BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7567_g2_i1 len=455 path=[433:0-454]

Length=455
                                                                      Score     E

ref|XP_011036009.1|  PREDICTED: laccase-4-like                        96.3    3e-20   
ref|XP_002316233.1|  hypothetical protein POPTR_0010s20050g           96.3    3e-20   Populus trichocarpa [western balsam poplar]
ref|XP_004294236.1|  PREDICTED: laccase-4-like                        96.3    4e-20   
ref|XP_003616564.1|  Laccase                                          95.9    8e-20   
gb|EYU41257.1|  hypothetical protein MIMGU_mgv1a003880mg              94.7    1e-19   
gb|AES99522.2|  laccase/diphenol oxidase family protein               94.4    2e-19   
ref|XP_004490949.1|  PREDICTED: laccase-4-like                        94.4    2e-19   
emb|CAA74101.1|  laccase                                              92.8    2e-19   Populus trichocarpa [western balsam poplar]
ref|XP_004308920.1|  PREDICTED: laccase-22-like                       94.0    2e-19   
emb|CAC14718.1|  laccase                                              92.4    2e-19   Populus trichocarpa [western balsam poplar]
emb|CAA74103.1|  laccase                                              94.0    3e-19   Populus trichocarpa [western balsam poplar]
ref|XP_010044089.1|  PREDICTED: laccase-4-like                        94.0    3e-19   
emb|CAC14719.1|  laccase                                              94.0    3e-19   Populus trichocarpa [western balsam poplar]
ref|XP_010044090.1|  PREDICTED: laccase-4-like                        94.0    3e-19   
ref|XP_011084946.1|  PREDICTED: laccase-4-like                        93.6    4e-19   
gb|KHG22893.1|  Laccase-4 -like protein                               92.8    4e-19   
ref|XP_008220423.1|  PREDICTED: laccase-4                             93.6    4e-19   
ref|XP_007207096.1|  hypothetical protein PRUPE_ppa022440mg           93.2    4e-19   
ref|XP_002280416.1|  PREDICTED: laccase-4                             93.2    4e-19   Vitis vinifera
ref|XP_006435668.1|  hypothetical protein CICLE_v10031134mg           93.2    5e-19   
ref|XP_004500229.1|  PREDICTED: laccase-4-like                        93.2    5e-19   
ref|XP_008358974.1|  PREDICTED: laccase-4-like                        93.2    5e-19   
gb|KDO69098.1|  hypothetical protein CISIN_1g008799mg                 93.2    5e-19   
ref|XP_009337309.1|  PREDICTED: laccase-4-like                        93.2    5e-19   
ref|XP_009346884.1|  PREDICTED: laccase-4-like                        93.2    6e-19   
ref|XP_008355354.1|  PREDICTED: laccase-4                             93.2    6e-19   
ref|XP_002520425.1|  laccase, putative                                92.8    6e-19   Ricinus communis
ref|XP_003539958.2|  PREDICTED: laccase-4-like                        92.8    6e-19   
gb|KHG17519.1|  Laccase-4 -like protein                               92.4    7e-19   
ref|XP_011019227.1|  PREDICTED: laccase-4-like                        90.5    7e-19   
ref|XP_004490574.1|  PREDICTED: laccase-4-like                        92.8    7e-19   
ref|XP_003544873.2|  PREDICTED: laccase-4-like                        92.8    7e-19   
ref|XP_003518300.1|  PREDICTED: laccase-4-like                        92.8    7e-19   
ref|XP_007142229.1|  hypothetical protein PHAVU_008G263100g           92.4    8e-19   
ref|XP_008775059.1|  PREDICTED: laccase-22-like                       92.4    8e-19   
gb|KDO37344.1|  hypothetical protein CISIN_1g009854mg                 92.4    8e-19   
ref|XP_007146741.1|  hypothetical protein PHAVU_006G065800g           92.4    9e-19   
gb|AES98533.2|  laccase/diphenol oxidase family protein               92.4    1e-18   
ref|XP_006425016.1|  hypothetical protein CICLE_v10028117mg           92.4    1e-18   
ref|XP_003615575.1|  Laccase 1a                                       92.4    1e-18   
ref|XP_008785423.1|  PREDICTED: laccase-22                            92.0    1e-18   
ref|XP_002265173.1|  PREDICTED: laccase-4-like                        92.0    1e-18   Vitis vinifera
emb|CBI31539.3|  unnamed protein product                              92.0    1e-18   
ref|XP_007026782.1|  Laccase/Diphenol oxidase family protein isof...  91.7    1e-18   
gb|KDP44830.1|  hypothetical protein JCGZ_01330                       91.7    1e-18   
ref|XP_011003662.1|  PREDICTED: laccase-4-like                        92.0    1e-18   
ref|XP_011039810.1|  PREDICTED: laccase-4-like                        92.0    1e-18   
ref|XP_007205010.1|  hypothetical protein PRUPE_ppa003646mg           92.0    1e-18   
ref|XP_002322961.2|  hypothetical protein POPTR_0016s11950g           92.0    1e-18   Populus trichocarpa [western balsam poplar]
ref|XP_007009094.1|  Laccase/Diphenol oxidase family protein          92.0    1e-18   
ref|XP_002533894.1|  laccase, putative                                92.0    1e-18   Ricinus communis
ref|XP_010923124.1|  PREDICTED: laccase-22                            92.0    1e-18   
gb|ABK96121.1|  unknown                                               89.4    1e-18   Populus trichocarpa [western balsam poplar]
ref|XP_010044088.1|  PREDICTED: laccase-4-like                        92.0    1e-18   
ref|XP_009384856.1|  PREDICTED: laccase-22-like                       91.7    1e-18   
ref|XP_008239590.1|  PREDICTED: laccase-4-like                        91.7    1e-18   
ref|XP_009593041.1|  PREDICTED: laccase-4-like                        91.7    2e-18   
ref|XP_009786393.1|  PREDICTED: laccase-4-like                        91.7    2e-18   
ref|XP_010104683.1|  hypothetical protein L484_022066                 91.7    2e-18   
ref|XP_007026781.1|  Laccase/Diphenol oxidase family protein isof...  91.7    2e-18   
ref|XP_009374280.1|  PREDICTED: laccase-4-like                        91.7    2e-18   
ref|XP_006287399.1|  hypothetical protein CARUB_v10000605mg           91.7    2e-18   
ref|XP_010044087.1|  PREDICTED: laccase-4-like                        91.7    2e-18   
gb|AFN53658.1|  hypothetical protein                                  90.9    2e-18   
ref|XP_009590412.1|  PREDICTED: laccase-4-like                        91.3    2e-18   
ref|XP_010256659.1|  PREDICTED: laccase-4                             91.3    2e-18   
ref|XP_010041000.1|  PREDICTED: laccase-4-like                        91.3    2e-18   
gb|KEH34185.1|  laccase/diphenol oxidase family protein               91.3    2e-18   
ref|XP_006349470.1|  PREDICTED: laccase-4-like                        91.3    2e-18   
ref|XP_004249084.1|  PREDICTED: laccase-4-like                        91.3    2e-18   
ref|XP_002278638.1|  PREDICTED: laccase-4                             91.3    3e-18   Vitis vinifera
ref|XP_010529771.1|  PREDICTED: laccase-4-like                        91.3    3e-18   
ref|XP_008449180.1|  PREDICTED: laccase-4-like                        91.3    3e-18   
gb|KHN06247.1|  Laccase-4                                             91.3    3e-18   
ref|XP_004249583.1|  PREDICTED: laccase-4-like                        91.3    3e-18   
ref|XP_003551299.1|  PREDICTED: laccase-4-like                        90.9    3e-18   
ref|XP_006338994.1|  PREDICTED: laccase-4-like                        90.9    3e-18   
ref|XP_010262771.1|  PREDICTED: laccase-4-like                        90.9    3e-18   
gb|KDP24484.1|  hypothetical protein JCGZ_25048                       90.5    3e-18   
ref|XP_009767351.1|  PREDICTED: laccase-4-like                        88.6    3e-18   
gb|KHG18161.1|  Laccase-4 -like protein                               90.9    3e-18   
ref|XP_009407561.1|  PREDICTED: laccase-22-like                       90.9    4e-18   
ref|XP_010553253.1|  PREDICTED: laccase-4                             90.5    4e-18   
gb|KDP46534.1|  hypothetical protein JCGZ_08506                       90.5    4e-18   
ref|XP_010104682.1|  hypothetical protein L484_022065                 90.5    5e-18   
ref|XP_002530417.1|  laccase, putative                                90.1    5e-18   Ricinus communis
ref|XP_007140382.1|  hypothetical protein PHAVU_008G107100g           90.1    5e-18   
ref|XP_009125430.1|  PREDICTED: laccase-10                            90.1    6e-18   
ref|XP_006398646.1|  hypothetical protein EUTSA_v10015593mg           90.1    6e-18   
emb|CDY55905.1|  BnaAnng13970D                                        90.1    6e-18   
ref|XP_002322962.2|  laccase family protein                           90.1    6e-18   Populus trichocarpa [western balsam poplar]
gb|KHN20872.1|  Laccase-4                                             90.1    6e-18   
ref|XP_011032153.1|  PREDICTED: laccase-4-like isoform X1             89.7    6e-18   
emb|CDP14064.1|  unnamed protein product                              90.1    6e-18   
ref|XP_007220829.1|  hypothetical protein PRUPE_ppa027203mg           90.1    6e-18   
ref|XP_010509229.1|  PREDICTED: laccase-4-like                        90.1    7e-18   
emb|CAB69847.1|  laccase-like protein                                 90.1    7e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004147923.1|  PREDICTED: laccase-4-like                        90.1    7e-18   
ref|XP_002873023.1|  predicted protein                                90.1    7e-18   
emb|CAA74102.1|  laccase                                              89.0    7e-18   Populus trichocarpa [western balsam poplar]
ref|NP_195739.2|  laccase 10                                          89.7    7e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011032154.1|  PREDICTED: laccase-4-like isoform X2             89.7    7e-18   
emb|CDY48114.1|  BnaC02g03710D                                        89.7    7e-18   
ref|XP_010505418.1|  PREDICTED: laccase-4                             89.7    7e-18   
ref|XP_006293932.1|  hypothetical protein CARUB_v10022927mg           89.7    7e-18   
ref|XP_002314124.1|  hypothetical protein POPTR_0009s04720g           89.7    7e-18   Populus trichocarpa [western balsam poplar]
gb|KHG28836.1|  Laccase-22                                            90.1    7e-18   
gb|KFK44563.1|  hypothetical protein AALP_AA1G273400                  89.7    7e-18   
ref|XP_003544123.1|  PREDICTED: laccase-4-like                        89.7    7e-18   
ref|XP_010490598.1|  PREDICTED: laccase-10-like isoform X1            89.7    7e-18   
ref|XP_010517091.1|  PREDICTED: laccase-4-like                        89.7    7e-18   
ref|XP_010926015.1|  PREDICTED: laccase-11-like                       90.5    7e-18   
ref|XP_011035200.1|  PREDICTED: laccase-4                             89.7    8e-18   
ref|XP_010452014.1|  PREDICTED: laccase-10 isoform X1                 89.7    8e-18   
ref|XP_010423919.1|  PREDICTED: laccase-10-like                       89.7    8e-18   
gb|KHG11130.1|  Laccase-4 -like protein                               89.4    8e-18   
ref|XP_006363052.1|  PREDICTED: laccase-4-like                        89.7    8e-18   
ref|XP_011019150.1|  PREDICTED: laccase-4 isoform X1                  89.7    9e-18   
ref|XP_002308209.2|  laccase family protein                           89.7    9e-18   Populus trichocarpa [western balsam poplar]
ref|XP_006387495.1|  hypothetical protein POPTR_0958s00200g           89.7    9e-18   
ref|XP_007016183.1|  Laccase/Diphenol oxidase family protein          89.7    9e-18   
ref|XP_002308208.2|  laccase family protein                           89.7    9e-18   Populus trichocarpa [western balsam poplar]
ref|XP_008457399.1|  PREDICTED: laccase-4                             89.7    9e-18   
ref|XP_006429309.1|  hypothetical protein CICLE_v10011400mg           89.7    9e-18   
gb|EPS61127.1|  laccase 3                                             89.4    9e-18   
ref|XP_011019151.1|  PREDICTED: laccase-4 isoform X2                  89.4    1e-17   
ref|XP_009392410.1|  PREDICTED: laccase-11                            89.4    1e-17   
ref|XP_004246339.1|  PREDICTED: laccase-4                             89.4    1e-17   
gb|AAC49537.1|  diphenol oxidase                                      83.6    1e-17   Nicotiana tabacum [American tobacco]
ref|XP_002299828.2|  hypothetical protein POPTR_0001s25580g           89.4    1e-17   Populus trichocarpa [western balsam poplar]
ref|XP_010067496.1|  PREDICTED: laccase-4-like                        89.4    1e-17   
ref|XP_006602641.1|  PREDICTED: laccase-4-like isoform X1             89.4    1e-17   
ref|XP_002311202.1|  laccase family protein                           89.4    1e-17   Populus trichocarpa [western balsam poplar]
ref|XP_010101806.1|  hypothetical protein L484_023595                 89.0    1e-17   
ref|XP_009416212.1|  PREDICTED: laccase-22-like                       89.0    1e-17   
ref|XP_010037723.1|  PREDICTED: laccase-4-like                        89.0    1e-17   
gb|KHN24301.1|  Laccase-4                                             89.0    1e-17   
ref|XP_006878556.1|  hypothetical protein AMTR_s00011p00235480        89.0    1e-17   
ref|XP_010690098.1|  PREDICTED: laccase-4-like                        89.0    2e-17   
gb|ACN39933.1|  unknown                                               89.0    2e-17   Picea sitchensis
ref|XP_004163861.1|  PREDICTED: laccase-4-like                        88.6    2e-17   
ref|XP_004137913.1|  PREDICTED: laccase-4-like                        88.6    2e-17   
ref|XP_003604619.1|  Laccase 1a                                       88.6    2e-17   
gb|EYU41858.1|  hypothetical protein MIMGU_mgv1a003895mg              88.6    2e-17   
ref|XP_008442464.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-4-like   88.6    2e-17   
emb|CDX91428.1|  BnaC04g07220D                                        88.6    2e-17   
ref|XP_009143427.1|  PREDICTED: laccase-4                             88.6    2e-17   
emb|CDX74915.1|  BnaA05g06610D                                        88.6    2e-17   
emb|CDP06511.1|  unnamed protein product                              88.6    2e-17   
gb|EPS65618.1|  hypothetical protein M569_09159                       88.2    2e-17   
emb|CDX93330.1|  BnaC04g45660D                                        88.2    2e-17   
ref|NP_565881.1|  laccase-4                                           88.2    2e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009141718.1|  PREDICTED: laccase-4-like                        88.2    2e-17   
ref|XP_006411009.1|  hypothetical protein EUTSA_v10016460mg           88.2    2e-17   
ref|XP_002879726.1|  IRX12/LAC4                                       88.2    3e-17   
emb|CDY18406.1|  BnaA04g21810D                                        88.2    3e-17   
gb|KFK36706.1|  hypothetical protein AALP_AA4G158700                  88.2    3e-17   
ref|XP_009799024.1|  PREDICTED: laccase-4-like                        88.2    3e-17   
ref|XP_009624727.1|  PREDICTED: laccase-4-like                        88.2    3e-17   
ref|XP_004150626.1|  PREDICTED: laccase-4-like                        87.8    3e-17   
gb|AAC49536.1|  diphenol oxidase                                      88.2    3e-17   Nicotiana tabacum [American tobacco]
ref|XP_010543748.1|  PREDICTED: laccase-22-like                       88.2    3e-17   
ref|XP_010685615.1|  PREDICTED: laccase-4                             88.2    3e-17   
ref|XP_010907627.1|  PREDICTED: laccase-22-like                       87.8    3e-17   
ref|XP_008800741.1|  PREDICTED: laccase-11-like                       88.6    3e-17   
ref|XP_004159811.1|  PREDICTED: laccase-4-like                        85.9    4e-17   
gb|KGN65788.1|  hypothetical protein Csa_1G528530                     87.8    4e-17   
ref|XP_009370205.1|  PREDICTED: laccase-4                             87.4    4e-17   
ref|XP_008377498.1|  PREDICTED: laccase-4-like                        87.4    5e-17   
ref|XP_008388134.1|  PREDICTED: laccase-4-like                        87.4    5e-17   
ref|XP_009789474.1|  PREDICTED: laccase-4-like isoform X2             87.4    5e-17   
ref|XP_010107530.1|  hypothetical protein L484_024383                 87.4    5e-17   
ref|XP_009358852.1|  PREDICTED: laccase-4-like                        87.4    5e-17   
gb|KCW52562.1|  hypothetical protein EUGRSUZ_J01941                   87.0    6e-17   
gb|KHN04832.1|  Laccase-4                                             87.0    7e-17   
gb|EAZ12812.1|  hypothetical protein OsJ_02731                        87.0    7e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010033027.1|  PREDICTED: laccase-4-like                        87.0    7e-17   
gb|EYU26646.1|  hypothetical protein MIMGU_mgv1a003805mg              87.0    7e-17   
ref|XP_009789473.1|  PREDICTED: laccase-4-like isoform X1             87.0    7e-17   
ref|XP_003516941.1|  PREDICTED: laccase-4-like                        87.0    7e-17   
ref|XP_002275392.1|  PREDICTED: laccase-11                            87.0    8e-17   Vitis vinifera
ref|XP_003522150.1|  PREDICTED: laccase-4-like                        87.0    8e-17   
ref|XP_010676357.1|  PREDICTED: laccase-4-like                        87.0    8e-17   
ref|XP_004506788.1|  PREDICTED: laccase-4-like                        86.7    8e-17   
ref|XP_004969263.1|  PREDICTED: laccase-2-like                        86.7    9e-17   
ref|XP_007141799.1|  hypothetical protein PHAVU_008G226700g           86.7    9e-17   
ref|XP_008233715.1|  PREDICTED: laccase-4-like                        86.7    9e-17   
gb|KDO50695.1|  hypothetical protein CISIN_1g036540mg                 86.7    1e-16   
emb|CDY70510.1|  BnaAnng33960D                                        83.2    1e-16   
ref|XP_006428774.1|  hypothetical protein CICLE_v10013446mg           86.7    1e-16   
ref|XP_008811561.1|  PREDICTED: laccase-11-like                       86.3    1e-16   
ref|XP_006350822.1|  PREDICTED: laccase-4-like                        86.3    1e-16   
ref|XP_004302643.1|  PREDICTED: laccase-4-like                        86.3    1e-16   
ref|XP_004241179.1|  PREDICTED: laccase-4-like                        86.3    1e-16   
ref|XP_010543228.1|  PREDICTED: laccase-10                            86.3    1e-16   
ref|XP_011094977.1|  PREDICTED: laccase-4-like                        85.9    2e-16   
dbj|BAN10308.1|  laccase                                              85.9    2e-16   
ref|XP_007042164.1|  Laccase 11                                       86.7    2e-16   
ref|XP_011077581.1|  PREDICTED: laccase-4-like                        85.9    2e-16   
ref|XP_003632636.1|  PREDICTED: laccase-11                            85.9    2e-16   
ref|XP_006401026.1|  hypothetical protein EUTSA_v10013285mg           85.5    2e-16   
gb|KDP29119.1|  hypothetical protein JCGZ_16508                       84.0    2e-16   
ref|XP_009787551.1|  PREDICTED: laccase-4-like                        85.5    2e-16   
ref|XP_008441433.1|  PREDICTED: laccase-4-like                        85.5    2e-16   
ref|XP_004138572.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-4-like   85.5    2e-16   
ref|XP_008797558.1|  PREDICTED: laccase-11-like                       86.3    2e-16   
gb|KGN45770.1|  hypothetical protein Csa_6G009490                     85.5    2e-16   
sp|Q0IQU1.2|LAC22_ORYSJ  RecName: Full=Laccase-22; AltName: Full=...  85.5    2e-16   Oryza sativa Japonica Group [Japonica rice]
gb|KDP41783.1|  hypothetical protein JCGZ_26801                       85.9    3e-16   
ref|XP_010535416.1|  PREDICTED: laccase-16                            85.5    3e-16   
ref|XP_006840270.1|  hypothetical protein AMTR_s00045p00045490        85.5    3e-16   
ref|XP_011080855.1|  PREDICTED: laccase-4                             85.1    3e-16   
ref|XP_006663136.1|  PREDICTED: laccase-22-like                       85.1    3e-16   
sp|Q8RYM9.1|LAC2_ORYSJ  RecName: Full=Laccase-2; AltName: Full=Be...  85.1    3e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008392913.1|  PREDICTED: laccase-4-like                        85.1    3e-16   
ref|XP_009350996.1|  PREDICTED: laccase-4-like                        85.1    3e-16   
gb|AAC49538.1|  diphenol oxidase                                      84.0    3e-16   Nicotiana tabacum [American tobacco]
gb|EMT26873.1|  Laccase-22                                            85.1    4e-16   
dbj|BAJ98144.1|  predicted protein                                    85.1    4e-16   
emb|CBI17500.3|  unnamed protein product                              84.3    5e-16   
ref|XP_002266464.1|  PREDICTED: laccase-11                            84.3    5e-16   Vitis vinifera
ref|XP_009589148.1|  PREDICTED: laccase-4-like                        84.3    6e-16   
ref|XP_007134763.1|  hypothetical protein PHAVU_010G0738000g          84.3    6e-16   
ref|XP_010543401.1|  PREDICTED: laccase-11-like                       84.3    6e-16   
emb|CDX80325.1|  BnaC09g34170D                                        84.3    7e-16   
ref|XP_009120399.1|  PREDICTED: laccase-16                            84.0    7e-16   
ref|XP_010263632.1|  PREDICTED: laccase-11-like                       84.7    8e-16   
gb|AAK37829.1|AF132125_1  laccase                                     84.0    8e-16   Pinus taeda
emb|CAN71338.1|  hypothetical protein VITISV_008643                   84.0    8e-16   Vitis vinifera
ref|XP_010452196.1|  PREDICTED: laccase-11                            84.0    8e-16   
ref|XP_010423743.1|  PREDICTED: laccase-11-like                       84.0    9e-16   
ref|XP_002873085.1|  hypothetical protein ARALYDRAFT_487097           84.0    9e-16   
ref|XP_009593274.1|  PREDICTED: laccase-4-like                        83.6    1e-15   
emb|CDO97037.1|  unnamed protein product                              83.6    1e-15   
ref|XP_004143251.1|  PREDICTED: laccase-11-like                       83.6    1e-15   
ref|NP_200699.1|  laccase 16                                          83.6    1e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004972357.1|  PREDICTED: laccase-2-like                        83.6    1e-15   
ref|XP_008449246.1|  PREDICTED: laccase-11                            83.6    1e-15   
gb|AAK37830.1|AF132126_1  laccase                                     83.6    1e-15   Pinus taeda
gb|ABE66261.1|  laccase/diphenol oxidase                              83.6    1e-15   
gb|ABK28766.1|  unknown                                               83.6    1e-15   
ref|XP_006282033.1|  hypothetical protein CARUB_v10028274mg           83.2    1e-15   
ref|XP_003558760.1|  PREDICTED: laccase-22                            83.6    1e-15   
ref|XP_010443638.1|  PREDICTED: laccase-16-like                       83.6    1e-15   
ref|XP_010454388.1|  PREDICTED: laccase-16                            83.2    1e-15   
sp|Q1PDH6.2|LAC16_ARATH  RecName: Full=Laccase-16; AltName: Full=...  83.2    1e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010483501.1|  PREDICTED: laccase-16-like isoform X1            83.2    1e-15   
ref|XP_010483503.1|  PREDICTED: laccase-16-like isoform X3            83.2    1e-15   
ref|XP_004292037.1|  PREDICTED: laccase-11-like                       83.2    2e-15   
ref|XP_004980096.1|  PREDICTED: laccase-22-like                       83.2    2e-15   
gb|AAK37827.1|AF132123_1  laccase                                     82.8    2e-15   Pinus taeda
dbj|BAF01776.1|  laccase (diphenol oxidase)-like protein              80.9    2e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002866298.1|  hypothetical protein ARALYDRAFT_496014           82.4    3e-15   
ref|XP_010490794.1|  PREDICTED: laccase-11-like                       82.0    4e-15   
ref|XP_009122722.1|  PREDICTED: laccase-11-like                       82.0    4e-15   
emb|CDX70319.1|  BnaA10g26680D                                        82.0    4e-15   
ref|XP_010924287.1|  PREDICTED: laccase-11-like                       82.0    4e-15   
ref|XP_006287320.1|  hypothetical protein CARUB_v10000520mg           82.0    4e-15   
ref|XP_010654256.1|  PREDICTED: laccase-17-like isoform X2            82.0    4e-15   
ref|XP_002519529.1|  laccase, putative                                82.0    4e-15   Ricinus communis
gb|EPS60103.1|  laccase 1a                                            81.6    5e-15   
emb|CDY10394.1|  BnaCnng02950D                                        82.0    5e-15   
ref|XP_002313847.2|  hypothetical protein POPTR_0009s10550g           81.6    5e-15   Populus trichocarpa [western balsam poplar]
gb|KFK24777.1|  hypothetical protein AALP_AA8G023500                  81.6    5e-15   
emb|CBI30530.3|  unnamed protein product                              79.0    6e-15   
gb|KHN41965.1|  Laccase-11                                            81.3    6e-15   
ref|XP_008790512.1|  PREDICTED: laccase-6-like                        81.3    6e-15   
ref|XP_010919279.1|  PREDICTED: laccase-6-like                        81.3    7e-15   
emb|CBI30529.3|  unnamed protein product                              81.3    8e-15   
ref|XP_008775011.1|  PREDICTED: laccase-6-like                        80.9    9e-15   
gb|KHN36103.1|  Laccase-11                                            80.9    9e-15   
gb|KHF97742.1|  Laccase-17 -like protein                              80.9    1e-14   
ref|XP_002531824.1|  laccase, putative                                80.5    1e-14   Ricinus communis
ref|NP_195946.2|  laccase 11                                          80.1    2e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010933847.1|  PREDICTED: laccase-6-like isoform X2             80.1    2e-14   
ref|XP_010558158.1|  PREDICTED: laccase-11                            80.1    2e-14   
emb|CAB86093.1|  laccase precursor-like                               80.1    2e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007200216.1|  hypothetical protein PRUPE_ppa015544mg           80.1    2e-14   
ref|XP_009125488.1|  PREDICTED: laccase-11                            80.1    2e-14   
ref|XP_004292029.1|  PREDICTED: laccase-11-like                       80.1    2e-14   
ref|XP_006445791.1|  hypothetical protein CICLE_v10018047mg           80.1    2e-14   
emb|CDY62896.1|  BnaAnng18410D                                        80.1    2e-14   
gb|KDO70945.1|  hypothetical protein CISIN_1g008484mg                 78.6    2e-14   
ref|XP_006398771.1|  hypothetical protein EUTSA_v10013135mg           79.7    2e-14   
emb|CDY44351.1|  BnaC02g03260D                                        79.7    2e-14   
ref|XP_009342664.1|  PREDICTED: laccase-11-like                       79.7    2e-14   
ref|XP_004160985.1|  PREDICTED: laccase-11-like                       79.7    2e-14   
ref|XP_004146556.1|  PREDICTED: laccase-11-like                       79.7    2e-14   
ref|XP_008236999.1|  PREDICTED: laccase-11-like                       79.7    2e-14   
ref|XP_006466813.1|  PREDICTED: laccase-11-like                       79.7    2e-14   
ref|XP_006425656.1|  hypothetical protein CICLE_v10025287mg           79.7    3e-14   
ref|XP_011000403.1|  PREDICTED: laccase-11-like                       79.7    3e-14   
ref|XP_002512915.1|  laccase, putative                                79.7    3e-14   
ref|XP_008452071.1|  PREDICTED: laccase-11-like                       79.7    3e-14   
emb|CDP09155.1|  unnamed protein product                              80.1    3e-14   
ref|XP_006646133.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-2-like   79.3    3e-14   
ref|XP_004300985.1|  PREDICTED: laccase-11-like                       79.3    3e-14   
ref|XP_010679744.1|  PREDICTED: laccase-11                            79.3    3e-14   
ref|XP_006300062.1|  hypothetical protein CARUB_v10016290mg           79.3    3e-14   
ref|XP_010097581.1|  hypothetical protein L484_017391                 79.3    3e-14   
gb|EYU40190.1|  hypothetical protein MIMGU_mgv1a003793mg              79.3    4e-14   
ref|XP_010933846.1|  PREDICTED: laccase-6-like isoform X1             79.3    4e-14   
gb|KDO70944.1|  hypothetical protein CISIN_1g008484mg                 78.2    4e-14   
ref|XP_008385897.1|  PREDICTED: laccase-11-like                       79.0    5e-14   
gb|KDO37152.1|  hypothetical protein CISIN_1g040938mg                 78.6    5e-14   
gb|KDO48719.1|  hypothetical protein CISIN_1g0085922mg                77.8    5e-14   
ref|XP_010690891.1|  PREDICTED: laccase-17-like                       79.0    5e-14   
ref|XP_006480875.1|  PREDICTED: laccase-17-like isoform X2            78.6    5e-14   
ref|XP_002305436.1|  hypothetical protein POPTR_0004s16370g           78.6    6e-14   
ref|XP_007046899.1|  Laccase 11                                       78.6    6e-14   
ref|XP_002269038.2|  PREDICTED: laccase-17 isoform X2                 78.6    6e-14   
gb|AAB17192.1|  laccase                                               78.6    6e-14   
emb|CDM84967.1|  unnamed protein product                              78.6    6e-14   
ref|XP_007198990.1|  hypothetical protein PRUPE_ppa003590mg           78.6    7e-14   
emb|CDY08537.1|  BnaA05g27730D                                        78.2    7e-14   
ref|XP_006480874.1|  PREDICTED: laccase-17-like isoform X1            78.6    7e-14   
ref|XP_006429124.1|  hypothetical protein CICLE_v10011358mg           78.6    7e-14   
gb|AAB17193.1|  laccase                                               78.6    7e-14   
ref|XP_002268628.2|  PREDICTED: laccase-17-like isoform X1            78.2    8e-14   
ref|XP_010267525.1|  PREDICTED: laccase-6                             78.2    8e-14   
ref|XP_006341211.1|  PREDICTED: laccase-17-like                       78.2    8e-14   
ref|XP_011099634.1|  PREDICTED: laccase-11-like                       78.2    9e-14   
gb|KHG01609.1|  Laccase-11 -like protein                              78.2    9e-14   
emb|CDP02005.1|  unnamed protein product                              78.2    9e-14   
ref|XP_010254791.1|  PREDICTED: laccase-11-like                       78.6    9e-14   
emb|CDY01010.1|  BnaC05g41900D                                        78.2    9e-14   
ref|XP_008338318.1|  PREDICTED: laccase-11-like                       77.8    1e-13   
ref|XP_008338086.1|  PREDICTED: laccase-11-like                       77.8    1e-13   
ref|XP_009371609.1|  PREDICTED: laccase-11-like                       77.8    1e-13   
ref|XP_002310245.1|  hypothetical protein POPTR_0007s13050g           77.8    1e-13   
ref|XP_009590676.1|  PREDICTED: laccase-11-like                       77.8    1e-13   
ref|XP_011025818.1|  PREDICTED: laccase-11-like                       77.8    1e-13   
ref|XP_002309069.1|  hypothetical protein POPTR_0006s08780g           77.8    1e-13   
ref|XP_008352457.1|  PREDICTED: laccase-11-like                       77.8    1e-13   
ref|XP_006856866.1|  hypothetical protein AMTR_s00055p00190270        77.8    1e-13   
ref|XP_008778964.1|  PREDICTED: laccase-17-like                       77.8    1e-13   
ref|XP_008785574.1|  PREDICTED: laccase-17-like                       77.8    1e-13   
ref|XP_011019838.1|  PREDICTED: laccase-17-like                       77.8    1e-13   
gb|KDO73109.1|  hypothetical protein CISIN_1g047497mg                 77.8    1e-13   
ref|XP_006424671.1|  hypothetical protein CICLE_v10030166mg           77.8    1e-13   
ref|XP_010690924.1|  PREDICTED: laccase-17-like                       77.8    1e-13   
ref|XP_010922297.1|  PREDICTED: laccase-17-like                       77.8    1e-13   
gb|ACN34362.1|  unknown                                               77.8    1e-13   
emb|CBI30528.3|  unnamed protein product                              78.6    1e-13   
gb|AAK37825.1|AF132121_1  laccase                                     77.4    1e-13   
ref|XP_002278232.1|  PREDICTED: laccase-17-like                       77.4    1e-13   
ref|XP_007140298.1|  hypothetical protein PHAVU_008G100400g           77.8    1e-13   
gb|KDP44151.1|  hypothetical protein JCGZ_05618                       77.4    2e-13   
ref|XP_004232419.1|  PREDICTED: laccase-11-like                       77.4    2e-13   
emb|CAN60069.1|  hypothetical protein VITISV_012401                   77.4    2e-13   
ref|XP_002278275.1|  PREDICTED: laccase-17                            77.4    2e-13   
ref|XP_011029469.1|  PREDICTED: laccase-17-like                       77.4    2e-13   
ref|XP_004289138.1|  PREDICTED: laccase-11-like                       77.4    2e-13   
ref|XP_007026974.1|  Laccase 17                                       77.4    2e-13   
ref|XP_004294637.1|  PREDICTED: laccase-17-like                       77.4    2e-13   
ref|XP_002317504.2|  hypothetical protein POPTR_0011s12090g           77.0    2e-13   
gb|EYU24320.1|  hypothetical protein MIMGU_mgv1a021399mg              77.0    2e-13   
ref|XP_006341009.1|  PREDICTED: laccase-17-like                       77.0    2e-13   
ref|XP_002458747.1|  hypothetical protein SORBIDRAFT_03g039530        77.0    2e-13   
gb|KHG14663.1|  Laccase-4                                             77.0    2e-13   
ref|XP_002300066.1|  hypothetical protein POPTR_0001s35740g           77.0    2e-13   
ref|XP_009146739.1|  PREDICTED: laccase-22-like                       77.0    2e-13   
ref|XP_009782930.1|  PREDICTED: laccase-4-like                        77.0    2e-13   
ref|NP_001147942.1|  L-ascorbate oxidase precursor                    77.0    2e-13   
ref|XP_002317505.2|  hypothetical protein POPTR_0011s12100g           77.0    2e-13   
gb|KEH22816.1|  laccase/diphenol oxidase family protein               77.0    2e-13   
ref|XP_002962788.1|  hypothetical protein SELMODRAFT_165365           77.0    2e-13   
ref|XP_006340637.1|  PREDICTED: laccase-11-like                       77.0    2e-13   
ref|XP_007140300.1|  hypothetical protein PHAVU_008G1006001g          74.3    2e-13   
ref|XP_007016607.1|  Laccase 17                                       77.0    2e-13   
ref|XP_004246869.2|  PREDICTED: laccase-17-like                       77.0    2e-13   
ref|XP_002520231.1|  laccase, putative                                77.0    2e-13   
ref|XP_007022468.1|  Laccase 17                                       77.0    2e-13   
ref|XP_004246356.1|  PREDICTED: laccase-17-like                       77.0    2e-13   
ref|XP_007026975.1|  Laccase 17                                       77.0    2e-13   
ref|XP_003622953.1|  Laccase                                          77.0    3e-13   
ref|XP_004137934.1|  PREDICTED: laccase-17-like                       76.6    3e-13   
gb|KHN41966.1|  Laccase-11                                            76.6    3e-13   
ref|XP_003516567.1|  PREDICTED: laccase-11-like                       76.6    3e-13   
gb|EMS48628.1|  Laccase-12/13                                         76.6    3e-13   
ref|XP_006370271.1|  hypothetical protein POPTR_0001s41170g           76.6    3e-13   
emb|CBI16199.3|  unnamed protein product                              76.6    3e-13   
ref|XP_003632204.1|  PREDICTED: laccase-17                            76.6    3e-13   
ref|XP_003538856.1|  PREDICTED: laccase-11-like                       76.6    3e-13   
ref|XP_002284473.1|  PREDICTED: laccase-17                            76.6    3e-13   
ref|XP_002299296.1|  laccase family protein                           76.6    3e-13   
ref|XP_009400979.1|  PREDICTED: laccase-6                             76.6    3e-13   
ref|XP_006363101.1|  PREDICTED: laccase-17-like                       76.6    3e-13   
ref|XP_009378520.1|  PREDICTED: laccase-11-like                       76.6    3e-13   
ref|XP_008357173.1|  PREDICTED: laccase-11-like                       76.6    3e-13   
gb|KHN16225.1|  Laccase-17                                            76.6    3e-13   
ref|XP_002962497.1|  hypothetical protein SELMODRAFT_78002            76.6    3e-13   
ref|XP_010256874.1|  PREDICTED: laccase-17-like                       76.6    3e-13   
ref|XP_007027504.1|  Laccase 11                                       76.3    3e-13   
emb|CAN60348.1|  hypothetical protein VITISV_005802                   76.6    3e-13   
gb|AAB17194.1|  laccase                                               76.6    3e-13   
ref|XP_006480879.1|  PREDICTED: laccase-17-like                       76.6    3e-13   
ref|XP_008222577.1|  PREDICTED: laccase-17-like                       76.6    3e-13   
gb|KHN16226.1|  Laccase-17                                            76.6    3e-13   
ref|XP_006602563.1|  PREDICTED: laccase-17-like                       76.6    3e-13   
ref|XP_009593898.1|  PREDICTED: laccase-11-like                       76.3    3e-13   
ref|XP_009793780.1|  PREDICTED: laccase-11-like                       76.3    3e-13   
ref|XP_002282823.1|  PREDICTED: laccase-17                            76.6    3e-13   
emb|CAN72263.1|  hypothetical protein VITISV_037366                   76.3    3e-13   
ref|XP_002520232.1|  laccase, putative                                76.3    3e-13   
ref|XP_010494695.1|  PREDICTED: laccase-22-like                       76.3    3e-13   
emb|CBI31631.3|  unnamed protein product                              77.0    3e-13   
gb|KDO51175.1|  hypothetical protein CISIN_1g008090mg                 76.3    3e-13   
ref|XP_006429120.1|  hypothetical protein CICLE_v10011363mg           76.3    3e-13   
ref|XP_008246065.1|  PREDICTED: laccase-11-like                       75.1    3e-13   
gb|KDO52342.1|  hypothetical protein CISIN_1g008085mg                 76.3    3e-13   
ref|XP_007156959.1|  hypothetical protein PHAVU_002G031700g           76.3    3e-13   
gb|AAN59950.1|  laccase LAC12                                         73.2    4e-13   
ref|XP_004492318.1|  PREDICTED: laccase-17-like                       76.3    4e-13   
ref|XP_003530894.1|  PREDICTED: laccase-17-like                       76.3    4e-13   
gb|KHN24984.1|  Laccase-17                                            76.3    4e-13   
ref|XP_003623041.1|  Laccase                                          76.3    4e-13   
gb|EMT07841.1|  Laccase-4                                             75.1    4e-13   
ref|XP_004302731.1|  PREDICTED: laccase-17-like                       76.3    4e-13   
ref|XP_009340732.1|  PREDICTED: laccase-11-like                       76.3    4e-13   
ref|XP_007207546.1|  hypothetical protein PRUPE_ppa017421mg           76.3    4e-13   
gb|EYU42613.1|  hypothetical protein MIMGU_mgv1a003791mg              76.3    4e-13   
ref|XP_010486778.1|  PREDICTED: laccase-22-like isoform X2            76.3    4e-13   
ref|XP_010486777.1|  PREDICTED: laccase-22-like isoform X1            76.3    4e-13   
ref|XP_011002147.1|  PREDICTED: laccase-17-like                       76.3    4e-13   
ref|XP_004961859.1|  PREDICTED: laccase-12/13-like                    76.3    4e-13   
ref|XP_003564592.1|  PREDICTED: laccase-4-like                        76.3    4e-13   
ref|XP_010464832.1|  PREDICTED: laccase-22-like                       76.3    4e-13   
ref|XP_007156958.1|  hypothetical protein PHAVU_002G031600g           76.3    4e-13   
ref|XP_011089492.1|  PREDICTED: laccase-17                            76.3    4e-13   
ref|XP_006857864.1|  hypothetical protein AMTR_s00069p00085210        76.3    4e-13   
ref|XP_009587566.1|  PREDICTED: laccase-17-like                       76.3    4e-13   
ref|XP_010920540.1|  PREDICTED: laccase-10-like                       76.3    4e-13   
ref|XP_010092993.1|  hypothetical protein L484_007174                 76.3    4e-13   
ref|XP_006339020.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-10-like  75.9    4e-13   
gb|EEC71780.1|  hypothetical protein OsI_04394                        75.9    5e-13   
ref|XP_010683865.1|  PREDICTED: laccase-17-like                       75.9    5e-13   
ref|XP_009621093.1|  PREDICTED: laccase-17-like                       75.9    5e-13   
ref|XP_009796361.1|  PREDICTED: laccase-17-like                       75.9    5e-13   
ref|XP_011094888.1|  PREDICTED: laccase-17-like                       75.9    5e-13   
ref|XP_006644994.1|  PREDICTED: laccase-12/13-like                    75.9    5e-13   
gb|AAK37823.1|  laccase                                               75.9    5e-13   
ref|XP_008223967.1|  PREDICTED: laccase-17                            75.9    5e-13   
gb|EMS50562.1|  Laccase-12/13                                         75.5    5e-13   
ref|XP_010107320.1|  hypothetical protein L484_009454                 75.9    5e-13   
gb|EEC74953.1|  hypothetical protein OsI_10938                        75.9    5e-13   
ref|XP_009764219.1|  PREDICTED: laccase-11-like                       75.9    5e-13   
dbj|BAJ96691.1|  predicted protein                                    75.9    5e-13   
ref|XP_011000467.1|  PREDICTED: laccase-1-like                        75.9    5e-13   
dbj|BAJ84890.1|  predicted protein                                    75.9    5e-13   
ref|XP_007046995.1|  Laccase 6, putative                              75.9    6e-13   
ref|XP_004148786.1|  PREDICTED: laccase-17-like                       75.9    6e-13   
ref|XP_007199239.1|  hypothetical protein PRUPE_ppa022262mg           75.1    6e-13   
ref|NP_001049699.1|  Os03g0273200                                     75.5    6e-13   
ref|XP_007204198.1|  hypothetical protein PRUPE_ppa003577mg           75.5    6e-13   
ref|XP_007036761.1|  Laccase 1                                        75.5    6e-13   
ref|XP_011077639.1|  PREDICTED: laccase-17-like                       75.5    7e-13   
ref|XP_010654257.1|  PREDICTED: laccase-17 isoform X1                 75.5    7e-13   
ref|XP_008241697.1|  PREDICTED: laccase-11-like                       75.5    7e-13   
ref|XP_002991629.1|  hypothetical protein SELMODRAFT_133734           75.5    7e-13   
ref|XP_008778578.1|  PREDICTED: laccase-10-like                       75.5    7e-13   
ref|XP_011088411.1|  PREDICTED: laccase-11-like                       75.5    7e-13   
ref|XP_008463808.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-17-like  75.5    7e-13   
ref|XP_009597231.1|  PREDICTED: laccase-17-like                       75.5    7e-13   
ref|XP_010037821.1|  PREDICTED: laccase-17-like                       75.5    7e-13   
ref|XP_009354529.1|  PREDICTED: laccase-17-like                       75.5    7e-13   
ref|XP_010275879.1|  PREDICTED: laccase-17-like                       75.5    7e-13   
ref|XP_004492322.1|  PREDICTED: laccase-17-like                       75.5    7e-13   
ref|XP_007140515.1|  hypothetical protein PHAVU_008G119200g           75.5    7e-13   
ref|XP_010683867.1|  PREDICTED: laccase-17-like                       75.5    7e-13   
ref|XP_011094887.1|  PREDICTED: laccase-17-like                       75.5    8e-13   
ref|XP_002971503.1|  hypothetical protein SELMODRAFT_95740            75.5    8e-13   
ref|XP_010685718.1|  PREDICTED: laccase-17-like                       75.5    8e-13   
ref|XP_007026973.1|  Laccase 17                                       75.5    8e-13   
ref|XP_009414328.1|  PREDICTED: laccase-17-like                       75.5    8e-13   
ref|XP_010043648.1|  PREDICTED: laccase-17-like                       75.5    8e-13   
ref|XP_010031544.1|  PREDICTED: laccase-17-like                       75.5    8e-13   
ref|XP_009354528.1|  PREDICTED: laccase-17-like                       75.5    8e-13   
ref|XP_010024157.1|  PREDICTED: laccase-11                            75.1    8e-13   
ref|XP_009774063.1|  PREDICTED: laccase-17-like                       75.5    8e-13   
ref|XP_009358279.1|  PREDICTED: laccase-17-like                       75.5    8e-13   
ref|XP_008358049.1|  PREDICTED: laccase-17-like                       75.5    8e-13   
ref|XP_003558240.1|  PREDICTED: laccase-10-like                       75.1    9e-13   
ref|XP_008385215.1|  PREDICTED: laccase-17-like                       75.1    9e-13   
ref|XP_006347000.1|  PREDICTED: laccase-11-like                       75.1    9e-13   
ref|XP_003532315.1|  PREDICTED: laccase-17-like                       75.1    9e-13   
ref|XP_010654259.1|  PREDICTED: laccase-2-like                        75.1    9e-13   
gb|KHN24985.1|  Laccase-17                                            75.1    9e-13   
ref|XP_009354571.1|  PREDICTED: laccase-17-like                       75.1    1e-12   
gb|KHN24986.1|  Laccase-17                                            75.1    1e-12   
ref|XP_004970543.1|  PREDICTED: laccase-12/13-like                    75.1    1e-12   
ref|XP_006603494.1|  PREDICTED: laccase-17-like                       74.7    1e-12   
ref|XP_006602579.1|  PREDICTED: laccase-17-like isoform X2            75.1    1e-12   
ref|XP_009595163.1|  PREDICTED: laccase-17-like                       74.7    1e-12   
ref|XP_008358843.1|  PREDICTED: laccase-17-like                       75.1    1e-12   
ref|XP_003552160.2|  PREDICTED: laccase-17-like isoform X1            75.1    1e-12   
gb|EPS68485.1|  hypothetical protein M569_06281                       74.7    1e-12   
gb|AAB17191.1|  laccase                                               75.1    1e-12   
ref|XP_004512055.1|  PREDICTED: laccase-11-like                       74.7    1e-12   
gb|KHN16229.1|  Laccase-17                                            75.1    1e-12   



>ref|XP_011036009.1| PREDICTED: laccase-4-like [Populus euphratica]
Length=555

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 41/42 (98%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRF+ADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI
Sbjct  504  AIRFKADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  545



>ref|XP_002316233.1| hypothetical protein POPTR_0010s20050g [Populus trichocarpa]
 gb|EEF02404.1| hypothetical protein POPTR_0010s20050g [Populus trichocarpa]
Length=555

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 41/42 (98%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRF+ADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI
Sbjct  504  AIRFKADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  545



>ref|XP_004294236.1| PREDICTED: laccase-4-like [Fragaria vesca subsp. vesca]
Length=561

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAFVVDNGKGPNES+
Sbjct  510  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVDNGKGPNESV  551



>ref|XP_003616564.1| Laccase [Medicago truncatula]
Length=675

 Score = 95.9 bits (237),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 39/42 (93%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWFLHCHLEVHTTWGLKMAF+VDNG+GP+ESI
Sbjct  624  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFIVDNGRGPSESI  665



>gb|EYU41257.1| hypothetical protein MIMGU_mgv1a003880mg [Erythranthe guttata]
Length=558

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 39/42 (93%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWFLHCHLE+HTTWGLKMAFVV+NGKGPN+SI
Sbjct  507  AIRFRADNPGVWFLHCHLEIHTTWGLKMAFVVENGKGPNQSI  548



>gb|AES99522.2| laccase/diphenol oxidase family protein [Medicago truncatula]
Length=529

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 39/42 (93%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWFLHCHLEVHTTWGLKMAF+VDNG+GP+ESI
Sbjct  478  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFIVDNGRGPSESI  519



>ref|XP_004490949.1| PREDICTED: laccase-4-like [Cicer arietinum]
Length=554

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNES  332
            AIRFRADNPGVWFLHCHLEVHTTWGLKMAF+VDNG+GPNES
Sbjct  503  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFIVDNGRGPNES  543



>emb|CAA74101.1| laccase [Populus trichocarpa]
Length=407

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAF+VDNGKGPNES+LPPPSDLP C
Sbjct  353  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNESLLPPPSDLPKC  404



>ref|XP_004308920.1| PREDICTED: laccase-22-like [Fragaria vesca subsp. vesca]
Length=556

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 38/42 (90%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPG+WFLHCHLEVHTTWGLKMAF+VDNG+GPNES+
Sbjct  505  AIRFRADNPGIWFLHCHLEVHTTWGLKMAFLVDNGEGPNESL  546



>emb|CAC14718.1| laccase [Populus trichocarpa]
Length=396

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAF+VDNGKGPNES+LPPPSDLP C
Sbjct  342  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNESLLPPPSDLPKC  393



>emb|CAA74103.1| laccase [Populus trichocarpa]
Length=555

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 50/52 (96%), Positives = 52/52 (100%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRF+ADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESILPPPSDLP+C
Sbjct  504  AIRFKADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESILPPPSDLPTC  555



>ref|XP_010044089.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 gb|KCW86095.1| hypothetical protein EUGRSUZ_B02796 [Eucalyptus grandis]
Length=556

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 38/42 (90%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLE+HTTWGLKMAF+VDNGKGPNES+
Sbjct  505  AIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNGKGPNESL  546



>emb|CAC14719.1| laccase [Populus trichocarpa]
Length=555

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 50/52 (96%), Positives = 52/52 (100%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRF+ADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESILPPPSDLP+C
Sbjct  504  AIRFKADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESILPPPSDLPTC  555



>ref|XP_010044090.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 ref|XP_010044092.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 ref|XP_010044093.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 gb|KCW86096.1| hypothetical protein EUGRSUZ_B02797 [Eucalyptus grandis]
 gb|KCW86097.1| hypothetical protein EUGRSUZ_B02798 [Eucalyptus grandis]
 gb|KCW86098.1| hypothetical protein EUGRSUZ_B02799 [Eucalyptus grandis]
Length=556

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 38/42 (90%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLE+HTTWGLKMAF+VDNGKGPNES+
Sbjct  505  AIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNGKGPNESL  546



>ref|XP_011084946.1| PREDICTED: laccase-4-like [Sesamum indicum]
Length=555

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 38/42 (90%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAF+V+NGKGPN+SI
Sbjct  504  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGPNQSI  545



>gb|KHG22893.1| Laccase-4 -like protein [Gossypium arboreum]
Length=486

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/52 (94%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAFVVDNGKGPNES+LPPPSDLP C
Sbjct  435  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVDNGKGPNESLLPPPSDLPKC  486



>ref|XP_008220423.1| PREDICTED: laccase-4 [Prunus mume]
Length=558

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/52 (94%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAFVVDNGKGPNES+LPPPSDLP C
Sbjct  507  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVDNGKGPNESVLPPPSDLPKC  558



>ref|XP_007207096.1| hypothetical protein PRUPE_ppa022440mg [Prunus persica]
 gb|EMJ08295.1| hypothetical protein PRUPE_ppa022440mg [Prunus persica]
Length=558

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/52 (94%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAFVVDNGKGPNES+LPPPSDLP C
Sbjct  507  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVDNGKGPNESVLPPPSDLPKC  558



>ref|XP_002280416.1| PREDICTED: laccase-4 [Vitis vinifera]
 emb|CBI16002.3| unnamed protein product [Vitis vinifera]
Length=554

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/52 (94%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAFVVDNGKGPNES+LPPPSDLP C
Sbjct  503  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVDNGKGPNESVLPPPSDLPKC  554



>ref|XP_006435668.1| hypothetical protein CICLE_v10031134mg [Citrus clementina]
 ref|XP_006486373.1| PREDICTED: laccase-4-like [Citrus sinensis]
 gb|ESR48908.1| hypothetical protein CICLE_v10031134mg [Citrus clementina]
Length=553

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 52/52 (100%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWFLHCHLEVHT+WGLKMAFVVDNGKGPNES++PPPSDLP+C
Sbjct  502  AIRFRADNPGVWFLHCHLEVHTSWGLKMAFVVDNGKGPNESLIPPPSDLPTC  553



>ref|XP_004500229.1| PREDICTED: laccase-4-like [Cicer arietinum]
Length=556

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLE+HTTWGLKMAFVVDNGKGPNES+LPPPSDLP C
Sbjct  505  AIRFRADNPGVWFMHCHLEIHTTWGLKMAFVVDNGKGPNESVLPPPSDLPKC  556



>ref|XP_008358974.1| PREDICTED: laccase-4-like [Malus domestica]
Length=557

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 49/52 (94%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAFVVDNGKGPNES+LPPPSDLP C
Sbjct  506  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVDNGKGPNESVLPPPSDLPKC  557



>gb|KDO69098.1| hypothetical protein CISIN_1g008799mg [Citrus sinensis]
Length=553

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 52/52 (100%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWFLHCHLEVHT+WGLKMAFVVDNGKGPNES++PPPSDLP+C
Sbjct  502  AIRFRADNPGVWFLHCHLEVHTSWGLKMAFVVDNGKGPNESLIPPPSDLPTC  553



>ref|XP_009337309.1| PREDICTED: laccase-4-like [Pyrus x bretschneideri]
Length=558

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 49/52 (94%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAFVVDNGKGPNES+LPPPSDLP C
Sbjct  507  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVDNGKGPNESVLPPPSDLPKC  558



>ref|XP_009346884.1| PREDICTED: laccase-4-like [Pyrus x bretschneideri]
Length=558

 Score = 93.2 bits (230),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 49/52 (94%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAFVVDNGKGPNES+LPPPSDLP C
Sbjct  507  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVDNGKGPNESVLPPPSDLPKC  558



>ref|XP_008355354.1| PREDICTED: laccase-4 [Malus domestica]
 ref|XP_008355361.1| PREDICTED: laccase-4 [Malus domestica]
 ref|XP_008363414.1| PREDICTED: laccase-4-like [Malus domestica]
Length=558

 Score = 93.2 bits (230),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 49/52 (94%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAFVVDNGKGPNES+LPPPSDLP C
Sbjct  507  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVDNGKGPNESVLPPPSDLPKC  558



>ref|XP_002520425.1| laccase, putative [Ricinus communis]
 gb|EEF41838.1| laccase, putative [Ricinus communis]
Length=556

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 49/52 (94%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAFVVDNGKGPNES+LPPPSDLP C
Sbjct  505  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVDNGKGPNESLLPPPSDLPKC  556



>ref|XP_003539958.2| PREDICTED: laccase-4-like [Glycine max]
 gb|KHN07789.1| Laccase-4 [Glycine soja]
Length=556

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLE+HTTWGLKMAFVVDNGKGPNES+LPPP+DLP C
Sbjct  505  AIRFRADNPGVWFMHCHLEIHTTWGLKMAFVVDNGKGPNESLLPPPTDLPKC  556



>gb|KHG17519.1| Laccase-4 -like protein [Gossypium arboreum]
Length=503

 Score = 92.4 bits (228),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAFVVDNGKGPNES+LPPPSD P C
Sbjct  452  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVDNGKGPNESLLPPPSDFPKC  503



>ref|XP_011019227.1| PREDICTED: laccase-4-like, partial [Populus euphratica]
Length=315

 Score = 90.5 bits (223),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAF+VDNGKGP ES+LPPPSDLP C
Sbjct  264  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPKESLLPPPSDLPKC  315



>ref|XP_004490574.1| PREDICTED: laccase-4-like [Cicer arietinum]
Length=570

 Score = 92.8 bits (229),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 49/52 (94%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAFVVDNGKGPNES+LPPPSDLP C
Sbjct  519  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVDNGKGPNESLLPPPSDLPKC  570



>ref|XP_003544873.2| PREDICTED: laccase-4-like [Glycine max]
 gb|KHN40048.1| Laccase-4 [Glycine soja]
Length=557

 Score = 92.8 bits (229),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLE+HTTWGLKMAFVVDNGKGPNES+LPPPSDLP C
Sbjct  506  AIRFRADNPGVWFMHCHLEIHTTWGLKMAFVVDNGKGPNESLLPPPSDLPKC  557



>ref|XP_003518300.1| PREDICTED: laccase-4-like [Glycine max]
 gb|KHN46170.1| Laccase-4 [Glycine soja]
Length=557

 Score = 92.8 bits (229),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLE+HTTWGLKMAFVVDNGKGPNES+LPPPSDLP C
Sbjct  506  AIRFRADNPGVWFMHCHLEIHTTWGLKMAFVVDNGKGPNESLLPPPSDLPKC  557



>ref|XP_007142229.1| hypothetical protein PHAVU_008G263100g [Phaseolus vulgaris]
 gb|ESW14223.1| hypothetical protein PHAVU_008G263100g [Phaseolus vulgaris]
Length=555

 Score = 92.4 bits (228),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLE+HTTWGLKMAF+VDNGKGPNESI
Sbjct  504  AIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNGKGPNESI  545



>ref|XP_008775059.1| PREDICTED: laccase-22-like [Phoenix dactylifera]
Length=554

 Score = 92.4 bits (228),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 38/42 (90%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRF+ADNPGVWF+HCHLEVHTTWGLKMAFVVDNG+GPNES+
Sbjct  503  AIRFQADNPGVWFMHCHLEVHTTWGLKMAFVVDNGEGPNESL  544



>gb|KDO37344.1| hypothetical protein CISIN_1g009854mg [Citrus sinensis]
Length=524

 Score = 92.4 bits (228),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAF+VDNGKGPNES+LPPPSDLP C
Sbjct  473  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFIVDNGKGPNESLLPPPSDLPKC  524



>ref|XP_007146741.1| hypothetical protein PHAVU_006G065800g [Phaseolus vulgaris]
 gb|ESW18735.1| hypothetical protein PHAVU_006G065800g [Phaseolus vulgaris]
Length=556

 Score = 92.4 bits (228),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLE+HTTWGLKMAFVVDNGKGPNES+LPPPSDLP C
Sbjct  505  AIRFRADNPGVWFMHCHLEIHTTWGLKMAFVVDNGKGPNESLLPPPSDLPKC  556



>gb|AES98533.2| laccase/diphenol oxidase family protein [Medicago truncatula]
Length=558

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLE+HTTWGLKMAFVVDNGKGPNES+LPPPSDLP C
Sbjct  507  AIRFRADNPGVWFMHCHLEIHTTWGLKMAFVVDNGKGPNESLLPPPSDLPKC  558



>ref|XP_006425016.1| hypothetical protein CICLE_v10028117mg [Citrus clementina]
 ref|XP_006488481.1| PREDICTED: laccase-4-like [Citrus sinensis]
 gb|ESR38256.1| hypothetical protein CICLE_v10028117mg [Citrus clementina]
Length=557

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAF+VDNGKGPNES+LPPPSDLP C
Sbjct  506  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFIVDNGKGPNESLLPPPSDLPKC  557



>ref|XP_003615575.1| Laccase 1a [Medicago truncatula]
Length=593

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLE+HTTWGLKMAFVVDNGKGPNES+
Sbjct  542  AIRFRADNPGVWFMHCHLEIHTTWGLKMAFVVDNGKGPNESL  583



>ref|XP_008785423.1| PREDICTED: laccase-22 [Phoenix dactylifera]
Length=554

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/41 (98%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNES  332
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAFVVDNGKGPNES
Sbjct  503  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVDNGKGPNES  543



>ref|XP_002265173.1| PREDICTED: laccase-4-like [Vitis vinifera]
Length=553

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVW LHCHLEVHTTWGLKMAF+V+NGKGPNES+
Sbjct  502  AIRFRADNPGVWLLHCHLEVHTTWGLKMAFLVENGKGPNESL  543



>emb|CBI31539.3| unnamed protein product [Vitis vinifera]
Length=533

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVW LHCHLEVHTTWGLKMAF+V+NGKGPNES+
Sbjct  482  AIRFRADNPGVWLLHCHLEVHTTWGLKMAFLVENGKGPNESL  523



>ref|XP_007026782.1| Laccase/Diphenol oxidase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY07284.1| Laccase/Diphenol oxidase family protein isoform 2 [Theobroma 
cacao]
Length=490

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWFLHCHLEVHTTWGLKMAF+VDNGKGPN+S+LPPPSDLP C
Sbjct  439  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFLVDNGKGPNQSLLPPPSDLPKC  490



>gb|KDP44830.1| hypothetical protein JCGZ_01330 [Jatropha curcas]
Length=475

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLEVHT+WGLKMAFVVDNGKGPNES+
Sbjct  424  AIRFRADNPGVWFMHCHLEVHTSWGLKMAFVVDNGKGPNESL  465



>ref|XP_011003662.1| PREDICTED: laccase-4-like [Populus euphratica]
Length=557

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAF+VDNGKGPNES+LPPPSDLP C
Sbjct  506  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNESLLPPPSDLPKC  557



>ref|XP_011039810.1| PREDICTED: laccase-4-like [Populus euphratica]
Length=556

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWFLHCHLEVHTTWGLKM FVVDNG+GP+ES+
Sbjct  505  AIRFRADNPGVWFLHCHLEVHTTWGLKMVFVVDNGEGPDESL  546



>ref|XP_007205010.1| hypothetical protein PRUPE_ppa003646mg [Prunus persica]
 gb|EMJ06209.1| hypothetical protein PRUPE_ppa003646mg [Prunus persica]
Length=559

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/52 (94%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRF+ADNPGVWFLHCHLEVHTTWGLKMAF+VDNGKGPNESILPPPSDLP C
Sbjct  508  AIRFQADNPGVWFLHCHLEVHTTWGLKMAFLVDNGKGPNESILPPPSDLPKC  559



>ref|XP_002322961.2| hypothetical protein POPTR_0016s11950g [Populus trichocarpa]
 gb|EEF04722.2| hypothetical protein POPTR_0016s11950g [Populus trichocarpa]
Length=557

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAF+VDNGKGPNES+LPPPSDLP C
Sbjct  506  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNESLLPPPSDLPKC  557



>ref|XP_007009094.1| Laccase/Diphenol oxidase family protein [Theobroma cacao]
 gb|EOY17904.1| Laccase/Diphenol oxidase family protein [Theobroma cacao]
Length=554

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF HCHLEVHTTWGLKMAF+V+NGKGPNES+
Sbjct  503  AIRFRADNPGVWFFHCHLEVHTTWGLKMAFLVENGKGPNESL  544



>ref|XP_002533894.1| laccase, putative [Ricinus communis]
 gb|EEF28494.1| laccase, putative [Ricinus communis]
Length=556

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAF+VDNGKGPNES+LPPPSDLP C
Sbjct  505  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNESLLPPPSDLPKC  556



>ref|XP_010923124.1| PREDICTED: laccase-22 [Elaeis guineensis]
Length=554

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/41 (98%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNES  332
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAFVVDNGKGPNES
Sbjct  503  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVDNGKGPNES  543



>gb|ABK96121.1| unknown [Populus trichocarpa]
Length=276

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWFLHCHLEVHTTWGLKM FVVDNG+GP+ES+LPPPSDLP+C
Sbjct  225  AIRFRADNPGVWFLHCHLEVHTTWGLKMVFVVDNGEGPDESLLPPPSDLPNC  276



>ref|XP_010044088.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 gb|KCW86094.1| hypothetical protein EUGRSUZ_B02795 [Eucalyptus grandis]
Length=556

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 37/42 (88%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLE+HTTWGLKMAF+VDNGKGP+ES+
Sbjct  505  AIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNGKGPSESL  546



>ref|XP_009384856.1| PREDICTED: laccase-22-like [Musa acuminata subsp. malaccensis]
Length=558

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWFLHCH EVHTTWGLKMAFVV++GKGPNES+
Sbjct  507  AIRFRADNPGVWFLHCHFEVHTTWGLKMAFVVEDGKGPNESL  548



>ref|XP_008239590.1| PREDICTED: laccase-4-like [Prunus mume]
Length=559

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/52 (94%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRF+ADNPGVWFLHCHLEVHTTWGLKMAF+VDNGKGPNESILPPPSDLP C
Sbjct  508  AIRFQADNPGVWFLHCHLEVHTTWGLKMAFLVDNGKGPNESILPPPSDLPKC  559



>ref|XP_009593041.1| PREDICTED: laccase-4-like [Nicotiana tomentosiformis]
Length=556

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAF+VDNGKGPNES+LPPP DLP C
Sbjct  505  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNESLLPPPKDLPKC  556



>ref|XP_009786393.1| PREDICTED: laccase-4-like [Nicotiana sylvestris]
Length=556

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAF+VDNGKGPNES+LPPP DLP C
Sbjct  505  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNESLLPPPKDLPKC  556



>ref|XP_010104683.1| hypothetical protein L484_022066 [Morus notabilis]
 gb|EXC01489.1| hypothetical protein L484_022066 [Morus notabilis]
Length=556

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRF+ADNPGVWF+HCHLEVHTTWGLKMAFVVDNGKGPNES+
Sbjct  505  AIRFKADNPGVWFMHCHLEVHTTWGLKMAFVVDNGKGPNESL  546



>ref|XP_007026781.1| Laccase/Diphenol oxidase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY07283.1| Laccase/Diphenol oxidase family protein isoform 1 [Theobroma 
cacao]
Length=556

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWFLHCHLEVHTTWGLKMAF+VDNGKGPN+S+LPPPSDLP C
Sbjct  505  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFLVDNGKGPNQSLLPPPSDLPKC  556



>ref|XP_009374280.1| PREDICTED: laccase-4-like [Pyrus x bretschneideri]
Length=558

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRF+ADNPG+WF+HCHLEVHTTWGLKMAFVVDNGKGPNES+LPPPSDLP C
Sbjct  507  AIRFKADNPGIWFMHCHLEVHTTWGLKMAFVVDNGKGPNESVLPPPSDLPKC  558



>ref|XP_006287399.1| hypothetical protein CARUB_v10000605mg [Capsella rubella]
 gb|EOA20297.1| hypothetical protein CARUB_v10000605mg [Capsella rubella]
Length=558

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAF+VDNGKGPN+SI
Sbjct  507  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNQSI  548



>ref|XP_010044087.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 gb|KCW86093.1| hypothetical protein EUGRSUZ_B02794 [Eucalyptus grandis]
Length=556

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLE+HTTWGLKMAF+VDNGKGPNES+LPPPSDLP C
Sbjct  505  AIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNGKGPNESLLPPPSDLPKC  556



>gb|AFN53658.1| hypothetical protein [Linum usitatissimum]
Length=480

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLEVHTTWGLKMA+VVDNGKGPNESI
Sbjct  429  AIRFRADNPGVWFMHCHLEVHTTWGLKMAWVVDNGKGPNESI  470



>ref|XP_009590412.1| PREDICTED: laccase-4-like [Nicotiana tomentosiformis]
Length=556

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 37/42 (88%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLEVHTTWGLKM F+V+NGKGPN+SI
Sbjct  505  AIRFRADNPGVWFMHCHLEVHTTWGLKMGFLVENGKGPNQSI  546



>ref|XP_010256659.1| PREDICTED: laccase-4 [Nelumbo nucifera]
Length=554

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/51 (94%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = -2

Query  451  IRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            IRFRADNPGVWF+HCHLEVHTTWGLKMAFVVDNGKGPNES+LPPPSDLP C
Sbjct  504  IRFRADNPGVWFMHCHLEVHTTWGLKMAFVVDNGKGPNESLLPPPSDLPKC  554



>ref|XP_010041000.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 gb|KCW44721.1| hypothetical protein EUGRSUZ_L01734 [Eucalyptus grandis]
Length=556

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLE+HTTWGLKMAF+VDNGKGPNES+
Sbjct  505  AIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNGKGPNESL  546



>gb|KEH34185.1| laccase/diphenol oxidase family protein [Medicago truncatula]
Length=556

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRF+ADNPGVWF+HCHLE+HTTWGLKMAFVVDNGKGPNES+LPPPSDLP C
Sbjct  505  AIRFKADNPGVWFMHCHLEIHTTWGLKMAFVVDNGKGPNESLLPPPSDLPKC  556



>ref|XP_006349470.1| PREDICTED: laccase-4-like [Solanum tuberosum]
Length=556

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLE+HTTWGLKMAF+VDNGKGPNES+
Sbjct  505  AIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNGKGPNESL  546



>ref|XP_004249084.1| PREDICTED: laccase-4-like [Solanum lycopersicum]
Length=556

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLE+HTTWGLKMAF+VDNGKGPNES+LPPP DLP C
Sbjct  505  AIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNGKGPNESLLPPPKDLPKC  556



>ref|XP_002278638.1| PREDICTED: laccase-4 [Vitis vinifera]
 emb|CBI30423.3| unnamed protein product [Vitis vinifera]
Length=556

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRF ADNPGVWF+HCHLEVHTTWGLKMAF+VDNGKGPN+SI
Sbjct  505  AIRFLADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNQSI  546



>ref|XP_010529771.1| PREDICTED: laccase-4-like [Tarenaya hassleriana]
Length=559

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAF+V+NGKGPNESILPPP DLP C
Sbjct  508  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGPNESILPPPKDLPKC  559



>ref|XP_008449180.1| PREDICTED: laccase-4-like [Cucumis melo]
Length=556

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAF+V+NGKGPNESI
Sbjct  505  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGPNESI  546



>gb|KHN06247.1| Laccase-4 [Glycine soja]
Length=556

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFR DNPGVWF+HCHLE+HTTWGLKMAFVVDNGKGPNES+LPPPSDLP C
Sbjct  505  AIRFRTDNPGVWFMHCHLEIHTTWGLKMAFVVDNGKGPNESLLPPPSDLPKC  556



>ref|XP_004249583.1| PREDICTED: laccase-4-like [Solanum lycopersicum]
Length=557

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLE+HTTWGLKMAF+VDNGKGPNES+LPPP DLP C
Sbjct  506  AIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNGKGPNESLLPPPKDLPKC  557



>ref|XP_003551299.1| PREDICTED: laccase-4-like [Glycine max]
Length=556

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFR DNPGVWF+HCHLE+HTTWGLKMAFVVDNGKGPNES+LPPPSDLP C
Sbjct  505  AIRFRTDNPGVWFMHCHLEIHTTWGLKMAFVVDNGKGPNESLLPPPSDLPKC  556



>ref|XP_006338994.1| PREDICTED: laccase-4-like [Solanum tuberosum]
Length=557

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLE+HTTWGLKMAF+VDNGKGPNES+LPPP DLP C
Sbjct  506  AIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNGKGPNESLLPPPKDLPKC  557



>ref|XP_010262771.1| PREDICTED: laccase-4-like [Nelumbo nucifera]
Length=555

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAFVVDNGKG N+S+
Sbjct  504  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVDNGKGTNQSL  545



>gb|KDP24484.1| hypothetical protein JCGZ_25048 [Jatropha curcas]
Length=486

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAF+V+NGKGPNES+LPPPSDLP C
Sbjct  435  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGPNESLLPPPSDLPKC  486



>ref|XP_009767351.1| PREDICTED: laccase-4-like, partial [Nicotiana sylvestris]
Length=321

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWFLHCHLEVHTTWGLKM F V+NG+GPN+SILPPPSDLP C
Sbjct  270  AIRFRADNPGVWFLHCHLEVHTTWGLKMVFFVENGRGPNQSILPPPSDLPKC  321



>gb|KHG18161.1| Laccase-4 -like protein [Gossypium arboreum]
Length=556

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAF+VDNGKGPN+S+LPPPSDLP C
Sbjct  505  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNQSLLPPPSDLPKC  556



>ref|XP_009407561.1| PREDICTED: laccase-22-like [Musa acuminata subsp. malaccensis]
Length=559

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 37/42 (88%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWFLHCH EVHTTWGLKMAFVVD+G+GPN+S+
Sbjct  508  AIRFRADNPGVWFLHCHFEVHTTWGLKMAFVVDDGEGPNQSL  549



>ref|XP_010553253.1| PREDICTED: laccase-4 [Tarenaya hassleriana]
Length=559

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAF+V+NGKGPNES+
Sbjct  508  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGPNESV  549



>gb|KDP46534.1| hypothetical protein JCGZ_08506 [Jatropha curcas]
Length=563

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNE  335
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAFVVDNGKGPNE
Sbjct  512  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVDNGKGPNE  551



>ref|XP_010104682.1| hypothetical protein L484_022065 [Morus notabilis]
 gb|EXC01488.1| hypothetical protein L484_022065 [Morus notabilis]
Length=556

 Score = 90.5 bits (223),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRF+ADNPGVWF+HCHLEVHTTWGLKMAFVVDNGKGPNE++LPPP+DLP C
Sbjct  505  AIRFKADNPGVWFMHCHLEVHTTWGLKMAFVVDNGKGPNETLLPPPTDLPKC  556



>ref|XP_002530417.1| laccase, putative [Ricinus communis]
 gb|EEF31987.1| laccase, putative [Ricinus communis]
Length=554

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWFLHCHLEVHT+WGLKMAFVVDNG+GPN+SI
Sbjct  503  AIRFRADNPGVWFLHCHLEVHTSWGLKMAFVVDNGEGPNDSI  544



>ref|XP_007140382.1| hypothetical protein PHAVU_008G107100g [Phaseolus vulgaris]
 gb|ESW12376.1| hypothetical protein PHAVU_008G107100g [Phaseolus vulgaris]
Length=560

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            A+RFRADNPGVWFLHCH EVHTTWGLKMAF+VDNGKGPNES+
Sbjct  509  ALRFRADNPGVWFLHCHFEVHTTWGLKMAFLVDNGKGPNESL  550



>ref|XP_009125430.1| PREDICTED: laccase-10 [Brassica rapa]
Length=559

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAF+V+NGKGPN+SILPPPSDLP C
Sbjct  508  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGPNQSILPPPSDLPKC  559



>ref|XP_006398646.1| hypothetical protein EUTSA_v10015593mg [Eutrema salsugineum]
 gb|ESQ40099.1| hypothetical protein EUTSA_v10015593mg [Eutrema salsugineum]
Length=558

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAF+V+NGKGPN+SILPPPSDLP C
Sbjct  507  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGPNQSILPPPSDLPKC  558



>emb|CDY55905.1| BnaAnng13970D [Brassica napus]
Length=563

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAF+V+NGKGPN+SILPPPSDLP C
Sbjct  512  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGPNQSILPPPSDLPKC  563



>ref|XP_002322962.2| laccase family protein [Populus trichocarpa]
 gb|EEF04723.2| laccase family protein [Populus trichocarpa]
Length=564

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFR DNPGVWF+HCHLEVHTTWGLKMAF+VDNGKGPNES+LPPPSDLP C
Sbjct  513  AIRFRVDNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNESLLPPPSDLPKC  564



>gb|KHN20872.1| Laccase-4 [Glycine soja]
Length=562

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNES  332
            AIRFRA+NPGVWFLHCHLEVHTTWGLKMAF+VDNG GP+ES
Sbjct  511  AIRFRANNPGVWFLHCHLEVHTTWGLKMAFIVDNGNGPHES  551



>ref|XP_011032153.1| PREDICTED: laccase-4-like isoform X1 [Populus euphratica]
Length=523

 Score = 89.7 bits (221),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRF ADNPGVWF+HCHLEVHTTWGLKMAFVVDNGKGPNES+
Sbjct  472  AIRFIADNPGVWFMHCHLEVHTTWGLKMAFVVDNGKGPNESV  513



>emb|CDP14064.1| unnamed protein product [Coffea canephora]
Length=555

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 36/41 (88%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = -2

Query  451  IRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            IRFRADNPG+WF+HCHLEVHTTWGLKMAF+V+NG GPNESI
Sbjct  505  IRFRADNPGIWFMHCHLEVHTTWGLKMAFLVENGNGPNESI  545



>ref|XP_007220829.1| hypothetical protein PRUPE_ppa027203mg [Prunus persica]
 gb|EMJ22028.1| hypothetical protein PRUPE_ppa027203mg [Prunus persica]
Length=558

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPG+WFLHCHLEVHTTWGLKM F+V+NGKGPNE++
Sbjct  507  AIRFRADNPGIWFLHCHLEVHTTWGLKMPFLVENGKGPNETL  548



>ref|XP_010509229.1| PREDICTED: laccase-4-like [Camelina sativa]
Length=558

 Score = 90.1 bits (222),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAF+V+NGKGPN+SILPPP DLP C
Sbjct  507  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGPNQSILPPPKDLPKC  558



>emb|CAB69847.1| laccase-like protein [Arabidopsis thaliana]
Length=553

 Score = 90.1 bits (222),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAF+V+NGKGPN+SI
Sbjct  502  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGPNQSI  543



>ref|XP_004147923.1| PREDICTED: laccase-4-like [Cucumis sativus]
 ref|XP_004165325.1| PREDICTED: laccase-4-like [Cucumis sativus]
 gb|KGN54357.1| hypothetical protein Csa_4G308480 [Cucumis sativus]
Length=556

 Score = 90.1 bits (222),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAF+V+NGKGPN+SI
Sbjct  505  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGPNQSI  546



>ref|XP_002873023.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49282.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=559

 Score = 90.1 bits (222),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAF+V+NGKGPN+SILPPPSDLP C
Sbjct  508  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGPNQSILPPPSDLPKC  559



>emb|CAA74102.1| laccase [Populus trichocarpa]
Length=437

 Score = 89.0 bits (219),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWFLHCHLEVHTTWGLKM FVVDNG+GP+ES+LPPPSDLP+C
Sbjct  386  AIRFRADNPGVWFLHCHLEVHTTWGLKMVFVVDNGEGPDESLLPPPSDLPNC  437



>ref|NP_195739.2| laccase 10 [Arabidopsis thaliana]
 sp|Q6ID18.1|LAC10_ARATH RecName: Full=Laccase-10; AltName: Full=Benzenediol:oxygen oxidoreductase 
10; AltName: Full=Diphenol oxidase 10; AltName: 
Full=Urishiol oxidase 10; Flags: Precursor [Arabidopsis thaliana]
 gb|AAT41838.1| At5g01190 [Arabidopsis thaliana]
 gb|AED90308.1| laccase 10 [Arabidopsis thaliana]
Length=558

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAF+V+NGKGPN+SI
Sbjct  507  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGPNQSI  548



>ref|XP_011032154.1| PREDICTED: laccase-4-like isoform X2 [Populus euphratica]
Length=556

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRF ADNPGVWF+HCHLEVHTTWGLKMAFVVDNGKGPNES+
Sbjct  505  AIRFIADNPGVWFMHCHLEVHTTWGLKMAFVVDNGKGPNESV  546



>emb|CDY48114.1| BnaC02g03710D [Brassica napus]
Length=559

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAF+V+NGKGPN+SI
Sbjct  508  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGPNQSI  549



>ref|XP_010505418.1| PREDICTED: laccase-4 [Camelina sativa]
Length=558

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAF+V+NGKGPN+SILPPP DLP C
Sbjct  507  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGPNQSILPPPKDLPKC  558



>ref|XP_006293932.1| hypothetical protein CARUB_v10022927mg [Capsella rubella]
 gb|EOA26830.1| hypothetical protein CARUB_v10022927mg [Capsella rubella]
Length=558

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAF+V+NGKGPN+SILPPP DLP C
Sbjct  507  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGPNQSILPPPKDLPKC  558



>ref|XP_002314124.1| hypothetical protein POPTR_0009s04720g [Populus trichocarpa]
 gb|EEE88079.1| hypothetical protein POPTR_0009s04720g [Populus trichocarpa]
Length=556

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRF ADNPGVWF+HCHLEVHTTWGLKMAFVVDNGKGPNES+
Sbjct  505  AIRFIADNPGVWFMHCHLEVHTTWGLKMAFVVDNGKGPNESV  546



>gb|KHG28836.1| Laccase-22 [Gossypium arboreum]
Length=574

 Score = 90.1 bits (222),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPG+WF HCHLEVHTTWGLKMAF+V+NGKGPNESI PPPSDLP C
Sbjct  523  AIRFRADNPGIWFFHCHLEVHTTWGLKMAFLVENGKGPNESIEPPPSDLPKC  574



>gb|KFK44563.1| hypothetical protein AALP_AA1G273400 [Arabis alpina]
Length=556

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAF+V+NGKGPN+SI
Sbjct  505  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGPNQSI  546



>ref|XP_003544123.1| PREDICTED: laccase-4-like [Glycine max]
Length=554

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNES  332
            AIRFRA+NPGVWFLHCHLEVHTTWGLKMAF+VDNG GP+ES
Sbjct  503  AIRFRANNPGVWFLHCHLEVHTTWGLKMAFIVDNGNGPHES  543



>ref|XP_010490598.1| PREDICTED: laccase-10-like isoform X1 [Camelina sativa]
 ref|XP_010490599.1| PREDICTED: laccase-10-like isoform X2 [Camelina sativa]
Length=558

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAF+V+NGKGPN+SILPPPSDLP C
Sbjct  507  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGPNQSILPPPSDLPKC  558



>ref|XP_010517091.1| PREDICTED: laccase-4-like [Camelina sativa]
Length=558

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAF+V+NGKGPN+SILPPP DLP C
Sbjct  507  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGPNQSILPPPKDLPKC  558



>ref|XP_010926015.1| PREDICTED: laccase-11-like [Elaeis guineensis]
Length=847

 Score = 90.5 bits (223),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 38/42 (90%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAFVV+NG GP ESI
Sbjct  796  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVENGNGPEESI  837



>ref|XP_011035200.1| PREDICTED: laccase-4 [Populus euphratica]
Length=556

 Score = 89.7 bits (221),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRF ADNPGVWF+HCHLEVHTTWGLKMAFVVDNGKGPNES+
Sbjct  505  AIRFIADNPGVWFMHCHLEVHTTWGLKMAFVVDNGKGPNESV  546



>ref|XP_010452014.1| PREDICTED: laccase-10 isoform X1 [Camelina sativa]
 ref|XP_010452015.1| PREDICTED: laccase-10 isoform X2 [Camelina sativa]
Length=559

 Score = 89.7 bits (221),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAF+V+NGKGPN+SILPPPSDLP C
Sbjct  508  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGPNQSILPPPSDLPKC  559



>ref|XP_010423919.1| PREDICTED: laccase-10-like [Camelina sativa]
Length=558

 Score = 89.7 bits (221),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAF+V+NGKGPN+SILPPPSDLP C
Sbjct  507  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGPNQSILPPPSDLPKC  558



>gb|KHG11130.1| Laccase-4 -like protein [Gossypium arboreum]
Length=503

 Score = 89.4 bits (220),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAF+V+NGKGPN+S++PPPSDLP C
Sbjct  452  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGPNQSLVPPPSDLPKC  503



>ref|XP_006363052.1| PREDICTED: laccase-4-like [Solanum tuberosum]
Length=561

 Score = 89.7 bits (221),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFR DNPGVWF+HCHLE+HTTWGLKMAF+VDNGKGPNES+
Sbjct  510  AIRFRTDNPGVWFMHCHLEIHTTWGLKMAFLVDNGKGPNESL  551



>ref|XP_011019150.1| PREDICTED: laccase-4 isoform X1 [Populus euphratica]
Length=559

 Score = 89.7 bits (221),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAF+VDNGKGP ES+LPPPSDLP C
Sbjct  508  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPKESLLPPPSDLPKC  559



>ref|XP_002308209.2| laccase family protein [Populus trichocarpa]
 gb|EEE91732.2| laccase family protein [Populus trichocarpa]
Length=559

 Score = 89.7 bits (221),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAF+VDNGKGP ES+LPPPSDLP C
Sbjct  508  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPKESLLPPPSDLPKC  559



>ref|XP_006387495.1| hypothetical protein POPTR_0958s00200g [Populus trichocarpa]
 gb|ERP46409.1| hypothetical protein POPTR_0958s00200g [Populus trichocarpa]
Length=559

 Score = 89.7 bits (221),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAF+VDNGKGP ES+LPPPSDLP C
Sbjct  508  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPKESLLPPPSDLPKC  559



>ref|XP_007016183.1| Laccase/Diphenol oxidase family protein [Theobroma cacao]
 gb|EOY33802.1| Laccase/Diphenol oxidase family protein [Theobroma cacao]
Length=557

 Score = 89.7 bits (221),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAFVVDNG GPNE++LPPPSDLP C
Sbjct  506  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVDNGNGPNETLLPPPSDLPKC  557



>ref|XP_002308208.2| laccase family protein [Populus trichocarpa]
 gb|EEE91731.2| laccase family protein [Populus trichocarpa]
Length=558

 Score = 89.7 bits (221),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAF+VDNGKGP ES+
Sbjct  507  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPKESL  548



>ref|XP_008457399.1| PREDICTED: laccase-4 [Cucumis melo]
Length=562

 Score = 89.7 bits (221),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAFVVDNG+GP ES+LPPPSDLP C
Sbjct  511  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVDNGRGPEESLLPPPSDLPKC  562



>ref|XP_006429309.1| hypothetical protein CICLE_v10011400mg [Citrus clementina]
 ref|XP_006480970.1| PREDICTED: laccase-4-like [Citrus sinensis]
 gb|ESR42549.1| hypothetical protein CICLE_v10011400mg [Citrus clementina]
Length=555

 Score = 89.7 bits (221),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRF ADNPGVWF+HCHLEVHTTWGLKMAF+VDNGKGPNES+LPPPSDLP C
Sbjct  504  AIRFSADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNESLLPPPSDLPKC  555



>gb|EPS61127.1| laccase 3, partial [Genlisea aurea]
Length=551

 Score = 89.4 bits (220),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPG+WFLHCHLEVHTTWGLKMAF+V+NG+GPN +I
Sbjct  500  AIRFRADNPGIWFLHCHLEVHTTWGLKMAFLVENGEGPNATI  541



>ref|XP_011019151.1| PREDICTED: laccase-4 isoform X2 [Populus euphratica]
Length=558

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAF+VDNGKGP ES+
Sbjct  507  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPKESL  548



>ref|XP_009392410.1| PREDICTED: laccase-11 [Musa acuminata subsp. malaccensis]
Length=559

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLEVHT+WGLKMAFVV+NG GP ESI
Sbjct  508  AIRFRADNPGVWFMHCHLEVHTSWGLKMAFVVENGDGPEESI  549



>ref|XP_004246339.1| PREDICTED: laccase-4 [Solanum lycopersicum]
Length=561

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLE+HTTWGLKMAF+V+NGKGPNES+
Sbjct  510  AIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVENGKGPNESL  551



>gb|AAC49537.1| diphenol oxidase, partial [Nicotiana tabacum]
Length=91

 Score = 83.6 bits (205),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIR+RADNPGVWF+HCHLEVHTTWGLKMAF+VDNGKG NES+LPPP DLP C
Sbjct  40   AIRWRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGSNESLLPPPKDLPKC  91



>ref|XP_002299828.2| hypothetical protein POPTR_0001s25580g [Populus trichocarpa]
 gb|EEE84633.2| hypothetical protein POPTR_0001s25580g [Populus trichocarpa]
Length=557

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRF ADNPGVWF+HCHLEVHTTWGLKMAFVVDNGKGPNES+
Sbjct  506  AIRFIADNPGVWFMHCHLEVHTTWGLKMAFVVDNGKGPNESV  547



>ref|XP_010067496.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 gb|KCW65638.1| hypothetical protein EUGRSUZ_G03028 [Eucalyptus grandis]
Length=561

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWFLHCHLEVHTTWGLKM F+V++G GPNES+
Sbjct  510  AIRFRADNPGVWFLHCHLEVHTTWGLKMVFIVEDGDGPNESL  551



>ref|XP_006602641.1| PREDICTED: laccase-4-like isoform X1 [Glycine max]
Length=560

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            A RFRADNPGVWFLHCH EVHTTWGLKMAF+VDNGKGPNES+
Sbjct  509  AFRFRADNPGVWFLHCHFEVHTTWGLKMAFLVDNGKGPNESL  550



>ref|XP_002311202.1| laccase family protein [Populus trichocarpa]
 gb|EEE88569.1| laccase family protein [Populus trichocarpa]
Length=556

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWFLHCHLEVHTTWGLKM FVVDNG+GP+ES+
Sbjct  505  AIRFRADNPGVWFLHCHLEVHTTWGLKMVFVVDNGEGPDESL  546



>ref|XP_010101806.1| hypothetical protein L484_023595 [Morus notabilis]
 gb|EXB89943.1| hypothetical protein L484_023595 [Morus notabilis]
Length=558

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRF ADNPGVWF+HCHLEVHTTWGLKMAF+VDNGKGPNES++PPPSDLP C
Sbjct  507  AIRFLADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNESLIPPPSDLPKC  558



>ref|XP_009416212.1| PREDICTED: laccase-22-like [Musa acuminata subsp. malaccensis]
Length=562

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWFLHCH EVHT+WGLKMAFVVD+GKG NES+
Sbjct  511  AIRFRADNPGVWFLHCHFEVHTSWGLKMAFVVDDGKGTNESL  552



>ref|XP_010037723.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 gb|KCW49475.1| hypothetical protein EUGRSUZ_K02996 [Eucalyptus grandis]
Length=562

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRF ADNPGVWFLHCHLEVHTTWGLKMAF+VDNGKGP E++
Sbjct  511  AIRFTADNPGVWFLHCHLEVHTTWGLKMAFLVDNGKGPKETL  552



>gb|KHN24301.1| Laccase-4 [Glycine soja]
Length=522

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            A RFRADNPGVWFLHCH EVHTTWGLKMAF+VDNGKGPNES+
Sbjct  471  AFRFRADNPGVWFLHCHFEVHTTWGLKMAFLVDNGKGPNESL  512



>ref|XP_006878556.1| hypothetical protein AMTR_s00011p00235480 [Amborella trichopoda]
 gb|ERM94701.1| hypothetical protein AMTR_s00011p00235480 [Amborella trichopoda]
Length=556

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAFVV++GKGP +S+
Sbjct  505  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVEDGKGPQQSV  546



>ref|XP_010690098.1| PREDICTED: laccase-4-like [Beta vulgaris subsp. vulgaris]
Length=565

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 35/42 (83%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLEVHT+WGLKMAF+++NG GPN+SI
Sbjct  514  AIRFRADNPGVWFMHCHLEVHTSWGLKMAFLIENGDGPNKSI  555



>gb|ACN39933.1| unknown [Picea sitchensis]
Length=559

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAFVV+NG GPN+SILPPP DLP C
Sbjct  508  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVENGDGPNQSILPPPKDLPKC  559



>ref|XP_004163861.1| PREDICTED: laccase-4-like [Cucumis sativus]
Length=559

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLE+HTTWGLKMAF+V+NGKGPN+S+LPPP+DLP C
Sbjct  508  AIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVENGKGPNQSLLPPPTDLPKC  559



>ref|XP_004137913.1| PREDICTED: laccase-4-like [Cucumis sativus]
 gb|KGN58791.1| hypothetical protein Csa_3G732490 [Cucumis sativus]
Length=559

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLE+HTTWGLKMAF+V+NGKGPN+S+LPPP+DLP C
Sbjct  508  AIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVENGKGPNQSLLPPPTDLPKC  559



>ref|XP_003604619.1| Laccase 1a [Medicago truncatula]
 gb|AES86816.1| laccase/diphenol oxidase family protein [Medicago truncatula]
Length=557

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAF+VDNGKGP +S++ PP DLP C
Sbjct  506  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPKQSVIAPPKDLPKC  557



>gb|EYU41858.1| hypothetical protein MIMGU_mgv1a003895mg [Erythranthe guttata]
Length=557

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRF ADNPGVWF+HCHLEVHTTWGLKMAF+VDNGKGPN+SI
Sbjct  506  AIRFLADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNQSI  547



>ref|XP_008442464.1| PREDICTED: LOW QUALITY PROTEIN: laccase-4-like [Cucumis melo]
Length=559

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLE+HTTWGLKMAF+V+NGKGPN+S+
Sbjct  508  AIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVENGKGPNQSL  549



>emb|CDX91428.1| BnaC04g07220D [Brassica napus]
Length=558

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/51 (88%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = -2

Query  451  IRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            IRFRADNPGVWF+HCHLEVHTTWGLKMAF+V+NGKGPN+SILPPP DLP C
Sbjct  508  IRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGPNQSILPPPKDLPKC  558



>ref|XP_009143427.1| PREDICTED: laccase-4 [Brassica rapa]
Length=561

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/51 (88%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = -2

Query  451  IRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            IRFRADNPGVWF+HCHLEVHTTWGLKMAF+V+NGKGPN+SILPPP DLP C
Sbjct  511  IRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGPNQSILPPPKDLPKC  561



>emb|CDX74915.1| BnaA05g06610D [Brassica napus]
Length=558

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/51 (88%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = -2

Query  451  IRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            IRFRADNPGVWF+HCHLEVHTTWGLKMAF+V+NGKGPN+SILPPP DLP C
Sbjct  508  IRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGPNQSILPPPKDLPKC  558



>emb|CDP06511.1| unnamed protein product [Coffea canephora]
Length=561

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAF+VDNGKG NES+LPPPSDLP C
Sbjct  510  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGTNESLLPPPSDLPKC  561



>gb|EPS65618.1| hypothetical protein M569_09159, partial [Genlisea aurea]
Length=539

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 35/42 (83%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLEVHTTWGLKM F+V+NG GPN+S+
Sbjct  488  AIRFRADNPGVWFMHCHLEVHTTWGLKMVFLVENGNGPNQSV  529



>emb|CDX93330.1| BnaC04g45660D [Brassica napus]
Length=560

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = -2

Query  451  IRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            IRFRADNPGVWF+HCHLEVHTTWGLKMAF+V+NGKGPN+SI
Sbjct  510  IRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGPNQSI  550



>ref|NP_565881.1| laccase-4 [Arabidopsis thaliana]
 sp|O80434.2|LAC4_ARATH RecName: Full=Laccase-4; AltName: Full=Benzenediol:oxygen oxidoreductase 
4; AltName: Full=Diphenol oxidase 4; AltName: Full=Protein 
IRREGULAR XYLEM 12; AltName: Full=Urishiol oxidase 
4; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK96573.1| At2g38080/T8P21 [Arabidopsis thaliana]
 gb|AAL36080.1| At2g38080/T8P21 [Arabidopsis thaliana]
 gb|AAL38363.1| putative diphenol oxidase [Arabidopsis thaliana]
 gb|AAC27158.2| putative diphenol oxidase [Arabidopsis thaliana]
 gb|AAM47955.1| putative diphenol oxidase [Arabidopsis thaliana]
 gb|AEC09487.1| laccase-4 [Arabidopsis thaliana]
Length=558

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/51 (88%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = -2

Query  451  IRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            IRFRADNPGVWF+HCHLEVHTTWGLKMAF+V+NGKGPN+SILPPP DLP C
Sbjct  508  IRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGPNQSILPPPKDLPKC  558



>ref|XP_009141718.1| PREDICTED: laccase-4-like [Brassica rapa]
Length=559

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = -2

Query  451  IRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            IRFRADNPGVWF+HCHLEVHTTWGLKMAF+V+NGKGPN+SI
Sbjct  509  IRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGPNQSI  549



>ref|XP_006411009.1| hypothetical protein EUTSA_v10016460mg [Eutrema salsugineum]
 gb|ESQ52462.1| hypothetical protein EUTSA_v10016460mg [Eutrema salsugineum]
Length=557

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = -2

Query  451  IRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            IRFRADNPGVWF+HCHLEVHTTWGLKMAF+V+NGKGPN+SI
Sbjct  507  IRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGPNQSI  547



>ref|XP_002879726.1| IRX12/LAC4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55985.1| IRX12/LAC4 [Arabidopsis lyrata subsp. lyrata]
Length=557

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = -2

Query  451  IRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            IRFRADNPGVWF+HCHLEVHTTWGLKMAF+V+NGKGPN+SI
Sbjct  507  IRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGPNQSI  547



>emb|CDY18406.1| BnaA04g21810D [Brassica napus]
Length=559

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = -2

Query  451  IRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            IRFRADNPGVWF+HCHLEVHTTWGLKMAF+V+NGKGPN+SI
Sbjct  509  IRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGPNQSI  549



>gb|KFK36706.1| hypothetical protein AALP_AA4G158700 [Arabis alpina]
Length=560

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/51 (88%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = -2

Query  451  IRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            IRFRADNPGVWF+HCHLEVHTTWGLKMAF+V+NGKGPN+SILPPP DLP C
Sbjct  510  IRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGPNQSILPPPKDLPKC  560



>ref|XP_009799024.1| PREDICTED: laccase-4-like [Nicotiana sylvestris]
Length=557

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLE+HTTWGLKMA++VDNGKGPNES+LPPP DLP C
Sbjct  506  AIRFRADNPGVWFMHCHLEIHTTWGLKMAWLVDNGKGPNESLLPPPKDLPKC  557



>ref|XP_009624727.1| PREDICTED: laccase-4-like [Nicotiana tomentosiformis]
Length=557

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLE+HTTWGLKMA++VDNGKGPNES+
Sbjct  506  AIRFRADNPGVWFMHCHLEIHTTWGLKMAWLVDNGKGPNESL  547



>ref|XP_004150626.1| PREDICTED: laccase-4-like [Cucumis sativus]
 ref|XP_004169234.1| PREDICTED: laccase-4-like [Cucumis sativus]
Length=517

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAFVV+NG+GP ES+LPPPSDLP C
Sbjct  466  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVNNGRGPEESLLPPPSDLPKC  517



>gb|AAC49536.1| diphenol oxidase [Nicotiana tabacum]
Length=557

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLE+HTTWGLKMA++VDNGKGPNES+
Sbjct  506  AIRFRADNPGVWFMHCHLEIHTTWGLKMAWLVDNGKGPNESL  547



>ref|XP_010543748.1| PREDICTED: laccase-22-like [Tarenaya hassleriana]
Length=555

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 35/42 (83%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF HCHLEVHT+WGLKM F+V+NGKGPNE++
Sbjct  504  AIRFRADNPGVWFFHCHLEVHTSWGLKMVFLVENGKGPNETL  545



>ref|XP_010685615.1| PREDICTED: laccase-4 [Beta vulgaris subsp. vulgaris]
Length=560

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWFLHCHLE+HTTWGLKMAF+VDNGKG NES+
Sbjct  509  AIRFRADNPGVWFLHCHLEIHTTWGLKMAFLVDNGKGLNESL  550



>ref|XP_010907627.1| PREDICTED: laccase-22-like [Elaeis guineensis]
Length=554

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 37/41 (90%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNES  332
            AIRF ADNPGVWF+HCHLEVHTTWGLKMAFVVDNG GP+ES
Sbjct  503  AIRFSADNPGVWFMHCHLEVHTTWGLKMAFVVDNGIGPDES  543



>ref|XP_008800741.1| PREDICTED: laccase-11-like [Phoenix dactylifera]
Length=973

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 35/42 (83%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLE+HT+WGLKMAFVV+NG GP +SI
Sbjct  922  AIRFRADNPGVWFMHCHLELHTSWGLKMAFVVENGNGPEQSI  963



>ref|XP_004159811.1| PREDICTED: laccase-4-like [Cucumis sativus]
Length=355

 Score = 85.9 bits (211),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 36/40 (90%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNE  335
            AIRFRADNPGVWFLHCHLEVHTTWGL+MAF+V+NG+GPNE
Sbjct  304  AIRFRADNPGVWFLHCHLEVHTTWGLRMAFLVENGEGPNE  343



>gb|KGN65788.1| hypothetical protein Csa_1G528530 [Cucumis sativus]
Length=562

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAFVV+NG+GP ES+LPPPSDLP C
Sbjct  511  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVNNGRGPEESLLPPPSDLPKC  562



>ref|XP_009370205.1| PREDICTED: laccase-4 [Pyrus x bretschneideri]
Length=559

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRF ADNPGVWF+HCHLEVHTTWGLKMAF+VDNGKGPN+S+
Sbjct  508  AIRFIADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNQSL  549



>ref|XP_008377498.1| PREDICTED: laccase-4-like [Malus domestica]
Length=559

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRF ADNPGVWF+HCHLEVHTTWGLKMAF+VDNGKGPN+S+
Sbjct  508  AIRFIADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNQSL  549



>ref|XP_008388134.1| PREDICTED: laccase-4-like [Malus domestica]
Length=559

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRF ADNPGVWF+HCHLEVHTTWGLKMAF+VDNGKGPN+S+
Sbjct  508  AIRFVADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNQSL  549



>ref|XP_009789474.1| PREDICTED: laccase-4-like isoform X2 [Nicotiana sylvestris]
Length=524

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRA+NPG+WFLHCHLEVHTTWGLKMAFVVDNG GP ES+LPPP DLP+C
Sbjct  473  AIRFRANNPGIWFLHCHLEVHTTWGLKMAFVVDNGNGPEESLLPPPKDLPTC  524



>ref|XP_010107530.1| hypothetical protein L484_024383 [Morus notabilis]
 gb|EXC16212.1| hypothetical protein L484_024383 [Morus notabilis]
Length=559

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLE+HT WGLKMAFVV+NGK P+ESI
Sbjct  508  AIRFRADNPGVWFMHCHLELHTMWGLKMAFVVENGKSPSESI  549



>ref|XP_009358852.1| PREDICTED: laccase-4-like [Pyrus x bretschneideri]
Length=559

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRF ADNPGVWF+HCHLEVHTTWGLKMAF+VDNGKGPN+S+
Sbjct  508  AIRFIADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNQSL  549



>gb|KCW52562.1| hypothetical protein EUGRSUZ_J01941, partial [Eucalyptus grandis]
Length=524

 Score = 87.0 bits (214),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAFVVD+G+GP++S+LPPPSDLP C
Sbjct  473  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVDDGEGPDQSLLPPPSDLPKC  524



>gb|KHN04832.1| Laccase-4 [Glycine soja]
Length=524

 Score = 87.0 bits (214),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            A RFRADNPGVWF+HCHLEVHTTWGLKMAF+VDNGKGP +S++PPP DLP C
Sbjct  473  AFRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPKQSVIPPPKDLPKC  524



>gb|EAZ12812.1| hypothetical protein OsJ_02731 [Oryza sativa Japonica Group]
Length=562

 Score = 87.0 bits (214),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 35/42 (83%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWFLHCHLEVHT+WGLKMAF+V++G GP+ES+
Sbjct  511  AIRFRADNPGVWFLHCHLEVHTSWGLKMAFLVEDGSGPDESV  552



>ref|XP_010033027.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
Length=553

 Score = 87.0 bits (214),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAFVVD+G+GP++S+LPPPSDLP C
Sbjct  502  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVDDGEGPDQSLLPPPSDLPKC  553



>gb|EYU26646.1| hypothetical protein MIMGU_mgv1a003805mg [Erythranthe guttata]
Length=563

 Score = 87.0 bits (214),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRF ADNPGVWF+HCHLEVHTTWGLKMAF+VDNGK PNES+
Sbjct  512  AIRFLADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKSPNESV  553



>ref|XP_009789473.1| PREDICTED: laccase-4-like isoform X1 [Nicotiana sylvestris]
Length=557

 Score = 87.0 bits (214),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRA+NPG+WFLHCHLEVHTTWGLKMAFVVDNG GP ES+LPPP DLP+C
Sbjct  506  AIRFRANNPGIWFLHCHLEVHTTWGLKMAFVVDNGNGPEESLLPPPKDLPTC  557



>ref|XP_003516941.1| PREDICTED: laccase-4-like [Glycine max]
Length=557

 Score = 87.0 bits (214),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            A RFRADNPGVWF+HCHLEVHTTWGLKMAF+VDNGKGP +S+
Sbjct  506  AFRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPKQSV  547



>ref|XP_002275392.1| PREDICTED: laccase-11 [Vitis vinifera]
 emb|CBI30020.3| unnamed protein product [Vitis vinifera]
Length=557

 Score = 87.0 bits (214),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLE+HT WGLKMAFVV+NGK P ESI
Sbjct  506  AIRFRADNPGVWFMHCHLELHTMWGLKMAFVVENGKSPEESI  547



>ref|XP_003522150.1| PREDICTED: laccase-4-like [Glycine max]
 gb|KHN02155.1| Laccase-4 [Glycine soja]
Length=557

 Score = 87.0 bits (214),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            A RFRADNPGVWF+HCHLEVHTTWGLKMAF+VDNGKGP +S+
Sbjct  506  AFRFRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPKQSV  547



>ref|XP_010676357.1| PREDICTED: laccase-4-like [Beta vulgaris subsp. vulgaris]
Length=561

 Score = 87.0 bits (214),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF HCHLE+HTTWGLKMAF+VD+GKGP+ES+
Sbjct  510  AIRFRADNPGVWFFHCHLEIHTTWGLKMAFLVDDGKGPSESL  551



>ref|XP_004506788.1| PREDICTED: laccase-4-like [Cicer arietinum]
Length=557

 Score = 86.7 bits (213),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLE+HTTWGLKMAF+VDNG+GP +S+
Sbjct  506  AIRFRADNPGVWFMHCHLEIHTTWGLKMAFLVDNGQGPKQSL  547



>ref|XP_004969263.1| PREDICTED: laccase-2-like [Setaria italica]
Length=566

 Score = 86.7 bits (213),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 35/42 (83%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWFLHCHLEVHT+WGLKMAF+V++G GP+ES+
Sbjct  515  AIRFRADNPGVWFLHCHLEVHTSWGLKMAFLVEDGDGPDESV  556



>ref|XP_007141799.1| hypothetical protein PHAVU_008G226700g [Phaseolus vulgaris]
 gb|ESW13793.1| hypothetical protein PHAVU_008G226700g [Phaseolus vulgaris]
Length=553

 Score = 86.7 bits (213),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 36/41 (88%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNES  332
            AIRFRA+NPGVWFLHCHLEVHTTWGLKMAF+VDNG  P+ES
Sbjct  502  AIRFRANNPGVWFLHCHLEVHTTWGLKMAFIVDNGNSPHES  542



>ref|XP_008233715.1| PREDICTED: laccase-4-like [Prunus mume]
Length=558

 Score = 86.7 bits (213),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 35/42 (83%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPG+WFLHCHLEVHTTWGLKM F+V+NGKG NE++
Sbjct  507  AIRFRADNPGIWFLHCHLEVHTTWGLKMPFLVENGKGANETL  548



>gb|KDO50695.1| hypothetical protein CISIN_1g036540mg [Citrus sinensis]
Length=562

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/42 (83%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLE+HT WGLKMAFVV+NGK P++SI
Sbjct  511  AIRFRADNPGVWFMHCHLELHTMWGLKMAFVVENGKSPDQSI  552



>emb|CDY70510.1| BnaAnng33960D, partial [Brassica napus]
Length=194

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRF ADNPGVWF+HCHLE+HTTWGLKMAFVVDNG GP++S+LPPP+DLP C
Sbjct  143  AIRFIADNPGVWFMHCHLEIHTTWGLKMAFVVDNGHGPDQSLLPPPADLPKC  194



>ref|XP_006428774.1| hypothetical protein CICLE_v10013446mg [Citrus clementina]
 ref|XP_006481839.1| PREDICTED: laccase-11-like [Citrus sinensis]
 gb|ESR42014.1| hypothetical protein CICLE_v10013446mg [Citrus clementina]
Length=562

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/42 (83%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLE+HT WGLKMAFVV+NGK P++SI
Sbjct  511  AIRFRADNPGVWFMHCHLELHTMWGLKMAFVVENGKSPDQSI  552



>ref|XP_008811561.1| PREDICTED: laccase-11-like [Phoenix dactylifera]
Length=541

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLE+HTTWGLKMAFVV+NG GP ESI
Sbjct  490  AIRFRADNPGVWFMHCHLELHTTWGLKMAFVVENGNGPEESI  531



>ref|XP_006350822.1| PREDICTED: laccase-4-like [Solanum tuberosum]
Length=559

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRA+NPGVWF HCHLEVHTTWGLKMAFVV+NG GPNES+
Sbjct  508  AIRFRANNPGVWFFHCHLEVHTTWGLKMAFVVNNGNGPNESL  549



>ref|XP_004302643.1| PREDICTED: laccase-4-like [Fragaria vesca subsp. vesca]
Length=561

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRF ADNPGVWF+HCHLEVHT+WGLKMAF+VDNGKGPN+S+LPPP DLP+C
Sbjct  510  AIRFIADNPGVWFMHCHLEVHTSWGLKMAFLVDNGKGPNQSLLPPPKDLPTC  561



>ref|XP_004241179.1| PREDICTED: laccase-4-like [Solanum lycopersicum]
Length=560

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRA+NPGVWF HCHLEVHTTWGLKMAFVV+NG GPNES+
Sbjct  509  AIRFRANNPGVWFFHCHLEVHTTWGLKMAFVVNNGNGPNESL  550



>ref|XP_010543228.1| PREDICTED: laccase-10 [Tarenaya hassleriana]
Length=558

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWFLHCHLEVHT+WGLKMAF+V++G GPN+SILPPPSDLP C
Sbjct  507  AIRFRADNPGVWFLHCHLEVHTSWGLKMAFLVEDGNGPNQSILPPPSDLPKC  558



>ref|XP_011094977.1| PREDICTED: laccase-4-like [Sesamum indicum]
Length=558

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRF ADNPGVWF+HCHLEVHTTWGLKMAF+V+NG GPNESI
Sbjct  507  AIRFLADNPGVWFMHCHLEVHTTWGLKMAFLVENGNGPNESI  548



>dbj|BAN10308.1| laccase [Chamaecyparis obtusa]
Length=555

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/42 (83%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAFVV+NG G  +S+
Sbjct  504  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFVVENGNGAEQSV  545



>ref|XP_007042164.1| Laccase 11 [Theobroma cacao]
 gb|EOX97995.1| Laccase 11 [Theobroma cacao]
Length=837

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/42 (83%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLE+HT WGLK AFVV+NGKGP++SI
Sbjct  786  AIRFRADNPGVWFMHCHLELHTGWGLKTAFVVENGKGPDQSI  827



>ref|XP_011077581.1| PREDICTED: laccase-4-like [Sesamum indicum]
Length=557

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRF ADNPGVWF+HCHLEVHTTWGLKMAF+VDNGKGPNE +
Sbjct  506  AIRFLADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNEVL  547



>ref|XP_003632636.1| PREDICTED: laccase-11 [Vitis vinifera]
 emb|CBI32739.3| unnamed protein product [Vitis vinifera]
Length=562

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/42 (83%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLE+HT WGLKMAFVV+NGK P ES+
Sbjct  511  AIRFRADNPGVWFMHCHLELHTMWGLKMAFVVENGKSPEESV  552



>ref|XP_006401026.1| hypothetical protein EUTSA_v10013285mg [Eutrema salsugineum]
 gb|ESQ42479.1| hypothetical protein EUTSA_v10013285mg [Eutrema salsugineum]
Length=512

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 34/42 (81%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRF ADNPGVWF+HCHLE+HT+WGLKMAFVVDNG GP++S+
Sbjct  461  AIRFLADNPGVWFMHCHLEIHTSWGLKMAFVVDNGHGPDQSL  502



>gb|KDP29119.1| hypothetical protein JCGZ_16508 [Jatropha curcas]
Length=349

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLE+HT WGLKMAFVV+NGK P++SILPPP DLP C
Sbjct  298  AIRFRADNPGVWFMHCHLELHTMWGLKMAFVVENGKLPDQSILPPPKDLPPC  349



>ref|XP_009787551.1| PREDICTED: laccase-4-like [Nicotiana sylvestris]
Length=554

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIR+RADNPGVWF+HCHLEVHTTWGLKMAF+VDNGKG NES+
Sbjct  503  AIRWRADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGSNESL  544



>ref|XP_008441433.1| PREDICTED: laccase-4-like [Cucumis melo]
Length=553

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/40 (90%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNE  335
            AIRFRADNPGVWFLHCHLEVHTTWGL+MAF+V+NG+GPNE
Sbjct  502  AIRFRADNPGVWFLHCHLEVHTTWGLRMAFLVENGEGPNE  541



>ref|XP_004138572.1| PREDICTED: LOW QUALITY PROTEIN: laccase-4-like [Cucumis sativus]
Length=561

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/40 (90%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNE  335
            AIRFRADNPGVWFLHCHLEVHTTWGL+MAF+V+NG+GPNE
Sbjct  510  AIRFRADNPGVWFLHCHLEVHTTWGLRMAFLVENGEGPNE  549



>ref|XP_008797558.1| PREDICTED: laccase-11-like [Phoenix dactylifera]
Length=859

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLE+HTTWGLKMAFVV+NG GP ESI
Sbjct  808  AIRFRADNPGVWFMHCHLELHTTWGLKMAFVVENGNGPEESI  849



>gb|KGN45770.1| hypothetical protein Csa_6G009490 [Cucumis sativus]
Length=555

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/40 (90%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNE  335
            AIRFRADNPGVWFLHCHLEVHTTWGL+MAF+V+NG+GPNE
Sbjct  504  AIRFRADNPGVWFLHCHLEVHTTWGLRMAFLVENGEGPNE  543



>sp|Q0IQU1.2|LAC22_ORYSJ RecName: Full=Laccase-22; AltName: Full=Benzenediol:oxygen oxidoreductase 
22; AltName: Full=Diphenol oxidase 22; AltName: 
Full=Urishiol oxidase 22; Flags: Precursor [Oryza sativa Japonica 
Group]
 gb|AAX95423.1| laccase (EC 1.10.3.2) precursor - common tobacco [Oryza sativa 
Japonica Group]
 gb|ABA95532.1| Multicopper oxidase family protein, expressed [Oryza sativa Japonica 
Group]
 gb|EAZ19339.1| hypothetical protein OsJ_34890 [Oryza sativa Japonica Group]
Length=564

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 34/42 (81%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFR+DNPGVWF+HCH EVHT+WGLKMAFVVDNGK P+E++
Sbjct  513  AIRFRSDNPGVWFMHCHFEVHTSWGLKMAFVVDNGKRPSETL  554



>gb|KDP41783.1| hypothetical protein JCGZ_26801 [Jatropha curcas]
Length=840

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 33/42 (79%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            A+RFRADNPGVWF+HCHLE+HT+WGLK AFVV+NG GP+ES+
Sbjct  789  AVRFRADNPGVWFMHCHLELHTSWGLKTAFVVENGNGPDESV  830



>ref|XP_010535416.1| PREDICTED: laccase-16 [Tarenaya hassleriana]
 ref|XP_010535417.1| PREDICTED: laccase-16 [Tarenaya hassleriana]
 ref|XP_010535418.1| PREDICTED: laccase-16 [Tarenaya hassleriana]
 ref|XP_010535419.1| PREDICTED: laccase-16 [Tarenaya hassleriana]
Length=568

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRF ADNPGVWF+HCHLE+HTTWGLKMAFVVDNG GPN S+LPPP+DLP C
Sbjct  517  AIRFTADNPGVWFMHCHLEIHTTWGLKMAFVVDNGDGPNHSLLPPPADLPKC  568



>ref|XP_006840270.1| hypothetical protein AMTR_s00045p00045490 [Amborella trichopoda]
 gb|ERN01945.1| hypothetical protein AMTR_s00045p00045490 [Amborella trichopoda]
Length=565

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNES  332
            A RF ADNPGVWF+HCHLE+HTTWGLKMAFVVDNGKGPN+S
Sbjct  514  AFRFIADNPGVWFMHCHLEIHTTWGLKMAFVVDNGKGPNQS  554



>ref|XP_011080855.1| PREDICTED: laccase-4 [Sesamum indicum]
Length=554

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRF ADNPGVWFLHCHLEVHT+WGLKMAF+V+NGKGPN+S+
Sbjct  503  AIRFIADNPGVWFLHCHLEVHTSWGLKMAFIVENGKGPNQSL  544



>ref|XP_006663136.1| PREDICTED: laccase-22-like [Oryza brachyantha]
Length=566

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 34/42 (81%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCH EVHT+WGLKM FVVDNGK P+E++
Sbjct  515  AIRFRADNPGVWFMHCHFEVHTSWGLKMVFVVDNGKRPSETL  556



>sp|Q8RYM9.1|LAC2_ORYSJ RecName: Full=Laccase-2; AltName: Full=Benzenediol:oxygen oxidoreductase 
2; AltName: Full=Diphenol oxidase 2; AltName: Full=Urishiol 
oxidase 2; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAB90733.1| putative laccase [Oryza sativa Japonica Group]
Length=562

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWFLHCHLEVHT+WGLKMAF+V++G GP+ES+LPPP DLP C
Sbjct  511  AIRFRADNPGVWFLHCHLEVHTSWGLKMAFLVEDGSGPDESVLPPPKDLPKC  562



>ref|XP_008392913.1| PREDICTED: laccase-4-like [Malus domestica]
Length=558

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 34/41 (83%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNES  332
            AIRFRA+NPG+WFLHCHLEVHT+WGLKMAF+V+NG+G NES
Sbjct  507  AIRFRANNPGIWFLHCHLEVHTSWGLKMAFLVENGEGQNES  547



>ref|XP_009350996.1| PREDICTED: laccase-4-like [Pyrus x bretschneideri]
Length=558

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 34/41 (83%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNES  332
            AIRFRA+NPG+WFLHCHLEVHT+WGLKMAF+V+NG+G NES
Sbjct  507  AIRFRANNPGIWFLHCHLEVHTSWGLKMAFLVENGEGQNES  547



>gb|AAC49538.1| diphenol oxidase, partial [Nicotiana tabacum]
Length=409

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIR+ ADNPGVWF+HCHLEVHTTWGLKMAF+VDNGKGP ES+LPPP DLP C
Sbjct  358  AIRWLADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPKESLLPPPKDLPKC  409



>gb|EMT26873.1| Laccase-22 [Aegilops tauschii]
Length=563

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 34/42 (81%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCH EVHT+WGLKM FVVDNGK P+E++
Sbjct  512  AIRFRADNPGVWFMHCHFEVHTSWGLKMVFVVDNGKRPSETL  553



>dbj|BAJ98144.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=564

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 34/42 (81%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCH EVHT+WGLKM FVVDNGK P+E++
Sbjct  513  AIRFRADNPGVWFMHCHFEVHTSWGLKMVFVVDNGKRPSETL  554



>emb|CBI17500.3| unnamed protein product [Vitis vinifera]
Length=542

 Score = 84.3 bits (207),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 33/42 (79%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLE+HT WGLKMAFVV++G+GP++S+
Sbjct  491  AIRFRADNPGVWFMHCHLELHTGWGLKMAFVVEDGEGPDQSV  532



>ref|XP_002266464.1| PREDICTED: laccase-11 [Vitis vinifera]
Length=563

 Score = 84.3 bits (207),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 33/42 (79%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLE+HT WGLKMAFVV++G+GP++S+
Sbjct  512  AIRFRADNPGVWFMHCHLELHTGWGLKMAFVVEDGEGPDQSV  553



>ref|XP_009589148.1| PREDICTED: laccase-4-like [Nicotiana tomentosiformis]
Length=557

 Score = 84.3 bits (207),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRF A+NPG+WFLHCHLEVHTTWGLKMAFVVDNG GP ES+LPPP DLP+C
Sbjct  506  AIRFTANNPGIWFLHCHLEVHTTWGLKMAFVVDNGNGPEESLLPPPIDLPTC  557



>ref|XP_007134763.1| hypothetical protein PHAVU_010G0738000g, partial [Phaseolus vulgaris]
 gb|ESW06757.1| hypothetical protein PHAVU_010G0738000g, partial [Phaseolus vulgaris]
Length=527

 Score = 84.3 bits (207),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCHLEVHTTWGLKMAF+V+NGKG  +S++ PP DLP C
Sbjct  476  AIRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGKGSKQSVIAPPKDLPKC  527



>ref|XP_010543401.1| PREDICTED: laccase-11-like [Tarenaya hassleriana]
Length=561

 Score = 84.3 bits (207),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLEVHT WGLKMAFVV+NGK P ES+
Sbjct  510  AIRFRADNPGVWFMHCHLEVHTMWGLKMAFVVENGKTPEESV  551



>emb|CDX80325.1| BnaC09g34170D [Brassica napus]
Length=570

 Score = 84.3 bits (207),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRF ADNPGVWF+HCHLE+HTTWGLKMAFVVDNG GP++S+LPPP+DLP C
Sbjct  519  AIRFIADNPGVWFMHCHLEIHTTWGLKMAFVVDNGHGPDQSLLPPPADLPKC  570



>ref|XP_009120399.1| PREDICTED: laccase-16 [Brassica rapa]
Length=565

 Score = 84.0 bits (206),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRF ADNPGVWF+HCHLE+HTTWGLKMAFVVDNG GP++S+LPPP+DLP C
Sbjct  514  AIRFIADNPGVWFMHCHLEIHTTWGLKMAFVVDNGHGPDQSLLPPPADLPKC  565



>ref|XP_010263632.1| PREDICTED: laccase-11-like [Nelumbo nucifera]
Length=871

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 34/42 (81%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLE+HT WGLKMAFVV++G GP++SI
Sbjct  820  AIRFRADNPGVWFMHCHLELHTGWGLKMAFVVEDGPGPDQSI  861



>gb|AAK37829.1|AF132125_1 laccase [Pinus taeda]
Length=555

 Score = 84.0 bits (206),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -2

Query  451  IRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            IRFRADNPGVWF+HCHLEVHTTWGLKMAF+V+NG GP +SI
Sbjct  505  IRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGHGPEQSI  545



>emb|CAN71338.1| hypothetical protein VITISV_008643 [Vitis vinifera]
Length=553

 Score = 84.0 bits (206),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 33/42 (79%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLE+HT WGLKMAFVV++G+GP++S+
Sbjct  502  AIRFRADNPGVWFMHCHLELHTGWGLKMAFVVEDGEGPDQSV  543



>ref|XP_010452196.1| PREDICTED: laccase-11 [Camelina sativa]
Length=561

 Score = 84.0 bits (206),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLEVHT WGLKMAFVV+NGK P  S+
Sbjct  510  AIRFRADNPGVWFMHCHLEVHTMWGLKMAFVVENGKTPELSV  551



>ref|XP_010423743.1| PREDICTED: laccase-11-like [Camelina sativa]
Length=561

 Score = 84.0 bits (206),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLEVHT WGLKMAFVV+NGK P  S+
Sbjct  510  AIRFRADNPGVWFMHCHLEVHTMWGLKMAFVVENGKTPELSV  551



>ref|XP_002873085.1| hypothetical protein ARALYDRAFT_487097 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49344.1| hypothetical protein ARALYDRAFT_487097 [Arabidopsis lyrata subsp. 
lyrata]
Length=557

 Score = 84.0 bits (206),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLEVHT WGLKMAFVV+NGK P  S+
Sbjct  506  AIRFRADNPGVWFMHCHLEVHTMWGLKMAFVVENGKTPELSV  547



>ref|XP_009593274.1| PREDICTED: laccase-4-like [Nicotiana tomentosiformis]
Length=554

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIR+ ADNPGVWF+HCHLEVHTTWGLKMAF+VDNGKGP ES+LPPP DLP C
Sbjct  503  AIRWLADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPKESLLPPPKDLPKC  554



>emb|CDO97037.1| unnamed protein product [Coffea canephora]
Length=566

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 33/42 (79%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLE+HT+WGLK AFVV+NG GP+++I
Sbjct  515  AIRFRADNPGVWFMHCHLELHTSWGLKTAFVVENGPGPDQTI  556



>ref|XP_004143251.1| PREDICTED: laccase-11-like [Cucumis sativus]
 ref|XP_004170658.1| PREDICTED: laccase-11-like [Cucumis sativus]
 gb|KGN48155.1| hypothetical protein Csa_6G445190 [Cucumis sativus]
Length=563

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLE+HT WGLKMAFVV+NGK   ESI
Sbjct  512  AIRFRADNPGVWFMHCHLELHTMWGLKMAFVVENGKSAEESI  553



>ref|NP_200699.1| laccase 16 [Arabidopsis thaliana]
 gb|AED97116.1| laccase 16 [Arabidopsis thaliana]
Length=523

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRF ADNPGVWF+HCHLE+HTTWGLKMAFVVDNG GP++S+LPPP+DLP C
Sbjct  472  AIRFIADNPGVWFMHCHLELHTTWGLKMAFVVDNGHGPDQSLLPPPADLPKC  523



>ref|XP_004972357.1| PREDICTED: laccase-2-like [Setaria italica]
Length=567

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWFLHCHLEVHT+WGL+MAF+V++G GP+ES+LPPP DLP C
Sbjct  516  AIRFRADNPGVWFLHCHLEVHTSWGLRMAFLVEDGDGPDESVLPPPKDLPEC  567



>ref|XP_008449246.1| PREDICTED: laccase-11 [Cucumis melo]
Length=563

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLE+HT WGLKMAFVV+NGK   ESI
Sbjct  512  AIRFRADNPGVWFMHCHLELHTMWGLKMAFVVENGKSAEESI  553



>gb|AAK37830.1|AF132126_1 laccase [Pinus taeda]
Length=577

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = -2

Query  451  IRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            IRFRADNPGVWF+HCHLEVHTTWGLKMAF+V+NG GP++S+LPPPSD P C
Sbjct  527  IRFRADNPGVWFMHCHLEVHTTWGLKMAFLVENGDGPDQSMLPPPSDFPKC  577



>gb|ABE66261.1| laccase/diphenol oxidase [Arabidopsis thaliana]
Length=530

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRF ADNPGVWF+HCHLE+HTTWGLKMAFVVDNG GP++S+LPPP+DLP C
Sbjct  479  AIRFIADNPGVWFMHCHLELHTTWGLKMAFVVDNGHGPDQSLLPPPADLPKC  530



>gb|ABK28766.1| unknown [Arabidopsis thaliana]
Length=531

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRF ADNPGVWF+HCHLE+HTTWGLKMAFVVDNG GP++S+LPPP+DLP C
Sbjct  479  AIRFIADNPGVWFMHCHLELHTTWGLKMAFVVDNGHGPDQSLLPPPADLPKC  530



>ref|XP_006282033.1| hypothetical protein CARUB_v10028274mg [Capsella rubella]
 gb|EOA14931.1| hypothetical protein CARUB_v10028274mg [Capsella rubella]
Length=530

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRF ADNPGVWF+HCHLE+HTTWGLKMAFVVDNG GP++S+LPPP+DLP C
Sbjct  479  AIRFIADNPGVWFMHCHLELHTTWGLKMAFVVDNGHGPDQSLLPPPADLPKC  530



>ref|XP_003558760.1| PREDICTED: laccase-22 [Brachypodium distachyon]
Length=561

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 33/42 (79%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCH EVHT+WGLKM FVV+NGK P+E++
Sbjct  510  AIRFRADNPGVWFMHCHFEVHTSWGLKMVFVVENGKRPSETL  551



>ref|XP_010443638.1| PREDICTED: laccase-16-like [Camelina sativa]
Length=568

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRF ADNPGVWF+HCHLE+HTTWGLKMAFVVDNG GP++S+LPPP+DLP C
Sbjct  517  AIRFIADNPGVWFMHCHLELHTTWGLKMAFVVDNGHGPDQSLLPPPADLPKC  568



>ref|XP_010454388.1| PREDICTED: laccase-16 [Camelina sativa]
Length=540

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRF ADNPGVWF+HCHLE+HTTWGLKMAFVVDNG GP++S+
Sbjct  489  AIRFIADNPGVWFMHCHLELHTTWGLKMAFVVDNGHGPDQSL  530



>sp|Q1PDH6.2|LAC16_ARATH RecName: Full=Laccase-16; AltName: Full=Benzenediol:oxygen oxidoreductase 
16; AltName: Full=Diphenol oxidase 16; AltName: 
Full=Urishiol oxidase 16; Flags: Precursor [Arabidopsis thaliana]
Length=566

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRF ADNPGVWF+HCHLE+HTTWGLKMAFVVDNG GP++S+
Sbjct  515  AIRFIADNPGVWFMHCHLELHTTWGLKMAFVVDNGHGPDQSL  556



>ref|XP_010483501.1| PREDICTED: laccase-16-like isoform X1 [Camelina sativa]
 ref|XP_010483502.1| PREDICTED: laccase-16-like isoform X2 [Camelina sativa]
Length=569

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRF ADNPGVWF+HCHLE+HTTWGLKMAFVVDNG GP++S+
Sbjct  518  AIRFIADNPGVWFMHCHLELHTTWGLKMAFVVDNGHGPDQSL  559



>ref|XP_010483503.1| PREDICTED: laccase-16-like isoform X3 [Camelina sativa]
Length=567

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRF ADNPGVWF+HCHLE+HTTWGLKMAFVVDNG GP++S+
Sbjct  516  AIRFIADNPGVWFMHCHLELHTTWGLKMAFVVDNGHGPDQSL  557



>ref|XP_004292037.1| PREDICTED: laccase-11-like [Fragaria vesca subsp. vesca]
Length=563

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 33/42 (79%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESI  329
            AIRFRADNPGVWF+HCHLE+HT+WGLK AFVV+NGKG ++S+
Sbjct  512  AIRFRADNPGVWFMHCHLELHTSWGLKTAFVVENGKGADKSV  553



>ref|XP_004980096.1| PREDICTED: laccase-22-like [Setaria italica]
Length=589

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -2

Query  454  AIRFRADNPGVWFLHCHLEVHTTWGLKMAFVVDNGKGPNESIlpppsdlpSC  299
            AIRFRADNPGVWF+HCH EVHT+WGLKM FVVDNGK P+E+++PPP DLP C
Sbjct  538  AIRFRADNPGVWFMHCHFEVHTSWGLKMVFVVDNGKRPDETLIPPPKDLPQC  589



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 507136922424