSGTPKKKNIP----DDNESSSDASSV  315



>ref|XP_010446434.1| PREDICTED: chaperone protein dnaJ 10-like [Camelina sativa]
 ref|XP_010446435.1| PREDICTED: chaperone protein dnaJ 10-like [Camelina sativa]
Length=344

 Score =   376 bits (966),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 192/345 (56%), Positives = 253/345 (73%), Gaps = 7/345 (2%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKE+EYYD+LGV   A+ A+IKKAYY+KARQVHPDKNP DP AA+NFQ LGEAYQVLSD
Sbjct  1     MVKESEYYDILGVKIDASGAEIKKAYYVKARQVHPDKNPGDPQAAKNFQSLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P +R AYD YGK G+  +A++DPAA+F MLFGSELFEDY+GQLA+AS+AS+D   +  E 
Sbjct  61    PEKRTAYDKYGKEGVQQDAMVDPAAVFGMLFGSELFEDYVGQLALASIASIDAELESYEP  120

Query  1416  DAKK--LQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVD  1243
             + +K  LQEK++ +Q+ RE+KL   LK +L  +V+G  +EF   A AE  RLS A +G  
Sbjct  121   EIRKHMLQEKIKAMQKGREDKLVATLKIKLEPFVEGQTDEFVNWATAEAKRLSTAGFGEA  180

Query  1242  MLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDM  1063
             ML+T+GYIYTR+AAKELGK   Y+ VPF+AEW R+KGH +KSQV AA+GA +L+QLQ+++
Sbjct  181   MLHTVGYIYTRKAAKELGKDKRYMKVPFLAEWVRDKGHQVKSQVMAASGAVSLLQLQDEV  240

Query  1062  KRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEEL  883
              R    +G   EE +++ +++ K  M+ SLW++NV DIE+TLSRVCQ VL+D  V K+ L
Sbjct  241   SR--LNQGVNKEENIQKAIEAKKDAMLQSLWQINVVDIESTLSRVCQAVLKDPTVSKDVL  298

Query  882   RARAKGLKTLGKVFQRVKSVNGNETETS---ANTPVQKLDGSEPS  757
             RARA+GL+ LG +FQ  K     E   S   A   +Q  D S+P+
Sbjct  299   RARARGLRKLGNIFQGSKKPYSRENSLSHEEAAVKLQAGDSSKPA  343



>ref|XP_009372977.1| PREDICTED: chaperone protein dnaJ 10-like [Pyrus x bretschneideri]
Length=339

 Score =   375 bits (964),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 189/324 (58%), Positives = 246/324 (76%), Gaps = 4/324 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVK+T YY+VL V+  A+ A+IKKAYY+KAR+VHPDKNP DP AA+NFQ LGEAYQVLSD
Sbjct  1     MVKDTAYYEVLDVNVDASYAEIKKAYYLKARRVHPDKNPGDPKAAENFQALGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDI--FTDGE  1423
             P +R+AYD +GK+GI  ++++DPAA+F MLFGSE FEDY+GQLA+AS++S++I   T   
Sbjct  61    PEKREAYDKHGKAGIQQDSMVDPAAVFGMLFGSEFFEDYVGQLALASLSSVEIEEETQDP  120

Query  1422  EFDAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVD  1243
             E   +K+ EKMR +Q+ERE KL  ILK+RL  +V G  +EF   A +E  RLS+AA+G  
Sbjct  121   EVRRQKVTEKMRTLQKEREVKLITILKDRLQPFVDGRNDEFVKWANSEAQRLSSAAFGEA  180

Query  1242  MLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDM  1063
             ML+TIGYIYTRQAA+E+GK   Y+ VPF+AEW R+KGH IKSQV+AA+GA ALIQLQED+
Sbjct  181   MLHTIGYIYTRQAAREIGKDKRYMKVPFLAEWVRDKGHQIKSQVSAASGAVALIQLQEDL  240

Query  1062  KRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEEL  883
             K+    +G   EE L + ++  K  +++SLW++NV DIE+TLSRVCQ VL+D  V ++ L
Sbjct  241   KK--LNQGENKEETLMKAIEERKDQVLNSLWQINVVDIESTLSRVCQAVLKDPTVSRDVL  298

Query  882   RARAKGLKTLGKVFQRVKSVNGNE  811
             R RAK LK LG VFQ  K+    E
Sbjct  299   RDRAKALKKLGTVFQGAKAAYSRE  322



>ref|XP_003627750.1| Chaperone protein dnaJ [Medicago truncatula]
 gb|AET02226.1| DnaJ heat shock amino-terminal domain protein [Medicago truncatula]
Length=339

 Score =   375 bits (964),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 188/318 (59%), Positives = 242/318 (76%), Gaps = 4/318 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKET YYD LGVS  A+ A IKKAYY+KAR VHPDKNP DP AA+NFQ+LGEAYQVLSD
Sbjct  1     MVKETAYYDTLGVSVDASAADIKKAYYVKARIVHPDKNPGDPKAAENFQLLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEE-  1420
             P +R+AYD  GK+G+S +A++DP  +F MLFGSE FE+YIG+LA+AS+AS+++  D  E 
Sbjct  61    PEKREAYDKNGKAGVSQDAMMDPTTVFGMLFGSEFFEEYIGKLALASLASIEVEEDSLEP  120

Query  1419  -FDAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVD  1243
                 +K+QEKM+V Q+EREEKL  +L +RL  +V G +EEF   A +E   LS AA+G  
Sbjct  121   QVRMQKIQEKMKVWQKEREEKLKSVLIDRLQPFVDGREEEFTTWANSEARNLSKAAFGEA  180

Query  1242  MLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDM  1063
             ML+TIGYIYTR+AAKELGK   ++ VPF+AEW R+KGH IKSQVTAA+GA +LIQ+QE++
Sbjct  181   MLHTIGYIYTRKAAKELGKDIRFMNVPFLAEWVRDKGHRIKSQVTAASGAVSLIQIQEEL  240

Query  1062  KRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEEL  883
             K+    +G   EE + + ++  K  MI+SLWK+NV DIE+TLSRVCQ VL+D +V K+ L
Sbjct  241   KKL--NQGENKEENIMKALEDKKDAMINSLWKINVIDIESTLSRVCQAVLKDPSVSKDVL  298

Query  882   RARAKGLKTLGKVFQRVK  829
              +RAK LK LG +FQ  K
Sbjct  299   VSRAKALKQLGTIFQGAK  316



>ref|XP_009386456.1| PREDICTED: chaperone protein dnaJ 10-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009386465.1| PREDICTED: chaperone protein dnaJ 10-like [Musa acuminata subsp. 
malaccensis]
Length=333

 Score =   375 bits (963),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 185/330 (56%), Positives = 250/330 (76%), Gaps = 5/330 (2%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVK+TEYYD+LGVS  A+ A+IKKAYY+KA+ VHPDKNP D  AA NFQVLGEAYQVLSD
Sbjct  1     MVKDTEYYDILGVSVDASSAEIKKAYYLKAKSVHPDKNPGDAQAAHNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDI-FTDGEE  1420
             PA+R+ YD +GK G+  ++++DPAA+F M+FGSELFEDY+GQLA+A++AS++   +   E
Sbjct  61    PAKREEYDKHGKEGVPKDSMVDPAAVFGMVFGSELFEDYVGQLALATIASIEAEESQVLE  120

Query  1419  FDAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDM  1240
                +++QEK++ +Q+ERE+KL + LK+RL++YV G ++EF   A +E   LS AA+G  M
Sbjct  121   TRRQRVQEKIKELQKEREQKLVQSLKDRLHLYVTGQEQEFINWANSEACHLSRAAFGEAM  180

Query  1239  LNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMK  1060
             L+TIGYIY RQAA+E+GK   Y+G+PF+AEW R+KGHF+KSQV AA+GA ALIQLQE MK
Sbjct  181   LHTIGYIYARQAAREIGKSRRYMGMPFVAEWVRDKGHFVKSQVNAASGAVALIQLQEGMK  240

Query  1059  RQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELR  880
             +    EG+  +++L   ++  K  M+ SLWK+NV DIE+TLS VCQ VL+DN+V K+ L+
Sbjct  241   K---TEGS-DDKDLTMNIEEKKDAMLSSLWKINVLDIESTLSHVCQEVLKDNSVSKDVLK  296

Query  879   ARAKGLKTLGKVFQRVKSVNGNETETSANT  790
              RAK LK LG +FQ  K++   E      T
Sbjct  297   LRAKALKKLGTIFQGAKALYRRENSLRVET  326



>ref|XP_007042114.1| DNAJ heat shock N-terminal domain-containing protein isoform 
2 [Theobroma cacao]
 gb|EOX97945.1| DNAJ heat shock N-terminal domain-containing protein isoform 
2 [Theobroma cacao]
Length=361

 Score =   375 bits (964),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 185/327 (57%), Positives = 248/327 (76%), Gaps = 4/327 (1%)
 Frame = -2

Query  1782  RSMVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVL  1603
             R MVK+T YYD+LGV+  A+ A+IKKAYY+KAR VHPDKNP DP AA+NFQ LGEAYQVL
Sbjct  21    RPMVKDTAYYDILGVNVEASAAEIKKAYYLKARLVHPDKNPGDPKAAENFQALGEAYQVL  80

Query  1602  SDPAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGE  1423
             SDP +R+AYD +GK+G+  +A++DP+A+F MLFGSE FE+Y+GQLA+AS++S++I  D  
Sbjct  81    SDPEKREAYDKHGKAGVQPDAMLDPSAVFGMLFGSEFFEEYVGQLALASLSSVEIEDDSL  140

Query  1422  EFDAK--KLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYG  1249
             + +A+  K+QEKM+ +Q+EREEKL  ILKNRL  +V+G  +EF   A  E  RLS AA+G
Sbjct  141   DKEARMQKIQEKMKALQKEREEKLITILKNRLQPFVEGQTDEFIRWANLEARRLSKAAFG  200

Query  1248  VDMLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQE  1069
               ML+TIGYIYTR+AA+ELGK   ++ VPF+AEW R+KGH IKSQV AA+GA +LIQ+Q+
Sbjct  201   EAMLHTIGYIYTRKAARELGKDKRFMKVPFLAEWVRDKGHRIKSQVMAASGAVSLIQIQD  260

Query  1068  DMKRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKE  889
             ++K+  + EG   EE + + ++  K  M+ SLW++NV DIE+TLS VC  VL+D +V K+
Sbjct  261   ELKK--AHEGENKEENILKTLEDKKDAMLQSLWQINVVDIESTLSHVCLAVLRDPSVSKD  318

Query  888   ELRARAKGLKTLGKVFQRVKSVNGNET  808
              L  RAKGLK LG +FQ  K+    E 
Sbjct  319   VLVLRAKGLKKLGAIFQGAKAAYSREN  345



>ref|XP_006654734.1| PREDICTED: chaperone protein dnaJ 10-like [Oryza brachyantha]
Length=338

 Score =   374 bits (961),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 194/342 (57%), Positives = 248/342 (73%), Gaps = 7/342 (2%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVK+T YY+ LGVS  AT A+IKKAYY+KA+ VHPDKNP +P AAQ FQ LGEAYQVLSD
Sbjct  1     MVKDTAYYNTLGVSVDATPAEIKKAYYLKAKLVHPDKNPGNPDAAQKFQELGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             PA+R+AYD +GK G+  + ++DPAA+F MLFGS+ FEDY+GQLA+AS+AS+++  +    
Sbjct  61    PAKREAYDKHGKEGLPQDNMVDPAAVFGMLFGSDYFEDYVGQLALASIASVEVDENLNSQ  120

Query  1416  DAK-KLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDM  1240
             +A+ K+QEK++ +QRERE+KL + LK+RL  +V G K+EF   A  E  RLS AA+G  M
Sbjct  121   EARAKVQEKIKELQREREQKLIQSLKDRLQPFVDGRKDEFVDWANGEARRLSEAAFGEAM  180

Query  1239  LNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMK  1060
             L+TIGYIY RQAA+ELGK  +Y+GVPFIAEW R+KGH IKSQV AA+GA AL+QLQE MK
Sbjct  181   LHTIGYIYVRQAARELGKSKLYMGVPFIAEWVRDKGHCIKSQVNAASGAIALMQLQEGMK  240

Query  1059  RQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELR  880
             +    E +  EE+     +  K  M+ SLWK+NV DIE+TLS VCQ VL+D +  KE L+
Sbjct  241   KM--EESDNKEEQFMRSFEEKKDAMLSSLWKINVVDIESTLSHVCQAVLKDTSASKEVLK  298

Query  879   ARAKGLKTLGKVFQRVKSVNGNETETSANT-PVQKLDGSEPS  757
              RAK LK LG +FQ  KS+   E      T P Q   G+ PS
Sbjct  299   LRAKALKKLGTIFQGAKSLYRRENSLRVETRPTQ---GATPS  337



>ref|XP_010531445.1| PREDICTED: chaperone protein dnaJ 10-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010531446.1| PREDICTED: chaperone protein dnaJ 10-like isoform X1 [Tarenaya 
hassleriana]
Length=351

 Score =   374 bits (961),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 185/328 (56%), Positives = 249/328 (76%), Gaps = 2/328 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKE+EYYD+LGV   A+ A+IKKAYY KARQVHPDKNP DP AA+NFQVLGEAYQVLSD
Sbjct  1     MVKESEYYDILGVKTEASAAEIKKAYYFKARQVHPDKNPGDPQAAKNFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P +R AYD YGK G+  +A++DPA++F MLFGSELFEDY+GQLA+A++AS++   +  E 
Sbjct  61    PEKRAAYDKYGKEGVVQDAMVDPASVFGMLFGSELFEDYVGQLALATLASIEADLESYEP  120

Query  1416  DAKK--LQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVD  1243
             + +K  LQEK++ +Q+ER++KL   LKN+L  +V+G  +EF   A  E +RLS+A +G  
Sbjct  121   EIRKQMLQEKIKALQKERQDKLVTTLKNKLEPFVEGQTDEFVNWANEEANRLSSAGFGEA  180

Query  1242  MLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDM  1063
             ML+TIGYIYTR+AAKELGK   Y+ VPFIAEW R+KGH IKSQV AA+GA +LIQLQ+++
Sbjct  181   MLHTIGYIYTRKAAKELGKDKRYMKVPFIAEWVRHKGHQIKSQVMAASGAVSLIQLQDEV  240

Query  1062  KRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEEL  883
              +    +    EE +++ +++  +  + SLW++NV DIE+TLSRVCQ VL+D +V K+ L
Sbjct  241   NKLNQHQAENREEHIQKAIEAKMEAFLQSLWQINVLDIESTLSRVCQGVLKDPSVSKDVL  300

Query  882   RARAKGLKTLGKVFQRVKSVNGNETETS  799
             RARA+GLK LG +FQ  +   G ++  S
Sbjct  301   RARARGLKKLGTIFQVSRKKRGAKSAYS  328



>ref|XP_010431873.1| PREDICTED: chaperone protein dnaJ 10-like [Camelina sativa]
 ref|XP_010431874.1| PREDICTED: chaperone protein dnaJ 10-like [Camelina sativa]
 ref|XP_010431875.1| PREDICTED: chaperone protein dnaJ 10-like [Camelina sativa]
Length=344

 Score =   374 bits (960),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 191/345 (55%), Positives = 252/345 (73%), Gaps = 7/345 (2%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKE+EYYD+LGV   A+ A+IKKAYY+KARQVHPDKNP DP AA+NFQ LGEAYQVLSD
Sbjct  1     MVKESEYYDILGVKIDASGAEIKKAYYVKARQVHPDKNPGDPQAAKNFQSLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P +R AYD YGK G+  +A++DPAA+F MLFGSELFEDY+GQLA+AS+AS+D   +  E 
Sbjct  61    PEKRTAYDKYGKEGVQQDAMVDPAAVFGMLFGSELFEDYVGQLALASIASIDAELESYEP  120

Query  1416  DAKK--LQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVD  1243
             + +K  LQEK++ +Q+ RE+KL   LK +L  +V+G  +EF   A AE  RLS A +G  
Sbjct  121   EIRKHMLQEKIKAMQKGREDKLVATLKIKLEPFVEGQTDEFVNWATAEAKRLSTAGFGEA  180

Query  1242  MLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDM  1063
             ML+T+GYIYTR+AAKELGK   Y+ VPF+AEW R+KGH +KSQV AA+GA +L+QLQ+++
Sbjct  181   MLHTVGYIYTRKAAKELGKDKRYMKVPFLAEWVRDKGHQVKSQVMAASGAVSLLQLQDEV  240

Query  1062  KRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEEL  883
              R    +G   EE +++ +++ K  M+ SLW++NV DIE+TLSRVCQ VL+D +V K+ L
Sbjct  241   SR--LNQGVNKEENIQKAIEAKKDAMLQSLWQINVVDIESTLSRVCQAVLKDPSVSKDVL  298

Query  882   RARAKGLKTLGKVFQRVKSVNGNETETSANTPVQKL---DGSEPS  757
             RARA+GL+ LG +FQ  K     E          KL   D S+P+
Sbjct  299   RARARGLRKLGNIFQGSKKPYSRENSLRHEEAAVKLHAGDSSKPA  343



>ref|XP_007042113.1| DNAJ heat shock N-terminal domain-containing protein isoform 
1 [Theobroma cacao]
 gb|EOX97944.1| DNAJ heat shock N-terminal domain-containing protein isoform 
1 [Theobroma cacao]
Length=339

 Score =   374 bits (959),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 184/325 (57%), Positives = 247/325 (76%), Gaps = 4/325 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVK+T YYD+LGV+  A+ A+IKKAYY+KAR VHPDKNP DP AA+NFQ LGEAYQVLSD
Sbjct  1     MVKDTAYYDILGVNVEASAAEIKKAYYLKARLVHPDKNPGDPKAAENFQALGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P +R+AYD +GK+G+  +A++DP+A+F MLFGSE FE+Y+GQLA+AS++S++I  D  + 
Sbjct  61    PEKREAYDKHGKAGVQPDAMLDPSAVFGMLFGSEFFEEYVGQLALASLSSVEIEDDSLDK  120

Query  1416  DAK--KLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVD  1243
             +A+  K+QEKM+ +Q+EREEKL  ILKNRL  +V+G  +EF   A  E  RLS AA+G  
Sbjct  121   EARMQKIQEKMKALQKEREEKLITILKNRLQPFVEGQTDEFIRWANLEARRLSKAAFGEA  180

Query  1242  MLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDM  1063
             ML+TIGYIYTR+AA+ELGK   ++ VPF+AEW R+KGH IKSQV AA+GA +LIQ+Q+++
Sbjct  181   MLHTIGYIYTRKAARELGKDKRFMKVPFLAEWVRDKGHRIKSQVMAASGAVSLIQIQDEL  240

Query  1062  KRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEEL  883
             K+  + EG   EE + + ++  K  M+ SLW++NV DIE+TLS VC  VL+D +V K+ L
Sbjct  241   KK--AHEGENKEENILKTLEDKKDAMLQSLWQINVVDIESTLSHVCLAVLRDPSVSKDVL  298

Query  882   RARAKGLKTLGKVFQRVKSVNGNET  808
               RAKGLK LG +FQ  K+    E 
Sbjct  299   VLRAKGLKKLGAIFQGAKAAYSREN  323



>ref|XP_010416628.1| PREDICTED: chaperone protein dnaJ 10-like isoform X2 [Camelina 
sativa]
Length=305

 Score =   372 bits (955),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 180/287 (63%), Positives = 224/287 (78%), Gaps = 2/287 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKET YYDVLGV+P A+E +I+KAYYIKARQVHPDKN  DPLAA+ FQVLGEAYQVLSD
Sbjct  1     MVKETVYYDVLGVTPSASEEEIRKAYYIKARQVHPDKNQGDPLAAEKFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P  R+AYD  GK     E ++DP A+FA+LFGSELFEDYIG LA+ASMAS  + ++ E  
Sbjct  61    PVHREAYDRTGKFSAPKETMVDPTAVFALLFGSELFEDYIGHLAVASMASTQMASEIESP  120

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             D  +  +K++ VQ+EREE LA  LK+ L+ YV G KE F   AE+E  RLS+AA+G DML
Sbjct  121   D--QFHDKLKAVQKEREENLARFLKDFLSQYVNGDKEGFIHRAESEAKRLSDAAFGADML  178

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             +TIGY+YTRQAA+ELGK+A+YLGVPF+AEW RNKGH  KSQ++AA GAF L+QLQE+  R
Sbjct  179   HTIGYVYTRQAAQELGKRALYLGVPFVAEWVRNKGHSWKSQISAAKGAFQLLQLQEESNR  238

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMV  916
             +L  +G  T  +LE ++QS+K+ ++ SLWKLNV DIE TL  VCQM+
Sbjct  239   RLKKDGTSTANDLESHIQSNKETLMGSLWKLNVVDIEVTLLHVCQMI  285



>emb|CDX88337.1| BnaC06g37810D [Brassica napus]
Length=356

 Score =   374 bits (960),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 193/321 (60%), Positives = 232/321 (72%), Gaps = 28/321 (9%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKET YYDVLGV+P A+E +I+KAYYIKARQVHPDKN  DPLAA+ FQ   EAYQVLSD
Sbjct  1     MVKETVYYDVLGVTPSASEEEIRKAYYIKARQVHPDKNQGDPLAAEKFQA-SEAYQVLSD  59

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P  R+AYD  GK     E ++DP A+FA+LFGSELFEDYIG LA                
Sbjct  60    PLLREAYDQTGKLSAPKETMVDPTAVFALLFGSELFEDYIGHLA----------------  103

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
                        VQREREE LA  LK+ LN YV G KE F   AE+E  RLS+AA+GVDML
Sbjct  104   ----------AVQREREENLARFLKDFLNQYVHGDKEGFIHRAESEAKRLSDAAFGVDML  153

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGY+YTRQAA+ELGK+AIYLGVPF+AEW RNKGH  KSQ++AA GAF L+QLQE+  R
Sbjct  154   NTIGYVYTRQAAQELGKRAIYLGVPFVAEWVRNKGHSWKSQMSAAKGAFQLLQLQEESNR  213

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             +   +G     ELE ++Q++K+ ++ SLWKLNV DIE TL  VCQMVL++NN++KEEL++
Sbjct  214   RFKKDGASPANELESHIQTNKETLMGSLWKLNVVDIEVTLLHVCQMVLRENNLRKEELKS  273

Query  876   RAKGLKTLGKVFQRVK-SVNG  817
             RA  LK LGK+FQ+ K S NG
Sbjct  274   RAMALKILGKIFQQGKQSRNG  294



>ref|XP_010437018.1| PREDICTED: chaperone protein dnaJ 10-like [Camelina sativa]
 ref|XP_010437019.1| PREDICTED: chaperone protein dnaJ 10-like [Camelina sativa]
Length=344

 Score =   373 bits (957),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 191/345 (55%), Positives = 252/345 (73%), Gaps = 7/345 (2%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKE+EYYD+LGV   A+ A+IKKAYY+KARQVHPDKNP DP AA+NFQ LGEAYQVLSD
Sbjct  1     MVKESEYYDILGVKIDASGAEIKKAYYVKARQVHPDKNPGDPQAAKNFQSLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P +R AYD YGK G+  +A++DPAA+F MLFGSELFEDY+GQLA+AS+AS+D   +  E 
Sbjct  61    PEKRIAYDKYGKEGVQQDAMVDPAAVFGMLFGSELFEDYVGQLALASIASIDAELESYEP  120

Query  1416  DAKK--LQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVD  1243
             + +K  LQEK++ +Q+ RE+KL   LK +L  +V+G  +EF   A AE  RLS A +G  
Sbjct  121   EIRKHMLQEKIKAMQKGREDKLVATLKIKLEPFVEGQTDEFVNWATAEAKRLSTAGFGEA  180

Query  1242  MLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDM  1063
             ML+T+GYIYTR+AAKELGK   Y+ VPF+AEW R+KGH +KSQV AA+GA +L+QLQ+++
Sbjct  181   MLHTVGYIYTRKAAKELGKDKRYMKVPFLAEWVRDKGHQVKSQVMAASGAVSLLQLQDEV  240

Query  1062  KRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEEL  883
              R    +G   EE +++ +++ K  M+ SLW++NV DIE+TLSRVCQ VL+D +V K+ L
Sbjct  241   SR--LNQGVNKEENIQKAIEAKKDAMLQSLWQINVVDIESTLSRVCQAVLKDPSVSKDVL  298

Query  882   RARAKGLKTLGKVFQRVKSVNGNETETSANTPVQKL---DGSEPS  757
             RARA+GL+ LG +FQ  K     E          KL   D S+P+
Sbjct  299   RARARGLRKLGNIFQGSKKPYSRENSLRHEEAAVKLRAGDSSKPA  343



>ref|XP_008377257.1| PREDICTED: chaperone protein dnaJ 10-like [Malus domestica]
 ref|XP_008377258.1| PREDICTED: chaperone protein dnaJ 10-like [Malus domestica]
Length=339

 Score =   372 bits (956),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 189/324 (58%), Positives = 245/324 (76%), Gaps = 4/324 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVK+T YY+VL V+  A+ A+IKKAYYIKAR+VHPDKNP DP AA+NFQ LGEAYQVLSD
Sbjct  1     MVKDTAYYEVLDVNVDASYAEIKKAYYIKARRVHPDKNPGDPKAAENFQALGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDI--FTDGE  1423
             P +R+AYD +GK+GI  ++++DPAA+F MLFGSE FEDY+GQLA+AS++S++I   T   
Sbjct  61    PEKREAYDKHGKAGILQDSMVDPAAVFGMLFGSEFFEDYVGQLALASLSSVEIEEETQDP  120

Query  1422  EFDAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVD  1243
             +   +K+ EKMR +Q+ERE KL  ILK+ L  +V G  +EF   A +E  RLS+AA+G  
Sbjct  121   QVRRQKVTEKMRTLQKEREVKLITILKDHLQPFVDGRNDEFVKWANSEARRLSSAAFGEA  180

Query  1242  MLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDM  1063
             ML+TIGYIYTRQAAKE+GK   Y+ VPF+AEW R+KGH IKSQV+AA+GA ALIQLQED+
Sbjct  181   MLHTIGYIYTRQAAKEIGKDKRYMKVPFLAEWVRDKGHQIKSQVSAASGAVALIQLQEDL  240

Query  1062  KRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEEL  883
             K+    +G   EE L + ++  K  +++SLW++NV DIE+TLSRVCQ VL+D  V ++ L
Sbjct  241   KK--LNQGENKEETLMKAIEERKDQVLNSLWQINVVDIESTLSRVCQAVLKDPTVSRDVL  298

Query  882   RARAKGLKTLGKVFQRVKSVNGNE  811
             R RAK LK LG VFQ  K+    E
Sbjct  299   RDRAKALKKLGTVFQGAKAAYSRE  322



>ref|XP_010089337.1| Chaperone protein dnaJ 10 [Morus notabilis]
 gb|EXB37662.1| Chaperone protein dnaJ 10 [Morus notabilis]
Length=347

 Score =   372 bits (956),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 190/328 (58%), Positives = 240/328 (73%), Gaps = 22/328 (7%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKETEYYDVLGV+  A+E +I+KAYY+K                    VLGEAYQVLSD
Sbjct  1     MVKETEYYDVLGVASSASEDEIRKAYYLK--------------------VLGEAYQVLSD  40

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P QR AYD  GK  IS E+++DP A+FA+LFGSELFEDYIG LA+ASMAS ++   GE  
Sbjct  41    PVQRDAYDRNGKYSISRESMLDPTAVFALLFGSELFEDYIGHLAVASMASSELV--GENE  98

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
             + +KL +K++ +QREREEKLA  L++ L  YV+G KE F   AE+E  RLS+AA+GV+ML
Sbjct  99    NPEKLHDKLKAIQREREEKLARSLRDFLYQYVRGDKEGFIKRAESEARRLSDAAFGVEML  158

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             ++IGYIY+RQAA+ELGKKAIYLGVPF+AEW RNKGHF KSQ+TAA GAF L+QLQED++R
Sbjct  159   HSIGYIYSRQAAQELGKKAIYLGVPFLAEWVRNKGHFWKSQLTAAKGAFQLLQLQEDIRR  218

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             Q   +G+  E ++E +++ +K  ++ SLWKLNV DIE TL  VCQ+VL +NN+KKEEL+A
Sbjct  219   QFKVDGSVPENDVESHIRQNKDTLMSSLWKLNVVDIEVTLLHVCQLVLHENNIKKEELKA  278

Query  876   RAKGLKTLGKVFQRVKSVNGNETETSAN  793
             RA  LK LGK+FQ  K      T    N
Sbjct  279   RALALKILGKIFQDEKLARNGGTSRRKN  306



>ref|XP_009353397.1| PREDICTED: chaperone protein dnaJ 10-like [Pyrus x bretschneideri]
Length=339

 Score =   372 bits (955),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 185/324 (57%), Positives = 244/324 (75%), Gaps = 4/324 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVK+T YY+VLGV+  A+ A+IKKAYY+KAR+VHPDKNP DP AA NFQ LGEAYQVLSD
Sbjct  1     MVKDTAYYEVLGVNVDASHAEIKKAYYLKARRVHPDKNPGDPKAADNFQALGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDI--FTDGE  1423
             P +R+AYD +GK+GI  ++++DPAA+F MLFGSE FEDY+GQLA+AS++S++I   T   
Sbjct  61    PEKREAYDKHGKAGIQQDSMVDPAAVFGMLFGSEFFEDYVGQLALASLSSVEIEEETQDP  120

Query  1422  EFDAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVD  1243
             E   +K+ EKMR +Q+ERE KL  ILK+RL  +V G  ++F   A +E  RLS+AA+G  
Sbjct  121   EVRRQKVTEKMRALQKEREVKLITILKDRLQPFVDGCTDDFVKWANSEARRLSSAAFGEA  180

Query  1242  MLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDM  1063
             ML+TIGYIYTR+AA+E+GK   Y+ VPF+AEW R+KGH IKSQV AA+GA ALIQLQED+
Sbjct  181   MLHTIGYIYTRKAAREIGKDKRYMKVPFLAEWVRDKGHQIKSQVAAASGAVALIQLQEDL  240

Query  1062  KRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEEL  883
             K+    E    EE L + ++  K ++++SLW++NV DIE+TLS VCQ VL+D  V ++ L
Sbjct  241   KKLNQVENK--EETLIKAIEDKKDLVLNSLWQINVVDIESTLSHVCQAVLKDPTVSRDVL  298

Query  882   RARAKGLKTLGKVFQRVKSVNGNE  811
             R RA+ LK LG +FQ  K+    E
Sbjct  299   RVRAQALKKLGTIFQGAKAAYSRE  322



>gb|KDP41758.1| hypothetical protein JCGZ_26776 [Jatropha curcas]
Length=338

 Score =   371 bits (953),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 186/319 (58%), Positives = 243/319 (76%), Gaps = 4/319 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVK+T YY++LGV+  AT  QIKKAYY+KAR VHPDKNP DP AA+NFQ LGEAYQ+LSD
Sbjct  1     MVKDTTYYEILGVNVDATPEQIKKAYYLKARIVHPDKNPGDPKAAENFQKLGEAYQILSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGE--  1423
             P +R+AYD +GK GI  E+++DPAA+F MLFGSE F+DYIGQLA+A+++S+++  D +  
Sbjct  61    PEKREAYDKHGKEGIPQESMLDPAAVFGMLFGSEFFDDYIGQLALATISSVELEEDTKDV  120

Query  1422  EFDAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVD  1243
             E   +++QEK+R +Q+ERE KL   LKN L  +V+G +EEF   A +E  RLS AA+G  
Sbjct  121   EIHKQRVQEKLRELQKEREAKLITNLKNHLEPFVEGQEEEFINWANSEAKRLSAAAFGEA  180

Query  1242  MLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDM  1063
             ML+TIGYIYTR+AA+ELGK   Y+ VPF+AEW R+KGH +KSQV AA+GA +LIQ+QED+
Sbjct  181   MLHTIGYIYTRKAARELGKDKRYMKVPFLAEWVRDKGHSLKSQVMAASGAVSLIQIQEDL  240

Query  1062  KRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEEL  883
             K+    E    EE L + ++  K  M+ SLW++NV DIE+TLSRVC  VL+D +V K+ L
Sbjct  241   KKLNQTENK--EENLMKAIEDRKDAMLQSLWQINVVDIESTLSRVCLAVLKDPSVSKDVL  298

Query  882   RARAKGLKTLGKVFQRVKS  826
             RARAKGLK LG +FQ  KS
Sbjct  299   RARAKGLKKLGTIFQGAKS  317



>ref|XP_007133797.1| hypothetical protein PHAVU_011G210000g [Phaseolus vulgaris]
 gb|ESW05791.1| hypothetical protein PHAVU_011G210000g [Phaseolus vulgaris]
Length=340

 Score =   371 bits (953),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 183/319 (57%), Positives = 248/319 (78%), Gaps = 4/319 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVK+T YYDVLGV+  A+ A IKKAYY+KAR VHPDKNP DP AA+NFQ LGEAYQVLSD
Sbjct  1     MVKDTAYYDVLGVNFDASAADIKKAYYVKARIVHPDKNPGDPKAAENFQKLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGE--  1423
             P +R+AYD +GK G+  ++++DP A+F M+FGSE+FE+YIGQLA+AS+AS++I  D +  
Sbjct  61    PGKREAYDKHGKEGLPQDSMMDPTAVFGMIFGSEVFEEYIGQLALASLASIEIDEDIQDP  120

Query  1422  EFDAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVD  1243
             E   +K+QEKM+  Q+ERE+KL+ ILK+RL + V G +EEF A A++E   LS AA+G  
Sbjct  121   EVQRQKIQEKMKAWQKEREQKLSVILKDRLQLSVVGQEEEFTAWAKSEARSLSKAAFGEA  180

Query  1242  MLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDM  1063
             ML+TIGYIYTR+AA+E+GK   Y+ VPF+AEW R+KGH IKSQVTAA+GA +LIQ+QE++
Sbjct  181   MLHTIGYIYTRKAAREIGKDLRYMNVPFLAEWVRDKGHRIKSQVTAASGAVSLIQIQEEL  240

Query  1062  KRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEEL  883
             K+    +G   EE + + ++  K  M++SLW++NV DIE+TLS VCQ VL+D++  ++ L
Sbjct  241   KKL--NQGENKEENIIKAIEDKKDAMVNSLWQINVIDIESTLSHVCQAVLKDSSASRDVL  298

Query  882   RARAKGLKTLGKVFQRVKS  826
             +ARAK LK LG +FQ  K+
Sbjct  299   KARAKALKKLGTIFQGAKA  317



>emb|CDX87548.1| BnaA07g33250D [Brassica napus]
Length=356

 Score =   372 bits (954),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 190/321 (59%), Positives = 232/321 (72%), Gaps = 28/321 (9%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKET YYDVLGV+P A+E +I+KAYYIKARQVHPDKN  DPLAA+ FQ   EAYQVLSD
Sbjct  1     MVKETVYYDVLGVTPSASEEEIRKAYYIKARQVHPDKNQGDPLAAEKFQA-SEAYQVLSD  59

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P  R+AYD  GK     E ++DP A+FA+LFGSELFEDYIG LA                
Sbjct  60    PVLREAYDQTGKLSAPKETMVDPTAVFALLFGSELFEDYIGHLA----------------  103

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
                        VQREREE LA  LK+ LN YV G K+ F   AE+E  RLS+AA+GVDML
Sbjct  104   ----------AVQREREENLARFLKDFLNQYVHGDKDGFIHRAESEAKRLSDAAFGVDML  153

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             NTIGY+YTRQAA+ELGK+A+YLGVPF+AEW RNKGH  KSQ++AA GAF L+QLQE+  R
Sbjct  154   NTIGYVYTRQAAQELGKRALYLGVPFVAEWVRNKGHSWKSQMSAAKGAFQLLQLQEESSR  213

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
             +   +G     ELE ++Q++K+ ++ SLWKLNV DIE TL  VCQ+VL++NN++KEEL++
Sbjct  214   RFKKDGTSPANELESHIQTNKETLMGSLWKLNVVDIEVTLLHVCQLVLRENNLRKEELKS  273

Query  876   RAKGLKTLGKVFQRVK-SVNG  817
             RA  LK LGK+FQ+ K S NG
Sbjct  274   RAMALKILGKIFQQGKQSRNG  294



>ref|XP_006411715.1| hypothetical protein EUTSA_v10025633mg [Eutrema salsugineum]
 ref|XP_006411716.1| hypothetical protein EUTSA_v10025633mg [Eutrema salsugineum]
 gb|ESQ53168.1| hypothetical protein EUTSA_v10025633mg [Eutrema salsugineum]
 gb|ESQ53169.1| hypothetical protein EUTSA_v10025633mg [Eutrema salsugineum]
Length=344

 Score =   371 bits (952),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 190/345 (55%), Positives = 249/345 (72%), Gaps = 7/345 (2%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKE+EYYD+LGV   A+ A+IKKAYYIKARQVHPDKNP DP AA+ FQVLGEAYQVLSD
Sbjct  1     MVKESEYYDILGVKTDASAAEIKKAYYIKARQVHPDKNPGDPQAAKKFQVLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
               +R AYD YGK G+  +A++DPAA+F MLFGSELFEDY+GQLA+AS+ASLD   +  E 
Sbjct  61    QEKRTAYDNYGKEGVQQDAMVDPAAVFGMLFGSELFEDYVGQLALASIASLDAELESHEP  120

Query  1416  DAKK--LQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVD  1243
             + ++  LQ+K++ +Q+ RE+KL   LK +L  +V+G  +EF   A AE  RLS A +G  
Sbjct  121   ETRRQMLQDKIKAMQKAREDKLVATLKIKLEPFVEGQTDEFVKWANAEAKRLSTAGFGEA  180

Query  1242  MLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDM  1063
             ML+T+GYIYTR+AAKELGK    + VPF+AEW R+KGH IKSQV AA+GA +L+QLQ+++
Sbjct  181   MLHTVGYIYTRKAAKELGKDKRLMKVPFLAEWVRDKGHKIKSQVMAASGAVSLLQLQDEV  240

Query  1062  KRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEEL  883
              + L+ E N  E   +  +++ K  M+ SLW++NV DIE+TLSRVCQ VL+D +V K+ L
Sbjct  241   SK-LNQEENREEHIQKA-IEAKKDAMLQSLWQINVLDIESTLSRVCQAVLKDPSVSKDVL  298

Query  882   RARAKGLKTLGKVFQRVKSVNGNETETSANTPVQKL---DGSEPS  757
             RARA+GL+ LG +FQ  K     E          KL   D S+P+
Sbjct  299   RARARGLRKLGNIFQGSKKPYSRENSLRHEEATVKLHAGDSSKPA  343



>gb|AFK46259.1| unknown [Lotus japonicus]
Length=340

 Score =   371 bits (952),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 185/325 (57%), Positives = 245/325 (75%), Gaps = 4/325 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKE+ YYDVLGV+  A+ A IKKAYYIKAR VHPDKNP DP AA+NFQ+LGEAYQVLSD
Sbjct  1     MVKESAYYDVLGVNVDASAADIKKAYYIKARIVHPDKNPGDPKAAENFQMLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGE--  1423
             P +R+AYD  GK+GI  + ++DP A+F MLFGSELFE+YIGQLA+AS+AS+++  D +  
Sbjct  61    PEKREAYDKNGKAGIPQDTMLDPTAVFGMLFGSELFEEYIGQLALASLASIEVEEDSQAP  120

Query  1422  EFDAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVD  1243
             E   +++ EKM+  Q+ERE+KL  ILK+RL  +V G  +EF A A +E   LS AA+G  
Sbjct  121   EVHRQRIHEKMKAWQKEREQKLMSILKDRLQPFVDGRVDEFTAWANSEARHLSTAAFGEA  180

Query  1242  MLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDM  1063
             ML+TIGYIYTR+A++ELG+   ++ VPF+AEW R+KGH +KSQV AA+GA +LIQ+QED+
Sbjct  181   MLHTIGYIYTRKASRELGRDIRFMNVPFLAEWVRDKGHRMKSQVMAASGAVSLIQIQEDL  240

Query  1062  KRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEEL  883
             K+    +G   EE+L + ++  K  M++SLWK+NV DIE+TLS VCQ VL+D +  K+ +
Sbjct  241   KK--INQGESKEEDLVKAVEDKKDTMVNSLWKINVIDIESTLSHVCQAVLRDPSASKDVV  298

Query  882   RARAKGLKTLGKVFQRVKSVNGNET  808
             R+RAK LK LG VFQ  K+V   E 
Sbjct  299   RSRAKALKKLGAVFQGAKAVYSREN  323



>ref|XP_007133798.1| hypothetical protein PHAVU_011G210000g [Phaseolus vulgaris]
 gb|ESW05792.1| hypothetical protein PHAVU_011G210000g [Phaseolus vulgaris]
Length=321

 Score =   370 bits (949),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 182/315 (58%), Positives = 246/315 (78%), Gaps = 4/315 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVK+T YYDVLGV+  A+ A IKKAYY+KAR VHPDKNP DP AA+NFQ LGEAYQVLSD
Sbjct  1     MVKDTAYYDVLGVNFDASAADIKKAYYVKARIVHPDKNPGDPKAAENFQKLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGE--  1423
             P +R+AYD +GK G+  ++++DP A+F M+FGSE+FE+YIGQLA+AS+AS++I  D +  
Sbjct  61    PGKREAYDKHGKEGLPQDSMMDPTAVFGMIFGSEVFEEYIGQLALASLASIEIDEDIQDP  120

Query  1422  EFDAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVD  1243
             E   +K+QEKM+  Q+ERE+KL+ ILK+RL + V G +EEF A A++E   LS AA+G  
Sbjct  121   EVQRQKIQEKMKAWQKEREQKLSVILKDRLQLSVVGQEEEFTAWAKSEARSLSKAAFGEA  180

Query  1242  MLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDM  1063
             ML+TIGYIYTR+AA+E+GK   Y+ VPF+AEW R+KGH IKSQVTAA+GA +LIQ+QE++
Sbjct  181   MLHTIGYIYTRKAAREIGKDLRYMNVPFLAEWVRDKGHRIKSQVTAASGAVSLIQIQEEL  240

Query  1062  KRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEEL  883
             K+    +G   EE + + ++  K  M++SLW++NV DIE+TLS VCQ VL+D++  ++ L
Sbjct  241   KK--LNQGENKEENIIKAIEDKKDAMVNSLWQINVIDIESTLSHVCQAVLKDSSASRDVL  298

Query  882   RARAKGLKTLGKVFQ  838
             +ARAK LK LG +FQ
Sbjct  299   KARAKALKKLGTIFQ  313



>ref|XP_010066148.1| PREDICTED: chaperone protein dnaJ 10-like [Eucalyptus grandis]
 gb|KCW63967.1| hypothetical protein EUGRSUZ_G01646 [Eucalyptus grandis]
Length=343

 Score =   370 bits (951),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 183/338 (54%), Positives = 246/338 (73%), Gaps = 3/338 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVK+T YYD+LGV+  A+ A IKKAYY+KAR VHPDKNP DP AAQNFQ+LGEAYQVLSD
Sbjct  1     MVKDTAYYDILGVNVDASAADIKKAYYLKARLVHPDKNPGDPKAAQNFQILGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGE--  1423
             P +R+AYD +GK+G++ + ++DP+A+F M+FGS+LFEDY+GQLA+AS+A ++   D +  
Sbjct  61    PEKREAYDKHGKAGVTQDTMLDPSAVFGMVFGSDLFEDYVGQLALASIAGIEAEEDSQDP  120

Query  1422  EFDAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVD  1243
             E   +K+QEKM+V+Q EREEKL  ILK+RL  +V+G  EEF   A++E  RLS A++G  
Sbjct  121   EVRKQKIQEKMKVLQNEREEKLINILKDRLQPFVEGQTEEFVKWAKSEARRLSQASFGEA  180

Query  1242  MLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDM  1063
             ML+TIGY+YTR+AA+ELGK   Y+ VPF+AEW R+ GH IKSQV AA+GA +LIQ+Q+++
Sbjct  181   MLHTIGYVYTRKAARELGKDKRYMKVPFLAEWVRDTGHQIKSQVMAASGAVSLIQIQDEL  240

Query  1062  KR-QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEE  886
             K           EE + + ++  K  M++SLW++NV DIE+TLS VCQ VL+D N  ++ 
Sbjct  241   KHLNEGENKENKEEIVLKTIEDKKDAMLNSLWQINVVDIESTLSHVCQAVLKDPNASRDV  300

Query  885   LRARAKGLKTLGKVFQRVKSVNGNETETSANTPVQKLD  772
             L+ RA  LK LG +FQ  KS    E      T V K D
Sbjct  301   LKLRAHALKKLGTIFQGAKSAYSRENSLRHETHVVKAD  338



>ref|XP_008385913.1| PREDICTED: chaperone protein dnaJ 10-like [Malus domestica]
Length=339

 Score =   370 bits (951),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 185/324 (57%), Positives = 244/324 (75%), Gaps = 4/324 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVK+T YY+VLGV+  A+ A+IKKAYY+KAR+VHPDKNP DP AA NFQ LGEAYQVLSD
Sbjct  1     MVKDTAYYEVLGVNVDASYAEIKKAYYLKARRVHPDKNPGDPKAADNFQALGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDI--FTDGE  1423
             P +R+AYD +GK+GI  ++++DPAA+F MLFGSE FEDY+GQLA+AS++S++I   T   
Sbjct  61    PEKREAYDKHGKAGIQQDSMVDPAAVFGMLFGSEFFEDYVGQLALASLSSVEIEEETQDP  120

Query  1422  EFDAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVD  1243
             E   +K+ EKMR +Q+ERE KL  ILK+RL  +V G  ++F   A +E  RLS+AA+G  
Sbjct  121   EVRRQKVTEKMRALQKEREVKLITILKDRLQPFVDGCTDDFVKWANSEARRLSSAAFGEA  180

Query  1242  MLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDM  1063
             ML+TIGYIYTR+AA+E+GK   Y+ VPF+AEW R+KGH IKSQV AA+GA ALIQLQED+
Sbjct  181   MLHTIGYIYTRKAAREIGKDKRYMKVPFLAEWVRDKGHQIKSQVAAASGAVALIQLQEDL  240

Query  1062  KRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEEL  883
             K+    E    EE L + ++  K ++++SLW++NV DIE+TLS VCQ VL+D  V ++ L
Sbjct  241   KKLNQVENK--EETLMKAIEDKKDLVLNSLWQINVVDIESTLSHVCQAVLKDPTVSRDVL  298

Query  882   RARAKGLKTLGKVFQRVKSVNGNE  811
             R RA+ LK LG +FQ  K+    E
Sbjct  299   RLRAQALKKLGTIFQGAKAAYSRE  322



>dbj|BAK03712.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=316

 Score =   368 bits (945),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 184/314 (59%), Positives = 241/314 (77%), Gaps = 3/314 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVKET YY+ LGVS  A+ + IKKAYY++AR VHPDKNP +P AA+ FQ LGEAYQVLSD
Sbjct  1     MVKETAYYETLGVSVDASPSDIKKAYYVQARLVHPDKNPGNPDAARKFQDLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             PA+++AYD +GK G+S E ++DPAA+F MLFGS+ FEDY+GQLA+AS+AS+++       
Sbjct  61    PAKKEAYDKHGKEGLSQENMVDPAAVFGMLFGSDYFEDYVGQLALASIASVEVDEGLSSQ  120

Query  1416  DAK-KLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDM  1240
             DA+ K+QEK++ +Q ERE+KL + LK+RL  YV G K++F   A AE  RLS AA+G  M
Sbjct  121   DARAKVQEKIKGLQTEREQKLTQSLKDRLQPYVDGRKDDFVHWANAEAKRLSEAAFGEAM  180

Query  1239  LNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMK  1060
             L+T+GYIY RQA++ELGK  +Y+GVPFIAEW R+KGH IKSQV AA+GA AL+QLQ+ MK
Sbjct  181   LHTVGYIYVRQASRELGKSKLYMGVPFIAEWVRDKGHTIKSQVHAASGAIALMQLQDGMK  240

Query  1059  RQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELR  880
             +    EG   EE+L +  +  K+ M++SLWK+NV DIE+TLSRVCQ VL+D+ V K+ L+
Sbjct  241   K--VEEGANKEEQLMKSFEEKKEAMLNSLWKINVVDIESTLSRVCQAVLKDSTVSKDVLK  298

Query  879   ARAKGLKTLGKVFQ  838
              R K LK LG +FQ
Sbjct  299   LRGKALKKLGTIFQ  312



>ref|NP_001242400.1| uncharacterized protein LOC100787075 [Glycine max]
 gb|ACU21512.1| unknown [Glycine max]
Length=339

 Score =   368 bits (945),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 180/324 (56%), Positives = 247/324 (76%), Gaps = 4/324 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVK+T YYD+LGV+  A+ A+IKKAYY+KAR VHPDKNP DP AA+NFQ LGEAYQVLSD
Sbjct  1     MVKDTAYYDILGVNFDASAAEIKKAYYVKARIVHPDKNPGDPKAAENFQKLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P +R AYD +GK G+  ++++DP  +F M+FGSE FE+YIG+LA+AS++S++I  D ++ 
Sbjct  61    PGKRAAYDEHGKEGVPQDSMMDPTTVFGMIFGSEYFEEYIGKLALASLSSIEIEEDSQDP  120

Query  1416  DA--KKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVD  1243
             +   +++QEKM+  Q+ERE+KL+ ILK+RL  +V   ++EF A A++E   LS AA+G  
Sbjct  121   EVLRQRIQEKMKAWQKEREQKLSTILKDRLQPFVDDREDEFTAWAQSEARSLSKAAFGEA  180

Query  1242  MLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDM  1063
             ML+TIGYIYTR++A+ELGK   Y+ VPF+AEW R+KGH IKSQVTAA+GA +LIQ+QE++
Sbjct  181   MLHTIGYIYTRKSARELGKDMRYMNVPFLAEWVRDKGHRIKSQVTAASGAVSLIQIQEEL  240

Query  1062  KRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEEL  883
             K+    +G   EE + + ++  K  MI+SLW++NV DIE+TLSRVCQ VL+D +  K+ L
Sbjct  241   KKL--NQGENKEESIVKAIEDKKDAMINSLWQINVIDIESTLSRVCQAVLKDPSASKDVL  298

Query  882   RARAKGLKTLGKVFQRVKSVNGNE  811
             R+RAK LK LG +FQ  KS    E
Sbjct  299   RSRAKALKKLGTIFQGAKSAYNRE  322



>ref|XP_007201379.1| hypothetical protein PRUPE_ppa007841mg [Prunus persica]
 gb|EMJ02578.1| hypothetical protein PRUPE_ppa007841mg [Prunus persica]
Length=354

 Score =   369 bits (947),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 195/358 (54%), Positives = 253/358 (71%), Gaps = 22/358 (6%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQV----------  1627
             MVK+T YYDVLGV+  A+ A+IKKAYY+KAR VHPDKNP DP AA+NFQ           
Sbjct  1     MVKDTTYYDVLGVNVEASYAEIKKAYYVKARIVHPDKNPGDPKAAENFQAQDASLKKQKP  60

Query  1626  -----LGEAYQVLSDPAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAM  1462
                  LGEAYQVLSDP +R+AYD +GK+GI  ++++DPAA+F MLFGSE FEDY+GQLA+
Sbjct  61    RLREALGEAYQVLSDPDKREAYDKHGKAGIQQDSMVDPAAVFGMLFGSEYFEDYVGQLAL  120

Query  1461  ASMASLDIF--TDGEEFDAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHA  1288
             AS++S++I   T   E   +++QEKMR +Q+ERE KL  ILK+RL  +V G  +EF   A
Sbjct  121   ASLSSVEIEEETQDPEVHRQRVQEKMRALQKEREVKLITILKDRLQPFVDGRTDEFVKWA  180

Query  1287  EAEVSRLSNAAYGVDMLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVT  1108
              +E  RLS AA+G  ML+TIGYIYTR+AA+E+GK   Y+ VPF+AEW R+KGH IKSQV+
Sbjct  181   NSEARRLSTAAFGEAMLHTIGYIYTRKAAREIGKDKRYMKVPFLAEWVRDKGHQIKSQVS  240

Query  1107  AATGAFALIQLQEDMKRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRV  928
             AA+GA ALIQLQED+K+    +G   EE L + ++  K  +++SLW++NV DIE+TLSRV
Sbjct  241   AASGAVALIQLQEDLKK--LNQGENKEETLMKAIEDKKDQVLNSLWQINVVDIESTLSRV  298

Query  927   CQMVLQDNNVKKEELRARAKGLKTLGKVFQRVKSVNGNETE-TSANTPVQKLDGSEPS  757
             CQ VL+D  V ++ LR RAK LK LG VFQ  K+    E      N P  K+D +  S
Sbjct  299   CQAVLKDPTVSRDVLRGRAKALKKLGTVFQGAKAAYSRENSLRHENDP--KIDSASSS  354



>ref|XP_011047951.1| PREDICTED: chaperone protein dnaJ 10 [Populus euphratica]
Length=339

 Score =   368 bits (944),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 178/319 (56%), Positives = 245/319 (77%), Gaps = 4/319 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVK+T +YD+LGVS  A+ A+IKKAYY+KA+ VHPDKNP DP AA NFQ+LGEAYQ+LSD
Sbjct  1     MVKDTTFYDILGVSVEASPAEIKKAYYLKAKVVHPDKNPGDPKAADNFQILGEAYQILSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTD--GE  1423
             P +R+ YD YGK GI+ E ++DP+A+F MLFGSELFEDY+GQLA+A+++S +   D   +
Sbjct  61    PQKREGYDKYGKEGITEEIMLDPSAVFGMLFGSELFEDYVGQLALATLSSFENEDDIQDK  120

Query  1422  EFDAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVD  1243
             E   ++ QEKM+V+Q+ER+EKL   LK RL  +V+G + EF   A++E  RLS AA+G  
Sbjct  121   EMQQQRNQEKMKVLQKERDEKLITNLKIRLETFVEGQENEFTNWAQSEARRLSTAAFGEA  180

Query  1242  MLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDM  1063
             ML+TIGYIYTR+AA+ELGK   Y+ VPF+AEW R+KGH +KSQV AA+GA +LIQ++E++
Sbjct  181   MLHTIGYIYTRKAARELGKDRRYMKVPFLAEWVRDKGHLMKSQVMAASGAVSLIQIREEL  240

Query  1062  KRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEEL  883
             K+    E    EE +++ ++  K  M+ SLW++NV DIE+TLSRVCQ VL+D +V ++ L
Sbjct  241   KKLNGVENQ--EEGMQKILEDKKDSMLQSLWQINVLDIESTLSRVCQAVLKDPSVSRDVL  298

Query  882   RARAKGLKTLGKVFQRVKS  826
             ++RAKGL+ LG +FQ  K+
Sbjct  299   KSRAKGLRKLGTIFQGAKA  317



>ref|XP_011037476.1| PREDICTED: chaperone protein dnaJ 10-like isoform X2 [Populus 
euphratica]
Length=332

 Score =   367 bits (943),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 183/322 (57%), Positives = 241/322 (75%), Gaps = 7/322 (2%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVK+T +YD+LGV   AT A+IKKAYY+KAR VHPDKNP DP AA+NFQ+L EAYQ+LSD
Sbjct  1     MVKDTAFYDLLGVKVEATPAEIKKAYYLKARIVHPDKNPGDPKAAENFQMLSEAYQILSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P +R+ YD YGK GI+ E+++DP+A+F M+FGSELFEDY+GQLA+A++ASL+      E 
Sbjct  61    PQKREKYDMYGKEGITQESMVDPSAVFGMMFGSELFEDYVGQLALATIASLE-----NEG  115

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
               + ++ KM+V+QREREEKL  ILKN L  +V+G + EF   A++E  RLS AA+G  ML
Sbjct  116   GIQDMEMKMKVLQREREEKLITILKNCLEKFVEGRENEFTNWAKSEARRLSAAAFGEAML  175

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             +TIGYIYTR+A+KELGK   Y+ VPF AEW R+KGH IKSQV AA+GA +LIQ+QE++K+
Sbjct  176   HTIGYIYTRKASKELGKDKRYMKVPFFAEWVRDKGHLIKSQVMAASGAVSLIQIQEELKK  235

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
                 E    EE +++ ++  K  M+ SLW++NV DIE TLSRVC  VL D +V +E L++
Sbjct  236   LDGVENR--EESMQKILEDKKDAMLQSLWQINVVDIERTLSRVCLEVLTDPSVSREVLKS  293

Query  876   RAKGLKTLGKVFQRVKSVNGNE  811
             RAKGLK LG +FQ  K+    E
Sbjct  294   RAKGLKKLGTIFQGAKAAYSRE  315



>ref|XP_011037471.1| PREDICTED: chaperone protein dnaJ 10-like isoform X1 [Populus 
euphratica]
 ref|XP_011037472.1| PREDICTED: chaperone protein dnaJ 10-like isoform X1 [Populus 
euphratica]
 ref|XP_011037473.1| PREDICTED: chaperone protein dnaJ 10-like isoform X1 [Populus 
euphratica]
 ref|XP_011037474.1| PREDICTED: chaperone protein dnaJ 10-like isoform X1 [Populus 
euphratica]
 ref|XP_011037475.1| PREDICTED: chaperone protein dnaJ 10-like isoform X1 [Populus 
euphratica]
Length=336

 Score =   367 bits (942),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 181/313 (58%), Positives = 238/313 (76%), Gaps = 7/313 (2%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVK+T +YD+LGV   AT A+IKKAYY+KAR VHPDKNP DP AA+NFQ+L EAYQ+LSD
Sbjct  1     MVKDTAFYDLLGVKVEATPAEIKKAYYLKARIVHPDKNPGDPKAAENFQMLSEAYQILSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P +R+ YD YGK GI+ E+++DP+A+F M+FGSELFEDY+GQLA+A++ASL+      E 
Sbjct  61    PQKREKYDMYGKEGITQESMVDPSAVFGMMFGSELFEDYVGQLALATIASLE-----NEG  115

Query  1416  DAKKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDML  1237
               + ++ KM+V+QREREEKL  ILKN L  +V+G + EF   A++E  RLS AA+G  ML
Sbjct  116   GIQDMEMKMKVLQREREEKLITILKNCLEKFVEGRENEFTNWAKSEARRLSAAAFGEAML  175

Query  1236  NTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMKR  1057
             +TIGYIYTR+A+KELGK   Y+ VPF AEW R+KGH IKSQV AA+GA +LIQ+QE++K+
Sbjct  176   HTIGYIYTRKASKELGKDKRYMKVPFFAEWVRDKGHLIKSQVMAASGAVSLIQIQEELKK  235

Query  1056  QLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELRA  877
                 E    EE +++ ++  K  M+ SLW++NV DIE TLSRVC  VL D +V +E L++
Sbjct  236   LDGVENR--EESMQKILEDKKDAMLQSLWQINVVDIERTLSRVCLEVLTDPSVSREVLKS  293

Query  876   RAKGLKTLGKVFQ  838
             RAKGLK LG +FQ
Sbjct  294   RAKGLKKLGTIFQ  306



>ref|XP_003540519.1| PREDICTED: chaperone protein dnaJ 10-like isoform X1 [Glycine 
max]
Length=339

 Score =   367 bits (942),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 183/335 (55%), Positives = 247/335 (74%), Gaps = 7/335 (2%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVK+T YYD+LGV+  A+ A+IKKAYY+KAR VHPDKNP DP AA+NFQ LGEAYQVLSD
Sbjct  1     MVKDTAYYDILGVNYDASAAEIKKAYYVKARIVHPDKNPEDPKAAENFQKLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P +R AYD +GK G+  ++++DP  +F M+FGSE FE+YIGQLA+AS+AS++I  D ++ 
Sbjct  61    PGKRAAYDEHGKEGVPQDSMMDPTTVFGMIFGSEFFEEYIGQLALASLASIEIEEDSQDP  120

Query  1416  DA--KKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVD  1243
             +   +++QEKM+  Q+ERE+KL+  LK+RL  +V G ++EF A A++E   LS AA+G  
Sbjct  121   EVLRQRIQEKMKAWQKEREQKLSTFLKDRLQPFVDGREDEFTAWAKSEARSLSKAAFGEA  180

Query  1242  MLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDM  1063
             ML+TIGYIYTR+AA+ELGK   Y+ VPF+AEW R KGH IKSQVTAA+GA +LIQ+QE++
Sbjct  181   MLHTIGYIYTRKAARELGKDIRYMNVPFLAEWVRGKGHCIKSQVTAASGAVSLIQIQEEL  240

Query  1062  KRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEEL  883
             K+    +G   EE + + ++  K  MI+SLW++NV DIE+TLS VCQ VL+D +  K+ L
Sbjct  241   KKL--NQGENKEESIVKAIEDKKDAMINSLWQINVIDIESTLSHVCQTVLKDPSASKDVL  298

Query  882   RARAKGLKTLGKVFQRVKSVNGNET---ETSANTP  787
             ++RAK LK LG +FQ  K     E      S  TP
Sbjct  299   KSRAKALKKLGTIFQGAKIAYNRENSLRRESGKTP  333



>ref|XP_006593418.1| PREDICTED: uncharacterized protein LOC100787075 isoform X1 [Glycine 
max]
 gb|KHN37638.1| Chaperone protein dnaJ 10 [Glycine soja]
Length=339

 Score =   367 bits (942),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 179/324 (55%), Positives = 247/324 (76%), Gaps = 4/324 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVK+T YYD+LGV+  A+ A+IKKAYY+KAR VHPDKNP DP AA+NFQ LGEAYQVLSD
Sbjct  1     MVKDTAYYDILGVNFDASAAEIKKAYYVKARIVHPDKNPGDPKAAENFQKLGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P +R AYD +GK G+  ++++DP  +F M+FGSE FE+YIG+LA+AS++S++I  D ++ 
Sbjct  61    PGKRAAYDEHGKEGVPQDSMMDPTTVFGMIFGSEYFEEYIGKLALASLSSIEIEEDSQDP  120

Query  1416  DA--KKLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVD  1243
             +   +++QEKM+  Q+ERE+KL+ ILK+RL  +V   ++EF A A++E   LS AA+G  
Sbjct  121   EVLRQRIQEKMKAWQKEREQKLSTILKDRLQPFVDDREDEFTAWAQSEARSLSKAAFGEA  180

Query  1242  MLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDM  1063
             ML+TIGYIYTR++A+ELGK   Y+ VPF+AEW R+KGH IKSQVTAA+GA +LIQ+QE++
Sbjct  181   MLHTIGYIYTRKSARELGKDMRYMNVPFLAEWVRDKGHRIKSQVTAASGAVSLIQIQEEL  240

Query  1062  KRQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEEL  883
             K+    +G   EE + + ++  K  MI+SLW++NV DIE+TLSRVCQ VL+D +  K+ L
Sbjct  241   KKL--NQGENKEESIVKAIEDKKDAMINSLWQINVIDIESTLSRVCQAVLKDPSASKDVL  298

Query  882   RARAKGLKTLGKVFQRVKSVNGNE  811
             ++RAK LK LG +FQ  KS    E
Sbjct  299   KSRAKALKKLGTIFQGAKSAYNRE  322



>ref|XP_002512946.1| Chaperone protein dnaJ, putative [Ricinus communis]
 gb|EEF49449.1| Chaperone protein dnaJ, putative [Ricinus communis]
Length=338

 Score =   367 bits (942),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 183/327 (56%), Positives = 245/327 (75%), Gaps = 10/327 (3%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVK+T YY++LGV+  A+ A IK+AYY+KAR VHPDKNP DP AA+NFQ LGEAYQ+LSD
Sbjct  1     MVKDTAYYEILGVNMDASPADIKRAYYLKARVVHPDKNPGDPKAAENFQKLGEAYQILSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P +R+AYD +GK GI  ++++DPAA+F MLFGSE FEDYIGQLA+A+++S++I  D  + 
Sbjct  61    PEKREAYDKHGKEGIPQDSMLDPAAVFGMLFGSEFFEDYIGQLALATLSSIEIEEDTPDV  120

Query  1416  DAKK--LQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVD  1243
             + +K  +QEKMR +Q+ERE KL  +LKNRL  +V+G  +EF   A +E  RLS A++G  
Sbjct  121   EIRKQRVQEKMREMQKEREGKLTTLLKNRLEPFVEGQVDEFINWANSEARRLSAASFGEA  180

Query  1242  MLNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDM  1063
             ML+TIGYIYTR+A++ELGK   Y+ VPF+AEW R+KGH IKSQV AA+GA +LIQ+QED+
Sbjct  181   MLHTIGYIYTRKASRELGKDKRYMKVPFLAEWVRDKGHQIKSQVMAASGAVSLIQIQEDL  240

Query  1062  KRQLSAEGNYTeeeleEYMQS---HKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKK  892
             K+      N TE + E  +++    K  M+ SLW++NV DIE+TLS VCQ VL+D +V K
Sbjct  241   KKL-----NQTETKEENLLKAIGDRKDAMLQSLWQINVVDIESTLSHVCQAVLKDPSVSK  295

Query  891   EELRARAKGLKTLGKVFQRVKSVNGNE  811
             + L+ RAKGLK LG +FQ  K+    E
Sbjct  296   DVLKLRAKGLKKLGTIFQGAKTAYSRE  322



>ref|XP_004969670.1| PREDICTED: chaperone protein dnaJ 10-like isoform X1 [Setaria 
italica]
Length=337

 Score =   367 bits (942),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 184/318 (58%), Positives = 243/318 (76%), Gaps = 3/318 (1%)
 Frame = -2

Query  1776  MVKETEYYDVLGVSPMATEAQIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD  1597
             MVK++ YYDVL VS  A+ AQIKKAYY+KA+ VHPDKNP++P AA  FQ LGEAYQVLSD
Sbjct  1     MVKDSAYYDVLEVSTDASVAQIKKAYYLKAKLVHPDKNPDNPDAAWRFQELGEAYQVLSD  60

Query  1596  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASMASLDIFTDGEEF  1417
             P +++AYD YGK G+  + +IDP A+F MLFGS+ FEDY+GQLA+AS+AS++I  +    
Sbjct  61    PVKKEAYDKYGKEGLPQDNMIDPTAVFGMLFGSDYFEDYVGQLALASVASVEIEEESTTP  120

Query  1416  DAK-KLQEKMRVVQREREEKLAEILKNRLNVYVQGSKEEFRAHAEAEVSRLSNAAYGVDM  1240
             +A+ ++QEK++ +Q ERE+ L + LK+RL  YV G +EEF   A AE  RLS AA+G  M
Sbjct  121   EARTRVQEKIKNLQTEREQTLIQSLKDRLQPYVDGRQEEFGDWANAEARRLSQAAFGEAM  180

Query  1239  LNTIGYIYTRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAFALIQLQEDMK  1060
             L+TIGYIY RQAA+ELGK  +Y+GVPFIAEW R+KGH +KSQV AA GA +LIQLQE +K
Sbjct  181   LHTIGYIYVRQAARELGKNKLYIGVPFIAEWVRDKGHHVKSQVNAAAGAISLIQLQEGIK  240

Query  1059  RQLSAEGNYTeeeleEYMQSHKKIMIDSLWKLNVADIETTLSRVCQMVLQDNNVKKEELR  880
             +    EG+  EE+L + ++  K  M++SLWK+NV DIE+TLSRVCQ VL++ N+ ++ L+
Sbjct  241   K--IEEGDNKEEQLIKNIEEKKDAMLNSLWKINVVDIESTLSRVCQAVLKETNIPRDVLK  298

Query  879   ARAKGLKTLGKVFQRVKS  826
              RA+GLK LG +FQ  KS
Sbjct  299   LRARGLKKLGTIFQGAKS  316



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6080211471996