BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7568_g1_i1 len=1334 path=[1312:0-713 2026:714-1333]

Length=1334
                                                                      Score     E

ref|XP_006348579.1|  PREDICTED: peroxidase 56-like                      365   7e-120   
ref|XP_004228554.1|  PREDICTED: peroxidase 57-like                      368   1e-119   
ref|XP_009759243.1|  PREDICTED: peroxidase 57-like                      359   3e-116   
ref|XP_009623183.1|  PREDICTED: peroxidase 57-like                      357   2e-115   
ref|XP_004239120.1|  PREDICTED: peroxidase 39-like                      355   5e-114   
ref|XP_006357629.1|  PREDICTED: peroxidase 39-like                      352   2e-112   
ref|XP_009623842.1|  PREDICTED: peroxidase 57-like                      351   3e-112   
ref|XP_009774685.1|  PREDICTED: peroxidase 57-like                      349   2e-111   
gb|EYU22520.1|  hypothetical protein MIMGU_mgv1a008023mg                312   1e-98    
ref|XP_011071133.1|  PREDICTED: peroxidase 39-like                      305   4e-95    
gb|EPS71843.1|  peroxidase 1                                            295   5e-93    
ref|XP_010938174.1|  PREDICTED: peroxidase 5-like                       276   2e-85    
ref|XP_007223978.1|  hypothetical protein PRUPE_ppa014723mg             275   3e-85    
ref|XP_010674605.1|  PREDICTED: peroxidase 5-like                       273   3e-84    
ref|XP_010040180.1|  PREDICTED: peroxidase 5-like                       271   4e-83    
ref|XP_008221882.1|  PREDICTED: peroxidase 5-like                       271   4e-83    
gb|KCW45421.1|  hypothetical protein EUGRSUZ_L00890                     270   4e-83    
ref|XP_010921348.1|  PREDICTED: peroxidase 5-like                       269   9e-83    
ref|XP_008781197.1|  PREDICTED: peroxidase 5-like                       269   1e-82    
ref|XP_010921347.1|  PREDICTED: peroxidase 5-like                       267   7e-82    
ref|XP_010251114.1|  PREDICTED: peroxidase 5-like                       267   8e-82    
ref|XP_010674524.1|  PREDICTED: peroxidase 5-like                       267   8e-82    
ref|XP_010911662.1|  PREDICTED: peroxidase 5-like                       266   1e-81    
ref|XP_010270944.1|  PREDICTED: peroxidase 5-like                       266   2e-81    
ref|XP_010675632.1|  PREDICTED: peroxidase 5-like                       266   3e-81    
ref|XP_010921346.1|  PREDICTED: peroxidase 5-like                       266   3e-81    
dbj|BAK03531.1|  predicted protein                                      265   4e-81    
ref|XP_007161895.1|  hypothetical protein PHAVU_001G106600g             264   5e-81    
ref|XP_010032734.1|  PREDICTED: peroxidase 5-like                       264   8e-81    
ref|XP_010041692.1|  PREDICTED: peroxidase 5-like                       263   3e-80    
ref|XP_009359339.1|  PREDICTED: peroxidase 57-like                      263   3e-80    
ref|XP_008340087.1|  PREDICTED: peroxidase 57-like                      263   3e-80    
gb|KCW44165.1|  hypothetical protein EUGRSUZ_L02416                     261   4e-80    
ref|XP_010032732.1|  PREDICTED: peroxidase 5-like                       262   5e-80    
ref|XP_010026045.1|  PREDICTED: peroxidase 5-like                       262   7e-80    
ref|XP_003565723.1|  PREDICTED: peroxidase 5-like                       263   8e-80    
ref|XP_002440652.1|  hypothetical protein SORBIDRAFT_09g004650          263   8e-80    Sorghum bicolor [broomcorn]
gb|KCW52190.1|  hypothetical protein EUGRSUZ_J01619                     261   1e-79    
ref|XP_008781200.1|  PREDICTED: peroxidase 5-like                       261   1e-79    
ref|XP_010234947.1|  PREDICTED: peroxidase 5-like                       260   1e-79    
ref|XP_010069737.1|  PREDICTED: peroxidase 5-like                       261   1e-79    
ref|XP_002872571.1|  peroxidase ATP19a                                  261   2e-79    
ref|XP_004310167.1|  PREDICTED: peroxidase 5-like                       261   2e-79    
ref|XP_004247506.1|  PREDICTED: peroxidase 44-like                      261   2e-79    
ref|XP_004968663.1|  PREDICTED: peroxidase 1-like                       261   3e-79    
gb|KCW58170.1|  hypothetical protein EUGRSUZ_H00887                     260   3e-79    
gb|ACN36789.1|  unknown                                                 260   4e-79    Zea mays [maize]
ref|XP_008647554.1|  PREDICTED: uncharacterized protein LOC100273...    260   4e-79    
gb|KCW52189.1|  hypothetical protein EUGRSUZ_J01618                     259   5e-79    
ref|XP_007153060.1|  hypothetical protein PHAVU_003G003200g             259   7e-79    
ref|XP_010455535.1|  PREDICTED: peroxidase 39-like                      259   1e-78    
ref|XP_006650985.1|  PREDICTED: peroxidase 5-like                       259   1e-78    
ref|XP_003534685.2|  PREDICTED: peroxidase 5-like                       259   1e-78    
ref|XP_004977105.1|  PREDICTED: peroxidase 1-like                       259   2e-78    
ref|XP_010032733.1|  PREDICTED: peroxidase 5-like                       258   2e-78    
gb|KHN30703.1|  Peroxidase 5                                            258   2e-78    
ref|XP_010435105.1|  PREDICTED: peroxidase 39                           258   2e-78    
ref|XP_010032731.1|  PREDICTED: peroxidase 5-like                       258   2e-78    
emb|CAC21393.1|  peroxidase                                             259   3e-78    Zea mays [maize]
ref|XP_003536264.1|  PREDICTED: peroxidase 5-like                       258   3e-78    
ref|XP_004300922.1|  PREDICTED: peroxidase 57-like                      262   3e-78    
ref|XP_007161518.1|  hypothetical protein PHAVU_001G076000g             258   4e-78    
ref|XP_011043754.1|  PREDICTED: peroxidase 5-like                       258   4e-78    
ref|XP_006367225.1|  PREDICTED: peroxidase 44-like                      257   4e-78    
ref|XP_006288205.1|  hypothetical protein CARUB_v10001445mg             257   4e-78    
ref|XP_010485714.1|  PREDICTED: peroxidase 28-like isoform X1           257   4e-78    
ref|NP_001140982.1|  uncharacterized protein LOC100273061 precursor     258   5e-78    Zea mays [maize]
ref|XP_009359340.1|  PREDICTED: peroxidase 44-like                      258   5e-78    
ref|XP_011037007.1|  PREDICTED: peroxidase 3-like                       257   5e-78    
gb|EEC74412.1|  hypothetical protein OsI_09774                          256   6e-78    Oryza sativa Indica Group [Indian rice]
ref|XP_009763027.1|  PREDICTED: peroxidase 44-like                      256   7e-78    
gb|AAM52317.1|AC105363_6  Putative peroxidase                           256   7e-78    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010941488.1|  PREDICTED: peroxidase 5-like                       256   8e-78    
ref|XP_010100382.1|  Peroxidase 5                                       258   9e-78    
gb|AAS75394.1|  peroxidase                                              257   1e-77    Zea mays [maize]
gb|KCW52187.1|  hypothetical protein EUGRSUZ_J01616                     256   1e-77    
gb|KHN29593.1|  Peroxidase 5                                            256   1e-77    
gb|AAS75395.1|  peroxidase                                              257   1e-77    Zea mays [maize]
gb|AAS75401.1|  peroxidase                                              257   1e-77    Zea mays [maize]
gb|AAM52320.1|AC105363_9  Putative peroxidase                           256   1e-77    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008649365.1|  PREDICTED: peroxidase 5                            257   2e-77    
ref|NP_001141388.1|  uncharacterized protein LOC100273479 precursor     257   2e-77    Zea mays [maize]
ref|NP_001048793.1|  Os03g0121200                                       256   2e-77    Oryza sativa Japonica Group [Japonica rice]
gb|AAS75393.1|  peroxidase                                              256   2e-77    Zea mays [maize]
ref|XP_010422076.1|  PREDICTED: peroxidase 39-like                      255   2e-77    
gb|AAS75400.1|  peroxidase                                              256   2e-77    Zea mays [maize]
ref|XP_004498110.1|  PREDICTED: peroxidase 5-like                       255   2e-77    
ref|XP_010659743.1|  PREDICTED: peroxidase 5-like                       255   2e-77    
ref|XP_002873856.1|  peroxidase 57                                      255   2e-77    
ref|XP_009627957.1|  PREDICTED: peroxidase 44                           255   3e-77    
ref|XP_007136358.1|  hypothetical protein PHAVU_009G038500g             255   3e-77    
gb|KCW52185.1|  hypothetical protein EUGRSUZ_J01614                     254   3e-77    
ref|XP_003533700.1|  PREDICTED: peroxidase 5-like                       255   3e-77    
ref|NP_192868.1|  peroxidase 39                                         255   3e-77    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006662005.1|  PREDICTED: peroxidase 5-like                       255   3e-77    
ref|XP_011047037.1|  PREDICTED: peroxidase 44                           256   4e-77    
emb|CAA67337.1|  peroxidase                                             254   4e-77    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010671316.1|  PREDICTED: peroxidase 5-like                       255   5e-77    
ref|XP_008340088.1|  PREDICTED: peroxidase 57-like                      255   5e-77    
ref|XP_007153059.1|  hypothetical protein PHAVU_003G003100g             254   5e-77    
ref|XP_003555769.1|  PREDICTED: peroxidase 5-like                       254   5e-77    
ref|XP_009382469.1|  PREDICTED: peroxidase 5 {ECO:0000250|UniProt...    254   6e-77    
ref|XP_010453985.1|  PREDICTED: peroxidase 57                           254   6e-77    
ref|XP_007149959.1|  hypothetical protein PHAVU_005G113800g             254   6e-77    
ref|NP_001065172.1|  Os10g0536700                                       254   6e-77    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006372957.1|  hypothetical protein POPTR_0017s06550g             254   7e-77    
ref|XP_006846505.1|  hypothetical protein AMTR_s00018p00156910          254   7e-77    
ref|XP_011075883.1|  PREDICTED: peroxidase 5-like                       254   8e-77    
ref|NP_001048794.1|  Os03g0121300                                       254   8e-77    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004310166.1|  PREDICTED: peroxidase 1-like                       254   9e-77    
gb|EAY79346.1|  hypothetical protein OsI_34475                          254   9e-77    Oryza sativa Indica Group [Indian rice]
ref|XP_007145114.1|  hypothetical protein PHAVU_007G211100g             254   9e-77    
gb|ACU19509.1|  unknown                                                 254   9e-77    Glycine max [soybeans]
emb|CAN68183.1|  hypothetical protein VITISV_028562                     254   9e-77    Vitis vinifera
ref|XP_002319196.2|  hypothetical protein POPTR_0013s06300g             254   9e-77    Populus trichocarpa [western balsam poplar]
gb|ABK93918.1|  unknown                                                 254   1e-76    Populus trichocarpa [western balsam poplar]
ref|XP_011092685.1|  PREDICTED: peroxidase 5-like                       254   1e-76    
ref|XP_003571312.2|  PREDICTED: peroxidase 47                           253   1e-76    
ref|XP_006372959.1|  hypothetical protein POPTR_0017s06570g             253   1e-76    
ref|XP_006372960.1|  hypothetical protein POPTR_0017s06570g             253   1e-76    
ref|XP_011037006.1|  PREDICTED: peroxidase 3-like                       253   2e-76    
ref|XP_008246297.1|  PREDICTED: peroxidase 5-like                       253   2e-76    
ref|XP_003535856.1|  PREDICTED: peroxidase 5-like                       253   2e-76    
ref|XP_003540316.1|  PREDICTED: peroxidase 3                            253   2e-76    
ref|XP_002440653.1|  hypothetical protein SORBIDRAFT_09g004660          254   2e-76    Sorghum bicolor [broomcorn]
gb|KHN00317.1|  Peroxidase 5                                            252   3e-76    
ref|XP_003520954.1|  PREDICTED: peroxidase 44-like                      252   3e-76    
gb|ACU20445.1|  unknown                                                 253   3e-76    Glycine max [soybeans]
gb|EYU45326.1|  hypothetical protein MIMGU_mgv1a009971mg                253   3e-76    
ref|XP_010671317.1|  PREDICTED: peroxidase 5-like                       253   3e-76    
ref|XP_007031236.1|  Class III peroxidase 70                            252   4e-76    
ref|XP_004502775.1|  PREDICTED: peroxidase 5-like                       252   4e-76    
ref|XP_010513283.1|  PREDICTED: peroxidase 28-like                      252   4e-76    
ref|XP_006299929.1|  hypothetical protein CARUB_v10016138mg             252   5e-76    
ref|XP_010420511.1|  PREDICTED: peroxidase 57-like isoform X1           251   5e-76    
ref|XP_010268457.1|  PREDICTED: peroxidase 46-like isoform X3           251   6e-76    
ref|XP_006649294.1|  PREDICTED: peroxidase 5-like                       251   6e-76    
ref|XP_002465968.1|  hypothetical protein SORBIDRAFT_01g049140          252   7e-76    Sorghum bicolor [broomcorn]
ref|XP_003567628.1|  PREDICTED: peroxidase 1-like                       253   7e-76    
ref|XP_010919027.1|  PREDICTED: peroxidase 5-like                       251   7e-76    
gb|AAD11481.1|  peroxidase precursor                                    252   8e-76    Glycine max [soybeans]
ref|XP_006840299.1|  hypothetical protein AMTR_s00045p00065690          252   9e-76    
ref|XP_010268455.1|  PREDICTED: peroxidase 46-like isoform X1           251   9e-76    
gb|AAM65434.1|  peroxidase ATP13a                                       251   9e-76    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006840300.1|  hypothetical protein AMTR_s00045p00066730          252   1e-75    
ref|NP_197284.1|  peroxidase 57                                         251   1e-75    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003540317.1|  PREDICTED: peroxidase 39-like                      251   1e-75    
ref|NP_001050193.1|  Os03g0369400                                       251   1e-75    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006594890.1|  PREDICTED: peroxidase 3                            251   1e-75    
ref|XP_010463825.1|  PREDICTED: peroxidase 28-like                      251   1e-75    
ref|XP_004487389.1|  PREDICTED: peroxidase 3-like                       251   1e-75    
ref|XP_008377046.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 5...    251   1e-75    
ref|XP_006350158.1|  PREDICTED: peroxidase 57-like                      251   1e-75    
ref|XP_009361266.1|  PREDICTED: peroxidase 5-like                       251   2e-75    
ref|XP_006408278.1|  hypothetical protein EUTSA_v10021155mg             250   2e-75    
ref|XP_003602405.1|  Peroxidase                                         251   2e-75    
ref|XP_008452817.1|  PREDICTED: peroxidase 18                           251   2e-75    
ref|XP_009798542.1|  PREDICTED: peroxidase 44-like                      251   2e-75    
gb|KFK34345.1|  hypothetical protein AALP_AA5G133200                    251   2e-75    
ref|XP_010674523.1|  PREDICTED: peroxidase 5-like                       251   2e-75    
ref|XP_010034487.1|  PREDICTED: peroxidase 5-like                       250   2e-75    
ref|XP_003558948.1|  PREDICTED: peroxidase 5-like                       251   2e-75    
ref|XP_004985933.1|  PREDICTED: peroxidase 5-like                       250   2e-75    
ref|XP_008808270.1|  PREDICTED: peroxidase 5-like                       250   2e-75    
gb|AAD11482.1|  peroxidase precursor                                    251   2e-75    Glycine max [soybeans]
ref|XP_004973034.1|  PREDICTED: peroxidase 47-like                      250   2e-75    
ref|XP_004977108.1|  PREDICTED: peroxidase 1-like                       251   2e-75    
ref|XP_008390085.1|  PREDICTED: peroxidase 5-like                       250   3e-75    
ref|XP_009126210.1|  PREDICTED: peroxidase 57                           249   3e-75    
gb|EYU39444.1|  hypothetical protein MIMGU_mgv1a009735mg                250   3e-75    
ref|XP_010659811.1|  PREDICTED: peroxidase 5-like                       250   3e-75    
ref|XP_004985934.1|  PREDICTED: peroxidase 5-like                       250   3e-75    
dbj|BAK01586.1|  predicted protein                                      250   3e-75    
gb|EAY90172.1|  hypothetical protein OsI_11737                          250   3e-75    Oryza sativa Indica Group [Indian rice]
dbj|BAJ88342.1|  predicted protein                                      250   4e-75    
ref|XP_008808268.1|  PREDICTED: peroxidase 5-like                       249   4e-75    
emb|CDY02685.1|  BnaC02g07500D                                          249   4e-75    
ref|XP_010540729.1|  PREDICTED: peroxidase 39                           251   5e-75    
ref|XP_011077202.1|  PREDICTED: peroxidase 5-like                       253   5e-75    
gb|EYU39443.1|  hypothetical protein MIMGU_mgv1a009818mg                249   6e-75    
ref|XP_006594891.1|  PREDICTED: peroxidase 39-like                      249   6e-75    
ref|XP_011077203.1|  PREDICTED: peroxidase 5-like                       253   6e-75    
ref|XP_007226228.1|  hypothetical protein PRUPE_ppa016743mg             249   7e-75    
gb|EYU39442.1|  hypothetical protein MIMGU_mgv1a009821mg                249   7e-75    
ref|XP_004960411.1|  PREDICTED: peroxidase 5-like                       249   7e-75    
gb|EMT07621.1|  Peroxidase 5                                            249   7e-75    
ref|XP_010069739.1|  PREDICTED: peroxidase 5-like                       249   8e-75    
gb|ACU24335.1|  unknown                                                 248   9e-75    Glycine max [soybeans]
gb|KCW58173.1|  hypothetical protein EUGRSUZ_H00890                     248   1e-74    
gb|KHN36550.1|  Peroxidase 39                                           248   1e-74    
gb|KFK26006.1|  hypothetical protein AALP_AA8G190700                    248   1e-74    
ref|XP_010558694.1|  PREDICTED: peroxidase 57-like                      248   1e-74    
ref|XP_009767393.1|  PREDICTED: peroxidase 47                           248   1e-74    
ref|XP_003613163.1|  Peroxidase                                         250   1e-74    
ref|NP_001054728.1|  Os05g0162000                                       249   1e-74    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009768802.1|  PREDICTED: peroxidase 5-like                       249   1e-74    
ref|XP_009629163.1|  PREDICTED: peroxidase 5 {ECO:0000250|UniProt...    249   1e-74    
ref|XP_002525672.1|  Peroxidase 44 precursor, putative                  248   1e-74    Ricinus communis
emb|CDX85441.1|  BnaA02g03720D                                          248   1e-74    
ref|XP_010492748.1|  PREDICTED: peroxidase 57-like                      248   1e-74    
tpe|CAH69314.1|  TPA: class III peroxidase 72 precursor                 249   1e-74    
ref|XP_004960409.1|  PREDICTED: peroxidase 5-like                       248   1e-74    
gb|KDP30908.1|  hypothetical protein JCGZ_15520                         248   1e-74    
dbj|BAA77387.1|  peroxidase 1                                           248   2e-74    Scutellaria baicalensis [Baikal skullcap]
ref|XP_006645837.1|  PREDICTED: peroxidase 1-like                       249   2e-74    
gb|EPS60748.1|  hypothetical protein M569_14053                         248   2e-74    
ref|XP_008808296.1|  PREDICTED: peroxidase 5-like                       248   2e-74    
ref|XP_009411413.1|  PREDICTED: peroxidase 5 {ECO:0000250|UniProt...    248   2e-74    
gb|ABS44862.1|  putative peroxidase                                     248   2e-74    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008673305.1|  PREDICTED: hypothetical protein isoform X1         248   2e-74    
ref|XP_010919026.1|  PREDICTED: peroxidase 5-like                       247   3e-74    
ref|XP_004304932.1|  PREDICTED: peroxidase 5-like                       247   3e-74    
gb|AHL39150.1|  class III peroxidase                                    247   3e-74    
ref|XP_011003206.1|  PREDICTED: peroxidase 3-like                       247   3e-74    
ref|XP_008221883.1|  PREDICTED: peroxidase 44-like                      248   3e-74    
gb|KCW52188.1|  hypothetical protein EUGRSUZ_J01617                     247   3e-74    
gb|EAY96656.1|  hypothetical protein OsI_18569                          248   4e-74    Oryza sativa Indica Group [Indian rice]
ref|XP_008777086.1|  PREDICTED: peroxidase 47-like                      247   4e-74    
gb|EMS48378.1|  Peroxidase 2                                            247   4e-74    
gb|AFK49308.1|  unknown                                                 249   4e-74    
ref|XP_009400935.1|  PREDICTED: peroxidase 5 {ECO:0000250|UniProt...    247   4e-74    
ref|XP_002443747.1|  hypothetical protein SORBIDRAFT_07g001280          246   5e-74    Sorghum bicolor [broomcorn]
ref|XP_003589739.1|  Peroxidase                                         247   5e-74    
gb|KFK31897.1|  hypothetical protein AALP_AA6G173300                    246   5e-74    
ref|XP_009615897.1|  PREDICTED: peroxidase 47                           246   5e-74    
ref|XP_008379618.1|  PREDICTED: peroxidase 3                            246   6e-74    
ref|XP_010918629.1|  PREDICTED: peroxidase 44-like                      246   6e-74    
ref|XP_006412001.1|  hypothetical protein EUTSA_v10025683mg             247   6e-74    
ref|XP_010055033.1|  PREDICTED: peroxidase 57-like                      246   6e-74    
ref|XP_002272663.1|  PREDICTED: peroxidase 5                            248   7e-74    Vitis vinifera
ref|XP_006574525.1|  PREDICTED: peroxidase 5-like                       246   7e-74    
emb|CDP12791.1|  unnamed protein product                                256   7e-74    
ref|XP_010550539.1|  PREDICTED: peroxidase 57-like                      249   8e-74    
ref|XP_002272800.1|  PREDICTED: peroxidase 5                            246   8e-74    Vitis vinifera
ref|XP_004151878.1|  PREDICTED: peroxidase 39-like                      246   9e-74    
gb|KGN63270.1|  hypothetical protein Csa_2G421020                       246   9e-74    
ref|XP_004493228.1|  PREDICTED: peroxidase 44-like                      246   1e-73    
ref|XP_009771021.1|  PREDICTED: peroxidase 9-like                       246   1e-73    
ref|XP_010906352.1|  PREDICTED: peroxidase 5-like                       246   1e-73    
ref|XP_003567635.1|  PREDICTED: peroxidase 1-like                       247   1e-73    
ref|XP_010069738.1|  PREDICTED: peroxidase 5-like                       246   1e-73    
ref|XP_002309832.1|  peroxidase precursor family protein                246   1e-73    Populus trichocarpa [western balsam poplar]
ref|XP_008455840.1|  PREDICTED: peroxidase 39-like                      246   1e-73    
ref|XP_010275557.1|  PREDICTED: peroxidase 5-like                       246   1e-73    
ref|XP_008390088.1|  PREDICTED: peroxidase 57-like                      246   2e-73    
ref|XP_004251979.1|  PREDICTED: peroxidase 5-like                       246   2e-73    
ref|XP_008776272.1|  PREDICTED: peroxidase 5-like                       246   2e-73    
ref|XP_004968662.1|  PREDICTED: peroxidase 1-like                       246   2e-73    
ref|XP_009342265.1|  PREDICTED: peroxidase 3-like                       245   2e-73    
ref|XP_009602319.1|  PREDICTED: peroxidase 44-like                      245   2e-73    
emb|CDP20342.1|  unnamed protein product                                245   2e-73    
ref|XP_006289697.1|  hypothetical protein CARUB_v10003258mg             244   3e-73    
gb|ACN25837.1|  unknown                                                 244   3e-73    Zea mays [maize]
ref|XP_004167193.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 5...    245   3e-73    
gb|EYU39447.1|  hypothetical protein MIMGU_mgv1a022629mg                245   3e-73    
ref|XP_008662930.1|  PREDICTED: peroxidase 5-like                       245   4e-73    
emb|CBI39654.3|  unnamed protein product                                246   4e-73    
emb|CDY13252.1|  BnaC09g24040D                                          244   4e-73    
emb|CDM82175.1|  unnamed protein product                                245   4e-73    
gb|EMS60334.1|  Peroxidase 5                                            245   4e-73    
ref|XP_010671321.1|  PREDICTED: peroxidase 5-like                       244   4e-73    
ref|XP_009619824.1|  PREDICTED: peroxidase 5 {ECO:0000250|UniProt...    244   4e-73    
ref|XP_002515749.1|  Peroxidase 3 precursor, putative                   244   4e-73    Ricinus communis
ref|XP_004252082.1|  PREDICTED: peroxidase 57-like                      244   4e-73    
gb|KFK30268.1|  hypothetical protein AALP_AA7G239300                    244   4e-73    
ref|XP_002323054.1|  hypothetical protein POPTR_0016s14030g             244   4e-73    Populus trichocarpa [western balsam poplar]
ref|XP_002963661.1|  hypothetical protein SELMODRAFT_266691             244   4e-73    
gb|ACJ11761.1|  class III peroxidase                                    244   4e-73    Gossypium hirsutum [American cotton]
ref|XP_011003587.1|  PREDICTED: cationic peroxidase 1-like              244   4e-73    
ref|XP_008648376.1|  PREDICTED: peroxidase 47-like                      244   5e-73    
gb|EMT15854.1|  Peroxidase 2                                            244   5e-73    
gb|EMT13671.1|  Peroxidase 5                                            244   5e-73    
gb|KHN19575.1|  Peroxidase 5                                            244   5e-73    
ref|XP_003578784.1|  PREDICTED: peroxidase 2-like                       244   5e-73    
dbj|BAJ95147.1|  predicted protein                                      244   5e-73    
gb|EYU39450.1|  hypothetical protein MIMGU_mgv1a009721mg                244   5e-73    
gb|KDO66295.1|  hypothetical protein CISIN_1g041695mg                   243   5e-73    
ref|XP_007161894.1|  hypothetical protein PHAVU_001G106500g             244   5e-73    
ref|XP_009781189.1|  PREDICTED: peroxidase 5-like                       244   5e-73    
dbj|BAA96643.1|  putative peroxidase 1                                  244   5e-73    
ref|XP_006840292.1|  hypothetical protein AMTR_s00045p00063130          244   5e-73    
ref|XP_004136142.1|  PREDICTED: peroxidase 5-like                       244   6e-73    
ref|XP_008801590.1|  PREDICTED: peroxidase 5-like                       244   6e-73    
ref|XP_007045599.1|  Peroxidase superfamily protein isoform 1           244   6e-73    
ref|XP_009108181.1|  PREDICTED: peroxidase 39                           244   6e-73    
ref|NP_001141025.1|  uncharacterized protein LOC100273104 precursor     244   7e-73    
ref|NP_001241968.1|  uncharacterized protein LOC100779031 precursor     244   7e-73    
ref|XP_006284092.1|  hypothetical protein CARUB_v10005221mg             244   7e-73    
gb|KHG05441.1|  Peroxidase 3 -like protein                              244   8e-73    
ref|XP_003567633.1|  PREDICTED: peroxidase 1-like                       244   8e-73    
ref|XP_006470493.1|  PREDICTED: peroxidase 5-like                       243   9e-73    
dbj|BAJ95190.1|  predicted protein                                      243   9e-73    
ref|XP_004290337.1|  PREDICTED: peroxidase 10-like                      243   1e-72    
gb|EYU24801.1|  hypothetical protein MIMGU_mgv1a009942mg                243   1e-72    
gb|EMT15855.1|  Peroxidase 2                                            243   1e-72    
ref|XP_009353060.1|  PREDICTED: peroxidase 57-like                      243   1e-72    
ref|XP_002452710.1|  hypothetical protein SORBIDRAFT_04g031120          243   1e-72    
ref|XP_006409192.1|  hypothetical protein EUTSA_v10022774mg             243   1e-72    
ref|XP_006346000.1|  PREDICTED: peroxidase 5-like                       244   1e-72    
ref|XP_011003281.1|  PREDICTED: peroxidase 5-like                       243   2e-72    
gb|EMT00726.1|  Peroxidase 2                                            243   2e-72    
emb|CDO98877.1|  unnamed protein product                                242   2e-72    
ref|XP_004977106.1|  PREDICTED: peroxidase 1-like                       244   2e-72    
ref|XP_009131612.1|  PREDICTED: peroxidase 57-like                      242   2e-72    
ref|NP_001141196.1|  hypothetical protein                               244   2e-72    
ref|XP_010553703.1|  PREDICTED: peroxidase 5-like                       243   2e-72    
ref|XP_009342252.1|  PREDICTED: peroxidase 3                            243   2e-72    
ref|XP_010048379.1|  PREDICTED: peroxidase 5-like                       242   2e-72    
ref|XP_002455568.1|  hypothetical protein SORBIDRAFT_03g013220          244   2e-72    
emb|CDP20371.1|  unnamed protein product                                243   2e-72    
ref|XP_008341973.1|  PREDICTED: peroxidase 3-like                       242   2e-72    
gb|EMT10333.1|  Peroxidase 5                                            243   2e-72    
ref|XP_003591355.1|  Peroxidase                                         243   2e-72    
ref|XP_003521878.1|  PREDICTED: peroxidase 44-like                      242   3e-72    
ref|XP_004145577.1|  PREDICTED: peroxidase 46-like                      242   3e-72    
gb|AES67274.2|  peroxidase family protein                               242   3e-72    
emb|CDX84214.1|  BnaC04g09760D                                          242   3e-72    
ref|XP_010432175.1|  PREDICTED: peroxidase 49                           242   3e-72    
ref|NP_001136740.1|  uncharacterized protein LOC100216881 precursor     243   3e-72    
ref|XP_006645835.1|  PREDICTED: peroxidase 1-like                       243   3e-72    
dbj|BAK01007.1|  predicted protein                                      242   3e-72    
ref|XP_010906360.1|  PREDICTED: peroxidase 5-like                       241   3e-72    
ref|XP_006581060.1|  PREDICTED: peroxidase isoform X1                   242   3e-72    
ref|XP_006347525.1|  PREDICTED: peroxidase 5-like                       242   4e-72    
ref|XP_004235031.1|  PREDICTED: peroxidase 5                            242   4e-72    
ref|XP_006396925.1|  hypothetical protein EUTSA_v10028797mg             242   4e-72    
ref|XP_001776111.1|  predicted protein                                  241   4e-72    
ref|XP_006353128.1|  PREDICTED: peroxidase 5-like                       243   4e-72    
ref|XP_010446794.1|  PREDICTED: peroxidase 49-like                      242   4e-72    
ref|XP_003597023.1|  Peroxidase                                         243   4e-72    
gb|KCW58172.1|  hypothetical protein EUGRSUZ_H00889                     242   4e-72    
ref|XP_009359075.1|  PREDICTED: peroxidase 18-like                      242   4e-72    
gb|KFK40198.1|  hypothetical protein AALP_AA3G342700                    242   4e-72    
ref|NP_001042908.1|  Os01g0327400                                       242   5e-72    
ref|XP_008377474.1|  PREDICTED: peroxidase 18                           242   5e-72    
ref|XP_002987767.1|  hypothetical protein SELMODRAFT_126670             242   5e-72    
ref|XP_002440543.1|  hypothetical protein SORBIDRAFT_09g002810          242   5e-72    
gb|KDP37026.1|  hypothetical protein JCGZ_06082                         241   5e-72    
ref|XP_002455566.1|  hypothetical protein SORBIDRAFT_03g013200          243   5e-72    
ref|XP_002987834.1|  hypothetical protein SELMODRAFT_235371             241   5e-72    
ref|NP_001054572.1|  Os05g0135200                                       242   5e-72    
gb|KHN41200.1|  Peroxidase 3                                            241   5e-72    
gb|EAY73611.1|  hypothetical protein OsI_01497                          242   5e-72    
ref|XP_010045225.1|  PREDICTED: peroxidase 5-like                       241   6e-72    
dbj|BAJ85754.1|  predicted protein                                      241   6e-72    
dbj|BAJ87108.1|  predicted protein                                      241   6e-72    
dbj|BAJ95224.1|  predicted protein                                      242   6e-72    
ref|XP_010671314.1|  PREDICTED: peroxidase 5-like                       241   6e-72    
ref|XP_010448337.1|  PREDICTED: peroxidase 44-like                      241   7e-72    
ref|XP_006846424.1|  hypothetical protein AMTR_s00018p00028320          241   7e-72    
ref|XP_010103062.1|  Peroxidase 5                                       241   7e-72    
ref|NP_001148340.1|  peroxidase 1 precursor                             241   7e-72    
gb|AFW57508.1|  peroxidase 1                                            241   7e-72    
ref|XP_011031408.1|  PREDICTED: peroxidase 46-like                      242   8e-72    
ref|XP_008351436.1|  PREDICTED: peroxidase 57-like                      241   8e-72    
gb|KDO49149.1|  hypothetical protein CISIN_1g020451mg                   241   8e-72    
ref|XP_010254703.1|  PREDICTED: peroxidase 72-like                      241   8e-72    
ref|XP_006444582.1|  hypothetical protein CICLE_v10021010mg             241   8e-72    
ref|XP_010024692.1|  PREDICTED: peroxidase 5-like                       241   9e-72    
ref|XP_006654965.1|  PREDICTED: peroxidase 5-like                       241   1e-71    
ref|XP_009382231.1|  PREDICTED: peroxidase 5 {ECO:0000250|UniProt...    240   1e-71    
ref|XP_007048630.1|  Peroxidase superfamily protein                     240   1e-71    
ref|XP_010313021.1|  PREDICTED: peroxidase 44-like                      241   1e-71    
emb|CDP11801.1|  unnamed protein product                                241   1e-71    
ref|XP_008341978.1|  PREDICTED: peroxidase 3-like                       241   1e-71    
gb|KCW61137.1|  hypothetical protein EUGRSUZ_H03910                     240   1e-71    
ref|XP_010696607.1|  PREDICTED: peroxidase 3                            241   1e-71    
gb|EMT01340.1|  Peroxidase 2                                            241   1e-71    
ref|XP_008440774.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 49      241   1e-71    
ref|XP_010931180.1|  PREDICTED: peroxidase 3-like isoform X1            240   1e-71    
ref|XP_003591332.1|  Peroxidase                                         241   1e-71    
ref|XP_006480139.1|  PREDICTED: peroxidase 10-like                      240   1e-71    
gb|AHL39146.1|  class III peroxidase                                    241   1e-71    
ref|XP_008391726.1|  PREDICTED: peroxidase 57-like                      240   1e-71    
ref|NP_179406.1|  peroxidase 14                                         241   1e-71    
ref|XP_009769971.1|  PREDICTED: peroxidase 5-like                       240   1e-71    
gb|KDP34818.1|  hypothetical protein JCGZ_11180                         240   1e-71    
gb|EMT23927.1|  Peroxidase 2                                            240   1e-71    
ref|XP_008784631.1|  PREDICTED: peroxidase 44-like                      240   1e-71    
ref|XP_009119172.1|  PREDICTED: peroxidase 3-like                       240   2e-71    
ref|XP_009771827.1|  PREDICTED: peroxidase 72-like                      240   2e-71    
emb|CDY64926.1|  BnaAnng19770D                                          240   2e-71    
ref|XP_008388923.1|  PREDICTED: peroxidase 5-like                       240   2e-71    
ref|XP_011070192.1|  PREDICTED: peroxidase 44                           240   2e-71    
ref|XP_010024694.1|  PREDICTED: peroxidase 5-like                       240   2e-71    
ref|XP_008240579.1|  PREDICTED: peroxidase 44                           239   2e-71    
ref|NP_001050187.1|  Os03g0368300                                       240   2e-71    
ref|XP_002450360.1|  hypothetical protein SORBIDRAFT_05g004180          240   2e-71    
ref|XP_002309694.2|  hypothetical protein POPTR_0006s28320g             241   2e-71    
gb|AAG46141.1|AC082644_23  putative peroxidase                          240   2e-71    
gb|KCW61140.1|  hypothetical protein EUGRSUZ_H03915                     239   2e-71    
ref|NP_001050186.2|  Os03g0368000                                       239   2e-71    
gb|ACJ11766.1|  class III peroxidase                                    239   2e-71    
gb|ACJ11760.1|  class III peroxidase                                    240   2e-71    
ref|XP_008230094.1|  PREDICTED: peroxidase 3                            240   2e-71    
ref|XP_011003280.1|  PREDICTED: peroxidase 5-like                       240   2e-71    
ref|XP_002876063.1|  predicted protein                                  240   2e-71    
ref|XP_004304037.1|  PREDICTED: peroxidase 44-like                      239   2e-71    
ref|XP_002993742.1|  hypothetical protein SELMODRAFT_137572             240   2e-71    
emb|CDX70777.1|  BnaC03g08610D                                          239   2e-71    
ref|XP_007157314.1|  hypothetical protein PHAVU_002G059600g             241   2e-71    
gb|AFK42142.1|  unknown                                                 239   3e-71    
ref|XP_006410696.1|  hypothetical protein EUTSA_v10016900mg             240   3e-71    
gb|EEC75333.1|  hypothetical protein OsI_11725                          239   3e-71    
ref|XP_010271091.1|  PREDICTED: peroxidase 5-like                       240   3e-71    
ref|XP_004984276.1|  PREDICTED: peroxidase 2-like                       239   3e-71    
gb|AHL39182.1|  class III peroxidase                                    239   3e-71    
ref|NP_195361.1|  peroxidase 49                                         239   3e-71    
ref|XP_010505042.1|  PREDICTED: peroxidase 20-like                      239   3e-71    
ref|NP_201440.1|  peroxidase 72                                         239   3e-71    
ref|XP_006654966.1|  PREDICTED: peroxidase 5-like                       239   3e-71    
gb|KDP27791.1|  hypothetical protein JCGZ_18871                         239   3e-71    
ref|XP_004298124.1|  PREDICTED: peroxidase 5-like                       239   3e-71    
ref|NP_001241977.1|  uncharacterized protein LOC100784922 precursor     239   4e-71    
ref|XP_009129875.1|  PREDICTED: peroxidase 49-like                      239   4e-71    
ref|XP_007215666.1|  hypothetical protein PRUPE_ppa008540mg             239   4e-71    
ref|XP_009335532.1|  PREDICTED: peroxidase 5-like                       239   4e-71    
emb|CDY65368.1|  BnaA05g34960D                                          239   4e-71    
ref|XP_006400325.1|  hypothetical protein EUTSA_v10014171mg             239   4e-71    
emb|CDX92047.1|  BnaC03g33490D                                          239   4e-71    
gb|KHN22848.1|  Peroxidase 3                                            239   4e-71    
ref|XP_006358573.1|  PREDICTED: peroxidase 5-like                       239   4e-71    
ref|XP_009138426.1|  PREDICTED: peroxidase 49                           239   4e-71    
ref|XP_004239722.1|  PREDICTED: peroxidase 5-like                       239   4e-71    
ref|XP_004953531.1|  PREDICTED: peroxidase 5-like                       239   4e-71    
ref|XP_002991683.1|  hypothetical protein SELMODRAFT_236348             239   4e-71    
ref|XP_004231304.1|  PREDICTED: peroxidase 5-like                       239   5e-71    
ref|XP_009365500.1|  PREDICTED: peroxidase 5-like                       239   5e-71    
ref|XP_010109530.1|  Peroxidase 3                                       246   5e-71    
ref|XP_011077167.1|  PREDICTED: peroxidase 5-like                       239   5e-71    
ref|XP_004986969.1|  PREDICTED: peroxidase 2-like                       239   5e-71    
ref|XP_010108290.1|  Peroxidase 46                                      239   5e-71    
ref|XP_010543944.1|  PREDICTED: peroxidase 10                           239   5e-71    
ref|XP_002321949.2|  hypothetical protein POPTR_0015s00580g             239   5e-71    
ref|XP_007152455.1|  hypothetical protein PHAVU_004G132000g             240   6e-71    
gb|KCW52186.1|  hypothetical protein EUGRSUZ_J01615                     238   6e-71    
ref|XP_011005582.1|  PREDICTED: peroxidase 47-like                      238   6e-71    
emb|CDX75574.1|  BnaA01g01280D                                          239   6e-71    
ref|XP_010049850.1|  PREDICTED: peroxidase 46-like                      239   6e-71    
ref|XP_006654017.1|  PREDICTED: peroxidase 5-like                       239   6e-71    
ref|XP_010472498.1|  PREDICTED: peroxidase 18                           239   6e-71    
gb|EMT05880.1|  Peroxidase 3                                            239   6e-71    
ref|XP_011043751.1|  PREDICTED: peroxidase 5-like                       239   7e-71    
dbj|BAJ90392.1|  predicted protein                                      239   7e-71    
ref|XP_006340673.1|  PREDICTED: peroxidase 49-like                      239   7e-71    
ref|XP_002991057.1|  hypothetical protein SELMODRAFT_132865             238   7e-71    
ref|XP_010426640.1|  PREDICTED: peroxidase 36                           239   7e-71    
ref|XP_008461438.1|  PREDICTED: peroxidase 5-like                       239   7e-71    
emb|CDP04200.1|  unnamed protein product                                239   7e-71    
emb|CAA76374.2|  peroxidase                                             238   7e-71    
gb|KDP25860.1|  hypothetical protein JCGZ_22890                         238   7e-71    
ref|XP_004232442.2|  PREDICTED: peroxidase 49-like                      239   8e-71    
ref|XP_009411603.1|  PREDICTED: peroxidase 5 {ECO:0000250|UniProt...    239   8e-71    
emb|CDY34754.1|  BnaA09g41210D                                          239   8e-71    
tpe|CAH69312.1|  TPA: class III peroxidase 70 precursor                 239   8e-71    
ref|XP_011028045.1|  PREDICTED: peroxidase 46-like isoform X2           239   8e-71    
ref|XP_008461391.1|  PREDICTED: peroxidase 5-like                       239   8e-71    
emb|CDP07473.1|  unnamed protein product                                239   8e-71    
emb|CDY46845.1|  BnaA10g03290D                                          238   9e-71    
gb|KHG03991.1|  Peroxidase 47 -like protein                             238   9e-71    
ref|NP_001050192.1|  Os03g0369200                                       238   9e-71    
emb|CAB62621.1|  peroxidase-like protein                                238   1e-70    
emb|CDX69223.1|  BnaC01g02300D                                          238   1e-70    
ref|XP_009779949.1|  PREDICTED: peroxidase 25                           238   1e-70    
ref|XP_010093296.1|  Peroxidase 5                                       238   1e-70    
ref|XP_002991055.1|  hypothetical protein SELMODRAFT_132915             238   1e-70    
ref|XP_008808267.1|  PREDICTED: peroxidase 5-like                       238   1e-70    
ref|XP_010914719.1|  PREDICTED: peroxidase 5-like                       239   1e-70    
ref|XP_002886150.1|  hypothetical protein ARALYDRAFT_480719             238   1e-70    
ref|XP_003567637.1|  PREDICTED: peroxidase 1-like                       239   1e-70    
ref|XP_009605400.1|  PREDICTED: peroxidase 5 {ECO:0000250|UniProt...    238   1e-70    
ref|XP_004135971.1|  PREDICTED: peroxidase 5-like                       238   1e-70    
ref|XP_006282801.1|  hypothetical protein CARUB_v10006454mg             238   1e-70    
gb|KHG08031.1|  Peroxidase 72 -like protein                             238   1e-70    
ref|NP_190668.2|  peroxidase 36                                         238   1e-70    
ref|XP_006284937.1|  hypothetical protein CARUB_v10006236mg             238   1e-70    
gb|KDP25855.1|  hypothetical protein JCGZ_22885                         238   1e-70    
ref|XP_010437350.1|  PREDICTED: peroxidase 49-like                      238   1e-70    
ref|XP_010429474.1|  PREDICTED: peroxidase 18-like isoform X1           238   1e-70    
ref|XP_006296673.1|  hypothetical protein CARUB_v10016420mg             238   1e-70    
ref|NP_181081.1|  peroxidase 20                                         238   1e-70    
ref|XP_009143676.1|  PREDICTED: peroxidase 20                           238   2e-70    
ref|XP_004307916.1|  PREDICTED: peroxidase 5-like                       238   2e-70    
ref|XP_003624729.1|  Peroxidase                                         237   2e-70    
ref|XP_007145112.1|  hypothetical protein PHAVU_007G210900g             238   2e-70    
ref|XP_010268491.1|  PREDICTED: peroxidase 10-like                      238   2e-70    
ref|XP_009117098.1|  PREDICTED: peroxidase 18                           238   2e-70    
ref|XP_010433564.1|  PREDICTED: peroxidase 44-like                      237   2e-70    
ref|XP_010936646.1|  PREDICTED: peroxidase 72-like                      238   2e-70    
ref|XP_007207711.1|  hypothetical protein PRUPE_ppa025326mg             237   2e-70    
gb|AAF63024.1|AF244921_1  peroxidase prx12 precursor                    238   2e-70    
ref|XP_002324930.1|  hypothetical protein POPTR_0018s02910g             238   2e-70    
ref|XP_002869634.1|  hypothetical protein ARALYDRAFT_913963             237   2e-70    
ref|XP_008234631.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 5...    237   2e-70    
ref|XP_002467585.1|  hypothetical protein SORBIDRAFT_01g030530          237   2e-70    
gb|AHL39151.1|  class III peroxidase                                    237   2e-70    
ref|XP_010509622.1|  PREDICTED: peroxidase 20                           238   2e-70    
ref|XP_006374082.1|  hypothetical protein POPTR_0015s00590g             237   2e-70    
ref|XP_010908100.1|  PREDICTED: peroxidase 47                           237   2e-70    
ref|XP_006846503.1|  hypothetical protein AMTR_s00018p00155980          237   2e-70    



>ref|XP_006348579.1| PREDICTED: peroxidase 56-like [Solanum tuberosum]
Length=344

 Score =   365 bits (938),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 174/302 (58%), Positives = 219/302 (73%), Gaps = 0/302 (0%)
 Frame = -1

Query  1148  EAAETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSV  969
             E  E   G+R GFY  TCP AE+I+KN + +AF +D  +AAAI RL  HDC V GCDGS+
Sbjct  42    EQPEILGGLREGFYQNTCPQAEQIIKNGLTRAFQNDSTIAAAIPRLFLHDCFVKGCDGSI  101

Query  968   LLDATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLS  789
              LD T  GG+VEK +PSNG TV+GFELID IK E+E++CPG+VSC+D+L + +RDA V S
Sbjct  102   FLDTTPSGGKVEKLSPSNGITVKGFELIDEIKAELEENCPGIVSCSDVLAYLSRDAFVAS  161

Query  788   GVPEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIG  609
             G+P +EV GGRRDG  SR  +   NL  PD TVDQM+ LF  KGL+ EDLV L+GAHSIG
Sbjct  162   GLPHYEVSGGRRDGMESRVENVVGNLPLPDDTVDQMIQLFNRKGLNAEDLVVLIGAHSIG  221

Query  608   VAHCSNFRYRLNTPARAKEVDGSLKVVMGTHCRNAATTIPMDSTTQYKMDSMFYKQLLQK  429
             VAHC NF YR++TP +A+ VD  L  VM   C +  +TI  D+TTQYKMDS+FYKQLL K
Sbjct  222   VAHCFNFLYRMDTPEKAQMVDPRLGGVMKFTCTSQMSTIAFDATTQYKMDSVFYKQLLMK  281

Query  428   KGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRF  249
             KGLLESD+ L  D RT   V+ F++D+  W  KF  ++ K+G + VLTG++GEIRK+CR 
Sbjct  282   KGLLESDQVLTQDIRTRGFVQRFSNDEVGWFNKFGVAMNKLGAVEVLTGNQGEIRKQCRA  341

Query  248   VN  243
             VN
Sbjct  342   VN  343



>ref|XP_004228554.1| PREDICTED: peroxidase 57-like [Solanum lycopersicum]
Length=435

 Score =   368 bits (944),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 174/305 (57%), Positives = 222/305 (73%), Gaps = 0/305 (0%)
 Frame = -1

Query  1157  RNAEAAETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCD  978
             +  E  E   G+R GFY  TCP AEEI++N +++AF +D  +AAAI RL  HDC V GCD
Sbjct  130   KEHEEPEILEGLREGFYQNTCPQAEEIIRNGLIRAFQNDSTIAAAIPRLFLHDCFVKGCD  189

Query  977   GSVLLDATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDAL  798
             GS+LLD T  GG++EK +PSNG TV+GFELID IK E+E++CPG+VSC+D+L + +RDA 
Sbjct  190   GSILLDTTPTGGKIEKLSPSNGITVKGFELIDEIKAELEENCPGIVSCSDVLAYLSRDAF  249

Query  797   VLSGVPEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAH  618
             V SG+P +EV GGRRDG  SR  +   NL  PD TVDQM+ LF  KGL+ EDLV L+GAH
Sbjct  250   VASGLPHYEVSGGRRDGMESRVENVVGNLPLPDDTVDQMIQLFNRKGLNAEDLVVLIGAH  309

Query  617   SIGVAHCSNFRYRLNTPARAKEVDGSLKVVMGTHCRNAATTIPMDSTTQYKMDSMFYKQL  438
             SIGVAHC NF YR++TP +A+ VD  L  VM   C    +TI  D+TTQYKMDS+FYKQL
Sbjct  310   SIGVAHCFNFLYRMDTPEKAQMVDPRLGNVMKFTCTGQMSTIAFDATTQYKMDSVFYKQL  369

Query  437   LQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKK  258
             L KKGLLESD+ L  D RT  LV+ F++D+  W  KF  ++ K+G + VLTG++G+IRK+
Sbjct  370   LMKKGLLESDQALTQDIRTRGLVQRFSNDEVGWFNKFGVAMNKLGAVEVLTGNQGQIRKQ  429

Query  257   CRFVN  243
             CR VN
Sbjct  430   CRAVN  434



>ref|XP_009759243.1| PREDICTED: peroxidase 57-like [Nicotiana sylvestris]
Length=434

 Score =   359 bits (922),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 170/295 (58%), Positives = 217/295 (74%), Gaps = 0/295 (0%)
 Frame = -1

Query  1127  GMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSG  948
             G+R GFY +TCP AE I++N +++AF +D  +AAA+ RL  HDC V GCDGS+LLD T  
Sbjct  140   GLREGFYQKTCPQAENIIRNGLIRAFQNDSTIAAALPRLLLHDCFVNGCDGSILLDTTPS  199

Query  947   GGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEV  768
             G RVEK A +NG TV+GFELID IK E+E+ CPG+VSC+DIL + +RDA VLSG+P + V
Sbjct  200   GARVEKLAGTNGATVKGFELIDEIKAELERQCPGIVSCSDILAYLSRDAFVLSGLPNYNV  259

Query  767   PGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNF  588
              GGRRDG  S E +   NL  P  TVDQM+ LF+ KGL+ EDLV L+GAHSIGVAHC NF
Sbjct  260   LGGRRDGMESNEANVVGNLPLPGDTVDQMIDLFQKKGLNSEDLVVLIGAHSIGVAHCFNF  319

Query  587   RYRLNTPARAKEVDGSLKVVMGTHCRNAATTIPMDSTTQYKMDSMFYKQLLQKKGLLESD  408
              YRL+ P +A+ +D  L  VM   C N   T+P D TTQYKMDS+FYKQL+ KKGL+ESD
Sbjct  320   LYRLDEPEKAQMLDPRLAGVMRFICTNQMNTLPFDPTTQYKMDSIFYKQLMMKKGLIESD  379

Query  407   ERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRFVN  243
             + LA D RT  LV++F DD+  W  KF +++ K+G I VLTG++G+IR++CR VN
Sbjct  380   QILAQDIRTRGLVQKFGDDEMGWFDKFGKAMNKLGAIEVLTGNQGQIRRQCRAVN  434



>ref|XP_009623183.1| PREDICTED: peroxidase 57-like [Nicotiana tomentosiformis]
Length=430

 Score =   357 bits (917),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 169/302 (56%), Positives = 216/302 (72%), Gaps = 0/302 (0%)
 Frame = -1

Query  1148  EAAETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSV  969
             E AE   G+R GFY +TCP  E I++N +++AF +D  +AAA  RL  HDC V GCDGS+
Sbjct  129   EPAENYDGLREGFYQKTCPQTENIIRNGLIRAFQNDSTIAAAFPRLLLHDCFVNGCDGSI  188

Query  968   LLDATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLS  789
             LLD T  G RVEK A +NG TV+GFELID IK E+E+ CPG+VSC+DIL + +RDA VLS
Sbjct  189   LLDTTPSGARVEKLAGTNGATVKGFELIDEIKAELERQCPGIVSCSDILVYLSRDAFVLS  248

Query  788   GVPEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIG  609
             G+P + V  GRRDG  S E +   NL  P  TVDQM+ LF+ KGL+ EDLV L+GAHSIG
Sbjct  249   GLPNYNVLAGRRDGMESNEANVVGNLPLPGDTVDQMIDLFQKKGLNSEDLVVLIGAHSIG  308

Query  608   VAHCSNFRYRLNTPARAKEVDGSLKVVMGTHCRNAATTIPMDSTTQYKMDSMFYKQLLQK  429
             VAHC NF YRL+ P +A+ +D  L  VM   C N   T+P D TTQYKMDS+FYKQL+ K
Sbjct  309   VAHCFNFLYRLDEPEKAQMLDPRLAGVMRFMCANQMNTLPFDPTTQYKMDSIFYKQLMMK  368

Query  428   KGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRF  249
             KGL+ESD+ LA D RT   V++F DD+  W  KF +++ K+G I VLTG++G++R++CR 
Sbjct  369   KGLIESDQILAQDIRTRGFVQKFGDDEMGWFDKFGKAMNKLGAIEVLTGNQGQMRRQCRA  428

Query  248   VN  243
             VN
Sbjct  429   VN  430



>ref|XP_004239120.1| PREDICTED: peroxidase 39-like [Solanum lycopersicum]
Length=487

 Score =   355 bits (912),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 169/296 (57%), Positives = 215/296 (73%), Gaps = 0/296 (0%)
 Frame = -1

Query  1130  AGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATS  951
             AG++VGFY  TCP AE+I+K+ M +AF +D  +AA I RL  HDC V GCD S+LLD T 
Sbjct  192   AGLQVGFYDSTCPNAEKIIKDGMNRAFGNDSSMAAPIGRLLFHDCFVNGCDASILLDKTP  251

Query  950   GGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFE  771
              G RVEK AP+NG T+RGFELID IK E+E  CPG+VSC+D+L + +RDA V+SGVP ++
Sbjct  252   SGARVEKLAPTNGATIRGFELIDEIKAELEAECPGIVSCSDLLVYLSRDAFVVSGVPYYD  311

Query  770   VPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSN  591
             VPGGRRDG  S E +   NL  PD TVD+M+ LFK KGL  EDLV L+GAHSIGVAHC +
Sbjct  312   VPGGRRDGMESLEANVIGNLPLPDNTVDKMIDLFKKKGLTEEDLVVLIGAHSIGVAHCFS  371

Query  590   FRYRLNTPARAKEVDGSLKVVMGTHCRNAATTIPMDSTTQYKMDSMFYKQLLQKKGLLES  411
             FRYR++ P +A  VD  L  VM   C    +T+  D+TTQYKMDS++YKQL  K+ LLES
Sbjct  372   FRYRVDNPVKATMVDPRLAGVMKFTCTTPMSTLAFDTTTQYKMDSVYYKQLSGKRALLES  431

Query  410   DERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRFVN  243
             D  L  DPRT   +++F DD+  W  KF +++ K+  I+VLTGD+G+IRK+CRFVN
Sbjct  432   DALLNEDPRTKDFIQKFGDDENGWFIKFGKAMNKLTSIQVLTGDQGQIRKQCRFVN  487



>ref|XP_006357629.1| PREDICTED: peroxidase 39-like [Solanum tuberosum]
Length=485

 Score =   352 bits (902),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 167/296 (56%), Positives = 214/296 (72%), Gaps = 0/296 (0%)
 Frame = -1

Query  1130  AGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATS  951
             AG++VGF   TCP AE+I+K+ M +AF +D  +AA I RL  HDC V GCD S+ LD T 
Sbjct  190   AGLQVGFSDYTCPNAEKIIKDGMTRAFGNDSSMAAPIPRLLFHDCFVNGCDASLFLDKTP  249

Query  950   GGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFE  771
              G RVEK APSNG TVRGFELID IK ++E  CPG+VSC+D+L + +RDA V+SGVP ++
Sbjct  250   SGARVEKLAPSNGATVRGFELIDEIKADLEAECPGIVSCSDLLVYLSRDAFVVSGVPYYD  309

Query  770   VPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSN  591
             VPGGRRDG  S E +   NL  PD TVD+M+ LFK KGL+ EDLV L+GAHSIGVAHC +
Sbjct  310   VPGGRRDGMESLEANVLGNLPLPDSTVDKMIDLFKKKGLNEEDLVVLIGAHSIGVAHCFS  369

Query  590   FRYRLNTPARAKEVDGSLKVVMGTHCRNAATTIPMDSTTQYKMDSMFYKQLLQKKGLLES  411
             FRYR++ P +A  VD  L  VM   C +  +T+  D+TTQYKMDS++YKQL  K+ LLES
Sbjct  370   FRYRVDDPVKATMVDPRLAGVMKFTCTSPMSTLAFDTTTQYKMDSIYYKQLSGKRALLES  429

Query  410   DERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRFVN  243
             D  L  DPRT   +++F DD+  W  K  +++ K+  I+VLTGD+G+IRK+CRFVN
Sbjct  430   DGLLNEDPRTKDFIQKFGDDEKGWFTKLGKAMNKLASIQVLTGDQGQIRKQCRFVN  485



>ref|XP_009623842.1| PREDICTED: peroxidase 57-like [Nicotiana tomentosiformis]
Length=500

 Score =   351 bits (901),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 167/296 (56%), Positives = 212/296 (72%), Gaps = 0/296 (0%)
 Frame = -1

Query  1130  AGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATS  951
             AG++VGFY  TCP  E+I+K+ M++AF +D  +AA I RL  HDC V GCD S+ LD T 
Sbjct  205   AGLKVGFYDETCPKVEKIIKDGMIRAFGNDSSIAAPIPRLLLHDCFVNGCDASLFLDQTP  264

Query  950   GGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFE  771
              G RVEK A SNG TVRGF+LID IK E+E  CPGVVSC D+L + +RDA V+SGVP ++
Sbjct  265   SGARVEKLANSNGPTVRGFDLIDEIKAELEAECPGVVSCTDLLAYLSRDAFVVSGVPHYD  324

Query  770   VPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSN  591
             VPGGRRDG  S E +   NL  PD TVD ++ LFK KGL+ EDLV L+GAHSIGVAHC +
Sbjct  325   VPGGRRDGMESLEANVPGNLPLPDNTVDMLIDLFKRKGLNEEDLVVLIGAHSIGVAHCFS  384

Query  590   FRYRLNTPARAKEVDGSLKVVMGTHCRNAATTIPMDSTTQYKMDSMFYKQLLQKKGLLES  411
             F YRL+ P +A  VD  L  VM   C N   T+  D+TTQYKMDS++YKQL +K+GLLES
Sbjct  385   FLYRLDNPQKAAMVDPRLAGVMRFTCTNQMNTLAFDTTTQYKMDSIYYKQLTEKRGLLES  444

Query  410   DERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRFVN  243
             D  L+ DPRT   +++F  DQ+ W  K  +++ K+  I+VLTGD+G+IRK+CR VN
Sbjct  445   DVLLSEDPRTKDYIQKFGHDQSGWFNKLGKAMNKLASIQVLTGDQGQIRKQCRAVN  500



>ref|XP_009774685.1| PREDICTED: peroxidase 57-like [Nicotiana sylvestris]
Length=499

 Score =   349 bits (895),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 166/296 (56%), Positives = 213/296 (72%), Gaps = 0/296 (0%)
 Frame = -1

Query  1130  AGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATS  951
             A ++VGFY   CP AE+I+K+ M++AF +D  +AAAI RL  HDC V GCD S+LLD T 
Sbjct  204   ARLKVGFYDEICPKAEKIIKDGMIRAFGNDSSIAAAIPRLLLHDCFVNGCDASLLLDQTP  263

Query  950   GGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFE  771
              G RVEK A SNG TVRGF+LID+IK E+E  CP VVSC D+L + +RDA V+SGVP ++
Sbjct  264   SGARVEKLANSNGPTVRGFDLIDQIKAELEAECPRVVSCTDLLVYLSRDAFVVSGVPHYD  323

Query  770   VPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSN  591
             VPGGRRDG  S E +   NL  PD TVD ++ LFK KGL+ EDL  L+GAHSIGVAHC +
Sbjct  324   VPGGRRDGMESLEANVHGNLPLPDNTVDTLIDLFKRKGLNEEDLAVLIGAHSIGVAHCFS  383

Query  590   FRYRLNTPARAKEVDGSLKVVMGTHCRNAATTIPMDSTTQYKMDSMFYKQLLQKKGLLES  411
             F YRL+ P +A  VD  L  VM   C N   T+  D+TTQYKMDS++YKQL +K+GLLES
Sbjct  384   FLYRLDNPQKAAMVDPRLAGVMRFTCTNQMNTLAFDTTTQYKMDSIYYKQLAEKRGLLES  443

Query  410   DERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRFVN  243
             D  L+ DPRT   +++F DDQ+ W  K  +++ K+  ++VLTGD+G+IRK+CR VN
Sbjct  444   DVLLSEDPRTKDYIQKFGDDQSGWFNKLGKAMNKLASMQVLTGDQGQIRKQCRAVN  499



>gb|EYU22520.1| hypothetical protein MIMGU_mgv1a008023mg [Erythranthe guttata]
Length=387

 Score =   312 bits (800),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 158/311 (51%), Positives = 201/311 (65%), Gaps = 4/311 (1%)
 Frame = -1

Query  1163  PDRNAEAAETTAGMRV--GFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVV  990
             P+  +E  E   G  +  GFYGR+CP AE IV   + + F  DP +A A VRL  HDC+V
Sbjct  77    PEYGSEMPEPGQGPTLIEGFYGRSCPRAEMIVNQTINEYFSKDPTLAPAYVRLFLHDCLV  136

Query  989   AGCDGSVLLDATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSA  810
              GCD S+LLD T  G  VEK+AP NGK VRGFE ID IK ++E  CPGVVSCADIL ++ 
Sbjct  137   NGCDASILLDETPSGEDVEKKAPHNGKFVRGFEAIDEIKSQLEAECPGVVSCADILAYTN  196

Query  809   RDALVLSGVPEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVAL  630
             RDALV +GVP ++V  GRRDG VS   +   N+  PD   + MV LF  KGL +E+LV L
Sbjct  197   RDALVYTGVPPYQVAAGRRDGLVSLAKNVEHNIPLPDAPAEHMVKLFARKGLSLEELVVL  256

Query  629   LGAHSIGVAHCSNFRYRLNTPARAKEVDGSLKVVMG--THCRNAATTIPMDSTTQYKMDS  456
              GAHSIG AHCS    R   P +  ++D    + M   T C + +  +P D  +Q KMDS
Sbjct  257   TGAHSIGSAHCSIVSGRFFDPRKTADIDPGYLIKMRSLTFCEDDSQDLPFDPYSQQKMDS  316

Query  455   MFYKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDE  276
              FYK+LL KK LLESD+ LA +PR   +++ +  DQ  WL KFT S+ K+G++ VLTGD 
Sbjct  317   RFYKELLAKKALLESDQNLANEPRGNAVMKRYVGDQQGWLKKFTSSIKKVGEMDVLTGDR  376

Query  275   GEIRKKCRFVN  243
             GEIR++CRFVN
Sbjct  377   GEIRRQCRFVN  387



>ref|XP_011071133.1| PREDICTED: peroxidase 39-like [Sesamum indicum]
Length=433

 Score =   305 bits (781),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 145/297 (49%), Positives = 199/297 (67%), Gaps = 2/297 (1%)
 Frame = -1

Query  1127  GMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSG  948
              +R GFY ++CP AE +V   + K F  DP +AAAIVRL  HDC V GCD S+LLDAT  
Sbjct  137   ALREGFYAQSCPQAENVVNQIINKHFRRDPTLAAAIVRLFFHDCFVTGCDASILLDATPT  196

Query  947   GGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEV  768
             G  VEK+AP NG+ VRGFE ID IK ++E  CPGVVSCADIL F+ RD+LV + VP + V
Sbjct  197   GEDVEKKAPHNGEFVRGFEPIDDIKTQLETECPGVVSCADILAFANRDSLVHAAVPHYNV  256

Query  767   PGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNF  588
               GRRDG  S   +  +NL  P  +  +++ +F+ KG+ +E+++ L GAHSIG AHCS  
Sbjct  257   AAGRRDGLASLAKNVDQNLPLPGNSAQEIIQIFEKKGMTIEEMIVLSGAHSIGAAHCSIV  316

Query  587   RYRLNTPARAKEVDGS--LKVVMGTHCRNAATTIPMDSTTQYKMDSMFYKQLLQKKGLLE  414
               R + P +++E+D    L++   T C+N    I  D  + +KMD+ FYK+LL  + LLE
Sbjct  317   ADRFHDPEKSREIDRGYLLRMQTLTFCQNQTQDIAFDPYSHHKMDARFYKELLNNRALLE  376

Query  413   SDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRFVN  243
             SD  LA +P    ++E++A DQ  W+ KFT ++IKMG+I VLTG++G+IRK+CR VN
Sbjct  377   SDHNLAQEPHAHKIMEKYAIDQQGWIAKFTSAIIKMGEIEVLTGNQGQIRKQCRAVN  433



>gb|EPS71843.1| peroxidase 1, partial [Genlisea aurea]
Length=311

 Score =   295 bits (756),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 145/305 (48%), Positives = 195/305 (64%), Gaps = 3/305 (1%)
 Frame = -1

Query  1148  EAAETTAG-MRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGS  972
             E   T  G +R  FY  +CP AE IV   +   F+ DP +A A+VRL  HDC V GCD S
Sbjct  7     ETPATQGGALRKDFYRESCPQAETIVNQTIHTIFNRDPTLAPALVRLLFHDCFVTGCDAS  66

Query  971   VLLDATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVL  792
             ++LD T  G  VEK+A  NG  VRGFE ID IK ++E  CPGVVSCAD+L FS RD+LV 
Sbjct  67    IMLDDTPSGEDVEKKARQNGPFVRGFEAIDEIKTQLEAQCPGVVSCADLLAFSVRDSLVF  126

Query  791   SGVPEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSI  612
             +GVP ++V  GRRDG  S   +   NL  PD  +D+++ +F  KG   EDLV L+GAHSI
Sbjct  127   TGVPTYKVAAGRRDGMASTARNCIGNLPLPDTPLDRIIHMFTKKGFTFEDLVILIGAHSI  186

Query  611   GVAHCSNFRYRLNTPARAKEVDGSLKVVMG--THCRNAATTIPMDSTTQYKMDSMFYKQL  438
             G AHCS    R +   ++KE+D    + M   T C+  +  IP D  + +KMDS FYK+L
Sbjct  187   GTAHCSVVADRFHDAEKSKEIDPGYLLTMQTLTQCQADSQDIPFDPYSSHKMDSRFYKEL  246

Query  437   LQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKK  258
             L +K LLESD  +A  P    ++ ++ +DQ  WL +FT ++IK+G++ VLTGD+G+IR++
Sbjct  247   LDRKALLESDHNVAKRPDANAIMRQYVNDQNGWLARFTSAMIKLGQVEVLTGDQGQIRRQ  306

Query  257   CRFVN  243
             CR VN
Sbjct  307   CRAVN  311



>ref|XP_010938174.1| PREDICTED: peroxidase 5-like [Elaeis guineensis]
Length=329

 Score =   276 bits (706),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 197/308 (64%), Gaps = 6/308 (2%)
 Frame = -1

Query  1151  AEAAETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGS  972
             A A+ T+A + VGFY  +CP+AE+IV+N + +A   +PG+AA ++R+  HDC V GCD S
Sbjct  22    AMASATSASLEVGFYKESCPSAEDIVRNTVSQAVAQNPGIAAGLIRMHFHDCFVRGCDAS  81

Query  971   VLLDATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVL  792
             VLL++T G    EK AP N  ++RGF++ID  K  +E  CP  VSCADIL F+ARD   L
Sbjct  82    VLLNSTPGN-TAEKDAPPNNPSLRGFQVIDAAKAAVEACCPRKVSCADILAFAARDGAYL  140

Query  791   SGVPEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSI  612
             +G  +++VP GRRDG +SRE +A  N+ SP+   +Q+   F +KGL ++++V L GAHSI
Sbjct  141   TGGIDYQVPAGRRDGRISRESEALANIPSPNSNAEQLKENFTNKGLSLDEMVTLSGAHSI  200

Query  611   GVAHCSNFRYRL---NTPARAKEVDGSLKVVM--GTHCRNAATTIPMDSTTQYKMDSMFY  447
             G +HCS+F  RL     P+        LK      T   +  TT+ +D+ T  ++D+M+Y
Sbjct  201   GRSHCSSFTNRLYGVQDPSMDPAFAAQLKATCPPSTASPSDPTTVVLDAVTPDRLDNMYY  260

Query  446   KQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEI  267
               LL+ +G+L SD+ L     T  LV  +A+DQ+ W  KF  +++KMG I VLTG +GEI
Sbjct  261   WNLLKHRGVLTSDQTLEESSETAKLVWYYAEDQSTWAAKFAAAMVKMGSIEVLTGSQGEI  320

Query  266   RKKCRFVN  243
             R+KC  VN
Sbjct  321   REKCWVVN  328



>ref|XP_007223978.1| hypothetical protein PRUPE_ppa014723mg, partial [Prunus persica]
 gb|EMJ25177.1| hypothetical protein PRUPE_ppa014723mg, partial [Prunus persica]
Length=313

 Score =   275 bits (704),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 142/316 (45%), Positives = 198/316 (63%), Gaps = 16/316 (5%)
 Frame = -1

Query  1151  AEAAETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGS  972
             A    T  G+RVGFY R+CP  E+IV + ++KA  DD  + AA++R  SHDC+V GCD S
Sbjct  1     AAGQSTGNGLRVGFYSRSCPNVEKIVADIVLKAHQDDLKLPAALIRFFSHDCLVKGCDAS  60

Query  971   VLLDATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVL  792
             +LLDAT+    VEKQA ++ + +RG+ELID IK+ +EQ CP  VSCADIL F+AR+A+ L
Sbjct  61    ILLDATASHEPVEKQAQAS-EMLRGYELIDEIKDRVEQECPQTVSCADILAFAAREAVFL  119

Query  791   SGVPEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSI  612
             +G+P   VP GRRD   SR  D    + +P    D+++  F  +G+ ++++V L GAHSI
Sbjct  120   AGLPRHMVPSGRRDSRTSRASDI--TIPNPTTPFDEIIDYFSRRGITIDEMVVLSGAHSI  177

Query  611   GVAHCSNFRYRLNTPARAKEVDGSLKVVMGTH----CRNAATTIP---------MDSTTQ  471
             G+AHCS F YRL T  + +  D +L     +     C    T  P         +D TT 
Sbjct  178   GIAHCSFFDYRLYTFNKDQPQDPALNASYASELSKTCPKPNTLNPAEAKQRNVELDPTTP  237

Query  470   YKMDSMFYKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRV  291
               +D+  Y  LLQ K LL+SD+ +  DPRT  LV++FA D  +W  +F +++IKMG+I V
Sbjct  238   LVLDNHHYLNLLQGKALLQSDQTMVTDPRTSGLVQQFALDPESWARRFAKAMIKMGRINV  297

Query  290   LTGDEGEIRKKCRFVN  243
             LTG+ GEIRK CR +N
Sbjct  298   LTGNVGEIRKNCRAIN  313



>ref|XP_010674605.1| PREDICTED: peroxidase 5-like [Beta vulgaris subsp. vulgaris]
Length=324

 Score =   273 bits (698),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 134/302 (44%), Positives = 188/302 (62%), Gaps = 10/302 (3%)
 Frame = -1

Query  1130  AGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATS  951
             + ++VGFY +TCP+AE IV N + KA   +PG+ A ++R+  HDC V GCD S+LLD T 
Sbjct  26    SNLKVGFYHKTCPSAETIVNNVVNKAISQNPGLGAGLIRMHFHDCFVRGCDASILLDPTP  85

Query  950   GGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFE  771
             G  +VEKQ P+N  ++RG+E+ID +K E+E  CPGVVSCADI+TF+ARD+    G  ++E
Sbjct  86    GN-QVEKQHPANNPSLRGYEVIDDVKAELEAQCPGVVSCADIITFAARDSASKLGGIKYE  144

Query  770   VPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSN  591
             V  GRRDG +S   D R N+  P F + Q+   F  K L +E++V L GAHSIGV+HCS 
Sbjct  145   VQSGRRDGRISNLNDPRGNIPLPSFNLQQLEDSFNRKSLSLEEMVVLSGAHSIGVSHCSA  204

Query  590   FRYRLNTPARAKEVDGSLKVVMGTHCRNAA------TTIPMDSTTQYKMDSMFYKQLLQK  429
             F     T  +   +D SL  V+   C N         T+P+D  T  K+D+ +Y+ L   
Sbjct  205   FN---ETHPQYPTLDPSLANVLRNTCPNPPFNANNDPTVPLDFVTPNKLDNRYYQDLQHN  261

Query  428   KGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRF  249
             +G+L SD+ L   P T+ +V  F      W  KF ++++ MG I VLTG++GEIR+ CR 
Sbjct  262   RGILNSDQALMTRPTTVHMVRSFGSKGGDWAKKFAKAMVHMGSIEVLTGNQGEIRRNCRV  321

Query  248   VN  243
             VN
Sbjct  322   VN  323



>ref|XP_010040180.1| PREDICTED: peroxidase 5-like [Eucalyptus grandis]
Length=337

 Score =   271 bits (692),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 140/313 (45%), Positives = 190/313 (61%), Gaps = 21/313 (7%)
 Frame = -1

Query  1124  MRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSGG  945
             ++VG+Y RTCP AE I+K  +  A   +PG+AA +VRL  HDC V GCD SVLL +T G 
Sbjct  27    LKVGYYLRTCPLAENIIKQTVFNAVSRNPGMAAGLVRLHFHDCFVRGCDASVLLKSTPGN  86

Query  944   GRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARD---------ALVL  792
                E+  P+N  ++RGFE+ID+ K  +E  CPG VSCADI+ F+ARD         AL  
Sbjct  87    P-AERDHPANNPSLRGFEIIDQAKARLEALCPGTVSCADIVAFAARDSAQFASRNSALFT  145

Query  791   SGVPEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSI  612
              G+  ++VP GRRDG VSR P+  +NL  P F   Q++A F  KGL V+++V L GAHSI
Sbjct  146   GGI-IYDVPAGRRDGRVSRLPEVTQNLPPPSFNAQQLIANFARKGLSVDEMVTLSGAHSI  204

Query  611   GVAHCSNFRYRLN----TPARAKEVDGSLKVVMGTHCRNAAT------TIPMDSTTQYKM  462
             G++HCS+F  RL     T A+   +D +    +   C   +       T+P+DS T   +
Sbjct  205   GISHCSSFSSRLYAFNATHAQDPTLDRAYAAFLKIKCPPPSNKTQPDPTVPLDSITANTL  264

Query  461   DSMFYKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTG  282
             D+ +Y QLLQ++GLL SDE L   P T  LV     +   W  KF ++++KMG I VLTG
Sbjct  265   DNKYYIQLLQRRGLLTSDETLYTSPSTSGLVVNNTRNGYTWSWKFAKAMVKMGSIEVLTG  324

Query  281   DEGEIRKKCRFVN  243
             ++GEIRK C  VN
Sbjct  325   NQGEIRKVCSVVN  337



>ref|XP_008221882.1| PREDICTED: peroxidase 5-like [Prunus mume]
Length=348

 Score =   271 bits (693),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 141/320 (44%), Positives = 195/320 (61%), Gaps = 16/320 (5%)
 Frame = -1

Query  1163  PDRNAEAAETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAG  984
             P   A    T  G+RVGFY  +CP  E+IV + + KA  DD  + AA++R  SHDC+V G
Sbjct  26    PWSEAAGESTGNGLRVGFYSHSCPNVEKIVADIVSKAHQDDLKLPAALIRFFSHDCLVKG  85

Query  983   CDGSVLLDATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARD  804
             CD S+LLDAT+    VEKQA ++ + +RG+ELID IK+ +EQ CP  VSCADIL F+AR+
Sbjct  86    CDASILLDATASHEPVEKQAQAS-EMLRGYELIDEIKDRVEQECPQTVSCADILAFAARE  144

Query  803   ALVLSGVPEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLG  624
             A+ L+G+P   VP GRRD   SR  D    + +P    D+++  F  +G+ ++++V L G
Sbjct  145   AVFLAGLPRHMVPAGRRDSRTSRASDI--TIPNPTTPFDEIIDYFSRRGITIDEMVVLSG  202

Query  623   AHSIGVAHCSNFRYRLNTPARAKEVDGSLKVVMGTH----CRNAATTIP---------MD  483
             AHSIG+AHCS F YRL T    +  D +L     +     C    T  P         +D
Sbjct  203   AHSIGIAHCSFFDYRLYTFKNDQPQDPALNASYASELSKTCPKPNTLNPAEAKQRAVELD  262

Query  482   STTQYKMDSMFYKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMG  303
              TT   +D+  Y  LLQ K LL+SD+ +  DPRT  LV++FA D  +W  +F +++IKMG
Sbjct  263   PTTPLVLDNHHYLNLLQGKALLQSDQTMVTDPRTSGLVQQFALDPESWARRFAKAMIKMG  322

Query  302   KIRVLTGDEGEIRKKCRFVN  243
             +  VLTG+ GEIRK CR +N
Sbjct  323   RTNVLTGNVGEIRKNCRAIN  342



>gb|KCW45421.1| hypothetical protein EUGRSUZ_L00890 [Eucalyptus grandis]
Length=316

 Score =   270 bits (690),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 140/313 (45%), Positives = 190/313 (61%), Gaps = 21/313 (7%)
 Frame = -1

Query  1124  MRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSGG  945
             ++VG+Y RTCP AE I+K  +  A   +PG+AA +VRL  HDC V GCD SVLL +T G 
Sbjct  6     LKVGYYLRTCPLAENIIKQTVFNAVSRNPGMAAGLVRLHFHDCFVRGCDASVLLKSTPGN  65

Query  944   GRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARD---------ALVL  792
                E+  P+N  ++RGFE+ID+ K  +E  CPG VSCADI+ F+ARD         AL  
Sbjct  66    P-AERDHPANNPSLRGFEIIDQAKARLEALCPGTVSCADIVAFAARDSAQFASRNSALFT  124

Query  791   SGVPEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSI  612
              G+  ++VP GRRDG VSR P+  +NL  P F   Q++A F  KGL V+++V L GAHSI
Sbjct  125   GGI-IYDVPAGRRDGRVSRLPEVTQNLPPPSFNAQQLIANFARKGLSVDEMVTLSGAHSI  183

Query  611   GVAHCSNFRYRLN----TPARAKEVDGSLKVVMGTHCRNAAT------TIPMDSTTQYKM  462
             G++HCS+F  RL     T A+   +D +    +   C   +       T+P+DS T   +
Sbjct  184   GISHCSSFSSRLYAFNATHAQDPTLDRAYAAFLKIKCPPPSNKTQPDPTVPLDSITANTL  243

Query  461   DSMFYKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTG  282
             D+ +Y QLLQ++GLL SDE L   P T  LV     +   W  KF ++++KMG I VLTG
Sbjct  244   DNKYYIQLLQRRGLLTSDETLYTSPSTSGLVVNNTRNGYTWSWKFAKAMVKMGSIEVLTG  303

Query  281   DEGEIRKKCRFVN  243
             ++GEIRK C  VN
Sbjct  304   NQGEIRKVCSVVN  316



>ref|XP_010921348.1| PREDICTED: peroxidase 5-like [Elaeis guineensis]
Length=321

 Score =   269 bits (688),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 134/311 (43%), Positives = 196/311 (63%), Gaps = 11/311 (4%)
 Frame = -1

Query  1145  AAETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVL  966
             A+ T+A ++VGFY  TCP+AE IV+  + +A   +PG AA ++R+  HDC V GCD SVL
Sbjct  11    ASATSASLKVGFYEETCPSAEAIVRETVSQAIAKNPGFAAGLIRMHFHDCFVRGCDASVL  70

Query  965   LDATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSG  786
             L++T G    EK+AP N  ++RGFE+ID  K  +E  CP  VSCADI+ F+ARD+  ++G
Sbjct  71    LNSTPGNPS-EKEAPPNNPSLRGFEVIDAAKAAVEAKCPCKVSCADIIAFAARDSAYITG  129

Query  785   VPEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGV  606
               ++EVP GRRDG +S   +A  N+  P FT D++   F+ KGL ++++V L GAHSIG 
Sbjct  130   GNDYEVPAGRRDGRISLASEALDNIPFPTFTADKLKESFERKGLTLDEMVTLSGAHSIGR  189

Query  605   AHCSNFRYRLNTPARAKEVDGSLK----VVMGTHCRNAA------TTIPMDSTTQYKMDS  456
             +HCS+F  RL   +  +  D S++      + T C  +       TT+ +D+ T  ++D+
Sbjct  190   SHCSSFTTRLYNFSATQPQDPSMEPAFAAYLKTRCPPSTASPSDPTTVLLDAVTPTRLDN  249

Query  455   MFYKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDE  276
             M+Y+ LL+ +G+L SD+ L     T   V   A  Q+AW  KF  +++KMG I VLTG +
Sbjct  250   MYYRNLLKHRGVLTSDQTLQDSSETTKHVWYNAKHQSAWAAKFASAMVKMGSIEVLTGSQ  309

Query  275   GEIRKKCRFVN  243
             GEIR+KC  VN
Sbjct  310   GEIREKCWVVN  320



>ref|XP_008781197.1| PREDICTED: peroxidase 5-like [Phoenix dactylifera]
Length=334

 Score =   269 bits (688),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 134/311 (43%), Positives = 195/311 (63%), Gaps = 11/311 (4%)
 Frame = -1

Query  1145  AAETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVL  966
             A+ T+A ++VGFY  TCP+AE IV+  + +A   +PG AA ++R+  HDC V GCD SVL
Sbjct  24    ASVTSASLKVGFYEETCPSAETIVRETVSQAIVRNPGFAAGLIRMHFHDCFVRGCDASVL  83

Query  965   LDATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSG  786
             L++TSG    EK+AP N  ++RGFE+ID  K  +E  CP  VSCADI+ F+ARD+  L+G
Sbjct  84    LNSTSGNPS-EKEAPPNNPSLRGFEVIDAAKAAVEAKCPRKVSCADIIAFAARDSAYLAG  142

Query  785   VPEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGV  606
               +++VP GRRDG +S   +A  N+  P FT D++   F+ KGL + ++V L GAHSIG 
Sbjct  143   GIDYQVPAGRRDGRISLSSEALDNIPFPSFTADKLKENFERKGLSLNEMVTLSGAHSIGR  202

Query  605   AHCSNFRYRLNTPARAKEVDGSLKVVMGTHCR----------NAATTIPMDSTTQYKMDS  456
             +HCS+F  RL   +     D S++  +  + +          +  TT+ +DS T   +D+
Sbjct  203   SHCSSFTTRLYNFSATHPQDPSMEPALAAYLKARCPPSTASLSDPTTVLLDSVTPTCLDN  262

Query  455   MFYKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDE  276
             ++Y+ LL+ +G+L SD+ L     T  LV   A  Q+AW  KF  +++KMG I VLTG +
Sbjct  263   LYYRNLLKHRGVLTSDQTLQDSSETTKLVWYNAKHQSAWAAKFASAMVKMGSIEVLTGSQ  322

Query  275   GEIRKKCRFVN  243
             GEIR+KC  VN
Sbjct  323   GEIREKCWVVN  333



>ref|XP_010921347.1| PREDICTED: peroxidase 5-like [Elaeis guineensis]
Length=321

 Score =   267 bits (682),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 131/311 (42%), Positives = 194/311 (62%), Gaps = 11/311 (4%)
 Frame = -1

Query  1145  AAETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVL  966
             A+ T+A ++VGFYG TCP+AE IV+  + +A   +PG AA ++R+  HDC V GCD SVL
Sbjct  11    ASATSASLKVGFYGETCPSAEAIVRETVSQAIAKNPGFAAGLIRMHFHDCFVRGCDASVL  70

Query  965   LDATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSG  786
             L++T G    EK+AP N  T+RGFE+ID  K  +E  CP  VSCADI+ F+ARD+  ++G
Sbjct  71    LNSTPGNPS-EKEAPPNNPTLRGFEVIDAAKAAVEAKCPRKVSCADIIAFAARDSAYITG  129

Query  785   VPEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGV  606
               ++EVP GRRDG +S   +A  N+  P FT D++   F+ KGL ++++V L GAHSIG 
Sbjct  130   GMDYEVPAGRRDGRISLASEALDNIPFPTFTADKLKENFERKGLSLDEMVTLSGAHSIGR  189

Query  605   AHCSNFRYRLNTPARAKEVDGSLKVVMGTHCR----------NAATTIPMDSTTQYKMDS  456
             +HCS+F  RL   +     D S++     + +          +  TT+ +D+ T  ++D+
Sbjct  190   SHCSSFTTRLYNFSATHPQDPSMEPAFAAYLKARCPPSTASLSDPTTVLLDAVTPTRLDN  249

Query  455   MFYKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDE  276
             ++Y+ LL+ +G+L SD+ L     T   V   A  Q+AW  KF  +++KMG I VLTG +
Sbjct  250   IYYRNLLKHRGVLTSDQTLQESSETAKHVWYNAKHQSAWAAKFASAMVKMGSIEVLTGSQ  309

Query  275   GEIRKKCRFVN  243
             G+IR+KC   N
Sbjct  310   GKIREKCWVAN  320



>ref|XP_010251114.1| PREDICTED: peroxidase 5-like [Nelumbo nucifera]
Length=337

 Score =   267 bits (683),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 140/307 (46%), Positives = 186/307 (61%), Gaps = 13/307 (4%)
 Frame = -1

Query  1124  MRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSGG  945
             +  GFY +TCP  E I +  + +A + + GVAA ++RL  HDC V GCD S+LLDAT  G
Sbjct  31    LHFGFYNKTCPQVETITRLVVAQAVNKNAGVAAGLIRLHFHDCFVNGCDASILLDATPSG  90

Query  944   GRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEVP  765
               VEK+A  N K++RG E+ID IK  +EQ CPG+VSCADIL F+ARDA V+ G+  ++VP
Sbjct  91    EPVEKEATGNYKSLRGLEVIDEIKARVEQFCPGIVSCADILAFAARDAAVIVGLIPYKVP  150

Query  764   GGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNFR  585
              GRRDG  SR  DA   L  P  TVD++  LF  KGL  E++V L GAHSIGVAHC  F 
Sbjct  151   AGRRDGRSSRAADAATELPKPTATVDELTKLFARKGLSQEEMVTLSGAHSIGVAHCPTFA  210

Query  584   YRLNTPARAKEVDGSLKVVMGTHCRNAA-------------TTIPMDSTTQYKMDSMFYK  444
             YRL   +     D SL  +  ++ + +               TIP D  +   +D+ +Y 
Sbjct  211   YRLYKYSPTVLQDPSLDYIFASYLKVSCPMPGTFMADYFSEATIPFDQASPTTLDNKYYL  270

Query  443   QLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIR  264
              L   +GLLESD+ L  D  T  +VEEF+ +  +W  KF  ++ +MG+I VLTG+ GEIR
Sbjct  271   GLKLGRGLLESDQALMKDRNTSKIVEEFSLNPTSWSQKFGRAMTRMGRIEVLTGNLGEIR  330

Query  263   KKCRFVN  243
               CR VN
Sbjct  331   NYCRLVN  337



>ref|XP_010674524.1| PREDICTED: peroxidase 5-like [Beta vulgaris subsp. vulgaris]
Length=335

 Score =   267 bits (683),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 126/306 (41%), Positives = 195/306 (64%), Gaps = 8/306 (3%)
 Frame = -1

Query  1136  TTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDA  957
             +TA + +G+Y  TCP+AE IV+  + +A   DPG+ A ++R+  HDC V GCD S+LLD+
Sbjct  29    STATLDIGYYQSTCPSAEAIVRRAVNRAITQDPGLGAGLIRMHFHDCFVRGCDASILLDS  88

Query  956   TSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPE  777
             T      EK++P+NG ++RGFE+ID  K E+E  CP  VSCADIL F+ARD++   G   
Sbjct  89    TLSNPSSEKESPANGPSLRGFEVIDEAKAELEIICPRTVSCADILAFAARDSVQELGGIS  148

Query  776   FEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHC  597
             + VP GR+DG +S + +A  N+ SP+ TV+Q+  +F +KGL+++D+VAL GAHSIG+  C
Sbjct  149   YNVPSGRKDGTISIKDEATTNIPSPNSTVEQLQQMFSNKGLNLQDIVALSGAHSIGMTRC  208

Query  596   SNFRYRLNTPARAKEVDGSLKVVMGTHCRNAATT--------IPMDSTTQYKMDSMFYKQ  441
             S F +RL+T       D S++V   +  ++   +        +P+D  T  ++D+ +Y+ 
Sbjct  209   SLFSHRLHTFNATHLQDPSMEVKFASEMKDKCPSLAASEQVKVPLDGLTPSRLDNKYYRN  268

Query  440   LLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRK  261
             L++ +GLL SD+ L   P T  +V+ FA     W+  F +++ +MG I VLT  +GE+R+
Sbjct  269   LVKGRGLLASDQALMDSPLTSKMVKRFAKYGRVWMPTFVDAMTRMGSIEVLTSSQGEVRR  328

Query  260   KCRFVN  243
              CR VN
Sbjct  329   HCRIVN  334



>ref|XP_010911662.1| PREDICTED: peroxidase 5-like [Elaeis guineensis]
Length=321

 Score =   266 bits (681),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 133/311 (43%), Positives = 195/311 (63%), Gaps = 11/311 (4%)
 Frame = -1

Query  1145  AAETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVL  966
             A+ T+A + VGFY +TCP+AE IV+  + +A   +PG AA ++R+  HDC V GCD SVL
Sbjct  11    ASATSASLNVGFYEKTCPSAEAIVRETVSQAIAKNPGFAAGLIRMHFHDCFVRGCDASVL  70

Query  965   LDATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSG  786
             L++T G    EK+AP N  ++RGFE+I+  K  +E  CP  VSCADI+ F+ARD+  ++G
Sbjct  71    LNSTPGNPS-EKEAPPNNPSLRGFEVINAAKAAVEAKCPCKVSCADIIAFAARDSAYITG  129

Query  785   VPEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGV  606
               ++EVP GRRDG +S   +A  N+  P FT D++   F+ KGL ++++V L GAHSIG 
Sbjct  130   GIDYEVPAGRRDGRISLASEALDNIPFPTFTADKLKESFERKGLTLDEMVTLSGAHSIGR  189

Query  605   AHCSNFRYRLNTPARAKEVDGSLK----VVMGTHCRNAA------TTIPMDSTTQYKMDS  456
             +HCS+F  RL   +     D S++      + T C  +       TT+ +D+ T  ++D+
Sbjct  190   SHCSSFTTRLYNFSATHPQDPSMEPAFAAYLKTRCPPSTASPTDPTTVLLDAVTPTRLDN  249

Query  455   MFYKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDE  276
             M+Y+ LL+ +G+L SD+ L     T   V   A  Q+AW  KF  +++KMG I VLTG +
Sbjct  250   MYYRNLLKHRGVLTSDQTLQESSETTKHVWYNAKHQSAWAAKFASAMVKMGSIEVLTGSQ  309

Query  275   GEIRKKCRFVN  243
             GEIR+KC  VN
Sbjct  310   GEIREKCWVVN  320



>ref|XP_010270944.1| PREDICTED: peroxidase 5-like [Nelumbo nucifera]
Length=339

 Score =   266 bits (681),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 137/312 (44%), Positives = 182/312 (58%), Gaps = 12/312 (4%)
 Frame = -1

Query  1145  AAETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVL  966
             A+ +TA ++VGFY  TCP+AE IV+  + KA   +PG+ A ++R+  HDC V GCD SVL
Sbjct  29    ASGSTASLKVGFYSSTCPSAEAIVRKAVTKAISQNPGIGAGLIRMHFHDCFVRGCDASVL  88

Query  965   LDATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSG  786
             LD+T G    EK  P+N  ++RGFE+ID  K  +E  CP  VSCADI+ F+ARD+    G
Sbjct  89    LDSTPGND-AEKSHPANNPSLRGFEVIDMAKAHIEAVCPQTVSCADIIAFAARDSAYKLG  147

Query  785   VPEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGV  606
                + VP GRRDG +SR  D R NL  P FT  Q+   F  KGL +E++V L GAHSIGV
Sbjct  148   GINYAVPAGRRDGLISRSADIRANLPPPSFTAKQLEDRFAGKGLSLEEMVTLSGAHSIGV  207

Query  605   AHCSNFRYRLN----TPARAKEVDGSLKVVMGTHCRNAAT-------TIPMDSTTQYKMD  459
             +HCS+F  RL     T  +   +D      + T C   +T       T+P+D  T  ++D
Sbjct  208   SHCSSFLNRLYNFNATHPQDPSMDPDYAAFLKTRCPPTSTAGSSLDPTVPLDVLTPNRLD  267

Query  458   SMFYKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGD  279
             + +YK L    GLL SD  L     T  +V   A   +AW  KF  +++ MG I VLTG 
Sbjct  268   NKYYKNLKNHHGLLTSDWTLMSSHSTAWMVRNNAKHPSAWASKFAAAMVHMGYIDVLTGT  327

Query  278   EGEIRKKCRFVN  243
             +GEIRK C  VN
Sbjct  328   QGEIRKSCSVVN  339



>ref|XP_010675632.1| PREDICTED: peroxidase 5-like [Beta vulgaris subsp. vulgaris]
Length=356

 Score =   266 bits (681),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 132/302 (44%), Positives = 187/302 (62%), Gaps = 9/302 (3%)
 Frame = -1

Query  1124  MRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSGG  945
             +RVGFY  +CP AE I+++ +  A ++DPG+AAA VRL  HDC V GCD S+LLD+T  G
Sbjct  55    LRVGFYDYSCPQAENIIEDVVKAAIYNDPGIAAAFVRLYFHDCFVNGCDASILLDSTPSG  114

Query  944   GRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEVP  765
                EK +P N   VRGFE+ID IK  +E  CP  VSCADIL+F+ RDA+  SG+P + V 
Sbjct  115   EPTEKTSPGN-LGVRGFEVIDEIKTRIEYVCPETVSCADILSFATRDAVKHSGIPYYNVL  173

Query  764   GGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNFR  585
              GRRDG  S E     NL  P+  V Q+  +F  KG++ +D+VALLGAHSIGVAHCS F 
Sbjct  174   AGRRDGQTSVEKTILGNLPFPNANVKQLDQIFTRKGMNKQDIVALLGAHSIGVAHCSVFE  233

Query  584   YRLNTPARAKEVDGSLKVVMGTHCRNAAT--------TIPMDSTTQYKMDSMFYKQLLQK  429
              + N      +++  L  +   H +             +P++   Q ++ ++FY  ++  
Sbjct  234   KQFNNFNSTFDINPRLDKMYAMHLKKTCPLHKTSKDDVLPLNIYDQKRLSNVFYSNVING  293

Query  428   KGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRF  249
             K ++ SD+ L  DP+T  LV  +A + + W+  F +S+IK+GK+ VLTG+ G+IRK CR 
Sbjct  294   KVIIPSDQSLLDDPKTNKLVHLYALEWSTWVSDFRDSMIKLGKVDVLTGENGQIRKSCRA  353

Query  248   VN  243
             VN
Sbjct  354   VN  355



>ref|XP_010921346.1| PREDICTED: peroxidase 5-like [Elaeis guineensis]
Length=328

 Score =   266 bits (679),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 140/309 (45%), Positives = 193/309 (62%), Gaps = 12/309 (4%)
 Frame = -1

Query  1136  TTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDA  957
             ++A ++VGFY   CP AE IV+  + +A   +PG+AA +VR+  HDC V GCD SVLLD+
Sbjct  21    SSATLQVGFYLSRCPAAESIVRRTVTEAVAKNPGIAAGLVRMHFHDCFVRGCDASVLLDS  80

Query  956   TSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPE  777
             T G    EK++P+N  ++RGFE+ID+ K E+E  CP  VSCADIL F+ARD    +G  +
Sbjct  81    TPGNP-AEKESPANNPSLRGFEVIDKAKAEIEAQCPQTVSCADILAFAARDGAFRAGGID  139

Query  776   FEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHC  597
             + VP GRRDG +S E D  +N+ +P FTVDQ+   F  KGL ++++V L GAHSIGV+HC
Sbjct  140   YTVPAGRRDGRISLESDVLQNIPAPFFTVDQLQQNFARKGLSLDEMVTLSGAHSIGVSHC  199

Query  596   SNFRYRLNTPARAKEVDGSLK----VVMGTHCRNAAT-------TIPMDSTTQYKMDSMF  450
             S+F  RL +       D SL       + T C   ++       T+P+D  T  ++D+ +
Sbjct  200   SSFSNRLYSFNATNPQDPSLNPGFAAFLKTKCPPPSSTGAGQDATVPLDIVTPNRLDNRY  259

Query  449   YKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGE  270
             YK L   KGLL SD+ L  DP T  +V   A+  A W  KF  ++++MG I VLTG +GE
Sbjct  260   YKNLRNNKGLLTSDQSLMSDPSTKTIVRNNANRGAEWAAKFAAAMVQMGSIEVLTGTQGE  319

Query  269   IRKKCRFVN  243
             IRK CR VN
Sbjct  320   IRKNCRLVN  328



>dbj|BAK03531.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=334

 Score =   265 bits (678),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 139/306 (45%), Positives = 190/306 (62%), Gaps = 8/306 (3%)
 Frame = -1

Query  1145  AAETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVL  966
             +A   A +RVGFY  +CP AE IV+  + KA   +PG+AA ++RL  HDC V GC+ SVL
Sbjct  31    SAGVRAQLRVGFYDSSCPAAEIIVQQEVSKAVTANPGLAAGLLRLHFHDCFVGGCEASVL  90

Query  965   LDATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSG  786
             +D+T G    EK A  N  ++RGFE+IDRIK  +EQ+C GVVSCADIL F+ARD++ L+G
Sbjct  91    VDSTKGN-TAEKDAGPN-TSLRGFEVIDRIKARVEQACFGVVSCADILAFAARDSVALTG  148

Query  785   VPEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGV  606
                ++VP GRRDG VSR  D   NL  P   V+Q+  +F SKGL+ +DLV L GAH+IG 
Sbjct  149   GNAYQVPAGRRDGGVSRAQDTGGNLPPPSPNVNQLTKIFASKGLNQKDLVTLSGAHTIGG  208

Query  605   AHCSNFRYRLNTP---ARAKEVDGSLKVVMGTHCRNAATT---IPMDSTTQYKMDSMFYK  444
             +HCS+F  RL TP   A+   +D      +   C  +++    +PMD+ T    D  FYK
Sbjct  209   SHCSSFSSRLQTPSPTAQDPTMDPGYVAQLAQQCGASSSPGPLVPMDAVTPNSFDEGFYK  268

Query  443   QLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIR  264
              ++  +GLL SD+ L  D  T   V  +A+D A +   F  +++KMG + VLTG  G+IR
Sbjct  269   GIMSNRGLLASDQALLSDGNTAVQVVSYANDPATFQSDFAAAMVKMGYVGVLTGSSGKIR  328

Query  263   KKCRFV  246
               CR V
Sbjct  329   ANCRVV  334



>ref|XP_007161895.1| hypothetical protein PHAVU_001G106600g [Phaseolus vulgaris]
 gb|ESW33889.1| hypothetical protein PHAVU_001G106600g [Phaseolus vulgaris]
Length=308

 Score =   264 bits (675),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 136/296 (46%), Positives = 192/296 (65%), Gaps = 10/296 (3%)
 Frame = -1

Query  1124  MRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSGG  945
             +RVGFYG +CP AEEIV+  + + F+ D  + AA++R+  HDC V GCD S+L+D +S G
Sbjct  21    LRVGFYGSSCPRAEEIVRQVVQRRFNRDRSITAALLRMHFHDCFVRGCDASILID-SSKG  79

Query  944   GRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEVP  765
              + EK A +NG TVRGFELID IK+ +E +CP  VSCADI+T + RD++ ++G P ++VP
Sbjct  80    NQSEKAAGANG-TVRGFELIDEIKKALETACPSTVSCADIITLATRDSVAMAGGPRYDVP  138

Query  764   GGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNFR  585
              GRRD  VSR  D    L  P  +V  +   F + G+ ++++V LLGAH++G+AHCS FR
Sbjct  139   TGRRDSVVSRASDV--ALPGPRSSVSVVQQTFAANGMSLDEMVTLLGAHTVGLAHCSFFR  196

Query  584   YRLNTPARAKEVDGSLKVVMGTHCR--NAATTIPMDSTTQYKMDSMFYKQLLQKKGLLES  411
              RL  P     +D  L+  +G  CR  N   T  +D  T    D+ FY Q++ KKG+L  
Sbjct  197   DRLKDP----NMDPGLQAKLGRICRPKNGDPTTFLDQNTSMVFDNEFYNQIVLKKGVLFI  252

Query  410   DERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRFVN  243
             D++LA DP +  LV  FA + AA+   F ++++KMGKIRVL G +G+IRK CR  N
Sbjct  253   DQQLALDPLSSSLVSAFAGNSAAFQRSFIDAIVKMGKIRVLVGTDGQIRKNCRVFN  308



>ref|XP_010032734.1| PREDICTED: peroxidase 5-like [Eucalyptus grandis]
Length=326

 Score =   264 bits (675),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 135/305 (44%), Positives = 188/305 (62%), Gaps = 9/305 (3%)
 Frame = -1

Query  1133  TAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDAT  954
             +A ++VGFY  TCP+AE +V+  + KA   +PG+ A ++R+  HDC V GCD S+LLD+T
Sbjct  23    SATLQVGFYRSTCPSAESVVRKAVNKAVAKNPGIGAGLIRMHFHDCFVRGCDASILLDST  82

Query  953   SGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEF  774
              G    EK+ P+N  ++RGFE+ID  K E+E  CP  VSCADIL F+ARD+    G   +
Sbjct  83    PGNPS-EKEHPANNPSLRGFEVIDEAKAELESLCPQKVSCADILAFAARDSAYKLGSINY  141

Query  773   EVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCS  594
              VP GRRDG VS + +  +NL    F   Q+ A F SKGL ++++V L GAHSIGV+HCS
Sbjct  142   AVPAGRRDGLVSLKDEPSQNLPPFFFNAQQLEANFASKGLSLDEMVTLSGAHSIGVSHCS  201

Query  593   NFRYRLN----TPARAKEVDGSLKVVMGTHCRN----AATTIPMDSTTQYKMDSMFYKQL  438
             +F  RL     T  +   +D  L   + + C N    +  T+P+D  T  ++D+ +Y  L
Sbjct  202   SFSDRLYSFNATHTQDPSMDTKLASQLKSKCPNNGGASDPTVPLDLVTPNRLDNKYYTNL  261

Query  437   LQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKK  258
                +GLL SD+ L   P T  +V   A++  AW  KF  +++KMG I VLTG EGEIR+K
Sbjct  262   KNHRGLLTSDQTLFNSPSTANIVRSNANNGGAWANKFAAAMVKMGSIDVLTGSEGEIRRK  321

Query  257   CRFVN  243
             CR VN
Sbjct  322   CRVVN  326



>ref|XP_010041692.1| PREDICTED: peroxidase 5-like [Eucalyptus grandis]
Length=323

 Score =   263 bits (672),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 133/305 (44%), Positives = 189/305 (62%), Gaps = 9/305 (3%)
 Frame = -1

Query  1133  TAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDAT  954
             +A ++VGFY  TCP+AE +V+  + KA   +PG+ A ++R+  HDC V GCD S+LLD+T
Sbjct  20    SATLQVGFYRSTCPSAESVVRKAVNKAVAKNPGIGAGLIRMHFHDCFVRGCDASILLDST  79

Query  953   SGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEF  774
              G    EK+ P+N  ++RGFE+ID  K E+E  CP  VSCADIL F+ARD+    G   +
Sbjct  80    PGNPS-EKEHPANNPSLRGFEVIDEAKAELESLCPQKVSCADILAFAARDSAYKLGSINY  138

Query  773   EVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCS  594
              VP GRRDG VS + +  ++L    F   Q+ A F  KGL ++++V L GAHSIGV+HCS
Sbjct  139   AVPAGRRDGLVSLKDEPSQDLPPFFFNAQQLEANFARKGLSLDEMVTLSGAHSIGVSHCS  198

Query  593   NFRYRLN----TPARAKEVDGSLKVVMGTHCRN----AATTIPMDSTTQYKMDSMFYKQL  438
             +F  RL     T  +   +D  L   + + C N    +  T+P+D  T  ++D+ +Y  L
Sbjct  199   SFSNRLYSFNATHTQDPSMDTKLATQLKSKCPNNGGASDPTVPLDLVTPNRLDNKYYTNL  258

Query  437   LQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKK  258
               ++GLL SD+ L   P T  +V   A++  AW  KF  +++KMG I VLTG+EGEIR+K
Sbjct  259   KNRRGLLTSDQTLFNSPSTANIVRSNANNGGAWANKFAAAMVKMGSIDVLTGNEGEIRRK  318

Query  257   CRFVN  243
             CR VN
Sbjct  319   CRVVN  323



>ref|XP_009359339.1| PREDICTED: peroxidase 57-like [Pyrus x bretschneideri]
Length=340

 Score =   263 bits (673),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 140/308 (45%), Positives = 184/308 (60%), Gaps = 16/308 (5%)
 Frame = -1

Query  1127  GMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSG  948
             G+ VGFY R+CP  E+IV + + +A   DP +  A++RL SHDC V GCD S+LL+AT  
Sbjct  36    GLNVGFYSRSCPNVEKIVADIVSEANRQDPKLPGALIRLFSHDCFVKGCDASILLEATRS  95

Query  947   GGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEV  768
                VEK+A  N   +RGFELID IK  +EQ CP  VSCADIL F+AR+A+ L+G+P  +V
Sbjct  96    KEPVEKKAQGN-DFIRGFELIDEIKARLEQECPQTVSCADILAFAAREAVFLAGLPRHKV  154

Query  767   PGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNF  588
             P GRRD   SR  D    L +P    + ++  F  KG+ +++LV L GAHSIGVAHCS F
Sbjct  155   PAGRRDSRTSRASDV--GLPAPTTPFNDIIDFFTRKGITLDELVVLSGAHSIGVAHCSFF  212

Query  587   RYRLNTPARAKEVDGSLKVV----MGTHCRNAAT---------TIPMDSTTQYKMDSMFY  447
              YRL     ++  D +L       + T C    T          +  D  T   +D+ FY
Sbjct  213   DYRLYNFNTSQPQDPALNSTYASDLSTKCPKQNTLPADEAKKRAVDFDPITPLVLDNNFY  272

Query  446   KQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEI  267
               LLQ K LL+SD+ +  DPRT  LV+  A D  AW  +F +++IKMG+  VLT DEGEI
Sbjct  273   VNLLQGKTLLQSDQIMVSDPRTSALVKTLASDSDAWSRRFAKAMIKMGRTNVLTRDEGEI  332

Query  266   RKKCRFVN  243
             RK CR  N
Sbjct  333   RKNCRTFN  340



>ref|XP_008340087.1| PREDICTED: peroxidase 57-like [Malus domestica]
Length=340

 Score =   263 bits (673),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 139/308 (45%), Positives = 183/308 (59%), Gaps = 16/308 (5%)
 Frame = -1

Query  1127  GMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSG  948
             G+ VGFY R+CP  E+IV + + +A   DP +  A++RL SHDC V GCD S+LL+ T  
Sbjct  36    GLNVGFYSRSCPNVEKIVADIVSEANRQDPKLPGALIRLFSHDCFVKGCDASILLETTRS  95

Query  947   GGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEV  768
                VEK+A  N   +RGFELID IK  +EQ CP  VSCADIL F+AR+A+ L+G+P  +V
Sbjct  96    KEPVEKKAQGN-DFIRGFELIDEIKARLEQECPQTVSCADILAFAAREAVFLAGLPRHKV  154

Query  767   PGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNF  588
             P GRRD   SR  D    L +P    + ++  F  KG+ +++LV L GAHSIGVAHCS F
Sbjct  155   PAGRRDSRTSRASDV--GLPAPTTPFNDIIDFFTRKGITLDELVVLSGAHSIGVAHCSFF  212

Query  587   RYRLNTPARAKEVDGSLKVV----MGTHCRNAAT---------TIPMDSTTQYKMDSMFY  447
              YRL     ++  D +L       + T C    T          +  D  T   +D+ FY
Sbjct  213   DYRLYNFNTSQPQDPALNSTYAADLSTKCPKQNTLPADEAKKRAVDFDPITPLVLDNNFY  272

Query  446   KQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEI  267
               LLQ K LL+SD+ +  DPRT  LV+  A D  AW  +F +++IKMG+  VLT DEGEI
Sbjct  273   LNLLQGKTLLQSDQIMVSDPRTSALVKTLASDSEAWSRRFAKAMIKMGRTNVLTRDEGEI  332

Query  266   RKKCRFVN  243
             RK CR  N
Sbjct  333   RKNCRTFN  340



>gb|KCW44165.1| hypothetical protein EUGRSUZ_L02416, partial [Eucalyptus grandis]
Length=302

 Score =   261 bits (668),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 132/302 (44%), Positives = 187/302 (62%), Gaps = 9/302 (3%)
 Frame = -1

Query  1124  MRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSGG  945
             ++VGFY  TCP+AE +V+  + KA   +PG+ A ++R+  HDC V GCD S+LLD+T G 
Sbjct  2     LQVGFYRSTCPSAESVVRKAVNKAVAKNPGIGAGLIRMHFHDCFVRGCDASILLDSTPGN  61

Query  944   GRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEVP  765
                EK+ P+N  ++RGFE+ID  K E+E  CP  VSCADIL F+ARD+    G   + VP
Sbjct  62    PS-EKEHPANNPSLRGFEVIDEAKAELESLCPQKVSCADILAFAARDSAYKLGSINYAVP  120

Query  764   GGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNFR  585
              GRRDG VS + +  ++L    F   Q+ A F  KGL ++++V L GAHSIGV+HCS+F 
Sbjct  121   AGRRDGLVSLKDEPSQDLPPFFFNAQQLEANFARKGLSLDEMVTLSGAHSIGVSHCSSFS  180

Query  584   YRLN----TPARAKEVDGSLKVVMGTHCRN----AATTIPMDSTTQYKMDSMFYKQLLQK  429
              RL     T  +   +D  L   + + C N    +  T+P+D  T  ++D+ +Y  L  +
Sbjct  181   NRLYSFNATHTQDPSMDTKLATQLKSKCPNNGGASDPTVPLDLVTPNRLDNKYYTNLKNR  240

Query  428   KGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRF  249
             +GLL SD+ L   P T  +V   A++  AW  KF  +++KMG I VLTG+EGEIR+KCR 
Sbjct  241   RGLLTSDQTLFNSPSTANIVRSNANNGGAWANKFAAAMVKMGSIDVLTGNEGEIRRKCRV  300

Query  248   VN  243
             VN
Sbjct  301   VN  302



>ref|XP_010032732.1| PREDICTED: peroxidase 5-like [Eucalyptus grandis]
Length=326

 Score =   262 bits (670),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 133/305 (44%), Positives = 188/305 (62%), Gaps = 9/305 (3%)
 Frame = -1

Query  1133  TAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDAT  954
             +A ++VGFY  TCP+AE +V+  + KA   +PG+ A ++R+  HDC V GCD S+LLD+T
Sbjct  23    SATLQVGFYRSTCPSAESVVRKAVNKAVAKNPGIGAGLIRMHFHDCFVRGCDASILLDST  82

Query  953   SGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEF  774
              G    EK+ P+N  ++RGFE+ID  K E+E  CP  VSCADIL F+ARD+    G   +
Sbjct  83    PGNPS-EKEHPANNPSLRGFEVIDEAKAELESLCPQKVSCADILAFAARDSAYKLGSINY  141

Query  773   EVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCS  594
              VP GRRDG VS + +  +NL    F   Q+ A F SKGL ++++V L GAHSIGV+HCS
Sbjct  142   AVPAGRRDGLVSLKDEPSQNLPPFFFNAQQLEANFASKGLSLDEMVTLSGAHSIGVSHCS  201

Query  593   NFRYRLN----TPARAKEVDGSLKVVMGTHCRN----AATTIPMDSTTQYKMDSMFYKQL  438
             +F  RL     T  +   +D  L   + + C N    +  T+P+D  T  ++D+ +Y  L
Sbjct  202   SFSDRLYSFNATHTQDPSMDTKLASQLKSKCPNNGGASDPTVPLDLVTPNRLDNKYYTNL  261

Query  437   LQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKK  258
                +GLL SD+ L   P T  +V   A++  AW  KF  +++KMG I +LTG+EGEIR+K
Sbjct  262   KNHRGLLTSDQTLFNSPSTANIVRSNANNGGAWANKFAAAMVKMGSIDILTGNEGEIRRK  321

Query  257   CRFVN  243
             C  VN
Sbjct  322   CTVVN  326



>ref|XP_010026045.1| PREDICTED: peroxidase 5-like [Eucalyptus grandis]
Length=330

 Score =   262 bits (670),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 133/308 (43%), Positives = 188/308 (61%), Gaps = 11/308 (4%)
 Frame = -1

Query  1136  TTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDA  957
             +++  RVGFY  TCP A  IVK  + +A   +PG+AA ++RL  HDC V GCD SVLL +
Sbjct  24    SSSKFRVGFYKYTCPAAASIVKQTVYEAVAKNPGMAAGLLRLHFHDCFVRGCDASVLLKS  83

Query  956   TSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPE  777
             T      E+  P+N  ++RGFE+ID+ K  +E  CP  VSCADI+ F+ARD++  +G   
Sbjct  84    TPENP-AERDHPTNNPSLRGFEIIDQAKARLEAVCPKTVSCADIVAFAARDSVYKTGGIY  142

Query  776   FEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHC  597
             + VP GRRDG VSR  +  +NL SP+F   Q++A F  KGL   ++V LLGAHSIG++HC
Sbjct  143   YNVPAGRRDGRVSRLSEVTQNLPSPNFNAQQLIANFARKGLSANEMVTLLGAHSIGISHC  202

Query  596   SNFRYRLN----TPARAKEVDGSLKVVMGTHCRNAAT------TIPMDSTTQYKMDSMFY  447
             S+F  RL     T  +   +D +    + T C   +       T+P+DS T   +D+ +Y
Sbjct  203   SSFSSRLYAFNATLTQDPSLDPAFAAFLKTKCLPQSNVTRVDPTVPLDSITPGTLDNKYY  262

Query  446   KQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEI  267
              QLL+ +G+L  DE L   P T  +V   A + AAW  KF ++++KMG + VLTG +GEI
Sbjct  263   LQLLKLRGVLAKDETLYTSPSTSRMVVSNAVNGAAWRAKFAKAMVKMGSLDVLTGAQGEI  322

Query  266   RKKCRFVN  243
             R+ C  VN
Sbjct  323   RELCSVVN  330



>ref|XP_003565723.1| PREDICTED: peroxidase 5-like [Brachypodium distachyon]
Length=355

 Score =   263 bits (671),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 131/310 (42%), Positives = 187/310 (60%), Gaps = 11/310 (4%)
 Frame = -1

Query  1142  AETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLL  963
             A   AG++VGFY +TCP+AE +V+  +  +F ++ GVAA ++RL  HDC V GCDGSVL+
Sbjct  24    AAVGAGLKVGFYSKTCPSAETLVQQAVAASFKNNGGVAAGLIRLHFHDCFVKGCDGSVLI  83

Query  962   DATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGV  783
             D+T+     EK A  N  ++RGFE+ID  K+ +E  CP +VSCADIL F+ARD++ L+G 
Sbjct  84    DSTANN-TAEKDAIPNNPSLRGFEVIDAAKKAIEAKCPKIVSCADILAFAARDSIALAGN  142

Query  782   PEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVA  603
               ++VP GRRDG +S + +A  NL SP  T  ++V  F  K L  ED+V L GAH+IGV+
Sbjct  143   VTYKVPAGRRDGRISSDQNALNNLPSPLSTASELVGNFTLKNLTAEDMVVLSGAHTIGVS  202

Query  602   HCSNFRYRLNTPARAKEVDGSLKVVMGTHCRNAA----------TTIPMDSTTQYKMDSM  453
              CS+F  RL   +   +VD ++        +N            TT+ MD  T   +D+ 
Sbjct  203   RCSSFTNRLYGFSNTSQVDPTMSSAYAFLLKNICPANSSQFFPNTTMDMDIITPAVLDNK  262

Query  452   FYKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEG  273
             +Y  L+   GL  SD+ L  +      V+EF  ++  W  KF +S++KMG I VLTG +G
Sbjct  263   YYVSLINNLGLFTSDQALLTNSTLKASVDEFVKNENRWKSKFVKSMVKMGNIEVLTGTQG  322

Query  272   EIRKKCRFVN  243
             EIR  CR +N
Sbjct  323   EIRLNCRVIN  332



>ref|XP_002440652.1| hypothetical protein SORBIDRAFT_09g004650 [Sorghum bicolor]
 gb|EES19082.1| hypothetical protein SORBIDRAFT_09g004650 [Sorghum bicolor]
Length=357

 Score =   263 bits (671),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 137/314 (44%), Positives = 187/314 (60%), Gaps = 18/314 (6%)
 Frame = -1

Query  1133  TAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDAT  954
             TA + VGFY +TCP+AE IV+  +  AF +  GVA A++R+  HDC V GCDGSVL+D+T
Sbjct  22    TARLDVGFYNKTCPSAESIVQQTVAAAFGNSSGVAPALIRMHFHDCFVRGCDGSVLIDST  81

Query  953   SGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEF  774
             +     EK +P+N  ++R F+++DR K  +E  CPGVVSCADIL F+ARD++VL+G   +
Sbjct  82    ANN-TAEKDSPANNPSLRFFDVVDRAKASLEAQCPGVVSCADILAFAARDSVVLTGGLGY  140

Query  773   EVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCS  594
             +VP GRRDG VS    A  NL  P F   Q+V  F SK L +ED+V L GAH++GV+HCS
Sbjct  141   QVPSGRRDGRVSNATQATNNLPPPFFNATQLVDRFASKNLTLEDMVVLSGAHTLGVSHCS  200

Query  593   NFRYRLNTPARAKEVDGS-----------LKVVMGTHCRNAA------TTIPMDSTTQYK  465
             +F    N   R     GS              ++ + C + +      TT  MD  T  K
Sbjct  201   SFAGPANLGDRLYNFSGSADGIDPALSKAYAFLLKSICPSNSSQFFPNTTTFMDIITPDK  260

Query  464   MDSMFYKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLT  285
              D+ +Y  L    GL ESD  L  +     LV+ F  ++  W  KF +S++KMGKI VLT
Sbjct  261   FDNKYYVGLTNNLGLFESDAALLTNATMKALVDSFVRNETTWKRKFAKSMVKMGKIEVLT  320

Query  284   GDEGEIRKKCRFVN  243
             G +GEIR+ CR +N
Sbjct  321   GTQGEIRRNCRVIN  334



>gb|KCW52190.1| hypothetical protein EUGRSUZ_J01619, partial [Eucalyptus grandis]
Length=313

 Score =   261 bits (666),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 133/302 (44%), Positives = 186/302 (62%), Gaps = 9/302 (3%)
 Frame = -1

Query  1133  TAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDAT  954
             +A ++VGFY  TCP+AE +V+  + KA   +PG+ A ++R+  HDC V GCD S+LLD+T
Sbjct  12    SATLQVGFYRSTCPSAESVVRKAVNKAVAKNPGIGAGLIRMHFHDCFVRGCDASILLDST  71

Query  953   SGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEF  774
              G    EK+ P+N  ++RGFE+ID  K E+E  CP  VSCADIL F+ARD+    G   +
Sbjct  72    PGNPS-EKEHPANNPSLRGFEVIDEAKAELESLCPQKVSCADILAFAARDSAYKLGSINY  130

Query  773   EVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCS  594
              VP GRRDG VS + +  +NL    F   Q+ A F SKGL ++++V L GAHSIGV+HCS
Sbjct  131   AVPAGRRDGLVSLKDEPSQNLPPFFFNAQQLEANFASKGLSLDEMVTLSGAHSIGVSHCS  190

Query  593   NFRYRLN----TPARAKEVDGSLKVVMGTHCRN----AATTIPMDSTTQYKMDSMFYKQL  438
             +F  RL     T  +   +D  L   + + C N    +  T+P+D  T  ++D+ +Y  L
Sbjct  191   SFSDRLYSFNATHTQDPSMDTKLASQLKSKCPNNGGASDPTVPLDLVTPNRLDNKYYTNL  250

Query  437   LQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKK  258
                +GLL SD+ L   P T  +V   A++  AW  KF  +++KMG I VLTG EGEIR+K
Sbjct  251   KNHRGLLTSDQTLFNSPSTANIVRSNANNGGAWANKFAAAMVKMGSIDVLTGSEGEIRRK  310

Query  257   CR  252
             CR
Sbjct  311   CR  312



>ref|XP_008781200.1| PREDICTED: peroxidase 5-like [Phoenix dactylifera]
Length=328

 Score =   261 bits (667),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 138/309 (45%), Positives = 192/309 (62%), Gaps = 12/309 (4%)
 Frame = -1

Query  1136  TTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDA  957
             ++A ++VGFY   CP AE IV+  + +A   +PG+AA ++R+  HDC V GCD SVLLD+
Sbjct  21    SSATLQVGFYQSKCPAAESIVRRTVTEAVAKNPGIAAGLLRMHFHDCFVRGCDASVLLDS  80

Query  956   TSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPE  777
             T G    EK++P+N  ++RGFE+IDR K E+E  CP  VSCADIL F+ARD    +G  +
Sbjct  81    TPGNP-AEKESPANKPSLRGFEVIDRAKAEIEAQCPQTVSCADILAFAARDGAFRAGGID  139

Query  776   FEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHC  597
             + VP GRRDG +S E +  +N+ +P FTVDQ+   F  KGL  +++V L GAHSIGV+HC
Sbjct  140   YAVPAGRRDGRISLESEVLQNIPAPFFTVDQLQQNFARKGLSRDEMVTLSGAHSIGVSHC  199

Query  596   SNFRYRLNTPARAKEVDGSLK----VVMGTHCRNAAT-------TIPMDSTTQYKMDSMF  450
             S+F  RL +       D SL       + T C   ++       T+P+D  +  ++D+ +
Sbjct  200   SSFSNRLYSFNATNPQDPSLNPGFAAFLKTKCPPPSSTGTGQDGTVPLDIVSPNRLDNWY  259

Query  449   YKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGE  270
             YK L   KGLL SD+ L  DP T  +V   A+  A W  KF  ++++MG I VLTG +GE
Sbjct  260   YKNLRSSKGLLTSDQSLMDDPSTKTIVRNNANRGAEWAAKFAAAMVRMGSIEVLTGTQGE  319

Query  269   IRKKCRFVN  243
             IRK CR VN
Sbjct  320   IRKNCRLVN  328



>ref|XP_010234947.1| PREDICTED: peroxidase 5-like [Brachypodium distachyon]
Length=303

 Score =   260 bits (665),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 135/304 (44%), Positives = 192/304 (63%), Gaps = 6/304 (2%)
 Frame = -1

Query  1145  AAETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVL  966
             AA  +A +RVGFY  +CP AE IV+  +  A   +PG+AA ++RL  HDC V GC+ SVL
Sbjct  2     AAAVSAQLRVGFYDSSCPAAEIIVQQEVSSAVAANPGLAAGLLRLHFHDCFVGGCEASVL  61

Query  965   LDATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSG  786
             +D+T+     EK A  N K++RGFE+IDRIK  +EQ+C GVVSCADIL F+ARD + L+G
Sbjct  62    VDSTASN-TAEKDAGPN-KSLRGFEVIDRIKARVEQACFGVVSCADILAFAARDGIALTG  119

Query  785   VPEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGV  606
                ++VP GRRDG+VS+  D   NL  P  +V Q+ A+F SKGL  +D+V L GAH+IG 
Sbjct  120   GNGYQVPAGRRDGSVSKASDTSGNLPPPTPSVPQLTAIFASKGLTQKDMVTLSGAHTIGG  179

Query  605   AHCSNFRYRLNTPARAK---EVDGSLKVVMGTHCRNAAT-TIPMDSTTQYKMDSMFYKQL  438
             +HC++F  RL TP        +D      + + C ++++  +PMD+ T    D  ++K +
Sbjct  180   SHCTSFSSRLQTPGPQTPDPTMDPGYVAQLASQCSSSSSGMVPMDAVTPNTFDEGYFKGV  239

Query  437   LQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKK  258
             +  +GLL SD+ L GD  T   V  +A+D A +   F  +++KMG + VLTG  G+IR  
Sbjct  240   MANRGLLASDQALLGDGATAGQVVAYANDPATFQSDFAAAMVKMGYVGVLTGSSGKIRAN  299

Query  257   CRFV  246
             CR V
Sbjct  300   CRVV  303



>ref|XP_010069737.1| PREDICTED: peroxidase 5-like [Eucalyptus grandis]
 gb|KCW58171.1| hypothetical protein EUGRSUZ_H00888 [Eucalyptus grandis]
Length=338

 Score =   261 bits (668),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 132/308 (43%), Positives = 189/308 (61%), Gaps = 11/308 (4%)
 Frame = -1

Query  1136  TTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDA  957
             T++   V FY  TCP AE I+K  +  A   +PG+AA ++RL  HDC V GCD SVLL +
Sbjct  32    TSSKFTVRFYKYTCPAAESIIKQTVYGAIAKNPGMAAGLLRLHFHDCFVRGCDASVLLKS  91

Query  956   TSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPE  777
             T      E+  P+N  ++RGFE+ID+ K  +E  CP  VSCADI+ F+ARD++  +G   
Sbjct  92    TPKNP-AERDHPANNPSLRGFEIIDQAKARLEAVCPKTVSCADIVAFAARDSIFKTGGIY  150

Query  776   FEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHC  597
             ++VP GRRDG +SR P+  +NL  P+F   Q++A F  KGL  +++V L GAHSIG++HC
Sbjct  151   YDVPAGRRDGRISRLPEVTQNLPPPNFNAQQLIANFARKGLSADEMVTLSGAHSIGISHC  210

Query  596   SNFRYRL----NTPARAKEVDGSLKVVMGTHC------RNAATTIPMDSTTQYKMDSMFY  447
             S+F  RL     T A+   +D +   ++ T C        A  T+P+DS T   +D+ +Y
Sbjct  211   SSFSSRLYAFNTTLAQDPTLDPAFASLLKTKCPPPSNATRADPTVPLDSITPNALDNKYY  270

Query  446   KQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEI  267
              QL + +G+L +DE L   P T  +V   A + AAW  KF ++++KMG + VLTG +GEI
Sbjct  271   LQLQKLRGVLATDETLYKSPSTSRMVVSNAVNGAAWRVKFAKAMVKMGSLDVLTGKQGEI  330

Query  266   RKKCRFVN  243
             RK C  VN
Sbjct  331   RKVCSVVN  338



>ref|XP_002872571.1| peroxidase ATP19a [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48830.1| peroxidase ATP19a [Arabidopsis lyrata subsp. lyrata]
Length=327

 Score =   261 bits (666),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 131/307 (43%), Positives = 195/307 (64%), Gaps = 10/307 (3%)
 Frame = -1

Query  1136  TTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDA  957
             + A +++GFY +TCP AE+IV++ + +  H+ P +AA ++R+  HDC V GCDGS+L++A
Sbjct  22    SEAQLKMGFYDQTCPYAEKIVQDVVNQHIHNAPSLAAGLIRMHFHDCFVRGCDGSILINA  81

Query  956   TSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPE  777
             TS   +VEK AP N  TVRGF+ ID++K  +E  CPG+VSCADI+T + RD++V  G P 
Sbjct  82    TSSNQQVEKLAPPN-LTVRGFDFIDKVKSALESKCPGIVSCADIITLATRDSIVAIGGPT  140

Query  776   FEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHC  597
             + VP GRRDG +S   +AR N+  P      ++ LF ++GLDV+DLV L GAH+IGV+HC
Sbjct  141   WNVPTGRRDGRISNFAEARNNIPPPFGNFTTLITLFGNQGLDVKDLVLLSGAHTIGVSHC  200

Query  596   SNFRYRL--------NTPARAKEVDGSLKVVMGTHCRNAATTIPMDSTTQYKMDSMFYKQ  441
             S+F  RL          P+   E   +LK        +  TT+ MD  ++   D  +Y+ 
Sbjct  201   SSFSNRLFNFTGVGDQDPSMDSEYVDNLKSRRCLALADNTTTVEMDPGSRNTFDLSYYRL  260

Query  440   LLQKKGLLESDERLAGDPRTLPLVEEFA-DDQAAWLGKFTESVIKMGKIRVLTGDEGEIR  264
             +L+++GL ESD  L  +P  L  V+ F+   +  +  +F++S+ KMG+I V TG +GEIR
Sbjct  261   VLKRRGLFESDAALTMNPAALAQVKRFSGGSEQEFFAEFSKSMEKMGRIGVKTGSDGEIR  320

Query  263   KKCRFVN  243
             + C FVN
Sbjct  321   RTCAFVN  327



>ref|XP_004310167.1| PREDICTED: peroxidase 5-like [Fragaria vesca subsp. vesca]
Length=340

 Score =   261 bits (667),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 135/303 (45%), Positives = 180/303 (59%), Gaps = 11/303 (4%)
 Frame = -1

Query  1127  GMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSG  948
             G+ VGFY  +CP  E+IV   + +    DP +  A++RL  HDC V GCD SVLLD T  
Sbjct  34    GLTVGFYASSCPKVEDIVTEVVARLSKQDPTLPPALLRLFFHDCFVKGCDASVLLDETPS  93

Query  947   GGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEV  768
             G  VEK++  NG T+RG E+ID IK ++E+ CP  VSCADIL F+AR+A+ LSG+P   V
Sbjct  94    GQPVEKKSAGNGDTIRGLEVIDEIKTQVEKECPKTVSCADILAFAAREAVNLSGLPRHTV  153

Query  767   PGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNF  588
             P GR D   SR  DA   L +P   +++++A+F  + L +ED+V LLGAHS+G AHC+ F
Sbjct  154   PAGRHDSRTSRASDADYYLPTPAMPLEKIIAMFAERNLTIEDMVVLLGAHSMGQAHCTQF  213

Query  587   RYRLNTPARAKEVDGSLKVVMGTH----CRNAA-------TTIPMDSTTQYKMDSMFYKQ  441
               RL    +    D SL  + G      C  A        TT+ +D TT   +D  +Y  
Sbjct  214   TDRLYKFNKDTPRDPSLNAIYGNELAGKCPEAMSKEQASRTTVDLDPTTPRVLDIQYYVN  273

Query  440   LLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRK  261
             LLQ +GLL+SD+ L+ D RT  +V   A     W  KF  ++IKMG+  VLT DEGEIR 
Sbjct  274   LLQGRGLLQSDQVLSTDSRTGGIVNAMAASSDTWSTKFLRAIIKMGRSNVLTEDEGEIRT  333

Query  260   KCR  252
              CR
Sbjct  334   NCR  336



>ref|XP_004247506.1| PREDICTED: peroxidase 44-like [Solanum lycopersicum]
Length=328

 Score =   261 bits (666),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/297 (42%), Positives = 186/297 (63%), Gaps = 5/297 (2%)
 Frame = -1

Query  1133  TAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDAT  954
             +A ++VGFY  TCP  E IV+  +   F+ DP + AA++R+  HDC V GCD S+L+ +T
Sbjct  28    SAQLQVGFYNSTCPQTETIVRQAVQNQFNSDPSITAALLRMHFHDCFVRGCDASILIKST  87

Query  953   SGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEF  774
              G  + E++A  N KTVRG+ELID+IK+ +E SCP  VSCADI+T + RD++ L+G P +
Sbjct  88    -GSKKSEREAGPN-KTVRGYELIDKIKKTLETSCPSTVSCADIITLATRDSVALAGGPNY  145

Query  773   EVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCS  594
              +P GRRDG +S   D   NL  P  T+ Q +  F +KGL + D+V LLGAH++G+AHC+
Sbjct  146   PIPTGRRDGLISNIADV--NLPGPSLTIPQALQFFTNKGLTLNDMVTLLGAHTVGIAHCN  203

Query  593   NFRYRLNTPARAKEVDGSLKVVMGTHCRNAATTIPMDSTTQYKMDSMFYKQLLQKKGLLE  414
              F+ RL +P   K +D +L   +   C  ++ T  +D  T + +D+ +Y+Q+  +KG+L 
Sbjct  204   FFQGRL-SPVPDKTMDPTLAAQLLKTCTKSSATAFLDQNTSFSVDNEYYRQITLRKGILT  262

Query  413   SDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRFVN  243
              D+ L  D  + P+V  FA ++  +   F  ++IKM  I VL G  GEIRK C   N
Sbjct  263   IDQELTLDKSSAPIVTSFAANKDVFSQSFANAMIKMANIDVLVGSAGEIRKNCGVFN  319



>ref|XP_004968663.1| PREDICTED: peroxidase 1-like [Setaria italica]
Length=362

 Score =   261 bits (668),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 135/307 (44%), Positives = 188/307 (61%), Gaps = 12/307 (4%)
 Frame = -1

Query  1130  AGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATS  951
             AG++VGFY ++CP+AE +V+  +  AF ++ G+AA ++RL  HDC V GCDGSVL+D TS
Sbjct  26    AGLKVGFYNKSCPSAESLVQQAVAAAFKNNSGIAAGLIRLHFHDCFVRGCDGSVLIDTTS  85

Query  950   GGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVP-EF  774
                  EK AP N  ++RGFE+ID  K+ +E  CP VVSCADIL F+ARDA+ LSG    +
Sbjct  86    -NNTAEKDAPPNNPSLRGFEVIDAAKKAIEARCPKVVSCADILAFAARDAVALSGNNLTY  144

Query  773   EVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCS  594
             +VP GRRDG +SR+ DA  NL SP     ++V  F  K L  ED+V L GAH++G +HCS
Sbjct  145   KVPAGRRDGRISRDTDASNNLPSPLSNATELVGNFTVKNLTAEDMVVLSGAHTVGRSHCS  204

Query  593   NFRYRLNTPARAKEVDGSLK-----VVMGTHCRNAA-----TTIPMDSTTQYKMDSMFYK  444
             +F  RL   + A +VD ++      ++ G    N++     TT  MD  T   +D+ +Y 
Sbjct  205   SFTNRLYGFSNASDVDPTISSAYAFLLRGICPSNSSQFFPNTTTEMDLMTPAVLDNKYYL  264

Query  443   QLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIR  264
              L    GL  SD+ L  +      V+EF   +  W  KF ++++KMG I VLTG +GEIR
Sbjct  265   GLANNLGLFTSDQALLTNATLKKSVDEFVKSENRWRSKFAKAMVKMGNIEVLTGTQGEIR  324

Query  263   KKCRFVN  243
               CR +N
Sbjct  325   LNCRVIN  331



>gb|KCW58170.1| hypothetical protein EUGRSUZ_H00887, partial [Eucalyptus grandis]
Length=337

 Score =   260 bits (665),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 132/305 (43%), Positives = 186/305 (61%), Gaps = 11/305 (4%)
 Frame = -1

Query  1139  ETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLD  960
              T++  RVGFY  TCP A  IVK  + +A   +PG+AA ++RL  HDC V GCD SVLL 
Sbjct  32    RTSSKFRVGFYKYTCPAAASIVKQTVYEAVAKNPGMAAGLLRLHFHDCFVRGCDASVLLK  91

Query  959   ATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVP  780
             +T      E+  P+N  ++RGFE+ID+ K  +E  CP  VSCADI+ F+ARD++  +G  
Sbjct  92    STPENP-AERDHPTNNPSLRGFEIIDQAKARLEAVCPKTVSCADIVAFAARDSVYKTGGI  150

Query  779   EFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAH  600
              + VP GRRDG VSR  +  +NL SP+F   Q++A F  KGL   ++V LLGAHSIG++H
Sbjct  151   YYNVPAGRRDGRVSRLSEVTQNLPSPNFNAQQLIANFARKGLSANEMVTLLGAHSIGISH  210

Query  599   CSNFRYRLN----TPARAKEVDGSLKVVMGTHCRNAAT------TIPMDSTTQYKMDSMF  450
             CS+F  RL     T  +   +D +    + T C   +       T+P+DS T   +D+ +
Sbjct  211   CSSFSSRLYAFNATLTQDPSLDPAFAAFLKTKCLPQSNVTRVDPTVPLDSITPGTLDNKY  270

Query  449   YKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGE  270
             Y QLL+ +G+L  DE L   P T  +V   A + AAW  KF ++++KMG + VLTG +GE
Sbjct  271   YLQLLKLRGVLAKDETLYTSPSTSRMVVSNAVNGAAWRAKFAKAMVKMGSLDVLTGAQGE  330

Query  269   IRKKC  255
             IR+ C
Sbjct  331   IRELC  335



>gb|ACN36789.1| unknown [Zea mays]
Length=343

 Score =   260 bits (665),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 135/303 (45%), Positives = 184/303 (61%), Gaps = 10/303 (3%)
 Frame = -1

Query  1133  TAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDAT  954
             +A +  GFY +TCP+AE IV+  +  AF ++ GVA A++R+  HDC V GCDGSVL+D+T
Sbjct  20    SASLEFGFYNKTCPSAETIVQQTVAAAFTNNSGVAPALLRMHFHDCFVRGCDGSVLIDST  79

Query  953   SGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEF  774
             +   + EK +  N  ++R F+++DR K  +E  CPGVVSCADIL F+ARD++VL+G   +
Sbjct  80    ANN-KAEKDSIPNSPSLRFFDVVDRAKASLEARCPGVVSCADILAFAARDSVVLTGGLGY  138

Query  773   EVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCS  594
             +VP GRRDG +S    A   L  P F   Q+V  F SK L +ED+V L GAH+IGV+HCS
Sbjct  139   KVPSGRRDGRISNATQALNELPPPFFNATQLVDNFASKNLSLEDMVVLSGAHTIGVSHCS  198

Query  593   NFRYRLNTPARAKEVDGSLKVVMGTHCRNAA------TTIPMDSTTQYKMDSMFYKQLLQ  432
             +F    NT  R     GS     G+ C + +      TT  MD  T  K D+ +Y  L  
Sbjct  199   SFAGINNTGDRLYNFSGSSD---GSICPSNSGRFFPNTTTFMDLITPAKFDNKYYVGLTN  255

Query  431   KKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCR  252
               GL ESD  L  +     LV+ F   +A W  KF  S++KMG+I VLTG +GEIR+ CR
Sbjct  256   NLGLFESDAALLTNATMKALVDSFVRSEATWKTKFANSMLKMGRIEVLTGTQGEIRRNCR  315

Query  251   FVN  243
              +N
Sbjct  316   VIN  318



>ref|XP_008647554.1| PREDICTED: uncharacterized protein LOC100273479 isoform X1 [Zea 
mays]
 gb|AFW77217.1| hypothetical protein ZEAMMB73_709802 [Zea mays]
Length=343

 Score =   260 bits (665),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 135/303 (45%), Positives = 185/303 (61%), Gaps = 10/303 (3%)
 Frame = -1

Query  1133  TAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDAT  954
             +A +  GFY +TCP+AE IV+  +  AF ++ GVA A++R+  HDC V GCDGSVL+D+T
Sbjct  20    SASLEFGFYNKTCPSAETIVQQTVAAAFTNNSGVAPALLRMHFHDCFVRGCDGSVLIDST  79

Query  953   SGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEF  774
             +   + EK +  N  ++R F+++DR K  +E  CPGVVSCADIL F+ARD++VL+G   +
Sbjct  80    ANN-KAEKDSIPNSPSLRFFDVVDRAKASLEARCPGVVSCADILAFAARDSVVLTGGLGY  138

Query  773   EVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCS  594
             +VP GRRDG +S    A   L  P F   Q+V  F SK L +ED+V L GAH+IGV+HCS
Sbjct  139   KVPSGRRDGRISNATQALNELPPPFFNATQLVDNFASKNLSLEDMVVLSGAHTIGVSHCS  198

Query  593   NFRYRLNTPARAKEVDGSLKVVMGTHCRNAA------TTIPMDSTTQYKMDSMFYKQLLQ  432
             +F    NT  R     GS     G+ C + +      TT  MD  T  K D+ +Y  L  
Sbjct  199   SFAGINNTGDRLYNFSGSSD---GSICPSNSGRFFPNTTTFMDLITPAKFDNKYYVGLTN  255

Query  431   KKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCR  252
               GL ESD  L  +     LV+ F   +A W  KF +S++KMG+I VLTG +GEIR+ CR
Sbjct  256   NLGLFESDAALLTNATMKALVDSFVRSEATWKTKFAKSMLKMGQIEVLTGTQGEIRRNCR  315

Query  251   FVN  243
              +N
Sbjct  316   VIN  318



>gb|KCW52189.1| hypothetical protein EUGRSUZ_J01618, partial [Eucalyptus grandis]
Length=313

 Score =   259 bits (662),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 131/301 (44%), Positives = 186/301 (62%), Gaps = 9/301 (3%)
 Frame = -1

Query  1133  TAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDAT  954
             +A ++VGFY  TCP+AE +V+  + KA   +PG+ A ++R+  HDC V GCD S+LLD+T
Sbjct  12    SATLQVGFYRSTCPSAESVVRKAVNKAVAKNPGIGAGLIRMHFHDCFVRGCDASILLDST  71

Query  953   SGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEF  774
              G    EK+ P+N  ++RGFE+ID  K E+E  CP  VSCADIL F+ARD+    G   +
Sbjct  72    PGNPS-EKEHPANNPSLRGFEVIDEAKAELESLCPQKVSCADILAFAARDSAYKLGSINY  130

Query  773   EVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCS  594
              VP GRRDG VS + +  +NL    F   Q+ A F SKGL ++++V L GAHSIGV+HCS
Sbjct  131   AVPAGRRDGLVSLKDEPSQNLPPFFFNAQQLEANFASKGLSLDEMVTLSGAHSIGVSHCS  190

Query  593   NFRYRLN----TPARAKEVDGSLKVVMGTHCRN----AATTIPMDSTTQYKMDSMFYKQL  438
             +F  RL     T  +   +D  L   + + C N    +  T+P+D  T  ++D+ +Y  L
Sbjct  191   SFSDRLYSFNATHTQDPSMDTKLASQLKSKCPNNGGASDPTVPLDLVTPNRLDNKYYTNL  250

Query  437   LQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKK  258
                +GLL SD+ L   P T  +V   A++  AW  KF  +++KMG I +LTG+EGEIR+K
Sbjct  251   KNHRGLLTSDQTLFNSPSTANIVRSNANNGGAWANKFAAAMVKMGSIDILTGNEGEIRRK  310

Query  257   C  255
             C
Sbjct  311   C  311



>ref|XP_007153060.1| hypothetical protein PHAVU_003G003200g [Phaseolus vulgaris]
 gb|ESW25054.1| hypothetical protein PHAVU_003G003200g [Phaseolus vulgaris]
Length=331

 Score =   259 bits (663),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 131/305 (43%), Positives = 188/305 (62%), Gaps = 8/305 (3%)
 Frame = -1

Query  1133  TAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDAT  954
             +A ++VGFY  TCP+AEEIV+  + K    +PG+AA ++R+  HDC V GC+GSVLL +T
Sbjct  27    SASLKVGFYASTCPSAEEIVRTAVNKGVSQNPGIAAGLIRMHFHDCFVRGCEGSVLLAST  86

Query  953   SGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEF  774
              G    E+   +N  ++RGFE+I+  K ++E +CP  VSCADIL F+ARD+ +  G   +
Sbjct  87    PGNPIAERDHFANNPSLRGFEVIEEAKIQLEAACPETVSCADILAFAARDSALKVGGITY  146

Query  773   EVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCS  594
             +VP GRRDG VS   +  +NL  P   VD++V  F  KGL  +++V L GAHSIGV+HCS
Sbjct  147   DVPSGRRDGRVSVADEVGQNLPGPTSNVDELVNRFAQKGLSADEMVTLSGAHSIGVSHCS  206

Query  593   NFRYRL----NTPARAKEVDGSLKVVMGTHC----RNAATTIPMDSTTQYKMDSMFYKQL  438
              F  RL    +T  +   +D S    + T C      +  T+  D +T  ++DS +Y+ L
Sbjct  207   AFSKRLYSFNDTFKQDPSMDSSYAETLKTQCPAPPATSDPTVSFDPSTPLRLDSKYYEGL  266

Query  437   LQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKK  258
             +  +GLL SD+ L     T  +V   A++ A+W  KF  +++KMG I VLTG+ GEIRK 
Sbjct  267   IGHRGLLTSDQTLFATQSTREMVVSNANNGASWSEKFARAMVKMGSIEVLTGNSGEIRKH  326

Query  257   CRFVN  243
             C FVN
Sbjct  327   CSFVN  331



>ref|XP_010455535.1| PREDICTED: peroxidase 39-like [Camelina sativa]
Length=326

 Score =   259 bits (661),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 130/307 (42%), Positives = 193/307 (63%), Gaps = 10/307 (3%)
 Frame = -1

Query  1136  TTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDA  957
             + A +++GFYG+TCP AE+IV++ + +  ++ P +AA ++R+  HDC V GCDGS+L++A
Sbjct  21    SEAQLKMGFYGKTCPNAEKIVQDVVNQHINNAPSLAAGLIRMHFHDCFVRGCDGSILINA  80

Query  956   TSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPE  777
             TS   +VEK AP N  TVRGF+ ID++K  +E  CPG+VSCADI+T + RD++V  G P 
Sbjct  81    TSSNQQVEKLAPPN-LTVRGFDFIDKVKSALESKCPGIVSCADIITLATRDSIVAIGGPT  139

Query  776   FEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHC  597
             + VP GRRDG +S   +AR N+  P      ++ LF ++GLDV+DLV L GAH+IGV+HC
Sbjct  140   WNVPTGRRDGRISNFAEARNNIPPPFGNFTTLITLFANQGLDVKDLVLLSGAHTIGVSHC  199

Query  596   SNFRYRL--------NTPARAKEVDGSLKVVMGTHCRNAATTIPMDSTTQYKMDSMFYKQ  441
             S+F  RL          P+   E   +LK        +  T + MD  ++   D  ++K 
Sbjct  200   SSFSNRLFNFTGVGDEDPSLDSEYAANLKSRRCLSLADNTTKVEMDPGSRNTFDLSYFKL  259

Query  440   LLQKKGLLESDERLAGDPRTLPLVEEFA-DDQAAWLGKFTESVIKMGKIRVLTGDEGEIR  264
             +L+++GL ESD  L  +P  L  V  FA   +  +  +F++++ KMG+I V TG  GEIR
Sbjct  260   VLKRRGLFESDAALTMNPAALAQVRRFAGGSEQDFFSEFSKAMEKMGRIGVKTGSAGEIR  319

Query  263   KKCRFVN  243
             + C FVN
Sbjct  320   RTCAFVN  326



>ref|XP_006650985.1| PREDICTED: peroxidase 5-like [Oryza brachyantha]
Length=336

 Score =   259 bits (662),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 128/305 (42%), Positives = 185/305 (61%), Gaps = 12/305 (4%)
 Frame = -1

Query  1124  MRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSGG  945
             +R GFY  TCP AE IV+  + +A + + G+AA +VR+  HDC V GCDGSVLL++T   
Sbjct  33    LRPGFYAATCPQAETIVRQEVARALYANAGLAAGLVRMHFHDCFVRGCDGSVLLESTPDS  92

Query  944   GRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEVP  765
                E+ +P N  ++RGFE+ID  K  +E +CPGVVSCAD+L ++ARD++ L+G P ++VP
Sbjct  93    A-AERDSPINNPSLRGFEVIDSAKVRLEAACPGVVSCADVLAYAARDSVALTGGPRYDVP  151

Query  764   GGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNFR  585
             GGRRDG VS E +   N+ +P FT+D++   F +KGL  E++V L GAH+IG AHC++F 
Sbjct  152   GGRRDGTVSLESEVADNIPAPTFTLDELTRSFAAKGLTQEEMVTLSGAHTIGRAHCTSFS  211

Query  584   YRLNTPARAKEVDGSLKVVMGTHCR-----------NAATTIPMDSTTQYKMDSMFYKQL  438
              RL   +     D S+     +  R           +A   +PM+  T    D+++Y  +
Sbjct  212   DRLYNFSAMGAADPSVAPAFLSQLRRACPAGPDGAVDANLAVPMEPRTPNGFDALYYWAV  271

Query  437   LQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKK  258
             L+ +GL  SD+ L   P T   V + A     W  KF  +++KMG++ VLTG  GEIR K
Sbjct  272   LRNRGLFTSDQALLSSPPTAAQVRQSAYGGYPWKLKFAAAMVKMGQVEVLTGSSGEIRTK  331

Query  257   CRFVN  243
             C  VN
Sbjct  332   CAAVN  336



>ref|XP_003534685.2| PREDICTED: peroxidase 5-like [Glycine max]
Length=328

 Score =   259 bits (661),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/301 (42%), Positives = 190/301 (63%), Gaps = 8/301 (3%)
 Frame = -1

Query  1121  RVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSGGG  942
             +VGFY  TCP+AEEIV++ + KA  D  G+AA ++R+  HDC V GCDGSVLL +T G  
Sbjct  28    KVGFYSSTCPSAEEIVRSTVNKAISDKAGIAAGLIRMHFHDCFVRGCDGSVLLASTPGNP  87

Query  941   RVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEVPG  762
               E+   +N  ++RGFE+I+  K ++E +CP  VSCADIL F+ARD+ +  G   ++VP 
Sbjct  88    VAERDNFANNPSLRGFEVIEEAKTQLEAACPQTVSCADILAFAARDSALKVGGINYDVPS  147

Query  761   GRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNFRY  582
             GRRDG +S   +  +NL +P  T D++V+ F  KGL  +++V L GAHSIGV+HCS F  
Sbjct  148   GRRDGRISIADEVPRNLPAPTSTADELVSNFSRKGLSADEMVTLSGAHSIGVSHCSAFSK  207

Query  581   RL----NTPARAKEVDGSLKVVMGTHC----RNAATTIPMDSTTQYKMDSMFYKQLLQKK  426
             RL    +T  +   +D S    + + C        +T+ +D +T  ++D+ +Y+ L+  +
Sbjct  208   RLYSFNDTVTQDPSMDSSYAETLKSICPAPPSTTDSTVSLDPSTPIRLDNKYYEGLINHR  267

Query  425   GLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRFV  246
             GLL SD+ L     T  +V+  A++ A+W  KF +++++MG I VLTG +GEIR+ C  V
Sbjct  268   GLLTSDQTLHTSQTTREMVQSNANNGASWAEKFAKAMVQMGSIEVLTGSDGEIRRHCSLV  327

Query  245   N  243
             N
Sbjct  328   N  328



>ref|XP_004977105.1| PREDICTED: peroxidase 1-like [Setaria italica]
Length=362

 Score =   259 bits (663),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 140/309 (45%), Positives = 184/309 (60%), Gaps = 18/309 (6%)
 Frame = -1

Query  1115  GFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSG-GGR  939
             GFY R CP AE IV+  +  AF ++ GVA A++RL  HDC V GCDGSVL+D+T+     
Sbjct  27    GFYDRMCPAAETIVQQTVADAFRNNSGVAPALIRLHFHDCFVRGCDGSVLIDSTTNPNNT  86

Query  938   VEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEVPGG  759
              EK AP N  ++R F++IDR K  +E  CPGVVSCADIL F+ARD++VLSG   +++P G
Sbjct  87    AEKDAPPNNPSLRFFDVIDRAKAAVEAQCPGVVSCADILAFAARDSVVLSGGLGYQLPAG  146

Query  758   RRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNFR--  585
             RRDG +SR+ DA  +L  P F   Q+   F SK L VEDLV L GAH+IGV+HCS+F   
Sbjct  147   RRDGRISRDTDALNDLPPPFFNATQLADSFASKNLTVEDLVVLSGAHTIGVSHCSSFAGV  206

Query  584   --------YRLNT-----PARAKEVDGSLKVVMGTHCRN--AATTIPMDSTTQYKMDSMF  450
                     Y  ++     PA +K     LK +  ++       TT  MD  T  K+D+ +
Sbjct  207   PDNPADRLYNFSSPEKIDPALSKAYAFLLKSICPSNSSQFFPTTTTLMDLITPDKLDNKY  266

Query  449   YKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGE  270
             Y  L    GL  SD  L  +     LV+ F   +A W  KF  S++KMG+I VLTG +GE
Sbjct  267   YVGLTNNLGLFISDAALLTNATMKALVDSFVRSEATWKAKFARSMLKMGQIGVLTGTQGE  326

Query  269   IRKKCRFVN  243
             IR+ CR VN
Sbjct  327   IRRNCRVVN  335



>ref|XP_010032733.1| PREDICTED: peroxidase 5-like [Eucalyptus grandis]
Length=326

 Score =   258 bits (660),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 131/305 (43%), Positives = 188/305 (62%), Gaps = 9/305 (3%)
 Frame = -1

Query  1133  TAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDAT  954
             +A ++VGFY  TCP+AE +V+  + KA   + G+ A ++R+  HDC V GCD S+LLD+T
Sbjct  23    SATLQVGFYRSTCPSAESVVRKAVNKAVAKNSGIGAGLIRMHFHDCFVRGCDASILLDST  82

Query  953   SGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEF  774
              G    EK+ P+N  ++RGFE+ID  K E+E  CP  VSCADIL F+ARD+    G   +
Sbjct  83    PGNPS-EKEHPANNPSLRGFEVIDEAKAELESLCPQKVSCADILAFAARDSAYKLGSINY  141

Query  773   EVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCS  594
              VP GRRDG VS + +  ++L    F   Q+ A F  KGL ++++V L GAHSIGV+HCS
Sbjct  142   AVPAGRRDGLVSLKDEPSQDLPPFFFNAQQLEANFARKGLSLDEMVTLSGAHSIGVSHCS  201

Query  593   NFRYRLN----TPARAKEVDGSLKVVMGTHCRN----AATTIPMDSTTQYKMDSMFYKQL  438
             +F  RL     T  +   +D  L   + + C N    +  T+P+D  T  ++D+ +Y  L
Sbjct  202   SFSNRLYSFNATHTQDPSMDTKLATQLKSKCPNNGGASDPTVPLDLVTPNRLDNKYYTNL  261

Query  437   LQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKK  258
               ++GLL SD+ L+  P T  +V   A++  AW  KF  +++KMG I VLTG+EGEIR+K
Sbjct  262   KNRRGLLTSDQTLSNSPSTANIVRSNANNGGAWANKFAAAMVKMGSIDVLTGNEGEIRRK  321

Query  257   CRFVN  243
             C  VN
Sbjct  322   CMVVN  326



>gb|KHN30703.1| Peroxidase 5 [Glycine soja]
Length=328

 Score =   258 bits (660),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/301 (41%), Positives = 192/301 (64%), Gaps = 8/301 (3%)
 Frame = -1

Query  1121  RVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSGGG  942
             +VGFY  TCP+AEEIV++ + KA  D+ G+AA ++R+  HDC V GCDGSVLL +T G  
Sbjct  28    KVGFYSSTCPSAEEIVRSTVNKAISDNAGIAAGLIRMHFHDCFVRGCDGSVLLASTPGNP  87

Query  941   RVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEVPG  762
               E+   +N  ++RGFE+I+  K ++E +CP  VSCADIL F+ARD+ +  G   ++VP 
Sbjct  88    VAERDHFANNPSLRGFEVIEEAKTQLEAACPQTVSCADILAFAARDSALKVGGINYDVPS  147

Query  761   GRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNFRY  582
             GRRDG +S   +  +NL +P  +  ++V+ F  KGL  +++V L GAHSIGV+HCS F  
Sbjct  148   GRRDGRISIADEVPRNLPAPTSSAHELVSNFSRKGLSADEMVTLSGAHSIGVSHCSAFSK  207

Query  581   RL----NTPARAKEVDGSLKVVMGTHC----RNAATTIPMDSTTQYKMDSMFYKQLLQKK  426
             RL    +T  +   +D S    + ++C        +T+ +D +T  ++D+ +Y+ L+  +
Sbjct  208   RLYSFNDTVTQDPSMDSSYAETLKSNCPAPPSTTDSTVSLDPSTPIRLDNKYYEGLINHR  267

Query  425   GLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRFV  246
             GLL SD+ L     T  +V+  A++ A+W  KF +++++MG I VLTG +GEIR++C  V
Sbjct  268   GLLTSDQTLYTSQTTREMVQSNANNGASWAEKFAKAMVQMGSIEVLTGSDGEIRRRCSLV  327

Query  245   N  243
             N
Sbjct  328   N  328



>ref|XP_010435105.1| PREDICTED: peroxidase 39 [Camelina sativa]
Length=326

 Score =   258 bits (659),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 131/305 (43%), Positives = 192/305 (63%), Gaps = 10/305 (3%)
 Frame = -1

Query  1130  AGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATS  951
             A +++GFY +TCPTAE+IV++ + +  ++ P +AA ++R+  HDC V GCDGS+L++ATS
Sbjct  23    AQLKMGFYDKTCPTAEKIVQDVVNQHINNAPSLAAGLIRMHFHDCFVLGCDGSILINATS  82

Query  950   GGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFE  771
                +VEK AP N  TVRGF+ ID++K  +E  CPG+VSCADI+T + RD++V  G P + 
Sbjct  83    SNQQVEKLAPPN-LTVRGFDFIDKVKSALESKCPGIVSCADIITLATRDSIVAIGGPTWN  141

Query  770   VPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSN  591
             VP GRRDG +S   +AR N+  P      ++ LF ++GLDV+DLV L GAH+IGV+HCS+
Sbjct  142   VPTGRRDGRISNFAEARDNIPPPFGNFTTLITLFANQGLDVKDLVLLSGAHTIGVSHCSS  201

Query  590   FRYRL--------NTPARAKEVDGSLKVVMGTHCRNAATTIPMDSTTQYKMDSMFYKQLL  435
             F  RL          P+   E   +LK        +  T + MD  ++   D  ++K +L
Sbjct  202   FSNRLFNFTGVGDQDPSLDSEYADNLKSRRCLSLADNTTKVEMDPGSRNTFDLSYFKLVL  261

Query  434   QKKGLLESDERLAGDPRTLPLVEEFA-DDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKK  258
             +++GL ESD  L  +P  L  V  FA   +  +  +F++S+ KMG+I V TG  GEIR+ 
Sbjct  262   KRRGLFESDAALTMNPAALAQVRRFAGGSEQDFFSEFSKSMEKMGRIGVKTGSAGEIRRT  321

Query  257   CRFVN  243
             C FVN
Sbjct  322   CAFVN  326



>ref|XP_010032731.1| PREDICTED: peroxidase 5-like [Eucalyptus grandis]
Length=327

 Score =   258 bits (659),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 127/305 (42%), Positives = 187/305 (61%), Gaps = 9/305 (3%)
 Frame = -1

Query  1133  TAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDAT  954
             +A ++VGFY  TCP+ E +V+  + KA   +PG+ A ++R+  HDC V GCD S+LLD+T
Sbjct  24    SATLQVGFYHSTCPSVESVVRKAVNKAVARNPGIGAGLIRMHFHDCFVRGCDASILLDST  83

Query  953   SGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEF  774
              G    EK+ P+N  ++RG+E+ID  K E+E  CP  VSCADIL F+ARD+    G   +
Sbjct  84    PGN-PAEKEHPANNPSLRGYEVIDEAKAELEYLCPQTVSCADILAFAARDSTYKLGSINY  142

Query  773   EVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCS  594
              VP GRRDG VS   +  +NL  P     Q+ A F  KGL ++++V L GAHS+GV+HCS
Sbjct  143   AVPAGRRDGLVSLRDEPSQNLPPPSLDAQQLEANFARKGLSLDEMVTLSGAHSVGVSHCS  202

Query  593   NFRYRLNTPARAKEVDGSLKVVMGTH----CRN----AATTIPMDSTTQYKMDSMFYKQL  438
             +F  RL++     + D S++  M +     C N    +  T+P+D  T  ++D+ +Y  L
Sbjct  203   SFSTRLSSFNATHKQDPSMEPRMASELKAKCLNNGGASDPTVPLDFATPNRLDNKYYTNL  262

Query  437   LQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKK  258
                +G+L SD+ L   P T  +V + A+   AW  KF  +++KMG I +LTG++GEIR+ 
Sbjct  263   KDHRGVLTSDQTLFDSPSTAYIVRKHANHGGAWANKFAAAMVKMGSIDILTGNQGEIRRN  322

Query  257   CRFVN  243
             CR VN
Sbjct  323   CRVVN  327



>emb|CAC21393.1| peroxidase [Zea mays]
Length=357

 Score =   259 bits (661),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 139/319 (44%), Positives = 188/319 (59%), Gaps = 20/319 (6%)
 Frame = -1

Query  1142  AETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLL  963
             + T A + VGFY RTCPTAE IV+  +  AF ++ GVA A++R+  HDC V GCDGSVL+
Sbjct  18    SATAACLDVGFYDRTCPTAETIVQQTVAAAFRNNSGVAPALIRMHFHDCFVRGCDGSVLI  77

Query  962   DATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGV  783
             D T G    EK AP N  ++R F+++DR K  +E  CPGVVSCAD+L F+ARD++VLSG 
Sbjct  78    D-TVGNLTAEKDAPPNNPSLRFFDVVDRAKASLEAQCPGVVSCADVLAFAARDSVVLSGG  136

Query  782   PEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVA  603
               ++VPGGRRDG +S + +A  NL  P F   ++   F SK L +EDLV L GAH+IGV+
Sbjct  137   LGYQVPGGRRDGRISNDTEALNNLPPPFFNATELADRFASKNLTIEDLVVLSGAHTIGVS  196

Query  602   HCSNFR------------YRLNT-----PARAKEVDGSLKVVMGTHCRN--AATTIPMDS  480
             HCS F             Y  ++     P  +K     LK +   +       TT+ MD 
Sbjct  197   HCSGFAGPTDLNGPVDRLYNFSSPDGIDPTLSKAYAFLLKSICPANTSQFFPNTTVFMDL  256

Query  479   TTQYKMDSMFYKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGK  300
              T  + D+ +Y  L    GL +SD  L  +     LV+ F   +A +  KF  S+IKMG+
Sbjct  257   ITPERFDNKYYVGLTNNLGLFKSDVALLTNATMKALVDSFVRSEATFRTKFARSMIKMGQ  316

Query  299   IRVLTGDEGEIRKKCRFVN  243
             I VLTG +GEIR+ CR +N
Sbjct  317   IEVLTGTQGEIRRNCRVIN  335



>ref|XP_003536264.1| PREDICTED: peroxidase 5-like [Glycine max]
Length=328

 Score =   258 bits (659),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 125/301 (42%), Positives = 192/301 (64%), Gaps = 8/301 (3%)
 Frame = -1

Query  1121  RVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSGGG  942
             +VGFY  TCP+AEEIV++ + KA  D+ G+AA ++R+  HDC V GCDGSVLL +T G  
Sbjct  28    KVGFYSSTCPSAEEIVRSTVNKAISDNAGIAAGLIRMHFHDCFVRGCDGSVLLASTPGNP  87

Query  941   RVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEVPG  762
               E+   +N  ++RGFE+I+  K ++E +CP  VSCADIL F+ARD+ +  G   ++VP 
Sbjct  88    VAERDHFANNPSLRGFEVIEEAKTQLEAACPQTVSCADILAFAARDSALKVGGINYDVPS  147

Query  761   GRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNFRY  582
             GRRDG +S   +  +NL +P  +  ++V+ F  KGL  +++V L GAHSIGV+HCS F  
Sbjct  148   GRRDGRISIADEVPRNLPAPTSSAHELVSNFSRKGLSADEMVTLSGAHSIGVSHCSAFSK  207

Query  581   RL----NTPARAKEVDGSLKVVMGTHCRNAATTI----PMDSTTQYKMDSMFYKQLLQKK  426
             RL    +T  +   +D S    + ++C    +TI     +D +T  ++D+ +Y+ L+  +
Sbjct  208   RLYSFNDTVTQDPSMDSSYAETLKSNCPAPPSTIDSTVSLDPSTPIRLDNKYYEGLINHR  267

Query  425   GLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRFV  246
             GLL SD+ L     T  +V+  A++ A+W  KF +++++MG I VLTG +GEIR++C  V
Sbjct  268   GLLTSDQTLYTSQTTREMVQSNANNGASWAEKFAKAMVQMGSIEVLTGSDGEIRRRCSLV  327

Query  245   N  243
             N
Sbjct  328   N  328



>ref|XP_004300922.1| PREDICTED: peroxidase 57-like [Fragaria vesca subsp. vesca]
Length=469

 Score =   262 bits (670),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 131/306 (43%), Positives = 187/306 (61%), Gaps = 12/306 (4%)
 Frame = -1

Query  1127  GMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSG  948
             G+ +GFY +TCP  E +V + + +    DP +  A++RL  HDC V GCD S+LLDAT  
Sbjct  164   GLSLGFYAKTCPKVENVVADVVKRVSQRDPKLPPALIRLLFHDCWVKGCDASILLDATPS  223

Query  947   GGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEV  768
             G  VEK +  NG+T+RG E+ID IK ++E+ CP  VSCADIL F+AR+A++L+G+P ++V
Sbjct  224   GQAVEKLSDRNGRTLRGLEVIDEIKTQLEKECPRTVSCADILAFAAREAVILAGLPRYDV  283

Query  767   PGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNF  588
               GRRD + SR  DA ++L +P   + +++ +F  +G   ED+V L GAHSIG A C   
Sbjct  284   VAGRRDSSTSRAIDADESLPTPKDDLKKIIGMFNQRGFSPEDMVVLSGAHSIGAAQCGQV  343

Query  587   RYRL-----NTPARAKEVDGSLKVVMGTHCRNAATTIP------MDSTTQYKMDSMFYKQ  441
             R RL     N P R   +D +    +   C       P      +D TT  K+D+ +Y  
Sbjct  344   RDRLYAFAPNVP-RDPAIDPAYAADLTKKCPAQPPPGPELFMVDLDPTTPLKLDNQYYLN  402

Query  440   LLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRK  261
             L +K+GLL+SD+ LA DP T+  V + A D A W  KF  ++ ++GK+ VLTGDEG+IR 
Sbjct  403   LQKKRGLLQSDQVLATDPGTVGFVNQLAGDNAGWSRKFVNAMERLGKVSVLTGDEGQIRL  462

Query  260   KCRFVN  243
              CR  N
Sbjct  463   NCRAFN  468



>ref|XP_007161518.1| hypothetical protein PHAVU_001G076000g [Phaseolus vulgaris]
 gb|ESW33512.1| hypothetical protein PHAVU_001G076000g [Phaseolus vulgaris]
Length=331

 Score =   258 bits (658),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 129/301 (43%), Positives = 190/301 (63%), Gaps = 8/301 (3%)
 Frame = -1

Query  1121  RVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSGGG  942
             +VGFY  TCP+AEEIV++ + K   ++ G+AA ++R+  HDC V GC+GSVLL +T G  
Sbjct  31    KVGFYTSTCPSAEEIVRSAVNKGISENSGIAAGLIRMHFHDCFVRGCEGSVLLASTPGNP  90

Query  941   RVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEVPG  762
               E+   +N  ++RGFE+I+  K ++E +CPG VSCADIL F+ARD+ +  G   ++VP 
Sbjct  91    IAERDHFANNPSLRGFEVIEEAKIQLEAACPGTVSCADILAFAARDSALKVGGINYDVPS  150

Query  761   GRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNFRY  582
             GRRDG VS   +  +NL +P   VD++V+ F+ KGL  +++V L GAHSIGV+HCS F  
Sbjct  151   GRRDGRVSIADEVAQNLPAPTSNVDELVSRFEQKGLSADEMVTLSGAHSIGVSHCSTFSK  210

Query  581   RL----NTPARAKEVDGSLKVVMGTHC----RNAATTIPMDSTTQYKMDSMFYKQLLQKK  426
             RL    +T  +   +D S    + T C      +  T+ +D +T  ++D+ +Y+ L+  +
Sbjct  211   RLYSFNDTFKQDPSMDSSYAETLKTKCPAPPPTSDPTLSLDPSTPVRLDNKYYEGLINHR  270

Query  425   GLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRFV  246
             GLL SD+ L     T  +V   AD+ A W  KF +++++MG I VLTG  GEIRK C FV
Sbjct  271   GLLTSDQTLFTTQSTREMVVSNADNGANWSEKFAKAMVQMGSIEVLTGSSGEIRKHCSFV  330

Query  245   N  243
             N
Sbjct  331   N  331



>ref|XP_011043754.1| PREDICTED: peroxidase 5-like [Populus euphratica]
Length=329

 Score =   258 bits (658),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 134/302 (44%), Positives = 183/302 (61%), Gaps = 9/302 (3%)
 Frame = -1

Query  1124  MRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSGG  945
             ++VGFY  +C  AE IV+  +  A   D GVAA +VRL  HDC V GC+GSVLLD+TS  
Sbjct  28    LQVGFYRNSCRRAESIVRGAVRDALRQDRGVAAGLVRLHFHDCFVRGCEGSVLLDSTSSN  87

Query  944   GRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEVP  765
              + EK +P+N  ++RGFE+ID  K  +E  C GVVSCADIL F+ARD+  L+G  +++VP
Sbjct  88    -KAEKDSPANFPSLRGFEVIDDAKARLEAECKGVVSCADILAFAARDSFDLTGGLDYDVP  146

Query  764   GGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNFR  585
              GRRDG VS   +   NL  P+F VDQ+   F  KGL  E++V L GAH+IG +HCS F 
Sbjct  147   AGRRDGIVSLASETFSNLPPPNFNVDQLTRRFSDKGLTQEEMVTLSGAHTIGTSHCSAFT  206

Query  584   YRL----NTPARAKEVDGSLKVVMGTHCRNAAT----TIPMDSTTQYKMDSMFYKQLLQK  429
             YRL     T ++   +D      +   C   +T     +PMD+ T    D  +YK +L  
Sbjct  207   YRLYNFSGTNSQDPSLDSQYAASLRKSCPQDSTDPNLEVPMDTRTPTISDVNYYKDILAN  266

Query  428   KGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRF  249
             +GL  SD+ L  +P T   V+  A   + W  KF  +++KMG+I VLTG++GEIR  CR 
Sbjct  267   RGLFSSDQILLTNPATASEVKSNARSPSGWKRKFAAAMVKMGQIEVLTGNKGEIRANCRV  326

Query  248   VN  243
             +N
Sbjct  327   IN  328



>ref|XP_006367225.1| PREDICTED: peroxidase 44-like [Solanum tuberosum]
Length=322

 Score =   257 bits (657),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 123/294 (42%), Positives = 183/294 (62%), Gaps = 5/294 (2%)
 Frame = -1

Query  1124  MRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSGG  945
             ++VGFY  TCP  E IV+  +   F+ DP + AA++R+  HDC V GCD S+L+ +  G 
Sbjct  25    LQVGFYNTTCPQTETIVRQAVQNQFNSDPSITAALLRMHFHDCFVRGCDASILIKSI-GS  83

Query  944   GRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEVP  765
              + E++A  N KTVRGFELID+IK+ +E +CP  VSCADI+T + RD++ L+G P + +P
Sbjct  84    KKSEREAGPN-KTVRGFELIDKIKKTLETTCPSTVSCADIITLATRDSVALAGGPNYPIP  142

Query  764   GGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNFR  585
              GRRDG +S   D   NL  P  T+ Q +  F +KGL + D+V LLGAH++G+AHC+ F+
Sbjct  143   TGRRDGLISNAADV--NLPGPSLTIPQALQFFTNKGLTLNDMVTLLGAHTVGIAHCNFFQ  200

Query  584   YRLNTPARAKEVDGSLKVVMGTHCRNAATTIPMDSTTQYKMDSMFYKQLLQKKGLLESDE  405
              RL +P   K +D +L   +   C  ++ T  +D  T + +D+ +Y+Q+  +KG+L  D+
Sbjct  201   DRL-SPVPDKTMDPTLAAQLLKTCAKSSATAFLDQNTSFTVDNEYYRQITLRKGILTIDQ  259

Query  404   RLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRFVN  243
              L  D  + P+V  FA ++  +   F  ++IKM  I VL G  GEIRK C   N
Sbjct  260   ELTLDKSSAPIVTSFAANKDVFSQSFANAMIKMANIDVLVGSAGEIRKNCGVFN  313



>ref|XP_006288205.1| hypothetical protein CARUB_v10001445mg [Capsella rubella]
 gb|EOA21103.1| hypothetical protein CARUB_v10001445mg [Capsella rubella]
Length=326

 Score =   257 bits (657),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 130/307 (42%), Positives = 192/307 (63%), Gaps = 10/307 (3%)
 Frame = -1

Query  1136  TTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDA  957
             + A +++GFY +TCP AE+IV++ + +  H+ P +AA ++R+  HDC V GCDGS+L++A
Sbjct  21    SEAQLKMGFYDKTCPYAEKIVQDVVNQHIHNAPSLAAGLIRMHFHDCFVRGCDGSILINA  80

Query  956   TSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPE  777
             TS   +VEK AP N  TVRGF+ ID++K  +E  CPG+VSCADI+T + RD++V  G P 
Sbjct  81    TSRNQQVEKLAPPN-LTVRGFDFIDKVKSALESKCPGIVSCADIITLATRDSIVAIGGPT  139

Query  776   FEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHC  597
             + VP GRRDG +S   +AR N+  P      ++ LF ++GLDV+DLV L GAH+IGV+HC
Sbjct  140   WNVPTGRRDGRISNFIEARNNIPPPFGNFTTLITLFGNQGLDVKDLVLLSGAHTIGVSHC  199

Query  596   SNFRYRL--------NTPARAKEVDGSLKVVMGTHCRNAATTIPMDSTTQYKMDSMFYKQ  441
             S+F  RL          P+   E   +LK        +  T + MD  ++   D  +++ 
Sbjct  200   SSFSKRLFNFTGVGDQDPSLDSEYAANLKSRRCLSIADNTTKVEMDPGSRNTFDLSYFRL  259

Query  440   LLQKKGLLESDERLAGDPRTLPLVEEFA-DDQAAWLGKFTESVIKMGKIRVLTGDEGEIR  264
             +L+++GL ESD  L  DP  L  V  FA   +  +  +F +++ KMG+I V TG +GEIR
Sbjct  260   VLKRRGLFESDAALTMDPAALAQVRRFAGGSEQEFFAEFAKAMEKMGRIGVKTGSDGEIR  319

Query  263   KKCRFVN  243
             + C FVN
Sbjct  320   RTCAFVN  326



>ref|XP_010485714.1| PREDICTED: peroxidase 28-like isoform X1 [Camelina sativa]
 ref|XP_010485715.1| PREDICTED: peroxidase 28-like isoform X2 [Camelina sativa]
Length=319

 Score =   257 bits (656),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 132/300 (44%), Positives = 184/300 (61%), Gaps = 5/300 (2%)
 Frame = -1

Query  1130  AGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATS  951
             A +R GFY ++CP AE IV+N + + F  DP + AA+ R+  HDC V GCD S+L+D T+
Sbjct  21    AQLRFGFYSQSCPNAETIVQNLVRQRFGRDPSITAALTRMHFHDCFVQGCDASLLIDPTT  80

Query  950   GGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFE  771
                  EK A  NG +VRGFELID IK  +E  CP  VSC+DI+T +ARD+++L G P + 
Sbjct  81    NQPSPEKTAGPNG-SVRGFELIDEIKTALEAQCPSTVSCSDIITLAARDSVLLGGGPSYL  139

Query  770   VPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSN  591
             VP GRRDG VS   DA + L  P  +V  M+  F +KG+DV D VALLGAH++GVA C N
Sbjct  140   VPTGRRDGFVSNLADAEQILPGPGISVAGMLGFFGNKGMDVFDAVALLGAHTVGVASCGN  199

Query  590   FRYRLN----TPARAKEVDGSLKVVMGTHCRNAATTIPMDSTTQYKMDSMFYKQLLQKKG  423
             F  R+     T      +D SL   +   C        +D +T +  D++F+ QL Q+KG
Sbjct  200   FGDRVTNFQGTGQPDPTMDPSLVASLRNTCAAPGGFAALDQSTPFSFDNLFFSQLRQRKG  259

Query  422   LLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRFVN  243
             +L  D+R+A DP T  +V ++A +   +  +F  +++KMG + VLTG  GEIR+ CR  N
Sbjct  260   ILFIDQRIATDPATSDVVSQYAANNELFQRQFEIAMVKMGAVDVLTGLAGEIRRNCRAFN  319



>ref|NP_001140982.1| uncharacterized protein LOC100273061 precursor [Zea mays]
 gb|ACF85102.1| unknown [Zea mays]
 gb|ACG36710.1| peroxidase 1 precursor [Zea mays]
Length=362

 Score =   258 bits (660),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 136/312 (44%), Positives = 188/312 (60%), Gaps = 12/312 (4%)
 Frame = -1

Query  1145  AAETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVL  966
             A  T AG++VGFY +TCP+AE +V+  +  AF ++ G+AA ++RL  HDC V GCDGSVL
Sbjct  25    AGATGAGLKVGFYSKTCPSAESLVQQAVAAAFKNNSGIAAGLIRLHFHDCFVRGCDGSVL  84

Query  965   LDATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSG  786
             +D+T+     EK A  N  ++RGFE+ID  K+ +E  CP  VSCADIL F+ARD++ L+G
Sbjct  85    IDSTA-NNTAEKDAVPNNPSLRGFEVIDAAKKAVEARCPKTVSCADILAFAARDSIALAG  143

Query  785   VP-EFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIG  609
                 ++VP GRRDG VSR+ DA  NL SP  T  ++V  F  K L  ED+V L GAH++G
Sbjct  144   NNLTYKVPAGRRDGRVSRDTDANSNLPSPLSTAAELVGNFTRKNLTAEDMVVLSGAHTVG  203

Query  608   VAHCSNFRYRLNTPARAKEVDGSLKVVMGTHCR-----NAA-----TTIPMDSTTQYKMD  459
              +HCS+F  RL   + A +VD ++        R     N +     TT  MD  T   +D
Sbjct  204   RSHCSSFTNRLYGFSNASDVDPTISSAYALLLRAICPSNTSQFFPNTTTDMDLITPALLD  263

Query  458   SMFYKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGD  279
             + +Y  L    GL  SD+ L  +      V+ F   ++AW  KF +S++KMG I VLTG 
Sbjct  264   NRYYVGLANNLGLFTSDQALLTNATLKKSVDAFVKSESAWKTKFAKSMVKMGNIDVLTGT  323

Query  278   EGEIRKKCRFVN  243
             +GEIR  CR +N
Sbjct  324   KGEIRLNCRVIN  335



>ref|XP_009359340.1| PREDICTED: peroxidase 44-like [Pyrus x bretschneideri]
Length=336

 Score =   258 bits (658),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 141/305 (46%), Positives = 185/305 (61%), Gaps = 17/305 (6%)
 Frame = -1

Query  1127  GMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSG  948
             G+ VGFY R CP  E+IV + + KA   D  + AA++RL  HDC V GCD S+LLD T  
Sbjct  33    GLHVGFYNRKCPKLEKIVIDVVAKAVEKDRKLPAALIRLFFHDCFVKGCDASLLLDVTPS  92

Query  947   GGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEV  768
             G  VE  +P++   VRG E+ID+IK  +EQ CPG VSCADIL F++R+A+ LSG+P +EV
Sbjct  93    GEPVEMLSPASFG-VRGLEVIDQIKARVEQECPGTVSCADILAFASREAVALSGLPRYEV  151

Query  767   PGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNF  588
             P GRRD   SR  D    L SP   +D+++  F  KGL +E++VAL GAHSIG  HCS F
Sbjct  152   PAGRRDSRTSRASDV--ILPSPTTPLDELIDFFSRKGLSLEEMVALSGAHSIGTVHCSFF  209

Query  587   RYRLNTPARAKEVDGSLKVVMGTHCRN---AATTIPM----------DSTTQYKMDSMFY  447
              YR+   A  K  D SL  V          A  T+P           D TT   +D+ +Y
Sbjct  210   DYRMYNFAPGKPKDPSLNEVFAAQLAQQCPAPNTLPAEEAKKRFVDSDPTTPLVLDNHYY  269

Query  446   KQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEI  267
               L+Q +GL+ESD+ LA DPRT  +V + A    ++   F  ++IKMG+I VLT D+GEI
Sbjct  270   TSLMQGRGLMESDQVLAIDPRTRGVVAKLARSD-SFARAFANAMIKMGRINVLTEDQGEI  328

Query  266   RKKCR  252
             RK CR
Sbjct  329   RKNCR  333



>ref|XP_011037007.1| PREDICTED: peroxidase 3-like [Populus euphratica]
Length=325

 Score =   257 bits (656),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 129/311 (41%), Positives = 189/311 (61%), Gaps = 10/311 (3%)
 Frame = -1

Query  1151  AEAAETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGS  972
             A    T A +++GFY  +CP AE+IV+  + +  H+ P +AA ++R+  HDC V GCD S
Sbjct  16    AFIGSTEAQLKMGFYNTSCPKAEKIVQGFVNQHIHNAPSLAATLIRMHFHDCFVRGCDAS  75

Query  971   VLLDATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVL  792
             VLL+ TSG     ++A +   T+RGF+ IDR+K  +E  CPG+VSCADILT  ARD++V 
Sbjct  76    VLLNTTSG--EQPERAATPNLTLRGFDFIDRVKRLVEAECPGIVSCADILTLVARDSIVA  133

Query  791   SGVPEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSI  612
             +G P + VP GRRDG +SR  +A  N+ SP      +  LF ++GLD++DLV L GAH+I
Sbjct  134   TGGPYWRVPTGRRDGLISRSSEALSNVPSPMINFTTLQTLFANQGLDLKDLVLLSGAHTI  193

Query  611   GVAHCSNFRYRLNT--------PARAKEVDGSLKVVMGTHCRNAATTIPMDSTTQYKMDS  456
             G+AHC +F  RL          PA   E   +LK        +  T + MD  ++   D 
Sbjct  194   GIAHCQSFSNRLYNFTGIGDEDPALDSEYAANLKARKCKSISDNTTIVEMDPGSRKTFDL  253

Query  455   MFYKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDE  276
              +YK LL+++GL +SD  L  +P TL ++ +  +    +  +F++S+ KMG+IRV TG  
Sbjct  254   SYYKLLLKRRGLFQSDAALTTNPNTLSMIRQLLEGSLDFRSEFSKSMEKMGRIRVKTGSN  313

Query  275   GEIRKKCRFVN  243
             GEIR++C  VN
Sbjct  314   GEIRRQCALVN  324



>gb|EEC74412.1| hypothetical protein OsI_09774 [Oryza sativa Indica Group]
Length=313

 Score =   256 bits (655),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 136/309 (44%), Positives = 186/309 (60%), Gaps = 11/309 (4%)
 Frame = -1

Query  1151  AEAAETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGS  972
             A A  + A ++VG+Y   CP AE IV+  + KA   +PG+AA +VRL  HDC V GCD S
Sbjct  4     AMATRSQAQLQVGYYDTLCPAAEIIVQEEVSKAVSGNPGMAAGLVRLHFHDCFVRGCDAS  63

Query  971   VLLDATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVL  792
             VLLD+T G  R EK AP N  ++RGFE+ID  K  +E +C GVVSCAD+L F+ARDAL L
Sbjct  64    VLLDSTQGN-RAEKDAPPN-TSLRGFEVIDSAKSRLETACFGVVSCADVLAFAARDALAL  121

Query  791   SGVPEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSI  612
              G   ++VPGGRRDGNVS   +   NL  P   V Q+  +F +KGL   ++VAL GAH+I
Sbjct  122   VGGNAYQVPGGRRDGNVSVAQETNGNLPPPSANVAQLNQMFGAKGLTQAEMVALSGAHTI  181

Query  611   GVAHCSNFRYRLNTP----ARAKEVDGSLKVVMGTHC-----RNAATTIPMDSTTQYKMD  459
             GV+HCS+F  RL +      +   +D S    + T C     + AA  +PMD+ T    D
Sbjct  182   GVSHCSSFSNRLYSSGPNAGQDPSMDPSYVAALTTQCPQQQGQPAAGMVPMDAVTPNAFD  241

Query  458   SMFYKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGD  279
             + +Y  ++  +GLL SD+ L  D  T   V  + ++  ++   F  +++KMG I VLTG+
Sbjct  242   TNYYAAIVANRGLLSSDQALLADQTTAAQVVGYTNNPDSFQTDFAAAMVKMGSIGVLTGN  301

Query  278   EGEIRKKCR  252
              G IR  CR
Sbjct  302   AGTIRTNCR  310



>ref|XP_009763027.1| PREDICTED: peroxidase 44-like [Nicotiana sylvestris]
Length=317

 Score =   256 bits (655),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 126/297 (42%), Positives = 180/297 (61%), Gaps = 5/297 (2%)
 Frame = -1

Query  1133  TAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDAT  954
             +A +RVGFY  TCP AE IV+  + K F+ D  + AA++R+  HDC V GCD S+L+ +T
Sbjct  16    SAQLRVGFYNSTCPQAETIVRQAVQKQFNSDRSITAALLRMHFHDCFVRGCDASILIKST  75

Query  953   SGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEF  774
                       P+  +TVRGFELID IK+ +E SCP  VSCADI+T + RDA+ L+G P +
Sbjct  76    KSKQSERNAGPN--QTVRGFELIDNIKKSIEISCPSTVSCADIITLATRDAVALAGGPTY  133

Query  773   EVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCS  594
              +P GRRDG VS   D   NL  P FTV Q +  F +KGL + D+V LLGAH++GVAHC+
Sbjct  134   AIPTGRRDGLVSNAADV--NLPGPSFTVPQALQSFTNKGLSLNDMVTLLGAHTVGVAHCN  191

Query  593   NFRYRLNTPARAKEVDGSLKVVMGTHCRNAATTIPMDSTTQYKMDSMFYKQLLQKKGLLE  414
              F+ RL +P     +D +L   +   C  +  T  +D  T + +D+ F++Q++ KKG+L+
Sbjct  192   FFQNRL-SPVPDNTMDPTLAAQLLKTCSKSTATAFLDQNTSFTIDNQFFRQIMLKKGILK  250

Query  413   SDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRFVN  243
              D+ L  D  +  +V  FA ++  +   F  ++IKM  I +L G  GEIR  C   N
Sbjct  251   IDQELTLDKSSASIVSGFASNENTFRQSFANAMIKMASIDILVGRAGEIRNNCGVFN  307



>gb|AAM52317.1|AC105363_6 Putative peroxidase [Oryza sativa Japonica Group]
 tpe|CAH69275.1| TPA: class III peroxidase 33 precursor [Oryza sativa Japonica 
Group]
Length=311

 Score =   256 bits (654),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 136/309 (44%), Positives = 186/309 (60%), Gaps = 11/309 (4%)
 Frame = -1

Query  1151  AEAAETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGS  972
             A A  + A ++VG+Y   CP AE IV+  + KA   +PG+AA +VRL  HDC V GCD S
Sbjct  2     AMATRSQAQLQVGYYDTLCPAAEIIVQEEVSKAVSGNPGMAAGLVRLHFHDCFVRGCDAS  61

Query  971   VLLDATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVL  792
             VLLD+T G  R EK AP N  ++RGFE+ID  K  +E +C GVVSCAD+L F+ARDAL L
Sbjct  62    VLLDSTQGN-RAEKDAPPN-TSLRGFEVIDSAKSRLETACFGVVSCADVLAFAARDALAL  119

Query  791   SGVPEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSI  612
              G   ++VPGGRRDGNVS   +   NL  P   V Q+  +F +KGL   ++VAL GAH+I
Sbjct  120   VGGNAYQVPGGRRDGNVSVAQETNGNLPPPSANVAQLNQMFGAKGLTQAEMVALSGAHTI  179

Query  611   GVAHCSNFRYRLNTP----ARAKEVDGSLKVVMGTHC-----RNAATTIPMDSTTQYKMD  459
             GV+HCS+F  RL +      +   +D S    + T C     + AA  +PMD+ T    D
Sbjct  180   GVSHCSSFSNRLYSSGPNAGQDPSMDPSYVAALTTQCPQQQGQPAAGMVPMDAVTPNAFD  239

Query  458   SMFYKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGD  279
             + +Y  ++  +GLL SD+ L  D  T   V  + ++  ++   F  +++KMG I VLTG+
Sbjct  240   TNYYAAIVANRGLLSSDQALLADQTTAAQVVGYTNNPDSFQTDFAAAMVKMGSIGVLTGN  299

Query  278   EGEIRKKCR  252
              G IR  CR
Sbjct  300   AGTIRTNCR  308



>ref|XP_010941488.1| PREDICTED: peroxidase 5-like [Elaeis guineensis]
Length=315

 Score =   256 bits (654),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 135/310 (44%), Positives = 190/310 (61%), Gaps = 13/310 (4%)
 Frame = -1

Query  1136  TTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDA  957
             + A + VG+Y   CP AE+IV+  +VKA   D G+AA ++RL  HDC V GCD SVLLD 
Sbjct  6     SLASLEVGYYESKCPMAEKIVRRTVVKAAARDHGLAAGLIRLYFHDCFVRGCDASVLLDP  65

Query  956   TSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPE  777
                    EK +P+N  ++RG+E+ID  K E+E  CP  VSCADI+ F+ARD+  ++G  +
Sbjct  66    LPNNPS-EKLSPANNASLRGYEVIDDAKAELEAFCPETVSCADIIAFAARDSTFITGGLD  124

Query  776   FEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHC  597
             + VP GRRDG VS + +  +NL  P F  +Q++  F  KGL V+D+V L GAHSIGV+HC
Sbjct  125   YSVPSGRRDGMVSIDSEVVQNLPFPTFNAEQLIKSFAGKGLSVKDMVTLSGAHSIGVSHC  184

Query  596   SNFR---YRLN-TPARAKEVDGSLKVVMGTHCRNAAT--------TIPMDSTTQYKMDSM  453
             S+F    YR N T  +   ++  L   +   C  ++         T+P+D      +D  
Sbjct  185   SSFDSRLYRFNATHPQDPSLNHHLANFLKARCLPSSKTVRTQTEPTVPLDIKAPNHLDVK  244

Query  452   FYKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEG  273
             +YK LL+ KGLL SD+ LAG   TL LV + A + + W  +F  ++++MG I VLTG++G
Sbjct  245   YYKNLLKGKGLLTSDQTLAGSRSTLGLVIDHARNPSKWKEEFAAAMVRMGNIDVLTGNKG  304

Query  272   EIRKKCRFVN  243
             EIRK CR VN
Sbjct  305   EIRKNCRVVN  314



>ref|XP_010100382.1| Peroxidase 5 [Morus notabilis]
 gb|EXB82516.1| Peroxidase 5 [Morus notabilis]
Length=361

 Score =   258 bits (658),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 127/306 (42%), Positives = 181/306 (59%), Gaps = 12/306 (4%)
 Frame = -1

Query  1124  MRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSGG  945
             + V +Y   CP  E +V   + +AF  DP VAA ++RL  HDC + GCD S+LLD+T  G
Sbjct  56    LHVKYYRDKCPQIEFVVAKAVARAFASDPNVAAGLIRLFFHDCFITGCDASILLDSTPTG  115

Query  944   GRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEVP  765
               VEK +P+NGK V+ + +ID IK ++E+ CP  VSCADIL +++R+++ LSG+P + V 
Sbjct  116   EPVEKISPANGKNVKAYYVIDEIKAQIERECPQTVSCADILAYASRESVFLSGLPYYPVQ  175

Query  764   GGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNFR  585
              GRRDG  SR  +   N+  P  +VD M+ ++  KGL ++DLV L GAHSIG  HC  F 
Sbjct  176   AGRRDGFTSRASNIIGNIPFPTMSVDAMIEVYARKGLTLKDLVVLAGAHSIGNIHCKMFD  235

Query  584   YRL-------NTPARAKEVDGSLKVV-----MGTHCRNAATTIPMDSTTQYKMDSMFYKQ  441
             YR+         P         LK       +GT        +  D  + +++D+ FYK 
Sbjct  236   YRIYLNLTDTKVPPMVTSFAAYLKTKCPSPNLGTWEERDKVIVQFDPFSPFRLDNTFYKN  295

Query  440   LLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRK  261
             LL+ +GLL+SD+ L  D RT  +V + A +   W  KF  ++IKMG + VLTG+EGEIR+
Sbjct  296   LLRGRGLLQSDQVLVSDRRTRRIVRDMAFNPEVWSRKFVRAMIKMGNVDVLTGNEGEIRR  355

Query  260   KCRFVN  243
              CR  N
Sbjct  356   NCRIFN  361



>gb|AAS75394.1| peroxidase [Zea mays]
 gb|AAS75396.1| peroxidase [Zea mays]
 gb|AAS75410.1| peroxidase [Zea mays]
 gb|AAS75413.1| peroxidase [Zea mays]
 gb|AAS75419.1| peroxidase [Zea mays]
 gb|AAS75422.1| peroxidase [Zea mays]
 gb|AAS75423.1| peroxidase [Zea mays]
Length=357

 Score =   257 bits (657),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 138/319 (43%), Positives = 187/319 (59%), Gaps = 20/319 (6%)
 Frame = -1

Query  1142  AETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLL  963
             + T A + VGFY RTCPTAE IV+  +  AF ++ GVA A++R+  HDC V GCDGSVL+
Sbjct  18    SATAACLDVGFYDRTCPTAETIVQQTVAAAFRNNSGVAPALIRMHFHDCFVRGCDGSVLI  77

Query  962   DATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGV  783
             D T G    EK AP N  ++R F+++DR K  +E  CPGVVSCAD+L F+ARD++VLSG 
Sbjct  78    D-TVGNLTAEKDAPPNNPSLRFFDVVDRAKASLEAQCPGVVSCADVLAFAARDSVVLSGG  136

Query  782   PEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVA  603
               ++VP GRRDG +S + +A  NL  P F   ++   F SK L +EDLV L GAH+IGV+
Sbjct  137   LGYQVPAGRRDGRISNDTEALNNLPPPFFNATELADRFASKNLSIEDLVVLSGAHTIGVS  196

Query  602   HCSNFR------------YRLNT-----PARAKEVDGSLKVVMGTHCRN--AATTIPMDS  480
             HCS F             Y  ++     P  +K     LK +   +       TT+ MD 
Sbjct  197   HCSGFAGPTDLNGPVDRLYNFSSPDGIDPTLSKAYAFLLKSICPANTSQFFPNTTVFMDL  256

Query  479   TTQYKMDSMFYKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGK  300
              T  + D+ +Y  L    GL +SD  L  +     LV+ F   +A +  KF  S+IKMG+
Sbjct  257   ITPERFDNKYYVGLTNNLGLFKSDVALLTNATMKALVDSFVRSEATFRTKFARSMIKMGQ  316

Query  299   IRVLTGDEGEIRKKCRFVN  243
             I VLTG +GEIR+ CR +N
Sbjct  317   IEVLTGTQGEIRRNCRVIN  335



>gb|KCW52187.1| hypothetical protein EUGRSUZ_J01616, partial [Eucalyptus grandis]
Length=313

 Score =   256 bits (653),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 129/301 (43%), Positives = 186/301 (62%), Gaps = 9/301 (3%)
 Frame = -1

Query  1133  TAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDAT  954
             +A ++VGFY  TCP+AE +V+  + KA   + G+ A ++R+  HDC V GCD S+LLD+T
Sbjct  12    SATLQVGFYRSTCPSAESVVRKAVNKAVAKNSGIGAGLIRMHFHDCFVRGCDASILLDST  71

Query  953   SGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEF  774
              G    EK+ P+N  ++RGFE+ID  K E+E  CP  VSCADIL F+ARD+    G   +
Sbjct  72    PGNPS-EKEHPANNPSLRGFEVIDEAKAELESLCPQKVSCADILAFAARDSAYKLGSINY  130

Query  773   EVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCS  594
              VP GRRDG VS + +  ++L    F   Q+ A F  KGL ++++V L GAHSIGV+HCS
Sbjct  131   AVPAGRRDGLVSLKDEPSQDLPPFFFNAQQLEANFARKGLSLDEMVTLSGAHSIGVSHCS  190

Query  593   NFRYRLN----TPARAKEVDGSLKVVMGTHCRN----AATTIPMDSTTQYKMDSMFYKQL  438
             +F  RL     T  +   +D  L   + + C N    +  T+P+D  T  ++D+ +Y  L
Sbjct  191   SFSNRLYSFNATHTQDPSMDTKLATQLKSKCPNNGGASDPTVPLDLVTPNRLDNKYYTNL  250

Query  437   LQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKK  258
               ++GLL SD+ L+  P T  +V   A++  AW  KF  +++KMG I VLTG+EGEIR+K
Sbjct  251   KNRRGLLTSDQTLSNSPSTANIVRSNANNGGAWANKFAAAMVKMGSIDVLTGNEGEIRRK  310

Query  257   C  255
             C
Sbjct  311   C  311



>gb|KHN29593.1| Peroxidase 5 [Glycine soja]
Length=328

 Score =   256 bits (654),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 125/301 (42%), Positives = 189/301 (63%), Gaps = 8/301 (3%)
 Frame = -1

Query  1121  RVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSGGG  942
             +VGFY  TCP+AEEIV++ + KA     G+AA ++R+  HDC V GCDGSVLL +T G  
Sbjct  28    KVGFYSSTCPSAEEIVRSTVNKAISHKAGIAAGLIRMHFHDCFVRGCDGSVLLASTPGNP  87

Query  941   RVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEVPG  762
               E+   +N  ++RGFE+I+  K ++E +CP  VSCADIL F+ARD+ +  G   ++VP 
Sbjct  88    VAERDNFANNPSLRGFEVIEEAKTQLEAACPQTVSCADILAFAARDSALKVGGINYDVPS  147

Query  761   GRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNFRY  582
             GRRDG +S   +  +NL +P  T D++V+ F  KGL  +++V L GAHSIGV+HCS F  
Sbjct  148   GRRDGRISIADEVPRNLPAPTSTADELVSNFSRKGLSADEMVTLSGAHSIGVSHCSAFSK  207

Query  581   RL----NTPARAKEVDGSLKVVMGTHC----RNAATTIPMDSTTQYKMDSMFYKQLLQKK  426
             RL    +T  +   +D S    + + C        +T+ +D +T  ++D+ +Y+ L+  +
Sbjct  208   RLYSFNDTVTQDPSMDSSYAETLKSICPAPPSTTDSTVSLDPSTPIRLDNKYYEGLINHR  267

Query  425   GLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRFV  246
             GLL SD+ L     T  +V+  A++ A+W  KF +++++MG I VLTG +GEIR+ C  V
Sbjct  268   GLLTSDQTLHTSQTTREMVQSNANNGASWAEKFAKAMVQMGSIEVLTGSDGEIRRHCSLV  327

Query  245   N  243
             N
Sbjct  328   N  328



>gb|AAS75395.1| peroxidase [Zea mays]
 gb|AAS75397.1| peroxidase [Zea mays]
 gb|AAS75398.1| peroxidase [Zea mays]
 gb|AAS75399.1| peroxidase [Zea mays]
 gb|AAS75403.1| peroxidase [Zea mays]
 gb|AAS75405.1| peroxidase [Zea mays]
 gb|AAS75411.1| peroxidase [Zea mays]
 gb|AAS75418.1| peroxidase [Zea mays]
Length=357

 Score =   257 bits (656),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 138/319 (43%), Positives = 187/319 (59%), Gaps = 20/319 (6%)
 Frame = -1

Query  1142  AETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLL  963
             + T A + VGFY RTCPTAE IV+  +  AF ++ GVA A++R+  HDC V GCDGSVL+
Sbjct  18    SATAACLDVGFYDRTCPTAETIVQQTVAAAFRNNSGVAPALIRMHFHDCFVRGCDGSVLI  77

Query  962   DATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGV  783
             D T G    EK AP N  ++R F+++DR K  +E  CPGVVSCAD+L F+ARD++VLSG 
Sbjct  78    D-TVGNLTAEKDAPPNNPSLRFFDVVDRAKAALEAQCPGVVSCADVLAFAARDSVVLSGG  136

Query  782   PEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVA  603
               ++VP GRRDG +S + +A  NL  P F   ++   F SK L +EDLV L GAH+IGV+
Sbjct  137   LGYQVPAGRRDGRISNDTEALNNLPPPFFNATELADRFASKNLSIEDLVVLSGAHTIGVS  196

Query  602   HCSNFR------------YRLNT-----PARAKEVDGSLKVVMGTHCRN--AATTIPMDS  480
             HCS F             Y  ++     P  +K     LK +   +       TT+ MD 
Sbjct  197   HCSGFAGPTDLNGPVDRLYNFSSPDGIDPTLSKAYAFLLKSICPANTSQFFPNTTVFMDL  256

Query  479   TTQYKMDSMFYKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGK  300
              T  + D+ +Y  L    GL +SD  L  +     LV+ F   +A +  KF  S+IKMG+
Sbjct  257   ITPERFDNKYYVGLTNNLGLFKSDVALLTNATMKALVDSFVRSEATFRTKFARSMIKMGQ  316

Query  299   IRVLTGDEGEIRKKCRFVN  243
             I VLTG +GEIR+ CR +N
Sbjct  317   IEVLTGTQGEIRRNCRVIN  335



>gb|AAS75401.1| peroxidase [Zea mays]
 gb|AAS75404.1| peroxidase [Zea mays]
 gb|AAS75406.1| peroxidase [Zea mays]
 gb|AAS75408.1| peroxidase [Zea mays]
 gb|AAS75409.1| peroxidase [Zea mays]
 gb|AAS75412.1| peroxidase [Zea mays]
 gb|AAS75416.1| peroxidase [Zea mays]
 gb|AAS75417.1| peroxidase [Zea mays]
 gb|AAS75420.1| peroxidase [Zea mays]
 gb|AAS75421.1| peroxidase [Zea mays]
 gb|AAS75424.1| peroxidase [Zea mays]
Length=357

 Score =   257 bits (656),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 138/319 (43%), Positives = 187/319 (59%), Gaps = 20/319 (6%)
 Frame = -1

Query  1142  AETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLL  963
             + T A + VGFY RTCPTAE IV+  +  AF ++ GVA A++R+  HDC V GCDGSVL+
Sbjct  18    SATAACLDVGFYDRTCPTAETIVQQTVAAAFRNNSGVAPALIRMHFHDCFVRGCDGSVLI  77

Query  962   DATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGV  783
             D T G    EK AP N  ++R F+++DR K  +E  CPGVVSCAD+L F+ARD++VLSG 
Sbjct  78    D-TVGNLTAEKDAPPNNPSLRFFDVVDRAKASLEAQCPGVVSCADVLAFAARDSVVLSGG  136

Query  782   PEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVA  603
               ++VP GRRDG +S + +A  NL  P F   ++   F SK L +EDLV L GAH+IGV+
Sbjct  137   LGYQVPAGRRDGRISNDTEALNNLPPPFFNATELADRFASKNLTIEDLVVLSGAHTIGVS  196

Query  602   HCSNFR------------YRLNT-----PARAKEVDGSLKVVMGTHCRN--AATTIPMDS  480
             HCS F             Y  ++     P  +K     LK +   +       TT+ MD 
Sbjct  197   HCSGFAGPTDLNGPVDRLYNFSSPDGIDPTLSKAYAFLLKSICPANTSQFFPNTTVFMDL  256

Query  479   TTQYKMDSMFYKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGK  300
              T  + D+ +Y  L    GL +SD  L  +     LV+ F   +A +  KF  S+IKMG+
Sbjct  257   ITPERFDNKYYVGLTNNLGLFKSDVALLTNATMKALVDSFVRSEATFRTKFARSMIKMGQ  316

Query  299   IRVLTGDEGEIRKKCRFVN  243
             I VLTG +GEIR+ CR +N
Sbjct  317   IEVLTGTQGEIRRNCRVIN  335



>gb|AAM52320.1|AC105363_9 Putative peroxidase [Oryza sativa Japonica Group]
 tpe|CAH69277.1| TPA: class III peroxidase 35 precursor [Oryza sativa Japonica 
Group]
 gb|EAZ25397.1| hypothetical protein OsJ_09215 [Oryza sativa Japonica Group]
Length=319

 Score =   256 bits (653),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 127/306 (42%), Positives = 181/306 (59%), Gaps = 13/306 (4%)
 Frame = -1

Query  1124  MRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSGG  945
             +   FY  TCP AE IV+  + +A + + G AA +VR+  HDC V GCDGSVLL++TS  
Sbjct  15    LHPNFYAATCPQAETIVRQEVTRALYTNIGFAAGLVRMHFHDCFVRGCDGSVLLESTSDN  74

Query  944   GRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEVP  765
                E+ +P N  ++RGFE+ID  K  +E +CPGVVSCAD+L ++ARD + L+G P ++VP
Sbjct  75    -VAERDSPINNPSLRGFEVIDAAKARLEAACPGVVSCADVLAYAARDGVALTGGPRYDVP  133

Query  764   GGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNFR  585
             GGRRDG  S EP+   N+ +P FT+DQ+   F +KGL  E++V L GAH++G AHC++F 
Sbjct  134   GGRRDGTASLEPEVADNIPAPTFTLDQLTQSFAAKGLTQEEMVTLSGAHTVGRAHCTSFS  193

Query  584   YRLNTPARAKEVDGSLKVVMGTHCR------------NAATTIPMDSTTQYKMDSMFYKQ  441
              RL   +     D S+   +    R            +A   +PM+  T    D+++Y  
Sbjct  194   DRLYNFSATGAADPSVDPALLPQLRRACPAAGPDGAVDAGLVVPMEPRTPNGFDALYYWA  253

Query  440   LLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRK  261
             +L+ + L  SD+ L   P T   V + A     W  KF  +++KMG+I VLTG  GEIR 
Sbjct  254   VLRNRALFTSDQALLSSPPTAAQVRQTAYGGYPWKLKFAAAMVKMGQIEVLTGGSGEIRT  313

Query  260   KCRFVN  243
             KC  VN
Sbjct  314   KCSAVN  319



>ref|XP_008649365.1| PREDICTED: peroxidase 5 [Zea mays]
 gb|AFW77214.1| peroxidase [Zea mays]
Length=360

 Score =   257 bits (656),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 138/319 (43%), Positives = 187/319 (59%), Gaps = 20/319 (6%)
 Frame = -1

Query  1142  AETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLL  963
             + T A + VGFY RTCPTAE IV+  +  AF ++ GVA A++R+  HDC V GCDGSVL+
Sbjct  21    SATAACLDVGFYDRTCPTAETIVQQTVAAAFRNNSGVAPALIRMHFHDCFVRGCDGSVLI  80

Query  962   DATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGV  783
             D T G    EK AP N  ++R F+++DR K  +E  CPGVVSCAD+L F+ARD++VLSG 
Sbjct  81    D-TVGNLTAEKDAPPNNPSLRFFDVVDRAKASLEAQCPGVVSCADVLAFAARDSVVLSGG  139

Query  782   PEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVA  603
               ++VP GRRDG +S + +A  NL  P F   ++   F SK L +EDLV L GAH+IGV+
Sbjct  140   LGYQVPAGRRDGRISNDTEALNNLPPPFFNATELADRFASKNLTIEDLVVLSGAHTIGVS  199

Query  602   HCSNFR------------YRLNT-----PARAKEVDGSLKVVMGTHCRN--AATTIPMDS  480
             HCS F             Y  ++     P  +K     LK +   +       TT+ MD 
Sbjct  200   HCSGFAGPTDLNGPVDRLYNFSSPDGIDPTLSKAYAFLLKSICPANTSQFFPNTTVFMDL  259

Query  479   TTQYKMDSMFYKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGK  300
              T  + D+ +Y  L    GL +SD  L  +     LV+ F   +A +  KF  S+IKMG+
Sbjct  260   ITPERFDNKYYVGLTNNLGLFKSDVALLTNATMKALVDSFVRSEATFRTKFARSMIKMGQ  319

Query  299   IRVLTGDEGEIRKKCRFVN  243
             I VLTG +GEIR+ CR +N
Sbjct  320   IEVLTGTQGEIRRNCRVIN  338



>ref|NP_001141388.1| uncharacterized protein LOC100273479 precursor [Zea mays]
 gb|ACF86224.1| unknown [Zea mays]
 gb|AFW77216.1| hypothetical protein ZEAMMB73_709802 [Zea mays]
Length=357

 Score =   257 bits (656),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 134/314 (43%), Positives = 186/314 (59%), Gaps = 18/314 (6%)
 Frame = -1

Query  1133  TAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDAT  954
             +A +  GFY +TCP+AE IV+  +  AF ++ GVA A++R+  HDC V GCDGSVL+D+T
Sbjct  20    SASLEFGFYNKTCPSAETIVQQTVAAAFTNNSGVAPALLRMHFHDCFVRGCDGSVLIDST  79

Query  953   SGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEF  774
             +   + EK +  N  ++R F+++DR K  +E  CPGVVSCADIL F+ARD++VL+G   +
Sbjct  80    ANN-KAEKDSIPNSPSLRFFDVVDRAKASLEARCPGVVSCADILAFAARDSVVLTGGLGY  138

Query  773   EVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCS  594
             +VP GRRDG +S    A   L  P F   Q+V  F SK L +ED+V L GAH+IGV+HCS
Sbjct  139   KVPSGRRDGRISNATQALNELPPPFFNATQLVDNFASKNLSLEDMVVLSGAHTIGVSHCS  198

Query  593   NFRYRLNTPARAKEVDGS-----------LKVVMGTHCRNAA------TTIPMDSTTQYK  465
             +F    NT  R     GS              ++ + C + +      TT  MD  T  K
Sbjct  199   SFAGINNTGDRLYNFSGSSDGIDPALSKAYAFLLKSICPSNSGRFFPNTTTFMDLITPAK  258

Query  464   MDSMFYKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLT  285
              D+ +Y  L    GL ESD  L  +     LV+ F   +A W  KF +S++KMG+I VLT
Sbjct  259   FDNKYYVGLTNNLGLFESDAALLTNATMKALVDSFVRSEATWKTKFAKSMLKMGQIEVLT  318

Query  284   GDEGEIRKKCRFVN  243
             G +GEIR+ CR +N
Sbjct  319   GTQGEIRRNCRVIN  332



>ref|NP_001048793.1| Os03g0121200 [Oryza sativa Japonica Group]
 gb|ABF93699.1| Peroxidase family protein, expressed [Oryza sativa Japonica Group]
 dbj|BAF10707.1| Os03g0121200 [Oryza sativa Japonica Group]
 dbj|BAG96194.1| unnamed protein product [Oryza sativa Japonica Group]
Length=331

 Score =   256 bits (653),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 136/309 (44%), Positives = 186/309 (60%), Gaps = 11/309 (4%)
 Frame = -1

Query  1151  AEAAETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGS  972
             A A  + A ++VG+Y   CP AE IV+  + KA   +PG+AA +VRL  HDC V GCD S
Sbjct  22    AMATRSQAQLQVGYYDTLCPAAEIIVQEEVSKAVSGNPGMAAGLVRLHFHDCFVRGCDAS  81

Query  971   VLLDATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVL  792
             VLLD+T G  R EK AP N  ++RGFE+ID  K  +E +C GVVSCAD+L F+ARDAL L
Sbjct  82    VLLDSTQGN-RAEKDAPPN-TSLRGFEVIDSAKSRLETACFGVVSCADVLAFAARDALAL  139

Query  791   SGVPEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSI  612
              G   ++VPGGRRDGNVS   +   NL  P   V Q+  +F +KGL   ++VAL GAH+I
Sbjct  140   VGGNAYQVPGGRRDGNVSVAQETNGNLPPPSANVAQLNQMFGAKGLTQAEMVALSGAHTI  199

Query  611   GVAHCSNFRYRLNTP----ARAKEVDGSLKVVMGTHC-----RNAATTIPMDSTTQYKMD  459
             GV+HCS+F  RL +      +   +D S    + T C     + AA  +PMD+ T    D
Sbjct  200   GVSHCSSFSNRLYSSGPNAGQDPSMDPSYVAALTTQCPQQQGQPAAGMVPMDAVTPNAFD  259

Query  458   SMFYKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGD  279
             + +Y  ++  +GLL SD+ L  D  T   V  + ++  ++   F  +++KMG I VLTG+
Sbjct  260   TNYYAAIVANRGLLSSDQALLADQTTAAQVVGYTNNPDSFQTDFAAAMVKMGSIGVLTGN  319

Query  278   EGEIRKKCR  252
              G IR  CR
Sbjct  320   AGTIRTNCR  328



>gb|AAS75393.1| peroxidase [Zea mays]
 gb|AAS75407.1| peroxidase [Zea mays]
 gb|AAS75414.1| peroxidase [Zea mays]
 gb|AAS75415.1| peroxidase [Zea mays]
Length=357

 Score =   256 bits (655),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 138/319 (43%), Positives = 187/319 (59%), Gaps = 20/319 (6%)
 Frame = -1

Query  1142  AETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLL  963
             + T A + VGFY RTCPTAE IV+  +  AF ++ GVA A++R+  HDC V GCDGSVL+
Sbjct  18    SATAACLDVGFYDRTCPTAETIVQQTVAAAFRNNSGVAPALIRMHFHDCFVRGCDGSVLI  77

Query  962   DATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGV  783
             D T G    EK AP N  ++R F+++DR K  +E  CPGVVSCAD+L F+ARD++VLSG 
Sbjct  78    D-TVGNLTAEKDAPPNNPSLRFFDVVDRAKAALEAQCPGVVSCADVLAFAARDSVVLSGG  136

Query  782   PEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVA  603
               ++VP GRRDG +S + +A  NL  P F   ++   F SK L +EDLV L GAH+IGV+
Sbjct  137   LGYQVPAGRRDGRISNDTEALNNLPPPFFNATELADRFASKNLTIEDLVVLSGAHTIGVS  196

Query  602   HCSNFR------------YRLNT-----PARAKEVDGSLKVVMGTHCRN--AATTIPMDS  480
             HCS F             Y  ++     P  +K     LK +   +       TT+ MD 
Sbjct  197   HCSGFAGPTDLNGPVDRLYNFSSPDGIDPTLSKAYAFLLKSICPANTSQFFPNTTVFMDL  256

Query  479   TTQYKMDSMFYKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGK  300
              T  + D+ +Y  L    GL +SD  L  +     LV+ F   +A +  KF  S+IKMG+
Sbjct  257   ITPERFDNKYYVGLTNNLGLFKSDVALLTNATMKALVDSFVRSEATFRTKFARSMIKMGQ  316

Query  299   IRVLTGDEGEIRKKCRFVN  243
             I VLTG +GEIR+ CR +N
Sbjct  317   IEVLTGTQGEIRRNCRVIN  335



>ref|XP_010422076.1| PREDICTED: peroxidase 39-like [Camelina sativa]
Length=326

 Score =   255 bits (652),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 129/307 (42%), Positives = 192/307 (63%), Gaps = 10/307 (3%)
 Frame = -1

Query  1136  TTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDA  957
             + A +++GFY +TCP AE+IV++ + +  ++ P +AA ++R+  HDC V GCDGS+L++A
Sbjct  21    SEAQLKMGFYDKTCPNAEKIVQDVVNQHINNAPSLAAGLIRMHFHDCFVRGCDGSILINA  80

Query  956   TSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPE  777
             TS   +VEK AP N  TVRGF+ ID++K  +E  CPG+VSCADI+T + RD++V  G P 
Sbjct  81    TSSNQQVEKLAPPN-LTVRGFDFIDKVKSALESKCPGIVSCADIITLATRDSIVAIGGPT  139

Query  776   FEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHC  597
             + VP GRRDG +S   +AR N+  P      ++ LF ++GLDV+DLV L GAH+IGV+HC
Sbjct  140   WNVPTGRRDGRISNFAEARDNIPPPFGNFTTLITLFANQGLDVKDLVLLSGAHTIGVSHC  199

Query  596   SNFRYRL--------NTPARAKEVDGSLKVVMGTHCRNAATTIPMDSTTQYKMDSMFYKQ  441
             S+F  RL          P+   E   +LK        +  T + MD  ++   D  ++K 
Sbjct  200   SSFSNRLFNFTGVGDEDPSLDSEYAANLKSRRCLSLADNTTKVEMDPGSRNTFDLSYFKL  259

Query  440   LLQKKGLLESDERLAGDPRTLPLVEEFA-DDQAAWLGKFTESVIKMGKIRVLTGDEGEIR  264
             +L+++GL ESD  L  +P  L  V  FA   +  +  +F++++ KMG+I V TG  GEIR
Sbjct  260   VLKRRGLFESDAALTMNPAALAQVRRFAGGSEQDFFSEFSKAMEKMGRIGVKTGSAGEIR  319

Query  263   KKCRFVN  243
             + C FVN
Sbjct  320   RTCAFVN  326



>gb|AAS75400.1| peroxidase [Zea mays]
 gb|AAS75402.1| peroxidase [Zea mays]
Length=357

 Score =   256 bits (655),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 138/319 (43%), Positives = 187/319 (59%), Gaps = 20/319 (6%)
 Frame = -1

Query  1142  AETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLL  963
             + T A + VGFY RTCPTAE IV+  +  AF ++ GVA A++R+  HDC V GCDGSVL+
Sbjct  18    SATAACLDVGFYDRTCPTAETIVQQTVAAAFRNNSGVAPALIRMHFHDCFVRGCDGSVLI  77

Query  962   DATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGV  783
             D T G    EK AP N  ++R F+++DR K  +E  CPGVVSCAD+L F+ARD++VLSG 
Sbjct  78    D-TVGNLTAEKDAPPNNPSLRFFDVVDRAKASLEAQCPGVVSCADVLAFAARDSVVLSGG  136

Query  782   PEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVA  603
               ++VP GRRDG +S + +A  NL  P F   ++   F SK L +EDLV L GAH+IGV+
Sbjct  137   LGYQVPAGRRDGRISNDTEALNNLPPPFFNATELADRFASKNLTIEDLVVLSGAHTIGVS  196

Query  602   HCSNFR------------YRLNT-----PARAKEVDGSLKVVMGTHCRN--AATTIPMDS  480
             HCS F             Y  ++     P  +K     LK +   +       TT+ MD 
Sbjct  197   HCSGFAGPTDLNGPVDRLYNFSSPDGIDPTLSKAYAFLLKSICPANTSQFFPNTTLFMDL  256

Query  479   TTQYKMDSMFYKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGK  300
              T  + D+ +Y  L    GL +SD  L  +     LV+ F   +A +  KF  S+IKMG+
Sbjct  257   ITPERFDNKYYVGLTNNLGLFKSDVALLTNATMKALVDSFVRSEATFRTKFARSMIKMGQ  316

Query  299   IRVLTGDEGEIRKKCRFVN  243
             I VLTG +GEIR+ CR +N
Sbjct  317   IEVLTGTQGEIRRNCRVIN  335



>ref|XP_004498110.1| PREDICTED: peroxidase 5-like [Cicer arietinum]
Length=327

 Score =   255 bits (652),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 129/302 (43%), Positives = 184/302 (61%), Gaps = 8/302 (3%)
 Frame = -1

Query  1124  MRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSGG  945
             + VGFY  TCP+AE IV++ + KA  D+PG+ A ++R+  HDC V GCD SVLL +  G 
Sbjct  26    LEVGFYSYTCPSAETIVRSIVNKAVSDNPGIGAGLIRMHFHDCFVRGCDASVLLASIPGN  85

Query  944   GRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEVP  765
                E+ +  N  ++RGFE+ID  K E+E  CP  VSCADILTF+ARD+ +  G   + VP
Sbjct  86    PTAERDSFVNNPSLRGFEVIDEAKAELEAKCPQTVSCADILTFAARDSALKLGNINYNVP  145

Query  764   GGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNFR  585
              GRRDG VS   +  +N+  P F  D+++  F  KGL  +++V L GAHSIGV+HCS+F 
Sbjct  146   SGRRDGRVSIADEVPQNVPGPSFNADRLITTFAKKGLSKDEMVTLSGAHSIGVSHCSSFS  205

Query  584   YRLNTPARAKEVDGSLKV----VMGTHC----RNAATTIPMDSTTQYKMDSMFYKQLLQK  429
              RL +   A  +D S+      ++ T C     N    + +D+ T  ++D+++Y+ L+  
Sbjct  206   NRLYSFDDANAIDPSMDPSFVELLKTKCPKPPSNIDPIVVLDAITPIRLDNVYYEGLINH  265

Query  428   KGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRF  249
             +GLL SD+ L     T  +V   A+  A W  KF E+++ MG I VLTG +GEIRK C F
Sbjct  266   QGLLGSDQTLLSSESTKEIVLSNANYGAHWATKFAEAMVHMGSIDVLTGYDGEIRKYCNF  325

Query  248   VN  243
             VN
Sbjct  326   VN  327



>ref|XP_010659743.1| PREDICTED: peroxidase 5-like [Vitis vinifera]
Length=314

 Score =   255 bits (651),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 131/310 (42%), Positives = 188/310 (61%), Gaps = 10/310 (3%)
 Frame = -1

Query  1145  AAETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVL  966
             A+ ++A + VGFY  +CP+AE IV+  + KA   +PG+AA ++R+  HDC V GCDGSVL
Sbjct  6     ASVSSASLEVGFYKSSCPSAETIVRKAVNKAVSKNPGMAAGLIRMHFHDCFVRGCDGSVL  65

Query  965   LDATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSG  786
             LD+T G    EK++P N  ++RGFE+ID  K E+E  CP  VSCAD+L F+ARD+    G
Sbjct  66    LDSTPGNPS-EKESPVNDPSLRGFEVIDEAKAEIEAQCPQTVSCADVLAFAARDSAYKVG  124

Query  785   VPEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGV  606
                + VP GRRDG +S + +   +L  P F   Q+   F  KGL ++++V L GAHSIGV
Sbjct  125   GINYAVPSGRRDGRISLKDEPSLHLPPPFFNAKQLEENFARKGLTLDEMVTLSGAHSIGV  184

Query  605   AHCSNFRYRLNTPARAKEVDGSLKVVMGTHCRN---------AATTIPMDSTTQYKMDSM  453
             +HCS+F  RL +       D S++     H +          +  T+P++  T  ++D+ 
Sbjct  185   SHCSSFSNRLYSFNATHPQDPSIEPEFARHLKTKCPPPSNTGSDPTVPLEVQTPNRLDNK  244

Query  452   FYKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEG  273
             +YK L  +KGLL SD+ L   P T+ +V+  A   A W  KF  ++++MG I VLTG +G
Sbjct  245   YYKDLKSRKGLLTSDQTLFDSPSTVRMVKNNARYGANWGNKFAAAMVQMGAIDVLTGTQG  304

Query  272   EIRKKCRFVN  243
              IRK CR VN
Sbjct  305   VIRKNCRVVN  314



>ref|XP_002873856.1| peroxidase 57 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50115.1| peroxidase 57 [Arabidopsis lyrata subsp. lyrata]
Length=313

 Score =   255 bits (651),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 131/300 (44%), Positives = 191/300 (64%), Gaps = 12/300 (4%)
 Frame = -1

Query  1130  AGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATS  951
             A +RVGFY R+CP AE IV+N + + F  DP V AA++R+  HDC V GCD S+L+D+T+
Sbjct  22    AQLRVGFYSRSCPQAETIVRNLVRQRFGVDPTVTAALLRMHFHDCFVRGCDASLLIDSTT  81

Query  950   GGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFE  771
                  EK A  NG +VR F+LIDRIK ++E +CP  VSCADI+T + RD+++L+G P + 
Sbjct  82    S----EKTAGPNG-SVREFDLIDRIKAQLEAACPSTVSCADIVTLATRDSVLLAGGPSYR  136

Query  770   VPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSN  591
             +P GRRDG VS   D    L  P  +V   V+ F +KGL+  D VALLGAH++G  +C  
Sbjct  137   IPTGRRDGRVSNNVDV--GLPGPTISVSGAVSFFTNKGLNTFDAVALLGAHTVGQGNCGL  194

Query  590   FRYRLNTPARAKEVDGSLKVVMGTH----CRNAATTIPMDSTTQYKMDSMFYKQLLQKKG  423
             F  R+         D S+   + T     CRN+AT   +D +T  + D+ F+KQ+ + +G
Sbjct  195   FSDRITNFQGTGRPDPSMNPALVTSLRNTCRNSATA-ALDQSTPLRFDNQFFKQIRKGRG  253

Query  422   LLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRFVN  243
             +L+ D+RLA DP+T  +V  +A++ A +  +F  +++KMG + VLTG +GEIR+ CR  N
Sbjct  254   VLQVDQRLASDPQTRGIVARYANNNAFFKRQFVRAMVKMGAVDVLTGRKGEIRRNCRRFN  313



>ref|XP_009627957.1| PREDICTED: peroxidase 44 [Nicotiana tomentosiformis]
Length=317

 Score =   255 bits (651),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 124/297 (42%), Positives = 181/297 (61%), Gaps = 5/297 (2%)
 Frame = -1

Query  1133  TAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDAT  954
             +A +RVGFY  TCP AE IV+  +   F+ D  + AA++R+  HDC V GCD S+L+ +T
Sbjct  16    SAQLRVGFYNSTCPQAETIVRQAVQNQFNSDRSITAALLRMHFHDCFVRGCDASILIKST  75

Query  953   SGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEF  774
                       P+  +TVRGFELID+IK+ +E  CP  VSCADI+T + RDA+ ++G P +
Sbjct  76    KSKQSERNAGPN--QTVRGFELIDKIKKSIETLCPSTVSCADIITLATRDAVAIAGGPSY  133

Query  773   EVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCS  594
              +P GRRDG VS   D   NL  P FTV Q +  F +KGL + D+V LLGAH++GVAHC+
Sbjct  134   AIPTGRRDGLVSNAADV--NLPGPSFTVPQALQSFTNKGLSLNDMVTLLGAHTVGVAHCN  191

Query  593   NFRYRLNTPARAKEVDGSLKVVMGTHCRNAATTIPMDSTTQYKMDSMFYKQLLQKKGLLE  414
              F+ RL +P     +D SL   +   C  +  T  +D  T + +D+ F++Q++ +KG+L+
Sbjct  192   FFQNRL-SPVPDNTMDPSLAAQLLKTCSKSTATTFLDQNTSFTVDNQFFRQIMLQKGILK  250

Query  413   SDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRFVN  243
              D+ L  D  +  +V  FA ++  +   F+ ++IKM  I +L G  GEIRK C   N
Sbjct  251   IDQELTLDNSSASIVSGFASNENTFRQSFSNAMIKMASIDILVGRAGEIRKNCGVFN  307



>ref|XP_007136358.1| hypothetical protein PHAVU_009G038500g [Phaseolus vulgaris]
 gb|ESW08352.1| hypothetical protein PHAVU_009G038500g [Phaseolus vulgaris]
Length=327

 Score =   255 bits (652),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 126/302 (42%), Positives = 187/302 (62%), Gaps = 9/302 (3%)
 Frame = -1

Query  1124  MRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSGG  945
             ++VGFY  +C  AE IVK+ + KA  ++PG+AA +VR+  HDC + GCD SVLLD+T   
Sbjct  26    LQVGFYSYSCGMAEFIVKDEVRKAVSNNPGIAAGLVRMHFHDCFIRGCDASVLLDSTPSN  85

Query  944   GRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEVP  765
                EK +P+N  ++RG+E+ID  K ++E  CPG+VSCADI+ F+ARD++ L+G   ++VP
Sbjct  86    -TAEKDSPANKPSLRGYEVIDHAKAQLEAVCPGIVSCADIVAFAARDSVELAGGLGYDVP  144

Query  764   GGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNFR  585
              GRRDG +S   D R  L  P F V+Q+  LF  KGL  +++V L GAH+IG +HCS+F 
Sbjct  145   AGRRDGRISLASDTRTELPPPTFNVNQLTQLFARKGLTQDEMVTLSGAHTIGRSHCSSFS  204

Query  584   YRL----NTPARAKEVDGSLKVVMGTHCRNAATT----IPMDSTTQYKMDSMFYKQLLQK  429
              RL     T ++   +D S   ++   C   +T     +PM+ ++    D  +Y  +L  
Sbjct  205   NRLYNFSGTSSKDPSLDPSYAALLKRQCPQGSTNPNLVVPMNPSSPGIADVGYYVDILSN  264

Query  428   KGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRF  249
             +GL  SD+ L  +  T   V++ A D   W  KF ++++KMG+I VLTG+ GEIR  CR 
Sbjct  265   RGLFTSDQTLLTNAETASQVKQNARDGYQWASKFADAMVKMGQISVLTGNAGEIRTNCRV  324

Query  248   VN  243
             V+
Sbjct  325   VS  326



>gb|KCW52185.1| hypothetical protein EUGRSUZ_J01614, partial [Eucalyptus grandis]
Length=307

 Score =   254 bits (650),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 125/302 (41%), Positives = 185/302 (61%), Gaps = 9/302 (3%)
 Frame = -1

Query  1133  TAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDAT  954
             +A ++VGFY  TCP+ E +V+  + KA   +PG+ A ++R+  HDC V GCD S+LLD+T
Sbjct  6     SATLQVGFYHSTCPSVESVVRKAVNKAVARNPGIGAGLIRMHFHDCFVRGCDASILLDST  65

Query  953   SGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEF  774
              G    EK+ P+N  ++RG+E+ID  K E+E  CP  VSCADIL F+ARD+    G   +
Sbjct  66    PGNP-AEKEHPANNPSLRGYEVIDEAKAELEYLCPQTVSCADILAFAARDSTYKLGSINY  124

Query  773   EVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCS  594
              VP GRRDG VS   +  +NL  P     Q+ A F  KGL ++++V L GAHS+GV+HCS
Sbjct  125   AVPAGRRDGLVSLRDEPSQNLPPPSLDAQQLEANFARKGLSLDEMVTLSGAHSVGVSHCS  184

Query  593   NFRYRLNTPARAKEVDGSLKVVMGTH----CRN----AATTIPMDSTTQYKMDSMFYKQL  438
             +F  RL++     + D S++  M +     C N    +  T+P+D  T  ++D+ +Y  L
Sbjct  185   SFSTRLSSFNATHKQDPSMEPRMASELKAKCLNNGGASDPTVPLDFATPNRLDNKYYTNL  244

Query  437   LQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKK  258
                +G+L SD+ L   P T  +V + A+   AW  KF  +++KMG I +LTG++GEIR+ 
Sbjct  245   KDHRGVLTSDQTLFDSPSTAYIVRKHANHGGAWANKFAAAMVKMGSIDILTGNQGEIRRN  304

Query  257   CR  252
             CR
Sbjct  305   CR  306



>ref|XP_003533700.1| PREDICTED: peroxidase 5-like [Glycine max]
Length=329

 Score =   255 bits (652),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 127/301 (42%), Positives = 185/301 (61%), Gaps = 8/301 (3%)
 Frame = -1

Query  1121  RVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSGGG  942
             +VGFY  TCP+AE IV++ + KA   +PG+AA ++R+  HDC V GCDGSVLL +  G  
Sbjct  29    KVGFYSSTCPSAEAIVRSAVEKAISANPGIAAGLIRMHFHDCFVRGCDGSVLLASRPGNP  88

Query  941   RVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEVPG  762
               E+    N  ++RGFE+I+  K ++E +CP  VSCADIL F+ARD++   G   ++VP 
Sbjct  89    ISERDNLVNNPSLRGFEVIEEAKNQIEDACPQTVSCADILAFAARDSVSKVGGINYDVPS  148

Query  761   GRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNFRY  582
             GRRDG VS   +   NL  P F+ D++V+ F  KGL  +++V L GAHSIGV+HC +F  
Sbjct  149   GRRDGGVSIGGEVIGNLPGPSFSADELVSSFSRKGLSADEMVTLSGAHSIGVSHCGSFSN  208

Query  581   RL----NTPARAKEVDGSLKVVMGTHCRNAAT----TIPMDSTTQYKMDSMFYKQLLQKK  426
             RL    +T  +   +D S    +   C         T+ ++ +T  ++DS +Y+ L+  +
Sbjct  209   RLYSFSDTATQDPSLDSSYAETLKGKCPPPPPTSDPTVSLEPSTPIRLDSKYYEALINHR  268

Query  425   GLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRFV  246
             GLL SD+ L     T  +VE  A + A+W  KF  ++++MG I VLTG +GEIRK+C FV
Sbjct  269   GLLTSDQTLYTSQSTRAMVESNAYNAASWAEKFALAMVRMGSIEVLTGSDGEIRKQCSFV  328

Query  245   N  243
             N
Sbjct  329   N  329



>ref|NP_192868.1| peroxidase 39 [Arabidopsis thaliana]
 sp|Q9SUT2.1|PER39_ARATH RecName: Full=Peroxidase 39; Short=Atperox P39; AltName: Full=ATP19a; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAB51413.1| peroxidase ATP19a [Arabidopsis thaliana]
 emb|CAB81230.1| peroxidase ATP19a [Arabidopsis thaliana]
 dbj|BAD95298.1| peroxidase ATP19a [Arabidopsis thaliana]
 gb|ABH04555.1| At4g11290 [Arabidopsis thaliana]
 gb|AEE82993.1| peroxidase 39 [Arabidopsis thaliana]
Length=326

 Score =   255 bits (651),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 129/305 (42%), Positives = 191/305 (63%), Gaps = 10/305 (3%)
 Frame = -1

Query  1130  AGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATS  951
             A +++GFY +TCP AE+IV++ + +  ++ P +AA ++R+  HDC V GCDGS+L++ATS
Sbjct  23    AQLKMGFYDQTCPYAEKIVQDVVNQHINNAPSLAAGLIRMHFHDCFVRGCDGSILINATS  82

Query  950   GGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFE  771
                +VEK AP N  TVRGF+ ID++K  +E  CPG+VSCADI+T + RD++V  G P + 
Sbjct  83    SNQQVEKLAPPN-LTVRGFDFIDKVKSALESKCPGIVSCADIITLATRDSIVAIGGPTWN  141

Query  770   VPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSN  591
             VP GRRDG +S   +A  N+  P      ++ LF ++GLDV+DLV L GAH+IGV+HCS+
Sbjct  142   VPTGRRDGRISNFAEAMNNIPPPFGNFTTLITLFGNQGLDVKDLVLLSGAHTIGVSHCSS  201

Query  590   FRYRL--------NTPARAKEVDGSLKVVMGTHCRNAATTIPMDSTTQYKMDSMFYKQLL  435
             F  RL          P+   E   +LK        +  T + MD  ++   D  +Y+ +L
Sbjct  202   FSNRLFNFTGVGDQDPSLDSEYADNLKSRRCLSIADNTTKVEMDPGSRNTFDLSYYRLVL  261

Query  434   QKKGLLESDERLAGDPRTLPLVEEFA-DDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKK  258
             +++GL ESD  L  +P  L  V+ FA   +  +  +F+ S+ KMG+I V TG +GEIR+ 
Sbjct  262   KRRGLFESDAALTMNPAALAQVKRFAGGSEQEFFAEFSNSMEKMGRIGVKTGSDGEIRRT  321

Query  257   CRFVN  243
             C FVN
Sbjct  322   CAFVN  326



>ref|XP_006662005.1| PREDICTED: peroxidase 5-like [Oryza brachyantha]
Length=334

 Score =   255 bits (652),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 131/301 (44%), Positives = 184/301 (61%), Gaps = 10/301 (3%)
 Frame = -1

Query  1130  AGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATS  951
             A +RVGFY  +CP AE IV+  + KA   +PG+AA +VRL  HDC V GCD SVL+D+T 
Sbjct  34    AQLRVGFYDNSCPAAEIIVQQEVSKAVSANPGLAAGLVRLHFHDCFVRGCDASVLIDSTK  93

Query  950   GGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFE  771
             G  + EK A  N  ++RGFE++DRIK  +EQ+C GVVSCADIL F+ARD++ L+G   ++
Sbjct  94    GN-QAEKDAGPN-TSLRGFEVVDRIKARVEQACFGVVSCADILAFAARDSVALTGGNAYQ  151

Query  770   VPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSN  591
             VP GRRDG+VSR  D   NL  P   V Q+  +F +KGL   ++VAL GAH+IG +HCS+
Sbjct  152   VPAGRRDGSVSRASDTGGNLPPPTAGVSQLTQMFAAKGLSQREMVALSGAHTIGASHCSS  211

Query  590   FRYRL----NTPARAKEVDGSLKVVMGTHCRNA----ATTIPMDSTTQYKMDSMFYKQLL  435
             F  RL     T  +   +D +    +   C  +       +PMD+ T    D  F+K ++
Sbjct  212   FSSRLYRSGTTAGQDPTMDPAYVAQLAQQCPQSGGGGGPLVPMDAVTPNTFDEGFFKGVM  271

Query  434   QKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKC  255
               +GLL SD+ L  D  T   V  +A+D + +   F  +++KMG + VLTG  G++R  C
Sbjct  272   ANRGLLSSDQVLLSDKNTAVQVVAYANDASTFQSDFAAAMVKMGAVGVLTGSSGKVRSNC  331

Query  254   R  252
             R
Sbjct  332   R  332



>ref|XP_011047037.1| PREDICTED: peroxidase 44 [Populus euphratica]
Length=353

 Score =   256 bits (653),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 138/299 (46%), Positives = 188/299 (63%), Gaps = 11/299 (4%)
 Frame = -1

Query  1130  AGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATS  951
             A +RVGFY  TCP AE I+   + K F+ D  V AA++R+  HDC V GCD S+L+D+T+
Sbjct  19    ADLRVGFYKPTCPDAESIIFQAVQKRFNTDKSVTAALLRMHFHDCFVRGCDASILIDSTT  78

Query  950   GGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFE  771
                + EK A  N +TVR +ELID IK+ +E  CP  VSCADI+T + RDA+VL+G P + 
Sbjct  79    QN-QAEKDAGPN-QTVREYELIDEIKKALEAKCPSKVSCADIITVATRDAVVLAGGPNYT  136

Query  770   VPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSN  591
             VP GRRDG VSR  D   NL  P   V Q   +F++KGL +E++V LLGAH++GVAHCS 
Sbjct  137   VPTGRRDGLVSRAGDV--NLPGPQVDVSQAFQIFRAKGLTLEEMVILLGAHTVGVAHCSF  194

Query  590   FRYRL-NTPARAKEVDGSLKVVMGTHCRNAAT--TIPMDSTTQYKMDSMFYKQLLQKKGL  420
             F  RL N P+    +D +L   +   C N  T  T+ +D  T + +D+ FYKQLL K+G+
Sbjct  195   FSERLQNDPS----MDANLAANLTNVCANPNTDPTVLLDQGTGFAVDNEFYKQLLLKRGI  250

Query  419   LESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRFVN  243
             +  D+ LA D  T   V  FA D   +  +F  +++KMG + VL G +GE+RK CR  N
Sbjct  251   MHIDQELAIDSSTSGFVSRFARDGNGFKQRFGNAMVKMGSVGVLVGKDGEVRKNCRVFN  309



>emb|CAA67337.1| peroxidase [Arabidopsis thaliana]
Length=326

 Score =   254 bits (650),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 129/307 (42%), Positives = 192/307 (63%), Gaps = 10/307 (3%)
 Frame = -1

Query  1136  TTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDA  957
             + A +++GFY +TCP AE+IV++ + +  ++ P +AA ++R+  HDC V GCDGS+L++A
Sbjct  21    SEAQLKMGFYDQTCPYAEKIVQDVVNQHINNAPSLAAGLIRMHFHDCFVRGCDGSILINA  80

Query  956   TSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPE  777
             TS   +VEK AP N  TVRGF+ ID++K  +E  CPG+VSCADI+T + RD++V  G P 
Sbjct  81    TSSNQQVEKLAPPN-LTVRGFDFIDKVKSALESKCPGIVSCADIITLATRDSIVAIGGPT  139

Query  776   FEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHC  597
             + VP GRRDG +S   +A  N+  P      ++ LF ++GLDV+DLV L GAH+IGV+HC
Sbjct  140   WNVPTGRRDGRISNFAEAMNNIPPPFGNFTTLITLFGNQGLDVKDLVLLSGAHTIGVSHC  199

Query  596   SNFRYRL--------NTPARAKEVDGSLKVVMGTHCRNAATTIPMDSTTQYKMDSMFYKQ  441
             S+F  RL          P+   E   +LK        +  T + MD  ++   D  +Y+ 
Sbjct  200   SSFSNRLFNFTGVGDQDPSLDSEYADNLKSRRCLSIADNTTKVEMDPGSRNTFDLSYYRL  259

Query  440   LLQKKGLLESDERLAGDPRTLPLVEEFA-DDQAAWLGKFTESVIKMGKIRVLTGDEGEIR  264
             +L+++GL ESD  L  +P  L  V+ FA   +  +  +F+ S+ KMG+I V TG +GEIR
Sbjct  260   VLKRRGLFESDAALTMNPAALAQVKRFAGGSEQEFFAEFSNSMEKMGRIGVKTGSDGEIR  319

Query  263   KKCRFVN  243
             + C FVN
Sbjct  320   RTCAFVN  326



>ref|XP_010671316.1| PREDICTED: peroxidase 5-like [Beta vulgaris subsp. vulgaris]
Length=334

 Score =   255 bits (651),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 132/304 (43%), Positives = 184/304 (61%), Gaps = 9/304 (3%)
 Frame = -1

Query  1130  AGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATS  951
             A ++ GFY ++CP AE IVK+ + +AF  D G AA +VRL  HDC V GCD SVLLD+T 
Sbjct  32    ADLQPGFYMQSCPMAEFIVKDEVRQAFFSDRGYAAGLVRLHFHDCFVRGCDASVLLDSTP  91

Query  950   GGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFE  771
             G    EK A +N  ++RGF++ID  K  +E  CPG VSCADIL ++ARD++ ++G   ++
Sbjct  92    GNA-AEKDAEANNPSLRGFDVIDNAKARLENLCPGTVSCADILAYAARDSVEMTGGFGYD  150

Query  770   VPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSN  591
             VPGGRRDG VS   +A +NL  P   VD +  +F SKGL  E++V L GAH+IG +HC++
Sbjct  151   VPGGRRDGRVSSSSEATRNLPPPFADVDLLTKIFGSKGLTQEEMVILSGAHTIGRSHCTS  210

Query  590   FRYRL----NTPARAKEVDGSLKVVMGTHC----RNAATTIPMDSTTQYKMDSMFYKQLL  435
             F  RL     T A+   ++ +    +   C      A   +PMD  +    D+ +Y+ +L
Sbjct  211   FSKRLYSFSTTAAQDPSINSAYAAQLQRQCPAGNAGANIVVPMDPISPTISDTAYYRNIL  270

Query  434   QKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKC  255
               +GL  SD+ L  D  T  LV  +A +   W  KF  ++  MG+I VLTGDEGEIR  C
Sbjct  271   NNRGLFTSDQALLSDSTTASLVTLYARNPGLWGRKFATAMGSMGQIGVLTGDEGEIRSNC  330

Query  254   RFVN  243
             R +N
Sbjct  331   RVIN  334



>ref|XP_008340088.1| PREDICTED: peroxidase 57-like [Malus domestica]
Length=336

 Score =   255 bits (651),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 139/305 (46%), Positives = 184/305 (60%), Gaps = 17/305 (6%)
 Frame = -1

Query  1127  GMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSG  948
             G+ VGFY R CP  E+IV + + KA   D  + AA++RL  HDC V GCD S+LLD T  
Sbjct  33    GLHVGFYNRKCPNLEKIVIDVVAKAVEKDRKLPAALIRLFFHDCFVKGCDASLLLDVTPS  92

Query  947   GGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEV  768
             G  VE  +P++   VRG E+ID+IK  +E+ CPG VSCADIL F++R+A+ LSG+P +EV
Sbjct  93    GEPVEMLSPASF-GVRGLEVIDQIKARVEKECPGTVSCADILAFASREAVALSGLPRYEV  151

Query  767   PGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNF  588
             P GRRD   SR  D    L SP   + +++  F  KGL +E++VAL GAHSIG  HCS F
Sbjct  152   PAGRRDSRTSRASDV--ILPSPTTPLKELIDFFSRKGLSLEEMVALSGAHSIGTVHCSFF  209

Query  587   RYRLNTPARAKEVDGSLKVVMGTHCRN---AATTIPM----------DSTTQYKMDSMFY  447
              YR+   A  K  D SL  V          A   +P           D TT   +D+ +Y
Sbjct  210   DYRMYNFAPGKPKDPSLNEVFAAQLAQQCPAPNALPAEEAKKRAVDSDPTTPLVLDNHYY  269

Query  446   KQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEI  267
             K L+Q +GL+ESD+ L  DPRT  +VE+ A    ++   F  ++IKMG+I VLT D+GEI
Sbjct  270   KSLMQGRGLMESDQVLVIDPRTRGVVEKLARSD-SFARAFANAMIKMGRINVLTEDQGEI  328

Query  266   RKKCR  252
             RK CR
Sbjct  329   RKNCR  333



>ref|XP_007153059.1| hypothetical protein PHAVU_003G003100g [Phaseolus vulgaris]
 gb|ESW25053.1| hypothetical protein PHAVU_003G003100g [Phaseolus vulgaris]
Length=330

 Score =   254 bits (650),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 130/300 (43%), Positives = 185/300 (62%), Gaps = 8/300 (3%)
 Frame = -1

Query  1118  VGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSGGGR  939
             VGFY  TCP+AE IVK+ + KA   +PG+AA ++R+  HDC V GCDGSVLL +  G   
Sbjct  31    VGFYSFTCPSAEAIVKSTVEKAISANPGLAAGLIRMHFHDCFVRGCDGSVLLASIPGNPI  90

Query  938   VEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEVPGG  759
              E+ +  N  ++RGFE+I+  K+++E +CP  VSCADIL F+ARD+    G   ++VP G
Sbjct  91    AERDSFINNPSLRGFEVIEEAKKQVEAACPNTVSCADILAFAARDSASKVGAINYDVPSG  150

Query  758   RRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNFRYR  579
             RRDG VS   +  +NL  P F VD+++  F  KGL V+++V L GAHSIGVAHC  F  R
Sbjct  151   RRDGRVSIGDEVIQNLPGPGFVVDELIGNFAQKGLSVDEMVTLSGAHSIGVAHCGAFSNR  210

Query  578   L----NTPARAKEVDGSLKVVMGTHCRNAA----TTIPMDSTTQYKMDSMFYKQLLQKKG  423
             L    +T  +   +D S    +   C          + ++ +T  ++DS +Y+ L+  +G
Sbjct  211   LYSFSDTLRQDPSLDPSYAETLKAMCPPPPPITDAIVSLEPSTPIRLDSKYYEGLINHRG  270

Query  422   LLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRFVN  243
             LL SD+ L   P T  +VE  A + A W  KF  ++++MG I+VLTG +GEIRK+C FVN
Sbjct  271   LLTSDQTLFDTPSTKEIVESNAYNGANWAQKFALAMVRMGSIQVLTGSDGEIRKQCSFVN  330



>ref|XP_003555769.1| PREDICTED: peroxidase 5-like [Glycine max]
Length=329

 Score =   254 bits (650),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 127/301 (42%), Positives = 186/301 (62%), Gaps = 8/301 (3%)
 Frame = -1

Query  1121  RVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSGGG  942
             +VGFY  TCP+AE IVK+ + KA   +PG+AA ++R+  HDC V GCDGSVLL +T G  
Sbjct  29    KVGFYSSTCPSAEAIVKSTVEKAISANPGIAAGLIRMHFHDCFVRGCDGSVLLASTPGNP  88

Query  941   RVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEVPG  762
               E+    N  ++RGFE+I+  K ++E +CP  VSCADIL F+ARD++   G   ++VP 
Sbjct  89    ISERDNFVNNPSLRGFEVIEDAKNQIEAACPETVSCADILAFAARDSVSKVGGISYDVPS  148

Query  761   GRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNFRY  582
             GRRDG VS   +   NL  P  + D +++ F+ KGL  +++V L GAHSIGV+HC  F  
Sbjct  149   GRRDGRVSIGDEVLDNLPRPSLSADDLISNFERKGLSADEMVTLSGAHSIGVSHCGAFSN  208

Query  581   RL----NTPARAKEVDGSLKVVMGTHCRNAAT----TIPMDSTTQYKMDSMFYKQLLQKK  426
             RL    +T  +   +D S    + T C         T+ ++ +T  ++DS +Y+ L+  +
Sbjct  209   RLYSFSDTVTQDPSLDSSYAETLKTQCPPPPPTSDPTVSLEPSTPIRLDSKYYEGLINHR  268

Query  425   GLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRFV  246
             GLL SD+ L     T  +V+  A++ A+W  KF  ++++MG I VLTG +GEIRK+C FV
Sbjct  269   GLLTSDQTLYTSQSTRGMVQSNANNGASWADKFALAMLRMGSIEVLTGSDGEIRKQCSFV  328

Query  245   N  243
             N
Sbjct  329   N  329



>ref|XP_009382469.1| PREDICTED: peroxidase 5 {ECO:0000250|UniProtKB:P22195}-like [Musa 
acuminata subsp. malaccensis]
Length=334

 Score =   254 bits (650),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 131/315 (42%), Positives = 191/315 (61%), Gaps = 13/315 (4%)
 Frame = -1

Query  1151  AEAAETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGS  972
             A A+ T+A + +GFY +TCP+AE IV+  + +A  ++PG+AA ++R+  HDC V GCD S
Sbjct  18    AMASSTSASLHLGFYRKTCPSAEAIVRRTVSEAVANNPGLAAGLIRMHFHDCFVRGCDAS  77

Query  971   VLLDATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVL  792
             +LL+ +S G   EK AP N  ++RGFE+ID  K  +E  CP  VSCADI+ F+ARD+  L
Sbjct  78    LLLN-SSPGNTAEKDAPPNNPSMRGFEVIDAAKAAVEARCPSTVSCADIIAFAARDSAYL  136

Query  791   SGVPEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSI  612
             +G  ++ VP GRRDG VS + +A  N+  P+ T   +   F  KGL V+++V L GAHSI
Sbjct  137   AGGIDYPVPAGRRDGRVSLDSEALTNIPLPNLTAAGLRDSFAKKGLSVDEMVTLSGAHSI  196

Query  611   GVAHCSNFRYRLN----TPARAKEVDGSLKVVMGTHCRNAA--------TTIPMDSTTQY  468
             G AHC+ F  RL     T  +   +D +    + + C  +         TT+P+D+ T  
Sbjct  197   GRAHCTAFAPRLYNFNATHTQDPSMDPAFAAYLKSRCSPSTVDFTSKDPTTVPLDAVTPR  256

Query  467   KMDSMFYKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVL  288
             ++D+ +YK L +++GLL SD+ L     T  LV   A   + W  KF  ++++MG I VL
Sbjct  257   RLDNQYYKNLAKRRGLLFSDQTLQASRLTARLVRLDAKLGSVWAAKFAAAMVRMGHIEVL  316

Query  287   TGDEGEIRKKCRFVN  243
             TG +GEIRK C  VN
Sbjct  317   TGSQGEIRKMCGVVN  331



>ref|XP_010453985.1| PREDICTED: peroxidase 57 [Camelina sativa]
Length=310

 Score =   254 bits (648),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 130/300 (43%), Positives = 190/300 (63%), Gaps = 12/300 (4%)
 Frame = -1

Query  1130  AGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATS  951
             A +RVGFY R+CP AE IV+N + + F  DP V AA++R+  HDC V GCD S+L+D+T+
Sbjct  19    AQLRVGFYSRSCPQAETIVRNLVRQRFGVDPTVTAALLRMHFHDCFVRGCDASLLIDSTN  78

Query  950   GGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFE  771
                  EK A  NG +VR F+LIDRIK ++E +CP  VSCADI+T + RD++ L+G P + 
Sbjct  79    S----EKAAGPNG-SVREFDLIDRIKAQLEAACPSTVSCADIVTLATRDSVALAGGPSYS  133

Query  770   VPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSN  591
             +P GRRDG VS   D    L  P  +V   V+ F +KGL+  D VALLGAH++G  +C  
Sbjct  134   IPTGRRDGRVSNNVDV--ALPGPTISVSGAVSFFTNKGLNTFDAVALLGAHTVGQGNCGL  191

Query  590   FRYRLNTPARAKEVDGSLKVVMGTH----CRNAATTIPMDSTTQYKMDSMFYKQLLQKKG  423
             F  R+         D S+   + T     CRN+A+   +D +T  + D+ F+KQ+ +++G
Sbjct  192   FSDRITNFQGTGRPDSSMDPALVTSLRNTCRNSASA-ALDQSTPLRFDNQFFKQIRRRRG  250

Query  422   LLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRFVN  243
             +L+ D+RLA DP+T  +V  +A++ A +  +F  +++KMG + VLTG  GEIR+ CR  N
Sbjct  251   VLQVDQRLASDPQTRGIVARYANNNAFFKRQFVRAMVKMGAVDVLTGRNGEIRRNCRRFN  310



>ref|XP_007149959.1| hypothetical protein PHAVU_005G113800g [Phaseolus vulgaris]
 gb|ESW21953.1| hypothetical protein PHAVU_005G113800g [Phaseolus vulgaris]
Length=324

 Score =   254 bits (649),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 138/313 (44%), Positives = 194/313 (62%), Gaps = 13/313 (4%)
 Frame = -1

Query  1151  AEAAETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGS  972
             A  A T A +++GFY ++CP AE+I+   + +  H+ P +AAA++R+  HDC V GCDGS
Sbjct  14    ALVASTHAQLQLGFYAKSCPKAEKIILKFVHEHIHNAPSLAAALIRMHFHDCFVRGCDGS  73

Query  971   VLLDATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVL  792
             VLL++T+   + EK AP N  TVRGF+ IDRIK  +E  CPGVVSCADILT +ARD +V 
Sbjct  74    VLLNSTTN--QAEKDAPPN-LTVRGFDFIDRIKSLVEAECPGVVSCADILTLTARDTIVA  130

Query  791   SGVPEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSI  612
             +G P ++VP GRRDG VS   +AR N+ +P   +  +  LF ++GLD++DLV L GAH+I
Sbjct  131   TGGPFWKVPTGRRDGVVSILEEARNNIPAPFDNITTLQTLFDNQGLDLKDLVLLSGAHTI  190

Query  611   GVAHCSNFRYRL--------NTPARAKEVDGSLKVVMGTHCRNAATT-IPMDSTTQYKMD  459
             GVAHCS+   RL          P+   E   +LK           TT I MD  ++   D
Sbjct  191   GVAHCSSLSNRLFNFTGKGDQDPSLDSEYAENLKTFKCNDINKLNTTKIEMDPGSRKTFD  250

Query  458   SMFYKQLLQKKGLLESDERLAGDPRTLP-LVEEFADDQAAWLGKFTESVIKMGKIRVLTG  282
               +Y+Q+++++GL ESD  L  +  T   ++E        +  +F +S+ KMG+I+V TG
Sbjct  251   LDYYRQVIKRRGLFESDAALLNNEVTKSQIIELLQGSIENFFAEFADSIEKMGRIKVKTG  310

Query  281   DEGEIRKKCRFVN  243
              EGEIRK C FVN
Sbjct  311   TEGEIRKHCAFVN  323



>ref|NP_001065172.1| Os10g0536700 [Oryza sativa Japonica Group]
 gb|AAL58122.1|AC092697_10 putative peroxidase [Oryza sativa Japonica Group]
 gb|AAM76351.1|AC074196_9 putative peroxidase [Oryza sativa Japonica Group]
 gb|AAP54814.1| Peroxidase family protein, expressed [Oryza sativa Japonica Group]
 tpe|CAH69370.1| TPA: class III peroxidase 128 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF27086.1| Os10g0536700 [Oryza sativa Japonica Group]
Length=338

 Score =   254 bits (650),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 131/308 (43%), Positives = 185/308 (60%), Gaps = 17/308 (6%)
 Frame = -1

Query  1130  AGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATS  951
             A +RVGFY  +CP AE IV+  + KA   +PG+AA +VRL  HDC V GCD SVL+D+T 
Sbjct  31    AQLRVGFYDNSCPAAEIIVQQEVSKAVSANPGLAAGLVRLHFHDCFVRGCDASVLIDSTK  90

Query  950   GGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFE  771
             G  + EK A  N  ++RGFE++DRIK  +EQ+C GVVSCADIL F+ARD++ L+G   ++
Sbjct  91    GN-QAEKDAGPN-TSLRGFEVVDRIKARVEQACFGVVSCADILAFAARDSVALTGGNAYQ  148

Query  770   VPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSN  591
             VP GRRDG+VSR  D   NL  P  +V Q+  +F +KGL   ++VAL GAH+IG +HCS+
Sbjct  149   VPAGRRDGSVSRSSDTGGNLPPPTASVSQLTQMFAAKGLSQREMVALSGAHTIGASHCSS  208

Query  590   FRYRL---------NTPARAKEVDGSLKVVMGTHCRNAATT------IPMDSTTQYKMDS  456
             F  RL             +   +D +    +   C  +         +PMD+ T    D 
Sbjct  209   FSSRLYRAGTTAGGAGGGQDPTMDPAYVAQLAQQCPQSGGAAGGGALVPMDAVTPNAFDE  268

Query  455   MFYKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDE  276
              F+K ++  +GLL SD+ L GD  T   V  +A+D + +   F  +++KMG + VLTG  
Sbjct  269   GFFKGVMNNRGLLSSDQALLGDKNTAVQVVAYANDASTFQSDFAAAMVKMGAVGVLTGSS  328

Query  275   GEIRKKCR  252
             G++R  CR
Sbjct  329   GKVRANCR  336



>ref|XP_006372957.1| hypothetical protein POPTR_0017s06550g [Populus trichocarpa]
 gb|ERP50754.1| hypothetical protein POPTR_0017s06550g [Populus trichocarpa]
 gb|AHL39190.1| class III peroxidase [Populus trichocarpa]
Length=328

 Score =   254 bits (649),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 130/309 (42%), Positives = 185/309 (60%), Gaps = 11/309 (4%)
 Frame = -1

Query  1139  ETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLD  960
              T   +++GFY R+CP AE+IV++++ +  H+ P VAA I+R+  HDC V GCD S+LL+
Sbjct  20    STEGQLQMGFYSRSCPNAEKIVQDYVNRHIHNAPSVAATILRMHFHDCFVRGCDASLLLN  79

Query  959   ATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVP  780
              TS G + EK A  N  T+RGF+ IDR+K  +E +CPGVVSCAD++   ARDA+V +G P
Sbjct  80    TTSSGNQTEKLATPN-VTLRGFDFIDRVKSLLEAACPGVVSCADVIALVARDAVVATGGP  138

Query  779   EFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAH  600
              ++VP GRRDG +SR  +A  N+  P      +  LF ++GLD++DLV L GAH+IGV+H
Sbjct  139   FWKVPTGRRDGTISRSSEASNNIPPPTSNFTSLQRLFANQGLDLKDLVVLSGAHTIGVSH  198

Query  599   CSNFRYRLNT---------PARAKEVDGSLKVVMGTHCRNAATTIPMDSTTQYKMDSMFY  447
             CS+F  RL           PA   E   +LK        +  T + MD  +    D  +Y
Sbjct  199   CSSFSNRLYNFTGVLGTQDPALDSEYAANLKARKCRSLNDNTTIVEMDPGSFRTFDLSYY  258

Query  446   KQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAA-WLGKFTESVIKMGKIRVLTGDEGE  270
               LL+++GL +SD  L  +  TL  V +        +  +F +S+ KMG+I V TG  GE
Sbjct  259   GHLLKRRGLFQSDSALTTNSTTLSFVNQLLQGSLENFFAEFADSMEKMGRINVKTGTVGE  318

Query  269   IRKKCRFVN  243
             IRK+C  VN
Sbjct  319   IRKQCAVVN  327



>ref|XP_006846505.1| hypothetical protein AMTR_s00018p00156910 [Amborella trichopoda]
 gb|ERN08180.1| hypothetical protein AMTR_s00018p00156910 [Amborella trichopoda]
Length=326

 Score =   254 bits (649),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 125/307 (41%), Positives = 190/307 (62%), Gaps = 14/307 (5%)
 Frame = -1

Query  1133  TAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDAT  954
             TA +   FY  TCP AE I+K  +   F+ DP + AA++R+  HDC V GCD S+L+++T
Sbjct  17    TAQLSFNFYRSTCPNAEFIIKTLVFNKFNKDPSITAALLRMHFHDCFVRGCDASILINST  76

Query  953   SGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEF  774
             S   + EK A  N +TVRG+E ID IK ++E+ CP  VSCADI+T + RDA+ LSG P +
Sbjct  77    SNN-QAEKDAGPN-ETVRGYEFIDEIKTQLEKKCPNTVSCADIITAATRDAVALSGGPSY  134

Query  773   EVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCS  594
              +P GRRDG +S   D   NL  P  +V Q  + F++KG  ++++V LLGAH++GVAHC 
Sbjct  135   PIPTGRRDGLISNANDV--NLPGPSLSVSQAFSFFRAKGFTLKEMVTLLGAHTVGVAHCG  192

Query  593   NFRYRLNTPARAKEVDGSLKVVMGTHCRN--AATTIP--------MDSTTQYKMDSMFYK  444
              FR RL       + D S+   + +  +    ++++P        +D  T +++D+ FY 
Sbjct  193   FFRGRLFNFQGTGKPDPSMDTALVSKLQKLCGSSSLPTVRDPTAFLDQNTSFRVDNEFYN  252

Query  443   QLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIR  264
             Q+L+K+G+L+ D+ L  D  ++  V +F+ D   +L  F ++++KMGK+ VL G+ GEIR
Sbjct  253   QVLKKRGILQIDQALGNDRSSVGFVRQFSSDGNGFLKTFVDAMVKMGKLEVLVGNAGEIR  312

Query  263   KKCRFVN  243
             KKC   N
Sbjct  313   KKCGVFN  319



>ref|XP_011075883.1| PREDICTED: peroxidase 5-like [Sesamum indicum]
Length=325

 Score =   254 bits (648),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 133/306 (43%), Positives = 181/306 (59%), Gaps = 8/306 (3%)
 Frame = -1

Query  1139  ETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLD  960
             E+ A ++VGFY  +C  AE IVK  +   F  D GVAA +VRL  HDC V GCDGSVL+D
Sbjct  20    ESEAQLQVGFYQSSCGLAELIVKQEVRIGFIKDKGVAAGLVRLHFHDCFVRGCDGSVLID  79

Query  959   ATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVP  780
             +T      EK AP N  ++RGFE+ID  K  +E  C GVVSCADIL F+ARD++ ++G  
Sbjct  80    STPSN-TAEKDAPPNNPSLRGFEVIDNAKSRLEAICKGVVSCADILAFAARDSIEITGGL  138

Query  779   EFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAH  600
              ++VP GRRDG VS   +A  NL  P F V+Q+  +F +KGL  E++V L GAH++G +H
Sbjct  139   GYDVPAGRRDGRVSVASEALSNLPPPTFDVNQLTKMFATKGLTQEEMVTLSGAHTLGRSH  198

Query  599   CSNFRYRLNTPARAKEVDGSLKVVMGTHCR-------NAATTIPMDSTTQYKMDSMFYKQ  441
             C++F  RL         D +L        R       NA   +PMD ++    D  +YK 
Sbjct  199   CTSFINRLYNFNSNSSQDPTLDTTYAAQLRQKCPQNSNANLVVPMDPSSPAFTDVGYYKG  258

Query  440   LLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRK  261
             +L  +GLL SD+ L   P+T   V +   +   W  KF  +++KMGKI VLTG+ GE+R 
Sbjct  259   VLANRGLLTSDQTLLTSPQTQFQVVQNVQNPFLWRNKFAAAMVKMGKIGVLTGNAGEVRA  318

Query  260   KCRFVN  243
              CR +N
Sbjct  319   NCRVIN  324



>ref|NP_001048794.1| Os03g0121300 [Oryza sativa Japonica Group]
 gb|AAM52318.1|AC105363_7 Putative peroxidase [Oryza sativa Japonica Group]
 tpe|CAH69276.1| TPA: class III peroxidase 34 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF10708.1| Os03g0121300 [Oryza sativa Japonica Group]
 gb|EAY88316.1| hypothetical protein OsI_09775 [Oryza sativa Indica Group]
 gb|EAZ25393.1| hypothetical protein OsJ_09211 [Oryza sativa Japonica Group]
Length=322

 Score =   254 bits (648),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 131/299 (44%), Positives = 185/299 (62%), Gaps = 7/299 (2%)
 Frame = -1

Query  1124  MRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSGG  945
             ++VGFY ++CP AE IV++ + KA   + G+AA +VR+  HDC V GCD SVLLD+T+  
Sbjct  26    LQVGFYDQSCPQAEVIVRDEVGKAVSANVGLAAGLVRMHFHDCFVKGCDASVLLDSTANS  85

Query  944   GRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEVP  765
                EK A  N K++RGFE++D  K  +E +C GVVSCADIL F+ARD++VL+G   + VP
Sbjct  86    -TAEKDAIPN-KSLRGFEVVDSAKRRLESACKGVVSCADILAFAARDSVVLAGGTPYRVP  143

Query  764   GGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNFR  585
              GRRDGN S   DA  NL  P   V Q+   F + GL  +D+V L GAH+IGVAHCS+F 
Sbjct  144   AGRRDGNTSVASDAMANLPRPTSDVAQLTQSFATHGLSQDDMVILSGAHTIGVAHCSSFS  203

Query  584   YRLNTPARAKEVDGSLKVVMGTHC-----RNAATTIPMDSTTQYKMDSMFYKQLLQKKGL  420
              RL     +   D +L   M +       + +A T+ MD  ++   D+ +Y+ LL  +G+
Sbjct  204   SRLYGYNSSTGQDPALNAAMASRLSRSCPQGSANTVAMDDGSENTFDTSYYQNLLAGRGV  263

Query  419   LESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRFVN  243
             L SD+ L  D  T  LV + A +   +  KF ++++KMG I+VLTG +G+IR  CR  N
Sbjct  264   LASDQTLTADNATAALVAQNAYNMYLFATKFGQAMVKMGAIQVLTGSDGQIRTNCRVAN  322



>ref|XP_004310166.1| PREDICTED: peroxidase 1-like [Fragaria vesca subsp. vesca]
Length=349

 Score =   254 bits (650),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 131/306 (43%), Positives = 183/306 (60%), Gaps = 13/306 (4%)
 Frame = -1

Query  1124  MRVGFYGRTCPTAEEIVKNHMVKAFH-DDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSG  948
             + VGFY +TCP  E+IV + +VK F   DP +  A++RL  HDC V GCD S+LLDAT  
Sbjct  36    LHVGFYSKTCPQVEDIVSD-VVKRFQAQDPKLPPALLRLFFHDCFVKGCDASILLDATPS  94

Query  947   GGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEV  768
             G  VEK + +NGKT+RG E+ID IK E+E+SCP  VSCADI+ ++AR+A+ L+G+P  +V
Sbjct  95    GQPVEKLSEANGKTLRGLEVIDEIKAELEKSCPRTVSCADIIAYAAREAVALAGLPRHDV  154

Query  767   PGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNF  588
             P GRRD   SR  DA  +L +P   + Q++ +F  +   +ED+V + GAHSIG + C+  
Sbjct  155   PAGRRDSTTSRATDADVSLPTPTMPLQQIIGIFNQRNFSLEDIVVMSGAHSIGESQCNQV  214

Query  587   RYRLNTPARAKEVDGSLKVVMGTH-CRNAATTIPMDSTTQYK----------MDSMFYKQ  441
               R+ T A     D +L         +     +P D    +K          +D+ +Y  
Sbjct  215   NRRIYTFAPNVPRDPALDPAYADELAQKCPAQVPPDQELNFKVNLDPVTPEVLDNQYYLN  274

Query  440   LLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRK  261
             L QKKGL  SD+ LA DP T  +V + A    AW  +F +++IKMG+ +VLT DEGEIR 
Sbjct  275   LQQKKGLFRSDQALATDPGTQEIVNQMAASNEAWTKRFIKNMIKMGRSQVLTRDEGEIRL  334

Query  260   KCRFVN  243
              CR  N
Sbjct  335   NCREFN  340



>gb|EAY79346.1| hypothetical protein OsI_34475 [Oryza sativa Indica Group]
Length=335

 Score =   254 bits (649),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 132/305 (43%), Positives = 186/305 (61%), Gaps = 14/305 (5%)
 Frame = -1

Query  1130  AGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATS  951
             A +RVGFY  +CP AE IV+  + KA   +PG+AA +VRL  HDC V GCD SVL+D+T 
Sbjct  31    AQLRVGFYDNSCPAAEIIVQQEVSKAVSANPGLAAGLVRLHFHDCFVRGCDASVLIDSTK  90

Query  950   GGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFE  771
                + EK A  N  ++RGFE++DRIK  +EQ+C GVVSCADIL F+ARD++ L+G   ++
Sbjct  91    VN-QAEKDAGPN-TSLRGFEVVDRIKARVEQACFGVVSCADILAFAARDSVALTGGNAYQ  148

Query  770   VPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSN  591
             VP GRRDG+VSR  D   NL  P  +V Q+  +F +KGL   ++VAL GAH+IG +HCS+
Sbjct  149   VPAGRRDGSVSRSSDTGGNLPPPTASVSQLTQMFAAKGLSQREMVALSGAHTIGASHCSS  208

Query  590   FR---YRLNTPARAKE---VDGSLKVVMGTHCRNAATT------IPMDSTTQYKMDSMFY  447
             F    YR  T A   +   +D +    +   C  +         +PMD+ T    D  F+
Sbjct  209   FSSRLYRAGTTAGGGQDPTMDPAYVAQLAQQCPQSGGAAGGGALVPMDAVTPNAFDEGFF  268

Query  446   KQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEI  267
             K ++  +GLL SD+ L GD  T   V  +A+D + +   F  +++KMG + VLTG  G++
Sbjct  269   KGVMNNRGLLSSDQALLGDKNTAVQVVAYANDASTFQSDFAAAMVKMGAVGVLTGSSGKV  328

Query  266   RKKCR  252
             R  CR
Sbjct  329   RANCR  333



>ref|XP_007145114.1| hypothetical protein PHAVU_007G211100g [Phaseolus vulgaris]
 gb|ESW17108.1| hypothetical protein PHAVU_007G211100g [Phaseolus vulgaris]
Length=324

 Score =   254 bits (648),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 127/302 (42%), Positives = 188/302 (62%), Gaps = 7/302 (2%)
 Frame = -1

Query  1133  TAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDAT  954
             +A ++  FY  TCP+AE IV++ + KA   +PG+AA ++R+  HDC V GCDGSVLL++T
Sbjct  25    SASLKADFYKTTCPSAESIVRSAVEKAVSLNPGIAAGLIRMHFHDCFVRGCDGSVLLEST  84

Query  953   SGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEF  774
              G    E+  P+N  ++RGF++ID  K ++E  CP  VSCADIL F+ARD+    G   +
Sbjct  85    PGNPS-ERDHPANNPSLRGFQVIDEAKAQIEAECPHTVSCADILAFAARDSANKVGGINY  143

Query  773   EVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCS  594
              VP GRRDG VS   +A + L  P    DQ++A F+ KGL  +++V L GAHSIGV+HCS
Sbjct  144   AVPAGRRDGRVSIRDEASQ-LPLPTSNADQLIANFRRKGLSADEMVTLSGAHSIGVSHCS  202

Query  593   NFRYRLN----TPARAKEVDGSLKVVMGTHCRNAA-TTIPMDSTTQYKMDSMFYKQLLQK  429
             +F  RL     T  +   +D      + + C   +  T+P+D++T  ++D+ +Y +L + 
Sbjct  203   SFSDRLYSFNATFPQDPSMDSKYATSLKSKCPAGSDNTVPLDASTPNRLDNKYYTELKKH  262

Query  428   KGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRF  249
             +GLL SD+ L G P T P++   A   + W  KF ++++ MG I VLTG +GEIR +C  
Sbjct  263   RGLLTSDQTLLGSPSTRPMLLTNAKHSSVWARKFAKAMVHMGSIDVLTGSQGEIRTRCAL  322

Query  248   VN  243
             VN
Sbjct  323   VN  324



>gb|ACU19509.1| unknown [Glycine max]
Length=326

 Score =   254 bits (648),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 136/310 (44%), Positives = 187/310 (60%), Gaps = 13/310 (4%)
 Frame = -1

Query  1142  AETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLL  963
             A T A +++GFY ++CP AE+IV   +    H+ P +AAA++R+  HDC V GCD SVLL
Sbjct  19    ASTHAQLQLGFYAKSCPNAEQIVLKFVHDHIHNAPSLAAALIRMHFHDCFVRGCDASVLL  78

Query  962   DATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGV  783
             ++T+   + EK AP N  TVRGF+ IDRIK  +E  CPGVVSCADILT SARD +V +G 
Sbjct  79    NSTTN--QAEKNAPPN-LTVRGFDFIDRIKSLVEAECPGVVSCADILTLSARDTIVATGG  135

Query  782   PEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVA  603
             P ++VP GRRDG +S   +AR N+ +P      +  LF ++GLD++DLV L GAH+IG+A
Sbjct  136   PFWKVPTGRRDGVISNLTEARDNIPAPSSNFTTLQTLFANQGLDLKDLVLLSGAHTIGIA  195

Query  602   HCSNFRYRL--------NTPARAKEVDGSLKVVMGTHCRNAATT-IPMDSTTQYKMDSMF  450
             HCS+   RL          P+   E   +LK    T      TT I MD  ++   D  +
Sbjct  196   HCSSLSNRLFNFTGKGDQDPSLGSEYAANLKAFKCTDLNKLNTTKIEMDPRSRKTFDLSY  255

Query  449   YKQLLQKKGLLESDERLAGDPRT-LPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEG  273
             Y  +++++GL ESD  L  +  T   ++E        +  +F  S+ KMG+I V TG EG
Sbjct  256   YSHVIKRRGLFESDAALLTNSVTKAQIIELLEGSVENFFAEFATSMEKMGRINVKTGTEG  315

Query  272   EIRKKCRFVN  243
             EIRK C FVN
Sbjct  316   EIRKHCAFVN  325



>emb|CAN68183.1| hypothetical protein VITISV_028562 [Vitis vinifera]
Length=322

 Score =   254 bits (648),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 132/307 (43%), Positives = 184/307 (60%), Gaps = 10/307 (3%)
 Frame = -1

Query  1136  TTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDA  957
             ++A ++VGFY  TCP+AE IV+  + KA   +PG+AA ++R+  HDC V GCDGSVLLD+
Sbjct  17    SSASLKVGFYKYTCPSAETIVRKVVNKAVSRNPGMAAGLIRMHFHDCFVRGCDGSVLLDS  76

Query  956   TSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPE  777
             T G    EK+ P+N  ++RGFE+ID  K E+E  CP  VSCAD+L F+ARD+    G   
Sbjct  77    TPGNPS-EKENPANNPSLRGFEVIDAAKAEIEAQCPQTVSCADVLAFAARDSAYKVGGIN  135

Query  776   FEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHC  597
             + VP GRRDG VS + +   +L  P F   Q+   F  KGL ++++V L GAHSIGV+HC
Sbjct  136   YAVPSGRRDGRVSLKDEPSLHLPPPFFNAKQLEDNFARKGLTLDEMVTLSGAHSIGVSHC  195

Query  596   SNFRYRLNTPARAKEVDGSLKVVMGTHCRN---------AATTIPMDSTTQYKMDSMFYK  444
             S+F  RL +       D S+      H +          +  T+P++  T  K+D+ +YK
Sbjct  196   SSFSNRLYSFNATHPQDPSMDPEFARHLKTKCPPPSNTGSDPTVPLEIQTPNKLDNKYYK  255

Query  443   QLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIR  264
              L   +GLL SD+ L   P T  +V+  A     W  KF  ++++MG I VLTG +GEIR
Sbjct  256   DLKNHRGLLASDQTLFYSPSTARMVKNNARYGENWGNKFAAAMVRMGAIDVLTGTQGEIR  315

Query  263   KKCRFVN  243
             K CR VN
Sbjct  316   KNCRVVN  322



>ref|XP_002319196.2| hypothetical protein POPTR_0013s06300g [Populus trichocarpa]
 gb|EEE95119.2| hypothetical protein POPTR_0013s06300g [Populus trichocarpa]
 gb|AHL39174.1| class III peroxidase [Populus trichocarpa]
Length=353

 Score =   254 bits (650),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 138/299 (46%), Positives = 188/299 (63%), Gaps = 11/299 (4%)
 Frame = -1

Query  1130  AGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATS  951
             A +RVGFY  TCP AE I+   + K F+ D  V AA++R+  HDC V GCD S+L+D+T+
Sbjct  19    ADLRVGFYKPTCPDAESIIFQAVQKRFNTDKSVTAALLRMHFHDCFVRGCDASILIDSTT  78

Query  950   GGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFE  771
                + EK A  N +TVR +ELID IK+ +E  CP  VSCADI+T + RDA+VL+G P + 
Sbjct  79    QN-QAEKDAGPN-QTVREYELIDEIKKALEAKCPSKVSCADIITVATRDAVVLAGGPNYT  136

Query  770   VPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSN  591
             VP GRRDG VSR  D   NL  P   V Q   +F++KGL +E++V LLGAH++GVAHCS 
Sbjct  137   VPTGRRDGLVSRAGDV--NLPGPQVDVSQAFQIFRAKGLTLEEMVILLGAHTVGVAHCSF  194

Query  590   FRYRL-NTPARAKEVDGSLKVVMGTHCRNAAT--TIPMDSTTQYKMDSMFYKQLLQKKGL  420
             F  RL N P+    +D +L   +   C N  T  T+ +D  T + +D+ FYKQLL K+G+
Sbjct  195   FSERLQNDPS----MDANLAANLSNVCANPNTDPTVLLDQGTGFVVDNEFYKQLLLKRGI  250

Query  419   LESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRFVN  243
             +  D+ LA D  T   V  FA D   +   F ++++KMG + VL G+ GE+RK CR  N
Sbjct  251   MHIDQELAIDSSTSGFVSRFARDGNGFKQSFGKAMVKMGSVGVLVGNGGEVRKNCRVFN  309



>gb|ABK93918.1| unknown [Populus trichocarpa]
Length=328

 Score =   254 bits (648),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 130/309 (42%), Positives = 185/309 (60%), Gaps = 11/309 (4%)
 Frame = -1

Query  1139  ETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLD  960
              T   +++GFY R+CP AE+IV++++ +  H+ P VAA I+R+  HDC V GCD S+LL+
Sbjct  20    STEGQLQMGFYSRSCPNAEKIVQDYVNRHVHNAPSVAATILRMHFHDCFVRGCDASLLLN  79

Query  959   ATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVP  780
              TS G + EK A  N  T+RGF+ IDR+K  +E +CPGVVSCAD++   ARDA+V +G P
Sbjct  80    TTSSGNQTEKLATPN-VTLRGFDFIDRVKSLLEAACPGVVSCADVIALVARDAVVATGGP  138

Query  779   EFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAH  600
              ++VP GRRDG +SR  +A  N+  P      +  LF ++GLD++DLV L GAH+IGV+H
Sbjct  139   FWKVPTGRRDGTISRSSEASNNIPPPTSNFTSLQRLFANQGLDLKDLVVLSGAHTIGVSH  198

Query  599   CSNFRYRLNT---------PARAKEVDGSLKVVMGTHCRNAATTIPMDSTTQYKMDSMFY  447
             CS+F  RL           PA   E   +LK        +  T + MD  +    D  +Y
Sbjct  199   CSSFSNRLYNFTGVLGTQDPALDSEYAANLKARKCRSLNDNTTIVEMDPGSFRTFDLSYY  258

Query  446   KQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAA-WLGKFTESVIKMGKIRVLTGDEGE  270
               LL+++GL +SD  L  +  TL  V +        +  +F +S+ KMG+I V TG  GE
Sbjct  259   GHLLKRRGLFQSDSALTTNSTTLSFVNQLLQGSLENFFAEFADSMEKMGRINVKTGTVGE  318

Query  269   IRKKCRFVN  243
             IRK+C  VN
Sbjct  319   IRKQCAVVN  327



>ref|XP_011092685.1| PREDICTED: peroxidase 5-like [Sesamum indicum]
Length=335

 Score =   254 bits (648),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 133/312 (43%), Positives = 185/312 (59%), Gaps = 12/312 (4%)
 Frame = -1

Query  1145  AAETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVL  966
             A  + A +RVG+Y  +CP+AE IV+  + KA   + G+ A ++R+  HDC V GCD SVL
Sbjct  25    ATVSLASLRVGYYQNSCPSAEAIVRKVVEKAVSRNLGLGAGLIRMHFHDCFVRGCDASVL  84

Query  965   LDATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSG  786
             LD+T G  R EKQ P+N  ++RGFE+ID  K E+E +CP  VSCADI+ F+ARD+    G
Sbjct  85    LDSTPGR-RSEKQHPANNPSLRGFEVIDEAKAELEFACPRTVSCADIIAFAARDSAYRLG  143

Query  785   VPEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGV  606
               ++ VP GRRDG +S E D   NL  P F   Q+   F  KGL +E++V L GAHS+GV
Sbjct  144   NIKYMVPSGRRDGRISLEDDVTANLPPPSFNAAQLEQNFARKGLTMEEMVTLSGAHSVGV  203

Query  605   AHCSNFRYRLNTPARAKEVDGSLKVVMGTHCR-----------NAATTIPMDSTTQYKMD  459
             +HCS+F  RL +       D SL   +    R           N+   + +D  T  ++D
Sbjct  204   SHCSSFSNRLYSFNSTHPQDPSLDPDLARELRKSCPRPDGEAGNSDRVVALDFATPNRLD  263

Query  458   SMFYKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGD  279
             + +Y  L   + LL SD+ L    R+  +V   A   A+W GKF ++++KMG I VLTG+
Sbjct  264   NRYYLNLKSGRVLLTSDQTLLSSARSGWMVRRNAKHGASWAGKFADAMVKMGYIDVLTGN  323

Query  278   EGEIRKKCRFVN  243
             +GEIR  CRFVN
Sbjct  324   QGEIRNNCRFVN  335



>ref|XP_003571312.2| PREDICTED: peroxidase 47 [Brachypodium distachyon]
Length=321

 Score =   253 bits (647),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 133/300 (44%), Positives = 185/300 (62%), Gaps = 4/300 (1%)
 Frame = -1

Query  1142  AETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLL  963
             A T A + V +Y   CP AE +V++ + KA   DP +AA ++RL  HDC V GCD SVLL
Sbjct  24    ATTVAALSVDYYAMGCPFAEYMVRDVVNKAVMADPTLAAGLLRLHFHDCFVQGCDASVLL  83

Query  962   DATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGV  783
             D+T      EK AP+N K++RGFE+ID+IK+ +E  CPGVVSCADIL  +ARDA++ +G 
Sbjct  84    DSTPKN-TAEKDAPAN-KSLRGFEVIDKIKQILESQCPGVVSCADILALAARDAVLAAGG  141

Query  782   PEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVA  603
             P + VP GRRDG+ S   D    L SP      + ALF + G DV+D+VAL G H++GVA
Sbjct  142   PYYMVPVGRRDGSRSVFTDTFTALPSPFLNASALTALFATHGFDVQDMVALSGGHTLGVA  201

Query  602   HCSNFRYRLNTPARAKEVDGSLKVVMGTHCRNAATTIPMDSTTQYKMDSMFYKQLLQKKG  423
             HC++F+ R+       E  G    + GT  +  + T   D T+    D +++K+L Q++G
Sbjct  202   HCASFKNRIAAETSTLE-SGLAASLAGTCAKGDSATAAFDRTST-AFDGVYFKELQQRRG  259

Query  422   LLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRFVN  243
             LL SD+ L   P T  LV  FA +QA +   F + + KMG+I +  G +GE+RK CR VN
Sbjct  260   LLTSDQTLFESPETQMLVNTFAMNQAYFFYAFQQGMYKMGQIDLKEGTQGEVRKSCRVVN  319



>ref|XP_006372959.1| hypothetical protein POPTR_0017s06570g [Populus trichocarpa]
 gb|ERP50756.1| hypothetical protein POPTR_0017s06570g [Populus trichocarpa]
Length=321

 Score =   253 bits (647),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 130/306 (42%), Positives = 187/306 (61%), Gaps = 10/306 (3%)
 Frame = -1

Query  1136  TTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDA  957
             T A +++GFY  +CP AE+IV+  + +  H+ P +AA ++R+  HDC V GCD SVLL+ 
Sbjct  17    TEAQLKMGFYNTSCPKAEKIVQGFVNQHIHNAPSLAATLIRMHFHDCFVRGCDASVLLNT  76

Query  956   TSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPE  777
             TSG  + EK A  N  T+RGF+ IDR+K  +E  CPG+VSCADILT  ARD++V +G P 
Sbjct  77    TSGE-QPEKAATPN-LTLRGFDFIDRVKRLVEAECPGIVSCADILTLVARDSIVATGGPF  134

Query  776   FEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHC  597
             + VP GRRDG +SR  +A  N+ SP      +  LF ++GLD++DLV L GAH+IG+AHC
Sbjct  135   WRVPTGRRDGLISRSSEALSNVPSPMINFTTLQTLFANQGLDLKDLVLLSGAHTIGIAHC  194

Query  596   SNFRYRLNT--------PARAKEVDGSLKVVMGTHCRNAATTIPMDSTTQYKMDSMFYKQ  441
              +F  RL          PA   E   +LK        +  T + MD  ++   D  +YK 
Sbjct  195   QSFSNRLYNFTGTGDEDPALDSEYAANLKARKCRSISDNTTIVEMDPGSRKTFDLSYYKL  254

Query  440   LLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRK  261
             LL+++GL +SD  L  +  TL ++ +       +  +F++S+ KMG+IRV TG  GEIR+
Sbjct  255   LLKRRGLFQSDAALTTNSNTLSMIRQILQGSIDFRSEFSKSMEKMGRIRVKTGSNGEIRR  314

Query  260   KCRFVN  243
             +C  VN
Sbjct  315   QCALVN  320



>ref|XP_006372960.1| hypothetical protein POPTR_0017s06570g [Populus trichocarpa]
 gb|ABK93506.1| unknown [Populus trichocarpa]
 gb|ERP50757.1| hypothetical protein POPTR_0017s06570g [Populus trichocarpa]
 gb|AHL39191.1| class III peroxidase [Populus trichocarpa]
Length=325

 Score =   253 bits (647),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 131/311 (42%), Positives = 188/311 (60%), Gaps = 10/311 (3%)
 Frame = -1

Query  1151  AEAAETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGS  972
             A    T A +++GFY  +CP AE+IV+  + +  H+ P +AA ++R+  HDC V GCD S
Sbjct  16    AFMGSTEAQLKMGFYNTSCPKAEKIVQGFVNQHIHNAPSLAATLIRMHFHDCFVRGCDAS  75

Query  971   VLLDATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVL  792
             VLL+ TSG  + EK A  N  T+RGF+ IDR+K  +E  CPG+VSCADILT  ARD++V 
Sbjct  76    VLLNTTSGE-QPEKAATPN-LTLRGFDFIDRVKRLVEAECPGIVSCADILTLVARDSIVA  133

Query  791   SGVPEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSI  612
             +G P + VP GRRDG +SR  +A  N+ SP      +  LF ++GLD++DLV L GAH+I
Sbjct  134   TGGPFWRVPTGRRDGLISRSSEALSNVPSPMINFTTLQTLFANQGLDLKDLVLLSGAHTI  193

Query  611   GVAHCSNFRYRLNT--------PARAKEVDGSLKVVMGTHCRNAATTIPMDSTTQYKMDS  456
             G+AHC +F  RL          PA   E   +LK        +  T + MD  ++   D 
Sbjct  194   GIAHCQSFSNRLYNFTGTGDEDPALDSEYAANLKARKCRSISDNTTIVEMDPGSRKTFDL  253

Query  455   MFYKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDE  276
              +YK LL+++GL +SD  L  +  TL ++ +       +  +F++S+ KMG+IRV TG  
Sbjct  254   SYYKLLLKRRGLFQSDAALTTNSNTLSMIRQILQGSIDFRSEFSKSMEKMGRIRVKTGSN  313

Query  275   GEIRKKCRFVN  243
             GEIR++C  VN
Sbjct  314   GEIRRQCALVN  324



>ref|XP_011037006.1| PREDICTED: peroxidase 3-like [Populus euphratica]
Length=328

 Score =   253 bits (646),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 131/310 (42%), Positives = 185/310 (60%), Gaps = 11/310 (4%)
 Frame = -1

Query  1142  AETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLL  963
               T   +++ FY R+CP AE+IV++++ +  H+ P +AA I+R+  HDC V GCDGSVLL
Sbjct  19    GSTEGQLQMDFYSRSCPNAEKIVQDYVNRHIHNAPSLAATILRMHFHDCFVRGCDGSVLL  78

Query  962   DATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGV  783
             + TS G + EK A  N  T+RGF  ID +K  +E +CPGVVSCAD++   ARDA+V +G 
Sbjct  79    NTTSSGNQTEKLATPN-LTLRGFGFIDGVKSLLEAACPGVVSCADVIALVARDAIVATGG  137

Query  782   PEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVA  603
             P ++VP GRRDG +SR  +A  N+  P      +  LF ++GLD++DLV L GAH+IGVA
Sbjct  138   PFWKVPTGRRDGTISRSSEASNNIPPPTSNFTNLRTLFANQGLDLKDLVVLSGAHTIGVA  197

Query  602   HCSNFRYRLNT---------PARAKEVDGSLKVVMGTHCRNAATTIPMDSTTQYKMDSMF  450
             HCS+F  RL           PA   E   +LK        +  T + MD  +    D  +
Sbjct  198   HCSSFSNRLYNFTGVLGSQDPALDSEYADNLKARKCRSLNDNTTIVEMDPGSFRTFDLSY  257

Query  449   YKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAA-WLGKFTESVIKMGKIRVLTGDEG  273
             Y+ LL+++GL +SD  L  +  TL LV +        +  +F +S+ KMG+I V TG  G
Sbjct  258   YRHLLKRRGLFQSDSALTTNSTTLSLVNQLLQGSLENFFAEFADSMEKMGRINVKTGTVG  317

Query  272   EIRKKCRFVN  243
             EIRK+C  VN
Sbjct  318   EIRKQCAVVN  327



>ref|XP_008246297.1| PREDICTED: peroxidase 5-like [Prunus mume]
Length=327

 Score =   253 bits (646),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 130/305 (43%), Positives = 181/305 (59%), Gaps = 9/305 (3%)
 Frame = -1

Query  1133  TAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDAT  954
             +A  +VGFY R+CP AE IV+  + KA   +PG+AA ++R+  HDC V GCD S+LLD+T
Sbjct  24    SAAPKVGFYQRSCPAAEAIVRKAVNKAVAKNPGIAAGLIRMHFHDCFVRGCDASILLDST  83

Query  953   SGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEF  774
              G    EK+ P+N  ++RGFE+ID  K E+E  CP  VSCADIL F+ARD+ +  G   +
Sbjct  84    PGQPS-EKEHPANNPSLRGFEVIDEAKAEIEAKCPKTVSCADILAFAARDSALEVGGINY  142

Query  773   EVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCS  594
             +VP GRRDG VS + +  ++L SP F   Q+   F  KGL ++++V L GAHSIGV+HCS
Sbjct  143   DVPSGRRDGRVSLQDEPTQHLPSPSFNAKQLEESFARKGLSLDEMVTLSGAHSIGVSHCS  202

Query  593   NFRYRLNTPARAKEVDGSLKVVMGTHCR--------NAATTIPMDSTTQYKMDSMFYKQL  438
             +F  RL         D S+  +   + +        N   T+P+D  T  ++D+ +Y  L
Sbjct  203   SFSDRLYFFNATHPQDPSMDPIFARNLKKKCPRSSNNDRVTVPLDILTPNRLDNKYYTDL  262

Query  437   LQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKK  258
                 GLL SD+ L     T  +V   A    AW  KF  +++KMG I VLTG +GEIR  
Sbjct  263   KNHHGLLTSDQTLLTSHSTAGIVRNNARFGTAWANKFAAAMVKMGSIDVLTGRQGEIRNN  322

Query  257   CRFVN  243
             C+ VN
Sbjct  323   CKVVN  327



>ref|XP_003535856.1| PREDICTED: peroxidase 5-like [Glycine max]
 ref|XP_003535859.1| PREDICTED: peroxidase 5-like [Glycine max]
Length=324

 Score =   253 bits (646),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 128/302 (42%), Positives = 185/302 (61%), Gaps = 7/302 (2%)
 Frame = -1

Query  1133  TAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDAT  954
             +A ++V FY  TCP+AE IVK  + KA   +PG+AA ++R+  HDC V GCDGSVLL++T
Sbjct  25    SASLKVDFYKTTCPSAEAIVKRAVNKAVSLNPGIAAGLIRMHFHDCFVRGCDGSVLLEST  84

Query  953   SGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEF  774
              G    E++ P+N  ++RGFE+ID  K E+E  CP  VSCADIL F+ARD+    G   +
Sbjct  85    QGNPS-EREHPANNPSLRGFEVIDEAKAEIEAECPHTVSCADILAFAARDSSNKVGGINY  143

Query  773   EVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCS  594
              VP GRRDG VS   +A + L  P F   Q+++ F+ KGL  +++V L GAHSIGV+HCS
Sbjct  144   VVPAGRRDGRVSNRDEASQ-LPRPTFNTQQLISNFEQKGLSADEMVTLSGAHSIGVSHCS  202

Query  593   NFRYRLNTPARAKEVDGSLKVVMGTHCRN-----AATTIPMDSTTQYKMDSMFYKQLLQK  429
             +F  RL +       D S+     T  ++     +  T+ +D+++  ++D+ +Y  L   
Sbjct  203   SFSDRLYSFNATFPQDPSMDTKFATSLKSKCPPRSDNTVELDASSPNRLDNNYYTMLNNH  262

Query  428   KGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRF  249
             +GLL SD+ L   P T P+V   A   + W  KF ++++ MG I VLTG +GEIR +C  
Sbjct  263   RGLLTSDQTLLTSPSTRPMVLTNAKHGSTWARKFAKAMVHMGSIEVLTGSQGEIRTRCSV  322

Query  248   VN  243
             VN
Sbjct  323   VN  324



>ref|XP_003540316.1| PREDICTED: peroxidase 3 [Glycine max]
Length=326

 Score =   253 bits (646),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 136/310 (44%), Positives = 187/310 (60%), Gaps = 13/310 (4%)
 Frame = -1

Query  1142  AETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLL  963
             A T A +++GFY ++CP AE+IV   +    H+ P +AAA++R+  HDC V GCD SVLL
Sbjct  19    ASTHAQLQLGFYAKSCPNAEQIVLKFVHDHIHNAPSLAAALIRMHFHDCFVRGCDASVLL  78

Query  962   DATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGV  783
             ++T+   + EK AP N  TVRGF+ IDRIK  +E  CPGVVSCADILT SARD +V +G 
Sbjct  79    NSTTN--QAEKNAPPN-LTVRGFDFIDRIKSLVEAECPGVVSCADILTLSARDTIVATGG  135

Query  782   PEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVA  603
             P ++VP GRRDG +S   +AR N+ +P      +  LF ++GLD++DLV L GAH+IG+A
Sbjct  136   PFWKVPTGRRDGVISNLTEARDNIPAPSSNFTTLQTLFANQGLDLKDLVLLSGAHTIGIA  195

Query  602   HCSNFRYRL--------NTPARAKEVDGSLKVVMGTHCRNAATT-IPMDSTTQYKMDSMF  450
             HCS+   RL          P+   E   +LK    T      TT I MD  ++   D  +
Sbjct  196   HCSSLSNRLFNFTGKGDQDPSLDSEYAANLKAFKCTDLNKLNTTKIEMDPGSRKTFDLSY  255

Query  449   YKQLLQKKGLLESDERLAGDPRT-LPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEG  273
             Y  +++++GL ESD  L  +  T   ++E        +  +F  S+ KMG+I V TG EG
Sbjct  256   YSHVIKRRGLFESDAALLTNSVTKAQIIELLEGSVENFFAEFATSMEKMGRINVKTGTEG  315

Query  272   EIRKKCRFVN  243
             EIRK C FVN
Sbjct  316   EIRKHCAFVN  325



>ref|XP_002440653.1| hypothetical protein SORBIDRAFT_09g004660 [Sorghum bicolor]
 gb|EES19083.1| hypothetical protein SORBIDRAFT_09g004660 [Sorghum bicolor]
Length=363

 Score =   254 bits (649),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 137/314 (44%), Positives = 186/314 (59%), Gaps = 18/314 (6%)
 Frame = -1

Query  1133  TAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDAT  954
             TA + VGFY +TCPTAE +V+  +  AF ++ GVA A++R+  HDC V GCDGSVL+D+T
Sbjct  27    TACLDVGFYDQTCPTAETVVQQTVAAAFTNNSGVAPALIRMHFHDCFVRGCDGSVLIDST  86

Query  953   SGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEF  774
             +     EK AP N  ++R F+++D  K  +E  CPGVVSCAD+L F+ARD++VLSG   +
Sbjct  87    ANN-TAEKDAPPNNPSLRFFDVVDSAKAALEAQCPGVVSCADVLAFAARDSVVLSGGLGY  145

Query  773   EVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCS  594
             +VP GRRDG +S   +A  NL  P F   Q+ A F SK L VEDLV L GAH++GV+HCS
Sbjct  146   QVPAGRRDGLISTATEALNNLPPPFFNATQLAASFASKNLTVEDLVVLSGAHTLGVSHCS  205

Query  593   NFR---------YRLN------TPARAKEVDGSLKVVMGTHCRN--AATTIPMDSTTQYK  465
             +F          Y  +       PA +K     LK +  ++       TT  MD  T  K
Sbjct  206   SFAGVGNLGDRLYNFSGSSDGTDPALSKAYAFLLKSICPSNSSQFFPNTTTFMDLITPEK  265

Query  464   MDSMFYKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLT  285
              D+ +Y  L    GL +SD  L  +     LV+ F   +A +  KF  S++KMG+I VLT
Sbjct  266   FDNKYYVGLTNNLGLFKSDVALLTNATMKALVDSFVRSEATFRTKFARSMLKMGQIEVLT  325

Query  284   GDEGEIRKKCRFVN  243
             G +GEIR  CR +N
Sbjct  326   GTQGEIRLNCRVIN  339



>gb|KHN00317.1| Peroxidase 5 [Glycine soja]
 gb|KHN00320.1| Peroxidase 5 [Glycine soja]
Length=318

 Score =   252 bits (644),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 128/302 (42%), Positives = 185/302 (61%), Gaps = 7/302 (2%)
 Frame = -1

Query  1133  TAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDAT  954
             +A ++V FY  TCP+AE IVK  + KA   +PG+AA ++R+  HDC V GCDGSVLL++T
Sbjct  19    SASLKVDFYKTTCPSAEAIVKRAVNKAVSLNPGIAAGLIRMHFHDCFVRGCDGSVLLEST  78

Query  953   SGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEF  774
              G    E++ P+N  ++RGFE+ID  K E+E  CP  VSCADIL F+ARD+    G   +
Sbjct  79    QGNPS-EREHPANNPSLRGFEVIDEAKAEIEAECPHTVSCADILAFAARDSSNKVGGINY  137

Query  773   EVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCS  594
              VP GRRDG VS   +A + L  P F   Q+++ F+ KGL  +++V L GAHSIGV+HCS
Sbjct  138   VVPAGRRDGRVSNRDEASQ-LPRPTFNTQQLISNFEQKGLSADEMVTLSGAHSIGVSHCS  196

Query  593   NFRYRLNTPARAKEVDGSLKVVMGTHCRN-----AATTIPMDSTTQYKMDSMFYKQLLQK  429
             +F  RL +       D S+     T  ++     +  T+ +D+++  ++D+ +Y  L   
Sbjct  197   SFSDRLYSFNATFPQDPSMDTKFATSLKSKCPPRSDNTVELDASSPNRLDNNYYTMLNNH  256

Query  428   KGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRF  249
             +GLL SD+ L   P T P+V   A   + W  KF ++++ MG I VLTG +GEIR +C  
Sbjct  257   RGLLTSDQTLLTSPSTRPMVLTNAKHGSTWARKFAKAMVHMGSIEVLTGSQGEIRTRCSV  316

Query  248   VN  243
             VN
Sbjct  317   VN  318



>ref|XP_003520954.1| PREDICTED: peroxidase 44-like [Glycine max]
 gb|KHN42186.1| Peroxidase 44 [Glycine soja]
Length=314

 Score =   252 bits (644),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 131/300 (44%), Positives = 196/300 (65%), Gaps = 12/300 (4%)
 Frame = -1

Query  1130  AGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATS  951
             A +RVGFY  +CP AE+IV   + + F+ D  + AA++R+  HDC V GCD S+L+D+T 
Sbjct  20    ADLRVGFYSSSCPRAEQIVGQVVQRRFNRDRSITAALLRMHFHDCFVRGCDASILIDSTR  79

Query  950   GGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFE  771
             G  + EK A +NG TVRG+ELID IK+ +E+ CP  VSCADI+T + RD++VL+G  +++
Sbjct  80    GN-QSEKAAGANG-TVRGYELIDEIKKALERECPSTVSCADIITLATRDSVVLAGGLKYD  137

Query  770   VPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSN  591
             V  GRRDG+VS+  +   NL  P  TV +++ +F + G+ ++++V LLGAH++G  HCS 
Sbjct  138   VATGRRDGHVSQSSEV--NLPGPRSTVSRVLEVFSANGMSLDEMVTLLGAHTVGFTHCSF  195

Query  590   FRYRLNTPARAKEVDGSLKVVMGTHCR--NAATTIPMDSTTQYKM--DSMFYKQLLQKKG  423
             FR RLN P     +D SL+  +G  C   N+     +D      M  D+ FYKQ++ ++G
Sbjct  196   FRDRLNDP----NMDPSLRAGLGRTCNRPNSDPRAFLDQNVSSSMVFDNAFYKQIVLRRG  251

Query  422   LLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRFVN  243
             +L  D++LA D  +  LV  FA + AA+   F ++++KMG I+VL G+EGEIR+ CR  N
Sbjct  252   VLFIDQQLALDTLSKGLVTVFAGNNAAFQRSFADAMVKMGNIKVLVGNEGEIRRNCRVFN  311



>gb|ACU20445.1| unknown [Glycine max]
Length=324

 Score =   253 bits (645),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 128/302 (42%), Positives = 185/302 (61%), Gaps = 7/302 (2%)
 Frame = -1

Query  1133  TAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDAT  954
             +A ++V FY  TCP+AE IVK  + KA   +PG+AA ++R+  HDC V GCDGSVLL++T
Sbjct  25    SASLKVDFYKTTCPSAEAIVKRAVNKAVSLNPGIAAGLIRMHFHDCFVRGCDGSVLLEST  84

Query  953   SGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEF  774
              G    E++ P+N  ++RGFE+ID  K E+E  CP  VSCADIL F+ARD+    G   +
Sbjct  85    QGNPS-EREHPANNPSLRGFEVIDEAKAEIEAECPHTVSCADILAFAARDSSNKVGGINY  143

Query  773   EVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCS  594
              VP GRRDG VS   +A + L  P F   Q+++ F+ KGL  +++V L GAHSIGV+HCS
Sbjct  144   VVPAGRRDGRVSNRDEASQ-LPRPTFNTQQLISNFEQKGLSADEMVTLSGAHSIGVSHCS  202

Query  593   NFRYRLNTPARAKEVDGSLKVVMGTHCRN-----AATTIPMDSTTQYKMDSMFYKQLLQK  429
             +F  RL +       D S+     T  ++     +  T+ +D+++  ++D+ +Y  L   
Sbjct  203   SFSDRLYSFNVTFPQDPSMDTKFATSLKSKCPPRSDNTVELDASSPNRLDNNYYTMLNNH  262

Query  428   KGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRF  249
             +GLL SD+ L   P T P+V   A   + W  KF ++++ MG I VLTG +GEIR +C  
Sbjct  263   RGLLTSDQTLLTSPSTRPMVLTNAKHGSTWARKFAKAMVHMGSIEVLTGSQGEIRTRCSV  322

Query  248   VN  243
             VN
Sbjct  323   VN  324



>gb|EYU45326.1| hypothetical protein MIMGU_mgv1a009971mg [Erythranthe guttata]
Length=325

 Score =   253 bits (645),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 127/306 (42%), Positives = 183/306 (60%), Gaps = 8/306 (3%)
 Frame = -1

Query  1139  ETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLD  960
             E+ A ++ GFY  +C  AE IVK  +   F  D G+AA +VRL  HDC V GCDGSVL+D
Sbjct  20    ESEAQLQTGFYRSSCGIAEFIVKQEVRNGFFKDNGIAAGLVRLHFHDCFVRGCDGSVLID  79

Query  959   ATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVP  780
             +T+   + EK +P+N  ++RGFE+ID  K  +E  C GVVSCADIL F+ARD++ ++G  
Sbjct  80    STASN-KAEKDSPANNPSLRGFEVIDNAKARIEAFCKGVVSCADILAFAARDSIEITGGF  138

Query  779   EFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAH  600
              ++VP GR+DG VS + +A +NL  P F V+Q+   F +KGL  E++V L GAH++G +H
Sbjct  139   GYDVPSGRKDGRVSLDTEASQNLPPPSFNVNQLTQAFANKGLTQEEMVTLSGAHTLGRSH  198

Query  599   CSNFRYRLNTPARAKEVDGSLKVVMGTHCRNAA-------TTIPMDSTTQYKMDSMFYKQ  441
             C++F  RL + +     D SL     +  R            +PMD  +  + D  +Y+ 
Sbjct  199   CTSFSNRLYSFSTNTSQDPSLDAFYASQLRQQCPRGTGPNPVVPMDPFSPAQTDVGYYRG  258

Query  440   LLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRK  261
             +L  +GL  SD+ L   P T   V + A +   W  KF  +++ MGKI VLTG+ GEIR 
Sbjct  259   VLSNRGLFTSDQTLMTSPITQAQVFQNAQNPFLWANKFAAAMVNMGKIGVLTGNSGEIRA  318

Query  260   KCRFVN  243
              CR +N
Sbjct  319   SCRVIN  324



>ref|XP_010671317.1| PREDICTED: peroxidase 5-like [Beta vulgaris subsp. vulgaris]
 ref|XP_010671319.1| PREDICTED: peroxidase 5-like [Beta vulgaris subsp. vulgaris]
Length=331

 Score =   253 bits (645),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 128/304 (42%), Positives = 182/304 (60%), Gaps = 9/304 (3%)
 Frame = -1

Query  1130  AGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATS  951
             A +RVGFY  +CP AE IV+  ++K F +D G+A  +VR+  HDC V GCDGSVL+D+TS
Sbjct  29    AQLRVGFYCNSCPLAERIVREEVMKGFMNDKGIAPGLVRMHFHDCFVRGCDGSVLIDSTS  88

Query  950   GGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFE  771
                  EK +P+N  ++RGFE+ID  K  +E  C GVVSCADIL F+ARD++ ++    + 
Sbjct  89    SN-TAEKDSPANSPSLRGFEVIDNAKTRLESQCKGVVSCADILAFAARDSVAITRGQSYN  147

Query  770   VPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSN  591
             VP GRRDG VS E +  +NL    F VDQ+   F +K L  E++V L GAH++G +HC++
Sbjct  148   VPSGRRDGRVSSESEVLQNLPGFSFNVDQLTQNFANKNLTQEEMVTLSGAHTLGRSHCTS  207

Query  590   FRYRL------NTPARAKEVD--GSLKVVMGTHCRNAATTIPMDSTTQYKMDSMFYKQLL  435
                RL      N P    E    G L+        +++  + MD  T +  D  +Y+ LL
Sbjct  208   VGSRLYNFNGTNGPDSTLESKYAGQLQQQCPEGSTDSSLVVSMDPQTPFVTDVNYYQDLL  267

Query  434   QKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKC  255
               +GL  SD+ L  +  T   V + A +Q  W+ KF  +++KMG+I VLTG+ GEIR  C
Sbjct  268   ANRGLFTSDQTLLSNSNTANEVNQNARNQFLWMRKFAAAMVKMGQIEVLTGNAGEIRANC  327

Query  254   RFVN  243
             R +N
Sbjct  328   RVIN  331



>ref|XP_007031236.1| Class III peroxidase 70 [Theobroma cacao]
 gb|EOY11738.1| Class III peroxidase 70 [Theobroma cacao]
Length=329

 Score =   252 bits (644),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 134/306 (44%), Positives = 184/306 (60%), Gaps = 9/306 (3%)
 Frame = -1

Query  1136  TTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDA  957
             ++A ++VGFY  +CP+AE  V+  + KA   +PG+AAA++R+  HDC V GCD SVLLD+
Sbjct  25    SSATLKVGFYQSSCPSAEAAVRKAVDKAVSRNPGMAAALIRMHFHDCFVRGCDASVLLDS  84

Query  956   TSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPE  777
             T G    EK+ P+N  ++RGFE+ID+ K E+E  CP  VSCADIL F+ARD+    G  +
Sbjct  85    TPGRPS-EKEHPANNPSLRGFEVIDQAKAEIEAQCPRTVSCADILAFAARDSAYKVGGIK  143

Query  776   FEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHC  597
             + VP GRRDG VS   +   NL  P F   Q+   F  KGL+++++V L GAHSIGV+HC
Sbjct  144   YAVPSGRRDGRVSLRDEGFGNLPPPFFNAKQLEDNFARKGLNLDEMVTLSGAHSIGVSHC  203

Query  596   SNFRYRLNTPARAKEVDGSLKVVMGTHCRNAA--------TTIPMDSTTQYKMDSMFYKQ  441
             S+F  RL +       D SL        R            T+P+D  + +++D+ +Y+ 
Sbjct  204   SSFSNRLFSFNATHLQDPSLDPEFARQLRKRCPAPGSSRDPTVPLDVLSPHRLDNKYYEV  263

Query  440   LLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRK  261
             L    GLL SD+ L     T  +V E A    AW  KFT +++KMG I VLTG +GEIRK
Sbjct  264   LKNHHGLLTSDQTLLSSRATAKIVRENARHGKAWAKKFTAAMVKMGYIDVLTGSKGEIRK  323

Query  260   KCRFVN  243
              CR VN
Sbjct  324   NCRVVN  329



>ref|XP_004502775.1| PREDICTED: peroxidase 5-like [Cicer arietinum]
Length=327

 Score =   252 bits (644),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 129/302 (43%), Positives = 184/302 (61%), Gaps = 9/302 (3%)
 Frame = -1

Query  1124  MRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSGG  945
             + VGFY  +C  AE IVK+ + K+F+ +PG+AA +VR+  HDC + GCD SVLLD+T   
Sbjct  26    LEVGFYSYSCGMAELIVKDEVRKSFNKNPGIAAGLVRMHFHDCFIRGCDASVLLDSTPSN  85

Query  944   GRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEVP  765
                EK +P+N  ++RGFE+ID  K ++E  C G VSCADI+ F+ARD++ L+G   ++VP
Sbjct  86    -TAEKDSPANKPSLRGFEVIDNAKAKLEAVCNGTVSCADIIAFAARDSVELAGGIGYDVP  144

Query  764   GGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNFR  585
              GRRDG +S   D R +L  P F V+Q+  LF  KGL  E++V L GAH+IG AHCS F 
Sbjct  145   AGRRDGKISLASDTRTDLPPPTFNVNQLTQLFAKKGLTQEEMVTLSGAHTIGRAHCSAFS  204

Query  584   YRL----NTPARAKEVDGSLKVVMGTHCRNAATT----IPMDSTTQYKMDSMFYKQLLQK  429
              RL    +T  +   +D S   ++   C    T     +PMD ++    D  +Y  +L+ 
Sbjct  205   NRLYNFSSTLKQDPNLDSSYVPLLKRQCPQGNTNPNLAVPMDPSSPGTADVGYYINILED  264

Query  428   KGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRF  249
             +GL  SD+ L  +  T   V + A +   W  KF ++++KMG+I VLTG+ GEIR  CR 
Sbjct  265   RGLFTSDQTLLTNTGTARQVNKNARNPYLWADKFADAMVKMGQIGVLTGNAGEIRTNCRM  324

Query  248   VN  243
             VN
Sbjct  325   VN  326



>ref|XP_010513283.1| PREDICTED: peroxidase 28-like [Camelina sativa]
Length=319

 Score =   252 bits (643),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 130/300 (43%), Positives = 182/300 (61%), Gaps = 5/300 (2%)
 Frame = -1

Query  1130  AGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATS  951
             A +R GFY ++CP AE IV+N + + F  DP + AA+ R+  HDC V GCD S+L+D T+
Sbjct  21    AQLRFGFYNQSCPNAETIVQNLVRQRFGRDPSITAALTRMHFHDCFVQGCDASLLIDPTT  80

Query  950   GGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFE  771
                  EK A  NG +VRGFELID IK  +E  CP  VSC+DI+T + RD++ L G P + 
Sbjct  81    TQPSPEKTAGPNG-SVRGFELIDEIKTALEAQCPFTVSCSDIITLATRDSVFLGGGPSYL  139

Query  770   VPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSN  591
             VP GRRDG VS   DA + L  P  +V  M+  F +KG++V D VALLGAH++GVA C N
Sbjct  140   VPTGRRDGFVSNLADAEQILPPPGISVAGMLGFFGNKGMNVFDAVALLGAHTVGVASCGN  199

Query  590   FRYRLN----TPARAKEVDGSLKVVMGTHCRNAATTIPMDSTTQYKMDSMFYKQLLQKKG  423
             F  R+     T      +D SL   +   C        +D +T +  D++F+ QL Q+KG
Sbjct  200   FGDRVTNFQGTGQPDPTMDPSLVASLRNTCAAPGGFAALDQSTPFSFDNLFFSQLRQRKG  259

Query  422   LLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRFVN  243
             +L  D+R+A DP T  +V ++A +   +  +F  +++KMG + VLTG  GEIR+ CR  N
Sbjct  260   ILFIDQRIATDPATSDVVSQYAANNELFKRQFEIAMVKMGAVDVLTGLAGEIRRNCRAFN  319



>ref|XP_006299929.1| hypothetical protein CARUB_v10016138mg [Capsella rubella]
 gb|EOA32827.1| hypothetical protein CARUB_v10016138mg [Capsella rubella]
Length=322

 Score =   252 bits (643),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 130/303 (43%), Positives = 185/303 (61%), Gaps = 8/303 (3%)
 Frame = -1

Query  1130  AGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATS  951
             A +RVGFY  +C  AE IV+N + + F +DP + AA+ R+  HDC V GCD S+L+D  +
Sbjct  21    AQLRVGFYSESCSDAETIVQNLVRQRFVNDPSITAALTRMHFHDCFVQGCDASLLIDPAT  80

Query  950   GGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFE  771
                  EK A  NG +VRGFELID IK  +E  CP  VSC+DI+T +ARD+++L+G P + 
Sbjct  81    TQPSPEKTAGPNG-SVRGFELIDEIKTALEAKCPSKVSCSDIITLAARDSVLLAGGPNYT  139

Query  770   VPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSN  591
             VP GRRDG VS   DA + L  P  +V+ M+  F +KG+DV D VALLGAH++GVA C N
Sbjct  140   VPTGRRDGFVSNLEDALRILPGPGISVEGMLGFFANKGMDVTDAVALLGAHTVGVASCGN  199

Query  590   FRYRLNTPARAKEVDGSLKVVMGTHCRNAATT----IPMDSTT---QYKMDSMFYKQLLQ  432
             F  R+       + D S+   + T  RN          +D +T    +  D++F+ QL  
Sbjct  200   FGDRITNFQGTGQPDPSMDPSLVTSLRNTCAAPGGFAALDQSTPSAPFSFDNLFFSQLRL  259

Query  431   KKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCR  252
             +KG+L  D+R+A DP T  +V +FA +   +  +F  +++KMG + VLTG  GE+R+ CR
Sbjct  260   RKGILFIDQRIATDPATSDVVSQFAANNELFKRQFAIAMVKMGAVDVLTGSAGEVRRNCR  319

Query  251   FVN  243
               N
Sbjct  320   VFN  322



>ref|XP_010420511.1| PREDICTED: peroxidase 57-like isoform X1 [Camelina sativa]
 ref|XP_010420512.1| PREDICTED: peroxidase 57-like isoform X2 [Camelina sativa]
Length=310

 Score =   251 bits (642),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 129/300 (43%), Positives = 189/300 (63%), Gaps = 12/300 (4%)
 Frame = -1

Query  1130  AGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATS  951
             A +RV FY R+CP AE IV+N + + F  DP V AA++R+  HDC V GCD S+L+D+T+
Sbjct  19    AQLRVKFYSRSCPQAETIVRNLVRQRFGVDPTVTAALLRMHFHDCFVRGCDASLLIDSTN  78

Query  950   GGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFE  771
                  EK A  NG +VR F+LIDRIK ++E +CP  VSCADI+T + RD++ L+G P + 
Sbjct  79    S----EKAAGPNG-SVREFDLIDRIKAQLEAACPSTVSCADIVTLATRDSVALAGGPSYS  133

Query  770   VPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSN  591
             +P GRRDG VS   D    L  P  +V   V+ F +KGL+  D VALLGAH++G  +C  
Sbjct  134   IPTGRRDGRVSNNVDV--ALPGPTISVSGAVSFFTNKGLNTFDAVALLGAHTVGQGNCGL  191

Query  590   FRYRLNTPARAKEVDGSLKVVMGTH----CRNAATTIPMDSTTQYKMDSMFYKQLLQKKG  423
             F  R+         D S+   + T     CRN+A+   +D +T  + D+ F+KQ+ +++G
Sbjct  192   FSDRITNFQGTGRPDSSMDPALVTSLRNTCRNSASA-ALDQSTPLRFDNQFFKQIRRRRG  250

Query  422   LLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRFVN  243
             +L+ D+RLA DP+T  +V  +A++ A +  +F  +++KMG + VLTG  GEIR+ CR  N
Sbjct  251   VLQVDQRLASDPQTRGIVARYANNNAFFKRQFVRAMVKMGAVDVLTGRNGEIRRNCRRFN  310



>ref|XP_010268457.1| PREDICTED: peroxidase 46-like isoform X3 [Nelumbo nucifera]
Length=312

 Score =   251 bits (641),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 130/306 (42%), Positives = 184/306 (60%), Gaps = 14/306 (5%)
 Frame = -1

Query  1133  TAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDAT  954
             ++G+   FY  +CPTAE +VKN +  A  DDP + A ++RL  HDC+V GCDGSVLL+  
Sbjct  11    SSGLLFDFYAASCPTAEAMVKNTLRSASTDDPTIPAKLLRLLFHDCMVEGCDGSVLLE--  68

Query  953   SGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEF  774
               G   E+  P+N  ++ GF +++  K  +E  CP  VSCADIL  +ARDA+  +G P  
Sbjct  69    --GNETERSDPANA-SLGGFSVVESAKGLLELFCPETVSCADILALAARDAVEFAGGPSI  125

Query  773   EVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCS  594
             ++P GRRDG VS   + R N+    FT+D+M+ LF SKGL +EDLV L GAH+IG AHCS
Sbjct  126   QIPTGRRDGRVSSVSNVRPNIVDTSFTMDEMLELFSSKGLSLEDLVTLSGAHTIGSAHCS  185

Query  593   NF--RYRLNTPARAKEVDGSLKVVMGT----HCR---NAATTIPMDSTTQYKMDSMFYKQ  441
             +F  R++ ++      +D SL  +        C    + + T+  D  T    D+ +Y+ 
Sbjct  186   SFSDRFQEDSKGNLTPIDASLDRIYANELIKQCPAGVDKSITVNNDPETSLLFDNQYYRN  245

Query  440   LLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRK  261
             L+  KGL +SD  L  D RT   VEEF+D Q  +  K+TES +K+  + V TGDEGE+R 
Sbjct  246   LISHKGLFQSDSVLFSDGRTKAKVEEFSDSQYMFFEKWTESFLKLSSVGVKTGDEGEVRT  305

Query  260   KCRFVN  243
              CR +N
Sbjct  306   SCRAIN  311



>ref|XP_006649294.1| PREDICTED: peroxidase 5-like [Oryza brachyantha]
Length=325

 Score =   251 bits (642),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 129/307 (42%), Positives = 185/307 (60%), Gaps = 7/307 (2%)
 Frame = -1

Query  1145  AAETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVL  966
             A    A ++VGFY ++CP AE IV++ + KA   +PG+AA +VR+  HDC V GCD SVL
Sbjct  20    AGAAKAQLQVGFYDQSCPQAEVIVRDEVGKAVSANPGLAAGLVRMHFHDCFVKGCDASVL  79

Query  965   LD-ATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLS  789
             LD A +     EK AP N K++RGFE++D  K+ +E +C GVVSCAD+L F+ARD++VL+
Sbjct  80    LDSAANSTTAAEKDAPPN-KSLRGFEVVDSAKQRLESACKGVVSCADVLAFAARDSVVLT  138

Query  788   GVPEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIG  609
             G   + VP GRRDGN S   DA  +L  P   V  +  +F   GL  E++V L GAH+IG
Sbjct  139   GGSPYRVPAGRRDGNTSVASDAMASLPPPTADVPTLTRMFAKYGLSQEEMVTLSGAHTIG  198

Query  608   VAHCSNFRYRLNTPARAKEVDGSLKVVMGTHC-----RNAATTIPMDSTTQYKMDSMFYK  444
             V HCS+F  RL     +   D +L   M +       + +  T+ MD  ++   D+ +Y+
Sbjct  199   VTHCSSFSSRLYGYNSSTGQDPALNAAMASRLARVCPQGSGNTVAMDDGSENTFDTSYYQ  258

Query  443   QLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIR  264
              LL  +G+L SD+ L  D  T  LV + A +   +  +F ++++KMG I+VLTG  G+IR
Sbjct  259   NLLAGRGVLASDQTLTADNATAALVAQNAYNMYLFATRFGQAMVKMGAIQVLTGSNGQIR  318

Query  263   KKCRFVN  243
               CR  N
Sbjct  319   TNCRVAN  325



>ref|XP_002465968.1| hypothetical protein SORBIDRAFT_01g049140 [Sorghum bicolor]
 gb|EER92966.1| hypothetical protein SORBIDRAFT_01g049140 [Sorghum bicolor]
Length=333

 Score =   252 bits (643),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 136/301 (45%), Positives = 184/301 (61%), Gaps = 10/301 (3%)
 Frame = -1

Query  1130  AGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATS  951
             A ++VGFY   CP AE IV+  + KA   +PGVAA ++RL  HDC V GCDGSVLLD+T+
Sbjct  32    AQLQVGFYDTLCPAAEIIVQEEVSKAASGNPGVAAGLLRLHFHDCFVRGCDGSVLLDSTA  91

Query  950   GGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFE  771
             G  + EK A  N  ++RGFE+ID  K  +EQ+C GVVSCADIL F+ARDAL L G   ++
Sbjct  92    GN-QAEKDAAPN-ASLRGFEVIDSAKTRLEQACFGVVSCADILAFAARDALALVGGNAYQ  149

Query  770   VPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSN  591
             VP GRRDGNVS   +A  NL  P  +V ++  +F +KGL   D+VAL GAH++G A CS+
Sbjct  150   VPAGRRDGNVSSAQEAGANLPPPTASVSRLNQVFGAKGLTQADMVALSGAHTVGAARCSS  209

Query  590   FRYRLNT--PARAKE---VDGSLKVVMGTHC---RNAATTIPMDSTTQYKMDSMFYKQLL  435
             F  RL +  P+ A +   +D +    +   C   + +   +PMD  T    D+ +Y  L+
Sbjct  210   FNGRLYSYGPSGAGQDPSMDPAYLAALTQQCPQVQGSDPAVPMDPVTPTTFDTNYYANLV  269

Query  434   QKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKC  255
              K+GLL SD+ L  DP T   V  + +  A +   F  +++KMG I VLTG  G IR  C
Sbjct  270   AKRGLLASDQALLADPTTAAQVVGYTNSPATFQTDFVAAMLKMGNIEVLTGTAGTIRTNC  329

Query  254   R  252
             R
Sbjct  330   R  330



>ref|XP_003567628.1| PREDICTED: peroxidase 1-like [Brachypodium distachyon]
Length=356

 Score =   253 bits (645),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 130/307 (42%), Positives = 185/307 (60%), Gaps = 10/307 (3%)
 Frame = -1

Query  1133  TAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDAT  954
             +A ++VGFY +TCP AE +V+  +  AF  + G+AA ++RL  HDC V GCD SVLL   
Sbjct  24    SAQLKVGFYQKTCPNAETLVRQAVSAAFAKNAGIAAGLIRLHFHDCFVRGCDASVLLTVN  83

Query  953   SGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEF  774
              GGGR E+ AP N  ++RGFE+ID  K  +EQSCP  VSCADIL F+ARD++ L+G   +
Sbjct  84    PGGGRTERDAPPNNPSLRGFEVIDAAKAAVEQSCPSTVSCADILAFAARDSVTLTGNVFY  143

Query  773   EVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCS  594
              VP GRRDG+VS+E DA  NL  P FT  Q++  FK+K L+ E++V L GAH++G + C+
Sbjct  144   PVPAGRRDGSVSKELDANANLPPPTFTAQQLIDRFKNKSLNAEEMVLLSGAHTVGRSFCA  203

Query  593   NFRYRL-----NTPARAKEVDGSLKVVMGTHC-----RNAATTIPMDSTTQYKMDSMFYK  444
             +F  R+     NTP     +  S   ++   C     +    T  MD  T   +D+ +YK
Sbjct  204   SFVDRVWKNGTNTPIVDAGLSPSYAALLRALCPFNTTQTTPITTAMDPGTLNVLDNNYYK  263

Query  443   QLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIR  264
              L +  GL  SD +L  D     +V  FA ++  W  +F  +++KMG+I+V TG  G++R
Sbjct  264   LLPRGMGLFFSDNQLRVDANLNAMVNRFAANETLWKERFAAAMVKMGRIQVQTGRCGQVR  323

Query  263   KKCRFVN  243
               C  VN
Sbjct  324   LNCSVVN  330



>ref|XP_010919027.1| PREDICTED: peroxidase 5-like [Elaeis guineensis]
Length=324

 Score =   251 bits (642),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 131/309 (42%), Positives = 186/309 (60%), Gaps = 10/309 (3%)
 Frame = -1

Query  1145  AAETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVL  966
             +++  A ++VGFY  TCP AE IVK  + +A   + G+AA +VR+  HDC V GCDGSVL
Sbjct  18    SSQLEAQLQVGFYDTTCPQAEIIVKTQVTQALASNIGLAAGLVRMHFHDCFVRGCDGSVL  77

Query  965   LDATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSG  786
             +D+TS     EK +  N K++RGFE+I   K ++E +C GVVSCADIL F+ARD++ L+G
Sbjct  78    IDSTSTN-TAEKDSSIN-KSLRGFEVIYSAKAQLEATCEGVVSCADILAFAARDSIALTG  135

Query  785   VPEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGV  606
                ++VP GRRDG VS   +   NL  P+F VDQ+   F+ KGL  + +V L GAH+IG 
Sbjct  136   GLSYQVPAGRRDGTVSLASETFTNLPGPNFNVDQVTQSFEVKGLTQDQMVTLSGAHTIGR  195

Query  605   AHCSNFRYRLNTPARAKEVDGSLKVV----MGTHCRNAAT----TIPMDSTTQYKMDSMF  450
             +HCS+F  RL   +   + D SL       +   C   +T     +PMD  T   +D+ +
Sbjct  196   SHCSSFSNRLYDFSTNTKQDPSLDATYAAQLKQQCPQGSTDPNLVVPMDPPTPNIVDTSY  255

Query  449   YKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGE  270
             Y  +L  +GL  SD+ L  +  T  LV + A +   W  KF  +++ MG+I VLTG+ GE
Sbjct  256   YNDILGNRGLFTSDQTLLSEAATASLVRQNAANSLLWQNKFAAAMVAMGQIGVLTGNNGE  315

Query  269   IRKKCRFVN  243
             IR  CR +N
Sbjct  316   IRLNCRVIN  324



>gb|AAD11481.1| peroxidase precursor, partial [Glycine max]
Length=352

 Score =   252 bits (644),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 135/310 (44%), Positives = 187/310 (60%), Gaps = 13/310 (4%)
 Frame = -1

Query  1142  AETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLL  963
             A T A +++GFY ++CP AE+IV   +    H+ P +AAA++R+  HDC V GCD SVLL
Sbjct  45    ASTHAQLQLGFYAKSCPNAEQIVLKFVHDHIHNAPSLAAALIRMHFHDCFVRGCDASVLL  104

Query  962   DATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGV  783
             ++T+   + EK AP N  TVRGF+ IDRIK  +E  CPGVVSCADILT SARD +V +G 
Sbjct  105   NSTTN--QAEKNAPPN-LTVRGFDFIDRIKSLVEAECPGVVSCADILTLSARDTIVATGG  161

Query  782   PEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVA  603
             P ++VP GRRDG +S   +AR N+ +P      +  LF ++GLD++DLV L GAH+IG+A
Sbjct  162   PFWKVPTGRRDGVISNLTEARDNIPAPSSNFTTLQTLFANQGLDLKDLVLLSGAHTIGIA  221

Query  602   HCSNFRYRL--------NTPARAKEVDGSLKVVMGTHCRNAATT-IPMDSTTQYKMDSMF  450
             HCS+   RL          P+   E   +LK    T      TT I MD  ++   D  +
Sbjct  222   HCSSLSNRLFNFTGKGDQDPSLDSEYAANLKAFKCTDLNKLNTTKIEMDPGSRKTFDLSY  281

Query  449   YKQLLQKKGLLESDERLAGDPRT-LPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEG  273
             Y  +++++GL ESD  L  +  T   ++E        +  +F  S+ KMG+I V TG EG
Sbjct  282   YSHVIKRRGLFESDAALLTNSVTKAQIIELLEGSVENFFAEFATSMEKMGRINVKTGTEG  341

Query  272   EIRKKCRFVN  243
             EIRK C F+N
Sbjct  342   EIRKHCAFLN  351



>ref|XP_006840299.1| hypothetical protein AMTR_s00045p00065690 [Amborella trichopoda]
 gb|ERN01974.1| hypothetical protein AMTR_s00045p00065690 [Amborella trichopoda]
Length=348

 Score =   252 bits (643),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 129/303 (43%), Positives = 179/303 (59%), Gaps = 10/303 (3%)
 Frame = -1

Query  1124  MRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSGG  945
             + +GFY +TC  AE +V + + +A + +PG+AA ++R+  HDC V GCDGSVL+D+T+G 
Sbjct  25    LEIGFYDQTCQGAELLVFDAVARAVNANPGIAAGLIRMFFHDCFVRGCDGSVLIDSTAGN  84

Query  944   GRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEVP  765
                EK +P N  ++RGFE+ID+ K  +E  CP  VSCAD+L F+ARD+  L+G   F VP
Sbjct  85    S-AEKDSPINNPSLRGFEVIDKAKAAIEAVCPKTVSCADVLAFAARDSTALTGGLNFPVP  143

Query  764   GGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNFR  585
              GRRDG +S   +   NL  P F   Q+   F  K L +E++V L GAHSIG +HCS+F 
Sbjct  144   AGRRDGRISIASETFTNLPPPTFNATQLEQSFARKNLTLEEMVTLSGAHSIGRSHCSSFV  203

Query  584   YRLNTPARAKEVDGSL----KVVMGTHC-----RNAATTIPMDSTTQYKMDSMFYKQLLQ  432
              RL   +   +VD +L       + + C      N  T +PMD  T   +D  +Y  L Q
Sbjct  204   RRLYNFSSTNQVDPTLDPGYATFLQSQCPFNASTNNVTVVPMDVFTPNDLDVGYYVGLTQ  263

Query  431   KKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCR  252
               GL  SD+ L  +  T P VEE   +   W  +F +++IKMGKI VLTG  GEIR  CR
Sbjct  264   HFGLFTSDQTLLTNSSTRPFVEENIVNPGVWAIRFAKAMIKMGKIEVLTGTTGEIRTNCR  323

Query  251   FVN  243
              +N
Sbjct  324   VIN  326



>ref|XP_010268455.1| PREDICTED: peroxidase 46-like isoform X1 [Nelumbo nucifera]
Length=336

 Score =   251 bits (642),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 130/306 (42%), Positives = 184/306 (60%), Gaps = 14/306 (5%)
 Frame = -1

Query  1133  TAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDAT  954
             ++G+   FY  +CPTAE +VKN +  A  DDP + A ++RL  HDC+V GCDGSVLL+  
Sbjct  35    SSGLLFDFYAASCPTAEAMVKNTLRSASTDDPTIPAKLLRLLFHDCMVEGCDGSVLLE--  92

Query  953   SGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEF  774
               G   E+  P+N  ++ GF +++  K  +E  CP  VSCADIL  +ARDA+  +G P  
Sbjct  93    --GNETERSDPANA-SLGGFSVVESAKGLLELFCPETVSCADILALAARDAVEFAGGPSI  149

Query  773   EVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCS  594
             ++P GRRDG VS   + R N+    FT+D+M+ LF SKGL +EDLV L GAH+IG AHCS
Sbjct  150   QIPTGRRDGRVSSVSNVRPNIVDTSFTMDEMLELFSSKGLSLEDLVTLSGAHTIGSAHCS  209

Query  593   NF--RYRLNTPARAKEVDGSLKVVMGT----HCR---NAATTIPMDSTTQYKMDSMFYKQ  441
             +F  R++ ++      +D SL  +        C    + + T+  D  T    D+ +Y+ 
Sbjct  210   SFSDRFQEDSKGNLTPIDASLDRIYANELIKQCPAGVDKSITVNNDPETSLLFDNQYYRN  269

Query  440   LLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRK  261
             L+  KGL +SD  L  D RT   VEEF+D Q  +  K+TES +K+  + V TGDEGE+R 
Sbjct  270   LISHKGLFQSDSVLFSDGRTKAKVEEFSDSQYMFFEKWTESFLKLSSVGVKTGDEGEVRT  329

Query  260   KCRFVN  243
              CR +N
Sbjct  330   SCRAIN  335



>gb|AAM65434.1| peroxidase ATP13a [Arabidopsis thaliana]
Length=312

 Score =   251 bits (640),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 128/300 (43%), Positives = 191/300 (64%), Gaps = 12/300 (4%)
 Frame = -1

Query  1130  AGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATS  951
             A +RVGFY ++CP AE IV+N + + F   P V AA++R+  HDC V GCD S+L+D+T+
Sbjct  21    AQLRVGFYSQSCPQAETIVRNLVRQRFGVTPTVTAALLRMHFHDCFVKGCDASLLIDSTN  80

Query  950   GGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFE  771
                  EK A  NG +VR F+LIDRIK ++E +CP  VSCADI+T + RD++ L+G P + 
Sbjct  81    S----EKTAGPNG-SVREFDLIDRIKAQLEAACPSTVSCADIVTLATRDSVALAGGPSYS  135

Query  770   VPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSN  591
             +P GRRDG VS   D    L  P  +V   V+LF +KG++  D VALLGAH++G  +C  
Sbjct  136   IPTGRRDGRVSNNLDV--TLPGPTISVSGAVSLFTNKGMNTFDAVALLGAHTVGQGNCGL  193

Query  590   FRYRLNTPARAKEVDGSLKVVMGTH----CRNAATTIPMDSTTQYKMDSMFYKQLLQKKG  423
             F  R+ +       D S+   + T     CRN+AT   +D ++  + D+ F+KQ+ +++G
Sbjct  194   FSDRITSFQGTGRPDPSMDPALVTSLRNTCRNSATA-ALDQSSPLRFDNQFFKQIRKRRG  252

Query  422   LLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRFVN  243
             +L+ D+RLA DP+T  +V  +A++ A +  +F  +++KMG + VLTG  GEIR+ CR  N
Sbjct  253   VLQVDQRLASDPQTRGIVARYANNNAFFKRQFVRAMVKMGAVDVLTGRNGEIRRNCRRFN  312



>ref|XP_006840300.1| hypothetical protein AMTR_s00045p00066730 [Amborella trichopoda]
 gb|ERN01975.1| hypothetical protein AMTR_s00045p00066730 [Amborella trichopoda]
Length=349

 Score =   252 bits (643),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 129/304 (42%), Positives = 178/304 (59%), Gaps = 10/304 (3%)
 Frame = -1

Query  1127  GMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSG  948
              + VGFY  TCP AE+++ + +  A   +PG+AA ++R+  HDC V GCDGSVLLD+T+ 
Sbjct  24    ALEVGFYNETCPQAEQLIFDAVSTAVTANPGIAAGLIRMYFHDCFVRGCDGSVLLDSTAD  83

Query  947   GGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEV  768
               + EK +P N  ++RGFE+ID  K  +E  CP  VSCAD+L F+ARD+  L+G   + +
Sbjct  84    N-QAEKDSPVNNPSLRGFEVIDEAKAAIETVCPNTVSCADVLAFAARDSTSLTGGLNYTL  142

Query  767   PGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNF  588
             P GRRDGNVS   +   NL  P F V Q+V  F  K L +E++V L G H+IG +HC++F
Sbjct  143   PAGRRDGNVSIANETFSNLPPPSFNVTQLVDNFAIKNLTLEEMVTLSGGHTIGRSHCTSF  202

Query  587   RYRLNTPARAKEVDGSLK----VVMGTHC-----RNAATTIPMDSTTQYKMDSMFYKQLL  435
               RL   +   +VD +L       + + C      N  TT+PMD  T   +D  +Y  + 
Sbjct  203   VSRLYNFSSTSQVDPTLDADYAATLQSLCPFNASTNNETTVPMDVFTPDDLDVNYYVGVT  262

Query  434   QKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKC  255
             Q  GL  SD+ L  +  T  LVEE       W  +F  ++IKMG I VLTG +GEIR  C
Sbjct  263   QNFGLFTSDQTLLTNDSTSALVEENIGSPDVWQARFAAAMIKMGDIEVLTGTDGEIRTNC  322

Query  254   RFVN  243
             R VN
Sbjct  323   RVVN  326



>ref|NP_197284.1| peroxidase 57 [Arabidopsis thaliana]
 sp|Q43729.1|PER57_ARATH RecName: Full=Peroxidase 57; Short=Atperox P57; AltName: Full=ATP13a; 
AltName: Full=PRXR10; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAA66966.1| peroxidase [Arabidopsis thaliana]
 emb|CAA67312.1| peroxidase ATP13a [Arabidopsis thaliana]
 dbj|BAB09581.1| peroxidase [Arabidopsis thaliana]
 gb|AAO22769.2| putative peroxidase [Arabidopsis thaliana]
 gb|AAS17635.1| peroxidase ATP13A [Arabidopsis thaliana]
 gb|AED92474.1| peroxidase 57 [Arabidopsis thaliana]
Length=313

 Score =   251 bits (640),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 128/300 (43%), Positives = 191/300 (64%), Gaps = 12/300 (4%)
 Frame = -1

Query  1130  AGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATS  951
             A +RVGFY ++CP AE IV+N + + F   P V AA++R+  HDC V GCD S+L+D+T+
Sbjct  22    AQLRVGFYSQSCPQAETIVRNLVRQRFGVTPTVTAALLRMHFHDCFVKGCDASLLIDSTN  81

Query  950   GGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFE  771
                  EK A  NG +VR F+LIDRIK ++E +CP  VSCADI+T + RD++ L+G P + 
Sbjct  82    S----EKTAGPNG-SVREFDLIDRIKAQLEAACPSTVSCADIVTLATRDSVALAGGPSYS  136

Query  770   VPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSN  591
             +P GRRDG VS   D    L  P  +V   V+LF +KG++  D VALLGAH++G  +C  
Sbjct  137   IPTGRRDGRVSNNLDV--TLPGPTISVSGAVSLFTNKGMNTFDAVALLGAHTVGQGNCGL  194

Query  590   FRYRLNTPARAKEVDGSLKVVMGTH----CRNAATTIPMDSTTQYKMDSMFYKQLLQKKG  423
             F  R+ +       D S+   + T     CRN+AT   +D ++  + D+ F+KQ+ +++G
Sbjct  195   FSDRITSFQGTGRPDPSMDPALVTSLRNTCRNSATA-ALDQSSPLRFDNQFFKQIRKRRG  253

Query  422   LLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRFVN  243
             +L+ D+RLA DP+T  +V  +A++ A +  +F  +++KMG + VLTG  GEIR+ CR  N
Sbjct  254   VLQVDQRLASDPQTRGIVARYANNNAFFKRQFVRAMVKMGAVDVLTGRNGEIRRNCRRFN  313



>ref|XP_003540317.1| PREDICTED: peroxidase 39-like [Glycine max]
Length=326

 Score =   251 bits (641),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 132/310 (43%), Positives = 191/310 (62%), Gaps = 13/310 (4%)
 Frame = -1

Query  1142  AETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLL  963
             A + A +++GFY ++CP AE+I+   + +  H+ P +AAA++R+  HDC V GCDGSVLL
Sbjct  19    ASSHAQLQLGFYAKSCPKAEQIILKFVHEHIHNAPSLAAALIRMHFHDCFVRGCDGSVLL  78

Query  962   DATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGV  783
             ++T+   + EK AP N  TVRGF+ IDRIK  +E  CPGVVSCADILT ++RD++V +G 
Sbjct  79    NSTTN--QAEKNAPPN-LTVRGFDFIDRIKSLVEAECPGVVSCADILTLASRDSIVATGG  135

Query  782   PEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVA  603
             P ++VP GRRDG +S   +AR N+ +P   +  +  LF ++GLD++DLV L GAH+IG+A
Sbjct  136   PYWKVPTGRRDGVISNLVEARNNIPAPFDNITTLQTLFANQGLDLKDLVLLSGAHTIGIA  195

Query  602   HCSNFRYRL--------NTPARAKEVDGSLKVVMGTHCRNAATT-IPMDSTTQYKMDSMF  450
             HCS+   RL          P+   E   +LK           TT I MD  ++   D  +
Sbjct  196   HCSSLSNRLFNFTGKGDQDPSLDSEYAANLKTFKCKDLNKLNTTKIEMDPGSRKTFDLSY  255

Query  449   YKQLLQKKGLLESDERLAGDPRT-LPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEG  273
             Y  +++++GL ESD  L  +  T   ++E        +  +F  S+ KMG+I+V TG EG
Sbjct  256   YSHVIKRRGLFESDAALLTNSVTKAQIIELLEGSVEKFFAEFATSIEKMGRIKVKTGTEG  315

Query  272   EIRKKCRFVN  243
             EIRK C FVN
Sbjct  316   EIRKHCAFVN  325



>ref|NP_001050193.1| Os03g0369400 [Oryza sativa Japonica Group]
 gb|AAG46130.1|AC082644_12 putative peroxidase [Oryza sativa Japonica Group]
 tpe|CAH69290.1| TPA: class III peroxidase 48 precursor [Oryza sativa Japonica 
Group]
 gb|ABF96162.1| Peroxidase family protein, expressed [Oryza sativa Japonica Group]
 dbj|BAF12107.1| Os03g0369400 [Oryza sativa Japonica Group]
Length=339

 Score =   251 bits (642),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 131/308 (43%), Positives = 181/308 (59%), Gaps = 11/308 (4%)
 Frame = -1

Query  1142  AETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLL  963
             + +T G+++G+Y   CP AE IVK  +  A H DPGV A ++R+  HDC V GCD SVLL
Sbjct  35    SPSTCGLKIGYYHDKCPHAEAIVKGVVAAALHRDPGVGAGLIRMLFHDCFVEGCDASVLL  94

Query  962   DATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDA--LVLS  789
             D T    + EK AP N  ++RGFE+ID  K+ +E +CPGVVSCADI+ F+ARDA   +  
Sbjct  95    DPTPANPQPEKLAPPNNPSLRGFEVIDAAKDAVEAACPGVVSCADIVAFAARDASFFLSD  154

Query  788   GVPEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIG  609
                 F++P GR DG  S    A   L  P F + Q+VA F +KGL VED+V L GAH+IG
Sbjct  155   SRVSFDIPSGRLDGRYSNASRALDFLPPPTFNLGQLVANFAAKGLSVEDMVVLSGAHTIG  214

Query  608   VAHCSNF-RYRLNTPARAKEVDGSLKVVMGTHCRNAAT-----TIPMDSTTQYKMDSMFY  447
             ++HCS+F   RL   A A ++D S   V+   C  + +     T+  D  T  K+D+ +Y
Sbjct  215   LSHCSSFVSDRL---AVASDIDPSFAAVLRAQCPASPSSSNDPTVVQDVVTPNKLDNQYY  271

Query  446   KQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEI  267
             K +L  + L  SD  L   P T  +V + A+    W  +F  +++KM  + V TG  GEI
Sbjct  272   KNVLAHRALFTSDASLLASPATAKMVVDNANIPGWWEDRFKTAMVKMAAVEVKTGSNGEI  331

Query  266   RKKCRFVN  243
             R+ CR VN
Sbjct  332   RRHCRAVN  339



>ref|XP_006594890.1| PREDICTED: peroxidase 3 [Glycine max]
 gb|KHN36549.1| Peroxidase 3 [Glycine soja]
Length=324

 Score =   251 bits (640),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 134/310 (43%), Positives = 186/310 (60%), Gaps = 13/310 (4%)
 Frame = -1

Query  1142  AETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLL  963
             A T A +++GFY  +CP AE+IV   +    H+ P +AAA++R+  HDC V GCD SVLL
Sbjct  17    ASTHAQLQLGFYANSCPKAEQIVLKFVHDHIHNAPSLAAALIRMHFHDCFVRGCDASVLL  76

Query  962   DATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGV  783
             ++T+   + EK AP N  TVRGF+ IDRIK  +E  CPGVVSCADILT +ARD +V +G 
Sbjct  77    NSTTN--QAEKNAPPN-LTVRGFDFIDRIKSLVEAECPGVVSCADILTLAARDTIVATGG  133

Query  782   PEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVA  603
             P ++VP GRRDG VS   +AR N+ +P      +  LF ++GLD++DLV L GAH+IG+A
Sbjct  134   PFWKVPTGRRDGVVSNLTEARNNIPAPSSNFTTLQTLFANQGLDLKDLVLLSGAHTIGIA  193

Query  602   HCSNFRYRL--------NTPARAKEVDGSLKVVMGTHCRNAATT-IPMDSTTQYKMDSMF  450
             HCS+   RL          P+   E   +LK    T      TT I MD  ++   D  +
Sbjct  194   HCSSLSNRLFNFTGKGDQDPSLDSEYAANLKAFKCTDLNKLNTTKIEMDPGSRKTFDLSY  253

Query  449   YKQLLQKKGLLESDERLAGDPRT-LPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEG  273
             Y  +++++GL ESD  L  +  T   +++        +  +F  S+ KMG+I V TG EG
Sbjct  254   YSHVIKRRGLFESDAALLTNSVTKAQIIQLLEGSVENFFAEFATSIEKMGRINVKTGTEG  313

Query  272   EIRKKCRFVN  243
             EIRK C F+N
Sbjct  314   EIRKHCAFIN  323



>ref|XP_010463825.1| PREDICTED: peroxidase 28-like [Camelina sativa]
Length=319

 Score =   251 bits (640),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 130/300 (43%), Positives = 181/300 (60%), Gaps = 5/300 (2%)
 Frame = -1

Query  1130  AGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATS  951
             A +R GFY ++CP AE IV+N + + F  DP + AA+ R+  HDC V GCD S+L+D T+
Sbjct  21    AQLRFGFYSQSCPNAETIVQNLVRQQFARDPSITAALTRMHFHDCFVQGCDASLLIDPTT  80

Query  950   GGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFE  771
                  EK A  NG +VRGFELID IK  +E  CP  VSC+DI+T + R+++ L G P + 
Sbjct  81    TQPSPEKTARPNG-SVRGFELIDEIKTALEAQCPLKVSCSDIITLATRESVFLGGGPSYP  139

Query  770   VPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSN  591
             VP GRRDG VS   DA + L  P  +V  M+  F +KG+DV D VALLGAH++GVA C N
Sbjct  140   VPTGRRDGFVSNLADAEQILPGPGISVAGMLGFFGNKGMDVFDAVALLGAHTVGVASCGN  199

Query  590   FRYRLN----TPARAKEVDGSLKVVMGTHCRNAATTIPMDSTTQYKMDSMFYKQLLQKKG  423
             F  R+     T      +D SL   +   C        +D +T +  D++F+ QL Q+KG
Sbjct  200   FGDRVTNFQGTGQPDPTMDPSLVASLRNTCAAPGGFAALDQSTPFSFDNLFFSQLRQRKG  259

Query  422   LLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRFVN  243
             +L  D+R+A DP T  +V ++A +   +  +F  +++KMG + VLTG  GEIR  CR  N
Sbjct  260   ILFIDQRMATDPATSDVVSQYAANNELFKRQFAIAMVKMGAVDVLTGLAGEIRGNCRAFN  319



>ref|XP_004487389.1| PREDICTED: peroxidase 3-like [Cicer arietinum]
Length=325

 Score =   251 bits (640),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 128/309 (41%), Positives = 194/309 (63%), Gaps = 12/309 (4%)
 Frame = -1

Query  1142  AETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLL  963
             A T A +++GFY ++CP AE+I+ N + +  H+ P +AAA++R+  HDC V GCDGS+LL
Sbjct  19    ASTHAQLQLGFYAKSCPKAEKIILNFVHEHIHNAPSLAAALIRMHFHDCFVRGCDGSILL  78

Query  962   DATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGV  783
             ++T+   + EK AP N  TVRGF+ IDRIK  +E  CPGVVSCADI+  SARD++V++G 
Sbjct  79    NSTTN--QAEKNAPPN-LTVRGFDFIDRIKSLVEAECPGVVSCADIIALSARDSIVVTGG  135

Query  782   PEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVA  603
             P ++VP GRRDG VS+  +A +N+ +P F    +   F ++GLD++DLV L GAH+IG++
Sbjct  136   PFWKVPTGRRDGVVSKLQEATQNIPAPFFNFTSLQTSFANQGLDLKDLVLLSGAHTIGIS  195

Query  602   HCSNFRYRLNT--------PARAKEVDGSLKVVMGTHCRNAATTIPMDSTTQYKMDSMFY  447
              C++F  RL          P+   E   +LK +   +  +  T + MD  ++   D  +Y
Sbjct  196   LCTSFSNRLYNFTGKGDQDPSLDSEYAKNLKTLKCKNINDNTTIVEMDPGSRNTFDLSYY  255

Query  446   KQLLQKKGLLESDERLAGDPRTLPLVEEFADDQ-AAWLGKFTESVIKMGKIRVLTGDEGE  270
              Q+++++GL +SD  L  +  T  LV +        +  +F +S+ KMG+I+V  G EGE
Sbjct  256   NQVVKRRGLFQSDSALLTNSVTKSLVTQLLHGSIEIFYDEFAKSMEKMGQIKVKIGSEGE  315

Query  269   IRKKCRFVN  243
             IRK C  VN
Sbjct  316   IRKHCALVN  324



>ref|XP_008377046.1| PREDICTED: LOW QUALITY PROTEIN: peroxidase 5-like [Malus domestica]
Length=333

 Score =   251 bits (641),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 125/302 (41%), Positives = 179/302 (59%), Gaps = 9/302 (3%)
 Frame = -1

Query  1124  MRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSGG  945
             ++VGFY  +C  AE IVK+ + KAF  DPGV A +VR+  HDC V GCD SVL+D+TS  
Sbjct  32    LQVGFYTTSCTLAETIVKDEVQKAFFRDPGVTAGLVRMHFHDCFVRGCDASVLIDSTSSN  91

Query  944   GRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEVP  765
                EK +P+N  ++RGFE+ID+ K  +E +C GV+SCADI+ F+ARD++VL+    ++VP
Sbjct  92    T-AEKDSPANNPSLRGFEVIDKAKARLEAACRGVISCADIVAFAARDSIVLTRGLGYDVP  150

Query  764   GGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNFR  585
              GRRD   S+  D  + L  P F VD +  LF +KG   E++V L GAH+IG +HC++F 
Sbjct  151   AGRRDSRSSKASDXTRKLPFPTFNVDNLTQLFANKGFTQEEMVTLSGAHTIGRSHCTSFS  210

Query  584   YRLNTPARAKEVDGSLKVVMGTHCR--------NAATTIPMDSTTQYKMDSMFYKQLLQK  429
              RL         D SL        +        NA   +PMD  +    D+ +Y  +L+ 
Sbjct  211   NRLTNFXATTNQDPSLDPAYAAQLKQQCPQGNTNANLVVPMDPASPIVTDASYYAGILKN  270

Query  428   KGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRF  249
             +GL  SD+ L  +P T   V+  A     W  KF+ +++KMG++ VL G+ GEIR  CR 
Sbjct  271   RGLFTSDQTLLTNPATANQVKHNARIPLLWKKKFSAAMVKMGQLEVLMGNAGEIRANCRA  330

Query  248   VN  243
             +N
Sbjct  331   IN  332



>ref|XP_006350158.1| PREDICTED: peroxidase 57-like [Solanum tuberosum]
Length=328

 Score =   251 bits (640),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 125/309 (40%), Positives = 195/309 (63%), Gaps = 15/309 (5%)
 Frame = -1

Query  1133  TAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDAT  954
             +A +++GFY  +CP AE IVK+ + K F ++P +  A++RL  HDC V GCD S+L+D+ 
Sbjct  20    SAQLKIGFYNSSCPNAEFIVKSIVQKRFKNNPSITGALLRLHFHDCGVRGCDASILIDSD  79

Query  953   SGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEF  774
             S   ++ ++  +   TVRG+ELID IKE++E  CP +VSC+DI+T + RDA+ L+G P++
Sbjct  80    SSKNQISEKDSAPNLTVRGYELIDEIKEKLESICPSIVSCSDIVTLATRDAVALAGGPKY  139

Query  773   EVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCS  594
              +P GRRDG VS   ++  +L  P   V +++  F++ GL+  D+V LLGAH++GVAHCS
Sbjct  140   TIPTGRRDGLVS---NSSVDLPGPTQPVSEILKFFRTIGLNKFDMVTLLGAHTVGVAHCS  196

Query  593   NFRYRLNTPARAKEVDGSL------KVVMGTHCRNAATTIP------MDSTTQYKMDSMF  450
              F+ R++        D ++      K+    +    ATT+       +D  T + +D+ +
Sbjct  197   FFQSRVSDFRGTGRPDPTMDPELVKKLFRLCNTSKPATTLNDVPRTFLDQNTSFIVDNQY  256

Query  449   YKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGE  270
             Y Q+L+KKG+L+ D+ LA D  + P+V  FA +  A+   F +S++KMG I VL GD+GE
Sbjct  257   YNQILKKKGILKIDQELALDKLSAPIVARFAKNGNAFRKSFAKSMVKMGNINVLVGDDGE  316

Query  269   IRKKCRFVN  243
             IRK CR  N
Sbjct  317   IRKNCRVFN  325



>ref|XP_009361266.1| PREDICTED: peroxidase 5-like [Pyrus x bretschneideri]
Length=328

 Score =   251 bits (640),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 126/302 (42%), Positives = 181/302 (60%), Gaps = 9/302 (3%)
 Frame = -1

Query  1124  MRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSGG  945
             ++VGFY  +C  AE IVK+ + KAF  DPGV A +VR+  HDC V GCD SVL+D+TS  
Sbjct  27    LQVGFYTTSCTLAETIVKDEVQKAFFRDPGVTAGLVRMHFHDCFVRGCDASVLIDSTSSN  86

Query  944   GRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEVP  765
                EK +P+N  ++RGFE+ID+ K  +E +C GVVSCADI+ F+ARD++VL+    ++VP
Sbjct  87    -TAEKDSPANNPSLRGFEVIDKAKARLEAACRGVVSCADIVAFAARDSIVLTRGLGYDVP  145

Query  764   GGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNFR  585
              GRRDG VS+  D   NL  P F V+ +   F +KG   +++V L GAH+IG +HC++F 
Sbjct  146   AGRRDGRVSKASDIPGNLPLPTFNVNNLTQHFANKGFTQQEMVTLSGAHTIGRSHCTSFS  205

Query  584   YRLNTPARAKEVDGSLKVVMGTHCR--------NAATTIPMDSTTQYKMDSMFYKQLLQK  429
              RL         D SL        +        NA   +PMD  +    D+ +Y  +L+ 
Sbjct  206   NRLYNFNATTNQDPSLDPAYAAQLKQQCPQGNTNANLVVPMDPASPTVTDASYYAGILKN  265

Query  428   KGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRF  249
             +GL  SD+ L  +  T   V++ A     W  KF+ +++KMG++ VLTG+ GEIR  CR 
Sbjct  266   RGLFTSDQTLLTNSATANQVKQNARIPFLWKNKFSAAMVKMGQLEVLTGNAGEIRANCRV  325

Query  248   VN  243
             +N
Sbjct  326   IN  327



>ref|XP_006408278.1| hypothetical protein EUTSA_v10021155mg [Eutrema salsugineum]
 gb|ESQ49731.1| hypothetical protein EUTSA_v10021155mg [Eutrema salsugineum]
Length=320

 Score =   250 bits (639),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 127/301 (42%), Positives = 182/301 (60%), Gaps = 6/301 (2%)
 Frame = -1

Query  1130  AGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATS  951
             A +RVGFY ++CP AE I++N + + F  DP + AA+ R+  HDC V GCD S+L+D T+
Sbjct  21    AQLRVGFYSQSCPNAETIIQNLVSERFGRDPSITAALTRMHFHDCFVQGCDASLLIDPTT  80

Query  950   GGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFE  771
                  EK A  NG +VRGFELID IK  +E  CP +VSC+DI+T + RD++ L G P + 
Sbjct  81    ANQEPEKIAGPNG-SVRGFELIDEIKTALEAQCPSIVSCSDIVTLATRDSVFLGGGPSYV  139

Query  770   VPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSN  591
             VP GRRDG VS   DA + L  P   V  M+  F +KG++V D VALLGAH++G   C N
Sbjct  140   VPTGRRDGFVSNRIDAERILPGPGLAVPDMLTFFGNKGMNVFDAVALLGAHTVGFGSCGN  199

Query  590   FRYRLNTPARAKEVDGSLKVVMGTHCRNAATT-----IPMDSTTQYKMDSMFYKQLLQKK  426
             F  RL       + D S+   +    RN  +        +D +T +  D++F+ Q+ ++K
Sbjct  200   FVDRLTNFQGTGQPDPSMDPGLAGRLRNTCSAGGSQFAALDQSTPFSFDNLFFTQIRERK  259

Query  425   GLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRFV  246
             G+L  D+RLA DP T  +V ++A +   +  +F  +++KMG + VLTG  GEIR+ CR  
Sbjct  260   GVLLLDQRLATDPATSGVVFQYAVNNELFKRQFAIAMVKMGAVDVLTGLAGEIRRNCRAF  319

Query  245   N  243
             N
Sbjct  320   N  320



>ref|XP_003602405.1| Peroxidase [Medicago truncatula]
 gb|AES72656.1| peroxidase family protein [Medicago truncatula]
Length=327

 Score =   251 bits (640),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 126/302 (42%), Positives = 184/302 (61%), Gaps = 9/302 (3%)
 Frame = -1

Query  1124  MRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSGG  945
             + VGFY  +C  AE IVK+ + K+F+ +PG+AA +VR+  HDC + GCD SVLLD+T   
Sbjct  26    LEVGFYTYSCGMAEFIVKDEVRKSFNKNPGIAAGLVRMHFHDCFIRGCDASVLLDSTLSN  85

Query  944   GRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEVP  765
                EK +P+N  ++RGFE+ID  K ++E+ C G+VSCADI+ F+ARD++ L+G   ++VP
Sbjct  86    -IAEKDSPANKPSLRGFEVIDNAKAKLEEECKGIVSCADIVAFAARDSVELAGGLGYDVP  144

Query  764   GGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNFR  585
              GRRDG +S   D R  L  P F V+Q+  LF  KGL  +++V L GAH+IG +HCS F 
Sbjct  145   AGRRDGKISLASDTRTELPPPTFNVNQLTQLFAKKGLTQDEMVTLSGAHTIGRSHCSAFS  204

Query  584   YRL----NTPARAKEVDGSLKVVMGTHC----RNAATTIPMDSTTQYKMDSMFYKQLLQK  429
              RL    +T  +   +D S   ++   C     N    +PMD ++    D  +Y  +L  
Sbjct  205   KRLYNFSSTSIQDPSLDPSYAALLKRQCPQGNTNQNLVVPMDPSSPGTADVGYYNDILAN  264

Query  428   KGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRF  249
             +GL  SD+ L  +  T   V + A +   W  KF ++++KMG++ VLTG+ GEIR  CR 
Sbjct  265   RGLFTSDQTLLTNTGTARKVHQNARNPYLWSNKFADAMVKMGQVGVLTGNAGEIRTNCRV  324

Query  248   VN  243
             VN
Sbjct  325   VN  326



>ref|XP_008452817.1| PREDICTED: peroxidase 18 [Cucumis melo]
Length=327

 Score =   251 bits (640),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 135/310 (44%), Positives = 181/310 (58%), Gaps = 20/310 (6%)
 Frame = -1

Query  1136  TTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDA  957
             TT  +  GFY  TCP AE +V+N +  A   DP V   ++RL  HDC V GCD SVL++ 
Sbjct  25    TTVALSFGFYAATCPAAELMVRNTVRSASSVDPTVPGKLLRLLFHDCFVEGCDASVLVE-  83

Query  956   TSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPE  777
                G   E+  P+N K++ GFE+ID  K  +E  CPG VSCADI+  +ARDA+  +G P 
Sbjct  84    ---GNGTERSDPAN-KSLGGFEVIDSAKRTLEIFCPGTVSCADIVVLAARDAVEFTGGPS  139

Query  776   FEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHC  597
              EVP GRRDG +S   + R N+A   F+V+QM+ LF SKGL V+DLV L GAH+IG +HC
Sbjct  140   VEVPTGRRDGKISAASNVRPNIADTSFSVNQMMNLFSSKGLSVDDLVILSGAHTIGTSHC  199

Query  596   SNF--RYRLNTPARAKEVDGSLKVVMGTHCRN----------AATTIPMDSTTQYKMDSM  453
             S F  R+R N   +   +D SL    G++              A T+  D  T +  D+ 
Sbjct  200   SAFSDRFRRNPNGQLTLIDASLD---GSYADELMRRCPAGAATAATVENDPATAFVFDNQ  256

Query  452   FYKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEG  273
             +Y+ +L  KGLL+SD  L  D RT   VE FA+DQ  +   + +S +K+  I V +GDEG
Sbjct  257   YYRNILSHKGLLQSDSVLISDGRTRARVESFANDQIGFFENWAQSFLKLSSIGVKSGDEG  316

Query  272   EIRKKCRFVN  243
             EIR  C  VN
Sbjct  317   EIRLSCSTVN  326



>ref|XP_009798542.1| PREDICTED: peroxidase 44-like [Nicotiana sylvestris]
Length=328

 Score =   251 bits (640),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 127/309 (41%), Positives = 190/309 (61%), Gaps = 14/309 (5%)
 Frame = -1

Query  1133  TAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDAT  954
             +A ++VGFY  +CPTAE IVK+ + + F  D  +  A++RL  HDC V GCD S+L+D+ 
Sbjct  21    SAQLKVGFYSSSCPTAENIVKSVVKEKFKSDHSITGALLRLHFHDCGVRGCDASILIDSD  80

Query  953   SGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEF  774
                 +  ++  +   TVRG+ELID IKE++E +CP  VSCADI+T + RD + L+G P++
Sbjct  81    PTNNQTSEKDSNPNFTVRGYELIDEIKEKLEANCPSTVSCADIITLATRDVIALAGGPKY  140

Query  773   EVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCS  594
              +P GRRDG+VS   +   +L  P+ +V +++A FK+ GL+  D+V LLGAH++GV HC 
Sbjct  141   IIPTGRRDGHVSNASEV--DLPGPNNSVSEILAFFKTLGLNKNDMVTLLGAHTVGVVHCF  198

Query  593   NFRYRLN----TPARAKEVDGSLKVVMGTHCRNAA--------TTIPMDSTTQYKMDSMF  450
              F+ R++    T      +D  L   +   C  +          T  +D  T + +D+ F
Sbjct  199   FFQSRVSNFRGTGKPDPTMDPELVTKLFKLCNTSTPPTTLDDVPTTFLDQNTSFIVDNQF  258

Query  449   YKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGE  270
             YKQ+L KKG+L+ D+ LA D  + P+V  FA +  A+   F +++IKMG I VL GD+GE
Sbjct  259   YKQILLKKGVLKIDQELALDKLSAPIVSRFAANGNAFRQSFAKAMIKMGNINVLVGDDGE  318

Query  269   IRKKCRFVN  243
             IRK CR  N
Sbjct  319   IRKNCRVFN  327



>gb|KFK34345.1| hypothetical protein AALP_AA5G133200 [Arabis alpina]
Length=340

 Score =   251 bits (641),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 130/308 (42%), Positives = 189/308 (61%), Gaps = 9/308 (3%)
 Frame = -1

Query  1142  AETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLL  963
             + TTA +   FY  +CP A+ IV++ +VKA+ DDP +AA+++RL  HDC V GCDGSVLL
Sbjct  30    STTTASLSPQFYDNSCPKAQAIVQSIVVKAYSDDPRMAASLLRLHFHDCFVNGCDGSVLL  89

Query  962   DATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGV  783
             D  SG    EK++  N  + RGFE+ID IK  +E  CP  VSCADIL   ARD+ V++G 
Sbjct  90    D-NSGTMESEKRSEPNQNSARGFEVIDDIKSTLENECPQTVSCADILALVARDSTVITGG  148

Query  782   PEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVA  603
             P +EV  GRRD   +    +  N+ SP+ T+  +V  F   GLD+ DLVALLG+H+IG +
Sbjct  149   PNWEVYLGRRDARDANLNGSNNNIPSPNSTIQTLVTKFYLHGLDLTDLVALLGSHTIGNS  208

Query  602   HCSNFRYRLNTPARAKEVDGSLKVVMGTHCRNAA-------TTIPMDSTTQYKMDSMFYK  444
              C+NFR RL   +   ++D +L     +  +              +D  T  K D+ ++K
Sbjct  209   RCTNFRQRLYNHSGNSDIDQTLNQNYASMLQQGCPISGDDQNLFALDYATPTKFDNYYFK  268

Query  443   QLLQKKGLLESDERLAGDPR-TLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEI  267
              L+  KGLL SDE L    + ++ LV+ +A+++ A+  +F +S++KMG I  LTG++GEI
Sbjct  269   NLVSYKGLLSSDEILYTKSKDSMELVKLYAENEEAFFEQFAKSMVKMGNISPLTGNDGEI  328

Query  266   RKKCRFVN  243
             R+ CR VN
Sbjct  329   RRICRRVN  336



>ref|XP_010674523.1| PREDICTED: peroxidase 5-like [Beta vulgaris subsp. vulgaris]
Length=336

 Score =   251 bits (640),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 128/301 (43%), Positives = 184/301 (61%), Gaps = 10/301 (3%)
 Frame = -1

Query  1118  VGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSGGGR  939
             VGFY +TCP+AEEIV+N +  A   +PG+ A ++R+  HDC V GCD S+LLD+T     
Sbjct  37    VGFYQQTCPSAEEIVRNVVNNAVTRNPGLGAGLIRMHFHDCFVRGCDASILLDSTLENPS  96

Query  938   VEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEVPGG  759
              EK+  +N  ++RG+E+ID  K+++E  CP VVSCADI+ F+ARD+    G   + V  G
Sbjct  97    -EKENIANNPSMRGYEVIDEAKKQLEAQCPQVVSCADIIAFAARDSASKLGGINYGVESG  155

Query  758   RRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNFRYR  579
             RRDG VS + D  +NL  P F ++Q+   F+ KGL +E++V L GAHSIGV+HCS+F  R
Sbjct  156   RRDGRVSLKDDPTQNLPPPFFNLNQLKENFERKGLSLEEMVILSGAHSIGVSHCSSFTQR  215

Query  578   LN----TPARAKEVDGSLKVVMGTHCRNAA-----TTIPMDSTTQYKMDSMFYKQLLQKK  426
             L     T  +   +D     ++ + C N +      T+  D  T  ++D+ +Y+ L  K+
Sbjct  216   LYSFNATHPQDPSMDPRFASMLKSKCLNNSPNNVDPTVLQDFVTPNRLDNKYYQNLQNKR  275

Query  425   GLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRFV  246
             GLL SD+ L   P T  +V  +    + W  KF ++++ MG I VLTG EGEIRK CR V
Sbjct  276   GLLTSDQTLVTSPETANMVRNYGGRSSDWANKFAKAMVHMGSIEVLTGIEGEIRKNCRIV  335

Query  245   N  243
             N
Sbjct  336   N  336



>ref|XP_010034487.1| PREDICTED: peroxidase 5-like [Eucalyptus grandis]
Length=327

 Score =   250 bits (639),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 127/305 (42%), Positives = 183/305 (60%), Gaps = 9/305 (3%)
 Frame = -1

Query  1133  TAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDAT  954
             +A ++VGFY   CP AE +V+  + KA   +PG  A ++R+  HDC V GCD S+LLD+T
Sbjct  24    SATLQVGFYRSACPAAESVVRKAVNKAVARNPGTGAGLIRMHFHDCFVRGCDASILLDST  83

Query  953   SGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEF  774
              G    EK+ P+N  ++RG+E+ID+ K E+E   P  VSCADIL F+ARD+    G   +
Sbjct  84    LGNPS-EKEHPANDPSLRGYEVIDKAKAELEHLYPQTVSCADILAFAARDSTYKLGSINY  142

Query  773   EVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCS  594
              VP GRRDG VS   +  +NL  P     Q+ A F  KGL ++++V + GAHSIGV+HCS
Sbjct  143   AVPAGRRDGLVSLRDEPSQNLPPPSLDAQQLEANFARKGLSLDEMVTVSGAHSIGVSHCS  202

Query  593   NFRYRLNTPARAKEVDGSLKVVMGTHCR-----NAAT---TIPMDSTTQYKMDSMFYKQL  438
             +F  RL +     + D SL+  + +  +     N  T   T+P+D  T  ++D+ +Y  L
Sbjct  203   SFSNRLYSFNATHKQDPSLEPKLASELKAKCPNNGGTSDPTVPLDFVTANRLDNKYYTNL  262

Query  437   LQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKK  258
              + +G+L SD+ L   P T  +V   A+   AW  KF  +++KMG I VLTG +GEIR+ 
Sbjct  263   KKHRGVLTSDQTLFNSPSTAHIVRRNANHGGAWASKFAAAMVKMGSIDVLTGSQGEIRRN  322

Query  257   CRFVN  243
             CR VN
Sbjct  323   CRVVN  327



>ref|XP_003558948.1| PREDICTED: peroxidase 5-like [Brachypodium distachyon]
Length=338

 Score =   251 bits (640),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 133/322 (41%), Positives = 192/322 (60%), Gaps = 18/322 (6%)
 Frame = -1

Query  1157  RNAEAAETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCD  978
             R+A+A      +++GFY ++CP AE IV++ + +A   DPG+AA ++RL  HDC V GCD
Sbjct  18    RDAQAQAPATQLQLGFYAQSCPQAEVIVRDEVGRAVSGDPGLAAGLLRLHFHDCFVKGCD  77

Query  977   GSVLLDATSGGGRV--EKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARD  804
              SVLLD  +G G    EK A  N +T+RGFE+ID  K+ +E +C G VSCADIL F+ARD
Sbjct  78    ASVLLDTIAGNGSTAAEKDAAPN-RTLRGFEVIDGAKKRLESACAGTVSCADILAFAARD  136

Query  803   ALVLSGVPEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLG  624
             ++VL+G   + VP GRRDGN S   DA+ +L  P   V Q+  +F   GL  ED+V L G
Sbjct  137   SVVLTGGSPYGVPAGRRDGNESSASDAQASLPPPTANVAQLTQIFARNGLSQEDMVTLSG  196

Query  623   AHSIGVAHCSNFRYRL--------NTPARAKEVDGSLKVVMGTHC-RNAATTIPMD----  483
             AH+IGV HCS+F  RL        +       +D +    +   C   +A T+PMD    
Sbjct  197   AHTIGVTHCSSFSARLYSGDNNNSDNTGHDPAMDDATATELARRCPPGSADTVPMDLGGG  256

Query  482   --STTQYKMDSMFYKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIK  309
                  +   D+ +++ LL  +GLL SD+ L  D  T  LV + A +   ++ +F +++++
Sbjct  257   GGPVDENAFDTGYFQALLAHRGLLGSDQALTADNATAALVAQNAGNLYLFVTRFADAMVR  316

Query  308   MGKIRVLTGDEGEIRKKCRFVN  243
             MG +RVLTG +G+IR  CR VN
Sbjct  317   MGAVRVLTGSDGQIRTSCRVVN  338



>ref|XP_004985933.1| PREDICTED: peroxidase 5-like [Setaria italica]
Length=316

 Score =   250 bits (638),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 125/305 (41%), Positives = 181/305 (59%), Gaps = 12/305 (4%)
 Frame = -1

Query  1124  MRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSGG  945
             ++  FYG TCP AE IV+  +++  H D G AA +VR+  HDC V GCD S+LL++T   
Sbjct  13    LQPNFYGATCPQAETIVRQEVIRWLHSDMGFAAGLVRMHFHDCFVRGCDASILLESTPDN  72

Query  944   GRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEVP  765
                E+ +P N  ++RGFE+ID  K  +E +CPGVVSCADIL F+ARD++ LSG P ++VP
Sbjct  73    -TAERDSPVNNPSLRGFEVIDSAKARLEDACPGVVSCADILAFAARDSVALSGGPRYDVP  131

Query  764   GGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNFR  585
             GGRRDG +S   +   N+ +P F +DQ+   F +KGL  E++V L GAH+IG AHC+ F 
Sbjct  132   GGRRDGTLSMASEVADNIPAPTFNLDQLTQSFAAKGLTQEEMVTLSGAHTIGRAHCTAFS  191

Query  584   YRLNTPARAKEVDGSLKVVMGTHCRNA-----------ATTIPMDSTTQYKMDSMFYKQL  438
              RL   +     D +L        ++A              +PM+  T + +D+++Y  +
Sbjct  192   DRLYNFSATGVADPTLDPPFLAQLQHACPAAGDGGVDPGLVVPMEPRTPHALDTLYYWGV  251

Query  437   LQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKK  258
             L+ +GL  SD+ L     T   V + A     W  KF  +++KMG+I+VLTG  G+IR K
Sbjct  252   LRNRGLFASDQALLASAPTAAQVRQSAYGGYPWKLKFAAAMVKMGQIQVLTGGGGQIRAK  311

Query  257   CRFVN  243
             C  VN
Sbjct  312   CSAVN  316



>ref|XP_008808270.1| PREDICTED: peroxidase 5-like [Phoenix dactylifera]
Length=332

 Score =   250 bits (639),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 136/305 (45%), Positives = 182/305 (60%), Gaps = 15/305 (5%)
 Frame = -1

Query  1124  MRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSGG  945
             + +G+YG+TCP AE IV + + KA   D G+AA +VR+  HDC V GCDGS+L+D+T   
Sbjct  29    LHMGYYGKTCPQAEFIVLDEVKKAVAGDAGLAADLVRMHFHDCFVRGCDGSILIDSTPNN  88

Query  944   GRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEVP  765
                EK AP N  ++ GFE+ID  K+ +E  C G+VSCADI+ F+ARDA+VL+G   +EVP
Sbjct  89    -MAEKDAPPNNPSLEGFEIIDNAKKRLEAECKGMVSCADIVAFAARDAVVLTGGLFYEVP  147

Query  764   GGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNFR  585
              GRRDG VS   +A  NL  P F ++Q+   F  KGL  ++++ L GAH+IG +HCS+F 
Sbjct  148   AGRRDGRVSIANEALTNLPPPSFDLNQLTQSFAQKGLSQDEMIILSGAHTIGQSHCSSFS  207

Query  584   YRLNTPARAKEVDGSLKVVMGTH----CRNAAT----TIPMDSTTQYKMDSMFYKQLLQK  429
              RL     A   D SL           C N ++     +PMD  +    D+ +Y  LL  
Sbjct  208   SRLYNFNSAFSQDPSLDPAYAAQLKQECPNTSSGANQEVPMDPKSPSTFDTSYYSNLLVN  267

Query  428   KGLLESDERLAGDPRTLPLVEEFADDQAAWLG---KFTESVIKMGKIRVLTGDEGEIRKK  258
             +GL  SD+ L   P T   V + A D   WLG   KF +++ KMGKI VLTG EGEIR  
Sbjct  268   RGLFTSDQTLMSTPATAAKVWQNAAD---WLGFQKKFGQAMRKMGKIGVLTGSEGEIRCN  324

Query  257   CRFVN  243
             CR VN
Sbjct  325   CRVVN  329



>gb|AAD11482.1| peroxidase precursor, partial [Glycine max]
Length=351

 Score =   251 bits (641),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 135/313 (43%), Positives = 187/313 (60%), Gaps = 13/313 (4%)
 Frame = -1

Query  1151  AEAAETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGS  972
             A  A T A +++GFY  +CP AE+IV   +    H+ P +AAA++R+  HDC V GCD S
Sbjct  41    ALIASTHAQLQLGFYANSCPKAEQIVLKFVHDHIHNAPSLAAALIRMHFHDCFVRGCDAS  100

Query  971   VLLDATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVL  792
             VLL++T+   + EK AP N  TVRGF+ IDRIK  +E  CPGVVSCADILT +ARD +V 
Sbjct  101   VLLNSTTN--QAEKNAPPN-LTVRGFDFIDRIKSLVEAECPGVVSCADILTLAARDTIVA  157

Query  791   SGVPEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSI  612
             +G P ++VP GRRDG VS   +AR N+ +P      +  LF ++GLD++DLV L GAH+I
Sbjct  158   TGGPFWKVPTGRRDGVVSNLTEARNNIPAPSSNFTTLQTLFANQGLDLKDLVLLSGAHTI  217

Query  611   GVAHCSNFRYRL--------NTPARAKEVDGSLKVVMGTHCRNAATT-IPMDSTTQYKMD  459
             G+AHCS+   RL          P+   E   +LK    T      TT I MD  ++   D
Sbjct  218   GIAHCSSLSNRLFNFTGKGDQDPSLDSEYAANLKAFKCTDLNKLNTTKIEMDPGSRKTFD  277

Query  458   SMFYKQLLQKKGLLESDERLAGDPRT-LPLVEEFADDQAAWLGKFTESVIKMGKIRVLTG  282
               +Y  +++++GL ESD  L  +  T   +++        +  +F  S+ KMG+I V TG
Sbjct  278   LSYYSHVIKRRGLFESDAALLTNSVTKAQIIQLLEGSVENFFAEFATSIEKMGRINVKTG  337

Query  281   DEGEIRKKCRFVN  243
              EGEIRK C F+N
Sbjct  338   TEGEIRKHCAFIN  350



>ref|XP_004973034.1| PREDICTED: peroxidase 47-like [Setaria italica]
Length=319

 Score =   250 bits (638),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 129/302 (43%), Positives = 188/302 (62%), Gaps = 6/302 (2%)
 Frame = -1

Query  1145  AAETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVL  966
             A    A + + +YG +CP AE IV+N + +A   DP +A +I+RL  HDC V GCD SVL
Sbjct  22    AGHGAAELSMDYYGMSCPYAEYIVRNVVGQALMKDPTLAGSILRLHFHDCFVQGCDASVL  81

Query  965   LDATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSG  786
             LD+T      EK AP+N K++RGFE+ID IKE +E+ CPGVVSCAD+L  +ARDA+ ++ 
Sbjct  82    LDSTDDN-TAEKDAPAN-KSLRGFEVIDSIKEALEEQCPGVVSCADVLALAARDAVFMAR  139

Query  785   VPEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGV  606
              P + VP GRRDG+ S   D    L  P   V  ++ +F   GLDV D+VAL G H++G+
Sbjct  140   GPYYGVPLGRRDGSRSVASDTFLTLPPPIKNVTVLIQIFDKVGLDVHDMVALSGGHTLGI  199

Query  605   AHCSNFRYRLNTPARAKEVDGSLKVVMGTHCRNAAT-TIPMDSTTQYKMDSMFYKQLLQK  429
             AHC+NF+ R+      + +D +L   +G+ C+   +   P D T+  + D+++Y++L  K
Sbjct  200   AHCANFKNRIKD--ETETLDATLASSLGSVCKGGDSGKAPFDRTST-RFDAVYYRELTSK  256

Query  428   KGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRF  249
             +GLL SD+ L   P T  +V  FA +   +   F + ++KMG+I +  GD+GEIR  CR 
Sbjct  257   RGLLSSDQTLFESPETKEMVSMFAMNPDYFFYAFQQGMLKMGQINLKEGDDGEIRHTCRV  316

Query  248   VN  243
             VN
Sbjct  317   VN  318



>ref|XP_004977108.1| PREDICTED: peroxidase 1-like [Setaria italica]
Length=351

 Score =   251 bits (641),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 133/313 (42%), Positives = 184/313 (59%), Gaps = 12/313 (4%)
 Frame = -1

Query  1148  EAAETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSV  969
              A    A + VGFY RTCP+AE +V+  +  AF ++ GVA A++RL  HDC V GCD SV
Sbjct  17    SATAVCACLEVGFYDRTCPSAETVVQQTVAAAFRNNSGVAPALIRLHFHDCFVRGCDCSV  76

Query  968   LLDATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLS  789
             L+D+T+     EK +P N  ++R F+++DR K  +E  CPGVVSCAD+L F+ARD + L+
Sbjct  77    LIDSTANN-TAEKDSPPNNPSLRFFDVVDRAKAAVEARCPGVVSCADVLAFAARDGVALA  135

Query  788   GVPEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIG  609
             G   ++VP GRRDG VS   +A   L  P F   +++  F SK L +ED+V L GAHSIG
Sbjct  136   GGLGYQVPAGRRDGRVSLAAEAFNELPPPSFNATELLDSFASKNLTLEDMVVLSGAHSIG  195

Query  608   VAHCSNFRYRL-NTPARAKEVDGSLK----VVMGTHC-RNAATTIP-----MDSTTQYKM  462
             V+HC +F  RL N       +D +L      ++   C RN     P     MD  T  K+
Sbjct  196   VSHCIHFFDRLYNVTNTTDGIDPALSKAYAFLLQCICPRNTGQFFPNTTTFMDLITPTKL  255

Query  461   DSMFYKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTG  282
             D+ +Y  L    GL +SD  L  +     LV+ F   +A W  KF  S++KMG+I VL+G
Sbjct  256   DNKYYVGLTNNLGLFQSDAALLTNATMKALVDSFIRSEATWKSKFARSMVKMGQIGVLSG  315

Query  281   DEGEIRKKCRFVN  243
              +GEIR+ CR +N
Sbjct  316   TQGEIRRNCRAIN  328



>ref|XP_008390085.1| PREDICTED: peroxidase 5-like [Malus domestica]
Length=339

 Score =   250 bits (639),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 134/308 (44%), Positives = 179/308 (58%), Gaps = 17/308 (6%)
 Frame = -1

Query  1127  GMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSG  948
             G+ VGFY R CP  EEIV + + KA   D  + A ++RL  HDC V GCD S+LLD+T  
Sbjct  36    GLHVGFYDRKCPNLEEIVTDVVAKAVETDQKLPAGLIRLFFHDCFVKGCDASILLDSTPS  95

Query  947   GGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEV  768
                VE Q+P+NG  +RG E+I+ IK  +EQ CP  VSCADIL F+ R+A+  SG+P  +V
Sbjct  96    NEPVEMQSPANGG-IRGIEVIEEIKARLEQECPETVSCADILAFATREAVAFSGLPRHQV  154

Query  767   PGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNF  588
             P GRRD   SR  D    L SP   +D+++  F  + L  E++V L GAHSIG  HCS F
Sbjct  155   PAGRRDSRTSRASDVI--LPSPATPMDEIIDFFSRRNLTPEEMVVLFGAHSIGTVHCSFF  212

Query  587   RYRLNTPARAKEVDGSLKVV----MGTHCRNAAT---------TIPMDSTTQYKMDSMFY  447
              YRL   A  +  D SL  V    +   C    T          + +D TT   +D+ +Y
Sbjct  213   DYRLYNFAPGQPQDPSLNPVFAADLAQQCPAPNTLQGEEAENKVVDLD-TTPLVLDNHYY  271

Query  446   KQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEI  267
               L+Q + L++SD+ LA +PRT   V + A    +W  +F  ++IKMG+I VLTGD GEI
Sbjct  272   MNLIQGRALMQSDQALATNPRTGAEVAKLAIRSDSWARQFVRAIIKMGRINVLTGDAGEI  331

Query  266   RKKCRFVN  243
             RK CR  N
Sbjct  332   RKNCRNFN  339



>ref|XP_009126210.1| PREDICTED: peroxidase 57 [Brassica rapa]
Length=310

 Score =   249 bits (637),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 131/300 (44%), Positives = 192/300 (64%), Gaps = 12/300 (4%)
 Frame = -1

Query  1130  AGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATS  951
             A +RVGFY R+CP AE IV+N + + F  DP V AA++R+  HDC V GCD S+L+D+T+
Sbjct  19    AQLRVGFYSRSCPQAETIVRNLVRQRFGVDPTVTAALLRMHFHDCFVRGCDASLLIDSTN  78

Query  950   GGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFE  771
                  EK A  NG +VR F+LIDRIK ++E +CP  VSCADI+T + RD++ L+G P + 
Sbjct  79    S----EKTAGPNG-SVREFDLIDRIKAQLEAACPSTVSCADIITLATRDSVALAGGPSYS  133

Query  770   VPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSN  591
             +P GRRDG VS   D    L  P  +V   V+LF +KG++V D VALLGAH++G  +C  
Sbjct  134   IPTGRRDGLVSNNVDV--ALPGPTISVAGAVSLFTNKGMNVFDAVALLGAHTVGQGNCGL  191

Query  590   FRYRLN----TPARAKEVDGSLKVVMGTHCRNAATTIPMDSTTQYKMDSMFYKQLLQKKG  423
             F  R+     T      +D +L   +   CRN+A+   +D +T  + D+ F+KQL +++G
Sbjct  192   FNDRITNFQGTGRPDPSMDPALVSSLRNTCRNSASA-ALDQSTPLRFDNQFFKQLRKRRG  250

Query  422   LLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRFVN  243
             +++ D+RLA D +T  +V  +A++ A +  +F  ++IKMG + VLTG  GEIR+ CR  N
Sbjct  251   VMQVDQRLATDRQTRGVVARYANNNAFFKRQFVRAMIKMGAVDVLTGRAGEIRRNCRRFN  310



>gb|EYU39444.1| hypothetical protein MIMGU_mgv1a009735mg [Erythranthe guttata]
Length=333

 Score =   250 bits (639),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 132/301 (44%), Positives = 178/301 (59%), Gaps = 7/301 (2%)
 Frame = -1

Query  1124  MRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSGG  945
             ++VGFY   CP AE IV+  + KA   +PG+AA I+RL  HDC V GCDGS+LLD  +G 
Sbjct  33    LKVGFYAYKCPHAEIIVRKAVNKAVSLNPGLAAGIIRLHFHDCFVRGCDGSLLLDTVAGK  92

Query  944   GRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEVP  765
                EK+  +N  ++RGFE+ID+ K ++E  CPG VSCADIL F+ARD+ + +G   +EVP
Sbjct  93    PAAEKENVANFPSLRGFEVIDQAKADIEAVCPGTVSCADILAFAARDSSLKAGYIGYEVP  152

Query  764   GGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNFR  585
              GRRDG VS   +  +NL  P F+  ++   FK KGL ++++V L GAHSIGV+HCS F 
Sbjct  153   SGRRDGRVSLSSEVLQNLPPPFFSAAELKENFKRKGLSLDEMVTLSGAHSIGVSHCSAFS  212

Query  584   YRLN----TPARAKEVDGSLKVVMGTHC---RNAATTIPMDSTTQYKMDSMFYKQLLQKK  426
              RL+    T  +   +D      + T C    N    +  D  T   +D+ +Y  L   K
Sbjct  213   NRLSGFNATFDKDPSLDSGYAAFLKTKCPVPANGDPAVNNDFQTPTVLDNKYYVNLKNHK  272

Query  425   GLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRFV  246
             GLL SD+ L   P T  LV       + W  KF  +++ MG I VLTG +GEIRK CR V
Sbjct  273   GLLTSDQTLFDSPLTKNLVLNNVKYGSVWAKKFAAAMVHMGSIEVLTGKQGEIRKNCRLV  332

Query  245   N  243
             N
Sbjct  333   N  333



>ref|XP_010659811.1| PREDICTED: peroxidase 5-like [Vitis vinifera]
Length=322

 Score =   250 bits (638),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 131/307 (43%), Positives = 184/307 (60%), Gaps = 10/307 (3%)
 Frame = -1

Query  1136  TTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDA  957
             ++A ++VGFY  TCP+AE IV+  + KA   +PG+AA ++R+  HDC V GCDGSVLLD+
Sbjct  17    SSASLKVGFYKYTCPSAETIVRKVVNKAVSQNPGMAAGLIRMHFHDCFVRGCDGSVLLDS  76

Query  956   TSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPE  777
             T G    EK+ P+N  ++RGFE+ID  K E+E  CP  VSCAD+L F+ARD+    G   
Sbjct  77    TPGNPS-EKENPANNPSLRGFEVIDAAKAEIEAQCPQTVSCADVLAFAARDSAYKVGGVN  135

Query  776   FEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHC  597
             + VP GRRDG VS + +   +L  P F   Q+   F  KGL ++++V L GAHSIGV+HC
Sbjct  136   YAVPSGRRDGRVSLKDEPSLHLPPPFFNAKQLEDNFARKGLTLDEMVTLSGAHSIGVSHC  195

Query  596   SNFRYRLN----TPARAKEVDGSLKVVMGTHCRNAAT-----TIPMDSTTQYKMDSMFYK  444
             S+F  RL     T  +   +D      + T C   +      T+ ++  T  ++D+ +YK
Sbjct  196   SSFSNRLYSFNATHPQDPSMDPEFARYLKTKCPPPSNTGSDPTVALEVQTPNRLDNKYYK  255

Query  443   QLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIR  264
              L   +GLL SD+ L   P T  +V+  A     W  KF  ++++MG I VLTG +GEIR
Sbjct  256   DLKNHRGLLTSDQTLFDSPSTARMVKNNARYGENWGNKFAAAMVRMGAIDVLTGTQGEIR  315

Query  263   KKCRFVN  243
             K CR VN
Sbjct  316   KNCRVVN  322



>ref|XP_004985934.1| PREDICTED: peroxidase 5-like [Setaria italica]
Length=331

 Score =   250 bits (639),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 135/300 (45%), Positives = 177/300 (59%), Gaps = 11/300 (4%)
 Frame = -1

Query  1124  MRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSGG  945
             ++VGFY   CP AE IV+  + KA   +PGVAA++VRL  HDC V GCD SVLLD+T G 
Sbjct  31    LQVGFYDMLCPAAEIIVQEEVSKAVSGNPGVAASLVRLHFHDCFVRGCDASVLLDSTPGN  90

Query  944   GRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEVP  765
              + EK A  N  ++RGFE+ID  K  +EQ+C GVVSCAD+L F+ARDAL L G   ++VP
Sbjct  91    -QAEKDASPN-TSLRGFEVIDSAKTRLEQACYGVVSCADVLAFAARDALALVGGNAYQVP  148

Query  764   GGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNFR  585
              GRRDGNVS   +   NL  P  +V Q+  +F SKGL   D+VAL GAH+IG AHCS+F 
Sbjct  149   SGRRDGNVSVAQETSGNLPPPTASVSQLNQIFGSKGLTQADMVALSGAHTIGNAHCSSFD  208

Query  584   YRLN----TPARAKEVDGSLKVVMGTHCRNAA-----TTIPMDSTTQYKMDSMFYKQLLQ  432
              RL        +   +D S    +   C N +      T+ MD  T    D+ +Y  ++ 
Sbjct  209   SRLYAYGPNAGQDPSMDPSYLAALTQQCPNQSGGGPDGTVAMDPVTPTAFDTNYYASIVA  268

Query  431   KKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCR  252
             K+GLL SD+ L  DP T   V  + +    +   F  +++KMG I VLTG  G IR  CR
Sbjct  269   KRGLLASDQALLADPTTAAQVVAYTNSPDTFQADFAAAMVKMGAIGVLTGTAGTIRTNCR  328



>dbj|BAK01586.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=322

 Score =   250 bits (638),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 131/305 (43%), Positives = 185/305 (61%), Gaps = 7/305 (2%)
 Frame = -1

Query  1151  AEAAETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGS  972
             A A    A + + +YG  CP A+ IV++ +  A  DDP +AA ++RL  HDC V GCD S
Sbjct  19    ALAGPGVAALSMNYYGMNCPFAQYIVQSVVRDAVMDDPTLAAGLLRLHFHDCFVQGCDAS  78

Query  971   VLLDATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVL  792
             VLLD+T G  + EK+A +N K++RGFE+ID+IK+ +E  CPGVV+CADIL  +ARDA+++
Sbjct  79    VLLDSTPGS-KAEKEAQAN-KSLRGFEVIDKIKDTLEAQCPGVVTCADILALAARDAVLM  136

Query  791   SGVPEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSI  612
              G P ++VP GRRDG  S + D    L SP      ++ LF + G +V+D+VAL G H++
Sbjct  137   VGGPYYDVPQGRRDGRRSVDTDTLTALPSPFLNASALITLFGTHGFNVQDMVALSGGHTL  196

Query  611   GVAHCSNFRYRLNTPARAKEVDGSLKVVMGTHCRNA--ATTIPMDSTTQYKMDSMFYKQL  438
             GVAHC  F  RL     A  +D      +   C     + T   D T+    D +++K+L
Sbjct  197   GVAHCPAFTPRLKF--EASTLDAGFASSLAATCSKGGDSATATFDRTST-AFDGVYFKEL  253

Query  437   LQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKK  258
              Q++GLL SD+ L   P T  LV  FA +Q  +   FT+ + KMG+I +  GD GE+RK 
Sbjct  254   QQRRGLLSSDQTLYESPETQRLVNMFAMNQGYFFYAFTQGMGKMGQIDLKEGDRGEVRKS  313

Query  257   CRFVN  243
             CR VN
Sbjct  314   CRVVN  318



>gb|EAY90172.1| hypothetical protein OsI_11737 [Oryza sativa Indica Group]
 gb|EAZ27062.1| hypothetical protein OsJ_10990 [Oryza sativa Japonica Group]
Length=339

 Score =   250 bits (639),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 131/308 (43%), Positives = 181/308 (59%), Gaps = 11/308 (4%)
 Frame = -1

Query  1142  AETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLL  963
             + +T G+++G+Y   CP AE IVK  +  A H DPGV A ++R+  HDC V GCD SVLL
Sbjct  35    SPSTCGLKIGYYHDKCPHAEAIVKGVVAAALHRDPGVGAGLIRMLFHDCFVEGCDASVLL  94

Query  962   DATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDA--LVLS  789
             D T    + EK AP N  ++RGFE+ID  K+ +E +CPGVVSCADI+ F+ARDA   +  
Sbjct  95    DPTPANPQPEKLAPPNNPSLRGFEVIDAAKDAVEAACPGVVSCADIVAFAARDASFFLSD  154

Query  788   GVPEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIG  609
                 F++P GR DG  S    A   L  P F + Q+VA F +KGL VED+V L GAH+IG
Sbjct  155   SRVSFDMPSGRLDGRYSNASRALDFLPPPTFNLGQLVANFAAKGLSVEDMVVLSGAHTIG  214

Query  608   VAHCSNF-RYRLNTPARAKEVDGSLKVVMGTHCRNAAT-----TIPMDSTTQYKMDSMFY  447
             ++HCS+F   RL   A A ++D S   V+   C  + +     T+  D  T  K+D+ +Y
Sbjct  215   LSHCSSFVSDRL---AVASDIDPSFAAVLRAQCPASPSSSNDPTVVQDVVTPNKLDNQYY  271

Query  446   KQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEI  267
             K +L  + L  SD  L   P T  +V + A+    W  +F  +++KM  + V TG  GEI
Sbjct  272   KNVLAHRALFTSDASLLASPATAKMVVDNANIPGWWEDRFKTAMVKMAAVEVKTGSNGEI  331

Query  266   RKKCRFVN  243
             R+ CR VN
Sbjct  332   RRHCRAVN  339



>dbj|BAJ88342.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=349

 Score =   250 bits (639),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 133/309 (43%), Positives = 182/309 (59%), Gaps = 16/309 (5%)
 Frame = -1

Query  1133  TAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDAT  954
             TA +RVGFY +TCP AE +V+  +  AF  D G+AA ++RL  HDC V GCD SVLL   
Sbjct  26    TAQLRVGFYQKTCPNAEALVRQAVAAAFTKDAGIAAGLIRLHFHDCFVRGCDASVLLATN  85

Query  953   SGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEF  774
              GGGR E+ A  N  ++RGFE+ID  K  +E+SCP  VSCADIL F+ARD++ L+G   +
Sbjct  86    PGGGRTERVAIPNNPSLRGFEVIDAAKAALERSCPRTVSCADILAFAARDSITLTGNVVY  145

Query  773   EVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCS  594
              VP GRRDG+VS E +A  NL  P FT  Q++  FK+K L  E++V L GAH++G + C+
Sbjct  146   PVPAGRRDGSVSIEQEALDNLPPPTFTAQQLIDRFKNKTLTAEEMVLLSGAHTVGRSFCA  205

Query  593   NFRYRL---NTPARAKEVDGSLKVVMGTHCR---------NAATTIPMDSTTQYKMDSMF  450
             +F  R+   NTP     VD  L        R             T PMD  +   +D+ +
Sbjct  206   SFVNRIWNGNTPI----VDAGLSPAYAAQLRALCPSTTTQTTPITAPMDPGSPNVLDNNY  261

Query  449   YKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGE  270
             YK L +  GL  SD +L  D     LV  FA +++ W  +F  +++KMG+I+V TG  G+
Sbjct  262   YKLLPRGMGLFFSDNQLRVDGNLNGLVNRFAANESLWKERFAAAMVKMGRIQVQTGSCGQ  321

Query  269   IRKKCRFVN  243
             +R  C  VN
Sbjct  322   VRLNCNVVN  330



>ref|XP_008808268.1| PREDICTED: peroxidase 5-like [Phoenix dactylifera]
Length=324

 Score =   249 bits (637),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 128/309 (41%), Positives = 184/309 (60%), Gaps = 10/309 (3%)
 Frame = -1

Query  1145  AAETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVL  966
             +++  A ++VGFYG TCP AE IVK  + KA   + G+AA +VR+  HDC V GCDGSVL
Sbjct  18    SSQLEAQLKVGFYGTTCPQAEPIVKLQVTKALASNIGLAAGLVRMHFHDCFVRGCDGSVL  77

Query  965   LDATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSG  786
             +D+TS     EK +  N  ++RGFE+ID  K ++E +C GVVSCADIL F+ARD++ ++G
Sbjct  78    IDSTSTN-TAEKDSSIN-TSLRGFEVIDSAKAQLEATCNGVVSCADILAFAARDSIAMTG  135

Query  785   VPEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGV  606
                ++VP GRRDG VS   D   NL +P   VDQ+   F+ KGL  + +V L GAH+IG 
Sbjct  136   GISYQVPAGRRDGRVSLASDTFANLPAPSSNVDQLTQSFQVKGLTQDQMVTLSGAHTIGR  195

Query  605   AHCSNFR---YRLNTPARAK-EVDGSLKVVMGTHCRNAATT----IPMDSTTQYKMDSMF  450
             +HCS+F    Y  NT  +    +D +    +   C   +T     +PMD  +   +D+ +
Sbjct  196   SHCSSFSNRLYNFNTTVKQDPSLDATYAAQLKQQCPQGSTNPNLVVPMDPPSPNIVDTSY  255

Query  449   YKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGE  270
             Y  +L  +GL  SD+ L  +  T   V + A +   W  KF  +++ MG++ VLTG  GE
Sbjct  256   YNDILVNRGLFTSDQTLLSEAATASHVTQNAANSLLWQNKFAAAMVAMGQVGVLTGSNGE  315

Query  269   IRKKCRFVN  243
             IR  CR +N
Sbjct  316   IRLNCRAIN  324



>emb|CDY02685.1| BnaC02g07500D [Brassica napus]
Length=310

 Score =   249 bits (636),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 132/300 (44%), Positives = 190/300 (63%), Gaps = 12/300 (4%)
 Frame = -1

Query  1130  AGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATS  951
             A +RVGFY R+CP AE IV+N + + F  DP V AA++R+  HDC V GCD S+L+D+T+
Sbjct  19    AQLRVGFYSRSCPQAETIVRNLVRQRFGVDPTVTAALLRMHFHDCFVRGCDASLLIDSTN  78

Query  950   GGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFE  771
                  EK A  NG +VR F+LIDRIK ++E +CP  VSCADI+T + RD++ L+G P + 
Sbjct  79    S----EKTAGPNG-SVREFDLIDRIKAQLEAACPSTVSCADIITLATRDSVALAGGPSYS  133

Query  770   VPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSN  591
             +P GRRDG VS   D    L  P  +V   V+LF +KG++V D VAL+GAH++G  +C  
Sbjct  134   IPTGRRDGLVSNNVDV--ALPGPTISVAGAVSLFTNKGMNVFDAVALIGAHTVGKGNCGL  191

Query  590   FRYRLN----TPARAKEVDGSLKVVMGTHCRNAATTIPMDSTTQYKMDSMFYKQLLQKKG  423
             F  R+     T      +D +L   +   CRN+AT   +D +T  + D+ F+KQL +K+G
Sbjct  192   FNDRITNFQGTGRPDPAMDPALVSSLRNTCRNSATA-ALDQSTPLRFDNQFFKQLRKKRG  250

Query  422   LLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRFVN  243
             + + D+RLA D +T  +V  +A + A +  +F  ++IKMG + VLTG  GEIR+ CR  N
Sbjct  251   VFQVDQRLATDRQTRGVVARYASNNAFFKRQFVRAMIKMGAVDVLTGRAGEIRRNCRRFN  310



>ref|XP_010540729.1| PREDICTED: peroxidase 39 [Tarenaya hassleriana]
Length=371

 Score =   251 bits (640),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 129/307 (42%), Positives = 188/307 (61%), Gaps = 10/307 (3%)
 Frame = -1

Query  1136  TTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDA  957
             + A +++GFY +TCP AE+IV++ + +  H+ P +AAA++R+  HDC V GCD S+L++A
Sbjct  66    SEAELKMGFYHKTCPNAEKIVQDFVNEHIHNAPSLAAALIRMHFHDCFVRGCDASILINA  125

Query  956   TSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPE  777
             TS   +VEK +P N  TVRGF+ IDR+K  +E+ CPGVVSCAD++T + RD++V +G P 
Sbjct  126   TSNNRQVEKVSPPN-LTVRGFDFIDRVKSLLEKECPGVVSCADVITLATRDSIVATGGPF  184

Query  776   FEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHC  597
             + VP GRRDG +S   ++  N+  P      +   F  +GLDV+DLV L GAH+IGV+HC
Sbjct  185   WNVPTGRRDGRISNAAESLNNIPPPFGNFSTLRKRFADQGLDVKDLVLLSGAHTIGVSHC  244

Query  596   SNFRYRLNTPARAKEVDGSLKVVMGTHCRNAATTIPMDSTTQYKMDS--------MFYKQ  441
             ++F  RL       + D SL      + R+     P D+ T+ +MD          +Y  
Sbjct  245   TSFSNRLFNFTGVGDQDPSLDSEYAANLRSRKCRSPSDNMTKVEMDPGSRKSFDLSYYNL  304

Query  440   LLQKKGLLESDERLAGDPRTLPLVEEF-ADDQAAWLGKFTESVIKMGKIRVLTGDEGEIR  264
             LL+++GL ESD  L  D   L LV    A     +  +F +S+ KMG+I V TG +GEIR
Sbjct  305   LLKRRGLFESDNALTTDSTALALVRRLVAGSMDEFFAEFAKSMEKMGRIGVKTGSDGEIR  364

Query  263   KKCRFVN  243
             + C FVN
Sbjct  365   RYCAFVN  371



>ref|XP_011077202.1| PREDICTED: peroxidase 5-like [Sesamum indicum]
Length=429

 Score =   253 bits (645),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 131/306 (43%), Positives = 182/306 (59%), Gaps = 9/306 (3%)
 Frame = -1

Query  1133  TAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDAT  954
             T  ++VG+Y +TCP AE IV+  + KA   +PG+AA ++R+  HDC V GCDGSVLLD+ 
Sbjct  124   TQKLKVGYYAKTCPYAEIIVRQAVEKAVSKNPGIAAGLIRMHFHDCFVRGCDGSVLLDSV  183

Query  953   SGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEF  774
              G    EK +P N  ++RGFE++D  K  +E  CPG VSCADIL F+ARD+ +  G   +
Sbjct  184   PGKPAAEKASPINFPSLRGFEVVDEAKALIEAKCPGTVSCADILAFAARDSALKVGWIGY  243

Query  773   EVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCS  594
             +VP GRRDG VS   +  +NL  P FT  Q+   FK KGL ++++V L GAHSIGV+HCS
Sbjct  244   DVPSGRRDGRVSLSSEVVQNLPPPFFTASQLRDNFKRKGLSLDEMVTLSGAHSIGVSHCS  303

Query  593   NFRYRLN----TPARAKEVDGSLKVVMGTHC-----RNAATTIPMDSTTQYKMDSMFYKQ  441
             +F  RL+    T  +   +D      + + C      N+   +  D  T  ++D+ +Y  
Sbjct  304   SFSNRLSGFNATFNQDPSLDPGFAAFLKSRCPAPGSSNSDPVVNNDVLTPNQLDNKYYVN  363

Query  440   LLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRK  261
             L   KGLL SD+ L   P T  LV +     + W  KF  +++ MG I VLTG +GEIR+
Sbjct  364   LKNHKGLLTSDQTLFDSPLTSKLVVDNVKYGSVWAKKFAAAMVHMGSIDVLTGKKGEIRR  423

Query  260   KCRFVN  243
              CR VN
Sbjct  424   NCRVVN  429



>gb|EYU39443.1| hypothetical protein MIMGU_mgv1a009818mg [Erythranthe guttata]
 gb|EYU39449.1| hypothetical protein MIMGU_mgv1a009802mg [Erythranthe guttata]
Length=331

 Score =   249 bits (636),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 142/313 (45%), Positives = 190/313 (61%), Gaps = 15/313 (5%)
 Frame = -1

Query  1151  AEAAETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGS  972
             + AA +TAG++VGFY ++CP AE IV+ ++ K    +PG AA ++RL  HDC V GCD S
Sbjct  24    SSAANSTAGLKVGFYRKSCPPAEAIVQKYVNKFVFRNPGFAAGLIRLHFHDCFVRGCDAS  83

Query  971   VLLDATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVL  792
             VLLD    G   EKQ+  N  ++RGFE+ID  K E+E  CPG+VSCADIL F+ARD+   
Sbjct  84    VLLD----GANSEKQSIPNRGSLRGFEIIDAAKAELEIRCPGIVSCADILAFAARDSSWR  139

Query  791   SGVPEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSI  612
              G   +EVP GRRDGN S   D   NL  P F   Q+   F  KGL ++++V L GAHSI
Sbjct  140   VGDIFYEVPAGRRDGNESNTLDPLLNLPPPFFNATQLRDNFARKGLTLDEMVTLSGAHSI  199

Query  611   GVAHCSNFRYRLNTPARAKEVDGSLKVVMGTHC----RNAA------TTIPMDSTTQYKM  462
             G+AHC++F  RL  P     +D +  V +   C     NA        T+  D  T  ++
Sbjct  200   GIAHCTSFNGRL-YPTVDPTLDPNYAVFLRNICPAPVANATGPPSVNPTVNQDVITPKRL  258

Query  461   DSMFYKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTG  282
             D+++Y+ L QKKGLL SD+ L     T  +V + A +  AW  KF  +++KMGKI VLTG
Sbjct  259   DNLYYELLKQKKGLLTSDQVLMTSTLTSKIVLKNAQNSPAWAKKFAAAMVKMGKIDVLTG  318

Query  281   DEGEIRKKCRFVN  243
              +GEIR+ CR VN
Sbjct  319   TQGEIRENCRLVN  331



>ref|XP_006594891.1| PREDICTED: peroxidase 39-like [Glycine max]
Length=326

 Score =   249 bits (636),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 136/316 (43%), Positives = 196/316 (62%), Gaps = 25/316 (8%)
 Frame = -1

Query  1142  AETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLL  963
             A T A +++GFY ++CP AE+I+   + +  H+ P +AAA++R+  HDC V GCDGSVLL
Sbjct  19    ASTHAQLQLGFYAQSCPKAEKIILKFVHEHIHNAPSLAAALIRMHFHDCFVRGCDGSVLL  78

Query  962   DATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGV  783
             ++T+   + EK AP N  TVRGF+ IDRIK  +E  CPGVVSCADILT +ARD +V +G 
Sbjct  79    NSTTN--QAEKNAPPN-LTVRGFDFIDRIKSLVEAECPGVVSCADILTLAARDTIVATGG  135

Query  782   PEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVA  603
             P ++VP GRRDG +S   +AR N+ +P   +  +  LF ++GLD++DLV L GAH+IG+A
Sbjct  136   PYWKVPTGRRDGVISNLVEARNNIPAPFDNITTLQTLFANQGLDLKDLVLLSGAHTIGIA  195

Query  602   HCSNFRYRL--------NTPARAKEVDGSLKVVMGTHCRNAA----TTIPMDSTTQYKMD  459
             HCS+   RL          P+   E   +LK      C++ +    T I MD  ++   D
Sbjct  196   HCSSLSNRLFNFTGKGDQDPSLDSEYAANLKAF---KCKDLSKLNTTKIEMDPGSRKTFD  252

Query  458   SMFYKQLLQKKGLLESDERLAGDPRT----LPLVEEFADDQAAWLGKFTESVIKMGKIRV  291
               +Y  +++++GL ESD  L  +  T    + L+E   ++ +A   +F  S+ KMG+I V
Sbjct  253   LSYYSHVIKRRGLFESDAALLTNSVTKSQIIQLLEGTVENFSA---EFATSIEKMGRINV  309

Query  290   LTGDEGEIRKKCRFVN  243
              TG EGEIRK C FVN
Sbjct  310   KTGTEGEIRKHCAFVN  325



>ref|XP_011077203.1| PREDICTED: peroxidase 5-like [Sesamum indicum]
Length=463

 Score =   253 bits (647),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 132/306 (43%), Positives = 181/306 (59%), Gaps = 9/306 (3%)
 Frame = -1

Query  1133  TAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDAT  954
             T  ++VG+Y +TCP AE IV+  + KA   +PG+AA ++R+  HDC V GCDGSVLLD+ 
Sbjct  158   TQKLQVGYYAKTCPYAEIIVRQAVEKAVSKNPGIAAGLIRMHFHDCFVRGCDGSVLLDSV  217

Query  953   SGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEF  774
              G    EK +P N  ++RGFE+ID  K  +E  CPG VSCADIL F+ARD+ +  G   +
Sbjct  218   PGKPAAEKASPINFPSLRGFEVIDEAKALIEAKCPGTVSCADILAFAARDSALKVGWIGY  277

Query  773   EVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCS  594
             +VP GRRDG VS   +  +NL  P FT  Q+   FK KGL ++++V L GAHSIGV+HCS
Sbjct  278   DVPSGRRDGRVSLSSEVVQNLPPPFFTASQLRDNFKRKGLSLDEMVTLSGAHSIGVSHCS  337

Query  593   NFRYRLN----TPARAKEVDGSLKVVMGTHC-----RNAATTIPMDSTTQYKMDSMFYKQ  441
             +F  RL+    T  +   +D      + + C      N+   +  D  T  ++D+ +Y  
Sbjct  338   SFSNRLSGFNATFNQDPSLDPGFAAFLKSRCPAPGSSNSDPVVNNDVLTPNQLDNKYYVN  397

Query  440   LLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRK  261
             L   KGLL SD+ L   P T  LV       + W  KF  +++ MG I VLTG +GEIR+
Sbjct  398   LKNHKGLLTSDQTLFDSPLTSKLVVNNVKYGSVWAKKFAAAMVHMGSIDVLTGKKGEIRR  457

Query  260   KCRFVN  243
              CR VN
Sbjct  458   NCRVVN  463



>ref|XP_007226228.1| hypothetical protein PRUPE_ppa016743mg [Prunus persica]
 gb|EMJ27427.1| hypothetical protein PRUPE_ppa016743mg [Prunus persica]
Length=341

 Score =   249 bits (637),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 136/319 (43%), Positives = 185/319 (58%), Gaps = 20/319 (6%)
 Frame = -1

Query  1151  AEAAETTAG--MRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCD  978
             +EAAE   G  + VGFYG  CP AE+IV + + KA   D  + AA +RL SHDC V GCD
Sbjct  25    SEAAEKGQGNGLHVGFYGIRCPNAEQIVADVVSKAVEADQKLPAAFIRLFSHDCFVKGCD  84

Query  977   GSVLLDATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDAL  798
              S+LLD+T     VE Q+P+N   ++G E+ID IK  +E  CP  VSCADIL F+AR+A+
Sbjct  85    ASILLDSTPSHEPVEIQSPAN-VGIKGLEVIDEIKARLEAECPETVSCADILAFAAREAV  143

Query  797   VLSGVPEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAH  618
              L+G+P  +VP GRRD   SR  D    L +P   +++++  F  +G+  +++V L GAH
Sbjct  144   ALAGLPRHKVPAGRRDSRTSRATDV--TLPAPATPLNEIIEYFSRRGMTSDEIVVLSGAH  201

Query  617   SIGVAHCSNFRYRL----NTPARAKEVDGSLKVVMGTHCRNAATTIP----------MDS  480
             SIG  HCS F YRL     T A+   +D      +   C  A  T+P           D 
Sbjct  202   SIGAVHCSFFDYRLYNYDQTQAQDPALDRFYAANLSQQC-PAPNTLPEAEAKNRVVDFDP  260

Query  479   TTQYKMDSMFYKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGK  300
              T   +D+ +Y  L+Q K LL+SD+ L  DPRT  +V   A    +W  +F  ++IKMG+
Sbjct  261   ITPLVLDNQYYANLMQGKALLQSDQALVTDPRTKAMVISMAASADSWTQRFVRAMIKMGR  320

Query  299   IRVLTGDEGEIRKKCRFVN  243
             I VLTG+ GEIRK CR  N
Sbjct  321   INVLTGENGEIRKNCRAFN  339



>gb|EYU39442.1| hypothetical protein MIMGU_mgv1a009821mg [Erythranthe guttata]
Length=330

 Score =   249 bits (636),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 142/313 (45%), Positives = 190/313 (61%), Gaps = 15/313 (5%)
 Frame = -1

Query  1151  AEAAETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGS  972
             + AA +TAG++VGFY ++CP AE IV+ ++ K    +PG AA ++RL  HDC V GCD S
Sbjct  23    SSAANSTAGLKVGFYRKSCPPAEAIVQKYVNKFVFRNPGFAAGLIRLHFHDCFVRGCDAS  82

Query  971   VLLDATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVL  792
             VLLD    G   EKQ+  N  ++RGFE+ID  K E+E  CPG+VSCADIL F+ARD+   
Sbjct  83    VLLD----GANSEKQSIPNRGSLRGFEIIDAAKAELEIRCPGIVSCADILAFAARDSSWR  138

Query  791   SGVPEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSI  612
              G   +EVP GRRDGN S   D   NL  P F   Q+   F  KGL ++++V L GAHSI
Sbjct  139   VGDIFYEVPAGRRDGNESNTLDPLLNLPPPFFNATQLRDNFARKGLTLDEMVTLSGAHSI  198

Query  611   GVAHCSNFRYRLNTPARAKEVDGSLKVVMGTHC----RNAA------TTIPMDSTTQYKM  462
             G+AHC++F  RL  P     +D +  V +   C     NA        T+  D  T  ++
Sbjct  199   GIAHCTSFNGRL-YPTVDPTLDPNYAVFLRNICPAPVANATGPPSVNPTVNQDVITPKRL  257

Query  461   DSMFYKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTG  282
             D+++Y+ L QKKGLL SD+ L     T  +V + A +  AW  KF  +++KMGKI VLTG
Sbjct  258   DNLYYELLKQKKGLLTSDQVLMTSTLTSKIVLKNAQNSPAWAKKFAAAMVKMGKIDVLTG  317

Query  281   DEGEIRKKCRFVN  243
              +GEIR+ CR VN
Sbjct  318   TQGEIRENCRLVN  330



>ref|XP_004960411.1| PREDICTED: peroxidase 5-like [Setaria italica]
Length=336

 Score =   249 bits (636),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 131/313 (42%), Positives = 187/313 (60%), Gaps = 14/313 (4%)
 Frame = -1

Query  1142  AETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLL  963
             A   A ++VGFY  +CP AEEIV+N + +    DPGV A ++R+  HDC V GCD S+L+
Sbjct  22    ASPPAKLKVGFYKHSCPEAEEIVRNAVRRGLARDPGVGAGLIRMHFHDCFVRGCDSSILI  81

Query  962   DATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGV  783
             ++T G  R EK + +N  ++RGF++ID  K  +E  CP  VSCAD++ F+ARD   L+G 
Sbjct  82    NSTPGN-RAEKDSVANNPSMRGFDVIDDAKAVLEAHCPRTVSCADVVAFAARDGAYLAGG  140

Query  782   PEFEVPGGRRDGNVSREPDA-RKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGV  606
              E++VP GRRDG VS E +    N+ +P   + +++  FK KGL  +D+V L GAH+IG 
Sbjct  141   IEYQVPSGRRDGRVSIEAEVLNNNVPAPTDRLRELIESFKRKGLSADDMVTLSGAHTIGR  200

Query  605   AHCSNFRYRL-NTPARAKEVDGSLKVVMGTHCRNA-----------ATTIPMDSTTQYKM  462
             +HCS+F  RL N   +  + D S+      H +              T +P+D  T    
Sbjct  201   SHCSSFTQRLYNFSGQLGKTDPSIDPAYAEHLKKRCPWPSSDDQMDPTVVPLDPVTPASF  260

Query  461   DSMFYKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTG  282
             D+ ++K +L  K +L SD+ L   P T  +V+  +  + AW  KF  S+IKMGKI VLTG
Sbjct  261   DNQYFKNVLSHKVVLTSDQTLLDSPWTAGIVKFNSAVEKAWQLKFAASMIKMGKIEVLTG  320

Query  281   DEGEIRKKCRFVN  243
             DEGEIR+KC  VN
Sbjct  321   DEGEIREKCFVVN  333



>gb|EMT07621.1| Peroxidase 5 [Aegilops tauschii]
Length=325

 Score =   249 bits (635),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 132/307 (43%), Positives = 187/307 (61%), Gaps = 9/307 (3%)
 Frame = -1

Query  1142  AETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLL  963
             A   A ++VGFY  +CP AE IV++ + +A    PG AA +VRL  HDC V GCD SVLL
Sbjct  21    ARGQAQLQVGFYAHSCPQAEVIVRDEVGRAVSAYPGFAAGLVRLHFHDCFVKGCDASVLL  80

Query  962   DATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGV  783
             D+T+     EK AP N K++RGFE+ID  K+ +E +C G VSCADIL F+ARD++VL+G 
Sbjct  81    DSTANS-TAEKDAPPN-KSLRGFEVIDAAKKRLEAACAGTVSCADILAFAARDSVVLAGG  138

Query  782   PEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVA  603
               + VP GRRDGNVS   DA+ +L  P   V  +   F   GL  ED+V L GAH+IGV 
Sbjct  139   SPYGVPAGRRDGNVSAASDAQASLPPPTANVAHLTEAFAKNGLSQEDMVTLSGAHTIGVT  198

Query  602   HCSNFRYRLN----TPARAKE--VDGSLKVVMGTHCR-NAATTIPMDSTTQYKMDSMFYK  444
             HCS+F  RL+    T    ++  +DG+    +   C   +   +PMD+ +    D+ +++
Sbjct  199   HCSSFSARLHGYNATTGTGQDPAMDGAKAAELARQCSPGSPNAVPMDAGSPDTFDTGYFR  258

Query  443   QLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIR  264
              LL   G+L SD+ L  D  T  L  + A +   ++ +F +++++MG IRVLTG +G+IR
Sbjct  259   ALLANPGVLASDQTLPSDNATAALGAQNAGNGYLFVTRFGDALVRMGGIRVLTGGDGQIR  318

Query  263   KKCRFVN  243
               CR VN
Sbjct  319   TNCRVVN  325



>ref|XP_010069739.1| PREDICTED: peroxidase 5-like [Eucalyptus grandis]
Length=333

 Score =   249 bits (635),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 132/311 (42%), Positives = 190/311 (61%), Gaps = 11/311 (4%)
 Frame = -1

Query  1145  AAETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVL  966
             A    + ++VG+Y RTCP+ E IV+  + +A   +PG+AA ++R+  HDC V GCD SVL
Sbjct  24    ARSPNSSLKVGYYRRTCPSTEAIVRKTVFEAVSRNPGMAAGLIRMHFHDCFVRGCDASVL  83

Query  965   LDATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSG  786
             L +T+G    E+  P+N  ++RGFE+ID+ K ++E  CP  VSCADI+ F+ARD+   + 
Sbjct  84    LKSTAGNP-AERDHPANNPSLRGFEIIDQAKAQLEALCPRTVSCADIVAFAARDSAYKAR  142

Query  785   VPEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGV  606
                ++V  GRRDG +SR P+  +NL  P F   Q++A F  KGL  +++V L GAHSIG+
Sbjct  143   GIYYDVAAGRRDGRISRLPEVTQNLPPPSFNAQQLIANFARKGLSADEMVTLSGAHSIGI  202

Query  605   AHCSNFRYRLN----TPARAKEVDGSLKVVMGTHC------RNAATTIPMDSTTQYKMDS  456
             +HCS+F  RL     T A+   +D +    +   C        A  T+P+DS T   +D+
Sbjct  203   SHCSSFSSRLYTFNATLAQDPSLDPAYAAFLKRKCPPPSNVTQADPTVPLDSITANTLDN  262

Query  455   MFYKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDE  276
              +Y QLL+ +GLL SDE L   P T  +V   A +  AW  KF ++++KMG I VLTG +
Sbjct  263   KYYLQLLKLRGLLTSDETLYTSPSTSRMVVNNAKNNFAWSVKFAKAMVKMGSIDVLTGKQ  322

Query  275   GEIRKKCRFVN  243
             GEIRK C  VN
Sbjct  323   GEIRKLCSIVN  333



>gb|ACU24335.1| unknown [Glycine max]
Length=324

 Score =   248 bits (634),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 133/310 (43%), Positives = 186/310 (60%), Gaps = 13/310 (4%)
 Frame = -1

Query  1142  AETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLL  963
             A T A +++GFY  +CP AE+IV   +    H+ P +AAA++R+  HDC V GCD SVLL
Sbjct  17    ASTHAQLQLGFYANSCPKAEQIVLKFVHDHIHNAPSLAAALIRMHFHDCFVRGCDASVLL  76

Query  962   DATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGV  783
             ++T+   + EK AP N  TVRGF+ IDRIK  +E  CPGVVSCADILT +ARD +V +G 
Sbjct  77    NSTTN--QAEKNAPPN-LTVRGFDFIDRIKSLVEAECPGVVSCADILTLAARDTIVATGG  133

Query  782   PEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVA  603
             P ++VP GRRDG VS   +AR ++ +P      +  LF ++GLD++DLV L GAH+IG+A
Sbjct  134   PFWKVPTGRRDGVVSNLTEARNDIPAPSSNFTTLQTLFANQGLDLKDLVLLSGAHTIGIA  193

Query  602   HCSNFRYRL--------NTPARAKEVDGSLKVVMGTHCRNAATT-IPMDSTTQYKMDSMF  450
             HCS+   RL          P+   E   +LK    T      TT I MD  ++   D  +
Sbjct  194   HCSSLSNRLFNFTGKGDQDPSLDSEYAANLKAFKCTDLNKLNTTKIEMDPGSRKTFDLSY  253

Query  449   YKQLLQKKGLLESDERLAGDPRT-LPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEG  273
             Y  +++++GL ESD  L  +  T   +++        +  +F  S+ KMG+I V TG EG
Sbjct  254   YSHVIKRRGLFESDAALLTNSVTKAQIIQLLEGSVENFFAEFATSIEKMGRINVKTGTEG  313

Query  272   EIRKKCRFVN  243
             EIRK C F+N
Sbjct  314   EIRKHCAFIN  323



>gb|KCW58173.1| hypothetical protein EUGRSUZ_H00890, partial [Eucalyptus grandis]
Length=309

 Score =   248 bits (633),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 131/306 (43%), Positives = 189/306 (62%), Gaps = 11/306 (4%)
 Frame = -1

Query  1130  AGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATS  951
             + ++VG+Y RTCP+ E IV+  + +A   +PG+AA ++R+  HDC V GCD SVLL +T+
Sbjct  5     SSLKVGYYRRTCPSTEAIVRKTVFEAVSRNPGMAAGLIRMHFHDCFVRGCDASVLLKSTA  64

Query  950   GGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFE  771
             G    E+  P+N  ++RGFE+ID+ K ++E  CP  VSCADI+ F+ARD+   +    ++
Sbjct  65    GNP-AERDHPANNPSLRGFEIIDQAKAQLEALCPRTVSCADIVAFAARDSAYKARGIYYD  123

Query  770   VPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSN  591
             V  GRRDG +SR P+  +NL  P F   Q++A F  KGL  +++V L GAHSIG++HCS+
Sbjct  124   VAAGRRDGRISRLPEVTQNLPPPSFNAQQLIANFARKGLSADEMVTLSGAHSIGISHCSS  183

Query  590   FRYRLN----TPARAKEVDGSLKVVMGTHC------RNAATTIPMDSTTQYKMDSMFYKQ  441
             F  RL     T A+   +D +    +   C        A  T+P+DS T   +D+ +Y Q
Sbjct  184   FSSRLYTFNATLAQDPSLDPAYAAFLKRKCPPPSNVTQADPTVPLDSITANTLDNKYYLQ  243

Query  440   LLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRK  261
             LL+ +GLL SDE L   P T  +V   A +  AW  KF ++++KMG I VLTG +GEIRK
Sbjct  244   LLKLRGLLTSDETLYTSPSTSRMVVNNAKNNFAWSVKFAKAMVKMGSIDVLTGKQGEIRK  303

Query  260   KCRFVN  243
              C  VN
Sbjct  304   LCSIVN  309



>gb|KHN36550.1| Peroxidase 39 [Glycine soja]
Length=326

 Score =   248 bits (634),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 135/316 (43%), Positives = 197/316 (62%), Gaps = 25/316 (8%)
 Frame = -1

Query  1142  AETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLL  963
             A T A +++GFY ++CP AE+I+   + +  H+ P +AAA++R+  HDC V GCDGSVLL
Sbjct  19    ASTHAQLQLGFYAQSCPKAEKIILKFVHEHIHNAPSLAAALIRMHFHDCFVRGCDGSVLL  78

Query  962   DATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGV  783
             ++T+   + EK AP N  TVRGF+ IDRIK  +E  CPGVVSCADILT ++RD++V +G 
Sbjct  79    NSTTN--QAEKNAPPN-LTVRGFDFIDRIKSLVEAECPGVVSCADILTLASRDSIVATGG  135

Query  782   PEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVA  603
             P ++VP GRRDG +S   +AR N+ +P   +  +  LF ++GLD++DLV L GAH+IG+A
Sbjct  136   PYWKVPTGRRDGVISNLVEARNNIPAPFDNITTLQTLFANQGLDLKDLVLLSGAHTIGIA  195

Query  602   HCSNFRYRL--------NTPARAKEVDGSLKVVMGTHCRNAA----TTIPMDSTTQYKMD  459
             HCS+   RL          P+   E   +LK      C++ +    T I MD  ++   D
Sbjct  196   HCSSLSNRLFNFTGKGDQDPSLDSEYAANLKAF---KCKDLSKLNTTKIEMDPGSRKTFD  252

Query  458   SMFYKQLLQKKGLLESDERLAGDPRT----LPLVEEFADDQAAWLGKFTESVIKMGKIRV  291
               +Y  +++++GL ESD  L  +  T    + L+E   ++ +A   +F  S+ KMG+I V
Sbjct  253   LSYYSHVIKRRGLFESDAALLTNSVTKSQIIQLLEGTVENFSA---EFATSIEKMGRINV  309

Query  290   LTGDEGEIRKKCRFVN  243
              TG EGEIRK C FVN
Sbjct  310   KTGTEGEIRKHCAFVN  325



>gb|KFK26006.1| hypothetical protein AALP_AA8G190700 [Arabis alpina]
Length=310

 Score =   248 bits (633),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 124/297 (42%), Positives = 186/297 (63%), Gaps = 10/297 (3%)
 Frame = -1

Query  1124  MRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSGG  945
             +RVGFY ++CP AE IV+N + + F  DP V AA++R+  HDC V GCD S+L+D+T+  
Sbjct  21    LRVGFYSQSCPQAETIVRNLVRQRFGADPTVTAALLRMHFHDCFVKGCDASLLIDSTTS-  79

Query  944   GRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEVP  765
                EK A  NG +VR F+LIDRIK ++E +CP  VSCADI+T + RD++ L+G P + +P
Sbjct  80    ---EKTAGPNG-SVREFDLIDRIKAQLETACPSTVSCADIVTLATRDSVALAGGPSYSIP  135

Query  764   GGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNFR  585
              GRRDG VS   D    L  P  +V   V+ F +KG++  D VALLGAH++GV +C  F 
Sbjct  136   TGRRDGLVSNRADV--GLPGPTISVSGAVSFFTNKGMNAFDAVALLGAHTVGVGNCGLFN  193

Query  584   YRLNTPARAKEVDGSLKVVMGTHCRNA---ATTIPMDSTTQYKMDSMFYKQLLQKKGLLE  414
              R+         D S+   + +  RN    + +  +D +T  + D+ F+KQ+ +++G+L+
Sbjct  194   DRITNFQGTGRPDSSMDPALVSRLRNTCANSASAALDQSTPLRFDNEFFKQIRKRRGVLQ  253

Query  413   SDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRFVN  243
              D+RLA DP T  +V  +A + A +  +F  +++KMG + VLTG  G+IR+ CR  N
Sbjct  254   IDQRLATDPLTRGIVSRYASNNAYFKRQFVRAMVKMGAVDVLTGRSGQIRRNCRRFN  310



>ref|XP_010558694.1| PREDICTED: peroxidase 57-like [Tarenaya hassleriana]
Length=321

 Score =   248 bits (634),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 131/301 (44%), Positives = 183/301 (61%), Gaps = 9/301 (3%)
 Frame = -1

Query  1130  AGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATS  951
             A +R+GFY R+CP AE IV++ + + F  D  + AA++R+  HDC V GCD S+L+D TS
Sbjct  22    AQLRIGFYSRSCPQAETIVRDLVRQRFGRDRTITAALLRMHFHDCFVRGCDASLLIDTTS  81

Query  950   GGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFE  771
                R  +++     +VRGF+LID+IK ++E  CP  VSCADI+T + RD++ L+G P + 
Sbjct  82    T--RTSEKSAGPNFSVRGFDLIDQIKTQLEAQCPSTVSCADIVTLATRDSVALAGGPSYT  139

Query  770   VPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSN  591
             VP GRRDG VS   D   NL  P  +VD  +  FKSK ++  D VALLGAH++GV HCS 
Sbjct  140   VPTGRRDGLVSSPLDV--NLPGPTISVDGAIGFFKSKRMNSFDAVALLGAHTVGVGHCSL  197

Query  590   FRYRLNTPARAKEVDGSLKVVMGTHCRNAAT-----TIPMDSTTQYKMDSMFYKQLLQKK  426
             F+ RL         D S+  V+    R+        T  +D  T    D+MF+KQ+ +K+
Sbjct  198   FQDRLTNFQGTGRPDPSMDPVLAARLRSTCAGPNDPTTALDQGTPLVFDNMFFKQIRRKR  257

Query  425   GLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRFV  246
             G+L+ D+RLA    T  LV  F  + A +  +F +S++KMG I VLTG  GEIRK CR  
Sbjct  258   GVLQLDQRLATAGATRGLVALFEANNAFFKRQFVKSIVKMGTIEVLTGQSGEIRKNCRAF  317

Query  245   N  243
             N
Sbjct  318   N  318



>ref|XP_009767393.1| PREDICTED: peroxidase 47 [Nicotiana sylvestris]
Length=328

 Score =   248 bits (634),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 124/299 (41%), Positives = 183/299 (61%), Gaps = 6/299 (2%)
 Frame = -1

Query  1127  GMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSG  948
             G+R+ +Y  +CP AE IVKN + +    DP +AAA+VR+  HDC V GCD SVL+D+T G
Sbjct  32    GLRMEYYMMSCPFAEGIVKNTVNRHLQADPTLAAALVRMHFHDCFVQGCDASVLIDSTKG  91

Query  947   GGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEV  768
             G   EK +P+N  ++RG+E+ID  KEE+E  CPGVVSCADIL  +ARDA+  +G P +++
Sbjct  92    GNAAEKDSPAN-LSLRGYEIIDEAKEELENQCPGVVSCADILAMAARDAVFFAGGPVYDI  150

Query  767   PGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNF  588
             P GR+DG  SR  D   NL SP     +++ +F   G   +D+VAL GAH++GVA CS+F
Sbjct  151   PKGRKDGRRSRIEDT-INLPSPTLNSSELIRIFAQHGFSAQDMVALSGAHTLGVARCSSF  209

Query  587   RYRLNTPARAKEVDGSLKV----VMGTHCRNAATTIPMDSTTQYKMDSMFYKQLLQKKGL  420
             ++RL+      +VD +L       +   C     +     TT+   D+ ++  L +K G+
Sbjct  210   KHRLSNFDSTHDVDPTLDAQFAKTLSKTCGGGDKSEQAFDTTKNDFDNDYFNALQRKSGV  269

Query  419   LESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRFVN  243
             L SD+ L   PRT  +V  +A +QA +   F ++++KMG + V  G  GE+R  CR +N
Sbjct  270   LFSDQTLYNSPRTRGIVNGYAFNQAMFFLDFQQAMVKMGLLDVKEGSSGEVRSNCRIIN  328



>ref|XP_003613163.1| Peroxidase [Medicago truncatula]
 gb|AES96121.1| peroxidase family protein [Medicago truncatula]
Length=377

 Score =   250 bits (638),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 129/316 (41%), Positives = 187/316 (59%), Gaps = 11/316 (3%)
 Frame = -1

Query  1157  RNAEAAETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCD  978
             +N +       ++ GFY  +CPTAE+IV + +V+    +P   A I+RLQ HDC V GCD
Sbjct  62    QNPKTGFDKGHLKQGFYSESCPTAEKIVADALVEITKTNPNAIANIIRLQFHDCFVVGCD  121

Query  977   GSVLLDATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDAL  798
              SVLLD T  G +VEK +  NG+ ++G + ID IK ++E+ CPG+VSC D + FS  + +
Sbjct  122   SSVLLDYTPTGDKVEKSSMLNGQLLKGTDFIDDIKAKLEEQCPGIVSCTDTIAFSVNEGM  181

Query  797   VLSGVPEFEVPGGRRDGNVSREPDAR-KNLASPDFTVDQMVALFKSKGLDVEDLVALLGA  621
              LSG+P     GGRRD   S    A   NL  P++ +++MV LF  KG  +E++V LLGA
Sbjct  182   FLSGLPRTAPLGGRRDALYSLASIAEDDNLPMPNWPMEKMVDLFTKKGFTIEEMVILLGA  241

Query  620   HSIGVAHCSNFRYRLNTPARAKEVDGSLKVVMGTH----CRNAATTIPMDSTTQYK----  465
             HSIGVAHC  F  R+   A  ++ D  L   +       C N  T +  +    +     
Sbjct  242   HSIGVAHCDVFMERIYNYADTRKPDPLLPFPIVNELQQICANPGTPLFRNPVVNFDETPA  301

Query  464   -MDSMFYKQLL-QKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRV  291
              +D++F+K ++ +KK LL +D  L  DPRT+P+VEE A D   +  KF E+++KMG   V
Sbjct  302   LLDNLFFKNMVTKKKTLLVTDAHLFNDPRTIPIVEELAKDNGLFQKKFAEAMVKMGSYNV  361

Query  290   LTGDEGEIRKKCRFVN  243
             +TG++GE+RK CR  N
Sbjct  362   ITGNDGEVRKTCRSTN  377



>ref|NP_001054728.1| Os05g0162000 [Oryza sativa Japonica Group]
 gb|AAT07651.1| peroxidase [Oryza sativa Japonica Group]
 gb|AAT93924.1| peroxidase [Oryza sativa Japonica Group]
 dbj|BAF16642.1| Os05g0162000 [Oryza sativa Japonica Group]
 dbj|BAG90410.1| unnamed protein product [Oryza sativa Japonica Group]
Length=359

 Score =   249 bits (637),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 139/316 (44%), Positives = 182/316 (58%), Gaps = 12/316 (4%)
 Frame = -1

Query  1154  NAEAAETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDG  975
             +A A    A + VGFY  TCPTAE +++  +  AF +D GVA A++R+  HDC V GCDG
Sbjct  16    SAAAVGARACLDVGFYDTTCPTAETLIQQVVAAAFRNDSGVAPAMIRMHFHDCFVRGCDG  75

Query  974   SVLLDATSGGG-RVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDAL  798
             SVL+D   G   R EK A  N  ++R F++IDR K  +E +CPGVVSCAD++ F ARD +
Sbjct  76    SVLIDTVPGSTTRAEKDAAPNNPSLRFFDVIDRAKSAVEAACPGVVSCADVVAFMARDGV  135

Query  797   VLSGVPEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAH  618
             VLSG   ++VP GRRDG  S E DA   L  P  T   +VA F +K L  ED+V L GAH
Sbjct  136   VLSGGLGYQVPAGRRDGRTSLEDDALNFLPPPTSTAADLVANFTAKNLTAEDMVVLSGAH  195

Query  617   SIGVAHCSNFRYRL-NTPARAKEVDGSLK-----VVMGTHCRNAATTIP-----MDSTTQ  471
             +IGV+HC +F  R+ N P     +D SL      ++ G    N+  T P     MD  T 
Sbjct  196   TIGVSHCDSFTNRIYNFPNTTDGIDPSLSKAYAFLLKGICPPNSNQTFPTTTTFMDILTP  255

Query  470   YKMDSMFYKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRV  291
              K D+ +Y  L    GL +SD  L  D      V  F   +A +  KF  ++IKMG+I V
Sbjct  256   TKFDNRYYVGLTNNLGLFQSDAALLTDAALKATVNSFVRSEATFRLKFARAMIKMGQIGV  315

Query  290   LTGDEGEIRKKCRFVN  243
             L+G +GEIR  CR VN
Sbjct  316   LSGTQGEIRLNCRVVN  331



>ref|XP_009768802.1| PREDICTED: peroxidase 5-like [Nicotiana sylvestris]
Length=343

 Score =   249 bits (635),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 129/302 (43%), Positives = 174/302 (58%), Gaps = 10/302 (3%)
 Frame = -1

Query  1118  VGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSGGGR  939
             VGFY R+CP AE I++  + KA   +PG AA I+R+  HDC + GCDGSVLLD+  G   
Sbjct  42    VGFYKRSCPAAEAIIRKAVFKAVLMNPGTAAGIIRMHFHDCFIRGCDGSVLLDSVRGKET  101

Query  938   VEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEVPGG  759
              EK +P N  ++RGFE+ID  K  +E+ CP  VSCADIL F+ARD+ + +G   + +PGG
Sbjct  102   AEKDSPINNPSLRGFEVIDEAKALLEKLCPRTVSCADILAFAARDSALFAGGISYALPGG  161

Query  758   RRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNFRYR  579
             RRDG VS   +  +NL  P F   Q+   FK KGL ++++V L GAHSIG  HCS+F  R
Sbjct  162   RRDGRVSLSSEVIQNLPPPFFNAQQLQDNFKRKGLSLDEMVTLSGAHSIGRTHCSSFSNR  221

Query  578   LNTPARAKEVDGSLKVVMGTHCRNAA----------TTIPMDSTTQYKMDSMFYKQLLQK  429
             L         D SL     +  +N              + +D +T  ++D+ +Y  L   
Sbjct  222   LYGFNATHPQDPSLDPRYASFLKNKCPRPISDTQVDPIVNLDISTPNRLDNKYYLNLKNH  281

Query  428   KGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRF  249
             KGLL SD+ L   P T  LV       + W  KF  +++ MG I VLTG++GEIRK C F
Sbjct  282   KGLLTSDQTLFESPLTSKLVFNNVKYGSTWARKFAAAMVHMGSIEVLTGNKGEIRKNCHF  341

Query  248   VN  243
             VN
Sbjct  342   VN  343



>ref|XP_009629163.1| PREDICTED: peroxidase 5 {ECO:0000250|UniProtKB:P22195}-like [Nicotiana 
tomentosiformis]
Length=346

 Score =   249 bits (636),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 128/302 (42%), Positives = 174/302 (58%), Gaps = 10/302 (3%)
 Frame = -1

Query  1118  VGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSGGGR  939
             VGFY R+CP AE I++  + KA   +PG AA I+R+  HDC + GCDGSVLLD+  G   
Sbjct  45    VGFYKRSCPAAEAIIRKAVFKAVLMNPGTAAGIIRMHFHDCFIRGCDGSVLLDSVRGKET  104

Query  938   VEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEVPGG  759
              EK +P N  ++RGFE+ID  K  +E+ CP  VSCADIL F+ARD+ + +G   + +PGG
Sbjct  105   AEKDSPINNPSLRGFEVIDEAKALLEKVCPRTVSCADILAFAARDSALFAGGISYALPGG  164

Query  758   RRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNFRYR  579
             RRDG +S   +  +NL  P F   Q+   FK KGL ++++V L GAHSIG  HCS+F  R
Sbjct  165   RRDGRISLSSEVIQNLPPPFFNAQQLQDNFKRKGLSLDEMVTLSGAHSIGRTHCSSFSNR  224

Query  578   LNTPARAKEVDGSLKVVMGTHCRNAA----------TTIPMDSTTQYKMDSMFYKQLLQK  429
             L         D SL     +  +N              + +D +T  ++D+ +Y  L   
Sbjct  225   LYGFNATHPQDPSLDPRYASFLKNKCPRPISDTQVDPIVNLDISTPNRLDNKYYLNLKNH  284

Query  428   KGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRF  249
             KGLL SD+ L   P T  LV       + W  KF  +++ MG I VLTG++GEIRK C F
Sbjct  285   KGLLTSDQTLFESPLTSKLVFNNVKYGSTWARKFAAAMVHMGSIEVLTGNKGEIRKNCHF  344

Query  248   VN  243
             VN
Sbjct  345   VN  346



>ref|XP_002525672.1| Peroxidase 44 precursor, putative [Ricinus communis]
 gb|EEF36655.1| Peroxidase 44 precursor, putative [Ricinus communis]
Length=324

 Score =   248 bits (634),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 127/296 (43%), Positives = 182/296 (61%), Gaps = 6/296 (2%)
 Frame = -1

Query  1124  MRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSGG  945
             +RVGFY  TCP AE IV   +   F  DP V AA++RL  HDC V GCD S+L+D T+  
Sbjct  21    LRVGFYQSTCPQAESIVFQVVQNRFKTDPSVTAALLRLHFHDCFVRGCDASILIDPTNKK  80

Query  944   GRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEVP  765
              + EKQA  N +TVRG+E+ID IK  +E +CP +VSCADI+  +A+DA+ L+G P + VP
Sbjct  81    -QSEKQAGPN-QTVRGYEIIDEIKNALEAACPSMVSCADIIALAAKDAVALAGGPNYSVP  138

Query  764   GGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNFR  585
              GRRDG VS   D   NL  P  TV +    F+ KG  V ++V LLGAH++GVAHCS F+
Sbjct  139   TGRRDGLVSNIGDV--NLPGPQLTVPEAFQFFRPKGFTVGEMVTLLGAHTVGVAHCSFFQ  196

Query  584   YRLNTPARAKEVDGSLKVVMGTHC--RNAATTIPMDSTTQYKMDSMFYKQLLQKKGLLES  411
              R++  A    +D +L   +   C   N+  ++ MD +T +  D+ +YKQLL K+G+++ 
Sbjct  197   ERVSNGAFDPTMDSNLAANLSKICASSNSDPSVFMDQSTGFVFDNEYYKQLLLKRGIMQI  256

Query  410   DERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRFVN  243
             D+ L+ D  +   V  FA +   +   F  +++K+G + VL G+ GE+R  CR  N
Sbjct  257   DQELSVDGSSAGFVSSFARNGIGFKQSFGNAMVKLGTVEVLVGNAGEVRTNCRVFN  312



>emb|CDX85441.1| BnaA02g03720D [Brassica napus]
Length=310

 Score =   248 bits (632),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 130/300 (43%), Positives = 191/300 (64%), Gaps = 12/300 (4%)
 Frame = -1

Query  1130  AGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATS  951
             A +RVGFY R+CP AE IV+N + + F  DP V AA++R+  HDC V GCD S+L+D+T+
Sbjct  19    AQLRVGFYSRSCPQAETIVRNLVRQRFGVDPTVTAALLRMHFHDCFVRGCDASLLIDSTN  78

Query  950   GGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFE  771
                  EK A  NG +VR F+LIDRIK ++E +CP  VSCADI+T + RD++ L+G P + 
Sbjct  79    S----EKTAGPNG-SVREFDLIDRIKAQLEAACPSTVSCADIITLATRDSVALAGGPSYS  133

Query  770   VPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSN  591
             +P GRRDG VS   D    L  P  +V   V+LF +KG++V D VALLGAH++G  +C  
Sbjct  134   IPTGRRDGLVSNNVDV--ALPGPTISVAGAVSLFTNKGMNVFDAVALLGAHTVGQGNCGL  191

Query  590   FRYRLN----TPARAKEVDGSLKVVMGTHCRNAATTIPMDSTTQYKMDSMFYKQLLQKKG  423
             F  R+     T      +D +L   +   CRN+A+   +D +T  + D+ F+KQL +++G
Sbjct  192   FNDRITNFQGTGRPDPSMDPALVSSLRNTCRNSASA-ALDQSTPLRFDNQFFKQLRKRRG  250

Query  422   LLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRFVN  243
             +++ D+RLA D +T  +V  +A++ A    +F  ++IKMG + VLTG  G+IR+ CR  N
Sbjct  251   VMQVDQRLATDRQTRGVVARYANNNAFLKRQFVRAMIKMGAVDVLTGSAGQIRRNCRRFN  310



>ref|XP_010492748.1| PREDICTED: peroxidase 57-like [Camelina sativa]
Length=310

 Score =   248 bits (632),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 128/300 (43%), Positives = 189/300 (63%), Gaps = 12/300 (4%)
 Frame = -1

Query  1130  AGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATS  951
             A +RVGFY ++CP AE IV+N + + F  DP V AA++R+  HDC V GCD S+L+D+T+
Sbjct  19    AQLRVGFYSQSCPQAETIVRNLVRQRFGVDPTVTAALLRMHFHDCFVRGCDASLLIDSTN  78

Query  950   GGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFE  771
                  EK A  NG +VR F+LIDRIK ++E +CP  VSCADI+T + RD++ L+G P + 
Sbjct  79    S----EKAAGPNG-SVREFDLIDRIKAQLEAACPSTVSCADIVTLATRDSVALAGGPSYS  133

Query  770   VPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSN  591
             +P GRRDG VS   D    L  P  +V   V+ F +KGL+  D VALLGAH++G  +C  
Sbjct  134   IPTGRRDGRVSNNVDV--ALPGPTISVSGAVSFFTNKGLNTFDAVALLGAHTVGQGNCGL  191

Query  590   FRYRLNTPARAKEVDGSLKVVMGTH----CRNAATTIPMDSTTQYKMDSMFYKQLLQKKG  423
             F  R+         D S+   + T     CRN+A+   +D +T  + D+ F+KQ+ +++G
Sbjct  192   FSDRITNFQGTGRPDSSMDPALVTSLRNTCRNSASA-ALDQSTPLRFDNQFFKQIRRRRG  250

Query  422   LLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRFVN  243
             +L+ D+RLA D +T  +V  +A++ A +  +F  +++KMG + VLTG  GEIR+ CR  N
Sbjct  251   VLQVDQRLATDRQTRGIVARYANNNAFFKRQFVRAMVKMGAVDVLTGRNGEIRRNCRRFN  310



>tpe|CAH69314.1| TPA: class III peroxidase 72 precursor [Oryza sativa Japonica 
Group]
Length=354

 Score =   249 bits (636),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 139/316 (44%), Positives = 182/316 (58%), Gaps = 12/316 (4%)
 Frame = -1

Query  1154  NAEAAETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDG  975
             +A A    A + VGFY  TCPTAE +++  +  AF +D GVA A++R+  HDC V GCDG
Sbjct  11    SAAAVGARACLDVGFYDTTCPTAETLIQQVVAAAFRNDSGVAPAMIRMHFHDCFVRGCDG  70

Query  974   SVLLDATSGGG-RVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDAL  798
             SVL+D   G   R EK A  N  ++R F++IDR K  +E +CPGVVSCAD++ F ARD +
Sbjct  71    SVLIDTVPGSTTRAEKDAAPNNPSLRFFDVIDRAKSAVEAACPGVVSCADVVAFMARDGV  130

Query  797   VLSGVPEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAH  618
             VLSG   ++VP GRRDG  S E DA   L  P  T   +VA F +K L  ED+V L GAH
Sbjct  131   VLSGGLGYQVPAGRRDGRTSLEDDALNFLPPPTSTAADLVANFTAKNLTAEDMVVLSGAH  190

Query  617   SIGVAHCSNFRYRL-NTPARAKEVDGSLK-----VVMGTHCRNAATTIP-----MDSTTQ  471
             +IGV+HC +F  R+ N P     +D SL      ++ G    N+  T P     MD  T 
Sbjct  191   TIGVSHCDSFTNRIYNFPNTTDGIDPSLSKAYAFLLKGICPPNSNQTFPTTTTFMDILTP  250

Query  470   YKMDSMFYKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRV  291
              K D+ +Y  L    GL +SD  L  D      V  F   +A +  KF  ++IKMG+I V
Sbjct  251   TKFDNRYYVGLTNNLGLFQSDAALLTDAALKATVNSFVRSEATFRLKFARAMIKMGQIGV  310

Query  290   LTGDEGEIRKKCRFVN  243
             L+G +GEIR  CR VN
Sbjct  311   LSGTQGEIRLNCRVVN  326



>ref|XP_004960409.1| PREDICTED: peroxidase 5-like [Setaria italica]
Length=333

 Score =   248 bits (634),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 131/316 (41%), Positives = 188/316 (59%), Gaps = 14/316 (4%)
 Frame = -1

Query  1151  AEAAETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGS  972
             A  +   + + VGFY  +CP AEEIV+N + +    DPGV A ++R+  HDC V GCDGS
Sbjct  16    ASVSAHASHLEVGFYKHSCPEAEEIVRNAVRRGLARDPGVGAGLIRMHFHDCFVRGCDGS  75

Query  971   VLLDATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVL  792
             +L+++T G  R EK + +N  ++RGF++ID  K  +E  CP  VSCAD++ F+ARD   L
Sbjct  76    ILINSTPGN-RAEKDSVANNPSMRGFDVIDDAKAVLEAHCPRTVSCADVVAFAARDGAYL  134

Query  791   SGVPEFEVPGGRRDGNVSREPDA-RKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHS  615
             +G  E++VP GRRDG VS E +    N+ +P   + +++  FK KGL  +D+V L GAH+
Sbjct  135   AGGIEYQVPSGRRDGRVSIEAEVLNNNVPAPTDRLRELIESFKRKGLSADDMVTLSGAHT  194

Query  614   IGVAHCSNFRYRL-NTPARAKEVDGSLKVVMGTHCRNA-----------ATTIPMDSTTQ  471
             IG +HCS+F  RL N   +  + D S+      H +              T +P+D  T 
Sbjct  195   IGRSHCSSFTQRLYNFSGQLGKTDPSIDPAYAEHLKMRCPWPSSDDQMDPTVVPLDPVTP  254

Query  470   YKMDSMFYKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRV  291
                D+ ++K +L  K +L SD+ L   P T  +V+  +  + AW  KF  S+IKMGKI V
Sbjct  255   ASFDNQYFKNVLAHKVVLTSDQTLLDSPWTAGIVKFNSAVEKAWQLKFAASMIKMGKIEV  314

Query  290   LTGDEGEIRKKCRFVN  243
             LTGDEGEIR+KC  VN
Sbjct  315   LTGDEGEIREKCFVVN  330



>gb|KDP30908.1| hypothetical protein JCGZ_15520 [Jatropha curcas]
Length=328

 Score =   248 bits (633),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 123/302 (41%), Positives = 181/302 (60%), Gaps = 9/302 (3%)
 Frame = -1

Query  1124  MRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSGG  945
             ++VG+Y  +C  AE IVK+ +   F  D GV AA++R+  HDC V GCDGSVL+D++S  
Sbjct  28    LQVGYYSSSCSVAEFIVKDAVRDGFSKDKGVPAALLRMHFHDCFVRGCDGSVLIDSSSSN  87

Query  944   GRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEVP  765
                EK  P+N  ++RGFE+ID  K  +E  C G+VSCADIL F+ARD++ LSG   ++VP
Sbjct  88    -TAEKDNPANNPSLRGFEVIDNAKSRLEAVCKGIVSCADILAFAARDSIELSGGLGYDVP  146

Query  764   GGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNFR  585
              GRRDG +S   D   NL +P F V+Q+  LF +KG    ++V L G H+IG +HC++F 
Sbjct  147   AGRRDGRISLSSDVSTNLPAPTFNVNQLTQLFANKGFSQAEMVTLSGGHTIGRSHCTSFS  206

Query  584   YRL----NTPARAKEVDGSLKVVMGTHCRNAAT----TIPMDSTTQYKMDSMFYKQLLQK  429
              RL     T +    +DG     +   C  ++T     +PM+ ++   +D+ +Y  +L  
Sbjct  207   NRLYNFNQTSSSDPSLDGMYAAKLKQQCPQSSTDNGLVVPMNPSSPGTIDAGYYIDILAN  266

Query  428   KGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRF  249
             +GL  SD+ L  +P T   V + A +   W  KF  +++KMG + VLTG+ GEIR  CR 
Sbjct  267   RGLFISDQTLLTNPATATQVSQNARNPLLWQTKFAAAMVKMGGLDVLTGNAGEIRANCRV  326

Query  248   VN  243
             +N
Sbjct  327   IN  328



>dbj|BAA77387.1| peroxidase 1 [Scutellaria baicalensis]
Length=322

 Score =   248 bits (633),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 126/306 (41%), Positives = 182/306 (59%), Gaps = 9/306 (3%)
 Frame = -1

Query  1136  TTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDA  957
             + A ++ GFY  +C  AE IVK  +  AF  D G+AA ++RL  HDC V GCDGSVL+D+
Sbjct  17    SEAQLQKGFYQLSCGFAETIVKQEVRNAFFRDSGIAAGLIRLHFHDCFVRGCDGSVLIDS  76

Query  956   TSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPE  777
             T G    EK +P N  ++RGFE++D IK  +E SCPGVVSCADIL ++ARD++ ++    
Sbjct  77    T-GSNTAEKDSPPNNPSLRGFEVVDAIKRRLEVSCPGVVSCADILAYAARDSVEITRGLG  135

Query  776   FEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHC  597
             ++V  GRRDG VS   +A  NL  P F VDQ+   F +KGL  +++V L GAH++G +HC
Sbjct  136   YDVLAGRRDGRVSLASEALSNLPPPSFNVDQLTRAFANKGLSQDEMVTLSGAHTLGRSHC  195

Query  596   SNFRYRLNTPARAKEVDGSLKVVMGTHCR--------NAATTIPMDSTTQYKMDSMFYKQ  441
             ++F  RL   + +   D +L +   +  +        N    +PMD  T    D  +Y+ 
Sbjct  196   TSFNNRLYNFSTSSMQDPTLDLAYASQLKQQCPQGSANPNLVVPMDPPTPAVSDVSYYRG  255

Query  440   LLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRK  261
             +L  +GL  SD+ L   P+T   V + A +Q  W  KF  +++ MG I V+TG  GEIR+
Sbjct  256   VLANRGLFTSDQTLLTSPQTRAQVLQNAQNQFLWWRKFAGAMVSMGNIGVITGGAGEIRR  315

Query  260   KCRFVN  243
              CR +N
Sbjct  316   DCRVIN  321



>ref|XP_006645837.1| PREDICTED: peroxidase 1-like [Oryza brachyantha]
Length=369

 Score =   249 bits (637),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 135/307 (44%), Positives = 187/307 (61%), Gaps = 11/307 (4%)
 Frame = -1

Query  1130  AGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATS  951
             AG++VGFY +TCP+AE +V+  +  AF ++ GVAA ++RL  HDC V GCDGSVL+D  +
Sbjct  27    AGLKVGFYSKTCPSAESLVQRAVAAAFRNNSGVAAGLIRLHFHDCFVRGCDGSVLIDPVA  86

Query  950   GGG-RVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEF  774
                 RVEKQA  N  ++RGF+++D  K  +E +CP  VSCADIL F+ARD++ LSG   +
Sbjct  87    NSSVRVEKQAIPNNPSLRGFDVVDAAKAAVEAACPRTVSCADILAFAARDSVALSGNVTY  146

Query  773   EVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCS  594
              VP GRRDGNVS E DA  NL +P  +  ++V  F  K L  ED+V L GAH+IGV+HCS
Sbjct  147   RVPAGRRDGNVSLEGDALANLPAPFSSAAELVGNFSRKNLTAEDMVVLSGAHTIGVSHCS  206

Query  593   NFRYRLNTPARAKEVDGSLKVVMGTHCR-----NAA-----TTIPMDSTTQYKMDSMFYK  444
             +F  RL   +   +VD ++        R     N++     TT+ MD  T   +D+ +Y 
Sbjct  207   SFTNRLYGFSAGSDVDPTISPAYAFLLRAVCPSNSSQFFPNTTVDMDVITPAALDNKYYV  266

Query  443   QLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIR  264
              L    GL  SD+ L  +      V+EF   +  W  KF ++++KMG I VLTG +GE+R
Sbjct  267   GLANNLGLFTSDQALLTNATLRASVDEFVKSERRWKSKFVKAMVKMGGIEVLTGTQGEVR  326

Query  263   KKCRFVN  243
               CR VN
Sbjct  327   LNCRVVN  333



>gb|EPS60748.1| hypothetical protein M569_14053, partial [Genlisea aurea]
Length=318

 Score =   248 bits (632),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/303 (41%), Positives = 179/303 (59%), Gaps = 8/303 (3%)
 Frame = -1

Query  1130  AGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATS  951
             A + V FY   CP A  I++  +  AF+ D G+AA +VR+  HDC V GCDGSVL+D+T 
Sbjct  16    AQLTVNFYDSVCPNARFIIREEVSNAFNRDRGLAAGLVRMHFHDCFVRGCDGSVLIDSTP  75

Query  950   GGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFE  771
                + EK AP N  ++RGFE+ID  K  +E +CPGVVSCADIL F+ARD++ ++G   FE
Sbjct  76    SN-KAEKDAPPNNPSLRGFEVIDAAKRRIEAACPGVVSCADILAFAARDSVEITGGYRFE  134

Query  770   VPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSN  591
             VP GRRDG VS   +   N+ +P F ++Q+   F++KGL  E++V L GAH+IG +HC+ 
Sbjct  135   VPAGRRDGRVSLASEVLTNIPAPTFDLNQLTQSFQNKGLTQEEMVTLSGAHTIGRSHCTT  194

Query  590   FRYRLNTPARAKEVDGSLKVVMGTHCRN-------AATTIPMDSTTQYKMDSMFYKQLLQ  432
                RL   +     D SL        +        A   +PMD  T  + D  +Y+++++
Sbjct  195   ITDRLYNFSSTASTDPSLDPAYANELKQRCPPNPAADLVLPMDPVTPDRTDVEYYREVIR  254

Query  431   KKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCR  252
              +GL +SD  L     T   V     D  AW  KF+++++K+G+  VLTG  GEIR+ CR
Sbjct  255   NRGLFQSDAALLTSTNTRDQVVLNVRDPNAWFTKFSDAMVKLGQTGVLTGSAGEIRRNCR  314

Query  251   FVN  243
              +N
Sbjct  315   VIN  317



>ref|XP_008808296.1| PREDICTED: peroxidase 5-like [Phoenix dactylifera]
Length=324

 Score =   248 bits (632),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 130/309 (42%), Positives = 183/309 (59%), Gaps = 10/309 (3%)
 Frame = -1

Query  1145  AAETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVL  966
             +++  A + VGFY  TCP AE IVK  + KA   + G+AA +VRL  HDC V GCDGSVL
Sbjct  18    SSQLEAQLEVGFYDATCPQAELIVKLLVTKAVASNIGLAAGLVRLHFHDCFVRGCDGSVL  77

Query  965   LDATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSG  786
             +D+TS     EK +  N  ++RGFE+ID  K  +E +C GVVSCADIL F+ARD++ L+G
Sbjct  78    IDSTSTN-TAEKDSSIN-TSLRGFEVIDSAKALLEATCNGVVSCADILAFAARDSIALTG  135

Query  785   VPEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGV  606
                ++VP GRRDG VS   D   NL +P F VDQ+   F++KGL  + +V L GAH+IG 
Sbjct  136   GISYQVPAGRRDGRVSLASDTFANLPAPSFNVDQLTQSFQAKGLTQDQMVTLSGAHTIGR  195

Query  605   AHCSNFR---YRLNTPARAK-EVDGSLKVVMGTHC----RNAATTIPMDSTTQYKMDSMF  450
             +HCS+F    Y  NT  +    +D +    +   C     N+   +PMD  +   +D+ +
Sbjct  196   SHCSSFSNRLYNFNTTVKQDPSLDATYAAQLKKQCPQGSTNSNLVVPMDPPSPNIVDTNY  255

Query  449   YKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGE  270
             Y  +L  +GL  SD+ L     T   V++ A +   W  KF  +++ MG++ VLTG  GE
Sbjct  256   YNDILVNRGLFTSDQTLLSKATTASHVKQNAANSLLWQNKFATAMVAMGQVGVLTGSNGE  315

Query  269   IRKKCRFVN  243
             IR  CR +N
Sbjct  316   IRLNCRAIN  324



>ref|XP_009411413.1| PREDICTED: peroxidase 5 {ECO:0000250|UniProtKB:P22195}-like [Musa 
acuminata subsp. malaccensis]
Length=324

 Score =   248 bits (632),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 132/306 (43%), Positives = 177/306 (58%), Gaps = 6/306 (2%)
 Frame = -1

Query  1145  AAETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVL  966
             A  T A ++VGFY  +CP AEEIVK  + KA  +D G+ + ++R+  HDC V GCDGS+L
Sbjct  20    AMGTEAYLKVGFYSYSCPKAEEIVKEELDKALQEDKGIGSDLLRMHFHDCFVRGCDGSLL  79

Query  965   LDATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSG  786
             +D+T      +   P+      GFE+ID++KE +E  C G VSCADIL F ARD++   G
Sbjct  80    IDSTKDNAAEKDGKPNETVEDEGFEVIDKVKERLEAECKGTVSCADILAFLARDSVAHYG  139

Query  785   VPEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGV  606
                + VP GRRDG +SR  D   +L  P F +  +  LF SKGL  +D+VAL GAH+IG+
Sbjct  140   GVHYPVPAGRRDGRISRSNDT-IDLPPPTFKLGNLTKLFVSKGLSRDDMVALSGAHTIGI  198

Query  605   AHCSNFRYRLNTPARAKEVDGSLKVVMGTHCRNAATT-----IPMDSTTQYKMDSMFYKQ  441
             AHCS F  RL   ++  + D SL        R    T     + MD  +    DS +YK 
Sbjct  199   AHCSAFSDRLYNFSQTVKADPSLGPNYAAQLRGQCPTGSDNEVDMDPPSPLTFDSSYYKN  258

Query  440   LLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRK  261
             LL  +GL  SD+ L     T  LV+ FA   A +  KF  +++KMG I VLTG++GEIR 
Sbjct  259   LLAHRGLFTSDQTLMSKHGTATLVKRFAKKPALFKKKFAAAMVKMGSIGVLTGEQGEIRT  318

Query  260   KCRFVN  243
              CR VN
Sbjct  319   NCRVVN  324



>gb|ABS44862.1| putative peroxidase [Oryza sativa Japonica Group]
Length=331

 Score =   248 bits (633),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 133/309 (43%), Positives = 180/309 (58%), Gaps = 11/309 (4%)
 Frame = -1

Query  1151  AEAAETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGS  972
             A A  + A ++VG+Y   CP AE IV+  + KA   +PG+AA +VRL  HDC V GCD S
Sbjct  22    AMATRSQAQLQVGYYDTLCPAAEIIVQEEVSKAVSGNPGMAAGLVRLHFHDCFVRGCDAS  81

Query  971   VLLDATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVL  792
             VLLD+T G  R  K AP N  ++RGFE+ID  K  +E +C GVVSCAD+L F+ARDAL L
Sbjct  82    VLLDSTXGN-RAXKDAPPN-TSLRGFEVIDSAKSRLETACFGVVSCADVLAFAARDALAL  139

Query  791   SGVPEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSI  612
              G   + VPGGRRDGNVS   +   NL  P   V Q+  +F +KGL   ++VAL GAH+I
Sbjct  140   VGGNAYXVPGGRRDGNVSVAQETNGNLPPPSANVAQLTQMFGAKGLTQAEMVALSGAHTI  199

Query  611   GVAHCSNFRYRLNTPARAKEVDGSLK----VVMGTHC-----RNAATTIPMDSTTQYKMD  459
             GV HC +F  RL +       D S+       + T C     +  A  +PMD+ T    D
Sbjct  200   GVXHCXSFSNRLYSSGPNAGQDPSMDPXYVAALTTQCPQQQGQPVAGMVPMDAVTPNAFD  259

Query  458   SMFYKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGD  279
             + +Y  ++  +GLL SD+ L  D  T   V  + ++  ++   F  +++KMG I VLTG+
Sbjct  260   TNYYAAIVANRGLLSSDQALLADQTTAAQVVGYTNNPDSFQTDFAAAMVKMGSIGVLTGN  319

Query  278   EGEIRKKCR  252
              G IR  CR
Sbjct  320   AGTIRTNCR  328



>ref|XP_008673305.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF83711.1| unknown [Zea mays]
 tpg|DAA43003.1| TPA: peroxidase 66 [Zea mays]
Length=329

 Score =   248 bits (632),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 132/304 (43%), Positives = 180/304 (59%), Gaps = 12/304 (4%)
 Frame = -1

Query  1124  MRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSGG  945
             ++VGFY   CP AE IV+  + KA   +PGVAA ++RL  HDC V GCD SVLLD +S G
Sbjct  28    LQVGFYDTLCPAAEIIVQEEVSKAASGNPGVAAGLLRLHFHDCFVRGCDASVLLD-SSAG  86

Query  944   GRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEVP  765
              + EK A  N  ++RGFE+ID  K  +EQ+C GVVSCAD+L F+ARDAL L G   ++VP
Sbjct  87    NQAEKDAAPN-ASLRGFEVIDSAKTRLEQACFGVVSCADVLAFAARDALALVGGDAYQVP  145

Query  764   GGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNFR  585
              GRRDGNVS   +A  NL  P  +  Q+   F +KGL   ++VAL GAH++G A CS+F 
Sbjct  146   AGRRDGNVSSAQEAGANLPPPTASASQLTQAFGAKGLSQAEMVALSGAHTVGAARCSSFA  205

Query  584   YRLNT--PARAKE---VDGSLKVVMGTHCRNAAT-----TIPMDSTTQYKMDSMFYKQLL  435
              RL +  P+ A +   +D +    +   C    T      +PMD  T    D+ +Y  L+
Sbjct  206   PRLYSYGPSGAGQDPSMDPAYLAALAQQCPPQGTGAADPPLPMDPVTPTAFDTNYYANLV  265

Query  434   QKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKC  255
              ++GLL SD+ L  DP T   V  + +  A +   F  ++IKMG I+VLTG  G +R  C
Sbjct  266   ARRGLLASDQALLADPATAAQVLAYTNSPATFQTDFVAAMIKMGAIQVLTGTAGTVRTNC  325

Query  254   RFVN  243
             R  +
Sbjct  326   RVAS  329



>ref|XP_010919026.1| PREDICTED: peroxidase 5-like [Elaeis guineensis]
Length=324

 Score =   247 bits (631),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 131/309 (42%), Positives = 183/309 (59%), Gaps = 10/309 (3%)
 Frame = -1

Query  1145  AAETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVL  966
             +++  A ++VGFY   CP AE IVK  +  A   + G+AA +VR+  HDC + GCDGSVL
Sbjct  18    SSQLEAQLQVGFYDSICPQAELIVKTQVTVALLSNIGLAAGLVRMHFHDCFIRGCDGSVL  77

Query  965   LDATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSG  786
             +D+TS     EK +  N K++RGF++ID  K  +E +CPG+VSCADIL  +ARD++ L+G
Sbjct  78    IDSTSTN-TAEKDSSIN-KSLRGFDVIDSAKALLEATCPGMVSCADILAIAARDSIELTG  135

Query  785   VPEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGV  606
                +EVP GRRDG VS   +   NL  P F VDQ+   FK KGL  E +V L GAH+IG 
Sbjct  136   GLSYEVPAGRRDGTVSLASETFTNLPGPGFNVDQLTQSFKVKGLTQEQMVTLSGAHTIGR  195

Query  605   AHCSNFRYRL-NTPARAKE---VDGSLKVVMGTHCRNAAT----TIPMDSTTQYKMDSMF  450
             +HCS+F  RL N     KE   +D +    +   C   +T     +PMD ++   +D+ +
Sbjct  196   SHCSSFSNRLYNFSTTVKEDPSLDATYAAQLMQECPQGSTDPNLVVPMDPSSPNIVDTGY  255

Query  449   YKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGE  270
             Y  +L  +GL  SD+ L     T   V + A +   W  KF  +++ MG+I VLTG  GE
Sbjct  256   YSNILANRGLFTSDQTLLSQVATAGQVRQNAANSMLWQNKFAAAMVAMGQIGVLTGSNGE  315

Query  269   IRKKCRFVN  243
             IR+ CR VN
Sbjct  316   IRRNCRVVN  324



>ref|XP_004304932.1| PREDICTED: peroxidase 5-like [Fragaria vesca subsp. vesca]
Length=324

 Score =   247 bits (631),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 129/300 (43%), Positives = 177/300 (59%), Gaps = 8/300 (3%)
 Frame = -1

Query  1121  RVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSGGG  942
             RVGFY  TCP+AE IV+  + KA   +PG+AA ++R+  HDC V GCD SVLLD+T G  
Sbjct  26    RVGFYRTTCPSAEAIVRKAVNKAVMKNPGIAAGLIRMHFHDCFVRGCDASVLLDSTPGK-  84

Query  941   RVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEVPG  762
               EK+ P+N  ++RGFE+ID  K E+E  CP  VSCADIL F+ARD  +  G   ++VP 
Sbjct  85    LSEKEHPANKPSLRGFEVIDEAKRELETLCPRTVSCADILAFAARDGALAVGGISYQVPS  144

Query  761   GRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNFRY  582
             GRRDG VS   +   NL SP     ++ A F  KG  ++++V L GAHSIGV+HCS+F  
Sbjct  145   GRRDGRVSLFDEPSNNLPSPSLNAKELAASFARKGFSLDEMVTLSGAHSIGVSHCSSFSN  204

Query  581   RL----NTPARAKEVDGSLKVVMGTHCRNAAT---TIPMDSTTQYKMDSMFYKQLLQKKG  423
             RL     T  +   +D      +   C  +++    + +D  T  ++D+ +Y  L+  +G
Sbjct  205   RLYAFNETHTQDPSLDPKFARDLKAKCPPSSSPNNVVQLDGVTPNRLDNKYYTNLMNHRG  264

Query  422   LLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRFVN  243
             L  SD+ L     T  +V   A    AW  KF  +++KMG I VLTG +GEIRKKC  VN
Sbjct  265   LFASDQTLLSSRSTAGMVRNNARLGPAWAKKFASAMVKMGSIDVLTGRQGEIRKKCGVVN  324



>gb|AHL39150.1| class III peroxidase [Populus trichocarpa]
Length=327

 Score =   247 bits (631),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 128/308 (42%), Positives = 180/308 (58%), Gaps = 10/308 (3%)
 Frame = -1

Query  1139  ETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLD  960
              T A +++GFY  +CP AE IV++++ +  H+ P +AAAI+R+  HDC V GCD SVLL+
Sbjct  20    STEAQLQMGFYSSSCPNAERIVQDYVNRHIHNAPSLAAAIIRMHFHDCFVRGCDASVLLN  79

Query  959   ATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVP  780
              TS   + EK A  N  T+RGF+ ID++K  +E +CP VVSCADI+   ARDA+V +G P
Sbjct  80    TTSSNNQTEKVATPN-LTLRGFDFIDKVKSLLEAACPAVVSCADIVALVARDAVVATGGP  138

Query  779   EFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAH  600
              + VP GRRDG +SR  +A  N+  P      +  LF ++GLD++DLV L GAH+IG++H
Sbjct  139   FWRVPTGRRDGTISRSSEALNNIPPPTSNFTNLQRLFANQGLDLKDLVLLSGAHTIGISH  198

Query  599   CSNFRYRLNT--------PARAKEVDGSLKVVMGTHCRNAATTIPMDSTTQYKMDSMFYK  444
             CS+F  RL          PA   E   +LK        +  T + MD  +    D  +Y 
Sbjct  199   CSSFSNRLYNFTGVGDQDPALDSEYAANLKARKCRSLNDNTTIVEMDPGSFRTFDLSYYS  258

Query  443   QLLQKKGLLESDERLAGDPRTLPLVEEFADDQAA-WLGKFTESVIKMGKIRVLTGDEGEI  267
              LL+++GL +SD  L  +  TL  V +        +  +F  S+ KMG+I V TG  GEI
Sbjct  259   LLLKRRGLFQSDSALTTNSATLSFVNQLLQGPLQNFFAEFANSMEKMGRINVKTGTTGEI  318

Query  266   RKKCRFVN  243
             RK C  VN
Sbjct  319   RKHCAVVN  326



>ref|XP_011003206.1| PREDICTED: peroxidase 3-like [Populus euphratica]
Length=327

 Score =   247 bits (631),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 127/308 (41%), Positives = 180/308 (58%), Gaps = 10/308 (3%)
 Frame = -1

Query  1139  ETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLD  960
              T A +++GFY  +CP AE IV++++ +  H+ P +AA I+R+  HDC V GCD SVLL+
Sbjct  20    STEAQLQMGFYSSSCPNAERIVQDYVNRHIHNAPSLAATILRMHFHDCFVRGCDASVLLN  79

Query  959   ATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVP  780
              TS   + EK A  N  T+RGF+ ID++K  +E +CP VVSCADI+   ARDA+V +G P
Sbjct  80    TTSSNNQTEKVATPN-LTLRGFDFIDKVKSLLEAACPAVVSCADIVALVARDAVVATGGP  138

Query  779   EFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAH  600
              + VP GRRDG +SR  +A  N+  P      +  LF ++GLD++DLV L GAH+IG++H
Sbjct  139   FWRVPTGRRDGTISRSSEALNNIPPPTSNFTNLQRLFANQGLDLKDLVLLSGAHTIGISH  198

Query  599   CSNFRYRLNT--------PARAKEVDGSLKVVMGTHCRNAATTIPMDSTTQYKMDSMFYK  444
             CS+F  RL          PA   E   +LK        +  T + MD  +    D  +Y+
Sbjct  199   CSSFSNRLYNFTGVGDQDPALDSEYAANLKARKCRSLNDNTTIVEMDPGSFRTFDLSYYR  258

Query  443   QLLQKKGLLESDERLAGDPRTLPLVEEFADDQAA-WLGKFTESVIKMGKIRVLTGDEGEI  267
              LL+++GL +SD  L  +  TL  V +        +  +F  S+ KMG+I V TG  GEI
Sbjct  259   HLLKRRGLFQSDSALTTNSTTLSFVNQLLQGPLQNFFAEFANSMEKMGRINVKTGTTGEI  318

Query  266   RKKCRFVN  243
             RK C  VN
Sbjct  319   RKHCAVVN  326



>ref|XP_008221883.1| PREDICTED: peroxidase 44-like [Prunus mume]
Length=339

 Score =   248 bits (632),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 136/319 (43%), Positives = 185/319 (58%), Gaps = 20/319 (6%)
 Frame = -1

Query  1151  AEAAETTAG--MRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCD  978
             +EAAE   G  + VGFYG  CP AE+IV + + KA   D  + AA +RL SHDC V GCD
Sbjct  23    SEAAEKGQGNGLHVGFYGLRCPNAEQIVADVVSKAVEADKKLPAAFIRLFSHDCFVKGCD  82

Query  977   GSVLLDATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDAL  798
              S+LLD+T     VE Q+P+N + +RG E+ID IK  +E  CP  VSCADIL F AR+A+
Sbjct  83    ASILLDSTPSHEPVEMQSPANVE-IRGLEVIDEIKARLEAECPETVSCADILAFVAREAV  141

Query  797   VLSGVPEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAH  618
              L+G+P  +VP GRRD   SR  D    +  P   +++++  F  +G+  +++V L GAH
Sbjct  142   ALAGLPRHKVPAGRRDSRTSRATDV--TVPGPATPLNEIIDYFGRRGMTSDEVVVLSGAH  199

Query  617   SIGVAHCSNFRYRL----NTPARAKEVDGSLKVVMGTHCRNAATTIP----------MDS  480
             SIG AHCS F YRL     T A+   +D      +   C  A  T+P           D 
Sbjct  200   SIGAAHCSFFDYRLYNYDQTQAQDPALDPFYAADLSQKC-PAPNTLPEAEAKKRVVDFDP  258

Query  479   TTQYKMDSMFYKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGK  300
              +   +D+ +Y  L+Q K LL+SD+ L  DPRT  +V   A    +W  +F  ++IKMG+
Sbjct  259   VSPLVLDNQYYANLMQGKALLQSDQALVTDPRTNAMVMRMAASADSWTQRFVRAMIKMGR  318

Query  299   IRVLTGDEGEIRKKCRFVN  243
             I VLTG+ GEIRK CR  N
Sbjct  319   INVLTGENGEIRKNCRAFN  337



>gb|KCW52188.1| hypothetical protein EUGRSUZ_J01617, partial [Eucalyptus grandis]
Length=319

 Score =   247 bits (630),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 125/305 (41%), Positives = 183/305 (60%), Gaps = 9/305 (3%)
 Frame = -1

Query  1133  TAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDAT  954
             +A ++VGFY   CP AE +V+  + KA   +PG  A ++R+  HDC V GCD S+LLD+T
Sbjct  6     SATLQVGFYRSACPAAESVVRKAVNKAVARNPGTGAGLIRMHFHDCFVRGCDASILLDST  65

Query  953   SGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEF  774
              G    EK+ P+N  ++RG+E+ID+ K E+E   P  VSCADIL F+ARD+    G   +
Sbjct  66    LGNPS-EKEHPANDPSLRGYEVIDKAKAELEHLYPQTVSCADILAFAARDSTYKLGSINY  124

Query  773   EVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCS  594
              VP GRRDG VS   +  +NL  P     Q+ A F  KGL ++++V + GAHSIGV+HCS
Sbjct  125   AVPAGRRDGLVSLRDEPSQNLPPPSLDAQQLEANFARKGLSLDEMVTVSGAHSIGVSHCS  184

Query  593   NFRYRLNTPARAKEVDGSLKVVMGTHCR-----NAAT---TIPMDSTTQYKMDSMFYKQL  438
             +F  RL +     + D SL+  + +  +     N  T   T+P+D  T  ++D+ +Y  L
Sbjct  185   SFSNRLYSFNATHKQDPSLEPKLASELKAKCPNNGGTSDPTVPLDFVTANRLDNKYYTNL  244

Query  437   LQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKK  258
              + +G+L SD+ L   P T  +V   A+   AW  KF  +++KMG I VLTG +GEIR+ 
Sbjct  245   KKHRGVLTSDQTLFNSPSTAHIVRRNANHGGAWASKFAAAMVKMGSIDVLTGSQGEIRRN  304

Query  257   CRFVN  243
             CR ++
Sbjct  305   CRVLS  309



>gb|EAY96656.1| hypothetical protein OsI_18569 [Oryza sativa Indica Group]
Length=354

 Score =   248 bits (633),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 138/316 (44%), Positives = 182/316 (58%), Gaps = 12/316 (4%)
 Frame = -1

Query  1154  NAEAAETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDG  975
             +A A    A + VGFY  TCPTAE +++  +  AF +D GVA A++R+  HDC V GCDG
Sbjct  11    SAAAVGARACLDVGFYDTTCPTAETLIQQVVAAAFRNDSGVAPAMIRMHFHDCFVRGCDG  70

Query  974   SVLLDATSGGG-RVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDAL  798
             SVL+D   G   R EK A  N  ++R F++IDR K  +E +CPGVVSCAD++ F ARD +
Sbjct  71    SVLIDTVPGSTTRAEKDAAPNNPSLRFFDVIDRAKSAVEAACPGVVSCADVVAFMARDGV  130

Query  797   VLSGVPEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAH  618
             VLSG   ++VP GRRDG  S E DA   L  P  T   +VA F +K L  ED+V L GAH
Sbjct  131   VLSGGLGYQVPAGRRDGRTSLEDDALNFLPPPTSTAADLVANFTAKNLTAEDMVVLSGAH  190

Query  617   SIGVAHCSNFRYRL-NTPARAKEVDGSLK-----VVMGTHCRNAATTIP-----MDSTTQ  471
             +IGV+HC +F  R+ N P     +D +L      ++ G    N+  T P     MD  T 
Sbjct  191   TIGVSHCDSFTNRIYNFPNTTDGIDPALSKAYAFLLKGICPPNSNQTFPTTTTFMDILTP  250

Query  470   YKMDSMFYKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRV  291
              K D+ +Y  L    GL +SD  L  D      V  F   +A +  KF  ++IKMG+I V
Sbjct  251   TKFDNRYYVGLTNNLGLFQSDAALLTDAALKATVNSFVRSEATFRLKFARAMIKMGQIGV  310

Query  290   LTGDEGEIRKKCRFVN  243
             L+G +GEIR  CR VN
Sbjct  311   LSGTQGEIRLNCRVVN  326



>ref|XP_008777086.1| PREDICTED: peroxidase 47-like [Phoenix dactylifera]
Length=321

 Score =   247 bits (630),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 125/299 (42%), Positives = 192/299 (64%), Gaps = 9/299 (3%)
 Frame = -1

Query  1124  MRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSGG  945
             + + +YG +CP  E IV+N + +A   DP +AA ++R+  HDC + GCDGSVL+D+T+  
Sbjct  27    LSMNYYGMSCPFVEPIVRNVVEQALRQDPTLAAGLLRMHFHDCFIQGCDGSVLIDSTNDN  86

Query  944   GRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEVP  765
                EK +P+N  ++RGFE+ID+ K+ +E  CPGVVSCADIL  +ARDA++ +G P +++P
Sbjct  87    -MAEKDSPAN-LSLRGFEIIDQAKQMIEYQCPGVVSCADILALAARDAVLFAGGPMYDIP  144

Query  764   GGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNFR  585
              GRRDG  S+  D   NL +P F    ++ +F   G DV++LVAL GAH++G A C++F+
Sbjct  145   KGRRDGRRSKIGDT-INLPAPIFNTTALIKMFGQHGFDVQELVALSGAHTLGAARCTSFK  203

Query  584   YRLNTPARAKEVDGSL-----KVVMGTHCRNAATTIPMDSTTQYKMDSMFYKQLLQKKGL  420
             +RL+      +VD +L     +++ GT  +    ++P+D TT    D+ ++  L +  GL
Sbjct  204   HRLSKFDSTHDVDPTLDPFLARMMSGTCSQGDNASMPLDWTTN-SFDNAYFYALQRGMGL  262

Query  419   LESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRFVN  243
             L SD+ L  DP+T   V  FA +QA +   F ++++KMG + V  GDEGEIR+ CR VN
Sbjct  263   LFSDQALFMDPQTKGFVNAFAMNQAMFFFTFQQAMVKMGLLDVKEGDEGEIRQNCRKVN  321



>gb|EMS48378.1| Peroxidase 2 [Triticum urartu]
Length=325

 Score =   247 bits (630),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 130/302 (43%), Positives = 185/302 (61%), Gaps = 9/302 (3%)
 Frame = -1

Query  1127  GMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSG  948
             G+ VG+Y +TCP  E IV++ + K  + + G+ A ++R+  HDC V GCDGSVLLD T  
Sbjct  25    GLEVGYYKKTCPRVEAIVRDEVKKFVYKNAGIGAGLIRMFFHDCFVQGCDGSVLLDPTPA  84

Query  947   GGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDAL-VLSGVP-EF  774
               + EK +P N  ++RGFE+ID  K+ +E++CPGVVSCADI+ F+ RDA   LS +  + 
Sbjct  85    NPQPEKLSPPNFPSLRGFEVIDAAKDAVEKACPGVVSCADIVAFAGRDAAHFLSKMKLKI  144

Query  773   EVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCS  594
              +P GR DG VS   +A  NL  P F +DQ+VA F +KGL  ED+V L GAH+IGV+HCS
Sbjct  145   NMPAGRLDGRVSNSTEALDNLPPPLFNLDQLVASFAAKGLSAEDMVVLSGAHTIGVSHCS  204

Query  593   NFRYRLNTPARAKEVDGSLKVVMGTHC-RNAAT----TIPMDSTTQYKMDSMFYKQLLQK  429
             +F    +  A   ++D      +   C  N +T    T+  D  T   +D+ +YK +L  
Sbjct  205   SFVS--DRIAVTSDIDAGFANFLRRRCPANPSTANDPTVNQDVVTPNALDNQYYKNVLAH  262

Query  428   KGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRF  249
             K L  SD  L   P T+ +V + A+    W  KF+++++KMG I V TG +GEIR+KCR 
Sbjct  263   KVLFTSDAALLTTPATIQMVRDSANIPGQWEAKFSKAMVKMGAIEVKTGKQGEIRRKCRV  322

Query  248   VN  243
             VN
Sbjct  323   VN  324



>gb|AFK49308.1| unknown [Medicago truncatula]
Length=377

 Score =   249 bits (635),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 129/316 (41%), Positives = 186/316 (59%), Gaps = 11/316 (3%)
 Frame = -1

Query  1157  RNAEAAETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCD  978
             +N +       ++ GFY  +CPTAE+IV + +V+    +P   A I+RLQ HDC V GCD
Sbjct  62    QNPKTGFDKGHLKQGFYSESCPTAEKIVADALVEITKTNPNAIANIIRLQFHDCFVVGCD  121

Query  977   GSVLLDATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDAL  798
              SVLLD T  G +VEK +  NG+ ++G + ID IK ++E+ CPG+VSC D + FS  + +
Sbjct  122   SSVLLDYTPTGDKVEKSSMLNGQLLKGTDFIDDIKAKLEEQCPGIVSCTDTIAFSVNEGM  181

Query  797   VLSGVPEFEVPGGRRDGNVSREPDAR-KNLASPDFTVDQMVALFKSKGLDVEDLVALLGA  621
              LSG+P     GGRRD   S    A   NL  P++ +++MV LF  KG  +E++V LLGA
Sbjct  182   FLSGLPRTAPLGGRRDALYSLASIAEDDNLPMPNWPMEKMVDLFTKKGFTIEEMVILLGA  241

Query  620   HSIGVAHCSNFRYRLNTPARAKEVDGSLKVVMGTH----CRNAATTIPMDSTTQYK----  465
             HSIGVAHC  F  R+   A   + D  L   +       C N  T +  +    +     
Sbjct  242   HSIGVAHCDVFMERIYNYADTGKPDPLLPFPIVNELQQICANPGTPLFRNPVVNFDETPA  301

Query  464   -MDSMFYKQLL-QKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRV  291
              +D++F+K ++ +KK LL +D  L  DPRT+P+VEE A D   +  KF E+++KMG   V
Sbjct  302   LLDNLFFKNMVTKKKTLLVTDAHLFNDPRTIPIVEELAKDNGLFQKKFAEAMVKMGSYNV  361

Query  290   LTGDEGEIRKKCRFVN  243
             +TG++GE+RK CR  N
Sbjct  362   ITGNDGEVRKTCRSTN  377



>ref|XP_009400935.1| PREDICTED: peroxidase 5 {ECO:0000250|UniProtKB:P22195}-like [Musa 
acuminata subsp. malaccensis]
Length=329

 Score =   247 bits (630),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 129/306 (42%), Positives = 184/306 (60%), Gaps = 11/306 (4%)
 Frame = -1

Query  1130  AGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATS  951
             A ++VGFY  TCP AE I+ + + +A   + G+AA +VR+  HDC V GCDGSVL+D++S
Sbjct  25    AQLQVGFYKSTCPQAESIIASEVRRALSSNIGLAAGLVRMHFHDCFVRGCDGSVLIDSSS  84

Query  950   GGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFE  771
                  EK +  N  ++RGFE+ID  K  +E +C GVVSCADIL  +ARD++V++G   ++
Sbjct  85    NN-TAEKDSFINNPSLRGFEVIDNAKTRLEAACQGVVSCADILALAARDSVVMTGGVMYQ  143

Query  770   VPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSN  591
             VP GRRDG VS   +   +L  P F VDQ+   F SKGL  +++V L GAH+IG +HC+ 
Sbjct  144   VPAGRRDGRVSLVSEVLASLPGPTFDVDQLTRSFTSKGLTQDEMVTLSGAHTIGRSHCAA  203

Query  590   FRYRL----NTPARAKEVDGSLKVVMGTHCRNAATTIP----MDSTTQYKMDSMFYKQLL  435
             F  RL    +T      +D +    +   C   +        MD  + Y +D+ +Y  LL
Sbjct  204   FSSRLFDFNSTDGHDPSLDSAYASQLKQQCPQGSNDTSLVAFMDPRSPYTLDTAYYANLL  263

Query  434   QKKGLLESDERLAGDPRTLPLVEE--FADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRK  261
             Q +GL  SD+ LA D  T  LV++   A    AW  KF  +++KMG+I VLTG +GEIR 
Sbjct  264   QNRGLFASDQALATDSTTAGLVKQNAAAGGGIAWKRKFAAAMVKMGQIDVLTGSDGEIRS  323

Query  260   KCRFVN  243
             +CR +N
Sbjct  324   RCRVIN  329



>ref|XP_002443747.1| hypothetical protein SORBIDRAFT_07g001280 [Sorghum bicolor]
 gb|EES13242.1| hypothetical protein SORBIDRAFT_07g001280 [Sorghum bicolor]
Length=319

 Score =   246 bits (629),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 127/298 (43%), Positives = 183/298 (61%), Gaps = 8/298 (3%)
 Frame = -1

Query  1130  AGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATS  951
             A + + +Y  +CP AE +V++ +  A   DP +A +++RL  HDC V GCD SVL+D+T 
Sbjct  27    AALSMDYYSMSCPFAEMMVRSVVYDALAKDPTLAGSLLRLHFHDCFVQGCDASVLIDSTD  86

Query  950   GGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFE  771
             G    EK A +N K++RGFE+IDRIKE +E  CPGVVSCAD+L  +ARDA++L+  P + 
Sbjct  87    GN-TAEKDAQAN-KSLRGFEVIDRIKEVLESQCPGVVSCADVLALAARDAVLLARGPYYG  144

Query  770   VPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSN  591
             VP GRRDG  S + D    L  P F    ++ LF S G  V+DLVAL G H++G+AHC N
Sbjct  145   VPLGRRDGTRSVDSDTFTALPPPFFNTTSLIKLFGSHGFTVQDLVALSGGHTLGIAHCGN  204

Query  590   FRYRLNTPARAKEVDGSLKVVMGTHCRNAAT--TIPMDSTTQYKMDSMFYKQLLQKKGLL  417
             F+ RL   A    +D +L   +G  C         P D T+  + D+++Y++L  ++GLL
Sbjct  205   FKARL---AETDTLDAALGSSLGATCAANGDDGAAPFDRTST-RFDTVYYRELQMRRGLL  260

Query  416   ESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRFVN  243
              SD+ L   P T  +V  FA +QA +   F + ++KMG++ +  GDEGEIR  C  +N
Sbjct  261   SSDQTLFESPETKGIVNMFAMNQAYFFYAFQQGMLKMGQLDLKEGDEGEIRHTCGVIN  318



>ref|XP_003589739.1| Peroxidase [Medicago truncatula]
 gb|AES59990.1| cationic peroxidase [Medicago truncatula]
Length=332

 Score =   247 bits (630),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 128/303 (42%), Positives = 185/303 (61%), Gaps = 10/303 (3%)
 Frame = -1

Query  1121  RVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSGGG  942
             +VGFY  +CP+AE IV++ + KA   +PG+ A ++R+  HDC V GCD SVLL +T G  
Sbjct  30    QVGFYSYSCPSAEAIVRSAIDKAVSLNPGIGAGLIRMHFHDCFVRGCDASVLLASTPGNP  89

Query  941   RVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALV-LS-GVPEFEV  768
               EK    N  ++ GFE+ID  K ++E  CP  VSCADILTF+ RD+++ LS G   ++V
Sbjct  90    IAEKDNFINNPSLHGFEVIDEAKAQLEVVCPQTVSCADILTFATRDSILKLSGGTINYDV  149

Query  767   PGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNF  588
             P GRRDG VS   +  KN+ SP    DQ++A F  KGL ++++V L GAHSIGV+HCS+F
Sbjct  150   PSGRRDGRVSISDEVPKNIPSPFLNADQLIANFAQKGLSIDEMVTLSGAHSIGVSHCSSF  209

Query  587   RYRL----NTPARAKEVDGSLKVVMGTHC----RNAATTIPMDSTTQYKMDSMFYKQLLQ  432
               RL    +T ++   +D S    + T C     N    + +D  T  ++D+++Y+ L+ 
Sbjct  210   SNRLYSFSDTISQDPSMDPSFAESLKTKCPPPPSNTNPIVMLDVATPNRLDNLYYEGLIN  269

Query  431   KKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCR  252
              +GLL SD+ L     T   V   A+  + W  KF ++++ MG I VL+G +GEIRK C 
Sbjct  270   HRGLLTSDQTLLSSQSTQESVLSNANYGSNWATKFAQAMVHMGSIDVLSGYDGEIRKHCS  329

Query  251   FVN  243
             FVN
Sbjct  330   FVN  332



>gb|KFK31897.1| hypothetical protein AALP_AA6G173300 [Arabis alpina]
Length=326

 Score =   246 bits (629),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 127/305 (42%), Positives = 186/305 (61%), Gaps = 10/305 (3%)
 Frame = -1

Query  1130  AGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATS  951
             A +++GFY +TCP AE+IV++ + +   + P +AA ++R+  HDC V GCDGS+L++ATS
Sbjct  23    AQLKMGFYDKTCPNAEKIVQSVVNQHIQNVPSLAAGLIRMHFHDCFVRGCDGSILINATS  82

Query  950   GGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFE  771
                +VEK AP N  TVRGF+ ID +K  +E  CPG+VSCADI+T + RD++   G P + 
Sbjct  83    RNQQVEKVAPPN-LTVRGFDFIDLVKFVLESKCPGIVSCADIITLATRDSIAAIGGPTWS  141

Query  770   VPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSN  591
             VP GRRDG +S   +AR N+  P      ++ LF ++GLDV+DLV L GAH+IGV+HCS+
Sbjct  142   VPTGRRDGRISNATEARNNIPPPFGNFTTLITLFGNQGLDVKDLVLLSGAHTIGVSHCSS  201

Query  590   FRYRL--------NTPARAKEVDGSLKVVMGTHCRNAATTIPMDSTTQYKMDSMFYKQLL  435
             F  RL          P+   E   +LK        +  T + MD  ++   D  ++K +L
Sbjct  202   FSNRLFNFTGVGDQDPSLDSEYAANLKTRRCLSLADNTTKVEMDPGSRNTFDLSYFKLVL  261

Query  434   QKKGLLESDERLAGDPRTLPLVEEFA-DDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKK  258
             +++GL ESD  L  +   L  V  FA   +  +  +F +S+ KMG+I V TG +GEIR+ 
Sbjct  262   KRRGLFESDAALTMNSEALSQVRRFARGSEQDFFAEFAKSMEKMGRIGVQTGSDGEIRRT  321

Query  257   CRFVN  243
             C  VN
Sbjct  322   CSVVN  326



>ref|XP_009615897.1| PREDICTED: peroxidase 47 [Nicotiana tomentosiformis]
Length=317

 Score =   246 bits (629),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 122/299 (41%), Positives = 183/299 (61%), Gaps = 6/299 (2%)
 Frame = -1

Query  1127  GMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSG  948
             G+R+ +Y  +CP AE IVKN + +    DP +AAA+VR+  HDC + GCD SVL+D+T G
Sbjct  21    GLRMEYYMMSCPFAEGIVKNTVNRHLQADPTLAAALVRMHFHDCFIQGCDASVLIDSTKG  80

Query  947   GGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEV  768
             G   EK +P+N  ++RG+E+ID  KEE+E  CPGVVSCADIL  +ARDA+  +G P +++
Sbjct  81    GNTAEKDSPAN-LSLRGYEIIDEAKEELEDQCPGVVSCADILAMAARDAVFFAGGPVYDI  139

Query  767   PGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNF  588
             P GR+DG  SR  D   NL SP     +++ +F   G   +++VAL GAH++GVA CS+F
Sbjct  140   PKGRKDGTRSRIEDT-INLPSPTLNSSELIRIFAQYGFSAQEMVALSGAHTLGVARCSSF  198

Query  587   RYRLNTPARAKEVDGSLKV----VMGTHCRNAATTIPMDSTTQYKMDSMFYKQLLQKKGL  420
             ++RL+      ++D +L       +   C     +     TT+   D+ +Y  L +K G+
Sbjct  199   KHRLSNFDSTHDMDPTLDAQFAKTLSKTCGGGDKSEQTFDTTKNDFDNDYYNALQRKSGV  258

Query  419   LESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRFVN  243
             L SD+ L   PRT  +V  +A +QA +   F ++++KMG + V  G  GE+R  CR +N
Sbjct  259   LFSDQTLYNSPRTRGIVNGYAFNQAMFFLDFQQAMLKMGLLDVKQGSNGEVRTNCRIIN  317



>ref|XP_008379618.1| PREDICTED: peroxidase 3 [Malus domestica]
Length=326

 Score =   246 bits (629),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 129/305 (42%), Positives = 183/305 (60%), Gaps = 11/305 (4%)
 Frame = -1

Query  1130  AGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATS  951
             A +++GFY + CP AE+IVK+++ K  H+ P +AAA++RL  HDC V GCD SVLL++TS
Sbjct  23    AQLQLGFYSKNCPKAEKIVKDYIEKHIHNAPSLAAALIRLHFHDCFVRGCDASVLLNSTS  82

Query  950   GGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFE  771
                + EK AP N  TVRGF+ IDRIK  +E  CPGVVSCAD++  +ARD++V +G P ++
Sbjct  83    SN-QAEKDAPPN-LTVRGFDFIDRIKSRLEAQCPGVVSCADVIALAARDSIVATGGPTWK  140

Query  770   VPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSN  591
             VP GRRDG ++R  +A  N+  P      +   F + GLD++DLV L GAH+IGV+HC +
Sbjct  141   VPTGRRDGVIARRAEALANIPPPFSNFSTLQRTFANVGLDLKDLVLLSGAHTIGVSHCPS  200

Query  590   FRYRLNTPARAKEVDGSLKVVMGTHCRNAATTIPMDSTTQYKMDS--------MFYKQLL  435
             F  RL       + D +L      + +      P D+TT  +MD          +Y  LL
Sbjct  201   FSNRLYNXTGVGDQDPALNAQYAANLKANKCKTPTDNTTIVEMDPGSVRTFDLSYYTLLL  260

Query  434   QKKGLLESDERLAGDPRTLPLVEEFADDQAA-WLGKFTESVIKMGKIRVLTGDEGEIRKK  258
             +++GL ESD  L     TL  + +        +  +F +S+ KMG+I V TG  GEIRK+
Sbjct  261   KRRGLFESDAALTSSSTTLNYINQLLKGSLQNFYDEFGKSMEKMGRINVKTGSAGEIRKQ  320

Query  257   CRFVN  243
             C  VN
Sbjct  321   CSVVN  325



>ref|XP_010918629.1| PREDICTED: peroxidase 44-like [Elaeis guineensis]
Length=323

 Score =   246 bits (629),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 134/305 (44%), Positives = 184/305 (60%), Gaps = 14/305 (5%)
 Frame = -1

Query  1124  MRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSGG  945
             +RVGFY  +CP AE IVK  + K F  DP +AA ++RL  HDC V GCD S+L+D+T   
Sbjct  19    LRVGFYNSSCPQAEPIVKAVVQKHFGTDPSIAAGLLRLYFHDCFVRGCDASILIDSTEKA  78

Query  944   GRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEVP  765
              R E+ A +N +++RG ++ID  K  +E  CP  VSCADI+  + RDA+VL+G   ++VP
Sbjct  79    -RSERFAGTN-RSLRGLDIIDEAKSNLEARCPSTVSCADIIALATRDAVVLAGGLGYDVP  136

Query  764   GGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNFR  585
              GRRDG  S   D R  +  P  T+ Q +  F  KGL V+D+V LLGAHSIGV HC  FR
Sbjct  137   TGRRDGLRSEVKDVR-GIPGPMDTIPQAIQDFARKGLTVKDMVVLLGAHSIGVTHCGGFR  195

Query  584   YRL-NTPARAK----EVDGSLKVVMGTHCRNAAT------TIPMDSTTQYKMDSMFYKQL  438
              RL  +P+  K     +D SL+  +   C N++       T+  D  T   +D+ FY +L
Sbjct  196   TRLLRSPSTGKFFGPTMDTSLRAKLQQACGNSSIQLENEPTVSFDQNTPMAIDNRFYSEL  255

Query  437   LQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKK  258
             L  +G+LE D+ LA D  T  +VE  A D   +L KF ++++K+G + VL G EGEIRKK
Sbjct  256   LHSRGVLEFDQMLALDNSTKGIVEHLASDNDGFLKKFADAMVKLGNVEVLVGSEGEIRKK  315

Query  257   CRFVN  243
             C   N
Sbjct  316   CNVFN  320



>ref|XP_006412001.1| hypothetical protein EUTSA_v10025683mg [Eutrema salsugineum]
 gb|ESQ53454.1| hypothetical protein EUTSA_v10025683mg [Eutrema salsugineum]
Length=330

 Score =   247 bits (630),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 128/299 (43%), Positives = 193/299 (65%), Gaps = 9/299 (3%)
 Frame = -1

Query  1115  GFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSGGGRV  936
             GFY R+CP AEEIV++ + KA   +  +AA+++RL  HDC V GCDGS+LLD +SGG   
Sbjct  32    GFYARSCPQAEEIVRSVVAKAVARETRMAASLLRLHFHDCFVQGCDGSLLLD-SSGGIVS  90

Query  935   EKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEVPGGR  756
             EK +  N K+ RGFE++D+IK ++E+ CPG+VSCAD+LT +ARD+ V+SG P + VP GR
Sbjct  91    EKSSNPNSKSARGFEVVDQIKAQLEKECPGIVSCADVLTLAARDSTVISGGPSWVVPLGR  150

Query  755   RDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNFRYRL  576
             RD   +    +  N+ +P+ T   +++ F  +GLDV DLVAL G+H+IG + C++FR RL
Sbjct  151   RDSRSASLSGSNNNIPAPNNTFQTILSRFNRQGLDVTDLVALSGSHTIGFSRCTSFRQRL  210

Query  575   ---NTPARAK-EVDGSLKVVMGTHC-RNAATTI--PMDSTTQYKMDSMFYKQLLQKKGLL  417
                N   R    ++ S    +   C R+    I   +D  +  + D+ +++ L+Q  GLL
Sbjct  211   YNQNGDGRPDMTLEQSFAANLRQRCPRSGGDQILSKLDMVSAARFDNSYFRNLVQNMGLL  270

Query  416   ESDERL-AGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRFVN  243
              SD+ L + + ++  LV+++A+DQ  +  +F +S+IKMG I  LTG  GEIRK CR +N
Sbjct  271   NSDQVLFSSNDQSRELVKKYAEDQGEFFRQFAQSMIKMGNISPLTGSSGEIRKNCRKIN  329



>ref|XP_010055033.1| PREDICTED: peroxidase 57-like [Eucalyptus grandis]
 gb|KCW89935.1| hypothetical protein EUGRSUZ_A02147 [Eucalyptus grandis]
Length=322

 Score =   246 bits (629),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 126/303 (42%), Positives = 188/303 (62%), Gaps = 11/303 (4%)
 Frame = -1

Query  1130  AGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATS  951
             A +RVGFY  TCP AE IV+  + K F  D  + AA++R+  HDC V GC+ S+L+D+T+
Sbjct  21    ADLRVGFYNSTCPQAESIVRQVIQKRFGADRSITAALLRMHFHDCFVRGCEASILIDSTA  80

Query  950   GGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFE  771
                  +   P+   +VRG+++ID  K+ +E +CP  VSCADI+T + RD++ L+G P + 
Sbjct  81    KKPSEKTAGPN--FSVRGYDIIDEAKKSLEAACPSTVSCADIITLATRDSVFLAGGPSYN  138

Query  770   VPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSN  591
             VP GRRDG VS  PD   +L +P  +V + +  F +KG  + ++V LLG HS+GVAHC  
Sbjct  139   VPTGRRDGLVS-NPD-EVDLPAPSLSVSEALQAFTAKGFTLTEMVTLLGGHSVGVAHCGL  196

Query  590   FRYRLN----TPARAKEVDGSLKVVMGTHCRNAATTIP---MDSTTQYKMDSMFYKQLLQ  432
             F  RL+    T A    +D SL   +   C N+ +  P   +D +T + MD+ FYKQ++Q
Sbjct  197   FEDRLSNFQGTGAPDPTMDSSLVAKLKGICGNSTSNDPTAFLDQSTSFIMDNQFYKQIMQ  256

Query  431   KKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCR  252
             KKG+L+ D+ LA D  +  +V  FA D  ++   F  +++KMG ++VLTG+ GEIR+ CR
Sbjct  257   KKGVLQIDQELAVDKSSAGIVSRFASDVNSFKTSFASAMVKMGNVQVLTGNAGEIRRNCR  316

Query  251   FVN  243
               N
Sbjct  317   AFN  319



>ref|XP_002272663.1| PREDICTED: peroxidase 5 [Vitis vinifera]
 emb|CBI23372.3| unnamed protein product [Vitis vinifera]
Length=360

 Score =   248 bits (632),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 123/303 (41%), Positives = 183/303 (60%), Gaps = 13/303 (4%)
 Frame = -1

Query  1112  FYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSGGGRVE  933
             FY  TCP AE I+   +  A    PG+AA ++RL  HDC V GCD S+LLD T  G  VE
Sbjct  58    FYRNTCPQAENIIAKSVYDAVLVQPGLAAGLIRLHFHDCFVNGCDASILLDTTPSGEPVE  117

Query  932   KQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEVPGGRR  753
             K + +N    + F+ IDR+K ++E+ CPGVVSCADIL ++ R+A+   G+P + VPGGRR
Sbjct  118   KTSRANVFASQIFKYIDRLKADIERECPGVVSCADILAYATREAVKEEGLPYYLVPGGRR  177

Query  752   DGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNFRYRL-  576
             DG  S   +   N+ SP+ ++  M  +F +KGL +ED+V L GAHSIG   C +   RL 
Sbjct  178   DGLSSSASNVAGNIPSPNESLKNMTQIFLTKGLSIEDMVVLFGAHSIGHTRCRSLFKRLY  237

Query  575   ---NTPARAKEVDGSLKVVMGTHCRNAA---------TTIPMDSTTQYKMDSMFYKQLLQ  432
                +T A+   +D +  + +   C  A            +P++  T  ++D+++Y QLL+
Sbjct  238   NYSSTQAQDPSMDFAHSLYLKGLCPKAGPLLQEVIDKVMVPLEPITPSRLDTLYYTQLLK  297

Query  431   KKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCR  252
              +G+L+SD+ L  +P T  +V+ F+ +   W  +FT ++I +GK+ VLTG EGEIR+ CR
Sbjct  298   GEGVLQSDQALTNNPTTNEIVKRFSQNPLEWGARFTNAMINLGKVDVLTGQEGEIRRNCR  357

Query  251   FVN  243
              VN
Sbjct  358   AVN  360



>ref|XP_006574525.1| PREDICTED: peroxidase 5-like [Glycine max]
Length=331

 Score =   246 bits (629),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 126/298 (42%), Positives = 185/298 (62%), Gaps = 7/298 (2%)
 Frame = -1

Query  1121  RVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSGGG  942
             +V FY  TCP+AE IV+  + KA   +PG+AA ++R+  HDC V GCDGSVLL++T+G  
Sbjct  36    KVDFYKTTCPSAEAIVRRAVNKAVSLNPGIAAGLIRMHFHDCFVRGCDGSVLLESTAGNP  95

Query  941   RVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEVPG  762
               E++ P+N  ++RGFE+ID  K ++E  CP  VSC+DIL F+ARD+    G   + VP 
Sbjct  96    S-EREHPANNPSLRGFEVIDEAKAQIEAECPHTVSCSDILAFAARDSTNRVGGINYVVPA  154

Query  761   GRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNFRY  582
             GRRDG VS   +A + L  P F   Q+++ F+ KGL  +++V L GAHSIGV+HCS+F  
Sbjct  155   GRRDGRVSIRDEASQ-LPRPTFNTQQLISNFEQKGLSADEMVTLSGAHSIGVSHCSSFSD  213

Query  581   RLN----TPARAKEVDGSLKVVMGTHC-RNAATTIPMDSTTQYKMDSMFYKQLLQKKGLL  417
             RL     T  +   +D      + T C   +  T+ +D++T  ++D+ +Y  L  ++GLL
Sbjct  214   RLYSFNATFPQDPSMDPKFATSLKTKCLPRSDNTVVLDASTPNRLDNNYYALLKNQRGLL  273

Query  416   ESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRFVN  243
              SD+ L   P T P+V   A   + W  KF ++++ MG I+VLTG +GEIR +C  VN
Sbjct  274   TSDQTLLTSPSTRPMVLTNAKHGSKWARKFAKAMVHMGSIQVLTGSQGEIRTRCSVVN  331



>emb|CDP12791.1| unnamed protein product [Coffea canephora]
Length=677

 Score =   256 bits (654),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 129/306 (42%), Positives = 185/306 (60%), Gaps = 10/306 (3%)
 Frame = -1

Query  1133  TAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDAT  954
              A ++VGFY   C   E ++K  +  AF  D GVAA +VR+  HDC V GCDGSVL+D+T
Sbjct  372   NAQLQVGFYNGVCDFVESMIKEEVRDAFILDRGVAAGLVRMHFHDCFVRGCDGSVLIDST  431

Query  953   SGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEF  774
                 + EK AP+N  ++RGFE+ID  K  +E  CPG+VSCADIL ++ARD++ ++G P +
Sbjct  432   PSN-QAEKDAPANNPSLRGFEVIDDAKSRLEFLCPGIVSCADILAYAARDSVEITGGPGY  490

Query  773   EVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCS  594
             +VP GRRDG +S   +A  NL SP   V+Q++  F +KGL  +++V L GAH+IG +HC 
Sbjct  491   DVPAGRRDGRISSSREASANLPSPALGVNQLIQAFANKGLRPDEMVTLSGAHTIGRSHCI  550

Query  593   NFRYRL----NTPARAKEVDGSLKVVMGTHC-----RNAATTIPMDSTTQYKMDSMFYKQ  441
             +F  RL     T  +   +D S    +   C      N    +PMD +T   MD+ +Y  
Sbjct  551   SFSNRLFNFNTTTTQDPSMDPSYAAQLAQQCPQGSISNPNLVVPMDPSTPTVMDTCYYDN  610

Query  440   LLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRK  261
             +L  +GL  SD+ L  +P T   V + A +   W  KF +++++MG+I VLTGD GEIR 
Sbjct  611   ILANRGLFTSDQTLLTNPSTANQVIQNAQNPLLWENKFADAMVRMGQIGVLTGDAGEIRA  670

Query  260   KCRFVN  243
              CR +N
Sbjct  671   NCRVIN  676


 Score =   219 bits (559),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 114/309 (37%), Positives = 180/309 (58%), Gaps = 14/309 (5%)
 Frame = -1

Query  1145  AAETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVL  966
             +++  A + VGFY   CP  E I+   ++KAF  D G+A  +VR   HDC V GCDGS+ 
Sbjct  15    SSQIKAQLVVGFYNSRCPRTESIIGEEVLKAFLKDKGIAPGLVRAHFHDCFVRGCDGSLF  74

Query  965   LDATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSG  786
             +D+T      EK  P NG T+RG E++D  K  +E  C GVVSCADIL ++ARD++V++G
Sbjct  75    IDSTPTN-VAEKDGPPNGITLRGLEVVDNAKARLEAECKGVVSCADILAYAARDSVVITG  133

Query  785   VPEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGV  606
                + VP GRRDG +SR  +   ++  P   +DQ+   F  K + +++++AL GAH+IG 
Sbjct  134   GRGWGVPAGRRDGRISRAAET-IDIPGPFQNLDQITQAFAKKNMTLDEMIALSGAHTIGR  192

Query  605   AHCSNFRYRLN--TPARAKE--VDGSLKVVMGTHCRNAAT-------TIPMDSTTQYKMD  459
             +HC++F  RL   +PA +++  +D  L  ++   C             +PM+ +     +
Sbjct  193   SHCTSFSNRLYDFSPANSQDPSLDRFLAALLKIQCPQGPQGDVDPNLVVPMNRSPAL-FE  251

Query  458   SMFYKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGD  279
             + +Y+ +L  + +L SD+ L   P +L  V E+A ++  W   F ++++KM +I VLTG 
Sbjct  252   NSYYRDILAHRVVLTSDQTLITSPESLSEVREYAFNEREWQEDFADAMVKMSQIEVLTGT  311

Query  278   EGEIRKKCR  252
              GEIR  CR
Sbjct  312   AGEIRSNCR  320



>ref|XP_010550539.1| PREDICTED: peroxidase 57-like [Tarenaya hassleriana]
Length=402

 Score =   249 bits (635),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 129/302 (43%), Positives = 181/302 (60%), Gaps = 9/302 (3%)
 Frame = -1

Query  1133  TAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDAT  954
             +A +R GFY   CP AE+IV+  + K F  D  + AA++R+  HDC V GCD S+L+D+T
Sbjct  19    SADLRTGFYDSACPNAEKIVRQVVEKRFATDKSIPAALLRMHFHDCFVRGCDASILIDST  78

Query  953   SGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEF  774
                   +   P+  ++VRGFELID  K  +E  CP  VSCADI+T + RDA+ L+G P +
Sbjct  79    KSKPSEKTAGPN--QSVRGFELIDEAKNLLEAQCPSTVSCADIITLATRDAVALAGGPSY  136

Query  773   EVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCS  594
              VP GRRDG VS+  D   NL  P F+V   +  FKSK LD+ D+  LLGAH++G+AHCS
Sbjct  137   PVPTGRRDGLVSKSNDV--NLPGPTFSVSMALQSFKSKNLDLNDMTTLLGAHTVGIAHCS  194

Query  593   NFRYRLN----TPARAKEVDGSLKVVMGTHC-RNAATTIPMDSTTQYKMDSMFYKQLLQK  429
              F  RL+    T      +D +L   + + C +    T  +D  T +  D+ FY Q+  K
Sbjct  195   LFSDRLSDFQGTGKPDPSMDPALVSNLSSICSKTNDPTAFLDQNTSFAFDNQFYVQIQAK  254

Query  428   KGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRF  249
             +G+L+ D+ LA D  T  +V  FA +  A+  +F E+++KMG I VL G+ GEIRK CR 
Sbjct  255   RGILQLDQELASDGSTRGIVSGFASNNEAFKKRFAEAMVKMGSIEVLLGNAGEIRKNCRV  314

Query  248   VN  243
              N
Sbjct  315   FN  316



>ref|XP_002272800.1| PREDICTED: peroxidase 5 [Vitis vinifera]
 emb|CBI37010.3| unnamed protein product [Vitis vinifera]
Length=339

 Score =   246 bits (629),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 125/305 (41%), Positives = 187/305 (61%), Gaps = 9/305 (3%)
 Frame = -1

Query  1133  TAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDAT  954
             ++ ++VGFYG TCP+AE +V+  + KA   + G+AA ++R+  HDC V GCD SVLLD+T
Sbjct  36    SSSLKVGFYGSTCPSAEAVVRKTVDKAVSRNLGIAAGLIRMHFHDCFVRGCDASVLLDST  95

Query  953   SGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEF  774
              G    EK+ P+N  ++RGF++I++ K ++E  CP  VSCADI+ F+ARD  +  G   +
Sbjct  96    PGN-LSEKEHPANNPSLRGFQVINKAKAKLEALCPETVSCADIIAFAARDGALKVGGINY  154

Query  773   EVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCS  594
              VPGGRRDG VSR+ +  ++L  P F  +Q+   F  KGL ++++V L GAHSIG++HCS
Sbjct  155   TVPGGRRDGRVSRKDEVAESLPPPHFNAEQLELRFARKGLSLDEMVTLSGAHSIGMSHCS  214

Query  593   NFRYRL---NTPARAKEVDGSLKVVMGTHC---RNAAT--TIPMDSTTQYKMDSMFYKQL  438
             +F  RL    T A    +       + T C   RN     T+P+++ T  ++D+ +YK+L
Sbjct  215   SFSKRLYSNGTHAHDPSMRRKYVSFLRTKCHPQRNGGQNPTVPLEAKTPGRLDNKYYKEL  274

Query  437   LQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKK  258
              + +GLL SD+ L     T  +V   A   + W  KF  +++ MG I VLT  +GEIR+ 
Sbjct  275   EKHRGLLNSDQTLMSSQSTAWMVRNNARHGSTWAAKFAAAMVHMGSIDVLTETQGEIRRS  334

Query  257   CRFVN  243
             C  VN
Sbjct  335   CHVVN  339



>ref|XP_004151878.1| PREDICTED: peroxidase 39-like [Cucumis sativus]
 ref|XP_004158555.1| PREDICTED: peroxidase 39-like [Cucumis sativus]
Length=326

 Score =   246 bits (628),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 128/306 (42%), Positives = 186/306 (61%), Gaps = 10/306 (3%)
 Frame = -1

Query  1136  TTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDA  957
             T A +++GFY ++CP AE+IV + + +  H+ P +AA  +R+  HDC V GCD SVL+++
Sbjct  22    TQAQLKLGFYAKSCPHAEKIVLDFVHQHIHNAPSLAATFIRMHFHDCFVRGCDASVLINS  81

Query  956   TSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPE  777
             TS        AP+  +T+RGF+ IDR+K  +E  CPGVVSCAD+L+  ARD +V +G P 
Sbjct  82    TSNNQAERDSAPN--QTLRGFDFIDRVKSLLEDECPGVVSCADVLSLIARDTIVATGGPY  139

Query  776   FEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHC  597
             +EVP GRRDG +SR  +A  N+  P   +  +  LF ++GLD++DLV L GAH+IG+AHC
Sbjct  140   WEVPTGRRDGVISRSREALNNIPPPFGNLSTLQRLFSNQGLDLKDLVLLSGAHTIGIAHC  199

Query  596   SNFRYRLNTPARAKEVDGSLKV-----VMGTHCR--NAATTIPMDSTTQYKMDSMFYKQL  438
              +F  RL       + D SL       +    CR   A   + MD  ++   D  +Y  L
Sbjct  200   QSFSNRLYNFTGVGDQDPSLDPRYAANLKANKCRTPTANNKVEMDPGSRNTFDLSYYSLL  259

Query  437   LQKKGLLESDERLAGDPRTLPLVEEFADDQ-AAWLGKFTESVIKMGKIRVLTGDEGEIRK  261
             L+++GL ESD  L  D  TL LV++  +     +  +F  S+ KMG+I+V TG EGEIR+
Sbjct  260   LKRRGLFESDAALTTDATTLGLVQKLVEGPIEEFFAEFAASMEKMGRIKVKTGTEGEIRR  319

Query  260   KCRFVN  243
             +C  VN
Sbjct  320   RCGVVN  325



>gb|KGN63270.1| hypothetical protein Csa_2G421020 [Cucumis sativus]
Length=328

 Score =   246 bits (628),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 128/306 (42%), Positives = 186/306 (61%), Gaps = 10/306 (3%)
 Frame = -1

Query  1136  TTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDA  957
             T A +++GFY ++CP AE+IV + + +  H+ P +AA  +R+  HDC V GCD SVL+++
Sbjct  24    TQAQLKLGFYAKSCPHAEKIVLDFVHQHIHNAPSLAATFIRMHFHDCFVRGCDASVLINS  83

Query  956   TSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPE  777
             TS        AP+  +T+RGF+ IDR+K  +E  CPGVVSCAD+L+  ARD +V +G P 
Sbjct  84    TSNNQAERDSAPN--QTLRGFDFIDRVKSLLEDECPGVVSCADVLSLIARDTIVATGGPY  141

Query  776   FEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHC  597
             +EVP GRRDG +SR  +A  N+  P   +  +  LF ++GLD++DLV L GAH+IG+AHC
Sbjct  142   WEVPTGRRDGVISRSREALNNIPPPFGNLSTLQRLFSNQGLDLKDLVLLSGAHTIGIAHC  201

Query  596   SNFRYRLNTPARAKEVDGSLKV-----VMGTHCR--NAATTIPMDSTTQYKMDSMFYKQL  438
              +F  RL       + D SL       +    CR   A   + MD  ++   D  +Y  L
Sbjct  202   QSFSNRLYNFTGVGDQDPSLDPRYAANLKANKCRTPTANNKVEMDPGSRNTFDLSYYSLL  261

Query  437   LQKKGLLESDERLAGDPRTLPLVEEFADDQ-AAWLGKFTESVIKMGKIRVLTGDEGEIRK  261
             L+++GL ESD  L  D  TL LV++  +     +  +F  S+ KMG+I+V TG EGEIR+
Sbjct  262   LKRRGLFESDAALTTDATTLGLVQKLVEGPIEEFFAEFAASMEKMGRIKVKTGTEGEIRR  321

Query  260   KCRFVN  243
             +C  VN
Sbjct  322   RCGVVN  327



>ref|XP_004493228.1| PREDICTED: peroxidase 44-like [Cicer arietinum]
Length=318

 Score =   246 bits (627),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 129/303 (43%), Positives = 183/303 (60%), Gaps = 12/303 (4%)
 Frame = -1

Query  1130  AGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATS  951
             A ++VGFY  +C  AE IV+  + K F+ D  + AA++R+  HDC V GCD S+L+D+T 
Sbjct  18    ADLQVGFYASSCRNAESIVQQVVQKRFNRDKSITAALLRMHFHDCFVRGCDASLLIDSTK  77

Query  950   GGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFE  771
                  EKQ  +N  +VRG++LID +KE +E +CP  VSCADI+  S RDA+ LSG P++ 
Sbjct  78    NTTS-EKQTGANA-SVRGYDLIDDVKEAIETACPSTVSCADIIALSTRDAVALSGGPKYN  135

Query  770   VPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSN  591
             VP GRRDG VS   D   +L  P   +  +   F  KG+  E++V LLGAH++GVAHC  
Sbjct  136   VPTGRRDGLVSDSNDV--DLPGPSIPISSLSQFFARKGITTEEMVTLLGAHTVGVAHCGF  193

Query  590   FRYRLNT------PARAKEVDGSL-KVVMGTHCRNAATTIPMDSTTQYKMDSMFYKQLLQ  432
             F  RL++      P     +D  L K+   T   N  +   +D  T + +D+ FYKQ+L 
Sbjct  194   FESRLSSFRGKPDPTMDPALDSKLVKLCKSTTGTNDPSAF-LDQNTSFIVDNEFYKQILV  252

Query  431   KKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCR  252
             K+G+++ D++LA D  T P V  FA +   ++  F  ++IKMGK+ VL G EGEIRK CR
Sbjct  253   KRGIMQIDQQLALDKSTSPFVSNFASNGDKFIKSFATAIIKMGKVGVLVGKEGEIRKNCR  312

Query  251   FVN  243
               N
Sbjct  313   IFN  315



>ref|XP_009771021.1| PREDICTED: peroxidase 9-like [Nicotiana sylvestris]
 gb|AAK52085.1| peroxidase [Nicotiana tabacum]
Length=329

 Score =   246 bits (628),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 131/304 (43%), Positives = 186/304 (61%), Gaps = 10/304 (3%)
 Frame = -1

Query  1127  GMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSG  948
             G+   FY  +CP A EIV + + +A   DP +AA+++RL  HDC V GCD S+LLD TS 
Sbjct  27    GLFPEFYQFSCPQANEIVMSVLEEAIAKDPRMAASLLRLHFHDCFVQGCDASILLDKTSA  86

Query  947   GGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEV  768
               + EK A  N  ++RGFE+ID+IK  +EQ CP  VSCADIL  +ARD+ VLSG P +EV
Sbjct  87    F-KSEKDAGPNKNSIRGFEVIDQIKARLEQVCPHTVSCADILALAARDSTVLSGGPHWEV  145

Query  767   PGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNF  588
             P GRRD  ++    A  N+ +P+ T+  ++ LF  +GL  +DLVAL GAH+IG+A C +F
Sbjct  146   PLGRRDSKIANLKKANTNIPAPNSTIQNLITLFARQGLSEQDLVALSGAHTIGMARCVSF  205

Query  587   RYRLNTPARAKEVDGSLKVVMGTHCRNAATTI-------PMDSTTQYKMDSMFYKQLLQK  429
             R RL         D +L+    T  + A   I       P+D T+  + D+ +++ LL  
Sbjct  206   RQRLYNQNGDNLPDATLEKTYYTGLKTACPRIGGDNNISPLDFTSPVRFDNTYFQLLLWG  265

Query  428   KGLLESDERLAGD--PRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKC  255
             KGLL SDE L      +T  LV+ +A+++A +   F +S++KMG I  LTG +G+IRK C
Sbjct  266   KGLLNSDEVLLTGKVKKTKELVKSYAENEALFFHHFAKSMVKMGNITPLTGFKGDIRKNC  325

Query  254   RFVN  243
             R +N
Sbjct  326   RRLN  329



>ref|XP_010906352.1| PREDICTED: peroxidase 5-like, partial [Elaeis guineensis]
Length=322

 Score =   246 bits (627),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 130/299 (43%), Positives = 184/299 (62%), Gaps = 4/299 (1%)
 Frame = -1

Query  1130  AGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATS  951
             A ++VG+Y   CP+AE IV+  + KA   +PG+ A ++R+  HDC V GCD SVLLD+T 
Sbjct  23    ASLKVGYYKHKCPSAETIVRQTVRKAMIHNPGIGAGLIRMHFHDCFVRGCDASVLLDSTP  82

Query  950   GGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFE  771
             G    EK++P+N  ++RGFE+ID  K  +E  CP  VSCADILTF++RDA   +G  ++ 
Sbjct  83    GNPS-EKESPANNPSLRGFEVIDEAKARIESVCPSTVSCADILTFASRDAAYFAGGIQYA  141

Query  770   VPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSN  591
             VP GRRDG VS E +   N+    F   Q+   F  KG  ++++V L GAHS GV+HCS+
Sbjct  142   VPAGRRDGRVSIESEVLDNVPPFFFNAVQLENSFARKGFTLDEMVTLSGAHSFGVSHCSS  201

Query  590   FRYRLNTPA-RAKEVDGSLKVVMGTHCRNAAT--TIPMDSTTQYKMDSMFYKQLLQKKGL  420
             F  RLNT A +  ++D      + + C  A +  T+ +D  T  ++D+ +YK L + +GL
Sbjct  202   FADRLNTTAPQDPKMDRKFAAFLKSKCSRAGSDPTVNLDVVTPNRLDNQYYKNLQKGRGL  261

Query  419   LESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRFVN  243
             L SD+ L     T  LV+  A    AW   F  +++KMG I VLTGD+GEIR+ CR VN
Sbjct  262   LTSDQTLQASALTSRLVDTNAKRPQAWAANFAAAMVKMGSIEVLTGDQGEIRRTCRAVN  320



>ref|XP_003567635.1| PREDICTED: peroxidase 1-like [Brachypodium distachyon]
Length=353

 Score =   247 bits (630),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 133/304 (44%), Positives = 185/304 (61%), Gaps = 8/304 (3%)
 Frame = -1

Query  1130  AGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATS  951
             A ++VGFY +TCP AE +V+  +  AF  + G+AA ++RL  HDC V GCD SVLL   S
Sbjct  30    AQLQVGFYEKTCPDAETLVRQAVAAAFAKNNGIAAGLIRLHFHDCFVRGCDASVLL--VS  87

Query  950   GGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFE  771
               G  E+ A  N  ++RGFE+ID  K  +E+SCP  VSCADI+ F+ARD++ L+G   ++
Sbjct  88    ANGMAERDAMPNKPSLRGFEVIDAAKAAVEKSCPLTVSCADIIAFAARDSINLTGQIVYQ  147

Query  770   VPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSN  591
             VP GRRDGN+S   DA +NL  P FT+ Q++ LF  K L  E++V L+GAH+IG + CS+
Sbjct  148   VPSGRRDGNISLMKDADENLPLPTFTLQQLIHLFAKKTLTAEEMVTLVGAHTIGRSFCSS  207

Query  590   FRYRL--NT-PARAKEVDGSLKVVMGTHC---RNAATTIPMDSTTQYKMDSMFYKQLLQK  429
             F  R+  NT P   + +      ++ + C    N +TT  +D +T   +D+ +YK L   
Sbjct  208   FLSRIWNNTNPIVDEGLSSGYAKLLRSLCPSTPNNSTTTVIDPSTPTVLDNNYYKLLPLN  267

Query  428   KGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRF  249
              GL  SD +L  +      V  FAD +A W  KF + +IKMG I VLTG +GEIR  C  
Sbjct  268   LGLFFSDNQLRTNAALNASVNTFADSEALWNEKFWKGMIKMGNIEVLTGTQGEIRLNCSV  327

Query  248   VN*I  237
             VN I
Sbjct  328   VNKI  331



>ref|XP_010069738.1| PREDICTED: peroxidase 5-like [Eucalyptus grandis]
Length=335

 Score =   246 bits (628),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 128/300 (43%), Positives = 182/300 (61%), Gaps = 9/300 (3%)
 Frame = -1

Query  1118  VGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSGGGR  939
             VGFY  TCP AE IV+  + +AF  DPG+AA  +R+  HDC V GCD S+LL++T G   
Sbjct  37    VGFYKYTCPPAEAIVRATLYEAFSSDPGLAADFLRMYFHDCFVRGCDASILLNSTKGN-T  95

Query  938   VEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEVPGG  759
              EK +P N  ++ GF++ID+ K  +E +CP  VSCADI+ F+ARD++  +G   ++VP G
Sbjct  96    AEKDSPVNNPSLEGFDVIDQAKARLEAACPRTVSCADIIAFAARDSVFKAGRIYYDVPSG  155

Query  758   RRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNFRYR  579
             RRDG +SR  +  +NL  P FTV Q++A F  KG  ++++V L GAHSIG +HCS+F  R
Sbjct  156   RRDGRISRASEVIQNLPPPTFTVPQLIANFARKGFSMDEMVTLSGAHSIGSSHCSSFSNR  215

Query  578   LN----TPARAKEVDGSLKVVMGTHCR--NAAT--TIPMDSTTQYKMDSMFYKQLLQKKG  423
             L     T  +   +D      + T C   N+ T   + +DS T   +D+ +Y+QLL  +G
Sbjct  216   LYSFNATHKQDPLLDPKYAAFLKTKCPQGNSKTDPKVALDSITPNTLDNKYYQQLLTYRG  275

Query  422   LLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRFVN  243
             L  SDE L     T  +V   A     W  KF ++++K+G + VLTG +GEIRK C  VN
Sbjct  276   LFSSDEALYTSKLTKGMVLNNAKYGRVWGPKFVKAMVKLGSLDVLTGQQGEIRKVCGAVN  335



>ref|XP_002309832.1| peroxidase precursor family protein [Populus trichocarpa]
 gb|EEE90282.1| peroxidase precursor family protein [Populus trichocarpa]
Length=327

 Score =   246 bits (627),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 127/308 (41%), Positives = 179/308 (58%), Gaps = 10/308 (3%)
 Frame = -1

Query  1139  ETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLD  960
              T A +++GFY  +CP AE I ++++ +  H+ P +AAAI+R+  HDC V GCD SVLL+
Sbjct  20    STEAQLQMGFYSSSCPNAERIAQDYVNRHIHNAPSLAAAIIRMHFHDCFVRGCDASVLLN  79

Query  959   ATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVP  780
              TS   + EK A  N  T+RGF+ ID++K  +E +CP VVSCADI+   ARDA+V +G P
Sbjct  80    TTSSNNQTEKVATPN-LTLRGFDFIDKVKSLLEAACPAVVSCADIVALVARDAVVATGGP  138

Query  779   EFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAH  600
              + VP GRRDG +SR  +A  N+  P      +  LF ++GLD++DLV L GAH+IG++H
Sbjct  139   FWRVPTGRRDGTISRSSEALNNIPPPTSNFTNLQRLFANQGLDLKDLVLLSGAHTIGISH  198

Query  599   CSNFRYRLNT--------PARAKEVDGSLKVVMGTHCRNAATTIPMDSTTQYKMDSMFYK  444
             CS+F  RL          PA   E   +LK        +  T + MD  +    D  +Y 
Sbjct  199   CSSFSNRLYNFTGVGDQDPALDSEYAANLKARKCRSLNDNTTIVEMDPGSFRTFDLSYYS  258

Query  443   QLLQKKGLLESDERLAGDPRTLPLVEEFADDQAA-WLGKFTESVIKMGKIRVLTGDEGEI  267
              LL+++GL +SD  L  +  TL  V +        +  +F  S+ KMG+I V TG  GEI
Sbjct  259   LLLKRRGLFQSDSALTTNSATLSFVNQLLQGPLQNFFAEFANSMEKMGRINVKTGTTGEI  318

Query  266   RKKCRFVN  243
             RK C  VN
Sbjct  319   RKHCAVVN  326



>ref|XP_008455840.1| PREDICTED: peroxidase 39-like [Cucumis melo]
Length=329

 Score =   246 bits (627),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 129/306 (42%), Positives = 188/306 (61%), Gaps = 10/306 (3%)
 Frame = -1

Query  1136  TTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDA  957
             T A +++GFY ++CP AE+IV + + +  H+ P +AA  +R+  HDC V GCD SVL+++
Sbjct  24    TQAQLKLGFYAKSCPKAEKIVLDFVHQHIHNAPSLAATFIRMHFHDCFVRGCDASVLINS  83

Query  956   TSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPE  777
             TS   + EK +  N +T+RGF+ IDR+K  +E  CPGVVSCAD+L+  ARD +V +G P 
Sbjct  84    TSNN-QAEKDSQPN-QTLRGFDFIDRVKSLLEDECPGVVSCADVLSLIARDTIVATGGPY  141

Query  776   FEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHC  597
             +EVP GRRDG +SR  +A  ++  P   +  +  LF ++GLD++DLV L GAH+IG+AHC
Sbjct  142   WEVPTGRRDGVISRSSEALNDIPPPFGNLSTLQRLFANQGLDLKDLVLLSGAHTIGIAHC  201

Query  596   SNFRYRLNTPARAKEVDGSLKV-----VMGTHCR--NAATTIPMDSTTQYKMDSMFYKQL  438
              +F  RL       + D SL       +    CR   A   + MD  ++   D  +Y  L
Sbjct  202   QSFSNRLYNFTGVGDQDPSLDPRYAANLKANKCRTPTANNKVEMDPGSRNTFDLSYYSLL  261

Query  437   LQKKGLLESDERLAGDPRTLPLVEEFADDQ-AAWLGKFTESVIKMGKIRVLTGDEGEIRK  261
             L+++GL ESD  L  D  TL LV++  +     +  +F  S+ KMG+I+V TG EGEIR+
Sbjct  262   LKRRGLFESDAALTTDATTLGLVQKLVEGPIEEFFAEFAASMEKMGRIKVKTGTEGEIRR  321

Query  260   KCRFVN  243
             KC  VN
Sbjct  322   KCAVVN  327



>ref|XP_010275557.1| PREDICTED: peroxidase 5-like [Nelumbo nucifera]
Length=329

 Score =   246 bits (627),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 131/311 (42%), Positives = 186/311 (60%), Gaps = 11/311 (4%)
 Frame = -1

Query  1145  AAETTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVL  966
             A   + G+   +Y  TCP AE ++   M K    D  V A ++R+  HDC V GCDGS+L
Sbjct  19    ATADSYGLSYDYYSETCPQAETLIAETMKKIVKKDVTVPARMIRMHFHDCFVRGCDGSIL  78

Query  965   LDATSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSG  786
             LD+T G  + EK AP N  +++GFE+ID++K  +E  CPGVVSCADIL ++AR+++ LSG
Sbjct  79    LDSTPGN-KAEKDAPPNNPSLKGFEVIDKLKAVLEHHCPGVVSCADILAYAARESVFLSG  137

Query  785   ---VPEFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHS  615
                V ++++ GGR+DG +S++ DA  NL  P   VD ++  + +KGL VEDLV L G H+
Sbjct  138   NGKVEQYKIRGGRKDGRISKDIDALNNLLPPTAEVDTLIQGYAAKGLSVEDLVTLSGGHT  197

Query  614   IGVAHCSNFRYRL----NTPARAKEVDGSLKVVMGTHCRNAATTIP---MDSTTQYKMDS  456
             +GV+HCS+   R     NT      +D  L  ++   CR++    P   MD  T   +D+
Sbjct  198   VGVSHCSSINGRQDNFKNTGRPDPTLDSHLASMLRGECRSSKGADPIVVMDRFTPLVLDN  257

Query  455   MFYKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDE  276
              +Y  L+Q KGL  SD+ L  +  T   V E A     W  KF  S+IKMG+I V TG++
Sbjct  258   KYYVGLVQNKGLFTSDQTLLTNELTRKEVMENAYYPGVWEKKFVASMIKMGEIEVKTGNQ  317

Query  275   GEIRKKCRFVN  243
             GE+RK CR VN
Sbjct  318   GEVRKVCRRVN  328



>ref|XP_008390088.1| PREDICTED: peroxidase 57-like [Malus domestica]
Length=339

 Score =   246 bits (627),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 131/307 (43%), Positives = 175/307 (57%), Gaps = 15/307 (5%)
 Frame = -1

Query  1127  GMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSG  948
             G+ VGFY R CP  E+IV + + KA   D  + A ++RL  HDC V GCD S+LLDAT  
Sbjct  36    GLHVGFYDRKCPNLEQIVTDVVAKAVERDQKLPAGLIRLFFHDCFVKGCDASILLDATPS  95

Query  947   GGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEV  768
                VE Q+P++G  +RG E+I+ IK  +EQ CP  VSCADIL F+ R+A+ LSG+P  +V
Sbjct  96    DEPVEMQSPASGG-IRGIEVIEEIKARLEQECPETVSCADILAFATREAVALSGLPRHQV  154

Query  767   PGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNF  588
             P GRRD   SR  D    L SP   +D+++  F  + L  E++V L GAHSIG  HC+ F
Sbjct  155   PAGRRDSRTSRASDVI--LPSPATPMDEIIDFFSRRNLTPEEMVVLFGAHSIGAVHCNFF  212

Query  587   RYRLNTPARAKEVDGSLKVVMGTHCRN---AATTIPMDS---------TTQYKMDSMFYK  444
              YRL   A     D SL  V          A  T+P +           T   +D+ +Y 
Sbjct  213   DYRLYNFAPGMPQDPSLNPVFAAELAQKCPAPNTLPAEEAKNRVVDLDATPLVLDNHYYT  272

Query  443   QLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIR  264
              L+Q + L++ D+ L  DPRT   V + A    +W  +F  ++IKMG+I VLTGD GEIR
Sbjct  273   NLMQGRALMQLDQALGTDPRTGAEVAKLAIRSDSWARQFVRAIIKMGRINVLTGDAGEIR  332

Query  263   KKCRFVN  243
             K CR  N
Sbjct  333   KNCRNFN  339



>ref|XP_004251979.1| PREDICTED: peroxidase 5-like [Solanum lycopersicum]
Length=354

 Score =   246 bits (628),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 124/302 (41%), Positives = 177/302 (59%), Gaps = 10/302 (3%)
 Frame = -1

Query  1118  VGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSGGGR  939
             +GFY ++CP AE I+K  + KA   +PG+AA I+R+  HDC + GCDGSVLLD+  G   
Sbjct  53    IGFYSKSCPQAEGIIKKAVFKAVLMNPGIAAGIIRMHFHDCFIRGCDGSVLLDSIPGKET  112

Query  938   VEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEVPGG  759
              EK +P N  ++RGF +ID  K  +E+ CP  VSCADIL ++ARD+    G  ++ VPGG
Sbjct  113   AEKDSPINNPSLRGFGVIDEAKVLLEKVCPHTVSCADILAYAARDSAFFVGGIKYAVPGG  172

Query  758   RRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNFRYR  579
             RRDG VS   +  +NL  P F   Q+   FK+KGL ++++V L GAHSIGV+HCS+F  R
Sbjct  173   RRDGRVSLSSEVIQNLPPPFFDAKQLEDNFKAKGLSLDEMVTLSGAHSIGVSHCSSFSNR  232

Query  578   LNTPARAKEVDGSLKVVMGTHCRNAA----------TTIPMDSTTQYKMDSMFYKQLLQK  429
             L         D SL     ++ ++              + +D ++   +D+ +Y  L   
Sbjct  233   LYGFNTTHPQDPSLDPRYASYLKHKCPRPMSDTQNDPIVNLDVSSPIYLDNKYYLNLRNH  292

Query  428   KGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKCRF  249
             KGLL SD+ L   P T  LV      ++ W  KF  +++ MG I +LTG++GEIRK C F
Sbjct  293   KGLLTSDQTLYQSPLTSKLVLNNIKFRSTWARKFANAMVHMGSIEILTGNKGEIRKNCHF  352

Query  248   VN  243
             +N
Sbjct  353   IN  354



>ref|XP_008776272.1| PREDICTED: peroxidase 5-like [Phoenix dactylifera]
Length=339

 Score =   246 bits (627),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 133/311 (43%), Positives = 184/311 (59%), Gaps = 14/311 (5%)
 Frame = -1

Query  1136  TTAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDA  957
             + A + VG+Y  TCP AE+IV+  +VKA   D G+AA ++RL  HDC V GCD SVLLD 
Sbjct  29    SLASLEVGYYRSTCPMAEKIVRRTVVKAVAGDHGLAAGLIRLYFHDCFVRGCDASVLLDP  88

Query  956   TSGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSA-RDALVLSGVP  780
                    EK +P N  ++RG+E+ID  K E+E  C   VSCADI+ F+A RD+  ++G  
Sbjct  89    LPNNPS-EKLSPVNNGSLRGYEVIDDAKAELEAYCSETVSCADIIAFAAARDSTFITGGF  147

Query  779   EFEVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAH  600
             ++ VP GRRDG VS + +  +NL  P F   Q++  F  KGL  +D+V L GAHSIGV+H
Sbjct  148   DYSVPSGRRDGVVSIDSEVVQNLPFPTFNAKQLIRNFARKGLSAKDMVTLSGAHSIGVSH  207

Query  599   CSNFR---YRLN-TPARAKEVDGSLKVVMGTHC--------RNAATTIPMDSTTQYKMDS  456
             CS+F    YR N T  +   ++  L   +   C           A T+P+D      +D 
Sbjct  208   CSSFDSRLYRFNATHPQDPSLNHHLATFLKARCLPPSKTVRTQPAPTVPLDIKAPNHLDV  267

Query  455   MFYKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDE  276
              +YK LL+ KGLL SD+ LA    TL LV + A + + W  +F  ++++MG + VL G+E
Sbjct  268   KYYKNLLKGKGLLTSDQTLASSRSTLRLVIDHARNPSKWNEEFAAAMVRMGNVDVLAGNE  327

Query  275   GEIRKKCRFVN  243
             GEIRK CR VN
Sbjct  328   GEIRKNCRVVN  338



>ref|XP_004968662.1| PREDICTED: peroxidase 1-like [Setaria italica]
Length=370

 Score =   246 bits (629),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 129/304 (42%), Positives = 180/304 (59%), Gaps = 12/304 (4%)
 Frame = -1

Query  1124  MRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATSGG  945
             ++VGFY  +CP AE +V+  +  AF +D G+AA ++RL  HDC V GCD SVLL  TS  
Sbjct  38    LQVGFYNTSCPNAESLVRQAVANAFANDSGIAAGLIRLHFHDCFVRGCDASVLL--TSPN  95

Query  944   GRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFEVP  765
                E+ A  N  ++RGF++ID  K  +EQSCP  VSCADI+ F+ARD++ L+G   ++VP
Sbjct  96    NTAERDAAPNNPSLRGFQVIDAAKAAVEQSCPRTVSCADIVAFAARDSINLTGNLPYQVP  155

Query  764   GGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSNFR  585
              GRRDGNVS   DA  NL  P F   Q+VA F +K L  E++V L GAH++G + C++F 
Sbjct  156   SGRRDGNVSTNTDAVNNLPQPTFNASQLVANFAAKNLTAEEMVILSGAHTVGRSFCTSFL  215

Query  584   YRL-NTPARAKEVDGSLK----VVMGTHC-RNAATTIP----MDSTTQYKMDSMFYKQLL  435
              R+ N    A  VD  L      ++   C  NA+++ P    +D +T   +D+ +YK L 
Sbjct  216   TRIYNQSTSAPIVDSGLSSGYAALLQALCPSNASSSTPTTTAVDPSTPAVLDNNYYKLLP  275

Query  434   QKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGEIRKKC  255
                GL  SD +L  +      V  FA ++  W  KF  ++IKMG I VLTG +G+IR  C
Sbjct  276   LNMGLFFSDNQLRVNSTLNASVNSFAANETLWKEKFVAAMIKMGSIEVLTGSQGQIRLNC  335

Query  254   RFVN  243
               VN
Sbjct  336   SIVN  339



>ref|XP_009342265.1| PREDICTED: peroxidase 3-like [Pyrus x bretschneideri]
Length=325

 Score =   245 bits (625),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 126/305 (41%), Positives = 185/305 (61%), Gaps = 12/305 (4%)
 Frame = -1

Query  1130  AGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDATS  951
             A +++GFY + CP AE+IVK+++ K  H+ P +AAA++RL  HDC V GCD SVLL++TS
Sbjct  23    AQLQLGFYAKNCPKAEKIVKDYVEKHIHNAPSLAAALLRLHFHDCFVRGCDASVLLNSTS  82

Query  950   GGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEFE  771
                + EK A  N  T+RGF+ IDRIK  +E  CPG+VSCAD++  +ARD++V +G P ++
Sbjct  83    SN-QAEKDASPN-LTLRGFDFIDRIKSRLEAQCPGIVSCADVVALAARDSIVATGGPTWK  140

Query  770   VPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCSN  591
             VP GRRDG ++R  +A  NL  P + V  +   F + GLD++DLV L GAH+IG++HC++
Sbjct  141   VPTGRRDGVIARAAEAVANLPQPTYNVSNLQRFFANVGLDLKDLVLLSGAHTIGISHCTS  200

Query  590   FRYRLNT--------PARAKEVDGSLKVVMGTHCRNAATTIPMDSTTQYKMDSMFYKQLL  435
             F  RL          PA   +    LK    T   N  T + MD  +    D  +Y  +L
Sbjct  201   FSNRLYNFTGVGDQDPALNTQYAAKLKAKCKTPTDN-TTIVEMDPGSFRTFDRSYYTHIL  259

Query  434   QKKGLLESDERLAGDPRTLPLVEEFADDQAA-WLGKFTESVIKMGKIRVLTGDEGEIRKK  258
             +++ L +SD  LA  P T   +++  +     +  +F +S+ KMG+  V TG  GEIRK+
Sbjct  260   KRRALFQSDAALATSPTTYNYIDQLLEGSLQNFYDEFGKSMEKMGRANVKTGSAGEIRKQ  319

Query  257   CRFVN  243
             C  VN
Sbjct  320   CSVVN  324



>ref|XP_009602319.1| PREDICTED: peroxidase 44-like [Nicotiana tomentosiformis]
Length=328

 Score =   245 bits (625),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 124/309 (40%), Positives = 192/309 (62%), Gaps = 14/309 (5%)
 Frame = -1

Query  1133  TAGMRVGFYGRTCPTAEEIVKNHMVKAFHDDPGVAAAIVRLQSHDCVVAGCDGSVLLDAT  954
             +A ++VGFY  +CP AE IVK+ + + F  D  +  A++RL  HDC V GCD S+L+D+ 
Sbjct  21    SAQLKVGFYSSSCPMAETIVKSVVKEKFKSDHSITGALLRLHFHDCGVRGCDASILIDSD  80

Query  953   SGGGRVEKQAPSNGKTVRGFELIDRIKEEMEQSCPGVVSCADILTFSARDALVLSGVPEF  774
                 +  ++  +   TVRG+ELID IK+++E +CP  VSCADI+T + RD + L+G P++
Sbjct  81    PTNNQTSEKDSNPNFTVRGYELIDEIKKKLEVNCPSTVSCADIITLATRDVVSLAGGPKY  140

Query  773   EVPGGRRDGNVSREPDARKNLASPDFTVDQMVALFKSKGLDVEDLVALLGAHSIGVAHCS  594
              +P GRRDG VS   +   +L  P+ +V +++A FK+ GL+  D+V LLGAH++GV HC 
Sbjct  141   TIPTGRRDGLVSNASEV--DLPGPNRSVPEILAFFKTLGLNKNDMVTLLGAHTVGVTHCF  198

Query  593   NFRYRLNTPARAKEVDGSLKVVMGTHC-RNAATTIP-----------MDSTTQYKMDSMF  450
              F+ R++     ++ D ++   + T   +   T+IP           +D  T + +D+ F
Sbjct  199   FFQSRVSNFRGTEKPDPTMDPELVTKLFKLCNTSIPPTTLDDVPTTFLDQNTSFVVDNQF  258

Query  449   YKQLLQKKGLLESDERLAGDPRTLPLVEEFADDQAAWLGKFTESVIKMGKIRVLTGDEGE  270
             YKQ+L KKG+L+ D+ LA D  + P+V  FA +  A+   F ++++KMG I VL GD+GE
Sbjct  259   YKQILLKKGVLKIDQELALDKLSAPIVSRFAANGNAFRQSFAKAMVKMGSINVLVGDDGE  318

Query  269   IRKKCRFVN  243
             IRK CR  N
Sbjct  319   IRKNCRVFN  327



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3488421182128