BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7561_g1_i1 len=273 path=[625:0-272]

Length=273
                                                                      Score     E

emb|CDY45516.1|  BnaCnng12750D                                        63.2    2e-10   
emb|CDY17588.1|  BnaC01g27120D                                        63.2    2e-10   
ref|XP_003588283.1|  Cytochrome c biogenesis                          65.1    6e-10   
ref|XP_003588309.1|  hypothetical protein MTR_1g005780                57.0    2e-08   
gb|AGC78908.1|  hypothetical protein                                  46.2    9e-06   
gb|AHY20300.1|  NADH dehydrogenase subunit 7 (mitochondrion)          45.8    1e-05   
ref|XP_004153091.1|  PREDICTED: NADH dehydrogenase [ubiquinone] i...  45.8    1e-05   
emb|CDY65733.1|  BnaCnng48520D                                        46.6    2e-05   
gb|AHX81471.1|  NADH dehydrogenase subunit 7                          45.4    3e-05   
dbj|BAO50877.1|  NADH dehydrogenase subunit 7                         45.4    3e-05   
ref|XP_004153330.1|  PREDICTED: NADH dehydrogenase [ubiquinone] i...  44.7    3e-05   
ref|YP_005090430.1|  nad7 gene product                                45.1    3e-05   
ref|XP_004174000.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...  44.7    3e-05   
gb|ABS50636.1|  NADH dehydrogenase subunit 7                          45.1    4e-05   Arabidopsis thaliana [mouse-ear cress]
gb|ACL26691.1|  NADH dehydrogenase subunit 7                          45.4    4e-05   Cucumis sativus [cucumbers]
ref|XP_004153002.1|  PREDICTED: NADH dehydrogenase [ubiquinone] i...  44.7    4e-05   
gb|AFK45435.1|  unknown                                               44.3    4e-05   
ref|YP_004222829.1|  NADH dehydrogenase subunit 7                     45.4    4e-05   
ref|NP_085511.1|  NADH dehydrogenase subunit 7                        45.1    4e-05   Arabidopsis thaliana [mouse-ear cress]
gb|AHH81705.1|  nad7                                                  45.4    4e-05   
gb|EPS74730.1|  hypothetical protein M569_00005                       45.4    4e-05   
gb|AEK01290.1|  nad7                                                  44.7    4e-05   
ref|YP_007516886.1|  NADH dehydrogenase subunit 7                     45.4    4e-05   
ref|YP_004927501.1|  nad7                                             45.1    4e-05   
ref|YP_004927561.1|  nad7                                             45.1    4e-05   
gb|AGC81666.1|  NADH dehydrogenase subunit 7                          45.1    4e-05   
ref|XP_002535141.1|  NADH-ubiquinone oxidoreductase fe-s protein,...  43.9    4e-05   Ricinus communis
ref|YP_009045735.1|  NADH dehydrogenase subunit 7                     45.1    4e-05   
gb|AGC78905.1|  NADH dehydrogenase subunit 7                          45.1    5e-05   
ref|YP_002608197.2|  NADH dehydrogenase subunit 7                     45.1    5e-05   Carica papaya [mamon]
ref|YP_004849328.1|  NADH dehydrogenase subunit 7                     45.1    5e-05   
ref|YP_173488.1|  NADH dehydrogenase subunit 7                        45.1    5e-05   Nicotiana tabacum [American tobacco]
ref|NP_064056.1|  orf155b gene product                                43.5    5e-05   Beta vulgaris subsp. vulgaris [field beet]
sp|Q36450.1|NDUS2_NICSY  RecName: Full=NADH dehydrogenase [ubiqui...  45.1    5e-05   Nicotiana sylvestris
gb|AAW63681.1|  NADH dehydrogenase subunit 7                          43.5    5e-05   Philodendron hederaceum var. oxycardium
ref|XP_004154392.1|  PREDICTED: NADH dehydrogenase [ubiquinone] i...  43.5    6e-05   
ref|YP_009049635.1|  NADH dehydrogenase subunit 7                     44.7    6e-05   
gb|AFK43004.1|  unknown                                               43.9    6e-05   
gb|AEN56121.1|  NADH dehydrogenase subunit 7                          43.9    8e-05   
gb|AGL75417.1|  NADH dehydrogenase subunit 7                          43.9    8e-05   
ref|YP_008992384.1|  NADH dehydrogenase subunit 7                     43.9    8e-05   
ref|YP_008964099.1|  NADH dehydrogenase subunit 7 (mitochondrion)     43.9    8e-05   
ref|YP_006460175.1|  NADH dehydrogenase subunit 7 (mitochondrion)     43.9    9e-05   
gb|ACH78248.1|  NADH dehydrogenase subunit 7                          43.1    1e-04   Arabidopsis thaliana [mouse-ear cress]
ref|YP_005090468.1|  NADH dehydrogenase subunit 7                     43.1    1e-04   
gb|AHA47104.1|  NADH dehydrogenase subunit 7                          43.1    1e-04   
ref|YP_008999610.1|  NADH dehydrogenase subunit 7                     44.3    1e-04   
sp|P93306.2|NDUS2_ARATH  RecName: Full=NADH dehydrogenase [ubiqui...  43.1    1e-04   Arabidopsis thaliana [mouse-ear cress]
ref|YP_003875501.1|  NADH dehydrogenase subunit 7                     43.1    1e-04   
gb|AHC94299.1|  NADH dehydrogenase subunit 7                          43.1    1e-04   
ref|YP_717100.1|  NADH dehydrogenase subunit 7                        43.1    1e-04   Brassica napus [oilseed rape]
ref|NP_064055.2|  nad7 gene product                                   43.1    1e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|YP_005090473.1|  NADH dehydrogenase subunit 7                     43.1    1e-04   
emb|CBJ20663.1|  NADH dehydrogenase subunit 7                         43.1    1e-04   
ref|YP_003587260.1|  NADH dehydrogenase subunit 7                     43.1    1e-04   Citrullus lanatus [wild melon]
gb|ADG85337.1|  NADH dehydrogenase subunit 7                          43.1    1e-04   
ref|YP_003587352.1|  NADH dehydrogenase subunit 7                     43.1    1e-04   Cucurbita pepo
gb|AAW63682.1|  NADH dehydrogenase subunit 7                          43.5    1e-04   Eichhornia crassipes
emb|CAI64462.1|  NADH-Ubiquinone oxidoreductase subunit 7             43.1    1e-04   Nicotiana sylvestris
pir||S57332  NADH2 dehydrogenase (ubiquinone) (EC 1.6.5.3) chain ...  42.7    1e-04
ref|YP_008802499.1|  NADH dehydrogenase subunit 7 (mitochondrion)     42.7    1e-04   
dbj|BAD83554.2|  NADH dehydrogenase subunit 7                         42.7    1e-04   Nicotiana tabacum [American tobacco]
gb|AHF22629.1|  NADH dehydrogenase subunit 7                          43.1    1e-04   
gb|AHF22630.1|  NADH dehydrogenase subunit 7                          42.7    1e-04   
gb|AHF22636.1|  NADH dehydrogenase subunit 7                          43.1    1e-04   
ref|YP_004935337.1|  NADH dehydrogenase subunit 7                     42.7    1e-04   
gb|AHF22631.1|  NADH dehydrogenase subunit 7                          42.7    1e-04   
gb|AFW86884.1|  hypothetical protein ZEAMMB73_495891                  43.5    1e-04   
ref|YP_004237249.1|  NADH dehydrogenase subunit 7                     43.1    2e-04   
dbj|BAD66737.1|  NADH dehydrogenase subunit 7                         43.1    2e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004987298.1|  PREDICTED: NADH dehydrogenase [ubiquinone] i...  43.5    2e-04   
ref|XP_010112426.1|  NADH dehydrogenase [ubiquinone] iron-sulfur ...  43.9    2e-04   
gb|AFO69227.1|  NADH dehydrogenase subunit 7                          42.7    2e-04   
ref|XP_004987297.1|  PREDICTED: NADH dehydrogenase [ubiquinone] i...  42.4    2e-04   
ref|YP_009041156.1|  NADH dehydrogenase subunit 7                     42.7    2e-04   
gb|ABE98776.1|  NADH dehydrogenase subunit 7                          42.7    2e-04   Zea mays subsp. mays [corn]
ref|YP_588347.1|  NADH dehydrogenase subunit 7                        42.7    2e-04   Zea mays subsp. mays [corn]
ref|YP_006666126.1|  NADH dehydrogenase subunit 7                     42.7    3e-04   
ref|YP_398427.1|  nad7                                                42.7    3e-04   Triticum aestivum [Canadian hard winter wheat]
ref|YP_740444.1|  NADH dehydrogenase subunit 7                        42.7    3e-04   Zea luxurians [Florida teosinte]
ref|YP_514643.1|  NADH dehydrogenase subunit 7                        42.7    3e-04   Oryza sativa Indica Group [Indian rice]
ref|YP_006280930.1|  NADH dehydrogenase subunit 7                     43.1    3e-04   
emb|CDM80240.1|  unnamed protein product                              42.7    3e-04   
gb|ADG85341.1|  NADH dehydrogenase subunit 7                          43.5    3e-04   
ref|YP_001661405.1|  NADH dehydrogenase subunit 7                     42.0    3e-04   Cycas taitungensis
ref|YP_002608348.1|  NADH dehydrogenase subunit 7                     42.7    3e-04   Vitis vinifera
gb|AAW63679.1|  NADH dehydrogenase subunit 7                          40.8    3e-04   Asarum sp. Qiu 96018
ref|YP_005090366.1|  NADH dehydrogenase subunit 7                     42.7    3e-04   
gb|AAW63675.1|  NADH dehydrogenase subunit 7                          40.4    3e-04   Laurus nobilis [bay laurel]
gb|AEZ35013.1|  NADH dehydrogenase subunit 7                          40.8    4e-04   
ref|XP_006397342.1|  hypothetical protein EUTSA_v10028891mg           47.0    4e-04   
emb|CBI33446.3|  unnamed protein product                              41.2    4e-04   
ref|YP_006291823.1|  nad7 gene product                                41.6    5e-04   
ref|YP_009091708.1|  NADH dehydrogenase subunit 7                     41.6    6e-04   
ref|YP_008080943.1|  NADH dehydrogenase subunit 7                     41.6    7e-04   
gb|AAW63673.1|  NADH dehydrogenase subunit 7                          40.8    7e-04   Amborella trichopoda
gb|AAW63686.1|  NADH dehydrogenase subunit 7                          40.4    9e-04   Berberis bealei



>emb|CDY45516.1| BnaCnng12750D [Brassica napus]
Length=114

 Score = 63.2 bits (152),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  23   QKDSPGWGQHRMKEVALMLCWQSQLIGFRADKSGHGDSGWG  145
            +K +PG GQHRMK  ALMLCWQSQL+  RA+KSG GDSG G
Sbjct  49   KKPAPGRGQHRMKGTALMLCWQSQLLRLRAEKSGRGDSGRG  89



>emb|CDY17588.1| BnaC01g27120D [Brassica napus]
Length=128

 Score = 63.2 bits (152),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  23   QKDSPGWGQHRMKEVALMLCWQSQLIGFRADKSGHGDSGWG  145
            +K +PG GQHRMK  ALMLCWQSQL+  RA+KSG GDSG G
Sbjct  49   KKPAPGRGQHRMKGTALMLCWQSQLLRLRAEKSGRGDSGRG  89



>ref|XP_003588283.1| Cytochrome c biogenesis [Medicago truncatula]
 gb|KEH16865.1| cytochrome C biogenesis protein CcmFC protein [Medicago truncatula]
Length=860

 Score = 65.1 bits (157),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  23   QKDSPGWGQHRMKEVALMLCWQSQLIGFRADKSGHGDSGWG  145
            +K +PG G+HRMK +ALMLCWQSQL+G RA+KSG GDS  G
Sbjct  356  KKPAPGQGRHRMKGMALMLCWQSQLLGLRAEKSGRGDSDRG  396



>ref|XP_003588309.1| hypothetical protein MTR_1g005780 [Medicago truncatula]
Length=91

 Score = 57.0 bits (136),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -2

Query  152  SLCPNPSPHVRFYPLETQ*VGFANTTLGPPPSFYADPSQGCLFGKA  15
            +L P  SPHVR  P  TQ VGFANTTLGP PSFYADP  G  F +A
Sbjct  6    TLRPGLSPHVRSSPPATQEVGFANTTLGPSPSFYADPGPGLAFWEA  51



>gb|AGC78908.1| hypothetical protein (mitochondrion) [Vicia faba]
 gb|AGC78935.1| hypothetical protein (mitochondrion) [Vicia faba]
 gb|AGC79022.1| hypothetical protein (mitochondrion) [Vicia faba]
Length=154

 Score = 46.2 bits (108),  Expect(2) = 9e-06, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQH  197
            FTQQFAS IDELEEMSTGN I KQ 
Sbjct  103  FTQQFASRIDELEEMSTGNRIWKQR  127


 Score = 29.6 bits (65),  Expect(2) = 9e-06, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  129  VDIGTVTAQQAKDWGF  144



>gb|AHY20300.1| NADH dehydrogenase subunit 7 (mitochondrion) (mitochondrion) 
[Brassica juncea var. tumida]
Length=155

 Score = 45.8 bits (107),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQH  197
            FTQQFAS IDELEEMSTGN I KQ 
Sbjct  104  FTQQFASRIDELEEMSTGNRIWKQR  128


 Score = 29.3 bits (64),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  130  VDIGTVTAQQAKDWGF  145



>ref|XP_004153091.1| PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 
2-like [Cucumis sativus]
 ref|XP_004153257.1| PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 
2-like [Cucumis sativus]
Length=154

 Score = 45.8 bits (107),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQH  197
            FTQQFAS IDELEEMSTGN I KQ 
Sbjct  103  FTQQFASRIDELEEMSTGNRIWKQR  127


 Score = 29.3 bits (64),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  129  VDIGTVTAQQAKDWGF  144



>emb|CDY65733.1| BnaCnng48520D [Brassica napus]
Length=625

 Score = 46.6 bits (109),  Expect(2) = 2e-05, Method: Composition-based stats.
 Identities = 21/24 (88%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQ  200
            FTQQFAS IDELEEMSTGN I KQ
Sbjct  256  FTQQFASRIDELEEMSTGNRIWKQ  279


 Score = 28.1 bits (61),  Expect(2) = 2e-05, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  282  VDIGTVTAQQAKDWGF  297



>gb|AHX81471.1| NADH dehydrogenase subunit 7 (mitochondrion) [Parinari campestris]
 gb|AHX81490.1| NADH dehydrogenase subunit 7 (mitochondrion) [Couepia guianensis]
 gb|AHX81492.1| NADH dehydrogenase subunit 7 (mitochondrion) [Licania sprucei]
 gb|AHX81523.1| NADH dehydrogenase subunit 7 (mitochondrion) [Hirtella racemosa]
 gb|AHX81527.1| NADH dehydrogenase subunit 7 (mitochondrion) [Licania heteromorpha]
 gb|AHX81534.1| NADH dehydrogenase subunit 7 (mitochondrion) [Hirtella physophora]
 gb|AHX81544.1| NADH dehydrogenase subunit 7 (mitochondrion) [Chrysobalanus icaco]
 gb|AHX81545.1| NADH dehydrogenase subunit 7 (mitochondrion) [Licania alba]
Length=394

 Score = 45.4 bits (106),  Expect(2) = 3e-05, Method: Composition-based stats.
 Identities = 21/24 (88%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQ  200
            FTQQFAS IDELEEMSTGN I KQ
Sbjct  178  FTQQFASRIDELEEMSTGNRIWKQ  201


 Score = 28.5 bits (62),  Expect(2) = 3e-05, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>dbj|BAO50877.1| NADH dehydrogenase subunit 7 (mitochondrion) [Hevea brasiliensis]
 dbj|BAO50933.1| NADH dehydrogenase subunit 7 (mitochondrion) [Hevea brasiliensis]
Length=394

 Score = 45.4 bits (106),  Expect(2) = 3e-05, Method: Composition-based stats.
 Identities = 21/24 (88%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQ  200
            FTQQFAS IDELEEMSTGN I KQ
Sbjct  178  FTQQFASRIDELEEMSTGNRIWKQ  201


 Score = 28.1 bits (61),  Expect(2) = 3e-05, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>ref|XP_004153330.1| PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 
2-like [Cucumis sativus]
Length=134

 Score = 44.7 bits (104),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQH  197
            FTQQFAS IDELEEMS GN I KQ 
Sbjct  83   FTQQFASRIDELEEMSIGNRIWKQR  107


 Score = 28.9 bits (63),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  109  VDIGTVTAQQAKDWGF  124



>ref|YP_005090430.1| nad7 gene product (mitochondrion) [Boea hygrometrica]
 gb|AEK53326.1| NADH dehydrogenase subunit 7 (mitochondrion) [Boea hygrometrica]
Length=392

 Score = 45.1 bits (105),  Expect(2) = 3e-05, Method: Composition-based stats.
 Identities = 21/24 (88%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQ  200
            FTQQFAS IDELEEMSTGN I KQ
Sbjct  176  FTQQFASRIDELEEMSTGNRIWKQ  199


 Score = 28.5 bits (62),  Expect(2) = 3e-05, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  202  VDIGTVTAQQAKDWGF  217



>ref|XP_004174000.1| PREDICTED: LOW QUALITY PROTEIN: NADH dehydrogenase [ubiquinone] 
iron-sulfur protein 2-like, partial [Cucumis sativus]
Length=92

 Score = 44.7 bits (104),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQH  197
            FTQQFAS IDELEEMS GN I KQ 
Sbjct  41   FTQQFASRIDELEEMSIGNRIWKQR  65


 Score = 28.9 bits (63),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  67   VDIGTVTAQQAKDWGF  82



>gb|ABS50636.1| NADH dehydrogenase subunit 7 [Arabidopsis thaliana]
 gb|ABS50637.1| NADH dehydrogenase subunit 7 [Arabidopsis thaliana]
Length=360

 Score = 45.1 bits (105),  Expect(2) = 4e-05, Method: Composition-based stats.
 Identities = 21/24 (88%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQ  200
            FTQQFAS IDELEEMSTGN I KQ
Sbjct  160  FTQQFASRIDELEEMSTGNRIWKQ  183


 Score = 28.5 bits (62),  Expect(2) = 4e-05, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  186  VDIGTVTAQQAKDWGF  201



>gb|ACL26691.1| NADH dehydrogenase subunit 7, partial (mitochondrion) [Cucumis 
sativus]
Length=344

 Score = 45.4 bits (106),  Expect(2) = 4e-05, Method: Composition-based stats.
 Identities = 21/24 (88%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQ  200
            FTQQFAS IDELEEMSTGN I KQ
Sbjct  146  FTQQFASRIDELEEMSTGNRIWKQ  169


 Score = 28.1 bits (61),  Expect(2) = 4e-05, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  172  VDIGTVTAQQAKDWGF  187



>ref|XP_004153002.1| PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 
2-like [Cucumis sativus]
Length=134

 Score = 44.7 bits (104),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQH  197
            FTQQFAS IDELEEMS GN I KQ 
Sbjct  83   FTQQFASRIDELEEMSIGNRIWKQR  107


 Score = 28.9 bits (63),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  109  VDIGTVTAQQAKDWGF  124



>gb|AFK45435.1| unknown [Lotus japonicus]
Length=199

 Score = 44.3 bits (103),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQH  197
            FTQQFAS IDELEEM TGN I KQ 
Sbjct  104  FTQQFASRIDELEEMLTGNRIWKQR  128


 Score = 29.3 bits (64),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  130  VDIGTVTAQQAKDWGF  145



>ref|YP_004222829.1| NADH dehydrogenase subunit 7 [Vigna radiata]
 ref|YP_007889806.1| NADH ehydrogenase subunit 7 (mitochondrion) [Vigna angularis]
 gb|ADO19890.1| NADH dehydrogenase subunit 7 [Vigna radiata]
 dbj|BAN15011.1| NADH ehydrogenase subunit 7 (mitochondrion) [Vigna angularis]
Length=394

 Score = 45.4 bits (106),  Expect(2) = 4e-05, Method: Composition-based stats.
 Identities = 21/24 (88%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQ  200
            FTQQFAS IDELEEMSTGN I KQ
Sbjct  178  FTQQFASRIDELEEMSTGNRIWKQ  201


 Score = 28.1 bits (61),  Expect(2) = 4e-05, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>ref|NP_085511.1| NADH dehydrogenase subunit 7 [Arabidopsis thaliana]
 emb|CAA69735.3| NADH dehydrogenase subunit 7 [Arabidopsis thaliana]
 gb|AEK01256.1| nad7 [Arabidopsis thaliana]
 gb|AEK01331.1| nad7 [Arabidopsis thaliana]
Length=394

 Score = 45.1 bits (105),  Expect(2) = 4e-05, Method: Composition-based stats.
 Identities = 21/24 (88%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQ  200
            FTQQFAS IDELEEMSTGN I KQ
Sbjct  178  FTQQFASRIDELEEMSTGNRIWKQ  201


 Score = 28.5 bits (62),  Expect(2) = 4e-05, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>gb|AHH81705.1| nad7 (mitochondrion) [Brassica juncea]
Length=377

 Score = 45.4 bits (106),  Expect(2) = 4e-05, Method: Composition-based stats.
 Identities = 21/24 (88%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQ  200
            FTQQFAS IDELEEMSTGN I KQ
Sbjct  161  FTQQFASRIDELEEMSTGNRIWKQ  184


 Score = 28.1 bits (61),  Expect(2) = 4e-05, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  187  VDIGTVTAQQAKDWGF  202



>gb|EPS74730.1| hypothetical protein M569_00005, partial [Genlisea aurea]
Length=363

 Score = 45.4 bits (106),  Expect(2) = 4e-05, Method: Composition-based stats.
 Identities = 20/24 (83%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQ  200
            FTQQF+S IDELEEMSTGN I KQ
Sbjct  166  FTQQFSSRIDELEEMSTGNRIWKQ  189


 Score = 27.7 bits (60),  Expect(2) = 4e-05, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  192  VDIGTVTAQQAKDWGF  207



>gb|AEK01290.1| nad7 [Arabidopsis thaliana]
Length=393

 Score = 44.7 bits (104),  Expect(2) = 4e-05, Method: Composition-based stats.
 Identities = 21/24 (88%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQ  200
            FTQQFAS IDELEEMSTGN I KQ
Sbjct  177  FTQQFASRIDELEEMSTGNRIWKQ  200


 Score = 28.5 bits (62),  Expect(2) = 4e-05, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  203  VDIGTVTAQQAKDWGF  218



>ref|YP_007516886.1| NADH dehydrogenase subunit 7 (mitochondrion) [Glycine max]
 gb|AFR34316.1| NADH dehydrogenase subunit 7 (mitochondrion) [Glycine max]
Length=394

 Score = 45.4 bits (106),  Expect(2) = 4e-05, Method: Composition-based stats.
 Identities = 21/24 (88%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQ  200
            FTQQFAS IDELEEMSTGN I KQ
Sbjct  178  FTQQFASRIDELEEMSTGNRIWKQ  201


 Score = 28.1 bits (61),  Expect(2) = 4e-05, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>ref|YP_004927501.1| nad7 (mitochondrion) [Brassica oleracea]
 ref|YP_004927820.1| nad7 (mitochondrion) [Brassica rapa subsp. oleifera]
 ref|YP_004927723.1| nad7 (mitochondrion) [Brassica juncea]
 gb|AEH43470.1| nad7 [Brassica rapa subsp. oleifera]
 gb|AEH43529.1| nad7 [Brassica oleracea]
 gb|AEH43623.1| nad7 [Brassica juncea]
 emb|CBX48321.1| nad7 [Brassica napus]
 gb|AGY62825.1| NADH dehydrogenase subunit 7 (mitochondrion) [Eruca vesicaria 
subsp. sativa]
 gb|AIC83249.1| NADH dehydrogenase subunit 7 (mitochondrion) (mitochondrion) 
[Brassica oleracea var. botrytis]
 dbj|BAP82273.1| NADH dehydrogenase subunit7 (mitochondrion) [Brassica oleracea]
Length=394

 Score = 45.1 bits (105),  Expect(2) = 4e-05, Method: Composition-based stats.
 Identities = 21/24 (88%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQ  200
            FTQQFAS IDELEEMSTGN I KQ
Sbjct  178  FTQQFASRIDELEEMSTGNRIWKQ  201


 Score = 28.5 bits (62),  Expect(2) = 4e-05, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>ref|YP_004927561.1| nad7 (mitochondrion) [Brassica carinata]
 ref|YP_006666000.1| NADH dehydrogenase subunit 7 (mitochondrion) [Raphanus sativus]
 gb|AEH43575.1| nad7 [Brassica carinata]
 gb|AEX57659.1| NADH dehydrogenase subunit 7 (mitochondrion) [Raphanus sativus]
 dbj|BAM36214.1| NADH dehydrogenase subunit 7 (mitochondrion) [Raphanus sativus]
 dbj|BAM36243.1| NADH dehydrogenase subunit 7 (mitochondrion) [Raphanus sativus]
 gb|AIE42607.1| NADH dehydrogenase subunit 7 (mitochondrion) [Raphanus sativus]
 dbj|BAP15862.1| NADH dehydrogenase subunit7 (mitochondrion) [Raphanus sativus]
Length=394

 Score = 45.1 bits (105),  Expect(2) = 4e-05, Method: Composition-based stats.
 Identities = 21/24 (88%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQ  200
            FTQQFAS IDELEEMSTGN I KQ
Sbjct  178  FTQQFASRIDELEEMSTGNRIWKQ  201


 Score = 28.5 bits (62),  Expect(2) = 4e-05, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>gb|AGC81666.1| NADH dehydrogenase subunit 7 (mitochondrion) [Raphanus sativus]
Length=394

 Score = 45.1 bits (105),  Expect(2) = 4e-05, Method: Composition-based stats.
 Identities = 21/24 (88%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQ  200
            FTQQFAS IDELEEMSTGN I KQ
Sbjct  178  FTQQFASRIDELEEMSTGNRIWKQ  201


 Score = 28.5 bits (62),  Expect(2) = 4e-05, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>ref|XP_002535141.1| NADH-ubiquinone oxidoreductase fe-s protein, putative [Ricinus 
communis]
 gb|EEF27247.1| NADH-ubiquinone oxidoreductase fe-s protein, putative [Ricinus 
communis]
Length=154

 Score = 43.9 bits (102),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  268  TQQFASHIDELEEMSTGNHILKQH  197
            TQQFAS IDELEEMSTGN I KQ 
Sbjct  104  TQQFASRIDELEEMSTGNRIWKQR  127


 Score = 29.6 bits (65),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  129  VDIGTVTAQQAKDWGF  144



>ref|YP_009045735.1| NADH dehydrogenase subunit 7 (mitochondrion) [Batis maritima]
 gb|AIC83338.1| NADH dehydrogenase subunit 7 (mitochondrion) (mitochondrion) 
[Batis maritima]
Length=394

 Score = 45.1 bits (105),  Expect(2) = 4e-05, Method: Composition-based stats.
 Identities = 21/24 (88%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQ  200
            FTQQFAS IDELEEMSTGN I KQ
Sbjct  178  FTQQFASRIDELEEMSTGNRIWKQ  201


 Score = 28.1 bits (61),  Expect(2) = 4e-05, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>gb|AGC78905.1| NADH dehydrogenase subunit 7 (mitochondrion) [Vicia faba]
 gb|AGC78933.1| NADH dehydrogenase subunit 7 (mitochondrion) [Vicia faba]
 gb|AGC79018.1| NADH dehydrogenase subunit 7 (mitochondrion) [Vicia faba]
Length=394

 Score = 45.1 bits (105),  Expect(2) = 5e-05, Method: Composition-based stats.
 Identities = 21/24 (88%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQ  200
            FTQQFAS IDELEEMSTGN I KQ
Sbjct  178  FTQQFASRIDELEEMSTGNRIWKQ  201


 Score = 28.1 bits (61),  Expect(2) = 5e-05, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>ref|YP_002608197.2| NADH dehydrogenase subunit 7 [Carica papaya]
 gb|ACB20486.2| NADH dehydrogenase subunit 7 (mitochondrion) [Carica papaya]
Length=394

 Score = 45.1 bits (105),  Expect(2) = 5e-05, Method: Composition-based stats.
 Identities = 21/24 (88%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQ  200
            FTQQFAS IDELEEMSTGN I KQ
Sbjct  178  FTQQFASRIDELEEMSTGNRIWKQ  201


 Score = 28.1 bits (61),  Expect(2) = 5e-05, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>ref|YP_004849328.1| NADH dehydrogenase subunit 7 [Cucumis sativus]
 gb|ADZ10755.1| NADH dehydrogenase subunit 7 [Cucumis sativus]
Length=394

 Score = 45.1 bits (105),  Expect(2) = 5e-05, Method: Composition-based stats.
 Identities = 21/24 (88%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQ  200
            FTQQFAS IDELEEMSTGN I KQ
Sbjct  178  FTQQFASRIDELEEMSTGNRIWKQ  201


 Score = 28.1 bits (61),  Expect(2) = 5e-05, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>ref|YP_173488.1| NADH dehydrogenase subunit 7 [Nicotiana tabacum]
Length=394

 Score = 45.1 bits (105),  Expect(2) = 5e-05, Method: Composition-based stats.
 Identities = 21/24 (88%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQ  200
            FTQQFAS IDELEEMSTGN I KQ
Sbjct  178  FTQQFASRIDELEEMSTGNRIWKQ  201


 Score = 28.1 bits (61),  Expect(2) = 5e-05, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>ref|NP_064056.1| orf155b gene product (mitochondrion) [Beta vulgaris subsp. vulgaris]
 ref|YP_004222250.1| hypothetical protein BevumaM_p011 [Beta vulgaris subsp. maritima]
 ref|YP_004842057.1| hypothetical protein BemaM_p009 [Beta macrocarpa]
 dbj|BAA99448.1| orf155b [Beta vulgaris subsp. vulgaris]
 emb|CBJ14081.1| hypothetical protein [Beta vulgaris subsp. maritima]
 emb|CBJ17490.1| hypothetical protein [Beta vulgaris subsp. maritima]
 emb|CBJ20664.1| hypothetical protein [Beta vulgaris subsp. maritima]
 emb|CBX24862.1| hypothetical protein [Beta macrocarpa]
 emb|CBL52069.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima]
Length=155

 Score = 43.5 bits (101),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  268  TQQFASHIDELEEMSTGNHILKQH  197
            TQQFAS IDELEEMSTGN I KQ 
Sbjct  105  TQQFASRIDELEEMSTGNRIWKQR  128


 Score = 29.3 bits (64),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  130  VDIGTVTAQQAKDWGF  145



>sp|Q36450.1|NDUS2_NICSY RecName: Full=NADH dehydrogenase [ubiquinone] iron-sulfur protein 
2; AltName: Full=NADH dehydrogenase subunit 7 (mitochondrion) 
[Nicotiana sylvestris]
 emb|CAA60392.1| NADH:ubiquinone oxydoreductase subunit 7 [Nicotiana sylvestris]
Length=394

 Score = 45.1 bits (105),  Expect(2) = 5e-05, Method: Composition-based stats.
 Identities = 21/24 (88%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQ  200
            FTQQFAS IDELEEMSTGN I KQ
Sbjct  178  FTQQFASRIDELEEMSTGNRIWKQ  201


 Score = 28.1 bits (61),  Expect(2) = 5e-05, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>gb|AAW63681.1| NADH dehydrogenase subunit 7 [Philodendron hederaceum var. oxycardium]
Length=194

 Score = 43.5 bits (101),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  268  TQQFASHIDELEEMSTGNHILKQH  197
            TQQFAS IDELEEMSTGN I KQ 
Sbjct  147  TQQFASRIDELEEMSTGNRIWKQR  170


 Score = 29.6 bits (65),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  172  VDIGTVTAQQAKDWGF  187



>ref|XP_004154392.1| PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 
2-like [Cucumis sativus]
Length=229

 Score = 43.5 bits (101),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQH  197
            FTQQFAS IDELEEMS GN I KQ 
Sbjct  178  FTQQFASRIDELEEMSIGNRIWKQR  202


 Score = 29.3 bits (64),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>ref|YP_009049635.1| NADH dehydrogenase subunit 7 (mitochondrion) [Capsicum annuum]
 gb|AIG89983.1| NADH dehydrogenase subunit 7 (mitochondrion) [Capsicum annuum]
 gb|AIG89993.1| NADH dehydrogenase subunit 7 (mitochondrion) [Capsicum annuum]
Length=394

 Score = 44.7 bits (104),  Expect(2) = 6e-05, Method: Composition-based stats.
 Identities = 21/24 (88%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQ  200
            FTQQFAS IDELEEMSTGN I KQ
Sbjct  178  FTQQFASRIDELEEMSTGNRIWKQ  201


 Score = 28.1 bits (61),  Expect(2) = 6e-05, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>gb|AFK43004.1| unknown [Lotus japonicus]
 gb|AFK46843.1| unknown [Lotus japonicus]
Length=320

 Score = 43.9 bits (102),  Expect(2) = 6e-05, Method: Composition-based stats.
 Identities = 20/24 (83%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQ  200
            FTQQFAS IDELEEM TGN I KQ
Sbjct  104  FTQQFASRIDELEEMLTGNRIWKQ  127


 Score = 28.9 bits (63),  Expect(2) = 6e-05, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  130  VDIGTVTAQQAKDWGF  145



>gb|AEN56121.1| NADH dehydrogenase subunit 7 [Cucumis melo subsp. melo]
Length=336

 Score = 43.9 bits (102),  Expect(2) = 8e-05, Method: Composition-based stats.
 Identities = 21/24 (88%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQ  200
            FTQQFAS IDELEEMSTGN I KQ
Sbjct  178  FTQQFASRIDELEEMSTGNRIWKQ  201


 Score = 28.1 bits (61),  Expect(2) = 8e-05, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>gb|AGL75417.1| NADH dehydrogenase subunit 7 (mitochondrion) [Utricularia gibba]
Length=394

 Score = 43.9 bits (102),  Expect(2) = 8e-05, Method: Composition-based stats.
 Identities = 20/24 (83%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQ  200
            FTQQF+S IDELEEMSTGN I KQ
Sbjct  178  FTQQFSSRIDELEEMSTGNRIWKQ  201


 Score = 28.5 bits (62),  Expect(2) = 8e-05, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>ref|YP_008992384.1| NADH dehydrogenase subunit 7 (mitochondrion) [Salvia miltiorrhiza]
 gb|AGU16646.1| NADH dehydrogenase subunit 7 (mitochondrion) [Salvia miltiorrhiza]
Length=394

 Score = 43.9 bits (102),  Expect(2) = 8e-05, Method: Composition-based stats.
 Identities = 20/24 (83%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQ  200
            FTQQF+S IDELEEMSTGN I KQ
Sbjct  178  FTQQFSSRIDELEEMSTGNRIWKQ  201


 Score = 28.5 bits (62),  Expect(2) = 8e-05, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>ref|YP_008964099.1| NADH dehydrogenase subunit 7 (mitochondrion) (mitochondrion) 
[Ajuga reptans]
 gb|AHA84983.1| NADH dehydrogenase subunit 7 (mitochondrion) [Ajuga reptans]
Length=394

 Score = 43.9 bits (102),  Expect(2) = 8e-05, Method: Composition-based stats.
 Identities = 20/24 (83%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQ  200
            FTQQF+S IDELEEMSTGN I KQ
Sbjct  178  FTQQFSSRIDELEEMSTGNRIWKQ  201


 Score = 28.5 bits (62),  Expect(2) = 8e-05, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>ref|YP_006460175.1| NADH dehydrogenase subunit 7 (mitochondrion) (mitochondrion) 
[Erythranthe guttata]
 gb|AEK26524.1| NADH dehydrogenase subunit 7 (mitochondrion) (mitochondrion) 
[Erythranthe guttata]
Length=394

 Score = 43.9 bits (102),  Expect(2) = 9e-05, Method: Composition-based stats.
 Identities = 20/24 (83%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQ  200
            FTQQF+S IDELEEMSTGN I KQ
Sbjct  178  FTQQFSSRIDELEEMSTGNRIWKQ  201


 Score = 28.5 bits (62),  Expect(2) = 9e-05, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>gb|ACH78248.1| NADH dehydrogenase subunit 7 [Arabidopsis thaliana]
Length=394

 Score = 43.1 bits (100),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 20/24 (83%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQ  200
            FTQQFAS IDELEEM TGN I KQ
Sbjct  178  FTQQFASRIDELEEMLTGNRIWKQ  201


 Score = 28.9 bits (63),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>ref|YP_005090468.1| NADH dehydrogenase subunit 7 (mitochondrion) [Millettia pinnata]
 gb|AET62928.1| NADH dehydrogenase subunit 7 (mitochondrion) [Millettia pinnata]
Length=394

 Score = 43.1 bits (100),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 20/24 (83%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQ  200
            FTQQFAS IDELEEM TGN I KQ
Sbjct  178  FTQQFASRIDELEEMLTGNRIWKQ  201


 Score = 28.9 bits (63),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>gb|AHA47104.1| NADH dehydrogenase subunit 7 (mitochondrion) [Amborella trichopoda]
Length=394

 Score = 43.1 bits (100),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 20/24 (83%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQ  200
            FTQQFAS IDELEEM TGN I KQ
Sbjct  178  FTQQFASRIDELEEMLTGNRIWKQ  201


 Score = 28.9 bits (63),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>ref|YP_008999610.1| NADH dehydrogenase subunit 7 (mitochondrion) [Vaccinium macrocarpon]
 gb|AGX28823.1| NADH dehydrogenase subunit 7 (mitochondrion) [Vaccinium macrocarpon]
Length=394

 Score = 44.3 bits (103),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 20/24 (83%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQ  200
            FTQQF+S IDELEEMSTGN I KQ
Sbjct  178  FTQQFSSRIDELEEMSTGNRIWKQ  201


 Score = 28.1 bits (61),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>sp|P93306.2|NDUS2_ARATH RecName: Full=NADH dehydrogenase [ubiquinone] iron-sulfur protein 
2; AltName: Full=NADH dehydrogenase subunit 7 (mitochondrion) 
[Arabidopsis thaliana]
Length=394

 Score = 43.1 bits (100),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 20/24 (83%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQ  200
            FTQQFAS IDELEEM TGN I KQ
Sbjct  178  FTQQFASRIDELEEMLTGNRIWKQ  201


 Score = 28.9 bits (63),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>ref|YP_003875501.1| NADH dehydrogenase subunit 7 [Silene latifolia]
 gb|ADK73324.1| NADH dehydrogenase subunit 7 [Silene latifolia]
Length=394

 Score = 43.1 bits (100),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 20/24 (83%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQ  200
            FTQQFAS IDELEEM TGN I KQ
Sbjct  178  FTQQFASRIDELEEMLTGNRIWKQ  201


 Score = 28.9 bits (63),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>gb|AHC94299.1| NADH dehydrogenase subunit 7, partial (mitochondrion) [Amborella 
trichopoda]
Length=386

 Score = 43.1 bits (100),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 20/24 (83%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQ  200
            FTQQFAS IDELEEM TGN I KQ
Sbjct  178  FTQQFASRIDELEEMLTGNRIWKQ  201


 Score = 28.9 bits (63),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>ref|YP_717100.1| NADH dehydrogenase subunit 7 [Brassica napus]
 dbj|BAC98848.1| NADH dehydrogenase subunit 7 [Brassica napus]
Length=394

 Score = 43.1 bits (100),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 20/24 (83%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQ  200
            FTQQFAS IDELEEM TGN I KQ
Sbjct  178  FTQQFASRIDELEEMLTGNRIWKQ  201


 Score = 28.9 bits (63),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>ref|NP_064055.2| nad7 gene product (mitochondrion) [Beta vulgaris subsp. vulgaris]
 ref|YP_004222248.1| NADH dehydrogenase subunit 7 [Beta vulgaris subsp. maritima]
 ref|YP_004842055.1| NADH dehydrogenase subunit 7 [Beta macrocarpa]
 gb|ABD36076.1| NADH dehydrogenase subunit 7 [Beta vulgaris subsp. vulgaris]
 dbj|BAA99447.2| NADH dehydrogenase subunit 7 [Beta vulgaris subsp. vulgaris]
 emb|CBJ14080.1| NADH dehydrogenase subunit 7 [Beta vulgaris subsp. maritima]
 emb|CBJ17489.1| NADH dehydrogenase subunit 7 [Beta vulgaris subsp. maritima]
 emb|CBX24860.1| NADH dehydrogenase subunit 7 [Beta macrocarpa]
 emb|CBL52068.1| NADH dehydrogenase subunit 7 (mitochondrion) [Beta vulgaris subsp. 
maritima]
Length=391

 Score = 43.1 bits (100),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 20/24 (83%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQ  200
            FTQQFAS IDELEEM TGN I KQ
Sbjct  175  FTQQFASRIDELEEMLTGNRIWKQ  198


 Score = 28.9 bits (63),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  201  VDIGTVTAQQAKDWGF  216



>ref|YP_005090473.1| NADH dehydrogenase subunit 7 (mitochondrion) [Lotus japonicus]
 gb|AET62933.1| NADH dehydrogenase subunit 7 (mitochondrion) [Lotus japonicus]
Length=394

 Score = 43.1 bits (100),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 20/24 (83%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQ  200
            FTQQFAS IDELEEM TGN I KQ
Sbjct  178  FTQQFASRIDELEEMLTGNRIWKQ  201


 Score = 28.9 bits (63),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>emb|CBJ20663.1| NADH dehydrogenase subunit 7 [Beta vulgaris subsp. maritima]
Length=391

 Score = 43.1 bits (100),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 20/24 (83%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQ  200
            FTQQFAS IDELEEM TGN I KQ
Sbjct  175  FTQQFASRIDELEEMLTGNRIWKQ  198


 Score = 28.9 bits (63),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  201  VDIGTVTAQQAKDWGF  216



>ref|YP_003587260.1| NADH dehydrogenase subunit 7 [Citrullus lanatus]
 gb|ACV96642.1| NADH dehydrogenase subunit 7 [Citrullus lanatus]
Length=394

 Score = 43.1 bits (100),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 20/24 (83%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQ  200
            FTQQFAS IDELEEM TGN I KQ
Sbjct  178  FTQQFASRIDELEEMLTGNRIWKQ  201


 Score = 28.9 bits (63),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>gb|ADG85337.1| NADH dehydrogenase subunit 7 [Silene latifolia]
Length=394

 Score = 43.1 bits (100),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 20/24 (83%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQ  200
            FTQQFAS IDELEEM TGN I KQ
Sbjct  178  FTQQFASRIDELEEMLTGNRIWKQ  201


 Score = 28.9 bits (63),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>ref|YP_003587352.1| NADH dehydrogenase subunit 7 [Cucurbita pepo]
 gb|ACV96684.1| NADH dehydrogenase subunit 7 [Cucurbita pepo]
Length=394

 Score = 43.1 bits (100),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 20/24 (83%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQ  200
            FTQQFAS IDELEEM TGN I KQ
Sbjct  178  FTQQFASRIDELEEMLTGNRIWKQ  201


 Score = 28.9 bits (63),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>gb|AAW63682.1| NADH dehydrogenase subunit 7 [Eichhornia crassipes]
Length=288

 Score = 43.5 bits (101),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 20/23 (87%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -3

Query  268  TQQFASHIDELEEMSTGNHILKQ  200
            TQQFAS IDELEEMSTGN I KQ
Sbjct  159  TQQFASRIDELEEMSTGNRIWKQ  181


 Score = 28.5 bits (62),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  184  VDIGTVTAQQAKDWGF  199



>emb|CAI64462.1| NADH-Ubiquinone oxidoreductase subunit 7 [Nicotiana sylvestris]
Length=394

 Score = 43.1 bits (100),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 20/24 (83%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQ  200
            FTQQFAS IDELEEM TGN I KQ
Sbjct  178  FTQQFASRIDELEEMLTGNRIWKQ  201


 Score = 28.9 bits (63),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>pir||S57332 NADH2 dehydrogenase (ubiquinone) (EC 1.6.5.3) chain 7 - wood 
tobacco mitochondrion
Length=394

 Score = 42.7 bits (99),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 20/24 (83%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQ  200
            FTQQFAS IDELEEM TGN I KQ
Sbjct  178  FTQQFASRIDELEEMLTGNRIWKQ  201


 Score = 28.9 bits (63),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>ref|YP_008802499.1| NADH dehydrogenase subunit 7 (mitochondrion) (mitochondrion) 
[Asclepias syriaca]
 gb|AGZ63034.1| NADH dehydrogenase subunit 7 (mitochondrion) (mitochondrion) 
[Asclepias syriaca]
Length=394

 Score = 42.7 bits (99),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 20/24 (83%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQ  200
            FTQQFAS IDELEEM TGN I KQ
Sbjct  178  FTQQFASRIDELEEMLTGNRIWKQ  201


 Score = 28.9 bits (63),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>dbj|BAD83554.2| NADH dehydrogenase subunit 7 (mitochondrion) [Nicotiana tabacum]
Length=394

 Score = 42.7 bits (99),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 20/24 (83%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQ  200
            FTQQFAS IDELEEM TGN I KQ
Sbjct  178  FTQQFASRIDELEEMLTGNRIWKQ  201


 Score = 28.9 bits (63),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>gb|AHF22629.1| NADH dehydrogenase subunit 7, partial (mitochondrion) [Dasiphora 
fruticosa subsp. floribunda]
Length=380

 Score = 43.1 bits (100),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 20/24 (83%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQ  200
            FTQQFAS IDELEEM TGN I KQ
Sbjct  178  FTQQFASRIDELEEMLTGNRIWKQ  201


 Score = 28.5 bits (62),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>gb|AHF22630.1| NADH dehydrogenase subunit 7, partial (mitochondrion) [Fragaria 
iinumae]
Length=394

 Score = 42.7 bits (99),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 20/24 (83%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQ  200
            FTQQFAS IDELEEM TGN I KQ
Sbjct  178  FTQQFASRIDELEEMLTGNRIWKQ  201


 Score = 28.9 bits (63),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>gb|AHF22636.1| NADH dehydrogenase subunit 7, partial (mitochondrion) [Fragaria 
vesca subsp. bracteata]
 gb|AHF22637.1| NADH dehydrogenase subunit 7, partial (mitochondrion) [Fragaria 
vesca subsp. bracteata]
Length=394

 Score = 43.1 bits (100),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 20/24 (83%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQ  200
            FTQQFAS IDELEEM TGN I KQ
Sbjct  178  FTQQFASRIDELEEMLTGNRIWKQ  201


 Score = 28.5 bits (62),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>ref|YP_004935337.1| NADH dehydrogenase subunit 7 (mitochondrion) [Silene vulgaris]
 gb|AEM46200.1| NADH dehydrogenase subunit 7 (mitochondrion) [Silene vulgaris]
 gb|AFI44271.1| NADH dehydrogenase subunit 7 (mitochondrion) [Silene vulgaris]
 gb|AFI44303.1| NADH dehydrogenase subunit 7 (mitochondrion) [Silene vulgaris]
 gb|AFI44332.1| NADH dehydrogenase subunit 7 (mitochondrion) [Silene vulgaris]
Length=394

 Score = 42.7 bits (99),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 20/23 (87%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -3

Query  268  TQQFASHIDELEEMSTGNHILKQ  200
            TQQFAS IDELEEMSTGN I KQ
Sbjct  179  TQQFASRIDELEEMSTGNRIWKQ  201


 Score = 28.5 bits (62),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>gb|AHF22631.1| NADH dehydrogenase subunit 7, partial (mitochondrion) [Fragaria 
mandshurica]
 gb|AHF22632.1| NADH dehydrogenase subunit 7, partial (mitochondrion) [Fragaria 
vesca subsp. bracteata]
 gb|AHF22633.1| NADH dehydrogenase subunit 7, partial (mitochondrion) [Fragaria 
chiloensis]
 gb|AHF22634.1| NADH dehydrogenase subunit 7, partial (mitochondrion) [Fragaria 
virginiana]
 gb|AHF22635.1| NADH dehydrogenase subunit 7, partial (mitochondrion) [Fragaria 
vesca subsp. vesca]
Length=394

 Score = 42.7 bits (99),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 20/24 (83%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQ  200
            FTQQFAS IDELEEM TGN I KQ
Sbjct  178  FTQQFASRIDELEEMLTGNRIWKQ  201


 Score = 28.9 bits (63),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>gb|AFW86884.1| hypothetical protein ZEAMMB73_495891 [Zea mays]
Length=311

 Score = 43.5 bits (101),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 20/23 (87%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -3

Query  268  TQQFASHIDELEEMSTGNHILKQ  200
            TQQFAS IDELEEMSTGN I KQ
Sbjct  179  TQQFASRIDELEEMSTGNRIWKQ  201


 Score = 28.1 bits (61),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>ref|YP_004237249.1| NADH dehydrogenase subunit 7 (mitochondrion) [Ricinus communis]
 gb|ADW96012.1| NADH dehydrogenase subunit 7 (mitochondrion) [Ricinus communis]
Length=394

 Score = 43.1 bits (100),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 20/23 (87%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -3

Query  268  TQQFASHIDELEEMSTGNHILKQ  200
            TQQFAS IDELEEMSTGN I KQ
Sbjct  179  TQQFASRIDELEEMSTGNRIWKQ  201


 Score = 28.1 bits (61),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>dbj|BAD66737.1| NADH dehydrogenase subunit 7 [Beta vulgaris subsp. vulgaris]
 dbj|BAD66781.1| NADH dehydrogenase subunit 7 [Beta vulgaris subsp. vulgaris]
Length=391

 Score = 43.1 bits (100),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 20/23 (87%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -3

Query  268  TQQFASHIDELEEMSTGNHILKQ  200
            TQQFAS IDELEEMSTGN I KQ
Sbjct  176  TQQFASRIDELEEMSTGNRIWKQ  198


 Score = 28.1 bits (61),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  201  VDIGTVTAQQAKDWGF  216



>ref|XP_004987298.1| PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 
2-like isoform X2 [Setaria italica]
Length=319

 Score = 43.5 bits (101),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 20/23 (87%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -3

Query  268  TQQFASHIDELEEMSTGNHILKQ  200
            TQQFAS IDELEEMSTGN I KQ
Sbjct  104  TQQFASRIDELEEMSTGNRIWKQ  126


 Score = 27.7 bits (60),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  129  VDIGTVTAQQAKDWGF  144



>ref|XP_010112426.1| NADH dehydrogenase [ubiquinone] iron-sulfur protein 2 [Morus 
notabilis]
 gb|EXC33547.1| NADH dehydrogenase [ubiquinone] iron-sulfur protein 2 [Morus 
notabilis]
Length=402

 Score = 43.9 bits (102),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 20/23 (87%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -3

Query  268  TQQFASHIDELEEMSTGNHILKQ  200
            TQQFAS IDELEEMSTGN I KQ
Sbjct  57   TQQFASRIDELEEMSTGNRIWKQ  79


 Score = 26.9 bits (58),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  82   VDIGTVTAQQAKDWGF  97



>gb|AFO69227.1| NADH dehydrogenase subunit 7 (mitochondrion) [Gossypium hirsutum]
Length=394

 Score = 42.7 bits (99),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 20/23 (87%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -3

Query  268  TQQFASHIDELEEMSTGNHILKQ  200
            TQQFAS IDELEEMSTGN I KQ
Sbjct  179  TQQFASRIDELEEMSTGNRIWKQ  201


 Score = 28.5 bits (62),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>ref|XP_004987297.1| PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 
2-like isoform X1 [Setaria italica]
Length=371

 Score = 42.4 bits (98),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 20/23 (87%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -3

Query  268  TQQFASHIDELEEMSTGNHILKQ  200
            TQQFAS IDELEEMSTGN I KQ
Sbjct  205  TQQFASRIDELEEMSTGNRIWKQ  227


 Score = 28.5 bits (62),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  230  VDIGTVTAQQAKDWGF  245



>ref|YP_009041156.1| NADH dehydrogenase subunit 7 (mitochondrion) [Rhazya stricta]
 gb|AIB08802.1| NADH dehydrogenase subunit 7 (mitochondrion) [Rhazya stricta]
Length=394

 Score = 42.7 bits (99),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 20/23 (87%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -3

Query  268  TQQFASHIDELEEMSTGNHILKQ  200
            TQQFAS IDELEEMSTGN I KQ
Sbjct  179  TQQFASRIDELEEMSTGNRIWKQ  201


 Score = 28.1 bits (61),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>gb|ABE98776.1| NADH dehydrogenase subunit 7 [Zea mays subsp. mays]
Length=394

 Score = 42.7 bits (99),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 20/23 (87%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -3

Query  268  TQQFASHIDELEEMSTGNHILKQ  200
            TQQFAS IDELEEMSTGN I KQ
Sbjct  179  TQQFASRIDELEEMSTGNRIWKQ  201


 Score = 27.7 bits (60),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>ref|YP_588347.1| NADH dehydrogenase subunit 7 [Zea mays subsp. mays]
 ref|YP_740386.1| NADH dehydrogenase subunit 7 [Zea mays subsp. parviglumis]
 gb|AAR91198.1| NADH dehydrogenase subunit 7 (mitochondrion) [Zea mays]
 gb|ABE98686.1| NADH dehydrogenase subunit 7 (mitochondrion) [Zea mays subsp. 
mays]
 gb|ABE98729.1| NADH dehydrogenase subunit 7 (mitochondrion) [Zea mays subsp. 
mays]
 gb|ABF70863.1| NADH dehydrogenase subunit 7 (mitochondrion) [Zea mays subsp. 
parviglumis]
 gb|ABF70926.1| NADH dehydrogenase subunit 7 (mitochondrion) [Zea mays subsp. 
mays]
 gb|AFW86883.1| NADH dehydrogenase subunit 7 [Zea mays]
Length=394

 Score = 42.7 bits (99),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 20/23 (87%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -3

Query  268  TQQFASHIDELEEMSTGNHILKQ  200
            TQQFAS IDELEEMSTGN I KQ
Sbjct  179  TQQFASRIDELEEMSTGNRIWKQ  201


 Score = 27.7 bits (60),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>ref|YP_006666126.1| NADH dehydrogenase subunit 7 (mitochondrion) [Malus domestica]
 emb|CBX33385.1| NADH dehydrogenase subunit 7 (mitochondrion) [Malus domestica]
Length=394

 Score = 42.7 bits (99),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 20/23 (87%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -3

Query  268  TQQFASHIDELEEMSTGNHILKQ  200
            TQQFAS IDELEEMSTGN I KQ
Sbjct  179  TQQFASRIDELEEMSTGNRIWKQ  201


 Score = 28.1 bits (61),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>ref|YP_398427.1| nad7 [Triticum aestivum]
 ref|YP_008757365.1| NADH dehydrogenase subunit 7 (mitochondrion) [Aegilops speltoides]
 ref|YP_008758164.1| NADH dehydrogenase subunit 7 (mitochondrion) [Triticum timopheevii]
 emb|CAA52952.1| NADH dehydrogenase [Triticum aestivum]
 dbj|BAE47694.1| nad7 [Triticum aestivum]
 gb|ACA62639.1| nad7 (mitochondrion) [Triticum aestivum]
 gb|ADE08107.1| nad7-1 (mitochondrion) [Triticum aestivum]
 gb|ADE08108.1| nad7-2 (mitochondrion) [Triticum aestivum]
 dbj|BAN94726.1| NADH dehydrogenase subunit 7 (mitochondrion) [Triticum timopheevii]
 dbj|BAN94742.1| NADH dehydrogenase subunit 7 (mitochondrion) [Aegilops speltoides]
 gb|AHI16356.1| nad7 (mitochondrion) [Aegilops longissima]
 gb|AHI16390.1| nad7 (mitochondrion) [Triticum turgidum subsp. durum]
 gb|AHI16417.1| nad7 (mitochondrion) [Triticum turgidum subsp. durum]
Length=394

 Score = 42.7 bits (99),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 20/23 (87%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -3

Query  268  TQQFASHIDELEEMSTGNHILKQ  200
            TQQFAS IDELEEMSTGN I KQ
Sbjct  179  TQQFASRIDELEEMSTGNRIWKQ  201


 Score = 27.7 bits (60),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>ref|YP_740444.1| NADH dehydrogenase subunit 7 [Zea luxurians]
 gb|ABG65654.1| NADH dehydrogenase subunit 7 (mitochondrion) [Zea luxurians]
Length=392

 Score = 42.7 bits (99),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 20/23 (87%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -3

Query  268  TQQFASHIDELEEMSTGNHILKQ  200
            TQQFAS IDELEEMSTGN I KQ
Sbjct  177  TQQFASRIDELEEMSTGNRIWKQ  199


 Score = 27.7 bits (60),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  202  VDIGTVTAQQAKDWGF  217



>ref|YP_514643.1| NADH dehydrogenase subunit 7 [Oryza sativa Indica Group]
 ref|YP_740366.1| NADH dehydrogenase subunit 7 [Zea perennis]
 ref|YP_762338.1| NADH dehydrogenase subunit 7 [Sorghum bicolor]
 ref|YP_762499.1| NADH dehydrogenase subunit 7 [Tripsacum dactyloides]
 ref|YP_002000562.1| NADH dehydrogenase subunit 7 [Oryza sativa Japonica Group]
 dbj|BAC19866.1| NADH dehydrogenase subunit 7 [Oryza sativa Japonica Group]
 gb|AAZ99276.1| NADH dehydrogenase subunit 7 (mitochondrion) [Oryza sativa Indica 
Group]
 gb|AAZ99330.1| NADH dehydrogenase subunit 7 (mitochondrion) [Oryza sativa Japonica 
Group]
 gb|AAZ99383.1| NADH dehydrogenase subunit 7 (mitochondrion) [Oryza sativa Japonica 
Group]
 gb|ABF70831.1| NADH dehydrogenase subunit 7 (mitochondrion) [Zea perennis]
 gb|ABI60886.1| NADH dehydrogenase subunit 7 (mitochondrion) [Sorghum bicolor]
 gb|ABI74658.1| NADH dehydrogenase subunit 7 (mitochondrion) [Tripsacum dactyloides]
 gb|ABY55217.1| NADH dehydrogenase subunit 7 [Bambusa oldhamii]
 gb|AEK66759.1| NADH dehydrogenase subunit 7 [Ferrocalamus rimosivaginus]
 gb|AER13024.1| NADH dehydrogenase subunit 7 (mitochondrion) [Oryza sativa Indica 
Group]
 gb|AER13097.1| NADH dehydrogenase subunit 7 (mitochondrion) [Oryza sativa Indica 
Group]
 gb|AEX98095.1| NADH dehydrogenase subunit 7 (mitochondrion) [Ferrocalamus rimosivaginus]
 gb|AEZ03747.1| NADH dehydrogenase subunit 7 (mitochondrion) [Oryza sativa Indica 
Group]
 gb|AEZ03790.1| NADH dehydrogenase subunit 7 (mitochondrion) [Oryza sativa Indica 
Group]
 gb|AGI48785.1| NADH dehydrogenase subunit 7 (mitochondrion) [Lolium perenne]
 gb|AGI48797.1| NADH dehydrogenase subunit 7 (mitochondrion) [Lolium perenne]
 dbj|BAN67484.1| NADH dehydrogenase subunit 7 (mitochondrion) [Oryza rufipogon]
 dbj|BAN67492.1| NADH dehydrogenase subunit 7 (mitochondrion) [Oryza rufipogon]
 dbj|BAN67516.1| NADH dehydrogenase subunit 7 (mitochondrion) [Oryza rufipogon]
 dbj|BAN67545.1| NADH dehydrogenase subunit 7 (mitochondrion) [Oryza rufipogon]
Length=394

 Score = 42.7 bits (99),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 20/23 (87%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -3

Query  268  TQQFASHIDELEEMSTGNHILKQ  200
            TQQFAS IDELEEMSTGN I KQ
Sbjct  179  TQQFASRIDELEEMSTGNRIWKQ  201


 Score = 27.7 bits (60),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>ref|YP_006280930.1| NADH dehydrogenase subunit 7 (mitochondrion) [Spirodela polyrhiza]
 gb|AFI54940.1| NADH dehydrogenase subunit 7 (mitochondrion) [Spirodela polyrhiza]
Length=375

 Score = 43.1 bits (100),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 20/23 (87%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -3

Query  268  TQQFASHIDELEEMSTGNHILKQ  200
            TQQFAS IDELEEMSTGN I KQ
Sbjct  160  TQQFASRIDELEEMSTGNRIWKQ  182


 Score = 27.3 bits (59),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  185  VDIGTVTAQQAKDWGF  200



>emb|CDM80240.1| unnamed protein product [Triticum aestivum]
Length=404

 Score = 42.7 bits (99),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 20/23 (87%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -3

Query  268  TQQFASHIDELEEMSTGNHILKQ  200
            TQQFAS IDELEEMSTGN I KQ
Sbjct  189  TQQFASRIDELEEMSTGNRIWKQ  211


 Score = 27.3 bits (59),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  214  VDIGTVTAQQAKDWGF  229



>gb|ADG85341.1| NADH dehydrogenase subunit 7 [Silene vulgaris]
Length=139

 Score = 43.5 bits (101),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQH  197
            FTQQFAS IDELEEM TGN I KQ 
Sbjct  99   FTQQFASRIDELEEMLTGNRIWKQR  123


 Score = 26.9 bits (58),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 11/15 (73%), Positives = 12/15 (80%), Gaps = 0/15 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGG  154
            +DIGTV AQQA D G
Sbjct  125  VDIGTVTAQQAKDWG  139



>ref|YP_001661405.1| NADH dehydrogenase subunit 7 [Cycas taitungensis]
 dbj|BAF98407.1| NADH dehydrogenase subunit 7 [Cycas taitungensis]
Length=394

 Score = 42.0 bits (97),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 20/24 (83%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQ  200
            FTQQFAS IDE EEMSTGN I KQ
Sbjct  178  FTQQFASRIDESEEMSTGNRIWKQ  201


 Score = 28.5 bits (62),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>ref|YP_002608348.1| NADH dehydrogenase subunit 7 [Vitis vinifera]
 emb|CAQ77574.1| NADH dehydrogenase subunit 7 [Vitis vinifera]
 gb|ACS15215.1| NADH dehydrogenase subunit 7 [Vitis vinifera]
Length=394

 Score = 42.7 bits (99),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 20/23 (87%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -3

Query  268  TQQFASHIDELEEMSTGNHILKQ  200
            TQQFAS IDELEEMSTGN I KQ
Sbjct  179  TQQFASRIDELEEMSTGNRIWKQ  201


 Score = 27.3 bits (59),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>gb|AAW63679.1| NADH dehydrogenase subunit 7 [Asarum sp. Qiu 96018]
Length=155

 Score = 40.8 bits (94),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = -3

Query  268  TQQFASHIDELEEMSTGNHILKQH  197
            TQQFAS IDE EEMSTGN I KQ 
Sbjct  108  TQQFASRIDESEEMSTGNRIWKQR  131


 Score = 29.6 bits (65),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  133  VDIGTVTAQQAKDWGF  148



>ref|YP_005090366.1| NADH dehydrogenase subunit 7 (mitochondrion) [Phoenix dactylifera]
 gb|AEM43907.1| NADH dehydrogenase subunit 7 (mitochondrion) [Phoenix dactylifera]
Length=394

 Score = 42.7 bits (99),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 20/23 (87%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -3

Query  268  TQQFASHIDELEEMSTGNHILKQ  200
            TQQFAS IDELEEMSTGN I KQ
Sbjct  179  TQQFASRIDELEEMSTGNRIWKQ  201


 Score = 27.3 bits (59),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>gb|AAW63675.1| NADH dehydrogenase subunit 7 [Laurus nobilis]
Length=188

 Score = 40.4 bits (93),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = -3

Query  268  TQQFASHIDELEEMSTGNHILKQH  197
            TQQFAS IDE EEMSTGN I KQ 
Sbjct  141  TQQFASRIDESEEMSTGNRIWKQR  164


 Score = 29.6 bits (65),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  166  VDIGTVTAQQAKDWGF  181



>gb|AEZ35013.1| NADH dehydrogenase subunit 7, partial (mitochondrion) [Phyllocladus 
aspleniifolius]
 gb|AEZ35014.1| NADH dehydrogenase subunit 7, partial (mitochondrion) [Phyllocladus 
trichomanoides]
Length=249

 Score = 40.8 bits (94),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQH  197
            FTQQFAS IDE EEM TGN I KQ 
Sbjct  91   FTQQFASRIDESEEMLTGNRIRKQR  115


 Score = 29.3 bits (64),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 14/27 (52%), Positives = 18/27 (67%), Gaps = 2/27 (7%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF--IVPQPESPC  124
            +DIGTV AQQA D GF  ++P+    C
Sbjct  117  VDIGTVTAQQAKDWGFSGVMPRGSGVC  143



>ref|XP_006397342.1| hypothetical protein EUTSA_v10028891mg [Eutrema salsugineum]
 gb|ESQ38795.1| hypothetical protein EUTSA_v10028891mg [Eutrema salsugineum]
Length=260

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -3

Query  271  FTQQFASHIDELEEMSTGNHILKQH  197
            FTQQFAS IDELEEMSTGN I KQ 
Sbjct  95   FTQQFASRIDELEEMSTGNRIWKQR  119



>emb|CBI33446.3| unnamed protein product [Vitis vinifera]
Length=285

 Score = 41.2 bits (95),  Expect(2) = 4e-04, Method: Composition-based stats.
 Identities = 19/23 (83%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -3

Query  268  TQQFASHIDELEEMSTGNHILKQ  200
            TQQFAS ID LEEMSTGN I KQ
Sbjct  157  TQQFASRIDGLEEMSTGNRIWKQ  179


 Score = 28.5 bits (62),  Expect(2) = 4e-04, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  182  VDIGTVTAQQAKDWGF  197



>ref|YP_006291823.1| nad7 gene product (mitochondrion) [Daucus carota subsp. sativus]
 gb|AEY81208.1| NADH dehydrogenase subunit 7 (mitochondrion) [Daucus carota subsp. 
sativus]
Length=394

 Score = 41.6 bits (96),  Expect(2) = 5e-04, Method: Composition-based stats.
 Identities = 19/23 (83%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -3

Query  268  TQQFASHIDELEEMSTGNHILKQ  200
            TQQF+S IDELEEMSTGN I KQ
Sbjct  179  TQQFSSRIDELEEMSTGNRIWKQ  201


 Score = 27.7 bits (60),  Expect(2) = 5e-04, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>ref|YP_009091708.1| NADH dehydrogenase subunit 7 (mitochondrion) [Panax ginseng]
 gb|AHJ80997.1| NADH dehydrogenase subunit 7 (mitochondrion) [Panax ginseng]
Length=394

 Score = 41.6 bits (96),  Expect(2) = 6e-04, Method: Composition-based stats.
 Identities = 19/23 (83%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -3

Query  268  TQQFASHIDELEEMSTGNHILKQ  200
            TQQF+S IDELEEMSTGN I KQ
Sbjct  179  TQQFSSRIDELEEMSTGNRIWKQ  201


 Score = 27.7 bits (60),  Expect(2) = 6e-04, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>ref|YP_008080943.1| NADH dehydrogenase subunit 7 (mitochondrion) [Butomus umbellatus]
 gb|AFY16560.1| NADH dehydrogenase subunit 7 (mitochondrion) [Butomus umbellatus]
Length=392

 Score = 41.6 bits (96),  Expect(2) = 7e-04, Method: Composition-based stats.
 Identities = 19/23 (83%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -3

Query  268  TQQFASHIDELEEMSTGNHILKQ  200
            TQQF+S IDELEEMSTGN I KQ
Sbjct  179  TQQFSSRIDELEEMSTGNRIWKQ  201


 Score = 27.3 bits (59),  Expect(2) = 7e-04, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  204  VDIGTVTAQQAKDWGF  219



>gb|AAW63673.1| NADH dehydrogenase subunit 7 [Amborella trichopoda]
Length=285

 Score = 40.8 bits (94),  Expect(2) = 7e-04, Method: Composition-based stats.
 Identities = 19/23 (83%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -3

Query  268  TQQFASHIDELEEMSTGNHILKQ  200
            TQQFAS IDE EEMSTGN I KQ
Sbjct  156  TQQFASRIDESEEMSTGNRIWKQ  178


 Score = 28.1 bits (61),  Expect(2) = 7e-04, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  181  VDIGTVTAQQAKDWGF  196



>gb|AAW63686.1| NADH dehydrogenase subunit 7 [Berberis bealei]
Length=282

 Score = 40.4 bits (93),  Expect(2) = 9e-04, Method: Composition-based stats.
 Identities = 19/23 (83%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -3

Query  268  TQQFASHIDELEEMSTGNHILKQ  200
            TQQFAS IDE EEMSTGN I KQ
Sbjct  153  TQQFASRIDESEEMSTGNRIWKQ  175


 Score = 28.1 bits (61),  Expect(2) = 9e-04, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  198  MDIGTVNAQQANDGGF  151
            +DIGTV AQQA D GF
Sbjct  178  VDIGTVTAQQAKDWGF  193



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 516332803020