BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7511_g1_i1 len=1731 path=[3443:0-585 2321:586-1730]

Length=1731
                                                                      Score     E

ref|XP_009628466.1|  PREDICTED: acetylornithine aminotransferase,...    537   0.0      
ref|XP_009800487.1|  PREDICTED: acetylornithine aminotransferase,...    536   0.0      
ref|XP_006358869.1|  PREDICTED: acetylornithine aminotransferase,...    530   0.0      
ref|XP_004245648.1|  PREDICTED: acetylornithine aminotransferase,...    530   0.0      
ref|XP_011082096.1|  PREDICTED: acetylornithine aminotransferase,...    523   6e-178   
ref|XP_008228754.1|  PREDICTED: acetylornithine aminotransferase,...    511   2e-173   
ref|XP_010249213.1|  PREDICTED: acetylornithine aminotransferase,...    506   4e-171   
gb|ABK95025.1|  unknown                                                 504   1e-170   Populus trichocarpa [western balsam poplar]
gb|KDP37012.1|  hypothetical protein JCGZ_06068                         503   5e-170   
ref|XP_004303261.1|  PREDICTED: acetylornithine aminotransferase,...    502   6e-170   
emb|CDO98200.1|  unnamed protein product                                502   1e-169   
ref|XP_006475328.1|  PREDICTED: acetylornithine aminotransferase,...    502   2e-169   
ref|XP_011041861.1|  PREDICTED: acetylornithine aminotransferase,...    500   4e-169   
gb|EYU24623.1|  hypothetical protein MIMGU_mgv1a006075mg                500   6e-169   
gb|KHG20983.1|  Acetylornithine aminotransferase, mitochondrial         499   1e-168   
emb|CBI36456.3|  unnamed protein product                                495   2e-168   
ref|XP_002323766.2|  hypothetical protein POPTR_0017s08060g             496   1e-167   Populus trichocarpa [western balsam poplar]
ref|XP_007023353.1|  Acetylornithine aminotransferase, mitochondrial    496   1e-167   
ref|XP_009341722.1|  PREDICTED: acetylornithine aminotransferase,...    496   2e-167   
sp|O04866.1|ARGD_ALNGL  RecName: Full=Acetylornithine aminotransf...    496   3e-167   Alnus glutinosa
ref|XP_002272158.1|  PREDICTED: acetylornithine aminotransferase,...    496   3e-167   Vitis vinifera
ref|XP_010691056.1|  PREDICTED: acetylornithine aminotransferase,...    495   6e-167   
emb|CDP11028.1|  unnamed protein product                                494   2e-166   
gb|KDO61628.1|  hypothetical protein CISIN_1g012363mg                   493   4e-166   
ref|XP_002307189.2|  hypothetical protein POPTR_0005s09860g             493   6e-166   Populus trichocarpa [western balsam poplar]
ref|XP_002513387.1|  acetylornithine aminotransferase, putative         493   8e-166   Ricinus communis
ref|XP_011022086.1|  PREDICTED: acetylornithine aminotransferase,...    492   2e-165   
ref|XP_008461165.1|  PREDICTED: acetylornithine aminotransferase,...    490   4e-165   
ref|XP_002268013.1|  PREDICTED: acetylornithine aminotransferase,...    489   2e-164   Vitis vinifera
ref|XP_008383084.1|  PREDICTED: acetylornithine aminotransferase,...    488   5e-164   
ref|XP_004135869.1|  PREDICTED: acetylornithine aminotransferase,...    486   1e-163   
gb|KDP25097.1|  hypothetical protein JCGZ_22632                         486   2e-163   
ref|XP_004294104.1|  PREDICTED: acetylornithine aminotransferase,...    486   4e-163   
ref|XP_010093044.1|  Acetylornithine aminotransferase                   485   4e-163   
ref|XP_008226105.1|  PREDICTED: acetylornithine aminotransferase,...    485   6e-163   
ref|XP_008372028.1|  PREDICTED: acetylornithine aminotransferase,...    483   3e-162   
ref|XP_003529021.1|  PREDICTED: acetylornithine aminotransferase,...    481   2e-161   
ref|XP_007213801.1|  hypothetical protein PRUPE_ppa005378mg             481   3e-161   
ref|XP_004492217.1|  PREDICTED: acetylornithine aminotransferase,...    480   5e-161   
ref|XP_003536567.1|  PREDICTED: acetylornithine aminotransferase,...    480   5e-161   
ref|XP_010937866.1|  PREDICTED: acetylornithine aminotransferase,...    480   9e-161   
ref|XP_010937867.1|  PREDICTED: acetylornithine aminotransferase,...    479   1e-160   
ref|XP_009416294.1|  PREDICTED: acetylornithine aminotransferase,...    479   2e-160   
gb|KEH22492.1|  acetylornithine aminotransferase                        479   2e-160   
ref|XP_010937865.1|  PREDICTED: acetylornithine aminotransferase,...    479   3e-160   
ref|XP_010064050.1|  PREDICTED: acetylornithine aminotransferase,...    477   1e-159   
ref|XP_004960383.1|  PREDICTED: acetylornithine aminotransferase,...    475   4e-159   
gb|ACJ84700.1|  unknown                                                 475   5e-159   Medicago truncatula
ref|XP_006302240.1|  hypothetical protein CARUB_v10020266mg             474   7e-159   
ref|NP_178175.1|  acetylornithine aminotransferase                      473   3e-158   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008789127.1|  PREDICTED: acetylornithine aminotransferase,...    473   5e-158   
ref|XP_007145969.1|  hypothetical protein PHAVU_006G002000g             473   6e-158   
ref|XP_006405081.1|  hypothetical protein EUTSA_v10000649mg             467   6e-158   
gb|KFK42443.1|  hypothetical protein AALP_AA2G257200                    472   6e-158   
ref|XP_010429934.1|  PREDICTED: acetylornithine aminotransferase,...    472   8e-158   
ref|XP_010472903.1|  PREDICTED: acetylornithine aminotransferase,...    471   1e-157   
ref|XP_006389814.1|  hypothetical protein EUTSA_v10018519mg             471   1e-157   
gb|AAM63124.1|  putative acetylornithine transaminase                   471   1e-157   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010417687.1|  PREDICTED: acetylornithine aminotransferase,...    471   2e-157   
gb|EPS60675.1|  hypothetical protein M569_14125                         466   5e-156   
ref|XP_002887819.1|  predicted protein                                  466   2e-155   
emb|CDY39963.1|  BnaC06g40410D                                          465   2e-155   
emb|CDX87325.1|  BnaA07g35480D                                          464   7e-155   
ref|XP_009128405.1|  PREDICTED: acetylornithine aminotransferase,...    464   8e-155   
emb|CDY37615.1|  BnaA02g19550D                                          464   8e-155   
ref|XP_010539525.1|  PREDICTED: acetylornithine aminotransferase,...    464   9e-155   
emb|CDY67620.1|  BnaC02g46570D                                          463   1e-154   
ref|XP_002439221.1|  hypothetical protein SORBIDRAFT_09g002480          463   2e-154   Sorghum bicolor [broomcorn]
gb|AAU10748.1|  putative acetylornithine aminotransferase               463   3e-154   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010905303.1|  PREDICTED: acetylornithine aminotransferase,...    463   3e-154   
ref|XP_010905305.1|  PREDICTED: acetylornithine aminotransferase,...    457   3e-154   
ref|XP_009106733.1|  PREDICTED: acetylornithine aminotransferase,...    462   4e-154   
ref|XP_009384919.1|  PREDICTED: acetylornithine aminotransferase,...    460   4e-153   
ref|XP_010537910.1|  PREDICTED: acetylornithine aminotransferase,...    459   6e-153   
ref|XP_006654954.1|  PREDICTED: acetylornithine aminotransferase,...    458   7e-153   
gb|EMT24167.1|  Acetylornithine aminotransferase, mitochondrial         454   1e-152   
dbj|BAJ87243.1|  predicted protein                                      456   1e-151   
dbj|BAJ97123.1|  predicted protein                                      456   2e-151   
gb|EMS55137.1|  Acetylornithine aminotransferase, mitochondrial         451   3e-151   
ref|XP_008648559.1|  PREDICTED: acetylornithine aminotransferase,...    452   3e-150   
gb|AFW74701.1|  putative acetylornithine/succinylornithine aminot...    454   3e-150   
ref|XP_006853412.1|  hypothetical protein AMTR_s00032p00157410          453   2e-149   
ref|XP_003569060.1|  PREDICTED: acetylornithine aminotransferase,...    449   8e-149   
ref|XP_006422230.1|  hypothetical protein CICLE_v10005019mg             437   1e-144   
ref|XP_008391155.1|  PREDICTED: acetylornithine aminotransferase,...    430   4e-143   
ref|NP_001059578.1|  Os07g0461900                                       416   1e-137   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006422229.1|  hypothetical protein CICLE_v10005019mg             416   5e-137   
ref|XP_010279487.1|  PREDICTED: acetylornithine aminotransferase,...    415   1e-136   
gb|KCW71212.1|  hypothetical protein EUGRSUZ_F043031                    405   1e-134   
ref|XP_002972235.1|  hypothetical protein SELMODRAFT_97066              405   2e-131   
ref|XP_002984148.1|  hypothetical protein SELMODRAFT_119949             402   2e-130   
ref|XP_010905304.1|  PREDICTED: acetylornithine aminotransferase,...    394   9e-128   
ref|XP_002989754.1|  hypothetical protein SELMODRAFT_184782             394   3e-127   
ref|XP_002991743.1|  hypothetical protein SELMODRAFT_186313             392   3e-126   
ref|XP_001783933.1|  predicted protein                                  391   7e-126   
gb|EEC81978.1|  hypothetical protein OsI_25895                          369   2e-119   Oryza sativa Indica Group [Indian rice]
ref|XP_002505636.1|  predicted protein                                  368   2e-117   Micromonas commoda
ref|XP_005846580.1|  hypothetical protein CHLNCDRAFT_35898              355   2e-112   
ref|XP_001698091.1|  acetylornithine aminotransferase                   355   3e-112   Chlamydomonas reinhardtii
ref|XP_002945774.1|  acetylornithine aminotransferase                   353   1e-111   
dbj|BAC84165.1|  putative acetylornithine aminotransferase              345   1e-111   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001752434.1|  predicted protein                                  349   1e-110   
emb|CEG02202.1|  Pyridoxal phosphate-dependent transferase, major...    343   2e-107   
ref|XP_003083141.1|  ARGD_ALNGL Acetylornithine aminotransferase,...    338   5e-107   
gb|ACQ66331.1|  N2-acetylornithine aminotransferase                     328   2e-105   Populus maximowiczii x Populus nigra
ref|XP_005651785.1|  acetylornithine aminotransferase                   337   3e-105   
ref|XP_007509701.1|  predicted protein                                  334   7e-104   
ref|XP_001422626.1|  predicted protein                                  329   2e-103   Ostreococcus lucimarinus CCE9901
ref|XP_003059947.1|  predicted protein                                  330   1e-102   
emb|CDY68670.1|  BnaA02g36300D                                          326   3e-101   
gb|KFM27780.1|  Acetylornithine aminotransferase, chloroplastic/m...    328   8e-97    
ref|WP_011955608.1|  acetylornithine aminotransferase                   301   3e-92    
gb|KDD73023.1|  class-III aminotransferase                              298   2e-91    
ref|WP_006562923.1|  acetylornithine aminotransferase                   293   4e-89    
gb|ADV91221.1|  mitochondrial acetylornithine aminotransferase          294   2e-88    
ref|WP_012119751.1|  acetylornithine aminotransferase                   284   9e-86    
ref|WP_012192076.1|  acetylornithine aminotransferase                   280   2e-84    
ref|XP_002530447.1|  acetylornithine aminotransferase, putative         272   7e-83    Ricinus communis
ref|WP_014432970.1|  acetylornithine aminotransferase                   275   4e-82    
ref|WP_028457475.1|  acetylornithine aminotransferase                   273   2e-81    
ref|WP_012257809.1|  MULTISPECIES: acetylornithine aminotransferase     272   4e-81    
gb|EPB91282.1|  acetylornithine aminotransferase                        272   1e-80    
gb|ESA18519.1|  hypothetical protein GLOINDRAFT_93361                   268   2e-79    
ref|XP_007217532.1|  hypothetical protein PRUPE_ppa023444mg             263   3e-79    
ref|WP_015940596.1|  acetylornithine aminotransferase                   266   3e-79    
ref|WP_031460130.1|  acetylornithine aminotransferase                   266   5e-79    
gb|EXX62564.1|  acetylornithine transaminase                            268   6e-79    
gb|ETK81594.1|  hypothetical protein L915_12918                         267   8e-79    
emb|CDS07224.1|  hypothetical protein LRAMOSA09747                      267   8e-79    
ref|XP_008894184.1|  hypothetical protein PPTG_03260                    267   8e-79    
gb|KFH63488.1|  acetylornithine aminotransferase                        267   1e-78    
ref|WP_029215161.1|  acetylornithine aminotransferase                   265   1e-78    
gb|ETP39434.1|  hypothetical protein F442_13097                         265   4e-78    
emb|CDH49279.1|  acetylornithine aminotransferase                       263   3e-77    
ref|XP_646043.1|  acetylornithine transaminase                          263   4e-77    Dictyostelium discoideum AX4
ref|WP_013932809.1|  acetylornithine aminotransferase                   260   7e-77    
gb|EFA79342.1|  acetylornithine transaminase                            261   9e-77    Heterostelium album PN500
ref|WP_022075976.1|  acetylornithine aminotransferase 1                 259   1e-76    
gb|EIE77747.1|  hypothetical protein RO3G_02451                         260   3e-76    
emb|CCI11131.1|  unnamed protein product                                258   8e-76    
emb|CCG80686.1|  Acetylornithine aminotransferase,mitochondrial         259   2e-75    
ref|XP_003298877.1|  hypothetical protein PTT_09712                     258   4e-75    
ref|WP_013707407.1|  acetylornithine aminotransferase                   256   5e-75    
ref|XP_007216288.1|  hypothetical protein PRUPE_ppa020493mg             248   9e-75    
ref|XP_003836538.1|  similar to acetylornithine aminotransferase        257   2e-74    
emb|CEG64595.1|  Putative Acetylornithine aminotransferase              255   2e-74    
ref|WP_022636951.1|  acetyl ornithine aminotransferase                  253   3e-74    
ref|WP_022249920.1|  acetylornithine aminotransferase                   253   4e-74    
ref|WP_004611278.1|  acetylornithine aminotransferase                   253   4e-74    
emb|CEJ03623.1|  Putative Acetylornithine aminotransferase              254   6e-74    
ref|WP_027340670.1|  acetylornithine aminotransferase                   252   8e-74    
gb|ETP39436.1|  hypothetical protein, variant 2                         253   9e-74    
gb|KDE09241.1|  hypothetical protein MVLG_00561                         256   9e-74    
ref|XP_008894186.1|  hypothetical protein, variant 2                    253   9e-74    
gb|ETK81596.1|  hypothetical protein, variant 2                         253   9e-74    
ref|XP_007416523.1|  hypothetical protein MELLADRAFT_93780              253   1e-73    
ref|WP_022206306.1|  acetylornithine aminotransferase                   251   2e-73    
ref|WP_018250215.1|  hypothetical protein                               251   2e-73    
gb|EUN23024.1|  hypothetical protein COCVIDRAFT_41241                   253   3e-73    
gb|EKE02225.1|  hypothetical protein ACD_20C00410G0011                  250   4e-73    
ref|XP_007706641.1|  hypothetical protein COCCADRAFT_369                253   5e-73    
gb|EMD96040.1|  hypothetical protein COCHEDRAFT_1221688                 253   5e-73    
emb|CCA20043.1|  acetylornithine aminotransferase putative              251   6e-73    
ref|XP_008021658.1|  hypothetical protein SETTUDRAFT_166841             253   7e-73    
ref|XP_001935646.1|  acetylornithine aminotransferase, mitochondr...    253   7e-73    Pyrenophora tritici-repentis Pt-1C-BFP
ref|XP_007694616.1|  hypothetical protein COCSADRAFT_195071             252   8e-73    
ref|XP_503166.1|  YALI0D22847p                                          250   1e-72    Yarrowia lipolytica CLIB122
ref|WP_038067649.1|  acetylornithine aminotransferase                   249   1e-72    
ref|XP_007683105.1|  hypothetical protein COCMIDRAFT_82121              252   1e-72    
ref|XP_011106933.1|  hypothetical protein H072_941                      251   1e-72    
ref|XP_009841736.1|  hypothetical protein H257_15347                    251   1e-72    
ref|WP_026485820.1|  acetylornithine aminotransferase                   249   2e-72    
gb|EMG45834.1|  Acetylornithine aminotransferase, mitochondrial         250   2e-72    
ref|WP_022204260.1|  acetylornithine aminotransferase                   249   2e-72    
ref|XP_004362086.1|  acetylornithine transaminase                       251   3e-72    
ref|WP_022360979.1|  acetylornithine aminotransferase 1                 248   4e-72    
ref|XP_001797854.1|  hypothetical protein SNOG_07520                    248   5e-72    Parastagonospora nodorum SN15
ref|XP_007373081.1|  acetylornithine aminotransferase                   248   6e-72    
ref|XP_004344556.1|  acetylornithine and succinylornithine aminot...    249   9e-72    
ref|XP_009535471.1|  hypothetical protein PHYSODRAFT_564720             248   9e-72    
ref|XP_011123454.1|  hypothetical protein AOL_s00081g335                249   1e-71    
ref|WP_008119747.1|  acetylornithine aminotransferase [                 246   1e-71    
gb|ESW97296.1|  Acetylornithine aminotransferase, mitochondrial         247   2e-71    
ref|WP_012546465.1|  MULTISPECIES: acetylornithine aminotransferase     246   2e-71    
gb|KDN46630.1|  acetylornithine and succinylornithine aminotransf...    248   2e-71    
ref|XP_003287502.1|  hypothetical protein DICPUDRAFT_151611             247   2e-71    
ref|WP_022239961.1|  acetylornithine aminotransferase                   246   2e-71    
gb|EPB88128.1|  hypothetical protein HMPREF1544_05072                   247   3e-71    
ref|WP_037500035.1|  acetylornithine aminotransferase                   246   3e-71    
gb|KEY75394.1|  acetylornithine aminotransferase                        248   3e-71    
ref|WP_028844494.1|  acetylornithine aminotransferase                   245   3e-71    
gb|KDO34595.1|  hypothetical protein SPRG_00658                         247   4e-71    
ref|WP_022098074.1|  acetylornithine aminotransferase                   245   5e-71    
ref|WP_026478019.1|  acetylornithine aminotransferase                   245   6e-71    
ref|WP_012981033.1|  acetylornithine aminotransferase                   245   6e-71    
ref|WP_012738845.1|  acetylornithine aminotransferase [                 244   8e-71    
ref|XP_755579.1|  acetylornithine aminotransferase                      247   8e-71    Aspergillus fumigatus Af293
ref|WP_003019851.1|  acetylornithine aminotransferase                   244   9e-71    
ref|NP_001054542.2|  Os05g0129100                                       237   1e-70    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002901483.1|  acetylornithine aminotransferase, mitochondr...    245   1e-70    
ref|WP_013176319.1|  acetylornithine aminotransferase                   244   1e-70    
dbj|GAM20999.1|  hypothetical protein SAMD00019534_041740               245   1e-70    
ref|XP_003049623.1|  predicted protein                                  245   1e-70    
ref|WP_029730714.1|  acetylornithine aminotransferase                   244   1e-70    
ref|XP_008879532.1|  hypothetical protein H310_13694                    245   1e-70    
ref|WP_033125070.1|  acetylornithine aminotransferase                   243   1e-70    
ref|WP_005337071.1|  acetylornithine aminotransferase                   244   2e-70    
ref|WP_022305917.1|  acetylornithine aminotransferase                   243   2e-70    
ref|XP_002617108.1|  hypothetical protein CLUG_02552                    245   2e-70    Clavispora lusitaniae ATCC 42720
ref|XP_008605392.1|  hypothetical protein SDRG_01636                    244   3e-70    
gb|KGK38132.1|  hypothetical protein JL09_g2760                         244   3e-70    
ref|WP_021983718.1|  acetylornithine aminotransferase                   239   3e-70    
ref|XP_004194670.1|  Piso0_005177                                       244   3e-70    
ref|WP_022279144.1|  acetylornithine aminotransferase                   243   4e-70    
gb|KHC76594.1|  acetylornithine/succinylornithine family transami...    244   4e-70    
gb|KGR07191.1|  acetylornithine/succinylornithine family transami...    244   4e-70    
gb|KHC34181.1|  acetylornithine/succinylornithine family transami...    244   5e-70    
ref|XP_003870026.1|  Arg8 acetylornithine aminotransferase              244   5e-70    
gb|KGQ96127.1|  acetylornithine/succinylornithine family transami...    244   5e-70    
ref|WP_009617506.1|  acetylornithine aminotransferase                   242   6e-70    
ref|XP_007783326.1|  hypothetical protein W97_07156                     245   6e-70    
ref|WP_036558067.1|  acetylornithine aminotransferase                   242   6e-70    
ref|WP_022465018.1|  acetylornithine aminotransferase                   242   7e-70    
gb|KEQ83505.1|  mitochondrial acetylornithine aminotransferase          242   8e-70    
gb|EEQ45002.1|  acetylornithine aminotransferase, mitochondrial p...    243   8e-70    Candida albicans
ref|XP_717254.1|  hypothetical protein CaO19.11254                      243   9e-70    Candida albicans SC5314
ref|XP_458070.1|  DEHA2C09042p                                          243   1e-69    Debaryomyces hansenii CBS767
gb|KGQ85851.1|  acetylornithine/succinylornithine family transami...    243   1e-69    
emb|CCH43456.1|  Glutamate-1-semialdehyde 2,1-aminomutase               242   1e-69    
ref|WP_022747710.1|  acetylornithine aminotransferase                   241   1e-69    
gb|AIJ06020.1|  acetylornithine and succinylornithine aminotransf...    241   1e-69    
ref|WP_022123702.1|  acetylornithine aminotransferase                   241   1e-69    
ref|WP_010870226.1|  acetylornithine aminotransferase                   241   1e-69    
emb|CBX27957.1|  Acetylornithine aminotransferase                       241   1e-69    
ref|WP_008601730.1|  Acetylornithine aminotransferase                   241   2e-69    
gb|KFZ13311.1|  hypothetical protein V502_06690                         243   2e-69    
gb|EMF17890.1|  acetylornithine aminotransferase mitochondrial pr...    243   2e-69    
ref|WP_015326454.1|  acetylornithine/succinylornithine aminotrans...    241   2e-69    
gb|KHC76264.1|  acetylornithine/succinylornithine family transami...    243   2e-69    
ref|WP_022502240.1|  acetylornithine aminotransferase                   241   2e-69    
ref|WP_005334441.1|  acetylornithine aminotransferase                   241   2e-69    
ref|XP_003857080.1|  acetylornithine aminotransferase, mitochondrial    241   2e-69    
ref|WP_022431851.1|  acetylornithine aminotransferase                   241   2e-69    
ref|WP_014967991.1|  acetylornithine aminotransferase                   241   2e-69    
ref|WP_011722448.1|  acetylornithine aminotransferase                   240   3e-69    
ref|WP_013908954.1|  acetylornithine aminotransferase                   240   3e-69    
ref|WP_007044676.1|  acetylornithine aminotransferase                   240   3e-69    
ref|WP_007778531.1|  acetylornithine aminotransferase                   240   3e-69    
gb|EIT78003.1|  acetylornithine aminotransferase                        243   3e-69    
gb|KEF58276.1|  acetylornithine aminotransferase                        241   3e-69    
ref|XP_007677561.1|  hypothetical protein BAUCODRAFT_72369              243   4e-69    
gb|EDK39670.2|  hypothetical protein PGUG_03768                         242   4e-69    Meyerozyma guilliermondii
ref|WP_013799319.1|  acetylornithine aminotransferase                   240   4e-69    
ref|WP_039242080.1|  MULTISPECIES: acetylornithine aminotransferase     239   4e-69    
gb|ELR02591.1|  hypothetical protein GMDG_05557                         242   4e-69    
ref|WP_035767862.1|  acetylornithine aminotransferase                   239   5e-69    
ref|WP_016299437.1|  acetylornithine/succinylornithine family tra...    239   5e-69    
ref|WP_009248101.1|  acetylornithine aminotransferase                   239   5e-69    
ref|WP_031556877.1|  acetylornithine aminotransferase                   239   5e-69    
gb|AHF05946.1|  acetylornithine aminotransferase                        239   6e-69    
gb|KFY87710.1|  hypothetical protein V500_06810                         242   6e-69    
ref|WP_014825610.1|  acetylornithine aminotransferase                   239   7e-69    
ref|XP_001821856.1|  acetylornithine aminotransferase                   241   7e-69    Aspergillus oryzae RIB40
ref|WP_004607003.1|  acetylornithine aminotransferase [                 239   7e-69    
emb|CCX30402.1|  Similar to Acetylornithine aminotransferase, mit...    241   8e-69    
ref|WP_027585815.1|  acetylornithine aminotransferase                   239   8e-69    
ref|WP_016221116.1|  acetylornithine/succinylornithine family tra...    239   8e-69    
ref|XP_001484387.1|  hypothetical protein PGUG_03768                    241   9e-69    Meyerozyma guilliermondii ATCC 6260
gb|KFY24330.1|  hypothetical protein V493_05309                         241   1e-68    
ref|WP_029683833.1|  acetylornithine aminotransferase                   238   1e-68    
ref|WP_011641663.1|  acetylornithine aminotransferase                   239   1e-68    
emb|CCA40494.1|  acetylornithine aminotransferase                       240   1e-68    
ref|WP_025644401.1|  acetylornithine aminotransferase                   238   1e-68    
gb|ENH87052.1|  acetylornithine aminotransferase                        240   2e-68    
ref|WP_034612170.1|  acetylornithine aminotransferase                   238   2e-68    
gb|KFY52704.1|  hypothetical protein V496_08240                         240   2e-68    
ref|WP_006832959.1|  acetylornithine aminotransferase                   238   2e-68    
gb|KFY86422.1|  hypothetical protein V498_07513                         240   2e-68    
ref|WP_012310899.1|  acetylornithine aminotransferase                   237   3e-68    
ref|WP_026506120.1|  acetylornithine aminotransferase                   237   4e-68    
ref|WP_038662102.1|  acetylornithine aminotransferase                   237   4e-68    
ref|WP_015732715.1|  acetylornithine aminotransferase                   237   4e-68    
gb|KFZ06058.1|  hypothetical protein V501_07769                         239   4e-68    
ref|WP_014182832.1|  acetylornithine aminotransferase                   237   4e-68    
ref|WP_024310441.1|  acetylornithine aminotransferase                   237   5e-68    
ref|WP_011943617.1|  acetylornithine aminotransferase                   237   5e-68    
ref|WP_026189057.1|  acetylornithine aminotransferase                   237   5e-68    
ref|WP_025561987.1|  MULTISPECIES: acetylornithine aminotransferase     237   5e-68    
gb|KFY78466.1|  hypothetical protein V499_02367                         239   5e-68    
ref|WP_026835855.1|  acetylornithine aminotransferase                   237   6e-68    
ref|WP_015616223.1|  acetylornithine/succinylornithine aminotrans...    236   6e-68    
emb|CCE44501.1|  hypothetical protein CPAR2_403030                      238   6e-68    
ref|WP_012635234.1|  acetylornithine aminotransferase                   237   6e-68    
ref|WP_013978077.1|  acetylornithine aminotransferase                   237   7e-68    
ref|WP_032906297.1|  acetylornithine aminotransferase                   237   7e-68    
gb|EME48557.1|  hypothetical protein DOTSEDRAFT_67563                   239   7e-68    
dbj|GAM00097.1|  acetylornithine/succinyldiaminopimelate aminotra...    236   7e-68    
ref|WP_014901273.1|  acetylornithine aminotransferase                   236   8e-68    
gb|KFY08270.1|  hypothetical protein V492_06381                         238   8e-68    
gb|KFY35585.1|  hypothetical protein V494_05782                         239   8e-68    
ref|WP_012896307.1|  acetylornithine aminotransferase                   236   8e-68    
ref|WP_034615870.1|  acetylornithine aminotransferase                   236   9e-68    
ref|WP_038033109.1|  MULTISPECIES: acetylornithine aminotransferase     236   9e-68    
ref|WP_009814329.1|  acetylornithine aminotransferase                   236   1e-67    
gb|EHK98209.1|  putative Acetylornithine aminotransferase, mitoch...    238   1e-67    
ref|WP_026498065.1|  acetylornithine aminotransferase                   236   1e-67    
ref|WP_037383641.1|  acetylornithine aminotransferase                   236   1e-67    
ref|WP_004082331.1|  MULTISPECIES: acetylornithine aminotransferase     236   1e-67    
ref|WP_022318447.1|  acetylornithine aminotransferase 1                 236   1e-67    
gb|EEQ19679.1|  Succinylornithine transaminase                          237   1e-67    
ref|XP_001208551.1|  acetylornithine aminotransferase, mitochondr...    238   1e-67    
ref|WP_034598186.1|  acetylornithine aminotransferase                   236   1e-67    
ref|WP_008939451.1|  acetylornithine transaminase (NAcOATase and ...    236   1e-67    
ref|WP_012175909.1|  acetylornithine aminotransferase                   236   1e-67    
ref|WP_035176174.1|  acetylornithine aminotransferase                   236   1e-67    
ref|XP_008081940.1|  PLP-dependent transferase                          238   2e-67    
ref|XP_007600488.1|  acetylornithine aminotransferase                   238   2e-67    
ref|WP_025773469.1|  acetylornithine aminotransferase                   236   2e-67    
ref|WP_027438105.1|  acetylornithine aminotransferase                   235   2e-67    
ref|WP_023923717.1|  hypothetical protein [                             235   2e-67    
ref|WP_022762867.1|  acetylornithine aminotransferase                   235   2e-67    
ref|WP_009243922.1|  acetylornithine aminotransferase                   235   2e-67    
ref|WP_022517228.1|  acetylornithine aminotransferase                   235   2e-67    
ref|WP_006441270.1|  acetylornithine aminotransferase [                 235   2e-67    
ref|XP_004195765.1|  Piso0_005177                                       237   2e-67    
ref|WP_018200059.1|  hypothetical protein                               235   3e-67    
gb|KEQ60543.1|  mitochondrial acetylornithine aminotransferase          236   3e-67    
ref|WP_021867253.1|  acetylornithine aminotransferase                   235   3e-67    
ref|WP_021916375.1|  acetylornithine aminotransferase                   235   3e-67    
ref|WP_011393770.1|  acetylornithine aminotransferase                   235   3e-67    
ref|WP_038052242.1|  acetylornithine aminotransferase                   234   4e-67    
ref|WP_036161581.1|  acetylornithine aminotransferase                   235   4e-67    
ref|WP_007407154.1|  acetylornithine aminotransferase                   234   4e-67    
ref|WP_022025374.1|  acetylornithine aminotransferase                   234   4e-67    
dbj|GAA90552.1|  acetylornithine aminotransferase                       237   4e-67    
gb|KEQ93093.1|  hypothetical protein AUEXF2481DRAFT_47691               235   4e-67    
ref|WP_016283497.1|  acetylornithine/succinylornithine family tra...    234   4e-67    
ref|WP_004843311.1|  acetylornithine aminotransferase [                 235   4e-67    
ref|WP_037999771.1|  acetylornithine aminotransferase                   234   5e-67    
ref|WP_034634394.1|  acetylornithine aminotransferase                   234   5e-67    
ref|WP_035256766.1|  acetylornithine aminotransferase                   234   5e-67    
ref|WP_015051580.1|  acetylornithine aminotransferase                   234   5e-67    
ref|XP_007921339.1|  hypothetical protein MYCFIDRAFT_159423             237   5e-67    
ref|WP_027431170.1|  acetylornithine aminotransferase                   234   5e-67    
ref|WP_014079284.1|  acetylornithine aminotransferase                   234   5e-67    
ref|WP_022689162.1|  acetylornithine aminotransferase                   233   5e-67    
ref|WP_012064471.1|  acetylornithine aminotransferase                   234   6e-67    
ref|WP_028793938.1|  acetylornithine aminotransferase                   234   6e-67    
ref|WP_011345144.1|  acetylornithine aminotransferase                   234   6e-67    
gb|AHE54911.1|  acetylornithine aminotransferase                        234   6e-67    
ref|WP_028285398.1|  acetylornithine aminotransferase                   234   6e-67    
ref|WP_003443549.1|  N-acetylornithine aminotransferase                 234   6e-67    
gb|KEQ69711.1|  mitochondrial acetylornithine aminotransferase          234   6e-67    
ref|WP_037532919.1|  acetylornithine aminotransferase                   234   6e-67    
gb|KER11486.1|  Acetylornithine/succinyldiaminopimelate aminotran...    234   7e-67    
ref|WP_035253180.1|  acetylornithine aminotransferase                   234   7e-67    
ref|WP_022367542.1|  acetylornithine aminotransferase                   234   7e-67    
gb|EQB56138.1|  hypothetical protein CGLO_03866                         236   7e-67    
ref|WP_037380426.1|  MULTISPECIES: acetylornithine aminotransferase     234   8e-67    
ref|WP_024838742.1|  acetylornithine aminotransferase                   234   8e-67    
ref|WP_026757875.1|  acetylornithine aminotransferase                   234   8e-67    
ref|XP_007003939.1|  hypothetical protein TREMEDRAFT_38616              236   9e-67    
ref|WP_013100406.1|  acetylornithine aminotransferase                   233   9e-67    
ref|WP_035636456.1|  acetylornithine aminotransferase                   233   9e-67    
ref|WP_015791619.1|  acetylornithine aminotransferase                   233   1e-66    
ref|WP_027113792.1|  acetylornithine aminotransferase                   234   1e-66    
gb|AHK21066.1|  acetylornithine aminotransferase                        234   1e-66    
gb|AHG88867.1|  Acetylornithine/succinyldiaminopimelate aminotran...    234   1e-66    
ref|WP_012681649.1|  acetylornithine/succinyldiaminopimelate amin...    234   1e-66    
ref|WP_009262643.1|  acetylornithine aminotransferase                   233   1e-66    
ref|XP_009252156.1|  hypothetical protein FPSE_00761                    235   1e-66    
ref|WP_007721442.1|  acetylornithine aminotransferase                   234   1e-66    
ref|WP_028467543.1|  acetylornithine aminotransferase                   233   1e-66    
ref|WP_014422570.1|  MULTISPECIES: succinyldiaminopimelate aminot...    233   1e-66    
emb|CCF40759.1|  acetylornithine aminotransferase                       235   1e-66    
ref|WP_008976043.1|  acetylornithine aminotransferase                   233   1e-66    
ref|WP_013247084.1|  acetylornithine aminotransferase                   233   1e-66    
ref|WP_002588322.1|  MULTISPECIES: acetylornithine aminotransferase     234   1e-66    
ref|WP_022037941.1|  acetylornithine aminotransferase                   233   2e-66    
ref|WP_034144116.1|  acetylornithine aminotransferase                   233   2e-66    
ref|WP_004845608.1|  acetylornithine aminotransferase [                 233   2e-66    
ref|WP_004589973.1|  acetylornithine aminotransferase                   233   2e-66    
ref|XP_001387310.1|  acetylornithine aminotransferase                   234   2e-66    
gb|KDN71719.1|  putative acetylornithine and succinylornithine am...    236   2e-66    
ref|WP_012899164.1|  acetylornithine aminotransferase                   233   2e-66    
ref|WP_008884017.1|  acetylornithine aminotransferase                   233   2e-66    
ref|WP_026892472.1|  acetylornithine aminotransferase [                 233   2e-66    
ref|WP_028052618.1|  acetylornithine aminotransferase                   233   2e-66    
ref|WP_023008677.1|  succinyldiaminopimelate aminotransferase           233   2e-66    
ref|WP_027426079.1|  acetylornithine aminotransferase                   233   2e-66    
ref|WP_022448787.1|  acetylornithine aminotransferase                   233   3e-66    
ref|WP_007715294.1|  acetylornithine aminotransferase [                 233   3e-66    
gb|AHM56509.1|  acetylornithine aminotransferase ArgD                   232   3e-66    
ref|WP_025234661.1|  acetylornithine aminotransferase                   233   3e-66    
ref|XP_381749.1|  hypothetical protein FG01573.1                        234   3e-66    
gb|KFY01739.1|  hypothetical protein V490_00784                         234   3e-66    
gb|EHK16090.1|  hypothetical protein TRIVIDRAFT_56664                   232   3e-66    
ref|WP_020039720.1|  acetylornithine aminotransferase                   232   3e-66    
pdb|2ORD|A  Chain A, Crystal Structure Of Acetylornithine Aminotr...    232   3e-66    
gb|ELQ36388.1|  acetylornithine aminotransferase                        233   4e-66    
gb|KFY01745.1|  hypothetical protein O988_02569                         234   4e-66    
ref|WP_026488077.1|  acetylornithine aminotransferase                   232   4e-66    
ref|WP_034160484.1|  acetylornithine aminotransferase                   232   4e-66    
ref|WP_006779034.1|  acetylornithine aminotransferase [                 232   4e-66    
ref|WP_010403855.1|  acetylornithine aminotransferase                   232   4e-66    
ref|XP_001396775.1|  acetylornithine aminotransferase                   234   4e-66    
ref|WP_006858403.1|  acetylornithine aminotransferase                   232   5e-66    
ref|WP_037278918.1|  acetylornithine aminotransferase                   231   5e-66    
ref|WP_015560306.1|  MULTISPECIES: acetylornithine aminotransfera...    232   5e-66    
ref|WP_019517766.1|  acetylornithine aminotransferase                   231   5e-66    
ref|WP_022203197.1|  acetylornithine aminotransferase                   232   6e-66    
ref|WP_009663918.1|  acetylornithine aminotransferase                   231   6e-66    
ref|WP_009242263.1|  MULTISPECIES: acetylornithine aminotransferase     231   6e-66    
ref|WP_024345426.1|  acetylornithine aminotransferase [                 231   6e-66    
ref|WP_038276957.1|  acetylornithine aminotransferase [                 231   6e-66    
ref|WP_026392855.1|  acetylornithine aminotransferase                   232   6e-66    
ref|WP_012744613.1|  acetylornithine aminotransferase                   231   7e-66    
gb|AHC73536.1|  acetylornithine transaminase                            231   7e-66    
ref|WP_018154736.1|  acetylornithine aminotransferase                   231   7e-66    
ref|WP_033922198.1|  acetylornithine aminotransferase                   231   7e-66    
ref|WP_034578083.1|  acetylornithine aminotransferase                   231   8e-66    
ref|WP_015520265.1|  acetylornithine aminotransferase apoenzyme         231   8e-66    
ref|WP_035242472.1|  acetylornithine aminotransferase                   231   8e-66    
ref|WP_013568591.1|  acetylornithine aminotransferase                   233   8e-66    
ref|WP_037529628.1|  acetylornithine aminotransferase                   231   8e-66    
ref|WP_020714432.1|  hypothetical protein                               231   8e-66    
ref|WP_031396001.1|  acetylornithine aminotransferase                   231   9e-66    
gb|EMD41113.1|  hypothetical protein CERSUDRAFT_111689                  233   9e-66    
ref|WP_026508310.1|  acetylornithine aminotransferase                   231   9e-66    
ref|WP_026884477.1|  acetylornithine aminotransferase                   231   9e-66    
ref|WP_024293884.1|  MULTISPECIES: acetylornithine aminotransferase     231   9e-66    
ref|WP_026174266.1|  acetylornithine aminotransferase                   231   9e-66    
ref|WP_027442386.1|  acetylornithine aminotransferase                   231   1e-65    
gb|EHK48794.1|  hypothetical protein TRIATDRAFT_237038                  233   1e-65    
ref|WP_015360098.1|  MULTISPECIES: acetylornithine aminotransfera...    231   1e-65    
ref|WP_034214882.1|  acetylornithine aminotransferase                   231   1e-65    
ref|XP_003709145.1|  acetylornithine aminotransferase                   233   1e-65    
ref|WP_006306408.1|  acetylornithine aminotransferase                   231   1e-65    
ref|WP_014785581.1|  acetylornithine aminotransferase                   232   1e-65    
ref|WP_018084516.1|  hypothetical protein                               231   1e-65    
ref|WP_022854753.1|  acetylornithine aminotransferase                   231   1e-65    
ref|WP_027626088.1|  acetylornithine aminotransferase                   230   1e-65    
ref|WP_018147627.1|  acetylornithine aminotransferase                   230   1e-65    
ref|WP_016440340.1|  acetylornithine/succinylornithine family tra...    230   1e-65    
ref|WP_025657219.1|  acetylornithine aminotransferase                   230   2e-65    
ref|WP_008516779.1|  acetylornithine aminotransferase                   230   2e-65    
ref|WP_024081135.1|  acetylornithine transaminase (NAcOATase and ...    230   2e-65    
ref|WP_024852607.1|  acetylornithine aminotransferase [                 230   2e-65    
ref|WP_013580266.1|  acetylornithine aminotransferase                   231   2e-65    
ref|WP_012035737.1|  acetylornithine aminotransferase                   230   2e-65    
ref|WP_005360071.1|  acetylornithine aminotransferase                   230   2e-65    
ref|WP_009573039.1|  acetylornithine aminotransferase                   230   2e-65    
ref|WP_024864506.1|  acetylornithine aminotransferase                   230   2e-65    
ref|WP_019813417.1|  acetylornithine/succinyldiaminopimelate amin...    230   2e-65    
ref|WP_022262343.1|  acetylornithine aminotransferase                   230   2e-65    
ref|WP_031441561.1|  acetylornithine aminotransferase                   230   2e-65    
emb|CAM77341.1|  Aminotransferase class-III                             229   2e-65    
ref|WP_012172548.1|  acetylornithine aminotransferase                   230   2e-65    
ref|WP_026495241.1|  acetylornithine aminotransferase                   230   2e-65    
gb|AIY88354.1|  acetylornithine aminotransferase                        237   2e-65    
ref|WP_012268933.1|  MULTISPECIES: acetylornithine aminotransferase     230   2e-65    
ref|WP_020820143.1|  acetylornithine aminotransferase                   230   2e-65    
ref|WP_026761861.1|  acetylornithine aminotransferase                   230   3e-65    
ref|WP_019956504.1|  acetylornithine aminotransferase                   229   3e-65    
ref|WP_029504950.1|  acetylornithine aminotransferase                   230   3e-65    
ref|WP_009002984.1|  acetylornithine aminotransferase                   229   3e-65    
ref|WP_005610257.1|  acetylornithine aminotransferase                   229   3e-65    
ref|WP_013041185.1|  acetylornithine aminotransferase                   229   3e-65    
ref|WP_027717906.1|  acetylornithine aminotransferase                   229   3e-65    
ref|WP_035791982.1|  MULTISPECIES: acetylornithine aminotransferase     229   3e-65    
ref|WP_009446616.1|  acetylornithine aminotransferase                   229   3e-65    
ref|WP_026443461.1|  acetylornithine aminotransferase                   230   3e-65    
ref|WP_010409613.1|  acetylornithine aminotransferase                   229   3e-65    
ref|WP_022774062.1|  acetylornithine aminotransferase                   229   3e-65    
gb|AIS53350.1|  acetylornithine aminotransferase ArgD                   229   3e-65    
ref|WP_009219893.1|  acetylornithine aminotransferase                   229   3e-65    
ref|WP_008410918.1|  Acetylornithine aminotransferase                   229   3e-65    
ref|WP_022988113.1|  succinyldiaminopimelate aminotransferase           229   4e-65    
ref|WP_013623669.1|  acetylornithine aminotransferase                   229   4e-65    
ref|WP_013638374.1|  acetylornithine aminotransferase                   229   4e-65    
ref|WP_038062438.1|  acetylornithine aminotransferase                   229   4e-65    
ref|WP_021893193.1|  acetylornithine aminotransferase                   229   4e-65    
ref|WP_020681107.1|  hypothetical protein                               229   4e-65    
gb|EKG21724.1|  Acetylornithine/Succinylornithine aminotransferase      231   4e-65    
ref|WP_024096441.1|  transaminase, acetylornithine/succinylornith...    229   4e-65    
ref|WP_025911701.1|  acetylornithine aminotransferase                   229   4e-65    
ref|WP_020613701.1|  acetylornithine aminotransferase                   229   4e-65    
gb|KIF23384.1|  acetylornithine aminotransferase                        229   4e-65    
ref|WP_038921987.1|  acetylornithine aminotransferase                   229   4e-65    
ref|WP_029940100.1|  acetylornithine aminotransferase                   229   4e-65    
ref|WP_008045863.1|  succinyldiaminopimelate aminotransferase           229   4e-65    
ref|WP_039266158.1|  acetylornithine aminotransferase                   229   5e-65    
ref|WP_026156232.1|  acetylornithine aminotransferase                   229   5e-65    
ref|WP_035265715.1|  acetylornithine aminotransferase                   229   5e-65    
ref|WP_027423557.1|  acetylornithine aminotransferase                   229   5e-65    
ref|WP_011910048.1|  acetylornithine aminotransferase                   229   5e-65    
gb|AIH04637.1|  acetylornithine aminotransferase                        229   5e-65    
ref|WP_024809546.1|  acetylornithine aminotransferase                   229   5e-65    
ref|WP_027707654.1|  acetylornithine aminotransferase                   229   6e-65    
ref|WP_028841552.1|  acetylornithine aminotransferase                   229   6e-65    



>ref|XP_009628466.1| PREDICTED: acetylornithine aminotransferase, mitochondrial [Nicotiana 
tomentosiformis]
Length=465

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/322 (87%), Positives = 304/322 (94%), Gaps = 0/322 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             +ELAKRLV  SFADRVFFSNSGTEANEAAIKF+RKFQRFSHPD +QPPVEFIAFSNCFHG
Sbjct  142   LELAKRLVASSFADRVFFSNSGTEANEAAIKFSRKFQRFSHPDEKQPPVEFIAFSNCFHG  201

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQ+ATELIQSGKIAAVFVEPIQGEGGIY
Sbjct  202   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQSATELIQSGKIAAVFVEPIQGEGGIY  261

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATKEFLQALRTSCD+ GSLLVFDEVQCGLGRTG+LWAHEAYG+YPDIMTLAKPLAGGLP
Sbjct  262   SATKEFLQALRTSCDSVGSLLVFDEVQCGLGRTGHLWAHEAYGIYPDIMTLAKPLAGGLP  321

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGAVLVTE+VAAAINYGDHGSTFAGGPLVCNAAV VL KI+ P FLASV+ KGQY +ELL
Sbjct  322   IGAVLVTERVAAAINYGDHGSTFAGGPLVCNAAVAVLNKIAEPSFLASVTKKGQYFRELL  381

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              KKLGGN+HVKE+RG+GLIIGI+LDV A+PLV+ACQ SGLLVLTAGKGNVVRLVPPL I+
Sbjct  382   VKKLGGNSHVKEVRGVGLIIGIDLDVPASPLVDACQQSGLLVLTAGKGNVVRLVPPLTIT  441

Query  1489  KQELEQAADVLAACLPVLDKST  1554
             +QEL+ AA++L  CLPVLDK+ 
Sbjct  442   EQELDHAAEILFNCLPVLDKTN  463



>ref|XP_009800487.1| PREDICTED: acetylornithine aminotransferase, mitochondrial [Nicotiana 
sylvestris]
Length=465

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/322 (87%), Positives = 304/322 (94%), Gaps = 0/322 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             +ELAKRLV  SFADRVFFSNSGTEANEAAIKF+RKFQRFSHP  +QPPVEFIAFSNCFHG
Sbjct  142   LELAKRLVASSFADRVFFSNSGTEANEAAIKFSRKFQRFSHPGEKQPPVEFIAFSNCFHG  201

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY
Sbjct  202   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  261

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATKEFLQALRTSCD+ GSLLVFDEVQCGLGRTG+LWAHEAYG+YPDIMTLAKPLAGGLP
Sbjct  262   SATKEFLQALRTSCDSVGSLLVFDEVQCGLGRTGHLWAHEAYGIYPDIMTLAKPLAGGLP  321

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGAVLVTE+VAAAINYGDHGSTFAGGPLVCNAAV VL+KI+ P FLASV+ KGQY +ELL
Sbjct  322   IGAVLVTERVAAAINYGDHGSTFAGGPLVCNAAVAVLKKIAEPSFLASVTKKGQYFRELL  381

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              KKLGGN+HVKE+RG+GLIIGI+LDV A+PLV+ACQ SGLLVLTAGKGNVVRLVPPL I+
Sbjct  382   VKKLGGNSHVKEVRGVGLIIGIDLDVPASPLVDACQQSGLLVLTAGKGNVVRLVPPLTIT  441

Query  1489  KQELEQAADVLAACLPVLDKST  1554
             +QEL+ AA++L  CLPVLDK+ 
Sbjct  442   EQELDHAAEILFNCLPVLDKTN  463



>ref|XP_006358869.1| PREDICTED: acetylornithine aminotransferase, mitochondrial-like 
[Solanum tuberosum]
Length=457

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/321 (87%), Positives = 303/321 (94%), Gaps = 0/321 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             +ELAKRLV  SFADRVF SNSGTEANEAAIKFARKFQRFSHPD +QPPVEFIAFSNCFHG
Sbjct  134   LELAKRLVANSFADRVFLSNSGTEANEAAIKFARKFQRFSHPDEKQPPVEFIAFSNCFHG  193

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMGAVALTSKE+YRSPFEPVMPGVTFLEYG++QAA ELIQSGKIAAVFVEPIQGEGGIY
Sbjct  194   RTMGAVALTSKEYYRSPFEPVMPGVTFLEYGSVQAAKELIQSGKIAAVFVEPIQGEGGIY  253

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SAT+EFLQALRT+CD+AGSLLVFDEVQCGLGRTG+LWAHEAYG+YPDIMTLAKPLAGGLP
Sbjct  254   SATQEFLQALRTACDSAGSLLVFDEVQCGLGRTGHLWAHEAYGIYPDIMTLAKPLAGGLP  313

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGAVLVTE+VAAAINYGDHGSTFAGGPLVCNAAV VL+KIS P FLASV+ KGQ  KELL
Sbjct  314   IGAVLVTERVAAAINYGDHGSTFAGGPLVCNAAVAVLDKISGPGFLASVTKKGQDFKELL  373

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              KKLGGN+HV+E+RG+GLIIGI+LDV A+PLVEACQ SGLLVLTAGKGNVVRLVPPL I+
Sbjct  374   VKKLGGNSHVREVRGVGLIIGIDLDVPASPLVEACQQSGLLVLTAGKGNVVRLVPPLTIT  433

Query  1489  KQELEQAADVLAACLPVLDKS  1551
             +QEL+ AA++L  CLPVLDK+
Sbjct  434   EQELDHAAEILFNCLPVLDKT  454



>ref|XP_004245648.1| PREDICTED: acetylornithine aminotransferase, mitochondrial [Solanum 
lycopersicum]
Length=460

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/321 (86%), Positives = 303/321 (94%), Gaps = 0/321 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             +ELAKRLV  SFADRVF SNSGTEANEAAIKFARKFQRFSHPD +QPPVEFIAFSNCFHG
Sbjct  137   LELAKRLVANSFADRVFLSNSGTEANEAAIKFARKFQRFSHPDEKQPPVEFIAFSNCFHG  196

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMGAVALTSKE+YRSPFEP+MPGVTFLEYGN+QAA ELIQSGKIAAVFVEPIQGEGGIY
Sbjct  197   RTMGAVALTSKEYYRSPFEPIMPGVTFLEYGNVQAAKELIQSGKIAAVFVEPIQGEGGIY  256

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SAT+EFLQALRT+CD+AGSLLVFDEVQCGLGRTG+LWAHEAYG+YPDIMTLAKPLAGGLP
Sbjct  257   SATQEFLQALRTACDSAGSLLVFDEVQCGLGRTGHLWAHEAYGIYPDIMTLAKPLAGGLP  316

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGAVLVTE+VAAAINYGDHGSTFAGGPLVCNAAV VL+KIS P FLASV+ KGQ  KELL
Sbjct  317   IGAVLVTERVAAAINYGDHGSTFAGGPLVCNAAVAVLDKISGPGFLASVAKKGQDFKELL  376

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              KKLGGN+HV+++RG+GLIIGI+LDV A+PLVEACQ SGLLVLTAGKGNVVRLVPPL I+
Sbjct  377   VKKLGGNSHVRDVRGVGLIIGIDLDVPASPLVEACQQSGLLVLTAGKGNVVRLVPPLTIT  436

Query  1489  KQELEQAADVLAACLPVLDKS  1551
             +QEL+ AA++L  CLPVLDK+
Sbjct  437   EQELDHAAEILFNCLPVLDKT  457



>ref|XP_011082096.1| PREDICTED: acetylornithine aminotransferase, chloroplastic/mitochondrial-like 
[Sesamum indicum]
Length=460

 Score =   523 bits (1347),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 273/322 (85%), Positives = 299/322 (93%), Gaps = 0/322 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             VELAKRLV  SFADRVFF NSGTEANEAAIKF+RKFQRFSHPD++ PPVEFIAF+NCFHG
Sbjct  137   VELAKRLVVSSFADRVFFCNSGTEANEAAIKFSRKFQRFSHPDLKDPPVEFIAFTNCFHG  196

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMGA+ALTSKE YRSPFEPVM GVTFLEYGN QAA ELI+SGK+AAVFVEPIQGEGGIY
Sbjct  197   RTMGALALTSKEQYRSPFEPVMSGVTFLEYGNTQAAVELIRSGKVAAVFVEPIQGEGGIY  256

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
              ATKEFLQ+LRT+CDNAG LLVFDEVQCGLGRTGYLWAHEA+GVYPDIMTLAKPLAGGLP
Sbjct  257   GATKEFLQSLRTACDNAGCLLVFDEVQCGLGRTGYLWAHEAFGVYPDIMTLAKPLAGGLP  316

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGAVLVTE+VA+AIN+GDHGSTFAG PLVC+A + VL+KISNP FLASVSDKGQY K+LL
Sbjct  317   IGAVLVTERVASAINFGDHGSTFAGNPLVCSAGIAVLDKISNPSFLASVSDKGQYFKDLL  376

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              +KLGGN+HVKEIRG GLIIGIELD AA+PLV+ACQ SGLLVLTAGKGNVVR+VPPLIIS
Sbjct  377   VEKLGGNSHVKEIRGFGLIIGIELDAAASPLVDACQKSGLLVLTAGKGNVVRIVPPLIIS  436

Query  1489  KQELEQAADVLAACLPVLDKST  1554
             KQEL+QAA++L  C PVLD+ T
Sbjct  437   KQELDQAAEILINCFPVLDQGT  458



>ref|XP_008228754.1| PREDICTED: acetylornithine aminotransferase, mitochondrial [Prunus 
mume]
Length=451

 Score =   511 bits (1317),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 264/322 (82%), Positives = 298/322 (93%), Gaps = 0/322 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             VELAKRLV CSFADRVFFSNSGTEANEAAIKFARKFQRFS P+ ++P  EFI+F+N FHG
Sbjct  130   VELAKRLVACSFADRVFFSNSGTEANEAAIKFARKFQRFSFPEKKEPATEFISFTNSFHG  189

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMGAVALTSKEHYRSPFEPVMPGVTFLEYG+IQAAT+L+ SGKIAAVF+EP+QGEGGI 
Sbjct  190   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGDIQAATKLVHSGKIAAVFLEPLQGEGGIL  249

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATKEFLQ+LR +CD++GSLLVFDEVQCGLGRTGYLWAHEAYGV+PDIMTLAKPLAGGLP
Sbjct  250   SATKEFLQSLRGACDDSGSLLVFDEVQCGLGRTGYLWAHEAYGVFPDIMTLAKPLAGGLP  309

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGAVLVTEKVAA+I YG+HGSTFAGGPL+CNAA+ VL+KIS PEFL+SVS+KGQY KELL
Sbjct  310   IGAVLVTEKVAASIKYGEHGSTFAGGPLICNAALAVLDKISKPEFLSSVSNKGQYFKELL  369

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              K LG N HV+E+RG GLI+G+ELDV+A+PLV+AC+N GLL++TAGKGNV+RLVPPLIIS
Sbjct  370   TKMLGKNPHVREVRGSGLIVGVELDVSASPLVDACRNLGLLIITAGKGNVLRLVPPLIIS  429

Query  1489  KQELEQAADVLAACLPVLDKST  1554
             KQELE AA+VL  CLPVLD S 
Sbjct  430   KQELEHAAEVLLECLPVLDGSN  451



>ref|XP_010249213.1| PREDICTED: acetylornithine aminotransferase, mitochondrial-like 
[Nelumbo nucifera]
Length=466

 Score =   506 bits (1303),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 264/321 (82%), Positives = 294/321 (92%), Gaps = 0/321 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             VELA+RLV CSFADRVFFSNSGTEANEAAIKFARKFQRF +PD +QP VEFI+FSN FHG
Sbjct  146   VELAQRLVECSFADRVFFSNSGTEANEAAIKFARKFQRFLNPDEKQPAVEFISFSNSFHG  205

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMGA+ALTSKEHYR PFEPVMPGVTFLEYGNIQA  E+IQ GK AAVFVEPIQGEGGIY
Sbjct  206   RTMGALALTSKEHYRLPFEPVMPGVTFLEYGNIQATKEVIQRGKTAAVFVEPIQGEGGIY  265

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATKEFLQ+LR++CD+AG+LLVFDEVQCGLGRTGYLWA+EAYGV PDIMTLAKPLAGGLP
Sbjct  266   SATKEFLQSLRSACDDAGALLVFDEVQCGLGRTGYLWAYEAYGVTPDIMTLAKPLAGGLP  325

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGAVLVT++VAAAI  GDHGSTFAGGPLVC AA+TVLEKI NPEFLA+VS KGQ  K+LL
Sbjct  326   IGAVLVTDRVAAAIKSGDHGSTFAGGPLVCKAALTVLEKIRNPEFLATVSKKGQSFKKLL  385

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              +KLG N HVKE+RGLGLIIGIELD+ A+PLV+AC++SGLL+LTAGKGNV RLVPPL+IS
Sbjct  386   SEKLGKNPHVKEVRGLGLIIGIELDIPASPLVDACRDSGLLILTAGKGNVARLVPPLVIS  445

Query  1489  KQELEQAADVLAACLPVLDKS  1551
             +QELE AA++L  CLPVLD +
Sbjct  446   EQELEHAAEILLKCLPVLDSN  466



>gb|ABK95025.1| unknown [Populus trichocarpa]
 gb|ABK95379.1| unknown [Populus trichocarpa]
Length=452

 Score =   504 bits (1298),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 264/322 (82%), Positives = 300/322 (93%), Gaps = 0/322 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             VELA+RLV CSFADRVFF+NSGTEANEAAIKFARK+QRF++PD +Q   EFI+FSN FHG
Sbjct  131   VELARRLVACSFADRVFFTNSGTEANEAAIKFARKYQRFTNPDEKQQVTEFISFSNSFHG  190

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMGA+ALTSKE YR PFEPVMPGV FLEYG++QAATELI+SG+IAAVFVEPIQGEGGIY
Sbjct  191   RTMGALALTSKEQYRFPFEPVMPGVNFLEYGDVQAATELIKSGRIAAVFVEPIQGEGGIY  250

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATKEFLQ+LR++CD+AGSLLVFDEVQCGLGRTGYLWAHEAYGV PDIMTLAKPLAGGLP
Sbjct  251   SATKEFLQSLRSACDDAGSLLVFDEVQCGLGRTGYLWAHEAYGVVPDIMTLAKPLAGGLP  310

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGA LV+EKVAAAI YGDHGSTFAGGPLVCNAA+ VL+KIS P FLASVS+KGQY KELL
Sbjct  311   IGAALVSEKVAAAIKYGDHGSTFAGGPLVCNAAIAVLDKISKPGFLASVSEKGQYFKELL  370

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
               KLGGN+HV+E+RGLGLIIGIELDV+A+PLV+AC++S LL+LTAGKGNVVRLVPPLIIS
Sbjct  371   IHKLGGNSHVREVRGLGLIIGIELDVSASPLVDACRDSSLLILTAGKGNVVRLVPPLIIS  430

Query  1489  KQELEQAADVLAACLPVLDKST  1554
             +QELE+AA+++  CLP LDK++
Sbjct  431   EQELERAAEIILECLPALDKTS  452



>gb|KDP37012.1| hypothetical protein JCGZ_06068 [Jatropha curcas]
Length=449

 Score =   503 bits (1294),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 262/322 (81%), Positives = 296/322 (92%), Gaps = 0/322 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             VELAKRLV  SFADRVFF+NSGTEANEAAIKFARKFQR SHPD +QPP EFI+F+N FHG
Sbjct  128   VELAKRLVDSSFADRVFFTNSGTEANEAAIKFARKFQRVSHPDEKQPPTEFISFTNSFHG  187

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNI+AA ELI+SGKIAAVF+EPIQGEGGIY
Sbjct  188   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIEAARELIKSGKIAAVFIEPIQGEGGIY  247

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATKEFLQ+LR++CD+AGSLLVFDEVQCGLGRTG LWAHEAY V PDIMT+AKPLAGGLP
Sbjct  248   SATKEFLQSLRSACDDAGSLLVFDEVQCGLGRTGCLWAHEAYSVVPDIMTIAKPLAGGLP  307

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGA L++E+VAAA+ YG+HGSTFAGGPLVCNAA+ VL+KIS P FLA V+ KGQY KE+L
Sbjct  308   IGAALMSERVAAAMKYGEHGSTFAGGPLVCNAAIAVLDKISGPGFLAKVAKKGQYFKEIL  367

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              +KLGGN+HVKE+RG+GLI+GIELDV+A+PLV+A +NSGLL+LTAGKGN+VRLVPPLIIS
Sbjct  368   IQKLGGNSHVKEVRGMGLILGIELDVSASPLVDASRNSGLLILTAGKGNIVRLVPPLIIS  427

Query  1489  KQELEQAADVLAACLPVLDKST  1554
             +QELE AAD L  CLPVLD + 
Sbjct  428   EQELELAADTLLQCLPVLDNNN  449



>ref|XP_004303261.1| PREDICTED: acetylornithine aminotransferase, mitochondrial-like 
[Fragaria vesca subsp. vesca]
Length=452

 Score =   502 bits (1293),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 257/322 (80%), Positives = 298/322 (93%), Gaps = 0/322 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             VELAKRLV CSFADRVFFSNSGTEANEAAIKF+RKFQRFS P+ ++P  EFI+F+N FHG
Sbjct  131   VELAKRLVACSFADRVFFSNSGTEANEAAIKFSRKFQRFSCPEKKEPATEFISFTNSFHG  190

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMG+VALTSK++YRSPFEPVMPGV FLEYG++QAA +LI+SGKIAAVFVEPIQGEGGI 
Sbjct  191   RTMGSVALTSKKYYRSPFEPVMPGVNFLEYGDVQAARKLIKSGKIAAVFVEPIQGEGGIN  250

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATKEFLQ LR +CD++GSLLVFDEVQCGLGRTGYLWAHE YGV+PDIMTLAKPLAGGLP
Sbjct  251   SATKEFLQTLRGACDDSGSLLVFDEVQCGLGRTGYLWAHEVYGVFPDIMTLAKPLAGGLP  310

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGAVLVTEKV A++ YG+HGSTFAGGPL+CNAA+ VL+KISNPEFL SVS+KGQY K++L
Sbjct  311   IGAVLVTEKVGASMKYGEHGSTFAGGPLICNAALAVLDKISNPEFLRSVSEKGQYFKQVL  370

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              KKLG N HV+E+RGLGLI+G+ELDV+A+PLV+AC+NSGLL++TAGKGNV+RLVPPLIIS
Sbjct  371   TKKLGTNPHVREVRGLGLIVGVELDVSASPLVDACRNSGLLIITAGKGNVIRLVPPLIIS  430

Query  1489  KQELEQAADVLAACLPVLDKST  1554
             K ELEQAA++++ CLP LD ST
Sbjct  431   KPELEQAAEIMSKCLPALDGST  452



>emb|CDO98200.1| unnamed protein product [Coffea canephora]
Length=457

 Score =   502 bits (1292),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 264/319 (83%), Positives = 293/319 (92%), Gaps = 0/319 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             VELAKRLV  SFADRVFF+NSGTEANEAAIKFARKFQR  HP  EQPPVEFIAFSNCFHG
Sbjct  134   VELAKRLVASSFADRVFFTNSGTEANEAAIKFARKFQRSLHPSEEQPPVEFIAFSNCFHG  193

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMGA+ALTSKEHYR PFEPVMPGV+FLEYG+ QAAT+LI SGKIAAVFVEPIQGEGGIY
Sbjct  194   RTMGALALTSKEHYRIPFEPVMPGVSFLEYGDTQAATKLISSGKIAAVFVEPIQGEGGIY  253

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATKEFL+ALRT+CD+AG+LLVFDEVQCGLGR GYLWAHEAYG+YPD+MTLAKPLAGGLP
Sbjct  254   SATKEFLKALRTACDSAGALLVFDEVQCGLGRAGYLWAHEAYGIYPDMMTLAKPLAGGLP  313

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGAVL +E+VA +IN+GDHGSTFAG PLVC+AA+ VL+KIS P FLASVS KG+Y KELL
Sbjct  314   IGAVLTSERVAGSINFGDHGSTFAGNPLVCSAAIAVLDKISKPGFLASVSKKGKYFKELL  373

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              KKLGGN HVKE+RGLGLIIGIELDV+A+PLV+ C+ SGLL+LTAGKGNVVRLVPPL+IS
Sbjct  374   VKKLGGNAHVKEVRGLGLIIGIELDVSASPLVDTCRQSGLLILTAGKGNVVRLVPPLVIS  433

Query  1489  KQELEQAADVLAACLPVLD  1545
             +QEL+ AA+VL  CLP LD
Sbjct  434   EQELDTAAEVLLDCLPALD  452



>ref|XP_006475328.1| PREDICTED: acetylornithine aminotransferase, mitochondrial-like 
[Citrus sinensis]
 gb|KDO61626.1| hypothetical protein CISIN_1g012363mg [Citrus sinensis]
 gb|KDO61627.1| hypothetical protein CISIN_1g012363mg [Citrus sinensis]
Length=465

 Score =   502 bits (1292),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 256/322 (80%), Positives = 290/322 (90%), Gaps = 0/322 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             +ELAKRLV CSFADRVFFSN+GTEANEAAIKFARKFQR S+PD ++P  EF++F+N FHG
Sbjct  143   IELAKRLVACSFADRVFFSNTGTEANEAAIKFARKFQRHSNPDSKEPATEFVSFTNSFHG  202

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMGA+ALTSKEHYRSPFEPVMPGV F+EYGNI+A  +LIQ GK AAVFVEPIQGEGGIY
Sbjct  203   RTMGALALTSKEHYRSPFEPVMPGVNFVEYGNIEATRKLIQPGKTAAVFVEPIQGEGGIY  262

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATKEFLQ LR +CD+AG+LLVFDEVQCGLGRTGYLWAHE YG++PDIMTLAKPLAGGLP
Sbjct  263   SATKEFLQFLRDACDDAGALLVFDEVQCGLGRTGYLWAHEHYGIFPDIMTLAKPLAGGLP  322

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGA LVTEKVA+AINYGDHGSTFAG PLVCNAA+ VL+KISNP FLASVS KG Y KE L
Sbjct  323   IGAALVTEKVASAINYGDHGSTFAGSPLVCNAAIAVLDKISNPAFLASVSKKGHYFKETL  382

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              +KL  N HVK++RGLGLIIGIE DV+ATP+V+AC++SGLLVLTAGKGNVVRLVPPLIIS
Sbjct  383   KQKLARNPHVKDVRGLGLIIGIEFDVSATPVVDACRDSGLLVLTAGKGNVVRLVPPLIIS  442

Query  1489  KQELEQAADVLAACLPVLDKST  1554
             +QEL+QA ++L   LPVLD ++
Sbjct  443   EQELDQAVEILCKTLPVLDSNS  464



>ref|XP_011041861.1| PREDICTED: acetylornithine aminotransferase, mitochondrial [Populus 
euphratica]
Length=452

 Score =   500 bits (1288),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 262/322 (81%), Positives = 296/322 (92%), Gaps = 0/322 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             VELA+RLV CSFADRVFFSNSGTEANEAAIKFARK+QRF++PD +Q   EFI+FSN FHG
Sbjct  131   VELARRLVACSFADRVFFSNSGTEANEAAIKFARKYQRFTNPDEKQQATEFISFSNSFHG  190

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMGA+ALTSKE YR PFEPVMPGV FLEYG++QAAT LI+SG+IAAVFVEPIQGEGGIY
Sbjct  191   RTMGALALTSKEQYRFPFEPVMPGVNFLEYGDVQAATALIKSGRIAAVFVEPIQGEGGIY  250

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATKEFLQ+LR++CD+AGSLLVFDEVQCGLGRTGYLWAHEAYGV PDIMTLAKPLAGGLP
Sbjct  251   SATKEFLQSLRSACDDAGSLLVFDEVQCGLGRTGYLWAHEAYGVVPDIMTLAKPLAGGLP  310

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGA L++EKVAAAI YGDHGSTFAGGPLVCNAA+ VL+KIS P FLASVS KGQ  KELL
Sbjct  311   IGAALLSEKVAAAIKYGDHGSTFAGGPLVCNAAIAVLDKISKPGFLASVSKKGQSFKELL  370

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
               KLGGN+HV+E+RGLGLIIGIELDV+A+PLV+AC++S LL+LTAGKGNVVRLVPPLIIS
Sbjct  371   IHKLGGNSHVREVRGLGLIIGIELDVSASPLVDACRDSSLLILTAGKGNVVRLVPPLIIS  430

Query  1489  KQELEQAADVLAACLPVLDKST  1554
             +QELE+AA+++  CLP LDK+ 
Sbjct  431   EQELERAAEIILECLPALDKTN  452



>gb|EYU24623.1| hypothetical protein MIMGU_mgv1a006075mg [Erythranthe guttata]
Length=458

 Score =   500 bits (1287),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 259/319 (81%), Positives = 291/319 (91%), Gaps = 0/319 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             VELAKRLV  SFADRVFF NSGTEANEAAIKF+RKFQRFSHPD + PPV F+AF NCFHG
Sbjct  139   VELAKRLVSGSFADRVFFCNSGTEANEAAIKFSRKFQRFSHPDEKDPPVGFVAFKNCFHG  198

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMGA+ALTSKE+YRSPFEPVMPGVTFLEYGN +AA E I+SGKIAAVFVEPIQGEGG+Y
Sbjct  199   RTMGALALTSKENYRSPFEPVMPGVTFLEYGNTEAAVEFIRSGKIAAVFVEPIQGEGGVY  258

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATKEFLQALRT+CD+ G LLVFDEVQCGLGRTGYLWAHEAY VYPDIMT+AKPLAGGLP
Sbjct  259   SATKEFLQALRTACDDIGCLLVFDEVQCGLGRTGYLWAHEAYRVYPDIMTVAKPLAGGLP  318

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGAVLVTEKVA++IN+GDHGSTFAG PLVC AA+ VL+KI+NP FLA V +KG Y K+LL
Sbjct  319   IGAVLVTEKVASSINFGDHGSTFAGNPLVCTAAIAVLDKIANPTFLAGVGEKGNYFKDLL  378

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              +KLGGN+HVKEIRG GLIIG+ELDV A+PLV+ACQ +GLL+LTAGKGNVVR+VPPLIIS
Sbjct  379   VEKLGGNSHVKEIRGFGLIIGVELDVPASPLVDACQKAGLLILTAGKGNVVRIVPPLIIS  438

Query  1489  KQELEQAADVLAACLPVLD  1545
             K+E+E+A ++LA C PVLD
Sbjct  439   KEEVERAVEILAGCFPVLD  457



>gb|KHG20983.1| Acetylornithine aminotransferase, mitochondrial [Gossypium arboreum]
Length=452

 Score =   499 bits (1285),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 259/322 (80%), Positives = 294/322 (91%), Gaps = 0/322 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             VELAKRLVG SFADRVFF+NSGTEANEAAIKF+RKFQRF HPD +QP  EFI F+N FHG
Sbjct  131   VELAKRLVGNSFADRVFFTNSGTEANEAAIKFSRKFQRFIHPDNKQPATEFITFTNSFHG  190

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMGA+ALTSKEHYRSPFEPVMPGVTFLEYGNI AA +LI++G IAAVFVEP+QGEGGIY
Sbjct  191   RTMGALALTSKEHYRSPFEPVMPGVTFLEYGNIHAAIDLIRNGMIAAVFVEPVQGEGGIY  250

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATKEFLQALR++CD+AGSLLVFDEVQCGL RTGYLWAHEAYGV+PD+MTLAKPLAGGLP
Sbjct  251   SATKEFLQALRSACDDAGSLLVFDEVQCGLARTGYLWAHEAYGVFPDMMTLAKPLAGGLP  310

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGA LVTE+VA+AI +GDHGSTFAG PLVC+AA++V  KI+NP FL+SVS KG Y+KELL
Sbjct  311   IGATLVTERVASAIAHGDHGSTFAGSPLVCSAAISVFNKIANPSFLSSVSKKGDYMKELL  370

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              +KLGGN HVKEIRG GL+IGIELDV+A+PLV+AC+NSGL+VLTAGKGNVVRLVPPLIIS
Sbjct  371   NQKLGGNPHVKEIRGWGLMIGIELDVSASPLVDACRNSGLIVLTAGKGNVVRLVPPLIIS  430

Query  1489  KQELEQAADVLAACLPVLDKST  1554
             ++EL+ AA++L  CLP LD S 
Sbjct  431   EEELKHAAEILHECLPALDNSN  452



>emb|CBI36456.3| unnamed protein product [Vitis vinifera]
Length=364

 Score =   495 bits (1274),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 267/321 (83%), Positives = 298/321 (93%), Gaps = 0/321 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             VELA+RLV CSFADRVFFSNSGTEANEAAIKFARKFQRF HPD +Q   EFI+FSN FHG
Sbjct  41    VELAERLVSCSFADRVFFSNSGTEANEAAIKFARKFQRFLHPDQKQLATEFISFSNSFHG  100

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMG++ALTSKE+YRSPFEPVMPGVTFLEYGNI AA ELIQSGKIAAVFVEPIQGEGGIY
Sbjct  101   RTMGSLALTSKEYYRSPFEPVMPGVTFLEYGNIHAARELIQSGKIAAVFVEPIQGEGGIY  160

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATKEFLQ+LR++CD+AGSLLVFDEVQCGLGRTGYLWAHE+YG++PDIMTLAKPLAGGLP
Sbjct  161   SATKEFLQSLRSACDDAGSLLVFDEVQCGLGRTGYLWAHESYGIFPDIMTLAKPLAGGLP  220

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGAVLVTE+VA+AI YGDHGSTFAGGPLVC AAV VL+KIS P FL SVS KGQY KELL
Sbjct  221   IGAVLVTERVASAIKYGDHGSTFAGGPLVCKAAVAVLDKISKPTFLDSVSKKGQYFKELL  280

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              +KLGGN HV+E+RGLGLI+GIELDV A+PLV+AC+NSGLL+LTAGKGNV+R+VPPLIIS
Sbjct  281   MQKLGGNPHVREVRGLGLIVGIELDVPASPLVDACRNSGLLILTAGKGNVIRIVPPLIIS  340

Query  1489  KQELEQAADVLAACLPVLDKS  1551
             ++ELE AA++L  CLPVLDK+
Sbjct  341   EEELELAAEILLKCLPVLDKT  361



>ref|XP_002323766.2| hypothetical protein POPTR_0017s08060g [Populus trichocarpa]
 gb|EEF03899.2| hypothetical protein POPTR_0017s08060g [Populus trichocarpa]
Length=451

 Score =   496 bits (1278),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 262/322 (81%), Positives = 299/322 (93%), Gaps = 1/322 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             VELAKRLV CSFADRVFF+NSGTEANEAAIKFARK+QRF++P+ +Q   EFI+FSN FHG
Sbjct  131   VELAKRLVACSFADRVFFTNSGTEANEAAIKFARKYQRFTNPEKQQA-TEFISFSNSFHG  189

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMGA+ALTSKE YR PFEPVMPGV FLEYG++QAATELI+SG+IAAVFVEPIQGEGGIY
Sbjct  190   RTMGALALTSKEQYRFPFEPVMPGVNFLEYGDVQAATELIKSGRIAAVFVEPIQGEGGIY  249

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATKEFLQ+LR++CD+AGSLLVFDEVQCGLGRTGYLWAHE YGV PDIMTLAKPLAGGLP
Sbjct  250   SATKEFLQSLRSACDDAGSLLVFDEVQCGLGRTGYLWAHEVYGVVPDIMTLAKPLAGGLP  309

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGA LV+EKVAAAI YGDHGSTFAGGPLVCNAA+ VL+KIS P FLASVS+KGQY KELL
Sbjct  310   IGAALVSEKVAAAIKYGDHGSTFAGGPLVCNAAIAVLDKISKPGFLASVSEKGQYFKELL  369

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
               KLGGN+HV+E+RGLGLIIGIELDV+A+PLV+AC++S LL+LTAGKGNVVRLVPPLIIS
Sbjct  370   IHKLGGNSHVREVRGLGLIIGIELDVSASPLVDACRDSSLLILTAGKGNVVRLVPPLIIS  429

Query  1489  KQELEQAADVLAACLPVLDKST  1554
             ++ELE+AA+++  CLP LDK++
Sbjct  430   EEELERAAEIILECLPALDKTS  451



>ref|XP_007023353.1| Acetylornithine aminotransferase, mitochondrial [Theobroma cacao]
 gb|EOY25975.1| Acetylornithine aminotransferase, mitochondrial [Theobroma cacao]
Length=451

 Score =   496 bits (1278),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 262/321 (82%), Positives = 291/321 (91%), Gaps = 0/321 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             VELAKRLV  SFADRVFFSNSGTEANEAAIKF+RKFQRF+HP+ +QP   FI+F+N FHG
Sbjct  131   VELAKRLVANSFADRVFFSNSGTEANEAAIKFSRKFQRFTHPNDKQPATGFISFTNSFHG  190

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RT+GA+ALTSKEHYRSPFEPVMPGVTFLEYGN Q A +LIQ GKIAAVFVEPIQGEGGIY
Sbjct  191   RTLGALALTSKEHYRSPFEPVMPGVTFLEYGNKQTAKDLIQQGKIAAVFVEPIQGEGGIY  250

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SA KEFLQALR +CD+AG LLVFDEVQCGLGRTGYLWAHE YGVYPDIMTLAKPLAGGLP
Sbjct  251   SAKKEFLQALRKACDDAGCLLVFDEVQCGLGRTGYLWAHEVYGVYPDIMTLAKPLAGGLP  310

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGA LVTE+VA+A+ +GDHGSTFAG PLVC+AA+ VL+KI+NP FL+SVS KG Y KELL
Sbjct  311   IGATLVTERVASAVAHGDHGSTFAGSPLVCSAAIAVLDKIANPSFLSSVSKKGHYFKELL  370

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              KKLGGN HVKE+RGLGLIIGIELDV+A+PLV+AC+NSGL+VLTAGKGNVVRLVPPLIIS
Sbjct  371   IKKLGGNAHVKEVRGLGLIIGIELDVSASPLVDACRNSGLIVLTAGKGNVVRLVPPLIIS  430

Query  1489  KQELEQAADVLAACLPVLDKS  1551
             ++ELE AADVL  CLP LD +
Sbjct  431   EKELEHAADVLHECLPALDSN  451



>ref|XP_009341722.1| PREDICTED: acetylornithine aminotransferase, mitochondrial-like 
[Pyrus x bretschneideri]
Length=465

 Score =   496 bits (1278),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 256/321 (80%), Positives = 295/321 (92%), Gaps = 0/321 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             VELAKRLVG SFADRVFF+NSGTEANEAAIKFARKFQR +HPD ++P   FI+F+N FHG
Sbjct  142   VELAKRLVGSSFADRVFFTNSGTEANEAAIKFARKFQRHNHPDAKEPATGFISFTNSFHG  201

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMGA+ALTSKEHYRSPFEPVMPGVTF+EYGNIQA  ELIQ GK AAVFVEPIQGEGGIY
Sbjct  202   RTMGALALTSKEHYRSPFEPVMPGVTFVEYGNIQATKELIQPGKTAAVFVEPIQGEGGIY  261

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SA+KEF+Q LRT+CD+AG+LLVFDEVQCGLGRTGYLWAHEAYGV+PDIMTLAKPLAGGLP
Sbjct  262   SASKEFMQFLRTACDDAGALLVFDEVQCGLGRTGYLWAHEAYGVFPDIMTLAKPLAGGLP  321

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGA L+TE+VA+AI +GDHGSTFAG PL+C+AA+ VL+KISNP+FL SVS KG Y K +L
Sbjct  322   IGAALMTERVASAIAFGDHGSTFAGAPLICSAALAVLDKISNPKFLNSVSKKGIYFKNIL  381

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              +KLGGN HV+EIRGLGLIIGIELDV+A+P+V+AC+NSGLL+LTAGKGNVVRLVPPLII+
Sbjct  382   KQKLGGNPHVREIRGLGLIIGIELDVSASPVVDACRNSGLLILTAGKGNVVRLVPPLIIT  441

Query  1489  KQELEQAADVLAACLPVLDKS  1551
             +QEL+ AAD+L+  LPVLD++
Sbjct  442   EQELDVAADILSQALPVLDET  462



>sp|O04866.1|ARGD_ALNGL RecName: Full=Acetylornithine aminotransferase, mitochondrial; 
Short=ACOAT; AltName: Full=Acetylornithine transaminase; Short=AOTA; 
Flags: Precursor [Alnus glutinosa]
 emb|CAA69936.1| acetylornithine aminotransferase [Alnus glutinosa]
Length=451

 Score =   496 bits (1276),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 257/320 (80%), Positives = 292/320 (91%), Gaps = 0/320 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             VELAKRLV  SFADRVFFSNSGTEANEAAIKFARKFQRF+ PD +QP  EF++FSN FHG
Sbjct  130   VELAKRLVASSFADRVFFSNSGTEANEAAIKFARKFQRFTRPDEKQPATEFVSFSNSFHG  189

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMG++ALTSKE+YRSPFEPVMPGVTFLEYGNI+AAT+LIQ  KIAAVFVEPIQGEGG+Y
Sbjct  190   RTMGSLALTSKENYRSPFEPVMPGVTFLEYGNIEAATQLIQRRKIAAVFVEPIQGEGGVY  249

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATKEFL ALR +CD++G+LLVFDEVQCGLGRTGYLWAHE Y V+PDIMTLAKPLAGGLP
Sbjct  250   SATKEFLYALRKACDDSGTLLVFDEVQCGLGRTGYLWAHEIYDVFPDIMTLAKPLAGGLP  309

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGAVLVTE+VA+AI YGDHG+TFAGGPLVC AA+TVL+KI  P FLASVS KG Y KE+L
Sbjct  310   IGAVLVTERVASAITYGDHGTTFAGGPLVCKAALTVLDKILRPGFLASVSKKGHYFKEML  369

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
               KLGGN+HV+E+RG+GLI+GIELDV+A+PLV AC NSGLLVLTAGKGNVVR+VPPLII+
Sbjct  370   INKLGGNSHVREVRGVGLIVGIELDVSASPLVNACLNSGLLVLTAGKGNVVRIVPPLIIT  429

Query  1489  KQELEQAADVLAACLPVLDK  1548
             +QELE+AA++L  CLP LD+
Sbjct  430   EQELEKAAEILLQCLPALDR  449



>ref|XP_002272158.1| PREDICTED: acetylornithine aminotransferase, mitochondrial [Vitis 
vinifera]
Length=463

 Score =   496 bits (1277),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 267/321 (83%), Positives = 298/321 (93%), Gaps = 0/321 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             VELA+RLV CSFADRVFFSNSGTEANEAAIKFARKFQRF HPD +Q   EFI+FSN FHG
Sbjct  140   VELAERLVSCSFADRVFFSNSGTEANEAAIKFARKFQRFLHPDQKQLATEFISFSNSFHG  199

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMG++ALTSKE+YRSPFEPVMPGVTFLEYGNI AA ELIQSGKIAAVFVEPIQGEGGIY
Sbjct  200   RTMGSLALTSKEYYRSPFEPVMPGVTFLEYGNIHAARELIQSGKIAAVFVEPIQGEGGIY  259

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATKEFLQ+LR++CD+AGSLLVFDEVQCGLGRTGYLWAHE+YG++PDIMTLAKPLAGGLP
Sbjct  260   SATKEFLQSLRSACDDAGSLLVFDEVQCGLGRTGYLWAHESYGIFPDIMTLAKPLAGGLP  319

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGAVLVTE+VA+AI YGDHGSTFAGGPLVC AAV VL+KIS P FL SVS KGQY KELL
Sbjct  320   IGAVLVTERVASAIKYGDHGSTFAGGPLVCKAAVAVLDKISKPTFLDSVSKKGQYFKELL  379

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              +KLGGN HV+E+RGLGLI+GIELDV A+PLV+AC+NSGLL+LTAGKGNV+R+VPPLIIS
Sbjct  380   MQKLGGNPHVREVRGLGLIVGIELDVPASPLVDACRNSGLLILTAGKGNVIRIVPPLIIS  439

Query  1489  KQELEQAADVLAACLPVLDKS  1551
             ++ELE AA++L  CLPVLDK+
Sbjct  440   EEELELAAEILLKCLPVLDKT  460



>ref|XP_010691056.1| PREDICTED: acetylornithine aminotransferase, mitochondrial [Beta 
vulgaris subsp. vulgaris]
Length=465

 Score =   495 bits (1275),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 258/319 (81%), Positives = 293/319 (92%), Gaps = 0/319 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             VELAKRLV  SFADRVFF+NSGTEANEAAIKFARKFQR++HPD + PP EF+AF NCFHG
Sbjct  147   VELAKRLVSSSFADRVFFTNSGTEANEAAIKFARKFQRYTHPDAKDPPTEFVAFCNCFHG  206

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RT+GA++LTSKE+YRSPFEP+MPGVTF+EYGN +AA ELI SGK+AAVFVEP+QGEGGIY
Sbjct  207   RTIGALSLTSKENYRSPFEPLMPGVTFIEYGNSEAARELILSGKVAAVFVEPVQGEGGIY  266

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATKEFLQ+LR +CD AGSLLV+DEVQCGLGRTG+LWAHEAYGVYPDIMTLAKPLAGGLP
Sbjct  267   SATKEFLQSLRAACDEAGSLLVYDEVQCGLGRTGHLWAHEAYGVYPDIMTLAKPLAGGLP  326

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGAVLVTE+V++AI+ GDHGSTFAGGPLVC+AA+TVL+KIS+P FLASVS+KGQY KELL
Sbjct  327   IGAVLVTERVSSAISPGDHGSTFAGGPLVCHAALTVLDKISSPGFLASVSNKGQYFKELL  386

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              KKL GN HVKE+RG GLIIGIELDV A PLV+AC+NSGLL+LTAGKGNVVRLVPPL IS
Sbjct  387   TKKLLGNRHVKEVRGQGLIIGIELDVPAGPLVDACRNSGLLILTAGKGNVVRLVPPLTIS  446

Query  1489  KQELEQAADVLAACLPVLD  1545
             +QELE  A++L  C+P LD
Sbjct  447   EQELETGAEILLKCVPALD  465



>emb|CDP11028.1| unnamed protein product [Coffea canephora]
Length=461

 Score =   494 bits (1272),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 262/322 (81%), Positives = 291/322 (90%), Gaps = 0/322 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             VELAKRLV  SFADRVFF+NSGTEANEAAIKFARKFQR  HP  EQPPVEFIAFSNCFHG
Sbjct  140   VELAKRLVASSFADRVFFTNSGTEANEAAIKFARKFQRSLHPSEEQPPVEFIAFSNCFHG  199

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMGA+ALTSKEHYR PFEPVMPGV FLEYG+ QAAT+LI +GKIAAVFVEPIQGEGGIY
Sbjct  200   RTMGALALTSKEHYRIPFEPVMPGVNFLEYGDTQAATKLISNGKIAAVFVEPIQGEGGIY  259

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATKEFL+ALRT+CD AG+LLVFDEVQCGLGR GYLWAHEAYGVYPD+MTLAKPLAGGLP
Sbjct  260   SATKEFLEALRTACDCAGALLVFDEVQCGLGRAGYLWAHEAYGVYPDMMTLAKPLAGGLP  319

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGAVL +E+VA  I+YGDHGSTFAG PLVC+AA+ V++KI  P FLASVS KG+Y K+LL
Sbjct  320   IGAVLTSERVAGCISYGDHGSTFAGSPLVCSAAIAVVDKILKPGFLASVSKKGKYFKDLL  379

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              KKLGGN HVKE+RGLGLIIGIELDV A+PLV+AC+ SGLL+LTAGKGNVVRLVPPL+IS
Sbjct  380   VKKLGGNAHVKEVRGLGLIIGIELDVPASPLVDACRQSGLLILTAGKGNVVRLVPPLVIS  439

Query  1489  KQELEQAADVLAACLPVLDKST  1554
             +QEL+ AA++L  CLP LD S+
Sbjct  440   EQELDIAAEILLDCLPALDGSS  461



>gb|KDO61628.1| hypothetical protein CISIN_1g012363mg [Citrus sinensis]
Length=451

 Score =   493 bits (1269),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 248/322 (77%), Positives = 281/322 (87%), Gaps = 14/322 (4%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             +ELAKRLV CSFADRVFFSN+GTEANEAAIKFARKFQR S+PD ++P  EF++F+N FHG
Sbjct  143   IELAKRLVACSFADRVFFSNTGTEANEAAIKFARKFQRHSNPDSKEPATEFVSFTNSFHG  202

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMGA+ALTSKEHYRSPFEPVMPGV F+EYGNI+A  +LIQ GK AAVFVEPIQGEGGIY
Sbjct  203   RTMGALALTSKEHYRSPFEPVMPGVNFVEYGNIEATRKLIQPGKTAAVFVEPIQGEGGIY  262

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATKEFLQ LR +CD+AG+LLVFDEVQCGLGRTGYLWAHE YG++PDIMTLAKPLAGGLP
Sbjct  263   SATKEFLQFLRDACDDAGALLVFDEVQCGLGRTGYLWAHEHYGIFPDIMTLAKPLAGGLP  322

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGA LVTEKVA+AINYGDHGSTFAG PLVCNAA+ VL+KISNP FLAS            
Sbjct  323   IGAALVTEKVASAINYGDHGSTFAGSPLVCNAAIAVLDKISNPAFLAS------------  370

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
               KL  N HVK++RGLGLIIGIE DV+ATP+V+AC++SGLLVLTAGKGNVVRLVPPLIIS
Sbjct  371   --KLARNPHVKDVRGLGLIIGIEFDVSATPVVDACRDSGLLVLTAGKGNVVRLVPPLIIS  428

Query  1489  KQELEQAADVLAACLPVLDKST  1554
             +QEL+QA ++L   LPVLD ++
Sbjct  429   EQELDQAVEILCKTLPVLDSNS  450



>ref|XP_002307189.2| hypothetical protein POPTR_0005s09860g [Populus trichocarpa]
 gb|EEE94185.2| hypothetical protein POPTR_0005s09860g [Populus trichocarpa]
Length=468

 Score =   493 bits (1269),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 256/321 (80%), Positives = 290/321 (90%), Gaps = 0/321 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             VELAKRLV CSFADRVFF+NSG EANEAAIKFARKFQR S+PD++ P  EFI+F+N FHG
Sbjct  145   VELAKRLVDCSFADRVFFTNSGAEANEAAIKFARKFQRHSNPDVKDPATEFISFTNSFHG  204

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMGA+ALTSKE YR+PFEPVMPGVTF+EYGNI+A  ELI+ GK AAVFVEPIQGEGGIY
Sbjct  205   RTMGALALTSKEQYRTPFEPVMPGVTFVEYGNIKATQELIRRGKTAAVFVEPIQGEGGIY  264

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATK FL+ LRT+CD+AG+LLVFDEVQCGLGRTGYLWAHEAYG++PDIMTLAKPLAGGLP
Sbjct  265   SATKAFLEFLRTACDDAGALLVFDEVQCGLGRTGYLWAHEAYGIFPDIMTLAKPLAGGLP  324

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGA LVTE+VA++INYGDHGSTFAGG LVCNAA+TVLEKIS PEFL+SVS KG YLKE+L
Sbjct  325   IGAALVTERVASSINYGDHGSTFAGGSLVCNAALTVLEKISKPEFLSSVSKKGLYLKEIL  384

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              +KLG N+HVKEIRGLG IIGIELDV A+PLV AC+NSGLLVLTAGKGNVVRLVPPL ++
Sbjct  385   QQKLGRNSHVKEIRGLGFIIGIELDVPASPLVSACRNSGLLVLTAGKGNVVRLVPPLTVT  444

Query  1489  KQELEQAADVLAACLPVLDKS  1551
             KQEL  A+D+L   + VLD++
Sbjct  445   KQELRLASDILQNAMSVLDEN  465



>ref|XP_002513387.1| acetylornithine aminotransferase, putative [Ricinus communis]
 gb|EEF48790.1| acetylornithine aminotransferase, putative [Ricinus communis]
Length=470

 Score =   493 bits (1268),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 256/321 (80%), Positives = 295/321 (92%), Gaps = 0/321 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             VELAK LV CSFADRVFF+NSGTEANEAA+KFARK+QR S+P+  +P  EFI+FSNCFHG
Sbjct  147   VELAKHLVACSFADRVFFTNSGTEANEAAMKFARKYQRHSNPNAAEPATEFISFSNCFHG  206

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMGA+ALTSKE YRSPFEP++PGVTF+EYGNI+A  +LIQ GK AAVFVEPIQGEGGIY
Sbjct  207   RTMGALALTSKEQYRSPFEPLVPGVTFVEYGNIEATRKLIQRGKTAAVFVEPIQGEGGIY  266

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATKEFL+ LR +CD+AG+LLVFDEVQCGLGRTGYLWAHEAYGV+PDIMTLAKPLAGGLP
Sbjct  267   SATKEFLEFLRAACDDAGALLVFDEVQCGLGRTGYLWAHEAYGVFPDIMTLAKPLAGGLP  326

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGA+LVTE+VA+AINYGDHGSTFAGG LVCNAA+TV++KI  P+FLASVS KG Y KE+L
Sbjct  327   IGAILVTERVASAINYGDHGSTFAGGSLVCNAALTVVQKIGKPDFLASVSKKGLYFKEIL  386

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              +KLGGN+HVKEIRG+GLIIGIELDV+A+PLV+AC+NSGLLVLTAGKGNVVRLVPPLII+
Sbjct  387   KQKLGGNSHVKEIRGVGLIIGIELDVSASPLVDACRNSGLLVLTAGKGNVVRLVPPLIIT  446

Query  1489  KQELEQAADVLAACLPVLDKS  1551
             ++EL  AAD+L   LPVL++S
Sbjct  447   EEELGSAADILQNTLPVLNES  467



>ref|XP_011022086.1| PREDICTED: acetylornithine aminotransferase, mitochondrial-like 
[Populus euphratica]
Length=468

 Score =   492 bits (1266),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 256/322 (80%), Positives = 292/322 (91%), Gaps = 0/322 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             VELAKRLV CSFADRVFF+NSG EANEAAIKFARKFQR S+PD++ P +EFI+F+N FHG
Sbjct  145   VELAKRLVDCSFADRVFFTNSGAEANEAAIKFARKFQRHSNPDVKDPAIEFISFTNSFHG  204

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMGA+ALTSKE YRSPFEPVMPGVTF+EYGNI+A  ELI+ GK AAVFVEPIQGEGGIY
Sbjct  205   RTMGALALTSKEQYRSPFEPVMPGVTFVEYGNIKATQELIRRGKTAAVFVEPIQGEGGIY  264

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATKEFL+ LRT+C++AG+LLVFDEVQCGLGRTGYLWAHEAYG++PDI+TLAKPLAGGLP
Sbjct  265   SATKEFLEFLRTACNDAGALLVFDEVQCGLGRTGYLWAHEAYGIFPDILTLAKPLAGGLP  324

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGA LVTE+VA++INYGDHGSTFAGG LVCNAA+TVLEKIS PEFLA VS KG YLKE+L
Sbjct  325   IGAALVTERVASSINYGDHGSTFAGGSLVCNAALTVLEKISKPEFLACVSKKGLYLKEIL  384

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              +KLG N+HVKEIRGLGLIIGIELDV A+PLV AC+NSGLLVLTAGKGNVVRLVPPL ++
Sbjct  385   QQKLGRNSHVKEIRGLGLIIGIELDVLASPLVSACRNSGLLVLTAGKGNVVRLVPPLTVT  444

Query  1489  KQELEQAADVLAACLPVLDKST  1554
             +QEL  A+D+L   + VLD++ 
Sbjct  445   EQELRLASDILQNAMSVLDENN  466



>ref|XP_008461165.1| PREDICTED: acetylornithine aminotransferase, mitochondrial [Cucumis 
melo]
Length=455

 Score =   490 bits (1262),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 261/325 (80%), Positives = 296/325 (91%), Gaps = 1/325 (0%)
 Frame = +1

Query  574   HDFM*VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDM-EQPPVEFIAF  750
             H    VELAKRLV  SFADRVFF+NSGTEANEAAIKFARKFQRFSH +  E PPVEFIAF
Sbjct  131   HSIPQVELAKRLVAKSFADRVFFTNSGTEANEAAIKFARKFQRFSHTESNELPPVEFIAF  190

Query  751   SNCFHGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQ  930
             SNCFHGRTMGA+ALTSKEHYR+PFEPVMPGV+FL YG+I+AAT LI +GKIAAVFVEPIQ
Sbjct  191   SNCFHGRTMGALALTSKEHYRTPFEPVMPGVSFLPYGDIEAATNLILTGKIAAVFVEPIQ  250

Query  931   GEGGIYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKP  1110
             GEGGI+SATKEFL +LR +C+ AG+LLVFDE+QCGLGR+G+LWAHEAYGVYPDIMTLAKP
Sbjct  251   GEGGIFSATKEFLLSLRNACNEAGTLLVFDEIQCGLGRSGHLWAHEAYGVYPDIMTLAKP  310

Query  1111  LAGGLPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgq  1290
             LAGGLPIGAVLVTE+VAAAINYGDHGSTFAG PLVCNAAV+V++KIS+P FL SVS KG+
Sbjct  311   LAGGLPIGAVLVTERVAAAINYGDHGSTFAGSPLVCNAAVSVVDKISDPSFLLSVSRKGE  370

Query  1291  ylkellgkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLV  1470
             Y++ LL +KLGGN+HVKE+RG GLIIGIELDV A PLVEAC+NSGLL+LTAG+GNVVRLV
Sbjct  371   YMRNLLKQKLGGNSHVKEVRGQGLIIGIELDVPAGPLVEACRNSGLLILTAGQGNVVRLV  430

Query  1471  PPLIISKQELEQAADVLAACLPVLD  1545
             PPLII++QELE AA++L  C+ VLD
Sbjct  431   PPLIIAEQELEFAANILLECIHVLD  455



>ref|XP_002268013.1| PREDICTED: acetylornithine aminotransferase, mitochondrial [Vitis 
vinifera]
 ref|XP_010644866.1| PREDICTED: acetylornithine aminotransferase, mitochondrial [Vitis 
vinifera]
 emb|CBI21681.3| unnamed protein product [Vitis vinifera]
Length=467

 Score =   489 bits (1259),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 261/322 (81%), Positives = 293/322 (91%), Gaps = 0/322 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             VELAKRLV CSF+DRVFFSNSGTEANEAAIKFARKFQR SHPD ++PP +FIAF+N FHG
Sbjct  144   VELAKRLVACSFSDRVFFSNSGTEANEAAIKFARKFQRHSHPDAKEPPTDFIAFTNSFHG  203

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMGA+ALTSKEHYRSPFEPVMPGVTF+EYGNI+A  ELIQ GK AAVFVEPIQGEGGIY
Sbjct  204   RTMGALALTSKEHYRSPFEPVMPGVTFVEYGNIEATKELIQKGKTAAVFVEPIQGEGGIY  263

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATKEFLQ LR++CD+AG LLVFDEVQCGLGRTG+LWAHE+YGV+PDIMTLAKPLAGGLP
Sbjct  264   SATKEFLQFLRSACDDAGVLLVFDEVQCGLGRTGHLWAHESYGVFPDIMTLAKPLAGGLP  323

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGAVLVTE+VA+AIN+GDHGSTFAG PLVCNAA+ VLEKIS P FLASV+ KGQYLK++L
Sbjct  324   IGAVLVTERVASAINFGDHGSTFAGSPLVCNAALAVLEKISEPSFLASVAKKGQYLKQIL  383

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              +KLG N HVKE+RG GLI+GIELDV A+PLV ACQ +GLLVLT+GKGNVVRLVPPLII+
Sbjct  384   TQKLGHNPHVKEVRGFGLIVGIELDVQASPLVVACQEAGLLVLTSGKGNVVRLVPPLIIT  443

Query  1489  KQELEQAADVLAACLPVLDKST  1554
             ++ELE AA+VL+  LP LD S 
Sbjct  444   EEELELAAEVLSGSLPALDGSN  465



>ref|XP_008383084.1| PREDICTED: acetylornithine aminotransferase, mitochondrial-like 
[Malus domestica]
Length=464

 Score =   488 bits (1256),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 252/321 (79%), Positives = 293/321 (91%), Gaps = 0/321 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             VELAKRLVG SFADRVFF+NSGTEANEAAIKFARKFQR +HPD ++P   FI+F+N FHG
Sbjct  141   VELAKRLVGSSFADRVFFTNSGTEANEAAIKFARKFQRHTHPDAKEPATGFISFTNSFHG  200

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMGA+ALTSKEHYRSPFEPVMPGVTF+EYGNIQA  ELIQ GK AAVFVEPIQGEGGIY
Sbjct  201   RTMGALALTSKEHYRSPFEPVMPGVTFVEYGNIQATKELIQPGKTAAVFVEPIQGEGGIY  260

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SA+KEFLQ LRT+CD+AG+LLVFDEVQCGLGRTGYLWAHEAYGV+PDIMTLAKPLAGGLP
Sbjct  261   SASKEFLQYLRTACDDAGALLVFDEVQCGLGRTGYLWAHEAYGVFPDIMTLAKPLAGGLP  320

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGA L+TE+VA+AI +GDHGSTFAG PL+C+AA+ V++KIS+P+FL SVS KG Y K +L
Sbjct  321   IGAALMTERVASAIAFGDHGSTFAGAPLICSAALAVVDKISDPKFLNSVSKKGIYFKNIL  380

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              +KLGGN HV+EIRGLGLIIGIELDV+A+ +V+AC+NSGLL+LTAGKGNVVRLVPPLII+
Sbjct  381   KQKLGGNPHVREIRGLGLIIGIELDVSASAVVDACRNSGLLILTAGKGNVVRLVPPLIIT  440

Query  1489  KQELEQAADVLAACLPVLDKS  1551
             +QE++ AAD+L+  L VLD++
Sbjct  441   EQEIDVAADILSQALSVLDET  461



>ref|XP_004135869.1| PREDICTED: acetylornithine aminotransferase, mitochondrial-like 
[Cucumis sativus]
 ref|XP_004158788.1| PREDICTED: acetylornithine aminotransferase, mitochondrial-like 
[Cucumis sativus]
 gb|KGN45233.1| hypothetical protein Csa_7G432140 [Cucumis sativus]
Length=455

 Score =   486 bits (1252),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 260/324 (80%), Positives = 294/324 (91%), Gaps = 1/324 (0%)
 Frame = +1

Query  574   HDFM*VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDM-EQPPVEFIAF  750
             H    VELAKRLV  SFADRVFF+NSGTEANEAAIKFARKFQRFSH +  E PPVEFIAF
Sbjct  131   HSIPQVELAKRLVAKSFADRVFFTNSGTEANEAAIKFARKFQRFSHTESNELPPVEFIAF  190

Query  751   SNCFHGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQ  930
             SNCFHGRTMGA+ALTSKEHYR+PFEPVMPGV+FL YG+I+AAT+LI +GKIAAVFVEPIQ
Sbjct  191   SNCFHGRTMGALALTSKEHYRTPFEPVMPGVSFLPYGDIEAATKLILTGKIAAVFVEPIQ  250

Query  931   GEGGIYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKP  1110
             GEGGI+SATKEFL +LR +C+ AG+LLVFDE+QCGLGR G+LWAHEAYGVYPDIMTLAKP
Sbjct  251   GEGGIFSATKEFLLSLRNACNEAGTLLVFDEIQCGLGRNGHLWAHEAYGVYPDIMTLAKP  310

Query  1111  LAGGLPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgq  1290
             LAGGLPIGAVLVTE+VAAAINYGDHGSTFAG PLVCNAAV V++KIS+P FL SVS KG+
Sbjct  311   LAGGLPIGAVLVTERVAAAINYGDHGSTFAGSPLVCNAAVAVVDKISDPAFLLSVSRKGE  370

Query  1291  ylkellgkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLV  1470
             Y+K LL +KLGGN+HVKE+RG GLIIGIELDV A PLVEAC+NSGLL+LTAG+GNVVRLV
Sbjct  371   YMKNLLNQKLGGNSHVKEVRGQGLIIGIELDVPAGPLVEACRNSGLLILTAGQGNVVRLV  430

Query  1471  PPLIISKQELEQAADVLAACLPVL  1542
             PPLII++QELE AA+++  C+ VL
Sbjct  431   PPLIITEQELEFAANIMLECISVL  454



>gb|KDP25097.1| hypothetical protein JCGZ_22632 [Jatropha curcas]
Length=476

 Score =   486 bits (1252),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 253/321 (79%), Positives = 291/321 (91%), Gaps = 0/321 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             V+LA+RLV CSFADRVFF+NSGTEANEAAIKFARK+QR S+  + +P  EFI+FSN FHG
Sbjct  147   VDLARRLVACSFADRVFFTNSGTEANEAAIKFARKYQRHSNSKVAEPATEFISFSNSFHG  206

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMGA+ALTSK+ YRSPFEP+MPG+TF EYGNI AA ELI+ GK AAVFVEP+QGEGGIY
Sbjct  207   RTMGALALTSKKQYRSPFEPLMPGITFSEYGNIDAARELIRKGKTAAVFVEPLQGEGGIY  266

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATKEFL+ LR +CD+AG+LLVFDEVQCGLGRTGYLWAHEAYGV+PDIMTLAKPLAGGLP
Sbjct  267   SATKEFLEFLRVACDDAGALLVFDEVQCGLGRTGYLWAHEAYGVFPDIMTLAKPLAGGLP  326

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGA LVTE+VA+AIN+GDHGSTFAGGPLVCNAA+TVLEKISNP FL SVS KG + KE+L
Sbjct  327   IGATLVTERVASAINFGDHGSTFAGGPLVCNAALTVLEKISNPAFLTSVSKKGLHFKEIL  386

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              +KLGGN+HVKEIRGLGLIIGIELD+ A+PLV+AC+NSGLLVLTAGKGNVVRLVPPL I+
Sbjct  387   KQKLGGNSHVKEIRGLGLIIGIELDLPASPLVDACRNSGLLVLTAGKGNVVRLVPPLTIT  446

Query  1489  KQELEQAADVLAACLPVLDKS  1551
             +QEL+ AA++L   LP LD++
Sbjct  447   EQELDLAAELLQNSLPALDET  467



>ref|XP_004294104.1| PREDICTED: acetylornithine aminotransferase, mitochondrial-like 
[Fragaria vesca subsp. vesca]
Length=465

 Score =   486 bits (1250),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 254/319 (80%), Positives = 285/319 (89%), Gaps = 0/319 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             VELAK+LVG SFADRVFF+NSGTEANEAAIKFARKFQR +HPD ++P   FI+F+N FHG
Sbjct  142   VELAKQLVGSSFADRVFFTNSGTEANEAAIKFARKFQRHNHPDAKEPATNFISFTNSFHG  201

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMGA+ALTSKEHYRSPFEPVMPGVTF EYGNI A  ELIQ GK AAVFVEPIQGEGGIY
Sbjct  202   RTMGALALTSKEHYRSPFEPVMPGVTFAEYGNIVATRELIQPGKTAAVFVEPIQGEGGIY  261

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATKEFLQ LRT+CD AG+LLVFDEVQCGLGRTGYLWAHEA+GV+PDIMTLAKPLAGGLP
Sbjct  262   SATKEFLQFLRTACDEAGALLVFDEVQCGLGRTGYLWAHEAFGVFPDIMTLAKPLAGGLP  321

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGA LVTE+VA+AI +GDHGSTFAG PLVC+AA+ VL KISN  FL SVS KG Y K +L
Sbjct  322   IGAALVTERVASAIAFGDHGSTFAGAPLVCSAALAVLNKISNSSFLNSVSTKGLYFKRIL  381

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              +KLGGN HV+EIRG GLI+G+ELDV A+PLV+AC+N+GLLVLTAGKGNVVRLVPPLIIS
Sbjct  382   NQKLGGNPHVREIRGFGLILGVELDVPASPLVDACRNAGLLVLTAGKGNVVRLVPPLIIS  441

Query  1489  KQELEQAADVLAACLPVLD  1545
             +QEL++AA++L   LPVLD
Sbjct  442   EQELDKAAEILCQALPVLD  460



>ref|XP_010093044.1| Acetylornithine aminotransferase [Morus notabilis]
 gb|EXB53372.1| Acetylornithine aminotransferase [Morus notabilis]
Length=448

 Score =   485 bits (1248),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 250/322 (78%), Positives = 294/322 (91%), Gaps = 0/322 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             VELAK LV  SFADRVFF+NSGTEANEAAIKFARKFQR SHPD ++P  EF++F+N FHG
Sbjct  125   VELAKSLVASSFADRVFFTNSGTEANEAAIKFARKFQRHSHPDTKEPATEFVSFTNSFHG  184

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMGA+ALTSKE+YR+PF+PVMPGVTF+EYGNI+A  ELI+ GK AAVFVEPIQGEGGIY
Sbjct  185   RTMGALALTSKENYRTPFQPVMPGVTFVEYGNIEATKELIRPGKTAAVFVEPIQGEGGIY  244

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATKEFLQ LR +CD+AG+LLVFDEVQCGLGRTGYLWAHEAYGV+PD+MTLAKPLAGGLP
Sbjct  245   SATKEFLQFLRRACDDAGALLVFDEVQCGLGRTGYLWAHEAYGVFPDMMTLAKPLAGGLP  304

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGAVL+TE+VA++I YGDHGSTFAG PLVC+AA+ VLEKI NP FL+SVS KG YLK++L
Sbjct  305   IGAVLLTERVASSIAYGDHGSTFAGSPLVCSAALAVLEKIWNPNFLSSVSRKGLYLKDIL  364

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              KKLG N HVK+IRGLGLI+GIELDV+A+PLV+AC+N+GLLVLTAGKGNVVRLVPPLII+
Sbjct  365   EKKLGKNPHVKDIRGLGLIMGIELDVSASPLVDACRNAGLLVLTAGKGNVVRLVPPLIIT  424

Query  1489  KQELEQAADVLAACLPVLDKST  1554
             +QEL++A ++L   LP+LD+++
Sbjct  425   EQELDRATEILCQALPILDENS  446



>ref|XP_008226105.1| PREDICTED: acetylornithine aminotransferase, mitochondrial-like 
[Prunus mume]
Length=464

 Score =   485 bits (1249),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 253/321 (79%), Positives = 286/321 (89%), Gaps = 0/321 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             VELAKRLV  SFADRVFF+NSGTEANEAAIKFARKFQR ++PD ++P   FI+F+N FHG
Sbjct  141   VELAKRLVASSFADRVFFTNSGTEANEAAIKFARKFQRHTNPDAKEPATSFISFTNSFHG  200

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMGA+ALTSKEHYRSPFEPVMPGVTF+EYGNIQA  ELIQ GK AAVFVEPIQGEGGIY
Sbjct  201   RTMGALALTSKEHYRSPFEPVMPGVTFVEYGNIQATKELIQPGKTAAVFVEPIQGEGGIY  260

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SA+KEFLQ LR +CD+AG+LLVFDEVQCGLGRTGYLWAHEAYGV+PDIMTLAKPLAGGLP
Sbjct  261   SASKEFLQFLRKACDDAGALLVFDEVQCGLGRTGYLWAHEAYGVFPDIMTLAKPLAGGLP  320

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGA LVTE+VA+ I +GDHGSTFAG PLVC+AA+ VL KISNP FL  VS KG Y K +L
Sbjct  321   IGAALVTERVASTIAFGDHGSTFAGAPLVCSAALAVLNKISNPNFLNGVSKKGLYFKNIL  380

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              +KLGGN HV+E+RG GLIIGIELDV+A+PLV+AC+NSGLLVLTAGKGNVVRLVPPLII+
Sbjct  381   KQKLGGNPHVREVRGFGLIIGIELDVSASPLVDACRNSGLLVLTAGKGNVVRLVPPLIIT  440

Query  1489  KQELEQAADVLAACLPVLDKS  1551
             +QEL+ AA++L   LPVLD +
Sbjct  441   EQELDVAAEILCQALPVLDAT  461



>ref|XP_008372028.1| PREDICTED: acetylornithine aminotransferase, mitochondrial-like 
[Malus domestica]
Length=464

 Score =   483 bits (1244),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 250/321 (78%), Positives = 289/321 (90%), Gaps = 0/321 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             VELAKRLVG SFADRVFF+NSGTEANEAAIKFARKFQR +H D ++P   FI+F+N FHG
Sbjct  141   VELAKRLVGASFADRVFFTNSGTEANEAAIKFARKFQRHAHXDAKEPATSFISFTNSFHG  200

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMGA+ALTSKEHYRSPFEPVMPGVTF+EYGNIQA  ELIQ GK AAVFVEPIQGEGGIY
Sbjct  201   RTMGALALTSKEHYRSPFEPVMPGVTFVEYGNIQATKELIQPGKTAAVFVEPIQGEGGIY  260

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SA+KEFLQ LRT+CD+AG+LLVFDE+QCGLGRTG+LWAHEAYGV+PDIMTLAKPLAGGLP
Sbjct  261   SASKEFLQFLRTACDDAGALLVFDEIQCGLGRTGHLWAHEAYGVFPDIMTLAKPLAGGLP  320

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGA L+TE+VA+AI +GDHGSTFAG PL+C+AA+ V EKIS+  FL SVS KG Y K +L
Sbjct  321   IGAALMTERVASAIAFGDHGSTFAGAPLICSAALAVFEKISDHNFLNSVSKKGLYFKNIL  380

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              +KLGGN HV+EIRGLGLIIGIELDV+A+P  +AC+NSGLL+LTAGKGNV+RLVPPLII+
Sbjct  381   KQKLGGNPHVREIRGLGLIIGIELDVSASPXXDACRNSGLLILTAGKGNVLRLVPPLIIT  440

Query  1489  KQELEQAADVLAACLPVLDKS  1551
             +QEL+ AAD+L+  LPVLD++
Sbjct  441   EQELDVAADILSQALPVLDET  461



>ref|XP_003529021.1| PREDICTED: acetylornithine aminotransferase, mitochondrial-like 
isoform X1 [Glycine max]
 ref|XP_006583516.1| PREDICTED: acetylornithine aminotransferase, mitochondrial-like 
isoform X2 [Glycine max]
 gb|KHN01607.1| Acetylornithine aminotransferase, mitochondrial [Glycine soja]
Length=467

 Score =   481 bits (1239),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 254/324 (78%), Positives = 290/324 (90%), Gaps = 0/324 (0%)
 Frame = +1

Query  574   HDFM*VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFS  753
             H    VELAKRLV  SFADRVFF+NSGTEANEAAIKFARK+QR +  D ++P  EFIAFS
Sbjct  143   HTIPQVELAKRLVASSFADRVFFANSGTEANEAAIKFARKYQRDTTTDGKEPATEFIAFS  202

Query  754   NCFHGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQG  933
             NCFHGRT+GA+ALTSK  YR+PFEPVMPGVTFLEYGN QAA ELI+ GKIAAVFVEPIQG
Sbjct  203   NCFHGRTLGALALTSKVQYRTPFEPVMPGVTFLEYGNAQAAVELIKQGKIAAVFVEPIQG  262

Query  934   EGGIYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPL  1113
             EGGIYSATKEFLQ+L ++CD AG+LLVFDEVQCGLGR+G+LWAHEA+GV+PD+MTLAKPL
Sbjct  263   EGGIYSATKEFLQSLHSACDEAGALLVFDEVQCGLGRSGFLWAHEAFGVFPDMMTLAKPL  322

Query  1114  AGGLPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqy  1293
             AGGLPIGAVLVTE+VA++INYGDHGSTFAG PLVC+AA+ V +KIS P+FL+SVS KG Y
Sbjct  323   AGGLPIGAVLVTERVASSINYGDHGSTFAGNPLVCSAALAVFDKISKPDFLSSVSKKGLY  382

Query  1294  lkellgkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVP  1473
              KELL +KLGGN HVKEIRG+GLIIGI+LDV A+P V+AC+NSGLLVLTAGKGNVVRLVP
Sbjct  383   FKELLKQKLGGNQHVKEIRGVGLIIGIDLDVPASPFVDACRNSGLLVLTAGKGNVVRLVP  442

Query  1474  PLIISKQELEQAADVLAACLPVLD  1545
             PLII+++ELE AAD+L   LPVLD
Sbjct  443   PLIITEKELELAADILCKTLPVLD  466



>ref|XP_007213801.1| hypothetical protein PRUPE_ppa005378mg [Prunus persica]
 gb|EMJ15000.1| hypothetical protein PRUPE_ppa005378mg [Prunus persica]
Length=464

 Score =   481 bits (1237),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 249/321 (78%), Positives = 286/321 (89%), Gaps = 0/321 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             VELAK LV  SFADRVFF+NSGTEANEAAIKFARKFQR ++PD ++P   FI+F+N FHG
Sbjct  141   VELAKHLVASSFADRVFFTNSGTEANEAAIKFARKFQRHTNPDAKEPATSFISFTNSFHG  200

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMGA+ALTSKEHYRSPFEPVMPG+TF+EYGNIQA  ELIQ GK AAVFVEPIQGEGGIY
Sbjct  201   RTMGALALTSKEHYRSPFEPVMPGITFVEYGNIQATKELIQPGKTAAVFVEPIQGEGGIY  260

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SA+KEFLQ LR +CD+AG+LLVFDEVQCGLGRTGYLWAHEAYGV+PDIMTLAKPLAGGLP
Sbjct  261   SASKEFLQFLRKACDDAGALLVFDEVQCGLGRTGYLWAHEAYGVFPDIMTLAKPLAGGLP  320

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGA L+TE+VA+ I +GDHGSTFAG PLVC+AA+ VL KISNP FL SVS KG Y K +L
Sbjct  321   IGAALLTERVASTIAFGDHGSTFAGAPLVCSAALAVLNKISNPNFLNSVSKKGLYFKNIL  380

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              +K+GG+ HV+E+RG GLIIGIELDV+A+PLV+AC+NSGLLVLTAGKGNVVRLVPPLII+
Sbjct  381   KQKMGGSPHVREVRGFGLIIGIELDVSASPLVDACRNSGLLVLTAGKGNVVRLVPPLIIT  440

Query  1489  KQELEQAADVLAACLPVLDKS  1551
             +QEL+ AA++L   LPVLD +
Sbjct  441   EQELDVAAEILYRALPVLDAT  461



>ref|XP_004492217.1| PREDICTED: acetylornithine aminotransferase, mitochondrial-like 
[Cicer arietinum]
Length=468

 Score =   480 bits (1236),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 252/324 (78%), Positives = 288/324 (89%), Gaps = 0/324 (0%)
 Frame = +1

Query  574   HDFM*VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFS  753
             H    VELAK LV  SFADRVFF+NSGTEANEAAIKF+RK+Q+    D + P  EFIAFS
Sbjct  143   HSIPQVELAKSLVTSSFADRVFFANSGTEANEAAIKFSRKYQQHVSTDSKVPATEFIAFS  202

Query  754   NCFHGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQG  933
             NCFHGRT+GA+ALTSK  YR+PFEPVMPGVTFLEYGN  AA ELI+ GKIAAVFVEPIQG
Sbjct  203   NCFHGRTLGALALTSKVQYRAPFEPVMPGVTFLEYGNALAAVELIRQGKIAAVFVEPIQG  262

Query  934   EGGIYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPL  1113
             EGG+YSATKEFLQ+LR +CD AG+LLVFDEVQCGLGR+GYLWAHE YGV+PDIMTLAKPL
Sbjct  263   EGGVYSATKEFLQSLRNACDEAGTLLVFDEVQCGLGRSGYLWAHEPYGVFPDIMTLAKPL  322

Query  1114  AGGLPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqy  1293
             AGGLPIGAVLVTE+VA+AINYGDHGSTFAGGPL+C+AA+ V+ KIS PEFL+ VS KG Y
Sbjct  323   AGGLPIGAVLVTERVASAINYGDHGSTFAGGPLICSAALAVMNKISKPEFLSDVSKKGLY  382

Query  1294  lkellgkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVP  1473
              KELL +KLGGN+HVKEIRG+GLI+GI+LDV+A+P V+AC+NSGLLVLTAGKGNVVRLVP
Sbjct  383   FKELLKQKLGGNSHVKEIRGVGLIVGIDLDVSASPYVDACRNSGLLVLTAGKGNVVRLVP  442

Query  1474  PLIISKQELEQAADVLAACLPVLD  1545
             PLII+++ELE AAD+L+  LPVLD
Sbjct  443   PLIITEKELEHAADILSQTLPVLD  466



>ref|XP_003536567.1| PREDICTED: acetylornithine aminotransferase, mitochondrial-like 
[Glycine max]
 gb|KHN23178.1| Acetylornithine aminotransferase, mitochondrial [Glycine soja]
Length=463

 Score =   480 bits (1235),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 254/324 (78%), Positives = 288/324 (89%), Gaps = 0/324 (0%)
 Frame = +1

Query  574   HDFM*VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFS  753
             H    VELAKRLV  SFADRVFF+NSGTEANEAAIKFARK+QR +  + + P  EFIAFS
Sbjct  139   HTIPQVELAKRLVASSFADRVFFANSGTEANEAAIKFARKYQRHTTSNGKVPATEFIAFS  198

Query  754   NCFHGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQG  933
             NCFHGRT+GA+ALTSK  YR PFEPVMPGVTFLEYGN QAA ELI+ GKIAAVFVEPIQG
Sbjct  199   NCFHGRTLGALALTSKVQYRMPFEPVMPGVTFLEYGNAQAAVELIKQGKIAAVFVEPIQG  258

Query  934   EGGIYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPL  1113
             EGGIYSATKEFLQ+LR +CD  G+LLVFDEVQCGLGR+G+LWAHEAYGV+PD+MTLAKPL
Sbjct  259   EGGIYSATKEFLQSLRNACDETGALLVFDEVQCGLGRSGFLWAHEAYGVFPDMMTLAKPL  318

Query  1114  AGGLPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqy  1293
             AGGLPIGA+LVTE+VA+AINYGDHGSTFAG PLVC+AA+ VL+KIS P+FL+SVS KG Y
Sbjct  319   AGGLPIGALLVTERVASAINYGDHGSTFAGSPLVCSAALAVLDKISKPDFLSSVSKKGLY  378

Query  1294  lkellgkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVP  1473
              KELL +KLG N HVKEIRG+GLIIGI+LDV A+PLV+AC++SGLLVLTAGKGNVVRLVP
Sbjct  379   FKELLREKLGENRHVKEIRGVGLIIGIDLDVPASPLVDACRSSGLLVLTAGKGNVVRLVP  438

Query  1474  PLIISKQELEQAADVLAACLPVLD  1545
             PLII+++ELEQAA +L   LPVLD
Sbjct  439   PLIITEKELEQAAGILCQTLPVLD  462



>ref|XP_010937866.1| PREDICTED: acetylornithine aminotransferase, mitochondrial-like 
isoform X2 [Elaeis guineensis]
Length=477

 Score =   480 bits (1235),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 248/322 (77%), Positives = 285/322 (89%), Gaps = 0/322 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             V L KRLV CSFADRVFF+NSGTEANEAAIKFARKFQR+SH D + P  EFIAF+NCFHG
Sbjct  154   VTLGKRLVDCSFADRVFFTNSGTEANEAAIKFARKFQRYSHADEKHPATEFIAFTNCFHG  213

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMGA+ALTSKEHYR PFEP+MPGVTF+EYGNI+   + I+SGK AAVFVEPIQGEGGIY
Sbjct  214   RTMGALALTSKEHYRLPFEPLMPGVTFIEYGNIEEFMKTIKSGKTAAVFVEPIQGEGGIY  273

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             S TKEFLQ LRT+CD+AG+LLVFDEVQCGLGRTG+LWAHEA+GV PDIMTLAKPLAGGLP
Sbjct  274   STTKEFLQTLRTACDDAGALLVFDEVQCGLGRTGHLWAHEAFGVTPDIMTLAKPLAGGLP  333

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGAVL+TE+VAAAI+ GDHGSTFAGGPLVC+AA+ VL+KI  P FLASV+ KG Y KELL
Sbjct  334   IGAVLITERVAAAISSGDHGSTFAGGPLVCHAALAVLDKIREPSFLASVTKKGIYFKELL  393

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              +KLG + HVK++RG GLI+GIELDV  +PLV+AC+++GLLVLTAGKGNV+RLVPPLIIS
Sbjct  394   IQKLGDSPHVKQVRGFGLIVGIELDVQGSPLVDACRDAGLLVLTAGKGNVIRLVPPLIIS  453

Query  1489  KQELEQAADVLAACLPVLDKST  1554
             ++ELE AA+VL  C  VLD +T
Sbjct  454   EKELEHAAEVLRECFSVLDANT  475



>ref|XP_010937867.1| PREDICTED: acetylornithine aminotransferase, mitochondrial-like 
isoform X3 [Elaeis guineensis]
 ref|XP_010937868.1| PREDICTED: acetylornithine aminotransferase, mitochondrial-like 
isoform X3 [Elaeis guineensis]
 ref|XP_010937869.1| PREDICTED: acetylornithine aminotransferase, mitochondrial-like 
isoform X3 [Elaeis guineensis]
 ref|XP_010937870.1| PREDICTED: acetylornithine aminotransferase, mitochondrial-like 
isoform X3 [Elaeis guineensis]
 ref|XP_010937871.1| PREDICTED: acetylornithine aminotransferase, mitochondrial-like 
isoform X3 [Elaeis guineensis]
 ref|XP_010937872.1| PREDICTED: acetylornithine aminotransferase, mitochondrial-like 
isoform X3 [Elaeis guineensis]
Length=471

 Score =   479 bits (1234),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 248/322 (77%), Positives = 285/322 (89%), Gaps = 0/322 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             V L KRLV CSFADRVFF+NSGTEANEAAIKFARKFQR+SH D + P  EFIAF+NCFHG
Sbjct  148   VTLGKRLVDCSFADRVFFTNSGTEANEAAIKFARKFQRYSHADEKHPATEFIAFTNCFHG  207

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMGA+ALTSKEHYR PFEP+MPGVTF+EYGNI+   + I+SGK AAVFVEPIQGEGGIY
Sbjct  208   RTMGALALTSKEHYRLPFEPLMPGVTFIEYGNIEEFMKTIKSGKTAAVFVEPIQGEGGIY  267

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             S TKEFLQ LRT+CD+AG+LLVFDEVQCGLGRTG+LWAHEA+GV PDIMTLAKPLAGGLP
Sbjct  268   STTKEFLQTLRTACDDAGALLVFDEVQCGLGRTGHLWAHEAFGVTPDIMTLAKPLAGGLP  327

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGAVL+TE+VAAAI+ GDHGSTFAGGPLVC+AA+ VL+KI  P FLASV+ KG Y KELL
Sbjct  328   IGAVLITERVAAAISSGDHGSTFAGGPLVCHAALAVLDKIREPSFLASVTKKGIYFKELL  387

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              +KLG + HVK++RG GLI+GIELDV  +PLV+AC+++GLLVLTAGKGNV+RLVPPLIIS
Sbjct  388   IQKLGDSPHVKQVRGFGLIVGIELDVQGSPLVDACRDAGLLVLTAGKGNVIRLVPPLIIS  447

Query  1489  KQELEQAADVLAACLPVLDKST  1554
             ++ELE AA+VL  C  VLD +T
Sbjct  448   EKELEHAAEVLRECFSVLDANT  469



>ref|XP_009416294.1| PREDICTED: acetylornithine aminotransferase, mitochondrial-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009416295.1| PREDICTED: acetylornithine aminotransferase, mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=466

 Score =   479 bits (1232),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 255/319 (80%), Positives = 285/319 (89%), Gaps = 0/319 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             V L KRLV CSFADRVFF+NSGTEANEAAIKFARKFQRFSH D +    EFIAF+N FHG
Sbjct  143   VTLGKRLVECSFADRVFFTNSGTEANEAAIKFARKFQRFSHADEKLLATEFIAFTNSFHG  202

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMGA+ALTSKEHYRSPFEPVMPGVTF+EYGN + A E IQ GK AAVFVEPIQGEGGIY
Sbjct  203   RTMGALALTSKEHYRSPFEPVMPGVTFIEYGNSEEAIEAIQPGKTAAVFVEPIQGEGGIY  262

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATK+FLQALRT+CDNAG+LLV+DEVQCGLGRTG+LWAHEA+GV PD+MTLAKPLAGGLP
Sbjct  263   SATKDFLQALRTACDNAGALLVYDEVQCGLGRTGHLWAHEAFGVAPDMMTLAKPLAGGLP  322

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IG VL TE+VAAAI+ GDHGSTFAGGPLVC+AA+ VL+KI N  FLASV+ KG YLK+LL
Sbjct  323   IGVVLTTERVAAAISSGDHGSTFAGGPLVCHAALAVLDKIQNSIFLASVTRKGLYLKDLL  382

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
               KLGGN HVKE+RG GLI+GIELDV A+PLV AC+++GLLVLTAGKGNVVRLVPPLIIS
Sbjct  383   LNKLGGNPHVKEVRGFGLIVGIELDVQASPLVNACRDAGLLVLTAGKGNVVRLVPPLIIS  442

Query  1489  KQELEQAADVLAACLPVLD  1545
             + ELEQAA+VL+ACLP L+
Sbjct  443   ETELEQAAEVLSACLPALN  461



>gb|KEH22492.1| acetylornithine aminotransferase [Medicago truncatula]
Length=470

 Score =   479 bits (1232),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 253/324 (78%), Positives = 288/324 (89%), Gaps = 0/324 (0%)
 Frame = +1

Query  574   HDFM*VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFS  753
             H    VELAKRLV  SFA+RVFF+NSGTEANEAAIKF+RK+Q+ +  D + P  EF+AFS
Sbjct  144   HSLPQVELAKRLVASSFANRVFFANSGTEANEAAIKFSRKYQKHTCTDGKVPATEFLAFS  203

Query  754   NCFHGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQG  933
             NCFHGRT+GA+ALTSK  YR+PFEPVMPGVTF+EYGN  AA ELIQ GKIAAVFVEPIQG
Sbjct  204   NCFHGRTLGALALTSKVQYRTPFEPVMPGVTFVEYGNAPAAVELIQQGKIAAVFVEPIQG  263

Query  934   EGGIYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPL  1113
             EGGIYSATKEFLQ+LR +CD  G+LLVFDEVQCGLGR+G+LWAHEA+GV+PDIMTLAKPL
Sbjct  264   EGGIYSATKEFLQSLRNACDETGALLVFDEVQCGLGRSGFLWAHEAFGVFPDIMTLAKPL  323

Query  1114  AGGLPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqy  1293
             AGGLPIGAVLVTEKVA+AINYGDHGSTFAGGPL+CNAA+ VL KIS P FL+ VS KG Y
Sbjct  324   AGGLPIGAVLVTEKVASAINYGDHGSTFAGGPLICNAALAVLNKISKPTFLSDVSKKGLY  383

Query  1294  lkellgkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVP  1473
              KELL +KLGGN HVKEIRG+GLIIGI+LDV+ATPLV+AC++SGLLVLTAGKGNVVRLVP
Sbjct  384   FKELLKQKLGGNRHVKEIRGVGLIIGIDLDVSATPLVDACRDSGLLVLTAGKGNVVRLVP  443

Query  1474  PLIISKQELEQAADVLAACLPVLD  1545
             PLII++QE+E AAD+L+  L VLD
Sbjct  444   PLIITEQEIEHAADILSQTLHVLD  467



>ref|XP_010937865.1| PREDICTED: acetylornithine aminotransferase, mitochondrial-like 
isoform X1 [Elaeis guineensis]
Length=483

 Score =   479 bits (1233),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 248/322 (77%), Positives = 285/322 (89%), Gaps = 0/322 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             V L KRLV CSFADRVFF+NSGTEANEAAIKFARKFQR+SH D + P  EFIAF+NCFHG
Sbjct  160   VTLGKRLVDCSFADRVFFTNSGTEANEAAIKFARKFQRYSHADEKHPATEFIAFTNCFHG  219

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMGA+ALTSKEHYR PFEP+MPGVTF+EYGNI+   + I+SGK AAVFVEPIQGEGGIY
Sbjct  220   RTMGALALTSKEHYRLPFEPLMPGVTFIEYGNIEEFMKTIKSGKTAAVFVEPIQGEGGIY  279

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             S TKEFLQ LRT+CD+AG+LLVFDEVQCGLGRTG+LWAHEA+GV PDIMTLAKPLAGGLP
Sbjct  280   STTKEFLQTLRTACDDAGALLVFDEVQCGLGRTGHLWAHEAFGVTPDIMTLAKPLAGGLP  339

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGAVL+TE+VAAAI+ GDHGSTFAGGPLVC+AA+ VL+KI  P FLASV+ KG Y KELL
Sbjct  340   IGAVLITERVAAAISSGDHGSTFAGGPLVCHAALAVLDKIREPSFLASVTKKGIYFKELL  399

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              +KLG + HVK++RG GLI+GIELDV  +PLV+AC+++GLLVLTAGKGNV+RLVPPLIIS
Sbjct  400   IQKLGDSPHVKQVRGFGLIVGIELDVQGSPLVDACRDAGLLVLTAGKGNVIRLVPPLIIS  459

Query  1489  KQELEQAADVLAACLPVLDKST  1554
             ++ELE AA+VL  C  VLD +T
Sbjct  460   EKELEHAAEVLRECFSVLDANT  481



>ref|XP_010064050.1| PREDICTED: acetylornithine aminotransferase, mitochondrial-like 
[Eucalyptus grandis]
 gb|KCW71348.1| hypothetical protein EUGRSUZ_F04428 [Eucalyptus grandis]
Length=471

 Score =   477 bits (1228),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 245/322 (76%), Positives = 290/322 (90%), Gaps = 0/322 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             VELAK LV  SFADRVFF+NSGTEANEAAIKFARKFQR +HPD ++P  EFI+F+N FHG
Sbjct  148   VELAKHLVASSFADRVFFTNSGTEANEAAIKFARKFQRHTHPDEKEPATEFISFTNSFHG  207

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMGA+ALTSKE+YR+PF+PVMPGVTF+EYGNI+A  E I+ GK AAVFVEPIQGEGGIY
Sbjct  208   RTMGALALTSKENYRTPFQPVMPGVTFVEYGNIEATKEKIKRGKTAAVFVEPIQGEGGIY  267

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SAT+EFLQ LR++CD+AG+LLVFDE+QCGLGR+GYLWA+EAYGVYPDIMTLAKPLAGGLP
Sbjct  268   SATREFLQYLRSACDDAGALLVFDEIQCGLGRSGYLWAYEAYGVYPDIMTLAKPLAGGLP  327

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGAVLVTE+VA+A+ YGDHGSTFAG PLVC AA  VL+KIS P+FLASV   G+Y K+ L
Sbjct  328   IGAVLVTEEVASAMKYGDHGSTFAGSPLVCKAAQAVLDKISKPDFLASVRKNGEYFKQKL  387

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              +KLGGN+HVKE+RGLGLIIGIELDV+A+PLV+AC+NSGLL+LTAGKGNVVRLVPPLII+
Sbjct  388   VQKLGGNSHVKEVRGLGLIIGIELDVSASPLVDACRNSGLLILTAGKGNVVRLVPPLIIT  447

Query  1489  KQELEQAADVLAACLPVLDKST  1554
              +EL++A ++L   LP LD+++
Sbjct  448   VEELDEAVEILFNALPALDENS  469



>ref|XP_004960383.1| PREDICTED: acetylornithine aminotransferase, mitochondrial-like 
[Setaria italica]
Length=470

 Score =   475 bits (1223),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 244/322 (76%), Positives = 280/322 (87%), Gaps = 0/322 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             V LAKRLV  SFADR FF+NSGTEANEAAIKF+RKFQR +HPD + PP EF+AF+NCFHG
Sbjct  148   VALAKRLVESSFADRAFFANSGTEANEAAIKFSRKFQRVAHPDSDDPPSEFLAFTNCFHG  207

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMG+VALTSK  YR PF PVMPG TF+EYGN+Q A ++IQSG++AAVFVEP+QGEGGI+
Sbjct  208   RTMGSVALTSKSQYREPFAPVMPGGTFVEYGNLQEAKKVIQSGRLAAVFVEPVQGEGGIH  267

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SAT+EFLQ LR +CD AG+LLVFDEVQCGLGRTGYLWAHEAYGV PDIMTLAKPLA GLP
Sbjct  268   SATQEFLQGLREACDEAGALLVFDEVQCGLGRTGYLWAHEAYGVAPDIMTLAKPLANGLP  327

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGAVLV EKVAAAINYGDHG+TF GGPLVC  A+TVL+KI  P FLA VS KG+  K+LL
Sbjct  328   IGAVLVKEKVAAAINYGDHGTTFGGGPLVCKTALTVLDKIQKPGFLAEVSKKGENFKQLL  387

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
               KL GN HVKE+RG+GLI+GIELDV A PLV+AC ++G++VLTAGKGNVVRLVPPLIIS
Sbjct  388   RTKLSGNPHVKEVRGVGLIVGIELDVPAGPLVDACLDAGVIVLTAGKGNVVRLVPPLIIS  447

Query  1489  KQELEQAADVLAACLPVLDKST  1554
             ++ELEQAADV+  CLP LD ++
Sbjct  448   EKELEQAADVIRDCLPALDAAS  469



>gb|ACJ84700.1| unknown [Medicago truncatula]
Length=470

 Score =   475 bits (1223),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 251/324 (77%), Positives = 286/324 (88%), Gaps = 0/324 (0%)
 Frame = +1

Query  574   HDFM*VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFS  753
             H    VELAKRLV  SFA+RVFF+NSGTEANEAAIKF+RK+Q+ +  D + P  EF+AFS
Sbjct  144   HSLPQVELAKRLVASSFANRVFFANSGTEANEAAIKFSRKYQKHTCTDGKVPATEFLAFS  203

Query  754   NCFHGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQG  933
             NCFHGRT+GA+ALTSK  YR+PFEPVMPGVTF+EYGN  AA ELIQ GKIAAVFVEPIQG
Sbjct  204   NCFHGRTLGALALTSKVQYRTPFEPVMPGVTFVEYGNAPAAVELIQQGKIAAVFVEPIQG  263

Query  934   EGGIYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPL  1113
             EGGIYSATKEFLQ+LR +CD  G+L VFDEVQCGLGR+G+LWAHEA+GV+PDIMTLAKPL
Sbjct  264   EGGIYSATKEFLQSLRNACDETGALPVFDEVQCGLGRSGFLWAHEAFGVFPDIMTLAKPL  323

Query  1114  AGGLPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqy  1293
             AGGLPIGAVLVTEKVA+AINYGDHGSTFAGGPL+CNAA+ VL KIS P FL+ VS KG  
Sbjct  324   AGGLPIGAVLVTEKVASAINYGDHGSTFAGGPLICNAALAVLNKISKPTFLSDVSKKGLC  383

Query  1294  lkellgkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVP  1473
              KELL +KLGGN HVKEIRG+GLIIGI+LDV+ATPLV+AC++SGLLVLTAGKGNVVRLVP
Sbjct  384   FKELLKQKLGGNRHVKEIRGVGLIIGIDLDVSATPLVDACRDSGLLVLTAGKGNVVRLVP  443

Query  1474  PLIISKQELEQAADVLAACLPVLD  1545
             PLII++QE+E AAD+L+  L VLD
Sbjct  444   PLIITEQEIEHAADILSQTLHVLD  467



>ref|XP_006302240.1| hypothetical protein CARUB_v10020266mg [Capsella rubella]
 gb|EOA35138.1| hypothetical protein CARUB_v10020266mg [Capsella rubella]
Length=458

 Score =   474 bits (1221),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 246/319 (77%), Positives = 287/319 (90%), Gaps = 0/319 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             +ELAKRLV  SFADRVFF NSGTEANEAAIKF+RKFQRF+HP+ ++    FIAF+N FHG
Sbjct  140   IELAKRLVASSFADRVFFCNSGTEANEAAIKFSRKFQRFTHPENKEVATGFIAFTNSFHG  199

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RT+GA+ALTSKE YR+PFEP+MPGVTFLEYGNIQ AT+LI+SGKIAAVFVEPIQGEGGIY
Sbjct  200   RTLGALALTSKEQYRTPFEPIMPGVTFLEYGNIQTATDLIRSGKIAAVFVEPIQGEGGIY  259

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATKEFLQ+LRT+CD AGSLLVFDEVQCGLGRTG +WA+EA+GV PDIMT+AKPLAGGLP
Sbjct  260   SATKEFLQSLRTACDAAGSLLVFDEVQCGLGRTGLMWAYEAFGVTPDIMTVAKPLAGGLP  319

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGAVLVTEKVA  INYGDHGSTFAG PLVCNAA+ VL+K+SNP FL+SVS KG+Y K+LL
Sbjct  320   IGAVLVTEKVAETINYGDHGSTFAGNPLVCNAAIAVLDKVSNPSFLSSVSSKGRYFKDLL  379

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              KKLGGN+HVKE+RG GLIIG+ELDV A  LV+AC++SGLL+LTAGKGNVVR+VPPL+IS
Sbjct  380   VKKLGGNSHVKEVRGEGLIIGVELDVPANSLVDACRDSGLLILTAGKGNVVRIVPPLVIS  439

Query  1489  KQELEQAADVLAACLPVLD  1545
             ++E+E+A +++   L  LD
Sbjct  440   EEEIERAVEIMCQNLTALD  458



>ref|NP_178175.1| acetylornithine aminotransferase [Arabidopsis thaliana]
 sp|Q9M8M7.1|ARGD_ARATH RecName: Full=Acetylornithine aminotransferase, chloroplastic/mitochondrial; 
Short=ACOAT; AltName: Full=Acetylornithine transaminase; 
Short=AOTA; AltName: Full=Protein HOPW1-1-INTERACTING 
1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF27117.1|AC018849_5 putative acetylornithine transaminase; 18117-19955 [Arabidopsis 
thaliana]
 gb|AAK96785.1| putative acetylornithine transaminase [Arabidopsis thaliana]
 gb|AAO00944.1| putative acetylornithine transaminase [Arabidopsis thaliana]
 gb|ABW84224.1| putative mitochondrial acetylornithine transaminase [Arabidopsis 
thaliana]
 gb|AEE36426.1| acetylornithine aminotransferase [Arabidopsis thaliana]
Length=457

 Score =   473 bits (1217),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 242/319 (76%), Positives = 290/319 (91%), Gaps = 0/319 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             +ELAKRLV  SFADRVFF NSGTEANEAAIKF+RKFQRF+HP+ ++    FIAF+N FHG
Sbjct  139   IELAKRLVASSFADRVFFCNSGTEANEAAIKFSRKFQRFTHPEDKEVATGFIAFTNSFHG  198

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RT+GA+ALTSKE YR+PFEP+MPGVTFLEYGNIQAAT+LI+SGKIAAVFVEPIQGEGGIY
Sbjct  199   RTLGALALTSKEQYRTPFEPIMPGVTFLEYGNIQAATDLIRSGKIAAVFVEPIQGEGGIY  258

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATKEFLQ+LR++CD AGSLLVFDEVQCGLGRTG +WA+EA+GV PDIMT+AKPLAGGLP
Sbjct  259   SATKEFLQSLRSACDAAGSLLVFDEVQCGLGRTGLMWAYEAFGVTPDIMTVAKPLAGGLP  318

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGAVLVTEKVA  INYGDHGSTFAG PLVC+AA+ V++K+S P FL+SVS+KG+Y ++LL
Sbjct  319   IGAVLVTEKVAETINYGDHGSTFAGSPLVCSAAIAVMDKVSKPSFLSSVSNKGRYFRDLL  378

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              KKLGGN+HVKE+RG GLIIG+ELDV A+ LV+AC++SGLL+LTAGKGNVVR+VPPL+IS
Sbjct  379   VKKLGGNSHVKEVRGEGLIIGVELDVPASSLVDACRDSGLLILTAGKGNVVRIVPPLVIS  438

Query  1489  KQELEQAADVLAACLPVLD  1545
             ++E+E+A ++++  L  LD
Sbjct  439   EEEIERAVEIMSQNLTALD  457



>ref|XP_008789127.1| PREDICTED: acetylornithine aminotransferase, mitochondrial [Phoenix 
dactylifera]
Length=488

 Score =   473 bits (1218),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 250/319 (78%), Positives = 283/319 (89%), Gaps = 0/319 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             V L K LV CSFADRVFFSNSGTEANEAAIKFARKFQR+ H D + P  EFIAF+N FHG
Sbjct  165   VTLGKCLVECSFADRVFFSNSGTEANEAAIKFARKFQRYLHADEKHPATEFIAFTNSFHG  224

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMGA+ALTSKE YR PFEPVMPGVTF+EYGNI+   + I+SGK AAVFVEPIQGEGGIY
Sbjct  225   RTMGALALTSKEQYRLPFEPVMPGVTFIEYGNIEEFKKTIKSGKTAAVFVEPIQGEGGIY  284

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATK+FLQ LRT CD+AG+LLVFDE+QCGLGRTG+LWAHEA+GV PDIMTLAKPLAGGLP
Sbjct  285   SATKDFLQTLRTGCDDAGALLVFDEIQCGLGRTGHLWAHEAFGVTPDIMTLAKPLAGGLP  344

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGAVL TE+VAAAI+ GDHGSTFAG PLVC+AA+ VL+KI  P FLASV+ KG YLKELL
Sbjct  345   IGAVLTTERVAAAISSGDHGSTFAGAPLVCHAALAVLDKIREPSFLASVTKKGLYLKELL  404

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              +KLG + HVKE+RGLGLI+GIELDV A+PLV+AC+++GLLVLTAGKGNV+RLVPPLIIS
Sbjct  405   IQKLGDSQHVKEVRGLGLIVGIELDVQASPLVDACRDAGLLVLTAGKGNVIRLVPPLIIS  464

Query  1489  KQELEQAADVLAACLPVLD  1545
             ++ELEQAA+VL  CLPVLD
Sbjct  465   EKELEQAAEVLRECLPVLD  483



>ref|XP_007145969.1| hypothetical protein PHAVU_006G002000g [Phaseolus vulgaris]
 gb|ESW17963.1| hypothetical protein PHAVU_006G002000g [Phaseolus vulgaris]
Length=467

 Score =   473 bits (1216),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 248/320 (78%), Positives = 284/320 (89%), Gaps = 0/320 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             V+LAKRLV  SFADRVFFSNSGTEANEAAIKFARK QR +  + ++P  EFIAFSN FHG
Sbjct  148   VKLAKRLVDSSFADRVFFSNSGTEANEAAIKFARKHQRHTTTNGKEPATEFIAFSNGFHG  207

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RT+GA+ALTSK  YR+PFEP+MPGVTFLEYG+ QAATELI+ GKIAAVFVEP+QGEGGIY
Sbjct  208   RTLGALALTSKVQYRTPFEPIMPGVTFLEYGDAQAATELIKQGKIAAVFVEPLQGEGGIY  267

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATKEFLQ+LR +CD  G+LLVFDEVQCGLGRTG LWAHEAYGV+PD+MTLAKPLAGGLP
Sbjct  268   SATKEFLQSLRNACDETGTLLVFDEVQCGLGRTGLLWAHEAYGVFPDMMTLAKPLAGGLP  327

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IG VLVTE VA++INYGDHGSTFAG PLVC+AA+ V +KIS PEFL+SVS KG Y KELL
Sbjct  328   IGLVLVTESVASSINYGDHGSTFAGNPLVCSAAIAVFDKISKPEFLSSVSKKGLYFKELL  387

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              +KLGGN HV+EIRG+GLIIG++LDV+A+P VEACQNSGLLVLTAGKGNVVR+VPPLII+
Sbjct  388   RQKLGGNRHVREIRGVGLIIGVDLDVSASPFVEACQNSGLLVLTAGKGNVVRIVPPLIIT  447

Query  1489  KQELEQAADVLAACLPVLDK  1548
             ++E+EQA  +L   L VLDK
Sbjct  448   EKEIEQAVHILFQNLKVLDK  467



>ref|XP_006405081.1| hypothetical protein EUTSA_v10000649mg, partial [Eutrema salsugineum]
 gb|ESQ46534.1| hypothetical protein EUTSA_v10000649mg, partial [Eutrema salsugineum]
Length=319

 Score =   467 bits (1201),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 243/319 (76%), Positives = 286/319 (90%), Gaps = 0/319 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             +ELAKRLV  SFADRVFF NSGTEANEAAIKF+RKFQRF+HP+ +     FIAF+N FHG
Sbjct  1     IELAKRLVASSFADRVFFCNSGTEANEAAIKFSRKFQRFTHPEDKGVATGFIAFTNSFHG  60

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RT+GA+ALTSKE YR+PFEP+MPGVTF+EYGNIQAAT+LI+SGKIAAVFVEP+QGEGG+Y
Sbjct  61    RTLGALALTSKEQYRTPFEPIMPGVTFVEYGNIQAATDLIRSGKIAAVFVEPLQGEGGVY  120

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATKEFLQ+LR++CD AGSLLVFDEVQCGLGRTG LWA+EA+GV PDIMT+AKPLAGGLP
Sbjct  121   SATKEFLQSLRSACDAAGSLLVFDEVQCGLGRTGNLWAYEAFGVTPDIMTVAKPLAGGLP  180

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGAVLVTEKVA  I YGDHGSTFAG PLVC+AA+ VL+K+S P FL+SVS KG Y K+LL
Sbjct  181   IGAVLVTEKVAETIKYGDHGSTFAGNPLVCSAAIAVLDKVSKPSFLSSVSSKGLYFKDLL  240

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              KKLGGN+HVKE+RG GLIIG+ELDV A PLV+AC++SGLL+LTAGKGNVVR+VPPLIIS
Sbjct  241   VKKLGGNSHVKEVRGEGLIIGVELDVPANPLVDACRDSGLLILTAGKGNVVRIVPPLIIS  300

Query  1489  KQELEQAADVLAACLPVLD  1545
             ++E+E+A ++++  L  LD
Sbjct  301   EEEIERAVEIVSHNLTALD  319



>gb|KFK42443.1| hypothetical protein AALP_AA2G257200 [Arabis alpina]
Length=453

 Score =   472 bits (1214),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 244/319 (76%), Positives = 287/319 (90%), Gaps = 0/319 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             ++LAKRLV  SFADRVFF NSGTEANEAAIKF+RKFQRF++P+ ++    FIAFSN FHG
Sbjct  135   IDLAKRLVASSFADRVFFCNSGTEANEAAIKFSRKFQRFTNPEDKEVATGFIAFSNSFHG  194

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RT+GA+ALTSKE YR+PFEPVMPGVTF+EYGN+QAAT+LI SGKIAAVFVEPIQGEGGIY
Sbjct  195   RTLGALALTSKEQYRTPFEPVMPGVTFVEYGNVQAATDLISSGKIAAVFVEPIQGEGGIY  254

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATKEFLQ+LR++CD +GSLLVFDEVQCGLGRTG LWA+EA+GV PDIMT+AKPLAGGLP
Sbjct  255   SATKEFLQSLRSACDASGSLLVFDEVQCGLGRTGKLWAYEAFGVTPDIMTVAKPLAGGLP  314

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGAVLVTEKVA  INYGDHGSTFAG PLVCNAA+ VL+K+S P FL+SVS KGQY ++ L
Sbjct  315   IGAVLVTEKVAGTINYGDHGSTFAGNPLVCNAAIAVLDKVSKPSFLSSVSSKGQYFRDSL  374

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              KKLGGN+HVKE+RG GLIIG+ELDVAA   V+AC++SGLL+LTAGKGNVVR+VPPLIIS
Sbjct  375   VKKLGGNSHVKEVRGEGLIIGVELDVAANSFVDACRDSGLLILTAGKGNVVRIVPPLIIS  434

Query  1489  KQELEQAADVLAACLPVLD  1545
             ++E+EQA ++++  L VL+
Sbjct  435   EEEIEQAVEIMSQNLTVLE  453



>ref|XP_010429934.1| PREDICTED: acetylornithine aminotransferase, chloroplastic/mitochondrial-like 
[Camelina sativa]
Length=461

 Score =   472 bits (1214),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 245/319 (77%), Positives = 286/319 (90%), Gaps = 0/319 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             +ELAKRLV  SFADRVFF NSGTEANEAAIKF+RKFQRF+HP+ ++    FIAF+N FHG
Sbjct  143   IELAKRLVASSFADRVFFCNSGTEANEAAIKFSRKFQRFTHPEDKEVATGFIAFTNSFHG  202

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RT+GA+ALTSKE YR+PFEP+MPGVTFLEYGNIQAAT+LI SGKIAAVFVEPIQGEGGIY
Sbjct  203   RTLGALALTSKEQYRTPFEPIMPGVTFLEYGNIQAATDLISSGKIAAVFVEPIQGEGGIY  262

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATKEFLQ+LRT+CD AGSLLVFDEVQCGLGRTG +WA+EA+ V PDIMT+AKPLAGGLP
Sbjct  263   SATKEFLQSLRTACDAAGSLLVFDEVQCGLGRTGLMWAYEAFNVTPDIMTVAKPLAGGLP  322

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGAVLVTEKVA  INYGDHGSTFAG PLVCNAA+ V++K+SNP FL+SVS KG+Y K+LL
Sbjct  323   IGAVLVTEKVAETINYGDHGSTFAGNPLVCNAAIAVVDKVSNPSFLSSVSSKGRYFKDLL  382

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              KKLGGN+HVKE+RG GLIIG+ELDV A  LV AC++SGLL+LTAGKGNVVR+VPPL+IS
Sbjct  383   VKKLGGNSHVKEVRGEGLIIGVELDVPANSLVNACRDSGLLILTAGKGNVVRIVPPLVIS  442

Query  1489  KQELEQAADVLAACLPVLD  1545
             ++E+E+A ++++  L  LD
Sbjct  443   EEEIERAVEIMSQNLYALD  461



>ref|XP_010472903.1| PREDICTED: acetylornithine aminotransferase, chloroplastic/mitochondrial-like 
[Camelina sativa]
Length=461

 Score =   471 bits (1213),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 245/319 (77%), Positives = 286/319 (90%), Gaps = 0/319 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             +ELAKRLV  SFADRVFF NSGTEANEAAIKF+RKFQRF+HP+ ++    FIAF+N FHG
Sbjct  143   IELAKRLVASSFADRVFFCNSGTEANEAAIKFSRKFQRFTHPEDKEVATGFIAFANSFHG  202

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RT+GA+ALTSKE YR+PFEP+MPGVTFLEYGNIQAAT+LI SGKIAAVFVEPIQGEGGIY
Sbjct  203   RTLGALALTSKEQYRTPFEPIMPGVTFLEYGNIQAATDLISSGKIAAVFVEPIQGEGGIY  262

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATKEFLQ+LRT+CD AGSLLVFDEVQCGLGRTG +WA+EA+ V PDIMT+AKPLAGGLP
Sbjct  263   SATKEFLQSLRTACDAAGSLLVFDEVQCGLGRTGLMWAYEAFNVTPDIMTVAKPLAGGLP  322

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGAVLVTEKVA  INYGDHGSTFAG PLVCNAA+ V++K+SNP FL+SVS KG+Y K+LL
Sbjct  323   IGAVLVTEKVATTINYGDHGSTFAGNPLVCNAAIAVVDKVSNPSFLSSVSSKGRYFKDLL  382

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              KKLGGN+HVKE+RG GLIIG+ELDV A  LV AC++SGLL+LTAGKGNVVR+VPPL+IS
Sbjct  383   VKKLGGNSHVKEVRGEGLIIGVELDVPANSLVNACRDSGLLILTAGKGNVVRIVPPLVIS  442

Query  1489  KQELEQAADVLAACLPVLD  1545
             ++E+E+A ++++  L  LD
Sbjct  443   EEEIERAVEIMSQNLYALD  461



>ref|XP_006389814.1| hypothetical protein EUTSA_v10018519mg [Eutrema salsugineum]
 gb|ESQ27100.1| hypothetical protein EUTSA_v10018519mg [Eutrema salsugineum]
Length=457

 Score =   471 bits (1212),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 245/319 (77%), Positives = 290/319 (91%), Gaps = 0/319 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             +ELAKRLV  SFADRVFF NSGTEANEAAIKF+RKFQRF+HP+ ++    FIAF+N FHG
Sbjct  139   IELAKRLVASSFADRVFFCNSGTEANEAAIKFSRKFQRFTHPENKEVATGFIAFTNSFHG  198

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RT+GA+ALTSKE YR+PFEP+MPGVTFLEYGNIQA+T+LI+SGKIAAVFVEPIQGEGGIY
Sbjct  199   RTLGALALTSKEQYRTPFEPIMPGVTFLEYGNIQASTDLIRSGKIAAVFVEPIQGEGGIY  258

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATKEFLQ+LR++CD AGSLLVFDEVQCGLGRTG LWA+EA+GV PDIMT+AKPLAGGLP
Sbjct  259   SATKEFLQSLRSACDAAGSLLVFDEVQCGLGRTGNLWAYEAFGVTPDIMTVAKPLAGGLP  318

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGAVLVTEKVA  I+YGDHGSTFAG PLVCNAA+ V++K+S P FL+SVS KG+Y K+LL
Sbjct  319   IGAVLVTEKVAETISYGDHGSTFAGNPLVCNAAIAVVDKVSKPSFLSSVSSKGRYFKDLL  378

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
             GKKLGGN+HVKE+RG GLI+G+ELDV A PLV+AC++SGLL+LTAGKGNVVR+VPPLIIS
Sbjct  379   GKKLGGNSHVKEVRGEGLILGVELDVPANPLVDACRDSGLLILTAGKGNVVRIVPPLIIS  438

Query  1489  KQELEQAADVLAACLPVLD  1545
             ++E+E+A ++++  L  LD
Sbjct  439   EEEIERAVEIISHNLTALD  457



>gb|AAM63124.1| putative acetylornithine transaminase [Arabidopsis thaliana]
Length=457

 Score =   471 bits (1212),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 242/319 (76%), Positives = 290/319 (91%), Gaps = 0/319 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             +ELAKRLV  SFADRVFF NSGTEANEAAIKF+RKFQRF+HP+ ++    FIAF+N FHG
Sbjct  139   IELAKRLVASSFADRVFFCNSGTEANEAAIKFSRKFQRFTHPEDKEVATGFIAFTNSFHG  198

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RT+GA+ALTSKE YR+PFEP+MPGVTFLEYGNIQAAT+LI+SGKIAAVFVEPIQGEGGIY
Sbjct  199   RTLGALALTSKEQYRTPFEPIMPGVTFLEYGNIQAATDLIRSGKIAAVFVEPIQGEGGIY  258

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATKEFLQ+LR++CD AGSLLVFDEVQCGLGRTG +WA+EA+GV PDIMT+AKPLAGGLP
Sbjct  259   SATKEFLQSLRSACDAAGSLLVFDEVQCGLGRTGLMWAYEAFGVTPDIMTVAKPLAGGLP  318

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGAVLVTEKVA  INYGDHGSTFAG PLVC+AA+ V++K+S P FL+SVS+KG+Y ++LL
Sbjct  319   IGAVLVTEKVAETINYGDHGSTFAGSPLVCSAAIAVMDKVSKPSFLSSVSNKGRYFRDLL  378

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              KKLGGN++VKE+RG GLIIG+ELDV A+ LV+AC++SGLL+LTAGKGNVVR+VPPL+IS
Sbjct  379   VKKLGGNSYVKEVRGEGLIIGVELDVPASSLVDACRDSGLLILTAGKGNVVRIVPPLVIS  438

Query  1489  KQELEQAADVLAACLPVLD  1545
             ++E+E+A +++A  L  LD
Sbjct  439   EEEIERAVEIMAQNLTALD  457



>ref|XP_010417687.1| PREDICTED: acetylornithine aminotransferase, chloroplastic/mitochondrial 
[Camelina sativa]
Length=461

 Score =   471 bits (1212),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 245/319 (77%), Positives = 286/319 (90%), Gaps = 0/319 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             +ELAKRLV  SFADRVFF NSGTEANEAAIKF+RKFQRF+HP+ ++    FIAF+N FHG
Sbjct  143   IELAKRLVASSFADRVFFCNSGTEANEAAIKFSRKFQRFTHPEDKEVATGFIAFTNSFHG  202

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RT+GA+ALTSKE YR+PFEP+MPGVTFLEYGNIQAAT+LI SGKIAAVFVEPIQGEGGIY
Sbjct  203   RTLGALALTSKEQYRTPFEPIMPGVTFLEYGNIQAATDLISSGKIAAVFVEPIQGEGGIY  262

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATKEFLQ+LRT+CD AGSLLVFDEVQCGLGRTG +WA+EA+ V PDIMT+AKPLAGGLP
Sbjct  263   SATKEFLQSLRTACDAAGSLLVFDEVQCGLGRTGLMWAYEAFNVTPDIMTVAKPLAGGLP  322

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGAVLVTEKVA  INYGDHGSTFAG PLVCNAA+ V++K+SNP FL+SVS KG+Y K+LL
Sbjct  323   IGAVLVTEKVAETINYGDHGSTFAGNPLVCNAAIAVVDKVSNPAFLSSVSSKGRYFKDLL  382

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              KKLGGN+HVKE+RG GLIIG+ELDV A  LV AC++SGLL+LTAGKGNVVR+VPPL+IS
Sbjct  383   VKKLGGNSHVKEVRGEGLIIGVELDVPANSLVNACRDSGLLILTAGKGNVVRIVPPLVIS  442

Query  1489  KQELEQAADVLAACLPVLD  1545
             ++E+E+A ++++  L  LD
Sbjct  443   EEEIERAVEIMSQNLYALD  461



>gb|EPS60675.1| hypothetical protein M569_14125, partial [Genlisea aurea]
Length=417

 Score =   466 bits (1198),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 242/319 (76%), Positives = 278/319 (87%), Gaps = 2/319 (1%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             VELAKRLV  SFADRVFF NSGTEANEAAIKF+RKFQR   P  + PPVEFIAFSNCFHG
Sbjct  101   VELAKRLVSTSFADRVFFCNSGTEANEAAIKFSRKFQRVKKP--QDPPVEFIAFSNCFHG  158

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMGA+ALTSKEHYRSPFEPVMPGV FLEYG+ ++A  LI+SGKIAAVFVEPIQGEGGIY
Sbjct  159   RTMGALALTSKEHYRSPFEPVMPGVHFLEYGDSESAVGLIRSGKIAAVFVEPIQGEGGIY  218

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
              A  +FL+ALR +CD+AG +LVFDEVQCGLGRTGYLWAHEAYG++PD+MTLAKPLAGGLP
Sbjct  219   GAPPQFLEALRVACDDAGCVLVFDEVQCGLGRTGYLWAHEAYGIFPDVMTLAKPLAGGLP  278

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGAVLVTE +A+AI+ GDHGSTFAG PLVC A + VL+KIS+  FLA VS+KG Y K LL
Sbjct  279   IGAVLVTESIASAIDRGDHGSTFAGNPLVCKAGIAVLDKISDRSFLAGVSEKGGYFKRLL  338

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              +KL  N HVK +RG GLI+G+ELDV+ + LVEAC+ SGLLVLTAGKGNV+R+VPPLIIS
Sbjct  339   EEKLSENPHVKGVRGFGLIVGVELDVSGSALVEACRESGLLVLTAGKGNVIRMVPPLIIS  398

Query  1489  KQELEQAADVLAACLPVLD  1545
             K+ELE+AAD+L +CLP L+
Sbjct  399   KEELERAADILVSCLPALE  417



>ref|XP_002887819.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64078.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=458

 Score =   466 bits (1199),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 241/319 (76%), Positives = 286/319 (90%), Gaps = 0/319 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             +ELAKRLV  SFADRVFF NSGTEANEAAIKF+RKFQRF+HPD ++    FIAF+N FHG
Sbjct  140   IELAKRLVASSFADRVFFCNSGTEANEAAIKFSRKFQRFTHPDDKEVATGFIAFTNSFHG  199

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RT+GA+ALTSKE YR+PFEP+MPGVTFLEYGNIQAAT+LI+S KIAAVFVEPIQGEGGIY
Sbjct  200   RTLGALALTSKEQYRTPFEPIMPGVTFLEYGNIQAATDLIRSSKIAAVFVEPIQGEGGIY  259

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATKEFLQ+LR++CD AGSLLVFDEVQCGLGRTG +WA+EA+GV PDIMT+AKPLAGGLP
Sbjct  260   SATKEFLQSLRSACDAAGSLLVFDEVQCGLGRTGLMWAYEAFGVTPDIMTVAKPLAGGLP  319

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGAVL+TEKVA  I YGDHGSTFAG PLVC+AA+ V++K+S P FL+SVS+KGQY ++LL
Sbjct  320   IGAVLLTEKVAETIKYGDHGSTFAGNPLVCSAAIAVIDKVSKPSFLSSVSNKGQYFRDLL  379

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              KKLGGN+HVKE+RG GLIIG+ELDV A  LV+AC++SGLL+LTAGKGNVVR+VPPL+IS
Sbjct  380   VKKLGGNSHVKEVRGEGLIIGVELDVPANSLVDACRDSGLLILTAGKGNVVRIVPPLVIS  439

Query  1489  KQELEQAADVLAACLPVLD  1545
             ++E+E+A +++   L  LD
Sbjct  440   EEEIERAVEIMFQNLTALD  458



>emb|CDY39963.1| BnaC06g40410D [Brassica napus]
Length=451

 Score =   465 bits (1197),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 243/318 (76%), Positives = 283/318 (89%), Gaps = 0/318 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             +ELAKRLV  SFADRVFF NSGTEANEAAIKF+RKFQRF+HP  +     FIAF+N FHG
Sbjct  133   IELAKRLVASSFADRVFFCNSGTEANEAAIKFSRKFQRFTHPQDKDVATGFIAFTNSFHG  192

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RT+GA+ALTSKE YR+PFEP+MPGVTFLEYGN+QAAT+LI SGKIAAVFVEPIQGEGG+Y
Sbjct  193   RTLGALALTSKEQYRTPFEPIMPGVTFLEYGNVQAATDLISSGKIAAVFVEPIQGEGGVY  252

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATKEFLQ+LR++CD +GSLLVFDEVQCGLGRTG LWA+EA+GV PDIMT+AKPLAGGLP
Sbjct  253   SATKEFLQSLRSACDASGSLLVFDEVQCGLGRTGNLWAYEAFGVTPDIMTVAKPLAGGLP  312

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGAVLVTEKVA  I YGDHGSTFAG PLVC+AA+ V++K+S P FLASVS KG Y KELL
Sbjct  313   IGAVLVTEKVAETIKYGDHGSTFAGNPLVCSAAIAVVDKVSKPSFLASVSGKGLYFKELL  372

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              KKLGGN+HVKE+RG GLIIG+ELDV A+PLV+AC++SGLL+LTAGKGNVVR+VPPLIIS
Sbjct  373   VKKLGGNSHVKEVRGEGLIIGVELDVPASPLVDACRDSGLLILTAGKGNVVRIVPPLIIS  432

Query  1489  KQELEQAADVLAACLPVL  1542
             ++E+E+A +++   L  L
Sbjct  433   EEEIERAVEIMFQNLTAL  450



>emb|CDX87325.1| BnaA07g35480D [Brassica napus]
Length=451

 Score =   464 bits (1194),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 239/311 (77%), Positives = 282/311 (91%), Gaps = 0/311 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             +ELAKRLV  SFADRVFF NSGTEANEAAIKF+RKFQR++HP+ ++    FIAF+N FHG
Sbjct  133   IELAKRLVASSFADRVFFCNSGTEANEAAIKFSRKFQRYTHPEDKEVATGFIAFTNSFHG  192

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RT+GA+ALTSKE YR+PFEP+MPGVTFLEYGN+QAAT+LI SGKIAAVFVEPIQGEGG+Y
Sbjct  193   RTLGALALTSKEQYRAPFEPIMPGVTFLEYGNVQAATDLISSGKIAAVFVEPIQGEGGVY  252

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATKEFLQ+LR++CD +G+LLVFDEVQCGLGRTG LWA+EA+GV PDIMT+AKPLAGGLP
Sbjct  253   SATKEFLQSLRSACDASGALLVFDEVQCGLGRTGNLWAYEAFGVTPDIMTVAKPLAGGLP  312

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGAVLVTEKVA  I YGDHGSTFAG PLVC+AA+ V++K+S P FLASVS KG Y KELL
Sbjct  313   IGAVLVTEKVAETIKYGDHGSTFAGNPLVCSAAIAVVDKVSKPSFLASVSSKGIYFKELL  372

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              KKLGGN+HVKE+RG GLIIG+ELDV A+PLV+AC++SGLL+LTAGKGNVVR+VPPLIIS
Sbjct  373   VKKLGGNSHVKEVRGEGLIIGVELDVPASPLVDACRDSGLLILTAGKGNVVRIVPPLIIS  432

Query  1489  KQELEQAADVL  1521
             ++E+E A +++
Sbjct  433   EEEIESAVEIM  443



>ref|XP_009128405.1| PREDICTED: acetylornithine aminotransferase, chloroplastic/mitochondrial-like 
[Brassica rapa]
Length=448

 Score =   464 bits (1193),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 243/319 (76%), Positives = 282/319 (88%), Gaps = 0/319 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             +ELAKRLV  SFADRVFF NSGTEANEAAIKF+RKFQRF+HP+ ++    FIAF+N FHG
Sbjct  130   IELAKRLVASSFADRVFFCNSGTEANEAAIKFSRKFQRFTHPEDKEVATSFIAFTNSFHG  189

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RT+GA+ALTSKE YR+PFEP+MPGVTFLEYGN QAAT+LI+ GKIAAVFVEPIQGEGG+Y
Sbjct  190   RTLGALALTSKEQYRTPFEPIMPGVTFLEYGNTQAATDLIRLGKIAAVFVEPIQGEGGVY  249

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATKEFLQ+LR++CD AGSLLVFDEVQCGLGRTG LWA+EA+GV PDIMT+AKPLAGGLP
Sbjct  250   SATKEFLQSLRSACDAAGSLLVFDEVQCGLGRTGNLWAYEAFGVTPDIMTVAKPLAGGLP  309

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGAVLVTEKVA  I YGDHGSTFAG PLVC+AA+ V +K+S P FLASVS KG Y K+LL
Sbjct  310   IGAVLVTEKVAETIKYGDHGSTFAGNPLVCSAAIAVFDKVSKPSFLASVSSKGLYFKDLL  369

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              KKLGGN HVKE+RG GLIIG+ELDV A PLV+AC++SGLL+LTAGKGNVVR+VPPLIIS
Sbjct  370   VKKLGGNLHVKEVRGKGLIIGVELDVPAGPLVDACRDSGLLILTAGKGNVVRIVPPLIIS  429

Query  1489  KQELEQAADVLAACLPVLD  1545
             ++E+E+A +++   L  LD
Sbjct  430   EEEIERAVEIIFHNLTALD  448



>emb|CDY37615.1| BnaA02g19550D [Brassica napus]
Length=448

 Score =   464 bits (1193),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 243/319 (76%), Positives = 282/319 (88%), Gaps = 0/319 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             +ELAKRLV  SFADRVFF NSGTEANEAAIKF+RKFQRF+HP+ ++    FIAF+N FHG
Sbjct  130   IELAKRLVASSFADRVFFCNSGTEANEAAIKFSRKFQRFTHPEDKEVATSFIAFTNSFHG  189

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RT+GA+ALTSKE YR+PFEP+MPGVTFLEYGN QAAT+LI+ GKIAAVFVEPIQGEGG+Y
Sbjct  190   RTLGALALTSKEQYRTPFEPIMPGVTFLEYGNTQAATDLIRLGKIAAVFVEPIQGEGGVY  249

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATKEFLQ+LR++CD AGSLLVFDEVQCGLGRTG LWA+EA+GV PDIMT+AKPLAGGLP
Sbjct  250   SATKEFLQSLRSACDAAGSLLVFDEVQCGLGRTGNLWAYEAFGVTPDIMTVAKPLAGGLP  309

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGAVLVTEKVA  I YGDHGSTFAG PLVC+AA+ V +K+S P FLASVS KG Y K+LL
Sbjct  310   IGAVLVTEKVAETIKYGDHGSTFAGNPLVCSAAIAVFDKVSKPSFLASVSSKGLYFKDLL  369

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              KKLGGN HVKE+RG GLIIG+ELDV A PLV+AC++SGLL+LTAGKGNVVR+VPPLIIS
Sbjct  370   VKKLGGNLHVKEVRGKGLIIGVELDVPAGPLVDACRDSGLLILTAGKGNVVRIVPPLIIS  429

Query  1489  KQELEQAADVLAACLPVLD  1545
             ++E+E+A +++   L  LD
Sbjct  430   EEEIERAVEIIFHNLTALD  448



>ref|XP_010539525.1| PREDICTED: acetylornithine aminotransferase, chloroplastic/mitochondrial-like 
[Tarenaya hassleriana]
Length=460

 Score =   464 bits (1194),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 250/319 (78%), Positives = 288/319 (90%), Gaps = 0/319 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             +ELAKRLV CSFADRVFF NSGTEANEAAIKFARKFQRF+HPD ++    FIAF+N FHG
Sbjct  139   IELAKRLVACSFADRVFFCNSGTEANEAAIKFARKFQRFNHPDEKEVATNFIAFTNSFHG  198

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RT+GA+ALTSKE YR+PFEP+MPGVTFLEYGN+QAAT+LI SGKIAAVFVEP+QGEGGIY
Sbjct  199   RTLGALALTSKEQYRTPFEPIMPGVTFLEYGNVQAATDLISSGKIAAVFVEPVQGEGGIY  258

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             +ATKEFL++LR++CD  GSLLVFDEVQCGLGRTG LWA+E +GV PDIMTLAKPLAGGLP
Sbjct  259   TATKEFLESLRSACDAVGSLLVFDEVQCGLGRTGNLWAYELFGVTPDIMTLAKPLAGGLP  318

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGAVLVTEKVA+AI YGDHGSTFAG PLVCNAA+ VL+KIS P FL S+S KG+Y ++LL
Sbjct  319   IGAVLVTEKVASAIKYGDHGSTFAGNPLVCNAAIVVLDKISKPSFLDSISSKGRYFRDLL  378

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              KKLGGN HVKE+RG GLIIGIELDV A PLV+AC+NSGLL+LTAGKGNVVRLVPPLIIS
Sbjct  379   EKKLGGNLHVKEVRGKGLIIGIELDVPANPLVDACRNSGLLILTAGKGNVVRLVPPLIIS  438

Query  1489  KQELEQAADVLAACLPVLD  1545
             ++E+E+AA+++A  +P LD
Sbjct  439   EEEIERAAEIIAQNMPALD  457



>emb|CDY67620.1| BnaC02g46570D [Brassica napus]
Length=448

 Score =   463 bits (1192),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 243/319 (76%), Positives = 282/319 (88%), Gaps = 0/319 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             +ELAKRLV  SFADRVFF NSGTEANEAAIKF+RKFQRF+HP+ ++    FIAF+N FHG
Sbjct  130   IELAKRLVASSFADRVFFCNSGTEANEAAIKFSRKFQRFTHPEDKEVATSFIAFTNSFHG  189

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RT+GA+ALTSKE YR+PFEP+MPGVTFLEYGN QAAT+LI+SGKIAAVFVEPIQGEGG+Y
Sbjct  190   RTLGALALTSKEQYRTPFEPIMPGVTFLEYGNTQAATDLIRSGKIAAVFVEPIQGEGGVY  249

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATKEFLQ+LR++CD AGSLLVFDEVQCGLGRTG LWA+EA+GV PDIMT+AKPLAGGLP
Sbjct  250   SATKEFLQSLRSACDAAGSLLVFDEVQCGLGRTGNLWAYEAFGVTPDIMTVAKPLAGGLP  309

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGAVLVTEKVA  I YGDHGSTFAG PLVC+AA+ V +K+S   FLASVS KG Y K+LL
Sbjct  310   IGAVLVTEKVAETIKYGDHGSTFAGNPLVCSAAIAVFDKVSKSSFLASVSSKGLYFKDLL  369

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              KKLGGN HVKE+RG GLIIG+ELDV A PLV+AC++SGLL+LTAGKGNVVR+VPPLIIS
Sbjct  370   VKKLGGNLHVKEVRGEGLIIGVELDVPAGPLVDACRDSGLLILTAGKGNVVRIVPPLIIS  429

Query  1489  KQELEQAADVLAACLPVLD  1545
             ++E+E+A +++   L  LD
Sbjct  430   EEEIERAVEIIFHDLTALD  448



>ref|XP_002439221.1| hypothetical protein SORBIDRAFT_09g002480 [Sorghum bicolor]
 gb|EES17651.1| hypothetical protein SORBIDRAFT_09g002480 [Sorghum bicolor]
Length=466

 Score =   463 bits (1192),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 236/319 (74%), Positives = 276/319 (87%), Gaps = 0/319 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             VELAKRLV  SFADR FF+++GTEANEAAIKF+RKFQR +HPD + PP+EF+AFS+ FHG
Sbjct  144   VELAKRLVEVSFADRAFFASTGTEANEAAIKFSRKFQRVAHPDSDDPPMEFLAFSSSFHG  203

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMGAVALTSK  YR PF PVMPGVTF++YG+++AA + IQSG++AAVFVEP+QGEGGI+
Sbjct  204   RTMGAVALTSKSQYREPFAPVMPGVTFVDYGDLEAAKKFIQSGRVAAVFVEPVQGEGGIH  263

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SAT+EFLQ LR +CD AG+LLVFDEVQCG GRTGYLWAHEAYGV PDIMTLAKPLA G+P
Sbjct  264   SATQEFLQGLREACDEAGALLVFDEVQCGFGRTGYLWAHEAYGVEPDIMTLAKPLANGIP  323

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IG VLV EKVAAAINYGDHG+TF GGPL C  A+TV +KI  P FLA VS KG+  K+LL
Sbjct  324   IGVVLVKEKVAAAINYGDHGTTFGGGPLACQTAITVFDKIMKPGFLAEVSKKGENFKQLL  383

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
               KL GN HVKE+RG+GL++GIELDV A PLV+AC ++G++VLTAGKGNVVRLVPPLIIS
Sbjct  384   RTKLSGNPHVKEVRGVGLLVGIELDVPAGPLVDACLDAGVIVLTAGKGNVVRLVPPLIIS  443

Query  1489  KQELEQAADVLAACLPVLD  1545
             ++ELE AADV+  CLPVLD
Sbjct  444   EKELEHAADVIRDCLPVLD  462



>gb|AAU10748.1| putative acetylornithine aminotransferase [Oryza sativa Japonica 
Group]
Length=465

 Score =   463 bits (1191),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 242/322 (75%), Positives = 278/322 (86%), Gaps = 1/322 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             V LAKRLV  SFADRVFF+N+GTEANEAAIKFARKFQR + PD + P  EF++F+NCFHG
Sbjct  144   VALAKRLVEASFADRVFFANTGTEANEAAIKFARKFQRVARPDGDAP-TEFMSFTNCFHG  202

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMG++ALTSK  YR PF PVMPG TF EYGN++ A ++IQSGKIAAVFVEP+QGEGGI+
Sbjct  203   RTMGSLALTSKVQYREPFAPVMPGATFAEYGNLEEAKKVIQSGKIAAVFVEPVQGEGGIH  262

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATKEFLQ LR +CD AG+LLVFDEVQCGLGRTGYLWA+EAYGV PDIMTLAKPLAGGLP
Sbjct  263   SATKEFLQGLRDACDEAGALLVFDEVQCGLGRTGYLWAYEAYGVLPDIMTLAKPLAGGLP  322

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IG VLVTEKVA+AIN+GDHG+TF GGPLVC AA+T L+KI  P FLA V+ KG+  K+LL
Sbjct  323   IGVVLVTEKVASAINFGDHGTTFGGGPLVCQAALTTLDKIQKPGFLAEVAKKGENFKQLL  382

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
               KL GN HVKEIRG+GLI+GIELDV A PLV+AC + G++VLTAGKGNVVRLVPPLIIS
Sbjct  383   STKLSGNAHVKEIRGIGLIVGIELDVPAGPLVDACLDRGVIVLTAGKGNVVRLVPPLIIS  442

Query  1489  KQELEQAADVLAACLPVLDKST  1554
             ++ELEQAA+V+  CLP LD ST
Sbjct  443   EKELEQAAEVIRDCLPALDAST  464



>ref|XP_010905303.1| PREDICTED: acetylornithine aminotransferase, mitochondrial-like 
isoform X1 [Elaeis guineensis]
Length=470

 Score =   463 bits (1191),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 244/322 (76%), Positives = 280/322 (87%), Gaps = 0/322 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             VEL KRLV CSFADRVFF+NSGTEANEAAIKFARKFQRF H D      EFIAF++ FHG
Sbjct  147   VELGKRLVECSFADRVFFTNSGTEANEAAIKFARKFQRFVHADEPHSATEFIAFTDSFHG  206

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMGA+ALTSK+HYR PFEPVMPGVTF+EYGNI+   + I+ GK AAVFVEPIQGEGGI+
Sbjct  207   RTMGALALTSKDHYRLPFEPVMPGVTFIEYGNIEEFKKTIKPGKTAAVFVEPIQGEGGIH  266

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATK+FLQ L  +CD+AG++LVFDEVQCGLGRTG LWAHEA+ V PDIMTLAKPLAGGLP
Sbjct  267   SATKDFLQTLHLTCDDAGAILVFDEVQCGLGRTGQLWAHEAFDVIPDIMTLAKPLAGGLP  326

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGA+L TE+VAAAI++GDHGSTFAGGPLVC+AA+ VL+KI  P FLASV+ KG YLKELL
Sbjct  327   IGAILTTERVAAAISFGDHGSTFAGGPLVCHAALAVLDKIREPSFLASVTKKGLYLKELL  386

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              +KLG + HVKE+RGLGL +GIELDV A PLV+ C+N+GLLVLTAGKGNVVRLVPPLIIS
Sbjct  387   TQKLGVSPHVKEVRGLGLFVGIELDVQAFPLVDECRNAGLLVLTAGKGNVVRLVPPLIIS  446

Query  1489  KQELEQAADVLAACLPVLDKST  1554
             ++ELEQAA++L  CLP LD +T
Sbjct  447   EKELEQAAEILRECLPALDTAT  468



>ref|XP_010905305.1| PREDICTED: acetylornithine aminotransferase, mitochondrial-like 
isoform X3 [Elaeis guineensis]
Length=330

 Score =   457 bits (1177),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 240/318 (75%), Positives = 277/318 (87%), Gaps = 0/318 (0%)
 Frame = +1

Query  601   KRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHGRTMG  780
             +RLV CSFADRVFF+NSGTEANEAAIKFARKFQRF H D      EFIAF++ FHGRTMG
Sbjct  11    RRLVECSFADRVFFTNSGTEANEAAIKFARKFQRFVHADEPHSATEFIAFTDSFHGRTMG  70

Query  781   AVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYSATK  960
             A+ALTSK+HYR PFEPVMPGVTF+EYGNI+   + I+ GK AAVFVEPIQGEGGI+SATK
Sbjct  71    ALALTSKDHYRLPFEPVMPGVTFIEYGNIEEFKKTIKPGKTAAVFVEPIQGEGGIHSATK  130

Query  961   EFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLPIGAV  1140
             +FLQ L  +CD+AG++LVFDEVQCGLGRTG LWAHEA+ V PDIMTLAKPLAGGLPIGA+
Sbjct  131   DFLQTLHLTCDDAGAILVFDEVQCGLGRTGQLWAHEAFDVIPDIMTLAKPLAGGLPIGAI  190

Query  1141  LVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkellgkkl  1320
             L TE+VAAAI++GDHGSTFAGGPLVC+AA+ VL+KI  P FLASV+ KG YLKELL +KL
Sbjct  191   LTTERVAAAISFGDHGSTFAGGPLVCHAALAVLDKIREPSFLASVTKKGLYLKELLTQKL  250

Query  1321  ggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIISKQEL  1500
             G + HVKE+RGLGL +GIELDV A PLV+ C+N+GLLVLTAGKGNVVRLVPPLIIS++EL
Sbjct  251   GVSPHVKEVRGLGLFVGIELDVQAFPLVDECRNAGLLVLTAGKGNVVRLVPPLIISEKEL  310

Query  1501  EQAADVLAACLPVLDKST  1554
             EQAA++L  CLP LD +T
Sbjct  311   EQAAEILRECLPALDTAT  328



>ref|XP_009106733.1| PREDICTED: acetylornithine aminotransferase, chloroplastic/mitochondrial 
[Brassica rapa]
Length=451

 Score =   462 bits (1188),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 240/318 (75%), Positives = 284/318 (89%), Gaps = 0/318 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             +ELAKRLV  SFADRVFF NSGTEANEAAIKF+RKFQR++HP+ ++    FIAF+N FHG
Sbjct  133   IELAKRLVASSFADRVFFCNSGTEANEAAIKFSRKFQRYTHPEDKEVATGFIAFTNSFHG  192

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RT+GA+ALTSKE YR+PFEP+MPGVTFLEYGN+QAAT+LI SGKIAAVFVEPIQGEGG+Y
Sbjct  193   RTLGALALTSKEQYRAPFEPIMPGVTFLEYGNVQAATDLISSGKIAAVFVEPIQGEGGVY  252

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATKEFLQ+LR++CD +G+LLVFDEVQCGLGRTG LWA+EA+GV PDIMT+AKPLAGGLP
Sbjct  253   SATKEFLQSLRSACDASGALLVFDEVQCGLGRTGSLWAYEAFGVTPDIMTVAKPLAGGLP  312

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGAVLVTEKVA  I YGDHGSTFAG PLVC+AA+ V++K+S P FLASVS KG Y KELL
Sbjct  313   IGAVLVTEKVAETIKYGDHGSTFAGNPLVCSAAIAVVDKVSKPSFLASVSSKGIYFKELL  372

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              KKLGGN+HVKE+RG GLIIG+ELDV A+PLV+AC++SGLL+LTAGKGNVVR+VPPLII 
Sbjct  373   VKKLGGNSHVKEVRGEGLIIGVELDVPASPLVDACRDSGLLILTAGKGNVVRIVPPLIIL  432

Query  1489  KQELEQAADVLAACLPVL  1542
             ++E+E+A +++   L  L
Sbjct  433   EEEIERAVEIIFQNLTAL  450



>ref|XP_009384919.1| PREDICTED: acetylornithine aminotransferase, mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=467

 Score =   460 bits (1184),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 256/322 (80%), Positives = 287/322 (89%), Gaps = 0/322 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             V L KRLV  SFADRVFF+NSGTEANEAAIKFARKFQRFSHPD + P  EFIAF+N FHG
Sbjct  143   VTLGKRLVESSFADRVFFTNSGTEANEAAIKFARKFQRFSHPDKKLPATEFIAFTNSFHG  202

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMGA+ALTSKE YR PFEPVMPGVTF+EYGN + A + IQ GKIAAVFVEPIQGEGGIY
Sbjct  203   RTMGALALTSKEQYRLPFEPVMPGVTFIEYGNSEEAKKAIQPGKIAAVFVEPIQGEGGIY  262

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATK+FLQALRT+CD AG+LLVFDEVQCGLGRTG+LWAHEA+GV PD+MTLAKPLAGGLP
Sbjct  263   SATKDFLQALRTACDEAGALLVFDEVQCGLGRTGHLWAHEAFGVMPDMMTLAKPLAGGLP  322

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IG VL TE+VAAAI+ GDHGSTFAGGPLVC+AA+ VL KI  P FLASV+ KG YLKELL
Sbjct  323   IGVVLTTERVAAAISSGDHGSTFAGGPLVCHAALAVLNKIQEPSFLASVTRKGLYLKELL  382

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              KKL G+ HVKEIRG GLI+GIELDV A+PLV+AC+++GLLVLTAGKGNVVRLVPPL++S
Sbjct  383   LKKLEGSPHVKEIRGFGLIVGIELDVQASPLVDACRDAGLLVLTAGKGNVVRLVPPLVVS  442

Query  1489  KQELEQAADVLAACLPVLDKST  1554
             K+ELEQAA+VL+ACLP LD +T
Sbjct  443   KEELEQAAEVLSACLPSLDGNT  464



>ref|XP_010537910.1| PREDICTED: acetylornithine aminotransferase, chloroplastic/mitochondrial 
[Tarenaya hassleriana]
Length=464

 Score =   459 bits (1182),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 241/300 (80%), Positives = 274/300 (91%), Gaps = 0/300 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             +ELAKRLV CSFADRVFFSNSGTEANEAAIKFARKFQRF+HP+ ++   +FIAF+N FHG
Sbjct  143   IELAKRLVACSFADRVFFSNSGTEANEAAIKFARKFQRFTHPEEKEVATDFIAFTNSFHG  202

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RT+GA+ALTSKE YR+PFEPVMPGVTFLEYGN+QAAT+LI  GKIAAVFVEP+QGEGGI+
Sbjct  203   RTLGALALTSKEQYRTPFEPVMPGVTFLEYGNVQAATDLISLGKIAAVFVEPVQGEGGIH  262

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             +ATKEFL +LR++CD +GSLLVFDEVQCGLGRTG LWA+EA+GV PDIMTLAKPLAGGLP
Sbjct  263   TATKEFLLSLRSACDASGSLLVFDEVQCGLGRTGNLWAYEAFGVTPDIMTLAKPLAGGLP  322

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGAVLVTEKVA+ I YGDHGSTFAG PLVCNAA+ VL+KIS P FL+SVS KG+Y K+LL
Sbjct  323   IGAVLVTEKVASTIKYGDHGSTFAGNPLVCNAAMAVLDKISKPSFLSSVSSKGRYFKDLL  382

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              KK+GGN HVKE+RG+GLIIGIE DV A PLV+AC+NSGLL+LTAGKGNVVRLVPPLIIS
Sbjct  383   EKKMGGNPHVKEVRGMGLIIGIEFDVPAKPLVDACRNSGLLILTAGKGNVVRLVPPLIIS  442



>ref|XP_006654954.1| PREDICTED: acetylornithine aminotransferase, mitochondrial-like 
[Oryza brachyantha]
Length=430

 Score =   458 bits (1178),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 239/322 (74%), Positives = 276/322 (86%), Gaps = 1/322 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             V LAKRLV  SFADR FF+N+GTEANEAAIKFARK+QR + PD + P  EF++F+NCFHG
Sbjct  109   VALAKRLVEASFADRAFFANTGTEANEAAIKFARKYQRVARPDGDAP-TEFMSFTNCFHG  167

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMG++ALTSK  YR PF PVMPG TF EYGN++ A ++IQSGKIAAVFVEP+QGEGGI+
Sbjct  168   RTMGSLALTSKVQYREPFAPVMPGATFAEYGNLEEAKKVIQSGKIAAVFVEPVQGEGGIH  227

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATKEFLQ LR +CD AG+LLVFDEVQCGLGRTGYLWAHEAYGV PD+MTLAKPLAGGLP
Sbjct  228   SATKEFLQGLRDACDEAGALLVFDEVQCGLGRTGYLWAHEAYGVVPDMMTLAKPLAGGLP  287

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IG VLVTEKVA+AI YGDHG+TF GGPLVC AA+T L+KI  P FL  V+ KG+  K+LL
Sbjct  288   IGVVLVTEKVASAIKYGDHGTTFGGGPLVCQAALTTLDKIQKPGFLEGVAKKGENFKQLL  347

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
               KL GN+HVKEIRG GLI+GIELDV A PLV+AC ++G++VLTAGKGNVVRLVPPLIIS
Sbjct  348   STKLSGNSHVKEIRGFGLIVGIELDVLAGPLVDACLDAGVIVLTAGKGNVVRLVPPLIIS  407

Query  1489  KQELEQAADVLAACLPVLDKST  1554
             ++ELEQAA+V+  CLP LD ST
Sbjct  408   EKELEQAAEVIRDCLPALDAST  429



>gb|EMT24167.1| Acetylornithine aminotransferase, mitochondrial [Aegilops tauschii]
Length=339

 Score =   454 bits (1168),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 238/322 (74%), Positives = 276/322 (86%), Gaps = 1/322 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             VELAKRLV  SFADR FF+NSGTEANEAAIKFARK+QR +HP+ + P  EF++F+NCFHG
Sbjct  18    VELAKRLVEASFADRAFFANSGTEANEAAIKFARKYQRVAHPNGDAP-TEFMSFTNCFHG  76

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RT+G++ALTSK  YR PFEPVMPG TF+EYGN++ A ++IQSGKIAAVFVEP+QGEGGI+
Sbjct  77    RTIGSLALTSKVQYREPFEPVMPGSTFVEYGNLEEAKKVIQSGKIAAVFVEPVQGEGGIH  136

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATKEFLQ LR +CD AG+LLVFDEVQCGLGRTGYLWAHE YGV PDIMTLAKPLA GLP
Sbjct  137   SATKEFLQGLRDACDEAGALLVFDEVQCGLGRTGYLWAHEVYGVVPDIMTLAKPLANGLP  196

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IG  LVTEKVAAAINYGDHG+TF GGP VC+AA+  L+KI  P FLA V+ KG+Y K+LL
Sbjct  197   IGVALVTEKVAAAINYGDHGTTFGGGPFVCHAALATLDKIQKPGFLAEVTKKGEYFKQLL  256

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
               KL GN HVKEIRG GLI+GIELDV A PLV+AC N+G+ +LTAGKGNVVRLVP LI+S
Sbjct  257   KTKLSGNPHVKEIRGAGLIVGIELDVPAGPLVDACLNAGVFLLTAGKGNVVRLVPALIVS  316

Query  1489  KQELEQAADVLAACLPVLDKST  1554
             ++ELEQAA+V+  CLP L+ ST
Sbjct  317   EKELEQAAEVIRECLPALEAST  338



>dbj|BAJ87243.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=457

 Score =   456 bits (1172),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 239/322 (74%), Positives = 276/322 (86%), Gaps = 1/322 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             VELAKRLV  SFADR FF+NSGTEANEAAIKFARK+QR +HPD +  P EF++F+NCFHG
Sbjct  136   VELAKRLVEASFADRAFFANSGTEANEAAIKFARKYQRVAHPDGD-APTEFMSFTNCFHG  194

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RT+G++ALTSK  YR PFEPVMPG TF EYGN++ A ++IQSGKIAAVFVEP+QGEGGI+
Sbjct  195   RTIGSLALTSKVQYREPFEPVMPGSTFAEYGNLEEAKKVIQSGKIAAVFVEPVQGEGGIH  254

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATKEFLQ LR +CD AG+LLVFDEVQCGLGRTGYLWAHE YGV PDIMTLAKPLA GLP
Sbjct  255   SATKEFLQGLRDACDEAGTLLVFDEVQCGLGRTGYLWAHEVYGVVPDIMTLAKPLANGLP  314

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IG  LVTEKVAAAINYGDHG+TF GGP VC+AA+  L+KI  P FLA V+ KG+Y K+LL
Sbjct  315   IGVALVTEKVAAAINYGDHGTTFGGGPFVCHAALATLDKIQKPGFLAEVTKKGEYFKQLL  374

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
               KLGGN HVKEIRG GLI+GIELDV A PLV+AC ++G+ +LTAGKGNVVRLVP LI+S
Sbjct  375   KTKLGGNPHVKEIRGAGLIVGIELDVPAGPLVDACLDAGVFLLTAGKGNVVRLVPALIVS  434

Query  1489  KQELEQAADVLAACLPVLDKST  1554
             ++ELEQAA+V+  CLP L+ ST
Sbjct  435   EKELEQAAEVIRECLPALEAST  456



>dbj|BAJ97123.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=457

 Score =   456 bits (1172),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 239/322 (74%), Positives = 276/322 (86%), Gaps = 1/322 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             VELAKRLV  SFADR FF+NSGTEANEAAIKFARK+QR +HPD +  P EF++F+NCFHG
Sbjct  136   VELAKRLVEASFADRAFFANSGTEANEAAIKFARKYQRVAHPDGD-APTEFMSFTNCFHG  194

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RT+G++ALTSK  YR PFEPVMPG TF EYGN++ A ++IQSGKIAAVFVEP+QGEGGI+
Sbjct  195   RTIGSLALTSKVQYREPFEPVMPGSTFAEYGNLEEAKKVIQSGKIAAVFVEPVQGEGGIH  254

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATKEFLQ LR +CD AG+LLVFDEVQCGLGRTGYLWAHE YGV PDIMTLAKPLA GLP
Sbjct  255   SATKEFLQGLRDACDEAGTLLVFDEVQCGLGRTGYLWAHEVYGVVPDIMTLAKPLANGLP  314

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IG  LVTEKVAAAINYGDHG+TF GGP VC+AA+  L+KI  P FLA V+ KG+Y K+LL
Sbjct  315   IGVALVTEKVAAAINYGDHGTTFGGGPFVCHAALATLDKIQKPGFLAEVTKKGEYFKQLL  374

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
               KLGGN HVKEIRG GLI+GIELDV A PLV+AC ++G+ +LTAGKGNVVRLVP LI+S
Sbjct  375   KTKLGGNPHVKEIRGAGLIVGIELDVPAGPLVDACLDAGVFLLTAGKGNVVRLVPALIVS  434

Query  1489  KQELEQAADVLAACLPVLDKST  1554
             ++ELEQAA+V+  CLP L+ ST
Sbjct  435   EKELEQAAEVIRECLPALEAST  456



>gb|EMS55137.1| Acetylornithine aminotransferase, mitochondrial [Triticum urartu]
Length=370

 Score =   451 bits (1161),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 238/322 (74%), Positives = 277/322 (86%), Gaps = 1/322 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             VELAKRL G SFADR FF+NSGTEANEAAIKFARK+QR +HP+ + P  EF++F+NCFHG
Sbjct  49    VELAKRLPGGSFADRAFFANSGTEANEAAIKFARKYQRVAHPNGDAP-TEFMSFTNCFHG  107

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RT+G++ALTSK  YR PFEPVMPG TF+EYGN+Q A ++IQSGKIAAVFVEP+QGEGGI+
Sbjct  108   RTIGSLALTSKVQYREPFEPVMPGSTFVEYGNLQEAKKVIQSGKIAAVFVEPVQGEGGIH  167

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATKEFLQ LR +CD AG+LLVFDEVQCGLGRTGYLWAHE YGV PDIMTLAKPLA GLP
Sbjct  168   SATKEFLQGLRDACDEAGALLVFDEVQCGLGRTGYLWAHEVYGVLPDIMTLAKPLANGLP  227

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IG  LVTEKVAAAI+YGDHG+TF GGP VC+AA+  L+KI  P FLA V+ KG+Y K+LL
Sbjct  228   IGVALVTEKVAAAIHYGDHGTTFGGGPFVCHAALATLDKIQKPGFLAEVTKKGEYFKQLL  287

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
               KLGGN HVKEIRG GLI+GIELDV A PLV+AC ++G+ +LTAGKGNVVRLVP LI+S
Sbjct  288   KTKLGGNPHVKEIRGAGLIVGIELDVPAGPLVDACLDAGVFLLTAGKGNVVRLVPALIVS  347

Query  1489  KQELEQAADVLAACLPVLDKST  1554
             ++ELEQAA+V+  CLP L+ ST
Sbjct  348   EKELEQAAEVIRECLPALEAST  369



>ref|XP_008648559.1| PREDICTED: acetylornithine aminotransferase, mitochondrial [Zea 
mays]
 gb|AFW74702.1| putative acetylornithine/succinylornithine aminotransferase family 
protein [Zea mays]
Length=455

 Score =   452 bits (1163),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 227/319 (71%), Positives = 274/319 (86%), Gaps = 0/319 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             VELAKRLV  SFADR FF+++GTEANEAAIKF+RKFQR +HP+   PP EF+AFS+ FHG
Sbjct  132   VELAKRLVEVSFADRAFFASTGTEANEAAIKFSRKFQRAAHPESGDPPTEFLAFSSSFHG  191

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMGAVALTSK  YR PF PVMPGVTF++YG+++AA + ++SG++AAVFVEP+QGEGGI+
Sbjct  192   RTMGAVALTSKSQYREPFAPVMPGVTFVDYGDLEAAKKFVRSGRVAAVFVEPVQGEGGIH  251

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SAT+EFLQ LR +CD AG+LLVFDEVQCG GRTG+LWAHEAYGV PDIMTLAKPLA G+P
Sbjct  252   SATREFLQGLRDACDEAGALLVFDEVQCGFGRTGHLWAHEAYGVEPDIMTLAKPLANGIP  311

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IG VLV EK+AAAINYGDHG+TF GGPL C  A+TV +KI+ P FLA VS KG+  K+LL
Sbjct  312   IGVVLVKEKIAAAINYGDHGTTFGGGPLACQTAITVFDKITRPGFLAEVSRKGESFKQLL  371

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
               KL GN HV+E+RG+GL++G+ELDV A PLV+AC ++G++VLTAGKGNVVRLVPPLI+S
Sbjct  372   RAKLSGNPHVREVRGVGLLVGVELDVPAGPLVDACLDAGVVVLTAGKGNVVRLVPPLIVS  431

Query  1489  KQELEQAADVLAACLPVLD  1545
             ++ELE AADV+  CLP LD
Sbjct  432   EKELEHAADVIRDCLPALD  450



>gb|AFW74701.1| putative acetylornithine/succinylornithine aminotransferase family 
protein [Zea mays]
Length=495

 Score =   454 bits (1167),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 230/349 (66%), Positives = 283/349 (81%), Gaps = 6/349 (2%)
 Frame = +1

Query  499   MMGSYVTGEIFLIVYCCKQTRKYFVHDFM*VELAKRLVGCSFADRVFFSNSGTEANEAAI  678
             M  ++ +G    + + C+            VELAKRLV  SFADR FF+++GTEANEAAI
Sbjct  148   MCSTHCSGRPIFLCFICRSA------SLSQVELAKRLVEVSFADRAFFASTGTEANEAAI  201

Query  679   KFARKFQRFSHPDMEQPPVEFIAFSNCFHGRTMGAVALTSKEHYRSPFEPVMPGVTFLEY  858
             KF+RKFQR +HP+   PP EF+AFS+ FHGRTMGAVALTSK  YR PF PVMPGVTF++Y
Sbjct  202   KFSRKFQRAAHPESGDPPTEFLAFSSSFHGRTMGAVALTSKSQYREPFAPVMPGVTFVDY  261

Query  859   GNIQAATELIQSGKIAAVFVEPIQGEGGIYSATKEFLQALRTSCDNAGSLLVFDEVQCGL  1038
             G+++AA + ++SG++AAVFVEP+QGEGGI+SAT+EFLQ LR +CD AG+LLVFDEVQCG 
Sbjct  262   GDLEAAKKFVRSGRVAAVFVEPVQGEGGIHSATREFLQGLRDACDEAGALLVFDEVQCGF  321

Query  1039  GRTGYLWAHEAYGVYPDIMTLAKPLAGGLPIGAVLVTEKVAAAINYGDHGSTFAGGPLVC  1218
             GRTG+LWAHEAYGV PDIMTLAKPLA G+PIG VLV EK+AAAINYGDHG+TF GGPL C
Sbjct  322   GRTGHLWAHEAYGVEPDIMTLAKPLANGIPIGVVLVKEKIAAAINYGDHGTTFGGGPLAC  381

Query  1219  NAAVTVLEKISNPEFLASVSDkgqylkellgkklggNNHVKEIRglgliigielDVAATP  1398
               A+TV +KI+ P FLA VS KG+  K+LL  KL GN HV+E+RG+GL++G+ELDV A P
Sbjct  382   QTAITVFDKITRPGFLAEVSRKGESFKQLLRAKLSGNPHVREVRGVGLLVGVELDVPAGP  441

Query  1399  LVEACQNSGLLVLTAGKGNVVRLVPPLIISKQELEQAADVLAACLPVLD  1545
             LV+AC ++G++VLTAGKGNVVRLVPPLI+S++ELE AADV+  CLP LD
Sbjct  442   LVDACLDAGVVVLTAGKGNVVRLVPPLIVSEKELEHAADVIRDCLPALD  490



>ref|XP_006853412.1| hypothetical protein AMTR_s00032p00157410 [Amborella trichopoda]
 gb|ERN14879.1| hypothetical protein AMTR_s00032p00157410 [Amborella trichopoda]
Length=529

 Score =   453 bits (1165),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 231/322 (72%), Positives = 275/322 (85%), Gaps = 0/322 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             V L KRLV   FADR+FFSNSGTEANEAAIKFARKFQR   P+ + PP EFI+++N FHG
Sbjct  207   VMLGKRLVDSCFADRIFFSNSGTEANEAAIKFARKFQRDIRPNDKNPPTEFISYTNSFHG  266

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMG++ALTSKEHYRSP+EPVMPGVTFLEYG+I+A+ + I+SGKIAAVFVEP+QGEGGIY
Sbjct  267   RTMGSLALTSKEHYRSPYEPVMPGVTFLEYGDIEASVKAIRSGKIAAVFVEPVQGEGGIY  326

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SA  EFL+ALR++C++AG+LLVFDEVQCGLGRTG LWAHEAYGV PD+MTLAKPLAGGLP
Sbjct  327   SAATEFLEALRSACNDAGALLVFDEVQCGLGRTGRLWAHEAYGVKPDMMTLAKPLAGGLP  386

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGA LVTE+VA+ +N  DHGSTFAGGPLVC++A+TVL+KI +P FL SV+ KG Y + LL
Sbjct  387   IGATLVTEQVASVMNPADHGSTFAGGPLVCHSALTVLDKIQSPGFLDSVAKKGLYTEGLL  446

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              KKLG N H+KEIR  GL+IG+ELDV A PLV+ C++ GLLVLTAGKGN+VRL PPL+IS
Sbjct  447   RKKLGSNPHLKEIRFAGLLIGVELDVKAQPLVDKCRDEGLLVLTAGKGNIVRLAPPLVIS  506

Query  1489  KQELEQAADVLAACLPVLDKST  1554
             ++ELEQ  ++L  C P LD  T
Sbjct  507   ERELEQGVEILCKCFPALDGET  528



>ref|XP_003569060.1| PREDICTED: acetylornithine aminotransferase, mitochondrial [Brachypodium 
distachyon]
Length=459

 Score =   449 bits (1154),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 234/317 (74%), Positives = 271/317 (85%), Gaps = 1/317 (0%)
 Frame = +1

Query  595   LAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHGRT  774
             LAKRLV  SFADR F +N+GTEANEAAIKFARK+QR +HP     P EF++FSNCFHGRT
Sbjct  140   LAKRLVESSFADRAFLANTGTEANEAAIKFARKYQRVAHPG-GGAPTEFMSFSNCFHGRT  198

Query  775   MGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYSA  954
             MG++ALTSK+ YR PFEPVMPG  F EYGN++ A ++I+SGKIAAVFVEP+QGEGGI+SA
Sbjct  199   MGSLALTSKQQYREPFEPVMPGAAFAEYGNLEEAKKVIRSGKIAAVFVEPVQGEGGIHSA  258

Query  955   TKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLPIG  1134
             TKEFLQ LR +CD AG+LLVFDEVQCGLGRTG LWA+E +GV PD+MTLAKPLAGGLPIG
Sbjct  259   TKEFLQGLRAACDEAGTLLVFDEVQCGLGRTGSLWAYENFGVVPDMMTLAKPLAGGLPIG  318

Query  1135  AVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkellgk  1314
             AVL+TEKVAAAINYGDHG+TF GGP VC AA+ VL+KI+ P FLA V+ KG+  K+LL  
Sbjct  319   AVLLTEKVAAAINYGDHGTTFGGGPFVCAAALVVLDKINKPSFLAEVTKKGENFKQLLRT  378

Query  1315  klggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIISKQ  1494
             KL GN HVKEIRG GLI+GIELDV A PLVEAC ++G+ +LTAGKGNVVRLVPPLIIS++
Sbjct  379   KLSGNPHVKEIRGFGLIVGIELDVPAGPLVEACLDAGVFLLTAGKGNVVRLVPPLIISEK  438

Query  1495  ELEQAADVLAACLPVLD  1545
             ELEQAADV+  CLP LD
Sbjct  439   ELEQAADVIRECLPALD  455



>ref|XP_006422230.1| hypothetical protein CICLE_v10005019mg [Citrus clementina]
 gb|ESR35470.1| hypothetical protein CICLE_v10005019mg [Citrus clementina]
Length=427

 Score =   437 bits (1123),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 224/322 (70%), Positives = 252/322 (78%), Gaps = 38/322 (12%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             +ELAKRLV CSFADRVFFSN+GTEANEAAIKFARKFQR S+PD ++P  EF++F+N FHG
Sbjct  143   IELAKRLVACSFADRVFFSNTGTEANEAAIKFARKFQRHSNPDSKEPATEFVSFTNSFHG  202

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMGA+ALTSKEHYRSPFEPVMPGV F+EYGNI+A  +LIQ GK AAVFVEPIQGEGGIY
Sbjct  203   RTMGALALTSKEHYRSPFEPVMPGVNFVEYGNIEATRKLIQPGKTAAVFVEPIQGEGGIY  262

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATKEFLQ LR +CD+AG+LLVFDEVQCGLGRTGYLWAHE YG++PDIMTLAKPLAGGLP
Sbjct  263   SATKEFLQFLRDACDDAGALLVFDEVQCGLGRTGYLWAHEHYGIFPDIMTLAKPLAGGLP  322

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGA LVTEKVA+AINYGDHGSTFAG PLVCNAA+ VL+KISNP FLASVS KG Y KE L
Sbjct  323   IGAALVTEKVASAINYGDHGSTFAGSPLVCNAAIAVLDKISNPAFLASVSKKGHYFKETL  382

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              +KL  N HVK+                                      V LVPPLIIS
Sbjct  383   KQKLARNPHVKD--------------------------------------VPLVPPLIIS  404

Query  1489  KQELEQAADVLAACLPVLDKST  1554
             +QEL+QA ++L   LPVLD ++
Sbjct  405   EQELDQAVEILCKTLPVLDSNS  426



>ref|XP_008391155.1| PREDICTED: acetylornithine aminotransferase, mitochondrial-like 
[Malus domestica]
Length=360

 Score =   430 bits (1106),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 238/321 (74%), Positives = 263/321 (82%), Gaps = 33/321 (10%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             VELAK LV C FADRVFFSNSGTEANEAAIKFARKFQR+S PD ++P  EFI+F+N FHG
Sbjct  72    VELAKPLVACLFADRVFFSNSGTEANEAAIKFARKFQRYSFPDKKEPATEFISFTNSFHG  131

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNI AA +LIQSGKIAAVFVEPIQGEGG++
Sbjct  132   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIDAAGKLIQSGKIAAVFVEPIQGEGGVH  191

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATKEFLQ+LR +CD++GSLLVFDEVQCGLGRTGYLWAHEAYGV PDIMTLAKPLAGGLP
Sbjct  192   SATKEFLQSLRGACDDSGSLLVFDEVQCGLGRTGYLWAHEAYGVVPDIMTLAKPLAGGLP  251

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGA LVTEK                                 PEFL SVS+KGQY KELL
Sbjct  252   IGAALVTEK---------------------------------PEFLLSVSNKGQYFKELL  278

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              +KLG N HVKE+RG GLI+G+ELD++A+ LV+AC+NSGLL++TAGKGNV+RLVPPLIIS
Sbjct  279   TRKLGANPHVKEVRGFGLIVGVELDISASTLVDACRNSGLLIITAGKGNVLRLVPPLIIS  338

Query  1489  KQELEQAADVLAACLPVLDKS  1551
             K ELE AADVL  CLPVLD S
Sbjct  339   KPELEHAADVLLVCLPVLDAS  359



>ref|NP_001059578.1| Os07g0461900 [Oryza sativa Japonica Group]
 dbj|BAF21492.1| Os07g0461900, partial [Oryza sativa Japonica Group]
Length=328

 Score =   416 bits (1068),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 220/292 (75%), Positives = 252/292 (86%), Gaps = 1/292 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             V LAKRLV  SFADRVFF+N+GTEANEAAIKFARK+QR + PD + P  EF++F+NCFHG
Sbjct  35    VALAKRLVEASFADRVFFANTGTEANEAAIKFARKYQRVARPDGDAP-TEFMSFTNCFHG  93

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMG++ALTSK  YR PF PVMPG TF EYGN++ A ++IQSGKIAAVFVEP+QGEGGI+
Sbjct  94    RTMGSLALTSKVQYREPFAPVMPGATFAEYGNLEEAKKVIQSGKIAAVFVEPMQGEGGIH  153

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATKEFLQ LR +CD AG+LLVFDEVQCGLGRTGYLWA+EAYGV PDIMTLAKPLAGGLP
Sbjct  154   SATKEFLQGLRDACDEAGALLVFDEVQCGLGRTGYLWAYEAYGVVPDIMTLAKPLAGGLP  213

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IG VLVTEKVA+AINYGDHG+TF GGPLVC AA+T L+KI  P FLA V+ KG+  K+LL
Sbjct  214   IGVVLVTEKVASAINYGDHGTTFGGGPLVCQAALTTLDKIQKPGFLAEVAKKGENFKQLL  273

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVR  1464
               KL GN HVKEIRG+GLI+GIELDV A PLV+AC + G++VLTAGKGNVVR
Sbjct  274   STKLSGNAHVKEIRGIGLIVGIELDVPAGPLVDACLDRGVIVLTAGKGNVVR  325



>ref|XP_006422229.1| hypothetical protein CICLE_v10005019mg [Citrus clementina]
 gb|ESR35469.1| hypothetical protein CICLE_v10005019mg [Citrus clementina]
Length=404

 Score =   416 bits (1070),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 204/253 (81%), Positives = 227/253 (90%), Gaps = 0/253 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             +ELAKRLV CSFADRVFFSN+GTEANEAAIKFARKFQR S+PD ++P  EF++F+N FHG
Sbjct  143   IELAKRLVACSFADRVFFSNTGTEANEAAIKFARKFQRHSNPDSKEPATEFVSFTNSFHG  202

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMGA+ALTSKEHYRSPFEPVMPGV F+EYGNI+A  +LIQ GK AAVFVEPIQGEGGIY
Sbjct  203   RTMGALALTSKEHYRSPFEPVMPGVNFVEYGNIEATRKLIQPGKTAAVFVEPIQGEGGIY  262

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATKEFLQ LR +CD+AG+LLVFDEVQCGLGRTGYLWAHE YG++PDIMTLAKPLAGGLP
Sbjct  263   SATKEFLQFLRDACDDAGALLVFDEVQCGLGRTGYLWAHEHYGIFPDIMTLAKPLAGGLP  322

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGA LVTEKVA+AINYGDHGSTFAG PLVCNAA+ VL+KISNP FLASVS KG Y KE L
Sbjct  323   IGAALVTEKVASAINYGDHGSTFAGSPLVCNAAIAVLDKISNPAFLASVSKKGHYFKETL  382

Query  1309  gkklggNNHVKEI  1347
              +KL  N HVK++
Sbjct  383   KQKLARNPHVKDV  395



>ref|XP_010279487.1| PREDICTED: acetylornithine aminotransferase, mitochondrial-like 
[Nelumbo nucifera]
Length=396

 Score =   415 bits (1066),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 237/328 (72%), Positives = 265/328 (81%), Gaps = 36/328 (11%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPV-------EFIA  747
             VELAK L  CSFADR+FFSNSGTEANEAAIKF RKFQRFSHPD+++PPV       E+I+
Sbjct  98    VELAKCL-ECSFADRIFFSNSGTEANEAAIKFGRKFQRFSHPDVKEPPVMPGVTFLEYIS  156

Query  748   FSNCFHGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPI  927
             FSN FHGRTMGA+ALTSKEHY SPFEPVMPGVTFLEYGNIQ A ++IQ GK AAVFVEPI
Sbjct  157   FSNSFHGRTMGALALTSKEHYGSPFEPVMPGVTFLEYGNIQTAKQVIQRGKTAAVFVEPI  216

Query  928   QGEGGIYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAK  1107
             QGEGGIYS+T EFLQ+LR +CD+AG+LLVFDE                            
Sbjct  217   QGEGGIYSSTTEFLQSLRNACDDAGALLVFDE----------------------------  248

Query  1108  PLAGGLPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkg  1287
             PLAGGLPIGAVLVTE+VAAAIN GDHGSTFAGGPLVC AA+TVL+KI NP FL+SVS KG
Sbjct  249   PLAGGLPIGAVLVTERVAAAINSGDHGSTFAGGPLVCKAALTVLDKIRNPSFLSSVSKKG  308

Query  1288  qylkellgkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRL  1467
             QY KELL +KLG N HVKE+RGLGLIIGIELD+ A PLV+ C+NSGLLVLTAGKGNVVRL
Sbjct  309   QYFKELLAQKLGRNPHVKEVRGLGLIIGIELDLPALPLVDECRNSGLLVLTAGKGNVVRL  368

Query  1468  VPPLIISKQELEQAADVLAACLPVLDKS  1551
             VPPL+IS+QELE AA++L  CLPVLD +
Sbjct  369   VPPLVISEQELEHAAEILLKCLPVLDSN  396



>gb|KCW71212.1| hypothetical protein EUGRSUZ_F043031, partial [Eucalyptus grandis]
Length=277

 Score =   405 bits (1041),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 217/290 (75%), Positives = 253/290 (87%), Gaps = 14/290 (5%)
 Frame = +1

Query  619   SFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHGRTMGAVALTS  798
             SFADR+FF+NSGTEANEAAIKFARKFQR +HPD ++P  EFI+F+N FHGRTMGA+ALTS
Sbjct  1     SFADRLFFTNSGTEANEAAIKFARKFQRHTHPDEKEPATEFISFTNSFHGRTMGALALTS  60

Query  799   KEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYSATKEFLQAL  978
             KE+YR+PF+PVMPGVTF+EYGNI+A  E I+ GK AAVFVEPIQGEG IYSAT+EFLQ L
Sbjct  61    KENYRTPFQPVMPGVTFVEYGNIEATKEKIERGKTAAVFVEPIQGEGSIYSATREFLQYL  120

Query  979   RTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLPIGAVLVTEKV  1158
             R++CD+AG+LLVFDE              EAYGVYPDIMTLAKPLAGGLPIGA+LVTE+V
Sbjct  121   RSACDDAGALLVFDE--------------EAYGVYPDIMTLAKPLAGGLPIGAILVTEEV  166

Query  1159  AAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkellgkklggNNHV  1338
             A+A+ YGDHGSTFAG PLVC AA  VL+KIS P+FLASV  KG+Y K+ L +KLGGN+HV
Sbjct  167   ASAVKYGDHGSTFAGSPLVCKAAQAVLDKISKPDFLASVRKKGEYFKQKLVQKLGGNSHV  226

Query  1339  KEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
             KE+RGLGLIIGIELDV+A+PLV+AC+NSGLL+LTAGKGNVVRLVPPLII+
Sbjct  227   KEVRGLGLIIGIELDVSASPLVDACRNSGLLILTAGKGNVVRLVPPLIIT  276



>ref|XP_002972235.1| hypothetical protein SELMODRAFT_97066 [Selaginella moellendorffii]
 gb|EFJ26321.1| hypothetical protein SELMODRAFT_97066 [Selaginella moellendorffii]
Length=481

 Score =   405 bits (1040),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 215/335 (64%), Positives = 265/335 (79%), Gaps = 11/335 (3%)
 Frame = +1

Query  574   HDFM*VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRF----------SHPDME  723
             H    V LA+RLV  SFADRVFFSNSGTEANEAAIKFARK+QR           S P +E
Sbjct  147   HSLPQVRLAERLVQSSFADRVFFSNSGTEANEAAIKFARKYQRVKAKEKSDKQASSPLVE  206

Query  724   QP-PVEFIAFSNCFHGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGK  900
              P P +F+AFSN FHGRT+GA+ALTSKE YR+PFEP+MPGV F+E+GN++AA +++Q  +
Sbjct  207   DPIPTDFVAFSNSFHGRTLGALALTSKEKYRAPFEPIMPGVKFVEFGNLEAAKKIVQQQR  266

Query  901   IAAVFVEPIQGEGGIYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGV  1080
              AAVFVEP+QGEGG+Y A   FL+ LR  C + G+LLVFDEVQCGLGRTG LWAHEAYG+
Sbjct  267   TAAVFVEPVQGEGGVYPAIGHFLEGLRALCSSTGTLLVFDEVQCGLGRTGKLWAHEAYGI  326

Query  1081  YPDIMTLAKPLAGGLPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPE  1260
              PDIMTLAKPLAGGLPIGAVLVT+ VA AI  GDHGSTFAG PLVC+AA+ VL+++  P 
Sbjct  327   EPDIMTLAKPLAGGLPIGAVLVTQAVADAIVPGDHGSTFAGSPLVCSAALAVLDRLQEPG  386

Query  1261  FLASVSDkgqylkellgkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLT  1440
             FL SV++KG +L++LL + L    HVKE+RG GL++GI+LDV+A PLV A ++ GL+VLT
Sbjct  387   FLDSVANKGNHLRDLLKRMLAPFPHVKEVRGAGLLVGIQLDVSAAPLVAAARSKGLIVLT  446

Query  1441  AGKGNVVRLVPPLIISKQELEQAADVLAACLPVLD  1545
             AG G+VVRL PPL+IS+ ELEQ A++L +C+  LD
Sbjct  447   AGAGDVVRLAPPLVISEAELEQCAEILVSCISSLD  481



>ref|XP_002984148.1| hypothetical protein SELMODRAFT_119949 [Selaginella moellendorffii]
 gb|EFJ14658.1| hypothetical protein SELMODRAFT_119949 [Selaginella moellendorffii]
Length=481

 Score =   402 bits (1033),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 216/335 (64%), Positives = 263/335 (79%), Gaps = 11/335 (3%)
 Frame = +1

Query  574   HDFM*VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRF----------SHPDME  723
             H    V LA+RLV  SFADRVFFSNSGTEANEAAIKFARK+QR           S P +E
Sbjct  147   HSLPQVRLAERLVQSSFADRVFFSNSGTEANEAAIKFARKYQRVKAKEKSDKQASSPLVE  206

Query  724   QP-PVEFIAFSNCFHGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGK  900
              P P  F+AFSN FHGRT+GA+ALTSKE YR+PFEP+MPGV F+E+GN++AA +++Q  +
Sbjct  207   DPIPTGFVAFSNSFHGRTLGALALTSKEKYRAPFEPIMPGVKFVEFGNLEAAEKIVQQQR  266

Query  901   IAAVFVEPIQGEGGIYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGV  1080
              AAVFVEP+QGEGG+Y A   FL+ LR  C + G+LLVFDEVQCGLGRTG LWAHEAYG+
Sbjct  267   TAAVFVEPVQGEGGVYPAIGHFLEGLRALCSSTGTLLVFDEVQCGLGRTGKLWAHEAYGI  326

Query  1081  YPDIMTLAKPLAGGLPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPE  1260
              PDIMTLAKPLAGGLPIGAVLVT+ VA AI  GDHGSTFAG PLVC+AA+ VL+++  P 
Sbjct  327   EPDIMTLAKPLAGGLPIGAVLVTQAVADAIVPGDHGSTFAGSPLVCSAALAVLDRLQEPG  386

Query  1261  FLASVSDkgqylkellgkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLT  1440
             FL SV+ KG +L+ELL + L    HVKE+RG GL++GI+LDV+A PLV A ++ GL+VLT
Sbjct  387   FLDSVASKGNHLRELLTRMLAPFPHVKEVRGAGLLVGIQLDVSAAPLVAAARSKGLIVLT  446

Query  1441  AGKGNVVRLVPPLIISKQELEQAADVLAACLPVLD  1545
             AG G+VVRL PPL+IS+ ELEQ A++L +C+  LD
Sbjct  447   AGAGDVVRLAPPLVISEAELEQCAEILVSCISSLD  481



>ref|XP_010905304.1| PREDICTED: acetylornithine aminotransferase, mitochondrial-like 
isoform X2 [Elaeis guineensis]
Length=433

 Score =   394 bits (1011),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 220/322 (68%), Positives = 252/322 (78%), Gaps = 37/322 (11%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             VEL KRLV CSFADRVFF+NSGTEANEAAIKFARKFQR                      
Sbjct  147   VELGKRLVECSFADRVFFTNSGTEANEAAIKFARKFQRL---------------------  185

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
                             PFEPVMPGVTF+EYGNI+   + I+ GK AAVFVEPIQGEGGI+
Sbjct  186   ----------------PFEPVMPGVTFIEYGNIEEFKKTIKPGKTAAVFVEPIQGEGGIH  229

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATK+FLQ L  +CD+AG++LVFDEVQCGLGRTG LWAHEA+ V PDIMTLAKPLAGGLP
Sbjct  230   SATKDFLQTLHLTCDDAGAILVFDEVQCGLGRTGQLWAHEAFDVIPDIMTLAKPLAGGLP  289

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGA+L TE+VAAAI++GDHGSTFAGGPLVC+AA+ VL+KI  P FLASV+ KG YLKELL
Sbjct  290   IGAILTTERVAAAISFGDHGSTFAGGPLVCHAALAVLDKIREPSFLASVTKKGLYLKELL  349

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              +KLG + HVKE+RGLGL +GIELDV A PLV+ C+N+GLLVLTAGKGNVVRLVPPLIIS
Sbjct  350   TQKLGVSPHVKEVRGLGLFVGIELDVQAFPLVDECRNAGLLVLTAGKGNVVRLVPPLIIS  409

Query  1489  KQELEQAADVLAACLPVLDKST  1554
             ++ELEQAA++L  CLP LD +T
Sbjct  410   EKELEQAAEILRECLPALDTAT  431



>ref|XP_002989754.1| hypothetical protein SELMODRAFT_184782 [Selaginella moellendorffii]
 gb|EFJ09231.1| hypothetical protein SELMODRAFT_184782 [Selaginella moellendorffii]
Length=481

 Score =   394 bits (1013),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 212/335 (63%), Positives = 260/335 (78%), Gaps = 11/335 (3%)
 Frame = +1

Query  574   HDFM*VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQ----PPV--  735
             H    V LA+RLV   FADRVFFSNSGTEANEAAIKFARK+QR    DM      PP+  
Sbjct  147   HSLPQVRLAERLVQSCFADRVFFSNSGTEANEAAIKFARKYQRVKAKDMSDKQASPPLVE  206

Query  736   -----EFIAFSNCFHGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGK  900
                  +F+AFSN FHGRT+GA+ALTSK+ YR+PFEP+MPGV F+E+GN++AA +++Q  +
Sbjct  207   EPIATDFVAFSNSFHGRTLGALALTSKDKYRAPFEPIMPGVKFVEFGNLEAAKKIVQQQR  266

Query  901   IAAVFVEPIQGEGGIYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGV  1080
              AAVFVEP+QGEGG+Y A   FL+ LR  C + G+LLVFDEVQCGLGRTG LWAHEAYG+
Sbjct  267   TAAVFVEPVQGEGGVYPAIGHFLEGLRALCSSTGTLLVFDEVQCGLGRTGKLWAHEAYGI  326

Query  1081  YPDIMTLAKPLAGGLPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPE  1260
              PDIMTLAKPLAGGLPIGAVLVT+ VA AI  GDHGSTFAG PLVC+AA+ VL+ +  P 
Sbjct  327   EPDIMTLAKPLAGGLPIGAVLVTQAVADAIVPGDHGSTFAGSPLVCSAALAVLDCLQEPG  386

Query  1261  FLASVSDkgqylkellgkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLT  1440
             FL SV+ KG +L+ELL ++L    HVKE+RG GL++GI+LDV A PLV A ++ GL+VLT
Sbjct  387   FLDSVAGKGNHLRELLTRRLAPFAHVKEVRGAGLLVGIQLDVPAAPLVTAARSKGLIVLT  446

Query  1441  AGKGNVVRLVPPLIISKQELEQAADVLAACLPVLD  1545
             AG G+VVRL PPL+IS+ ELEQ  ++L +C+  LD
Sbjct  447   AGAGDVVRLAPPLVISEAELEQCVEILVSCISSLD  481



>ref|XP_002991743.1| hypothetical protein SELMODRAFT_186313 [Selaginella moellendorffii]
 gb|EFJ07147.1| hypothetical protein SELMODRAFT_186313 [Selaginella moellendorffii]
Length=481

 Score =   392 bits (1006),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 210/335 (63%), Positives = 261/335 (78%), Gaps = 11/335 (3%)
 Frame = +1

Query  574   HDFM*VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRF----------SHPDME  723
             H    V LA+RLV   FADRVFFSNSGTEANEAAIKFARK+QR           S P +E
Sbjct  147   HSLPQVRLAERLVQSCFADRVFFSNSGTEANEAAIKFARKYQRVKAKEKSDKQASPPLVE  206

Query  724   QP-PVEFIAFSNCFHGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGK  900
              P   +F+AFSN FHGRT+GA+ALTSK+ YR+PFEP+MPGV F+E+GN++AA +++Q  +
Sbjct  207   GPIATDFVAFSNSFHGRTLGALALTSKDKYRAPFEPIMPGVKFVEFGNLEAAKKIVQQQR  266

Query  901   IAAVFVEPIQGEGGIYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGV  1080
              AAVFVEP+QGEGG+Y A   FL+ LR  C + G+LLVFDEVQCGLGRTG LWAHEAYG+
Sbjct  267   TAAVFVEPVQGEGGVYPAIGHFLEGLRALCSSTGTLLVFDEVQCGLGRTGKLWAHEAYGI  326

Query  1081  YPDIMTLAKPLAGGLPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPE  1260
              PDIMTLAKPLAGGLPIGAVLVT+ VA AI  GDHGSTFAG PLVC+AA+ VL+++  P 
Sbjct  327   EPDIMTLAKPLAGGLPIGAVLVTQAVADAIVPGDHGSTFAGSPLVCSAALAVLDRLQEPG  386

Query  1261  FLASVSDkgqylkellgkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLT  1440
             FL S++ KG +L+ELL ++L    HVKE+RG GL++GI+LDV+A PLV A ++ GL+VLT
Sbjct  387   FLDSIAGKGNHLRELLTRRLAPFAHVKEVRGAGLLVGIQLDVSAAPLVTAARSKGLIVLT  446

Query  1441  AGKGNVVRLVPPLIISKQELEQAADVLAACLPVLD  1545
             AG G+VVRL PPL+IS+ ELE   ++L +C+  LD
Sbjct  447   AGAGDVVRLAPPLVISEAELEHCVEILVSCISSLD  481



>ref|XP_001783933.1| predicted protein [Physcomitrella patens]
 gb|EDQ51278.1| predicted protein [Physcomitrella patens]
Length=484

 Score =   391 bits (1004),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 207/321 (64%), Positives = 257/321 (80%), Gaps = 4/321 (1%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRF---SHPDMEQPPVEFIAFSNC  759
             V+LA+RLV  SFADRVF  NSGTEANEAAIKFARK+      S+ D  Q   E +AF+N 
Sbjct  164   VKLAERLVRSSFADRVFMVNSGTEANEAAIKFARKYHYALAKSNGDTAQGATELVAFTNG  223

Query  760   FHGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEG  939
             FHGRT+GA++LTSK  YR+PFEP++PG +F+ +G+++A  E++ +GK AAVFVEP+QGEG
Sbjct  224   FHGRTLGALSLTSKIQYRTPFEPLVPGASFVNFGDLEATREIV-AGKTAAVFVEPLQGEG  282

Query  940   GIYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAG  1119
             GI  AT  FL+ LR  CD  G+LLVFDE+QCGLGRTG LWAHE Y V PDIMTLAKPLAG
Sbjct  283   GICPATASFLRGLRELCDETGTLLVFDEIQCGLGRTGRLWAHETYDVRPDIMTLAKPLAG  342

Query  1120  GLPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylk  1299
             GLPIGAVLVT++VA++I  GDHGSTFAGGPLVC+AA+ VL++I  P FL SV++KG YLK
Sbjct  343   GLPIGAVLVTDRVASSIAAGDHGSTFAGGPLVCHAALAVLDRIQAPGFLESVAEKGAYLK  402

Query  1300  ellgkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPL  1479
               L ++LG N+HVKE+RG GL++GI+LDV A+PLV +     LL+LTAGKG+VVRL PPL
Sbjct  403   SQLNERLGKNSHVKEVRGEGLLVGIQLDVPASPLVASALKEKLLILTAGKGDVVRLAPPL  462

Query  1480  IISKQELEQAADVLAACLPVL  1542
             IISKQE++QA D+L  C+P L
Sbjct  463   IISKQEIDQAVDILVKCMPSL  483



>gb|EEC81978.1| hypothetical protein OsI_25895 [Oryza sativa Indica Group]
Length=347

 Score =   369 bits (947),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 196/264 (74%), Positives = 225/264 (85%), Gaps = 1/264 (0%)
 Frame = +1

Query  673   AIKFARKFQRFSHPDMEQPPVEFIAFSNCFHGRTMGAVALTSKEHYRSPFEPVMPGVTFL  852
             AIKFARKFQR + PD + P  EF++F+NCFHGRTMG++ALTSK  YR PF PVMPG TF 
Sbjct  82    AIKFARKFQRVARPDGDAP-TEFMSFTNCFHGRTMGSLALTSKVQYREPFAPVMPGTTFA  140

Query  853   EYGNIQAATELIQSGKIAAVFVEPIQGEGGIYSATKEFLQALRTSCDNAGSLLVFDEVQC  1032
             EYGN++ A ++IQSGKIAAVFVEP+QGEGGI+SATKEFLQ LR +CD AG+LLVFDEVQC
Sbjct  141   EYGNLEEAKKVIQSGKIAAVFVEPMQGEGGIHSATKEFLQGLRDACDEAGALLVFDEVQC  200

Query  1033  GLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLPIGAVLVTEKVAAAINYGDHGSTFAGGPL  1212
             GLGRTGYLWA+EAYGV PDIMTLAKPLAGGLPIG VLVTEKVA+AINYGDHG+TF G PL
Sbjct  201   GLGRTGYLWAYEAYGVVPDIMTLAKPLAGGLPIGVVLVTEKVASAINYGDHGTTFGGRPL  260

Query  1213  VCNAAVTVLEKISNPEFLASVSDkgqylkellgkklggNNHVKEIRglgliigielDVAA  1392
             VC AA+T L+KI  P FLA V+ KG+  K+LL  KL GN HVKEIRG+GLI+GIELDV A
Sbjct  261   VCQAALTTLDKIQKPGFLAEVAKKGENFKQLLSTKLSGNAHVKEIRGIGLIVGIELDVPA  320

Query  1393  TPLVEACQNSGLLVLTAGKGNVVR  1464
              PLV+AC +  ++VLTAGKGNVVR
Sbjct  321   GPLVDACLDRSVIVLTAGKGNVVR  344



>ref|XP_002505636.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66894.1| predicted protein [Micromonas sp. RCC299]
Length=454

 Score =   368 bits (944),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 186/322 (58%), Positives = 249/322 (77%), Gaps = 4/322 (1%)
 Frame = +1

Query  595   LAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQ----RFSHPDMEQPPVEFIAFSNCF  762
             LA++LV   FADRVF+ NSGTEANE AIKFARK Q    + + PD  Q   E ++FSNCF
Sbjct  133   LARKLVDTCFADRVFYCNSGTEANEGAIKFARKVQMQRAKAADPDATQWATETVSFSNCF  192

Query  763   HGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGG  942
             HGRT+GA+ LT K+ YR+PFEP+ PG +F  YG++++A + I  GK AAVFVEP+QGEGG
Sbjct  193   HGRTLGALNLTWKKQYRTPFEPLSPGHSFATYGDLESAKKAIVKGKTAAVFVEPVQGEGG  252

Query  943   IYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGG  1122
             I+ A K FLQ L+  C+ AG++L+FDEVQCGLGRTGYLW H++  V PDIMT+AKPLAGG
Sbjct  253   IFPADKAFLQGLKDICEEAGAVLIFDEVQCGLGRTGYLWGHQSVDVTPDIMTVAKPLAGG  312

Query  1123  LPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylke  1302
             LPIGA+L T++VA A+  GDHGSTFAGGPLVCNAA  V +K+S+ +FLA+V+ +G+ L+ 
Sbjct  313   LPIGAILCTQEVANAMAPGDHGSTFAGGPLVCNAANAVFDKVSDEDFLANVTARGEQLRS  372

Query  1303  llgkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLI  1482
              L + L  N HVKE+RG GL++G++LD  A P+V  C+ +GLL+LTAG G+V+RL+PPL+
Sbjct  373   GLREALKDNGHVKEVRGSGLLVGVQLDCPAGPMVGECRKNGLLILTAGAGDVIRLLPPLV  432

Query  1483  ISKQELEQAADVLAACLPVLDK  1548
              +++E++ A  ++A  + VLDK
Sbjct  433   ATEEEVDAAVGIIAKAMSVLDK  454



>ref|XP_005846580.1| hypothetical protein CHLNCDRAFT_35898 [Chlorella variabilis]
 gb|EFN54478.1| hypothetical protein CHLNCDRAFT_35898 [Chlorella variabilis]
Length=466

 Score =   355 bits (912),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 190/318 (60%), Positives = 245/318 (77%), Gaps = 7/318 (2%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQR-------FSHPDMEQPPVEFIA  747
             V+LAKRLV  SFADRVF++N+GTEANEAAIKFARK+ +       ++     +   E ++
Sbjct  140   VKLAKRLVESSFADRVFYANTGTEANEAAIKFARKYAKVKAGLDPYNADTALECATEIVS  199

Query  748   FSNCFHGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPI  927
             F+  FHGRTMG++ALT K+ Y++PF+PVMPG   + Y +++AA  +I+ GK AAVFVEPI
Sbjct  200   FTGSFHGRTMGSLALTYKDQYKTPFQPVMPGSVMVPYMDLEAARGVIKKGKTAAVFVEPI  259

Query  928   QGEGGIYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAK  1107
             QGEGGI  A++EFLQ LR  CD A +LLVFDEVQ GLGRTG LW HE +GV PD+M+LAK
Sbjct  260   QGEGGINPASQEFLQGLRQLCDEADALLVFDEVQVGLGRTGKLWGHEHHGVSPDMMSLAK  319

Query  1108  PLAGGLPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkg  1287
             PLAGGLPIGAVL+ E VAA +  GDHGSTFAG PLVC+AA TV + IS+PEFLA V+ KG
Sbjct  320   PLAGGLPIGAVLLKEHVAAVMAPGDHGSTFAGNPLVCHAACTVFDIISDPEFLAGVTRKG  379

Query  1288  qylkellgkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRL  1467
             + L+  L   L GN HV+E+RGLGLI G++LD  A PLV A ++ G++V+TAGKG++VRL
Sbjct  380   ELLRSGLRAALEGNPHVQEVRGLGLICGVQLDQMAGPLVTAARDRGIIVITAGKGDIVRL  439

Query  1468  VPPLIISKQELEQAADVL  1521
             VPPL++S++E+E+   VL
Sbjct  440   VPPLVVSEEEIEKCCKVL  457



>ref|XP_001698091.1| acetylornithine aminotransferase [Chlamydomonas reinhardtii]
 gb|EDO99676.1| acetylornithine aminotransferase [Chlamydomonas reinhardtii]
 gb|ACD87738.1| N-acetyl ornithine amino-transferase [Chlamydomonas reinhardtii]
Length=460

 Score =   355 bits (910),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 182/320 (57%), Positives = 244/320 (76%), Gaps = 5/320 (2%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFS-----HPDMEQPPVEFIAFS  753
             VELAKRLV  SFAD+ FF N+GTEANE AIKFARK+ R       +      P E ++F+
Sbjct  135   VELAKRLVENSFADKAFFCNTGTEANEGAIKFARKWARVRAGIDPYDGGAVAPYELVSFT  194

Query  754   NCFHGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQG  933
             +CFHGRTMGA+ALT KE Y++PF P+MPG    EY N+++A  +I+ GK AAVFVEP+QG
Sbjct  195   SCFHGRTMGALALTYKEQYKTPFYPMMPGHQLAEYNNLESAAAVIKKGKTAAVFVEPVQG  254

Query  934   EGGIYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPL  1113
             EGG+  +T+ FL+ LR  CD AG+LLVFDEVQCGLGRTG LW H+ +GV PD+MTLAKPL
Sbjct  255   EGGVTPSTQAFLKGLRQLCDEAGALLVFDEVQCGLGRTGKLWGHQLFGVEPDMMTLAKPL  314

Query  1114  AGGLPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqy  1293
             AGGLPIG VL+ + VA  +  GDHGSTFAG PLVC+ A +V + I++P FLA+V  KG+ 
Sbjct  315   AGGLPIGTVLLKQHVADVMKPGDHGSTFAGNPLVCHVACSVFDIINSPAFLAAVEAKGER  374

Query  1294  lkellgkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVP  1473
             L+  L + + GN HV+E+RG+GL++G++LD+ A P+V+A ++ G++ +TAGKG+V+RLVP
Sbjct  375   LRAGLRRTMAGNPHVQEVRGVGLLVGVQLDMMAGPVVDAARDMGVMAITAGKGDVIRLVP  434

Query  1474  PLIISKQELEQAADVLAACL  1533
             PL+++  E++ A +VLAA L
Sbjct  435   PLVVTDAEIDTACEVLAAAL  454



>ref|XP_002945774.1| acetylornithine aminotransferase [Volvox carteri f. nagariensis]
 gb|EFJ52769.1| acetylornithine aminotransferase [Volvox carteri f. nagariensis]
Length=460

 Score =   353 bits (906),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 187/323 (58%), Positives = 238/323 (74%), Gaps = 5/323 (2%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFS-----HPDMEQPPVEFIAFS  753
             VELAKRLV  SFAD+ FF N+GTEANE AIKFARK+ R       +      P E ++F+
Sbjct  138   VELAKRLVENSFADKAFFCNTGTEANEGAIKFARKWARVRAGVDPYDANASAPYELVSFT  197

Query  754   NCFHGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQG  933
             +CFHGRTMGA+ALT KE Y++PF P+MPG    EY N+ +A  +I+ GK AAVFVEP+QG
Sbjct  198   SCFHGRTMGALALTYKEQYKTPFYPMMPGHRLAEYNNLDSARAVIEKGKTAAVFVEPVQG  257

Query  934   EGGIYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPL  1113
             EGGI  +   FL+ LR  CD AG+LLVFDEVQCGLGRTG LW H+ YGV PD+MTLAKPL
Sbjct  258   EGGITPSKLAFLKGLRELCDEAGALLVFDEVQCGLGRTGKLWGHQLYGVEPDMMTLAKPL  317

Query  1114  AGGLPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqy  1293
             AGGLPIGAVL+ + VA  +  GDHGSTFAG PLVC+ A TV + I+NP FL SV  +G  
Sbjct  318   AGGLPIGAVLMKQHVADVMKPGDHGSTFAGNPLVCHVACTVFDIINNPTFLTSVEQRGVR  377

Query  1294  lkellgkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVP  1473
             L+E L + +GGN HVKE+RG+GL++G++LDV A P+V+  +  G+L +TAGKG+V+RLVP
Sbjct  378   LREGLKRTMGGNPHVKEVRGVGLLVGVQLDVMAGPVVDTAREMGVLAITAGKGDVIRLVP  437

Query  1474  PLIISKQELEQAADVLAACLPVL  1542
             PL++   E+++  +VL   L  L
Sbjct  438   PLVVGDAEIDKCCEVLGQALKRL  460



>dbj|BAC84165.1| putative acetylornithine aminotransferase [Oryza sativa Japonica 
Group]
 dbj|BAG90800.1| unnamed protein product [Oryza sativa Japonica Group]
Length=244

 Score =   345 bits (885),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 183/241 (76%), Positives = 210/241 (87%), Gaps = 0/241 (0%)
 Frame = +1

Query  742   IAFSNCFHGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVE  921
             ++F+NCFHGRTMG++ALTSK  YR PF PVMPG TF EYGN++ A ++IQSGKIAAVFVE
Sbjct  1     MSFTNCFHGRTMGSLALTSKVQYREPFAPVMPGATFAEYGNLEEAKKVIQSGKIAAVFVE  60

Query  922   PIQGEGGIYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTL  1101
             P+QGEGGI+SATKEFLQ LR +CD AG+LLVFDEVQCGLGRTGYLWA+EAYGV PDIMTL
Sbjct  61    PMQGEGGIHSATKEFLQGLRDACDEAGALLVFDEVQCGLGRTGYLWAYEAYGVVPDIMTL  120

Query  1102  AKPLAGGLPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSD  1281
             AKPLAGGLPIG VLVTEKVA+AINYGDHG+TF GGPLVC AA+T L+KI  P FLA V+ 
Sbjct  121   AKPLAGGLPIGVVLVTEKVASAINYGDHGTTFGGGPLVCQAALTTLDKIQKPGFLAEVAK  180

Query  1282  kgqylkellgkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVV  1461
             KG+  K+LL  KL GN HVKEIRG+GLI+GIELDV A PLV+AC + G++VLTAGKGNVV
Sbjct  181   KGENFKQLLSTKLSGNAHVKEIRGIGLIVGIELDVPAGPLVDACLDRGVIVLTAGKGNVV  240

Query  1462  R  1464
             R
Sbjct  241   R  241



>ref|XP_001752434.1| predicted protein [Physcomitrella patens]
 gb|EDQ82673.1| predicted protein [Physcomitrella patens]
Length=410

 Score =   349 bits (895),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 194/328 (59%), Positives = 246/328 (75%), Gaps = 14/328 (4%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQ----------RFSHPDMEQPPVE  738
             V+LA+RLV  SFADRVFF+NSGTEAN+AAIKFARK+Q          R+      +P  E
Sbjct  83    VKLAERLVKWSFADRVFFTNSGTEANDAAIKFARKYQTVISNRKGDTRWIKFGKLRPASE  142

Query  739   FIAFSNCFHGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFV  918
              ++FS+ FHGRT GA +  SK +     EP+ PG   +E+G+++   + I+  + AAV V
Sbjct  143   LVSFSSGFHGRTSGAQSHFSKLN----LEPLAPGAHCVEFGDLETTAKAIRRDRTAAVLV  198

Query  919   EPIQGEGGIYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMT  1098
             EPIQGEGG+++A+ EFL+ LR  CD AG+LL+FDEVQCGLGRTG LWAH+AYGV PD+MT
Sbjct  199   EPIQGEGGVHTASAEFLRGLRRLCDEAGALLIFDEVQCGLGRTGLLWAHQAYGVQPDMMT  258

Query  1099  LAKPLAGGLPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVS  1278
             LAKPLAGGLPIGAVLVTE VA+ I+ GDHGSTFAGGPLVC AA++VL++I  P FL  V+
Sbjct  259   LAKPLAGGLPIGAVLVTEAVASTISAGDHGSTFAGGPLVCQAALSVLDRIQAPGFLEHVA  318

Query  1279  DkgqylkellgkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNV  1458
              KG +L+  L +K+G N HVKEIRG+GL+IG+ELDV A PLVEA   +GLL+LTAG G V
Sbjct  319   AKGGHLRAQLREKIGTNPHVKEIRGVGLLIGVELDVPAAPLVEAALQAGLLILTAGNGYV  378

Query  1459  VRLVPPLIISKQELEQAADVLAACLPVL  1542
             V+L PPL IS+ EL +A D++A C+  L
Sbjct  379   VKLAPPLTISEAELNRAVDIIAGCMSSL  406



>emb|CEG02202.1| Pyridoxal phosphate-dependent transferase, major region, subdomain 
1 [Ostreococcus tauri]
Length=485

 Score =   343 bits (880),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 181/317 (57%), Positives = 237/317 (75%), Gaps = 5/317 (2%)
 Frame = +1

Query  595   LAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRF----SHPDMEQPPVEFIAFSNCF  762
             LA++L   SFAD+VFF NSGTEANE A+KFARK+ +     +   +E    E ++F N F
Sbjct  163   LARKLSSTSFADKVFFCNSGTEANEGALKFARKYAKSRAQANGKSVEDAAYETVSFENGF  222

Query  763   HGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGG  942
             HGRTMGA++LT KE YR+PF P +PG TF  YG+++AA  +I  GK  AVF+EP+QGEGG
Sbjct  223   HGRTMGALSLTWKEGYRAPFAPGLPGNTFTPYGDLEAAKNVIVKGKTCAVFIEPVQGEGG  282

Query  943   IYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHE-AYGVYPDIMTLAKPLAG  1119
             IY A  EFL+ LR  CD A +LLV+DEVQCGLGRTG LW H+      PDI+T+AKPLA 
Sbjct  283   IYPADAEFLRGLRKLCDEADALLVYDEVQCGLGRTGKLWGHQMVQDAEPDILTVAKPLAN  342

Query  1120  GLPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylk  1299
             GLPIGAVL+ +KVA+ +  GDHGSTFAGGPLVC  A  V +++S P FL +V+D+G  LK
Sbjct  343   GLPIGAVLMKDKVASVMAPGDHGSTFAGGPLVCAVANEVFDRVSTPAFLQNVADRGNELK  402

Query  1300  ellgkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPL  1479
               L +KL G+ H+ E+RG GL++G++ DV A PLV+AC+++GLLV+TAGKGN++RLVPPL
Sbjct  403   SSLAEKLKGHPHLVEVRGAGLLVGVQFDVPAAPLVKACRDAGLLVITAGKGNILRLVPPL  462

Query  1480  IISKQELEQAADVLAAC  1530
             I++  E ++A DV+A C
Sbjct  463   IVTSAECQKAVDVIARC  479



>ref|XP_003083141.1| ARGD_ALNGL Acetylornithine aminotransferase, mitochondrial precursor 
(ISS), partial [Ostreococcus tauri]
Length=370

 Score =   338 bits (867),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 179/315 (57%), Positives = 234/315 (74%), Gaps = 5/315 (2%)
 Frame = +1

Query  601   KRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRF----SHPDMEQPPVEFIAFSNCFHG  768
             + L   SFAD+VFF NSGTEANE A+KFARK+ +     +   +E    E ++F N FHG
Sbjct  50    QSLSSTSFADKVFFCNSGTEANEGALKFARKYAKSRAQANGKSVEDAAYETVSFENGFHG  109

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMGA++LT KE YR+PF P +PG TF  YG+++AA  +I  GK  AVF+EP+QGEGGIY
Sbjct  110   RTMGALSLTWKEGYRAPFAPGLPGNTFTPYGDLEAAKNVIVKGKTCAVFIEPVQGEGGIY  169

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHE-AYGVYPDIMTLAKPLAGGL  1125
              A  EFL+ LR  CD A +LLV+DEVQCGLGRTG LW H+      PDI+T+AKPLA GL
Sbjct  170   PADAEFLRGLRKLCDEADALLVYDEVQCGLGRTGKLWGHQMVQDAEPDILTVAKPLANGL  229

Query  1126  PIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkel  1305
             PIGAVL+ +KVA+ +  GDHGSTFAGGPLVC  A  V +++S P FL +V+D+G  LK  
Sbjct  230   PIGAVLMKDKVASVMAPGDHGSTFAGGPLVCAVANEVFDRVSTPAFLQNVADRGNELKSS  289

Query  1306  lgkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLII  1485
             L +KL G+ H+ E+RG GL++G++ DV A PLV+AC+++GLLV+TAGKGN++RLVPPLI+
Sbjct  290   LAEKLKGHPHLVEVRGAGLLVGVQFDVPAAPLVKACRDAGLLVITAGKGNILRLVPPLIV  349

Query  1486  SKQELEQAADVLAAC  1530
             +  E ++A DV+A C
Sbjct  350   TSAECQKAVDVIARC  364



>gb|ACQ66331.1| N2-acetylornithine aminotransferase [Populus maximowiczii x Populus 
nigra]
Length=226

 Score =   328 bits (842),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 154/182 (85%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             VELA+RLV CSFADRVFF+NSGTEANEAAIKFARK+QRF++PD +Q   EFI+FSN FHG
Sbjct  45    VELARRLVACSFADRVFFTNSGTEANEAAIKFARKYQRFTNPDEKQQVTEFISFSNSFHG  104

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMGA+ALTSKE YR PFEPVMPGV FLEYG++QAATELI+SG+IAAVFVEPIQGEGGIY
Sbjct  105   RTMGALALTSKEQYRFPFEPVMPGVNFLEYGDVQAATELIKSGRIAAVFVEPIQGEGGIY  164

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             SATKEFLQ+LR++CD+AGSLLVFDEVQCGLGRTGYLWAHEAYGV PDIMTLAKPLAGGL 
Sbjct  165   SATKEFLQSLRSACDDAGSLLVFDEVQCGLGRTGYLWAHEAYGVVPDIMTLAKPLAGGLS  224

Query  1129  IG  1134
              G
Sbjct  225   RG  226



>ref|XP_005651785.1| acetylornithine aminotransferase [Coccomyxa subellipsoidea C-169]
 gb|EIE27241.1| acetylornithine aminotransferase [Coccomyxa subellipsoidea C-169]
Length=455

 Score =   337 bits (863),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 184/322 (57%), Positives = 235/322 (73%), Gaps = 5/322 (2%)
 Frame = +1

Query  574   HDFM*VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFS-----HPDMEQPPVE  738
             H    V LAK+LV  SFAD+VF++NSGTEANEAAIKF RKF R       +    + P E
Sbjct  128   HSVPQVRLAKKLVELSFADKVFYANSGTEANEAAIKFCRKFARVQAGIDPYDKAAEAPYE  187

Query  739   FIAFSNCFHGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFV  918
              ++FSN FHGRT+GA+ALT K+ Y++PF P+MPG   + Y ++ AA  +I+ GK A V V
Sbjct  188   MVSFSNSFHGRTLGALALTYKDQYKTPFSPIMPGALMVPYMDLDAAAAVIKKGKTAGVIV  247

Query  919   EPIQGEGGIYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMT  1098
             EP+QGEGGI+ A+  FL  LR  CD AG+LLVFDEVQCGLGRTG L+ ++ +GV PDI+T
Sbjct  248   EPVQGEGGIFPASTAFLGGLRELCDEAGALLVFDEVQCGLGRTGKLFGYQNFGVEPDILT  307

Query  1099  LAKPLAGGLPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVS  1278
             LAKPLAGGLPIGA LV ++VA A+  GDHGSTFAG PLV  AA  VL+ I+ P FL  V 
Sbjct  308   LAKPLAGGLPIGAALVKQRVADAMAPGDHGSTFAGNPLVTAAADVVLDIIAQPAFLERVL  367

Query  1279  DkgqylkellgkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNV  1458
               G+ L+  L + L GN HVKE+RGLGLI GI+LDV A  +V+  ++ GL+V+TAGKG+V
Sbjct  368   SLGERLRSQLRQALAGNAHVKEVRGLGLITGIQLDVMAGDVVQKARDQGLIVITAGKGDV  427

Query  1459  VRLVPPLIISKQELEQAADVLA  1524
             VRLVPPLII++ +++ A  +LA
Sbjct  428   VRLVPPLIITEADVDIAVSILA  449



>ref|XP_007509701.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18816.1| predicted protein [Bathycoccus prasinos]
Length=483

 Score =   334 bits (856),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 177/319 (55%), Positives = 235/319 (74%), Gaps = 10/319 (3%)
 Frame = +1

Query  595   LAKRLVGCSFADRVFFSNSGTEANEAAIKFARK-----FQRFSHPDME---QPPVEFIAF  750
             LAK+LV  SFA++ FF NSGTEANEA +KFARK     F++ S  D E   +P  E ++F
Sbjct  156   LAKKLVETSFAEKAFFCNSGTEANEACVKFARKYHYEKFRKMSRSDQEFYKKPATETVSF  215

Query  751   SNCFHGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQ  930
              N FHGRTMGA+ALT KE YR PFEP+MPG  F  YG++++A ++I+ GK A VFVEP Q
Sbjct  216   KNGFHGRTMGALALTWKEQYRKPFEPLMPGNAFATYGDLKSAAKVIKRGKTAVVFVEPAQ  275

Query  931   GEGGIYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYG--VYPDIMTLA  1104
             GEGGI+ A  EFL+ LR  CD    LL +DEVQCGLGRTGYLWAH+  G    PD+++ A
Sbjct  276   GEGGIFPADAEFLKGLRKLCDENDCLLAYDEVQCGLGRTGYLWAHQKIGKECEPDLLSAA  335

Query  1105  KPLAGGLPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDk  1284
             KPLA GLPIG VL+ +KVA A+  GDHGSTFAGGPLVC AA+ V +++  P FL +V   
Sbjct  336   KPLANGLPIGCVLMKQKVADAMQPGDHGSTFAGGPLVCRAALHVFDRVQEPGFLDNVKTN  395

Query  1285  gqylkellgkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVR  1464
             G+YLK+ L + L G+   KE+RG GL++G++    A PLV+AC  +GLLV+TAGKG+V+R
Sbjct  396   GEYLKDTLAEGLKGHPMFKEVRGTGLLVGVQFTDMAAPLVKACGENGLLVITAGKGDVLR  455

Query  1465  LVPPLIISKQELEQAADVL  1521
             LVPPL+++K+++++A +++
Sbjct  456   LVPPLVVTKEQIDKAVEII  474



>ref|XP_001422626.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP00943.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=384

 Score =   329 bits (844),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 173/317 (55%), Positives = 231/317 (73%), Gaps = 5/317 (2%)
 Frame = +1

Query  595   LAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQ----PPVEFIAFSNCF  762
             LA++L   SFADRVFF NSGTEANE A+KFARK+ +     + +       E ++F N F
Sbjct  62    LARKLTATSFADRVFFCNSGTEANEGALKFARKYAKTRAQALGKNAGDAAWETVSFENGF  121

Query  763   HGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGG  942
             HGRT GA++LT KE YR+PF P +PG TF  YG+++ A ++I  G+  AVFVEP+QGEGG
Sbjct  122   HGRTFGALSLTWKEGYRAPFAPGLPGNTFTPYGDLEKARQVIVKGRTCAVFVEPVQGEGG  181

Query  943   IYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAY-GVYPDIMTLAKPLAG  1119
             IY A  EFL+ LR  CD A +LLV+DEVQCGLGRTG LW H+      PD+M++AKPLA 
Sbjct  182   IYPADAEFLRGLRAICDEADALLVYDEVQCGLGRTGKLWGHQLIKDAEPDMMSVAKPLAN  241

Query  1120  GLPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylk  1299
             GLPIGAVL+ EKVAA +  GDHGSTFAGGPLVC  A  V +++S+P FLA+V+++G  LK
Sbjct  242   GLPIGAVLMKEKVAAVMAAGDHGSTFAGGPLVCAVANEVFDRVSDPAFLANVTERGNELK  301

Query  1300  ellgkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPL  1479
               L +KL G+  ++E+RG GL++G++ D    PLV AC+  GLL +TAGKG+++RLVPPL
Sbjct  302   SSLTEKLAGHPRLREVRGAGLLVGVQFDCPTAPLVAACRARGLLTITAGKGDILRLVPPL  361

Query  1480  IISKQELEQAADVLAAC  1530
             I+S  ++++A D++  C
Sbjct  362   IVSSAQVQKATDIVKEC  378



>ref|XP_003059947.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55899.1| predicted protein [Micromonas pusilla CCMP1545]
Length=481

 Score =   330 bits (847),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 179/334 (54%), Positives = 237/334 (71%), Gaps = 18/334 (5%)
 Frame = +1

Query  595   LAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEF----IAFS---  753
             LA++L    FADRVF+ NSGTEANE AIKFARK+Q  +    ++   E+    ++F    
Sbjct  148   LARKLTDTCFADRVFYCNSGTEANEGAIKFARKYQMATAKAKDESATEWATETVSFRRVL  207

Query  754   -----------NCFHGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGK  900
                        NCFHGRT+G++ LT KE YR+PF P+ PG  F  YG++ +A   I  GK
Sbjct  208   YTGSHTTASTINCFHGRTLGSLNLTWKEAYRTPFAPLSPGHAFATYGDLDSARSAIVKGK  267

Query  901   IAAVFVEPIQGEGGIYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGV  1080
              AAVFVEP+QGEGGI+ A   FL  L+  CD+AG+LLVFDEVQCGLGRTGYLW H++ GV
Sbjct  268   TAAVFVEPVQGEGGIFPADGAFLSGLKEICDDAGALLVFDEVQCGLGRTGYLWGHQSVGV  327

Query  1081  YPDIMTLAKPLAGGLPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPE  1260
              PDIMT+AKPLAGGLPIGAVL T+ VA AI  GDHGSTFAGGPLVC AA  V +++++P 
Sbjct  328   TPDIMTVAKPLAGGLPIGAVLTTQAVANAIAPGDHGSTFAGGPLVCGAANAVFDRVNSPG  387

Query  1261  FLASVSDkgqylkellgkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLT  1440
             F+ +V  +G+ L+  L  KL G + VKE+RG GL++G++LDV A PLV   ++ GLL+LT
Sbjct  388   FMENVVKRGEQLRSGLRAKLEGCDRVKEVRGSGLLVGVQLDVPAGPLVGQARDRGLLLLT  447

Query  1441  AGKGNVVRLVPPLIISKQELEQAADVLAACLPVL  1542
             AG G+V+RL+PPL++S++E++ A  ++A  +  L
Sbjct  448   AGAGDVIRLLPPLVVSEEEVDIAVAIIADLVKAL  481



>emb|CDY68670.1| BnaA02g36300D [Brassica napus]
Length=446

 Score =   326 bits (835),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 201/331 (61%), Positives = 234/331 (71%), Gaps = 52/331 (16%)
 Frame = +1

Query  592   ELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHGR  771
             EL+KRLV  SFA+RVF  NSGTEANEAAIKF+RKFQRF+HP+ ++    FIAF+N FHG 
Sbjct  43    ELSKRLVASSFAERVFSCNSGTEANEAAIKFSRKFQRFTHPEDKEVATSFIAFTNSFHG-  101

Query  772   TMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYS  951
                                    VTFLEYGN QAAT+LI+SGKIA VFVEPIQ EGG++S
Sbjct  102   -----------------------VTFLEYGNSQAATDLIRSGKIADVFVEPIQEEGGVHS  138

Query  952   ATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGY-----------------------LWA  1062
             ATKEFLQ+LR +CD AGSLLVFDEV   + RT                         LWA
Sbjct  139   ATKEFLQSLRLACDAAGSLLVFDEVSDNMSRTILDLFFWFCYFSMFSVVWVEVVTYGLWA  198

Query  1063  HEAYGVYPDIMTLAKPLAGGLPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLE  1242
              EA+GV PDIMT+AK LAGGLPIG +LVTEKVA  I YGDHGS FAG PLVC+AA+ V +
Sbjct  199   FEAFGVTPDIMTVAKSLAGGLPIGVMLVTEKVAETIKYGDHGSIFAGNPLVCSAAIAVFD  258

Query  1243  KISNPEFLASVSDkgqylkellgkklggNNHVKEIRglgliigielDVAATPLVEACQNS  1422
             K+S P FLASVS KG Y K+LL KKLGGN HVK++RG GLIIG+ELDV+A+PLV+AC  S
Sbjct  259   KVSKPSFLASVSSKGLYFKDLLVKKLGGNLHVKKVRGEGLIIGVELDVSASPLVDACCGS  318

Query  1423  GL--LVLTAGKGNVVRLVPPLIISKQELEQA  1509
              L  L+LTAGKGNV   VPPLII K+E+ +A
Sbjct  319   RLLILILTAGKGNV---VPPLIIEKEEIGRA  346



>gb|KFM27780.1| Acetylornithine aminotransferase, chloroplastic/mitochondrial 
[Auxenochlorella protothecoides]
Length=1007

 Score =   328 bits (842),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 181/323 (56%), Positives = 234/323 (72%), Gaps = 12/323 (4%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQR------------FSHPDMEQPP  732
             V LAK LV  SFADR FF+NSGTEANEAAIKFARK+ +            +        P
Sbjct  676   VALAKALVENSFADRAFFANSGTEANEAAIKFARKYAKIRGGLSVAGVDPYDAEASASAP  735

Query  733   VEFIAFSNCFHGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAV  912
              + +AF   FHGRT+GA++LT K  YR+PF P+ PG + + YG++ A    + SG++AAV
Sbjct  736   SDLLAFEGSFHGRTLGALSLTYKSQYRTPFAPLTPGSSLVPYGDLDAVRAALSSGRVAAV  795

Query  913   FVEPIQGEGGIYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDI  1092
             FVEPIQGEGGI+    +FL+ LR++CD AG+LLVFDEVQ GLGRTG LWAHE  GV PD+
Sbjct  796   FVEPIQGEGGIHDPGADFLRGLRSACDEAGALLVFDEVQVGLGRTGSLWAHERAGVTPDL  855

Query  1093  MTLAKPLAGGLPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLAS  1272
             +TLAKPLAGGLPIGAVL++++VA A+  GDHGSTFAG PLVC AAVT  + I  P FLA 
Sbjct  856   LTLAKPLAGGLPIGAVLLSQRVADAMAPGDHGSTFAGNPLVCQAAVTTFDIIRQPRFLAE  915

Query  1273  VSDkgqylkellgkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKG  1452
             V+ KG+ L+  L   L GN HV+E+RG+GLI+GI+LD AA  +V A +  GLL++TAG G
Sbjct  916   VARKGEALRAGLRAALDGNPHVREVRGVGLIVGIQLDQAAGAVVAAARERGLLIITAGAG  975

Query  1453  NVVRLVPPLIISKQELEQAADVL  1521
             ++VRLVPPLI+S +++++A   +
Sbjct  976   DIVRLVPPLIVSDEDIDEAVQTI  998



>ref|WP_011955608.1| acetylornithine aminotransferase [Roseiflexus sp. RS-1]
 ref|YP_001275205.1| acetylornithine and succinylornithine aminotransferase [Roseiflexus 
sp. RS-1]
 gb|ABQ89255.1| acetylornithine aminotransferase [Roseiflexus sp. RS-1]
Length=399

 Score =   301 bits (770),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 169/317 (53%), Positives = 222/317 (70%), Gaps = 7/317 (2%)
 Frame = +1

Query  589   VELAKRLVG-CSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFH  765
             VELA+ LV   S+ADRVFF NSG EA E A+KF+R++ R  H + +      +AFS  FH
Sbjct  84    VELAQTLVNHTSWADRVFFCNSGAEAVEGALKFSRRYARDIHGEGK---TTIVAFSGSFH  140

Query  766   GRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGI  945
             GRTMGAVA+T++E YR PFEPVMPGV F+ + +  AA   I +  +  V VEPIQGEGG+
Sbjct  141   GRTMGAVAVTAREKYRQPFEPVMPGVRFIPFNDSAAAAAAI-TDDVCGVIVEPIQGEGGL  199

Query  946   YSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGL  1125
               AT EFL+ALR  CD   +LL+FDE+QCG+GRTG LWAHE YGV PD+MT+AKPL GGL
Sbjct  200   SVATPEFLRALRERCDAVDALLIFDEIQCGIGRTGTLWAHEPYGVAPDLMTIAKPLGGGL  259

Query  1126  PIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkel  1305
             PIGA+L+ +KVA AI+ GDHG+TF GGP V   A TV  KI++P FLA V + G YL E 
Sbjct  260   PIGAILMRQKVAQAIHTGDHGTTFGGGPFVTAVAQTVFRKIADPTFLAHVREVGDYLGEA  319

Query  1306  lgkklggN-NHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLI  1482
             L        N V E+RG GL+ G+ ++ +++ + EA  N GLL+ TAG  +V+RLVPPLI
Sbjct  320   LADLQAARPNVVLEVRGRGLMRGVVINGSSSAVREAAHNEGLLIATAGD-DVLRLVPPLI  378

Query  1483  ISKQELEQAADVLAACL  1533
             +++ ++++A + L   L
Sbjct  379   LTRAQVDEAIEKLTRAL  395



>gb|KDD73023.1| class-III aminotransferase, partial [Helicosporidium sp. ATCC 
50920]
Length=382

 Score =   298 bits (763),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 155/261 (59%), Positives = 190/261 (73%), Gaps = 7/261 (3%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQR-------FSHPDMEQPPVEFIA  747
             VELAK+LV  SFADRVFF+N+GTEANEAAIKFARKF +       +     ++ P E ++
Sbjct  103   VELAKKLVSSSFADRVFFANTGTEANEAAIKFARKFAKVHAGLDPYDASSAQKAPCEIVS  162

Query  748   FSNCFHGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPI  927
             F+  FHGRTMG++ALT K+ YR+PF P+MP    L YG++ AA   ++ G  AAV VEP+
Sbjct  163   FTGSFHGRTMGSLALTYKDRYRTPFAPLMPHARMLPYGDVAAARAAVKKGVTAAVVVEPV  222

Query  928   QGEGGIYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAK  1107
             QGEGGIY A   FL+ALR  CD AG+LLVFDEVQ GLGRTG LWAHE +GV PD+M+LAK
Sbjct  223   QGEGGIYPAPPGFLEALRQLCDEAGALLVFDEVQVGLGRTGTLWAHEQFGVEPDMMSLAK  282

Query  1108  PLAGGLPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkg  1287
             PLAGGLPIG +LV E+VA  ++ GDHGSTFAG P VC AA  VL+ I+ P FL  V  KG
Sbjct  283   PLAGGLPIGVLLVKERVAEVMDVGDHGSTFAGNPFVCAAANAVLDVIAEPAFLREVRRKG  342

Query  1288  qylkellgkklggNNHVKEIR  1350
               L + L   LGGN+HV+E+R
Sbjct  343   DLLVDELRGALGGNSHVREVR  363



>ref|WP_006562923.1| acetylornithine aminotransferase [Oscillochloris trichoides]
 gb|EFO79762.1| acetylornithine and succinylornithine aminotransferase [Oscillochloris 
trichoides DG-6]
Length=399

 Score =   293 bits (749),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 165/316 (52%), Positives = 212/316 (67%), Gaps = 7/316 (2%)
 Frame = +1

Query  592   ELAKRLVGCSFA-DRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             +LA+ LV  S A D+VFFSNSGTE  E AIKFAR++ R  H + +      IA    FHG
Sbjct  88    DLARMLVTSSPAFDKVFFSNSGTEVVEGAIKFARRYAREHHGEGK---TTIIACDGSFHG  144

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMGAVA+TS+E YR PF PVMPGV F  Y +I A+ E      + A+F+EPIQGEGG+ 
Sbjct  145   RTMGAVAITSREKYREPFMPVMPGVRFANYNDI-ASLEAAMGDDVCALFIEPIQGEGGLR  203

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
              A+ EFL A RT CD   +LLVFDE+QCG+GR+G LWAH A GV PD+MT+AKPLAGGLP
Sbjct  204   VASDEFLAAARTLCDQHHALLVFDEIQCGMGRSGTLWAHHASGVLPDMMTVAKPLAGGLP  263

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgq-ylkel  1305
             IGAVL+ +++A  I+ GDHG+TF G PL    A  VL+KI+ PEFLA V +      + L
Sbjct  264   IGAVLLNQRIADTIHPGDHGTTFGGNPLATAVAGVVLQKINTPEFLAHVREVSNYLDESL  323

Query  1306  lgkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLII  1485
                     N ++EIRG GL+ G +L  +A  +  A  N GLLV T+G+ +V+RL+PPLII
Sbjct  324   QDLATDMPNQIREIRGRGLMRGFQLHGSAADVRNAALNQGLLVGTSGE-DVIRLLPPLII  382

Query  1486  SKQELEQAADVLAACL  1533
             + Q ++ A + L A L
Sbjct  383   TNQHVDAAIEKLRAAL  398



>gb|ADV91221.1| mitochondrial acetylornithine aminotransferase [Karlodinium veneficum]
Length=500

 Score =   294 bits (752),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 167/321 (52%), Positives = 214/321 (67%), Gaps = 10/321 (3%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             V+LA+ LV  SFAD+VFF+NSGTEANE AIKFARKF    H    QP    +AF N FHG
Sbjct  179   VQLAEHLVASSFADKVFFANSGTEANEGAIKFARKF----HVAQGQPRERLVAFENSFHG  234

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMGA++LT KE YR+PF P+MP   FL Y ++ A   + ++  + AVFVEP+QGEGG  
Sbjct  235   RTMGALSLTWKEKYRTPFAPLMPSADFLPYNDVNAVAAIDET--VCAVFVEPVQGEGGCI  292

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
                  FL ALR+ CD  G+LLVFDEVQCGLGRTG L+A+E  GV PDI+TLAKPLA GLP
Sbjct  293   PGDSAFLAALRSRCDAVGALLVFDEVQCGLGRTGKLFAYEHVGVVPDIVTLAKPLAAGLP  352

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGA L+++KVA AI  GDHGSTFAGGPLVC AA   L+++ N  FLA+V       +   
Sbjct  353   IGACLMSDKVAKAIEPGDHGSTFAGGPLVCAAANYTLDRLDNEAFLANVD--AMGHRLRE  410

Query  1309  gkklggNNHVKEIRglgliigielDVA--ATPLVEACQNSGLLVLTAGKGNVVRLVPPLI  1482
             G +     +  E+RG+GL+ GI    A   T +    + +GLL+LTAG G+V+RLVP L 
Sbjct  411   GLRSIVTPYGCEVRGVGLLNGIVCPSAQIVTAVQGVARENGLLILTAGAGDVIRLVPSLT  470

Query  1483  ISKQELEQAADVLAACLPVLD  1545
             ++  E+++   +L      +D
Sbjct  471   VTAGEVDECIAILKQAFDRVD  491



>ref|WP_012119751.1| acetylornithine aminotransferase [Roseiflexus castenholzii]
 ref|YP_001431339.1| acetylornithine and succinylornithine aminotransferase [Roseiflexus 
castenholzii DSM 13941]
 gb|ABU57321.1| acetylornithine and succinylornithine aminotransferase [Roseiflexus 
castenholzii DSM 13941]
Length=399

 Score =   284 bits (726),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 160/317 (50%), Positives = 213/317 (67%), Gaps = 7/317 (2%)
 Frame = +1

Query  589   VELAKRLVGCS-FADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFH  765
             VELA+ LV  + +ADR FF NSG EA E A+KF+R++ R  H + +      +AF+  FH
Sbjct  84    VELAQTLVEHTPWADRAFFCNSGAEAVEGALKFSRRYARDIHGESK---TTIVAFTGSFH  140

Query  766   GRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGI  945
             GRTMGAVA+T++E YR PFEPVMPG  F+ + +  AA   I +  +  V +EP+QGEGG+
Sbjct  141   GRTMGAVAVTAREKYRQPFEPVMPGARFVPFNDSAAAAAAI-TDDVCGVIIEPVQGEGGL  199

Query  946   YSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGL  1125
               AT EFL  LR  C+   +LL+FDE+QCG+GRTG LWAHE YG+ PDIMT+AKPL GGL
Sbjct  200   SVATPEFLHTLRERCNAVDALLIFDEIQCGIGRTGALWAHEPYGITPDIMTIAKPLGGGL  259

Query  1126  PIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkel  1305
             PIGA+L+ +KVA  I+ GDHG+TF GGP V   A TV  KI+NP FLA V + G YL E 
Sbjct  260   PIGAILMRQKVAQTIHVGDHGTTFGGGPFVTTVARTVFHKIANPTFLAHVREVGDYLGEA  319

Query  1306  lgkklggN-NHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLI  1482
             L      +   V E+RG GL+ G+ +   A  + EA    GLL+ TAG  +V+RLVPPLI
Sbjct  320   LNDLKAAHPGIVLEVRGRGLMRGVVIGGPAGAVREAAHGEGLLIATAGD-DVLRLVPPLI  378

Query  1483  ISKQELEQAADVLAACL  1533
             +++ ++++A + L   L
Sbjct  379   LTRAQVDEAVEKLTRAL  395



>ref|WP_012192076.1| acetylornithine aminotransferase [Herpetosiphon aurantiacus]
 ref|YP_001547313.1| acetylornithine and succinylornithine aminotransferase [Herpetosiphon 
aurantiacus DSM 785]
 gb|ABX07185.1| acetylornithine and succinylornithine aminotransferase [Herpetosiphon 
aurantiacus DSM 785]
Length=404

 Score =   280 bits (717),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 151/307 (49%), Positives = 206/307 (67%), Gaps = 6/307 (2%)
 Frame = +1

Query  592   ELAKRLVGCS-FADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             ELA+RLV  + +A + FF NSGTEA EA++KFAR++     P+ +     F+AF++ FHG
Sbjct  88    ELAQRLVDLTPWASKAFFCNSGTEAIEASLKFARRYTYNQRPEQQ---TGFVAFNDAFHG  144

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             R+MGA+++TS+E YR+PF P++PGV F+     QA  E      +AAV VEPIQGEGGI 
Sbjct  145   RSMGALSVTSREAYRTPFNPLIPGVRFINLECDQATLEATIDASVAAVIVEPIQGEGGIR  204

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
               + EF QALR  CD   +LL+FDE+QCG+GRTG +WAH+A GV PDIM LAKPL GGLP
Sbjct  205   PISPEFAQALRRRCDQVDALLIFDEIQCGMGRTGDVWAHQALGVNPDIMALAKPLGGGLP  264

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGAVLV E+ A A+NYGDHG+TF G P +C+ A  VL+K+++P  L  V   G  L   L
Sbjct  265   IGAVLVNERAAKALNYGDHGTTFGGNPFICSVANVVLQKVTHPTMLDHVRSVGAELGAGL  324

Query  1309  gkklggNNHVKEIRglgliigielD-VAATPLVEACQNSGLLVLTAGKGNVVRLVPPLII  1485
                    + +  +RG GL+ G+E     A  + EA  + GLL++ +G  +VVR++PPL+I
Sbjct  325   RDLGERFDVISAVRGRGLMWGVEFQGPTAAHITEAAFDQGLLLVGSG-ADVVRVIPPLVI  383

Query  1486  SKQELEQ  1506
                ++EQ
Sbjct  384   GHNDVEQ  390



>ref|XP_002530447.1| acetylornithine aminotransferase, putative [Ricinus communis]
 gb|EEF31917.1| acetylornithine aminotransferase, putative [Ricinus communis]
Length=280

 Score =   272 bits (695),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             VELAKRLV  SFADRVFFSNSGTEANEAAIKFARKFQR SHP++++P  EFI+F+N FHG
Sbjct  129   VELAKRLVDSSFADRVFFSNSGTEANEAAIKFARKFQRISHPELKKPATEFISFTNSFHG  188

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY
Sbjct  189   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  248

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGL  1038
             SATKEFLQ+LR++CD+ GSLLVFDEV   L
Sbjct  249   SATKEFLQSLRSACDDVGSLLVFDEVTSFL  278



>ref|WP_014432970.1| acetylornithine aminotransferase [Caldilinea aerophila]
 ref|YP_005441630.1| acetylornithine/succinyldiaminopimelate aminotransferase [Caldilinea 
aerophila DSM 14535 = NBRC 104270]
 dbj|BAL99732.1| acetylornithine/succinyldiaminopimelate aminotransferase [Caldilinea 
aerophila DSM 14535 = NBRC 104270]
Length=408

 Score =   275 bits (702),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 153/326 (47%), Positives = 214/326 (66%), Gaps = 20/326 (6%)
 Frame = +1

Query  595   LAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHGRT  774
             LA  L   SFAD+V F NSG EANE A KFAR++ R +H   E+  VE +AF+N FHGRT
Sbjct  87    LAALLCETSFADKVHFCNSGAEANEGAFKFARRYGR-AHGGEEK--VEILAFTNAFHGRT  143

Query  775   MGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYSA  954
             MGA+A T +  Y+ PF+P+MPGV F E+ ++++A   +   ++ A+ VEP+QGEGGI+ A
Sbjct  144   MGALAATPRPKYQDPFKPLMPGVRFAEFNDLESARRQMDE-RVCAIIVEPVQGEGGIHPA  202

Query  955   TKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAY-------------GVYPDIM  1095
             T EFL  LR   D   +LL++DEVQCG+GRTG LWAH+ Y                PDI+
Sbjct  203   TPEFLAGLRDLADEFDALLIYDEVQCGVGRTGSLWAHQGYCNQRGNCTCEDGCRFEPDIL  262

Query  1096  TLAKPLAGGLPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASV  1275
             T AKPLAGGLPIGA+L+ ++VA  +  GDHGSTFAG P + + A  V+ +I+ P+FLA+V
Sbjct  263   TAAKPLAGGLPIGAILMRQRVADVMQKGDHGSTFAGSPFITHVAYHVVSRIAQPDFLAAV  322

Query  1276  SDkgqylkellgkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGN  1455
                 +        +   + H++EIRG GL+IG+ELD+ A  ++      GL+++ AG  N
Sbjct  323   E--AKGKLLRELIEETNSPHIQEIRGKGLMIGVELDIEAAEVINRGYQEGLILVNAGP-N  379

Query  1456  VVRLVPPLIISKQELEQAADVLAACL  1533
             V+RLVPPL+I+++E+ Q  + LA  L
Sbjct  380   VLRLVPPLVITEREIHQVVERLARAL  405



>ref|WP_028457475.1| acetylornithine aminotransferase [Chloroflexus sp. Y-396-1]
Length=400

 Score =   273 bits (697),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 157/318 (49%), Positives = 205/318 (64%), Gaps = 9/318 (3%)
 Frame = +1

Query  589   VELAKRLVGCS--FADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCF  762
             +ELAK LV  S  FA + FF NSG EA E AIKF+R++ R       +     +AF   F
Sbjct  87    IELAKLLVQSSPAFA-KAFFCNSGAEAIEGAIKFSRRYAR---AHFGEGKTTIVAFDGSF  142

Query  763   HGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGG  942
             HGRTMGAVA+T++E YR PF PVMPGV F  Y ++ +  E + S  + AV +EP+QGEGG
Sbjct  143   HGRTMGAVAITAREKYREPFMPVMPGVRFARYNDLVSLAE-VMSDDVCAVVIEPVQGEGG  201

Query  943   IYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGG  1122
             + +A   F+Q +R  C   G+LL+FDE+QCG+GRTG LWAHE  GVYPD+MT+AKPLAGG
Sbjct  202   LRAAEPAFIQGVRDLCHRYGALLIFDEIQCGVGRTGTLWAHEQLGVYPDMMTVAKPLAGG  261

Query  1123  LPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylke  1302
             LPIGAVL+ + VA  I+ GDHG+TF G PL       V  KIS+P FL  V     Y  E
Sbjct  262   LPIGAVLMGQHVADTIHPGDHGTTFGGNPLATAVGTVVFRKISDPSFLNHVRQVSNYFDE  321

Query  1303  llgkklggN-NHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPL  1479
              L      + + V E+RG GL+ GI +  +A+ + EA    GLLV TAG+ +V+RL+PPL
Sbjct  322   ALHDFAADHADQVLELRGRGLMRGIRIAGSASAVREAAHRHGLLVATAGE-DVIRLLPPL  380

Query  1480  IISKQELEQAADVLAACL  1533
             II  + +++A   L A L
Sbjct  381   IIQPEHVDEALAGLRAAL  398



>ref|WP_012257809.1| MULTISPECIES: acetylornithine aminotransferase [Chloroflexus]
 ref|YP_001635544.1| acetylornithine and succinylornithine aminotransferase [Chloroflexus 
aurantiacus J-10-fl]
 ref|YP_002569820.1| acetylornithine and succinylornithine aminotransferase [Chloroflexus 
sp. Y-400-fl]
 gb|ABY35155.1| acetylornithine and succinylornithine aminotransferase [Chloroflexus 
aurantiacus J-10-fl]
 gb|ACM53494.1| acetylornithine and succinylornithine aminotransferase [Chloroflexus 
sp. Y-400-fl]
Length=400

 Score =   272 bits (695),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 159/318 (50%), Positives = 208/318 (65%), Gaps = 9/318 (3%)
 Frame = +1

Query  589   VELAKRLVGCS--FADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCF  762
             +ELAK LV  S  FA + FF NSG EA E AIKF+R++ R +H  + +     +AF   F
Sbjct  87    IELAKLLVQSSPAFA-KAFFCNSGAEAIEGAIKFSRRYAR-AH--VGEGKTTIVAFDGSF  142

Query  763   HGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGG  942
             HGRTMGAVA+T++E YR PF PVMPGV F  Y ++ +   ++    + AV VEP+QGEGG
Sbjct  143   HGRTMGAVAITAREKYREPFMPVMPGVRFARYNDLDSLAAVM-GDDVCAVVVEPVQGEGG  201

Query  943   IYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGG  1122
             + +A   F+Q +R  C   G+LLVFDE+QCG+GRTG LWAHE  GV PD+MT+AKPLAGG
Sbjct  202   LRAAEPAFMQGVRELCQRYGALLVFDEIQCGVGRTGTLWAHEQLGVQPDMMTVAKPLAGG  261

Query  1123  LPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylke  1302
             LPIGAVL+ + VA  I+ GDHG+TF G PL       V  KIS+P FLA V     YL E
Sbjct  262   LPIGAVLMGQHVADTIHPGDHGTTFGGNPLATAVGTVVFRKISDPAFLAHVQQVSNYLDE  321

Query  1303  llgkklggN-NHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPL  1479
              L      + + V E+RG GL+ G+ +  +A+ + EA    GLLV TAG+ +V+RL+PPL
Sbjct  322   ALQDFANEHADQVIELRGRGLMRGVRIAGSASAVREAAHRHGLLVATAGE-DVIRLLPPL  380

Query  1480  IISKQELEQAADVLAACL  1533
             II  Q +++A   L A L
Sbjct  381   IIEPQHVDEALSGLRAAL  398



>gb|EPB91282.1| acetylornithine aminotransferase [Mucor circinelloides f. circinelloides 
1006PhL]
Length=452

 Score =   272 bits (695),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 145/299 (48%), Positives = 207/299 (69%), Gaps = 7/299 (2%)
 Frame = +1

Query  604   RLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHGRTMGA  783
             R  G  +A ++F +NSGTEANE A+KFARK+ +   PD      E + F+N FHGR+MGA
Sbjct  140   RQHGGEWASKLFLANSGTEANEGALKFARKWGKQYSPDK----TEIVCFTNAFHGRSMGA  195

Query  784   VALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYSATKE  963
             +++T    Y+ PF P++PG+    Y +++AA   I + K   V +EPIQGEGG++ A  E
Sbjct  196   LSVTFNPKYQKPFAPLVPGIVTSPYNDVEAALSAI-TDKTCGVIIEPIQGEGGVHPAKAE  254

Query  964   FLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLPIGAVL  1143
             FL+ALR  CD   +LL+FDE+QCGL RTG +W H+ + V PD+MT+AKPLA G+PIGA+L
Sbjct  255   FLEALRKRCDETNTLLIFDEIQCGLARTGKMWGHQHFNVTPDVMTMAKPLANGVPIGAIL  314

Query  1144  VTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkellgkklg  1323
              TEKV   I  GDHG+TF G PL    A+ V+ +I+ PEF+ASV+ KG++LK LL +   
Sbjct  315   TTEKVGEMIKTGDHGTTFGGNPLAAAVALNVVNRITTPEFIASVNQKGEHLKGLLKQVQD  374

Query  1324  gN-NHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIISKQE  1497
              + + +KE+RG GL+IG+E     +P+V+  +  GLL++TAG  N VR++PPLII+++E
Sbjct  375   SHPDLIKEVRGKGLLIGVEFTKDPSPIVKMARERGLLLVTAG-CNTVRVIPPLIITEEE  432



>gb|ESA18519.1| hypothetical protein GLOINDRAFT_93361 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX62561.1| acetylornithine transaminase [Rhizophagus irregularis DAOM 197198w]
 gb|EXX62562.1| acetylornithine transaminase [Rhizophagus irregularis DAOM 197198w]
 gb|EXX62563.1| acetylornithine transaminase [Rhizophagus irregularis DAOM 197198w]
Length=432

 Score =   268 bits (685),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 156/330 (47%), Positives = 213/330 (65%), Gaps = 14/330 (4%)
 Frame = +1

Query  592   ELAKRLV-----GCSF-ADRVFFSNSGTEANEAAIKFARKF-QRFSHPDMEQPPVEFIAF  750
             ELA+ LV     G  F A RVFFSNSGTEANE A+KFARK+ ++ S    E+  V  I++
Sbjct  104   ELAELLVNITKEGGGFEAARVFFSNSGTEANEGALKFARKWGKQVSKEGKEKYGV--ISY  161

Query  751   SNCFHGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQ  930
             +N FHGRTMGA++ T    Y++PF P++PG     Y +I+   E++      AV VEPIQ
Sbjct  162   NNAFHGRTMGALSATPSPKYQAPFSPLVPGFVHSIYNDIEKIPEVVNEN-TCAVIVEPIQ  220

Query  931   GEGGIYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAY--GVYPDIMTLA  1104
             GEGG++ AT +FL+ALR  CD   +LL+FDE+QCGLGRTG LWAH+      +PDI+TLA
Sbjct  221   GEGGVWVATVDFLKALRKRCDEVNALLIFDEIQCGLGRTGKLWAHQHLPKSCHPDILTLA  280

Query  1105  KPLAGGLPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDk  1284
             KPLA G PIGA++ TEKVA  I  GDHG+TF G PL C AA++V+ +I+ PE L++V+  
Sbjct  281   KPLANGFPIGAIITTEKVANIIKIGDHGTTFGGNPLACRAALSVVRRINTPELLSNVNSV  340

Query  1285  gqylkel-lgkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVV  1461
             G YL            + +  IRG GLI+GI+  V  TPL+   +  GLL++TA     V
Sbjct  341   GDYLVNEFKRLASKYPSLITNIRGKGLILGIQFTVDPTPLIGLARERGLLLITAS-NQTV  399

Query  1462  RLVPPLIISKQELEQAADVLAACLPVLDKS  1551
             R++PPLI+ K+E +    ++   + + DK 
Sbjct  400   RIIPPLILKKEEAQHGVKIIEEIVDIFDKQ  429



>ref|XP_007217532.1| hypothetical protein PRUPE_ppa023444mg, partial [Prunus persica]
 gb|EMJ18731.1| hypothetical protein PRUPE_ppa023444mg, partial [Prunus persica]
Length=275

 Score =   263 bits (671),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 138/149 (93%), Gaps = 0/149 (0%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             VELAKRLV CSFADRVFFSNSGTEANEAAIKFARKFQRFS P+ ++P  EFI+F+N FHG
Sbjct  125   VELAKRLVACSFADRVFFSNSGTEANEAAIKFARKFQRFSFPEKKEPATEFISFTNSFHG  184

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMGAVALTSKEHYRSPFEPVMPGVTFLEYG+IQAAT+LI SGKIAAVF+EP+QGEGGI 
Sbjct  185   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGDIQAATKLIHSGKIAAVFLEPLQGEGGIL  244

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCG  1035
             SATKEFLQ+LR +CD++GSLLVFDE+  G
Sbjct  245   SATKEFLQSLRGACDDSGSLLVFDELVLG  273



>ref|WP_015940596.1| acetylornithine aminotransferase [Chloroflexus aggregans]
 ref|YP_002463173.1| acetylornithine and succinylornithine aminotransferase [Chloroflexus 
aggregans DSM 9485]
 gb|ACL24737.1| acetylornithine and succinylornithine aminotransferase [Chloroflexus 
aggregans DSM 9485]
Length=399

 Score =   266 bits (681),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 157/317 (50%), Positives = 202/317 (64%), Gaps = 7/317 (2%)
 Frame = +1

Query  589   VELAKRLVGCSFA-DRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFH  765
             +ELA  LV  S A  + FF NSG EA E AIKFAR++ R +H    +     +AF   FH
Sbjct  87    IELAALLVQSSPAFAKAFFCNSGAEAIEGAIKFARRYAR-AH--FGEGKTTIVAFDGSFH  143

Query  766   GRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGI  945
             GRTMGAVA+T++E YR PF PVMPGV F  Y ++ A+ E +    + AV +EP+QGEGG+
Sbjct  144   GRTMGAVAITAREKYREPFMPVMPGVRFARYNDL-ASLEAVMGDDVCAVVIEPVQGEGGL  202

Query  946   YSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGL  1125
              +A   F+Q +R  C    +LLVFDE+QCG+GRTG LWAHE  GV PDIMT+AKPLAGGL
Sbjct  203   RAAEPAFVQGVRALCQRHNALLVFDEIQCGMGRTGTLWAHEQLGVQPDIMTIAKPLAGGL  262

Query  1126  PIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkel  1305
             PIGA+L+++ VA AI  GDHG+TF G PL       V  KIS+P FL+ V     YL E 
Sbjct  263   PIGAILMSQPVADAIQPGDHGTTFGGNPLATAVGAVVFRKISDPHFLSHVQQVSNYLDEA  322

Query  1306  lgkklggN-NHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLI  1482
             L        + V E+RG GL+ GI +  +A  + E     GLLV TAG+ +V+RL+PPLI
Sbjct  323   LHDLAAERPDVVLELRGRGLMRGIRIAGSAGAVRETAHRHGLLVATAGE-DVIRLLPPLI  381

Query  1483  ISKQELEQAADVLAACL  1533
             I    +++A   L A L
Sbjct  382   IEPHHVDEAVAGLRASL  398



>ref|WP_031460130.1| acetylornithine aminotransferase [Chloroflexus sp. MS-G]
Length=400

 Score =   266 bits (680),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 154/318 (48%), Positives = 203/318 (64%), Gaps = 9/318 (3%)
 Frame = +1

Query  589   VELAKRLVGCS--FADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCF  762
             +ELAK LV  S  FA + FF NSG EA E AIKF+R++ R       +     +AF   F
Sbjct  87    IELAKLLVQSSPAFA-KAFFCNSGAEAIEGAIKFSRRYAR---AHFGEGKTTIVAFDGSF  142

Query  763   HGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGG  942
             HGRTMGAVA+T++E YR PF PVMPGV F  Y ++ +  E++    + AV +EP+QGEGG
Sbjct  143   HGRTMGAVAITAREKYREPFMPVMPGVRFARYNDLASLAEVMGH-DVCAVVIEPVQGEGG  201

Query  943   IYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGG  1122
             + +A   F+Q +R  C   G+LLV DE+QCG+GRTG LWAHE  GV PD+MT+AKPLAGG
Sbjct  202   LRAAEPTFMQGVRDLCHQYGALLVLDEIQCGVGRTGTLWAHEQLGVQPDMMTVAKPLAGG  261

Query  1123  LPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqy-lk  1299
             LPIGAVL+ + VA  I+ GDHG+TF G PL       V  KIS+P FL  V     Y  +
Sbjct  262   LPIGAVLMGQHVADTIHPGDHGTTFGGNPLATAVGTVVFRKISDPNFLNHVRQVSNYFDE  321

Query  1300  ellgkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPL  1479
              L       ++ V E+RG GL+ GI +  +A+ + EA    GLLV TAG+ +V+RL+PPL
Sbjct  322   ALHDFAADHSDQVLELRGRGLMRGIRIAGSASAVREAAHRHGLLVATAGE-DVIRLLPPL  380

Query  1480  IISKQELEQAADVLAACL  1533
             II  + +++A   L A L
Sbjct  381   IIQPEHVDEALAGLRAAL  398



>gb|EXX62564.1| acetylornithine transaminase [Rhizophagus irregularis DAOM 197198w]
Length=479

 Score =   268 bits (686),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 156/329 (47%), Positives = 214/329 (65%), Gaps = 14/329 (4%)
 Frame = +1

Query  592   ELAKRLV-----GCSF-ADRVFFSNSGTEANEAAIKFARKF-QRFSHPDMEQPPVEFIAF  750
             ELA+ LV     G  F A RVFFSNSGTEANE A+KFARK+ ++ S    E+  V  I++
Sbjct  151   ELAELLVNITKEGGGFEAARVFFSNSGTEANEGALKFARKWGKQVSKEGKEKYGV--ISY  208

Query  751   SNCFHGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQ  930
             +N FHGRTMGA++ T    Y++PF P++PG     Y +I+   E++      AV VEPIQ
Sbjct  209   NNAFHGRTMGALSATPSPKYQAPFSPLVPGFVHSIYNDIEKIPEVVNEN-TCAVIVEPIQ  267

Query  931   GEGGIYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAY--GVYPDIMTLA  1104
             GEGG++ AT +FL+ALR  CD   +LL+FDE+QCGLGRTG LWAH+      +PDI+TLA
Sbjct  268   GEGGVWVATVDFLKALRKRCDEVNALLIFDEIQCGLGRTGKLWAHQHLPKSCHPDILTLA  327

Query  1105  KPLAGGLPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDk  1284
             KPLA G PIGA++ TEKVA  I  GDHG+TF G PL C AA++V+ +I+ PE L++V+  
Sbjct  328   KPLANGFPIGAIITTEKVANIIKIGDHGTTFGGNPLACRAALSVVRRINTPELLSNVNSV  387

Query  1285  gqylkellgkklggN-NHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVV  1461
             G YL     +      + +  IRG GLI+GI+  V  TPL+   +  GLL++TA     V
Sbjct  388   GDYLVNEFKRLASKYPSLITNIRGKGLILGIQFTVDPTPLIGLARERGLLLITAS-NQTV  446

Query  1462  RLVPPLIISKQELEQAADVLAACLPVLDK  1548
             R++PPLI+ K+E +    ++   + + DK
Sbjct  447   RIIPPLILKKEEAQHGVKIIEEIVDIFDK  475



>gb|ETK81594.1| hypothetical protein L915_12918 [Phytophthora parasitica]
 gb|ETK81595.1| hypothetical protein, variant 1 [Phytophthora parasitica]
 gb|ETL35000.1| hypothetical protein L916_12827 [Phytophthora parasitica]
 gb|ETL35001.1| hypothetical protein, variant 1 [Phytophthora parasitica]
Length=439

 Score =   267 bits (682),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 154/318 (48%), Positives = 210/318 (66%), Gaps = 9/318 (3%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKF-QRFSH-PDMEQPPVEFIAFSNCF  762
             +ELAK LV  S  D+VFF+NSGTEANE A KFAR +  R S    +E    EFI+F + F
Sbjct  115   LELAKNLVDNSRFDKVFFANSGTEANEGAYKFARLYANRVSQGTPLEGKKFEFISFKHGF  174

Query  763   HGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGG  942
             HGRT  A+ LT K   R  F P++PGV + E+ +I++  +LI S K A VF+EP+QGEGG
Sbjct  175   HGRTAAALTLTHKPKIREAFMPLVPGVHYAEFNDIESVKKLI-SDKTAGVFIEPMQGEGG  233

Query  943   IYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGG  1122
             +Y A  EF++ LR  CD   +LL+ DEVQCGLGRTG L+AHE Y V PDIMTLAKPLAGG
Sbjct  234   LYPADPEFMRELRALCDKHDALLITDEVQCGLGRTGKLFAHELYDVTPDIMTLAKPLAGG  293

Query  1123  LPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylke  1302
             LPIGAVL++ KVA+ I  G HG+TF G PLVC  A TVL KI + +FL +V  +G+YL +
Sbjct  294   LPIGAVLMSNKVASGITPGQHGTTFGGNPLVCAVANTVLTKIMDEDFLENVQKRGKYLAD  353

Query  1303  llgkklgg-NNHVKEIRglgliigielDVAAT----PLVEACQNSGLLVLTAGKGNVVRL  1467
              L K      + V +IR      G+ + +       PL+E   +  +L+++AG+ N +RL
Sbjct  354   GLEKLQQKFPDQVVDIRKPIGKGGLFVAIECNKPVGPLIEYALSKQVLIISAGE-NTIRL  412

Query  1468  VPPLIISKQELEQAADVL  1521
              PPL++ ++++++  +V 
Sbjct  413   CPPLVVDEKDIDKLLEVF  430



>emb|CDS07224.1| hypothetical protein LRAMOSA09747 [Absidia idahoensis var. thermophila]
Length=454

 Score =   267 bits (683),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 145/314 (46%), Positives = 207/314 (66%), Gaps = 4/314 (1%)
 Frame = +1

Query  613   GCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHGRTMGAVAL  792
             G  +A ++FF+NSGTEANE A+KFARK+ +    D      + I+F N FHGR+MGA++ 
Sbjct  143   GGDWASKIFFANSGTEANEGALKFARKWGKHIAGDNGNK-TKVISFVNGFHGRSMGALSA  201

Query  793   TSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYSATKEFLQ  972
             T    Y+ PF P++PG + + Y ++ AA   I +  +  V +EP QGEGGI+SA KEFL+
Sbjct  202   TYNPKYQMPFAPLIPGFSSVPYNDVDAAINAI-TDDVCGVIIEPFQGEGGIHSANKEFLE  260

Query  973   ALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLPIGAVLVTE  1152
             ALR  CD   +LL+FDE+QCGLGRTG LW HE +G+ PD++T+AKPLA G+PIGAVL ++
Sbjct  261   ALRKRCDEKNALLIFDEIQCGLGRTGKLWGHEHHGIKPDLLTMAKPLANGVPIGAVLSSD  320

Query  1153  KVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDk-gqylkellgkklggN  1329
             KV+  I  GDHG+TF G PL    A+ V  +IS+  FL SV +K      +L   +    
Sbjct  321   KVSQIIKPGDHGTTFGGNPLATGVALHVFGRISDETFLKSVQEKGDALKSDLKALQAEMP  380

Query  1330  NHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIISKQELEQA  1509
             + +KE+RG GL++G+EL     P+V+  +  GLL++TAG  N +R+VPPL+++++E  +A
Sbjct  381   DVIKEVRGQGLLLGVELHKDPAPVVKMARERGLLLVTAG-CNTIRIVPPLVVTREEGREA  439

Query  1510  ADVLAACLPVLDKS  1551
                LA  L    KS
Sbjct  440   IARLAGALQEFKKS  453



>ref|XP_008894184.1| hypothetical protein PPTG_03260 [Phytophthora parasitica INRA-310]
 ref|XP_008894185.1| hypothetical protein, variant 1 [Phytophthora parasitica INRA-310]
 gb|ETI41550.1| hypothetical protein F443_13226 [Phytophthora parasitica P1569]
 gb|ETI41551.1| hypothetical protein, variant 1 [Phytophthora parasitica P1569]
 gb|ETL88241.1| hypothetical protein L917_12669 [Phytophthora parasitica]
 gb|ETL88242.1| hypothetical protein, variant 1 [Phytophthora parasitica]
 gb|ETM41507.1| hypothetical protein L914_12727 [Phytophthora parasitica]
 gb|ETM41508.1| hypothetical protein, variant 1 [Phytophthora parasitica]
 gb|ETN20206.1| hypothetical protein PPTG_03260 [Phytophthora parasitica INRA-310]
 gb|ETN20207.1| hypothetical protein, variant 1 [Phytophthora parasitica INRA-310]
 gb|ETO70195.1| hypothetical protein F444_13305 [Phytophthora parasitica P1976]
 gb|ETO70196.1| hypothetical protein, variant 1 [Phytophthora parasitica P1976]
 gb|ETP11297.1| hypothetical protein F441_13177 [Phytophthora parasitica CJ01A1]
 gb|ETP11298.1| hypothetical protein, variant 1 [Phytophthora parasitica CJ01A1]
Length=439

 Score =   267 bits (682),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 154/318 (48%), Positives = 210/318 (66%), Gaps = 9/318 (3%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKF-QRFSH-PDMEQPPVEFIAFSNCF  762
             +ELAK LV  S  D+VFF+NSGTEANE A KFAR +  R S    +E    EFI+F + F
Sbjct  115   LELAKNLVDNSRFDKVFFANSGTEANEGAYKFARLYANRVSQGTPLEGKKFEFISFKHGF  174

Query  763   HGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGG  942
             HGRT  A+ LT K   R  F P++PGV + E+ +I++  +LI S K A VF+EP+QGEGG
Sbjct  175   HGRTAAALTLTHKPKIREAFMPLVPGVHYAEFNDIESVKKLI-SDKTAGVFIEPMQGEGG  233

Query  943   IYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGG  1122
             +Y A  EF++ LR  CD   +LL+ DEVQCGLGRTG L+AHE Y V PDIMTLAKPLAGG
Sbjct  234   LYPADPEFMRELRALCDKHDALLITDEVQCGLGRTGKLFAHELYDVTPDIMTLAKPLAGG  293

Query  1123  LPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylke  1302
             LPIGAVL++ KVA+ I  G HG+TF G PLVC  A TVL KI + +FL +V  +G+YL +
Sbjct  294   LPIGAVLMSNKVASGITPGQHGTTFGGNPLVCAVANTVLTKIMDEDFLENVQKRGKYLAD  353

Query  1303  llgkklgg-NNHVKEIRglgliigielDVAAT----PLVEACQNSGLLVLTAGKGNVVRL  1467
              L K      + V +IR      G+ + +       PL+E   +  +L+++AG+ N +RL
Sbjct  354   GLEKLQQKFPDQVVDIRKPIGKGGLFVAIECNKPVGPLIEYALSKQVLIISAGE-NTIRL  412

Query  1468  VPPLIISKQELEQAADVL  1521
              PPL++ ++++++  +V 
Sbjct  413   CPPLVVDEKDIDKLLEVF  430



>gb|KFH63488.1| acetylornithine aminotransferase [Mortierella verticillata NRRL 
6337]
Length=464

 Score =   267 bits (683),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 144/330 (44%), Positives = 207/330 (63%), Gaps = 13/330 (4%)
 Frame = +1

Query  592   ELAKRLV------GCSFADRVFFSNSGTEANEAAIKFARKFQRFS-HPDMEQPPVEFIAF  750
             ELA++L+      G   A ++FFSNSGTEANE A+KFARK  + +  P  E      ++F
Sbjct  134   ELAEQLIESTRASGYFQASKIFFSNSGTEANEGALKFARKVAKVTAQPGQENNKFGVVSF  193

Query  751   SNCFHGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQ  930
              N FHGR+MGA++ T    Y+ PF P++PG     Y ++ A  + + + +  AV +EPIQ
Sbjct  194   VNGFHGRSMGALSATPNPKYQKPFLPLVPGFVHAPYNDVTAVDQFV-TPETCAVIIEPIQ  252

Query  931   GEGGIYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVY--PDIMTLA  1104
             GEGG+  A++ FL+ LR+ CD  G+LL++DE+QCGLGRTG LWAH+ +  +  PDI+T+A
Sbjct  253   GEGGVNIASEAFLKKLRSRCDEVGALLIYDEIQCGLGRTGKLWAHQHFSEHCTPDILTMA  312

Query  1105  KPLAGGLPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDk  1284
             KPLA G PIGA+++T+KVA  I  GDHG+TF G PL C  A +VL +I+NPEFL +V+  
Sbjct  313   KPLANGFPIGAIMITDKVAEKIVIGDHGTTFGGNPLGCAVASSVLRRINNPEFLDNVN--  370

Query  1285  gqylkellgkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVR  1464
                       +   +  +KE+R  G+I G++  V   PLV   +  GLL++TA   N VR
Sbjct  371   RNGEHFKQQLESIESTLIKEVRSKGMIHGLQFTVDPAPLVALARERGLLIITAAN-NTVR  429

Query  1465  LVPPLIISKQELEQAADVLAACLPVLDKST  1554
              VP L ISK E++Q  ++L   +   +  T
Sbjct  430   FVPALNISKAEIDQGMEILKQAIVAFEDKT  459



>ref|WP_029215161.1| acetylornithine aminotransferase [bacterium JKG1]
Length=396

 Score =   265 bits (677),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 152/315 (48%), Positives = 203/315 (64%), Gaps = 6/315 (2%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             +ELA+ LV   FA+RVFF NSG EA E A+KFARK      P+        +AF + FHG
Sbjct  85    IELARLLVDSCFAERVFFCNSGAEAVEGALKFARKIGLRRDPNK----YAIVAFEHGFHG  140

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RT GA+A+T K  YR PF P++PGV F  + ++ AA  +I +  + AV VEPIQGEGGI 
Sbjct  141   RTAGALAVTHKPAYREPFGPLLPGVRFTPFNDLAAAERVIDA-DVCAVIVEPIQGEGGIT  199

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
              A+  FL+ LR  CD   +LL+FDE+QCG GRTG +WAH+   V PDIM  AKPLA GLP
Sbjct  200   PASDAFLEGLRALCDRHQALLIFDEIQCGGGRTGKVWAHQWSAVTPDIMVAAKPLANGLP  259

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             +GA+L T  VA  +  GDHGSTFAGGPLVC    +V  ++ +P  L  V   G  L+  L
Sbjct  260   LGAILTTAAVAEHLQPGDHGSTFAGGPLVCAVGASVFRRLCDPALLEHVRAMGDELRARL  319

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
             G+    +  V+E+RG GL+ GI++      +  A Q +GLLV+TAG+ +V+RLVPPLI+ 
Sbjct  320   GELQQHDARVREVRGRGLMQGIQVAGDVAAVRAAAQEAGLLVVTAGE-DVIRLVPPLIVQ  378

Query  1489  KQELEQAADVLAACL  1533
             ++ +++A  VL   L
Sbjct  379   REHIDEAVSVLRHAL  393



>gb|ETP39434.1| hypothetical protein F442_13097 [Phytophthora parasitica P10297]
 gb|ETP39435.1| hypothetical protein, variant 1 [Phytophthora parasitica P10297]
Length=439

 Score =   265 bits (677),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 154/318 (48%), Positives = 209/318 (66%), Gaps = 9/318 (3%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKF-QRFSH-PDMEQPPVEFIAFSNCF  762
             +ELAK LV  S  D+VFF+NSGTEANE A KFAR +  R S    +E    EFI+F + F
Sbjct  115   LELAKNLVDNSRFDKVFFANSGTEANEGAYKFARLYANRVSQGTPLEGKKFEFISFKHGF  174

Query  763   HGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGG  942
             HGRT  A+ LT K   R  F P++PGV + E+ +I++  +LI S K A VF+EP+QGEGG
Sbjct  175   HGRTAAALTLTHKPKIREAFMPLVPGVHYAEFNDIESVKKLI-SDKTAGVFIEPMQGEGG  233

Query  943   IYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGG  1122
             +Y A  EF++ LR  CD   +LL+ DEVQCGLGRTG L+AHE Y V PDIMTLAKPLAGG
Sbjct  234   LYPADPEFMRELRALCDKHDALLITDEVQCGLGRTGKLFAHELYDVTPDIMTLAKPLAGG  293

Query  1123  LPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylke  1302
             LPIGAVL++ KVA+ I  G HG+TF G PLVC  A TVL KI + +FL +V  +G+YL +
Sbjct  294   LPIGAVLMSNKVASGITPGQHGTTFGGNPLVCAVANTVLTKIMDEDFLENVQKRGKYLAD  353

Query  1303  llgkklgg-NNHVKEIRglgliigielDVAAT----PLVEACQNSGLLVLTAGKGNVVRL  1467
              L K      + V  IR      G+ + +       PL+E   +  +L+++AG+ N +RL
Sbjct  354   GLEKLQQKFPDQVVVIRKPIGKGGLFVAIECNKPVGPLIEYALSKQVLIISAGE-NTIRL  412

Query  1468  VPPLIISKQELEQAADVL  1521
              PPL++ ++++++  +V 
Sbjct  413   CPPLVVDEKDIDKLLEVF  430



>emb|CDH49279.1| acetylornithine aminotransferase [Lichtheimia corymbifera JMRC:FSU:9682]
Length=455

 Score =   263 bits (673),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 146/315 (46%), Positives = 207/315 (66%), Gaps = 5/315 (2%)
 Frame = +1

Query  613   GCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHGRTMGAVAL  792
             G  +A ++FF+NSGTEANE A+KFARK+ +    D  +   + I+F N FHGR+MGA++ 
Sbjct  143   GGDWASKIFFANSGTEANEGALKFARKWGKHIAGDNSKK-TKIISFVNGFHGRSMGALSA  201

Query  793   TSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYSATKEFLQ  972
             T    Y+ PF P++PG + + Y ++ AA   I    +  V +EP QGEGGI+SA KEFL+
Sbjct  202   TYNPKYQIPFAPLVPGFSSVPYNDVDAALNAIDD-DVCGVIIEPFQGEGGIHSANKEFLE  260

Query  973   ALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAY-GVYPDIMTLAKPLAGGLPIGAVLVT  1149
             ALR  CD   +LL+FDE+QCGLGRTG LW HE + G+ PD++T+AKPLA G+PIGAVL +
Sbjct  261   ALRKRCDEKKALLIFDEIQCGLGRTGKLWGHEHHGGIKPDLLTMAKPLANGVPIGAVLSS  320

Query  1150  EKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDk-gqylkellgkklgg  1326
             +KV+  I  GDHG+TF G PL    A+ V  +IS+  FL SV DK      +L   +   
Sbjct  321   DKVSQIIKPGDHGTTFGGNPLATGVALHVFGRISDESFLKSVQDKGDALKADLKVLQAEM  380

Query  1327  NNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIISKQELEQ  1506
              + +KE+RG GL++G+EL    +P+V+  +  GLL++TAG  N +R+VPPL+++ +E  +
Sbjct  381   PDVIKEVRGQGLLLGVELFKDPSPVVKMARERGLLLVTAG-CNTIRIVPPLVVTPEEGRE  439

Query  1507  AADVLAACLPVLDKS  1551
             A   LA  L    KS
Sbjct  440   AVARLAGALQEFKKS  454



>ref|XP_646043.1| acetylornithine transaminase [Dictyostelium discoideum AX4]
 sp|Q55DT8.1|ARGD_DICDI RecName: Full=Probable acetylornithine aminotransferase, mitochondrial; 
Short=ACOAT; Flags: Precursor [Dictyostelium discoideum]
 gb|EAL72113.1| acetylornithine transaminase [Dictyostelium discoideum AX4]
Length=453

 Score =   263 bits (671),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 155/321 (48%), Positives = 213/321 (66%), Gaps = 10/321 (3%)
 Frame = +1

Query  589   VELAKRLVGCS-FADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFH  765
             +ELA+ ++  +   D+VFF+NSGTEANEAA+KFA+K    +   +++   E IAFS+ F 
Sbjct  129   IELAQSMIASTPIFDKVFFANSGTEANEAALKFAKKIG-IAKGGVDKH--EIIAFSHGFS  185

Query  766   GRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGI  945
             GR+MG+++ T K  YR  + P++PGV F EY +I++  +L+   K  AV +EP+QGEGG+
Sbjct  186   GRSMGSLSCTHKSKYREIYGPLVPGVHFAEYNDIESVKKLMSKSKTCAVIIEPVQGEGGL  245

Query  946   YSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGV---YPDIMTLAKPLA  1116
              +AT EF+Q L   C     LL+ DEVQCG+GRTG LWAH  +      PDIMTLAKPLA
Sbjct  246   EAATVEFMQQLYKLCKENDCLLIVDEVQCGIGRTGQLWAHTRFDTEKCKPDIMTLAKPLA  305

Query  1117  GGLPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqyl  1296
             GGLPIGAVLV++KVA+ I  GDHG+TF GGPLVC     V E+IS P FL  V +KG+YL
Sbjct  306   GGLPIGAVLVSDKVASEIKPGDHGTTFGGGPLVCEVGKYVFERISQPSFLKEVQEKGKYL  365

Query  1297  kellgkklgg-NNHVKEIRglgli-igielDVAATPLVEACQNSGLLVLTAGKGNVVRLV  1470
              + L K      N + EIR +G + +GI+LD   + LV   ++  +L++ AG  +V+R  
Sbjct  366   TDGLKKLKDQFPNSILEIRTVGGLFVGIQLDHNVSDLVSYAKSQKILIINAGD-DVIRFC  424

Query  1471  PPLIISKQELEQAADVLAACL  1533
             PPL I+KQE++Q   VL   L
Sbjct  425   PPLTITKQEIDQLLLVLKNYL  445



>ref|WP_013932809.1| acetylornithine aminotransferase [Thermotoga thermarum]
 ref|YP_004660693.1| acetylornithine aminotransferase apoenzyme [Thermotoga thermarum 
DSM 5069]
 gb|AEH51597.1| acetylornithine aminotransferase apoenzyme [Thermotoga thermarum 
DSM 5069]
Length=397

 Score =   260 bits (665),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 155/319 (49%), Positives = 216/319 (68%), Gaps = 12/319 (4%)
 Frame = +1

Query  589   VELAKRLVGCSFAD-RVFFSNSGTEANEAAIKFARKF-QRFSHPDMEQPPVEFIAFSNCF  762
             +ELAK L+  SF   +VFF+NSGTEANEAAIK ARK+ ++FS     Q   + ++ +N F
Sbjct  75    MELAKLLIEKSFGKGKVFFANSGTEANEAAIKIARKYGKKFS-----QTKFKILSATNSF  129

Query  763   HGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGG  942
             HGRT G+++ T++E Y+ PF P++ G  + E+ NI+   + + S  I AV +EPIQGE G
Sbjct  130   HGRTYGSLSATAQEKYQKPFTPLVDGFEYFEFNNIEDLKKKM-SEDICAVILEPIQGESG  188

Query  943   IYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGG  1122
             I  A KEFLQ +R  CD+  +LL+FDEVQCG+GRTG L+A++ Y V PD++TLAK L GG
Sbjct  189   IVPAKKEFLQQVRNLCDSYNALLIFDEVQCGVGRTGKLFAYQLYDVQPDVLTLAKGLGGG  248

Query  1123  LPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylke  1302
             LPIGAVLV EK A  +  GDHGSTF G PLVC+ A++VL++IS PEFL+ V   G+ LK 
Sbjct  249   LPIGAVLVNEK-ADILEPGDHGSTFGGNPLVCSVAISVLQEISKPEFLSKVEKAGKRLKN  307

Query  1303  llgkklggNNH-VKEIRglgliigielD-VAATPLVEACQNSGLLVLTAGKGNVVRLVPP  1476
              L +        +K++RG+GL+IG+EL+ ++A      C   GLL+  AG  N +R +PP
Sbjct  308   GLLRLKKKYPELIKDVRGIGLMIGVELNKISAKEFSSTCVKEGLLLAPAG-NNTLRFLPP  366

Query  1477  LIISKQELEQAADVLAACL  1533
             L IS +E+    ++  +CL
Sbjct  367   LTISFKEISYGLNIFESCL  385



>gb|EFA79342.1| acetylornithine transaminase [Polysphondylium pallidum PN500]
Length=428

 Score =   261 bits (667),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 157/328 (48%), Positives = 210/328 (64%), Gaps = 13/328 (4%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             + LA++L+G S  D+VFF+N+GTEANE A+KFARK    S PD      E +AF++ F G
Sbjct  105   IRLAQQLIGNSALDKVFFANTGTEANEGALKFARKHGLQSSPD----KYEIVAFTHGFSG  160

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             R+MGA+++T K  YR  + P++PG+ F  Y +I++    I       V VEP+QGEGG+ 
Sbjct  161   RSMGALSVTHKSKYREIYGPLVPGIKFATYNDIESMRAAIGP-NTCGVIVEPVQGEGGLE  219

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             +AT EF+QAL   C    +LL+ DEVQCGLGRTG LWAHE  GV PDIMTLAKPLAGG+ 
Sbjct  220   AATPEFMQALAEQCKKNNALLIVDEVQCGLGRTGELWAHERLGVKPDIMTLAKPLAGGMA  279

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGA+LV + VA  IN GDHG+TF G PLV  A + V +KI  P FL  V  KG++LK  L
Sbjct  280   IGAILVRDHVAGCINPGDHGTTFGGSPLVTQAGLYVFQKIVQPAFLEEVRAKGRHLKARL  339

Query  1309  gkklggN--NHVKEIRglgli-igielDVAATPLVE---ACQNSGLLVLTAGKGNVVRLV  1470
                   +    +KEIR +G + +GIE D A   LV    A  N  +  ++AG  N +RL 
Sbjct  340   QAIADSDAGRSIKEIRTVGGLFVGIEFDHAVKDLVNFAVAAPNH-VFFISAGD-NTLRLC  397

Query  1471  PPLIISKQELEQAADVLAACLPVLDKST  1554
             PPL IS ++L++A DV+ A L   ++ +
Sbjct  398   PPLTISTKDLDRACDVIEAYLKKYNQQS  425



>ref|WP_022075976.1| acetylornithine aminotransferase 1 [Firmicutes bacterium CAG:212]
 emb|CDA14288.1| acetylornithine aminotransferase 1 [Firmicutes bacterium CAG:212]
Length=393

 Score =   259 bits (663),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 144/311 (46%), Positives = 204/311 (66%), Gaps = 7/311 (2%)
 Frame = +1

Query  592   ELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHGR  771
             E AK+L   S  DRVFF+NSGTEA E A+K ARK+        E    E IA  N FHGR
Sbjct  84    EAAKKLNEISRMDRVFFTNSGTEAIEGALKSARKYAYTK----ESGRYEIIAMQNSFHGR  139

Query  772   TMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYS  951
             ++GAV++T  +HYR+PFEP++PGV F EY N+++   L+   K  A+ +EP+QGEGGIY 
Sbjct  140   SIGAVSVTGTKHYRTPFEPLLPGVKFAEYNNLESVKALVND-KTCAIILEPLQGEGGIYP  198

Query  952   ATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLPI  1131
             ATKEF++ +R  C     L++ DE+QCG+ RTGY++A + Y + PDIMT+AK +  G+P+
Sbjct  199   ATKEFMEGIRELCSKNDILMICDEIQCGMARTGYMFAWQEYNIKPDIMTMAKAIGNGIPV  258

Query  1132  GAVLVTEKVAA-AINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             GA  +TE+VA  ++  GDHGST+ G PL C A  TV++     + +  V + G+YL   L
Sbjct  259   GAFAMTEEVAKYSMEAGDHGSTYGGNPLACTAVKTVIDIFQKEQIVDHVKEMGEYLSTCL  318

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              K +   + VKE RG GLI GIEL   A  ++     +GLL++TA KGN +R VPPLII+
Sbjct  319   EKLVQKYDFVKECRGKGLIQGIELTKPAGDIITKAHEAGLLIITA-KGNTIRFVPPLIIT  377

Query  1489  KQELEQAADVL  1521
             K+++++  + L
Sbjct  378   KEQIDEMIEKL  388



>gb|EIE77747.1| hypothetical protein RO3G_02451 [Rhizopus delemar RA 99-880]
Length=444

 Score =   260 bits (664),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 150/311 (48%), Positives = 210/311 (68%), Gaps = 16/311 (5%)
 Frame = +1

Query  592   ELAKRLV------GCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFS  753
              LAK +V      G ++A ++F +NSGTEANE A+KFARK+ +   PD      E + F+
Sbjct  123   RLAKTIVETTKANGGTWARKLFLANSGTEANEGALKFARKWGK-QFPDK----TEIVCFT  177

Query  754   NCFHGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQG  933
             N FHGR+MGA++ T    Y+ PF P++PG     + +I+ A E I + K   V +EPIQG
Sbjct  178   NAFHGRSMGALSATYNPKYQKPFAPLIPGFVTSPFNDIERALEAI-TDKTCGVIIEPIQG  236

Query  934   EGGIYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYG--VYPDIMTLAK  1107
             EGG++ A  +FL+ALR  CD   +LL+FDE+QCGLGRTG LW H+ +     PDI+T+AK
Sbjct  237   EGGVHPAKAQFLEALRKRCDETNALLIFDEIQCGLGRTGKLWGHQHFSKECVPDILTMAK  296

Query  1108  PLAGGLPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkg  1287
             PLA G+PIGA++ +EKV   I  GDHG+TF G PL    A+ V+ +I+ PEFL SV++KG
Sbjct  297   PLANGVPIGAIMTSEKVGDLIKIGDHGTTFGGNPLASAVALNVVNRITQPEFLKSVNEKG  356

Query  1288  qylkellgkklggN-NHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVR  1464
             +Y+KELL      + + +KE+RG GL+IG+E +   +P+V+  +  GLLV+TAG  N VR
Sbjct  357   EYMKELLKLVQSSHPDLIKEVRGQGLLIGVEFNKDPSPIVKMARERGLLVVTAG-CNTVR  415

Query  1465  LVPPLIISKQE  1497
             +VPPL ISK+E
Sbjct  416   IVPPLNISKEE  426



>emb|CCI11131.1| unnamed protein product [Albugo candida]
Length=424

 Score =   258 bits (660),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 147/319 (46%), Positives = 196/319 (61%), Gaps = 10/319 (3%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKF--QRFSHPDMEQPPVEFIAFSNCF  762
             +ELAK LV  S  D+VFF NSGTEANE A KFAR +  Q+     +E   +EFI+F   F
Sbjct  99    LELAKMLVDHSSFDKVFFCNSGTEANEGAYKFARLYANQKAKGTALEGQKMEFISFKGGF  158

Query  763   HGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGG  942
             HGRT  A+ LT K   R  F P++PGV + EY +I     LI S K A V +EPIQGEGG
Sbjct  159   HGRTAAALTLTYKPAIREAFMPLIPGVRYAEYNDIDHVRNLI-SKKTAGVIIEPIQGEGG  217

Query  943   IYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGG  1122
             +  A   FLQ LR  CD   +LL+ DEVQCGLGRTG L+AHE YG+ PDIMTLAKPLAGG
Sbjct  218   VIPANPSFLQELRALCDENDALLITDEVQCGLGRTGKLFAHEWYGINPDIMTLAKPLAGG  277

Query  1123  LPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASV-SDkgqylk  1299
             LPIGA+LV + VA  +  G HG+TF G PL+C  A  VL KI + EFLA+V S      +
Sbjct  278   LPIGAILVRDHVADVVTPGSHGTTFGGNPLICKVAEVVLNKIKSTEFLANVQSRGAYLAQ  337

Query  1300  ellgkklggNNHVKEIRglgliigielDVA----ATPLVE-ACQNSGLLVLTAGKGNVVR  1464
             +L   +    + + ++R       + + V       PL + A     LL+++AG+   +R
Sbjct  338   QLEVLQAKYPDKISQVRVPHGRQALFIGVECKNPVNPLTKFALMEKNLLLISAGE-KTIR  396

Query  1465  LVPPLIISKQELEQAADVL  1521
             L PPLI+++++++   + +
Sbjct  397   LCPPLIVTQEDIDWVVNTI  415



>emb|CCG80686.1| Acetylornithine aminotransferase,mitochondrial [Taphrina deformans 
PYCC 5710]
Length=483

 Score =   259 bits (662),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 151/321 (47%), Positives = 211/321 (66%), Gaps = 15/321 (5%)
 Frame = +1

Query  592   ELAKRLV-------GCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAF  750
             ELAK L+           A +VFF+NSGTEANEAAIKFARK  +  +    +  +  + F
Sbjct  141   ELAKLLIESTKSSGAMKDASKVFFANSGTEANEAAIKFARKHGQVMNGGAGKHKI--MTF  198

Query  751   SNCFHGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQ  930
              N FHGRTMG ++ T+ E Y++PF P++PG  + E+ +I+    L  S    AV VEP+Q
Sbjct  199   KNAFHGRTMGTLSATANEKYQAPFRPMVPGFEYAEFNDIKCVDALDNS--YCAVMVEPVQ  256

Query  931   GEGGIYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAY--GVYPDIMTLA  1104
             GEGGI++A ++FL ALR  CD  G+LL+FDE+QCGLGR+G LWAH  +    +PDIMT+A
Sbjct  257   GEGGIFAAQEDFLLALRKKCDEIGALLIFDEIQCGLGRSGKLWAHSWFDSACHPDIMTMA  316

Query  1105  KPLAGGLPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDk  1284
             KPLA G+PIGA +VTEKVA AI  GDHG+TF G PL C     VL ++S+P  LA+V ++
Sbjct  317   KPLANGVPIGATMVTEKVADAIKIGDHGTTFGGNPLACRVGHHVLSRLSSPSLLANVKEQ  376

Query  1285  gqy-lkellgkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVV  1461
                 L  L   K    N + E+RG GL++G+++D   +P+V+  +  GLL++TAG  N V
Sbjct  377   SDRCLAALHKIKDTFPNRIVEVRGRGLLLGMQMDSDPSPIVKFARERGLLLITAGN-NTV  435

Query  1462  RLVPPLIISKQELEQAADVLA  1524
             R VPPL+I  + +++A  +L+
Sbjct  436   RFVPPLVIDTETMDKAMGILS  456



>ref|XP_003298877.1| hypothetical protein PTT_09712 [Pyrenophora teres f. teres 0-1]
 gb|EFQ93019.1| hypothetical protein PTT_09712 [Pyrenophora teres f. teres 0-1]
Length=484

 Score =   258 bits (660),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 142/318 (45%), Positives = 200/318 (63%), Gaps = 7/318 (2%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             ++L     G + A R F  NSG+EANEAAIKFARK  +   PD ++   EF++F N FHG
Sbjct  151   IQLTHATGGFASASRTFICNSGSEANEAAIKFARKVGKSISPDKDKH--EFVSFHNSFHG  208

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMG+++ T    Y++PF P++PG  +  + ++ A   L+ +     V VEPIQGEGG+ 
Sbjct  209   RTMGSLSATPNPKYQTPFSPMVPGFKYGTFNDVNAINNLV-TDATCGVIVEPIQGEGGVN  267

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYG--VYPDIMTLAKPLAGG  1122
              AT EFL ALRT C   G++L+FDE+QCGLGRTG  WAH  Y    +PDI+T AK L  G
Sbjct  268   VATPEFLLALRTRCTEVGAVLIFDEIQCGLGRTGTFWAHGGYPKECHPDIVTTAKALGNG  327

Query  1123  LPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASV-SDkgqylk  1299
              PIGA +V + V   I  GDHG+TF G PL    A  +L ++S+PE L S+ + +  + +
Sbjct  328   FPIGATIVNDFVCDHIKTGDHGTTFGGNPLGSRVASYILSRLSSPEILDSIPAKEQAFRQ  387

Query  1300  ellgkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPL  1479
                  +   +  +KE+RG GLI+G++LDV  TP+V A +  GLL++T G  N +R VPPL
Sbjct  388   HFDALRSRFSTQIKEVRGKGLILGLQLDVDPTPIVTAARERGLLIITCGT-NTLRFVPPL  446

Query  1480  IISKQELEQAADVLAACL  1533
             II+K E+E+   +L   +
Sbjct  447   IITKAEIEEGMRILGQAM  464



>ref|WP_013707407.1| acetylornithine aminotransferase [Desulfobacca acetoxidans]
 ref|YP_004371479.1| Acetylornithine/succinyldiaminopimelate aminotransferase [Desulfobacca 
acetoxidans DSM 11109]
 gb|AEB10298.1| Acetylornithine/succinyldiaminopimelate aminotransferase [Desulfobacca 
acetoxidans DSM 11109]
Length=412

 Score =   256 bits (654),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 153/337 (45%), Positives = 214/337 (64%), Gaps = 14/337 (4%)
 Frame = +1

Query  547   CKQTRKY-----FVHDFM*VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKF--QRF  705
             C+Q +         H    ++LA+RLV  SFADRVFF NSG EANE AIK  R++  Q+F
Sbjct  83    CRQVQDLVHVSNLYHTIPQIKLAERLVELSFADRVFFCNSGAEANEGAIKLCRRYSWQKF  142

Query  706   SHPDMEQPPVEFIAFSNCFHGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATEL  885
               PD      + I  +N FHGRT+  ++ T +E +   F P++PG  F+ + N  AA E 
Sbjct  143   G-PDR----YKIICAANSFHGRTLATLSATGQEKFWQGFAPLLPGFVFVPF-NDPAALEA  196

Query  886   IQSGKIAAVFVEPIQGEGGIYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAH  1065
                 +   V +EP+QGEGG+   T ++   +R  CD    LL+ DE+Q GLGRTG L+AH
Sbjct  197   AIDNQTCGVLLEPVQGEGGVKIPTADYFPEVRNLCDKHNLLLILDEIQVGLGRTGRLFAH  256

Query  1066  EAYGVYPDIMTLAKPLAGGLPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEK  1245
             E +G+ PDIMTLAK LA GLPIGA+LVTE+VAA    G H STF GGP+V  AA+TVLE 
Sbjct  257   EHFGITPDIMTLAKGLANGLPIGALLVTEEVAAGFVPGTHASTFGGGPVVTAAALTVLEI  316

Query  1246  ISNPEFLASVSDkgqylkellgkklggNNHVKEIRglgliigielDVAATPLVEACQNSG  1425
             ++ P+FLA V  KG+Y    L +    +  ++E+RGLGLI+GIE+D    PLV++C+  G
Sbjct  317   LAQPDFLAEVKAKGEYFLNGLRQLQPRHRFIQEVRGLGLILGIEIDGDGVPLVDSCREKG  376

Query  1426  LLVLTAGKGNVVRLVPPLIISKQELEQAADVLAACLP  1536
              L+    +GNV+R +PPL++S++E+++   +L   LP
Sbjct  377   ALI-NCTQGNVLRFLPPLVVSREEIDRFLAILDDVLP  412



>ref|XP_007216288.1| hypothetical protein PRUPE_ppa020493mg [Prunus persica]
 gb|EMJ17487.1| hypothetical protein PRUPE_ppa020493mg [Prunus persica]
Length=192

 Score =   248 bits (632),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 141/177 (80%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = +1

Query  1024  VQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLPIGAVLVTEKVAAAINYGDHGSTFAG  1203
             VQCGLGRTGYLWAHEAYGV+PDIMTLAKPLAGGLPIGAVLVTEKVAA+I YG+HGSTFAG
Sbjct  16    VQCGLGRTGYLWAHEAYGVFPDIMTLAKPLAGGLPIGAVLVTEKVAASIKYGEHGSTFAG  75

Query  1204  GPLVCNAAVTVLEKISNPEFLASVSDkgqylkellgkklggNNHVKEIRglgliigielD  1383
             GPL+CNAA++VL KIS  EFL+ VS+KGQY KELL KKLG N HV+E+RG GLI+G+ELD
Sbjct  76    GPLICNAALSVLNKISKTEFLSGVSNKGQYFKELLTKKLGKNPHVREVRGSGLIVGVELD  135

Query  1384  VAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIISKQELEQAADVLAACLPVLDKST  1554
             V+A+PLV+AC+N GLL++TAGKGNV+RLVPPLIISKQELE AA+VL  CLPVLD S 
Sbjct  136   VSASPLVDACRNLGLLIITAGKGNVLRLVPPLIISKQELEYAAEVLLECLPVLDGSN  192



>ref|XP_003836538.1| similar to acetylornithine aminotransferase [Leptosphaeria maculans 
JN3]
 emb|CBX93173.1| similar to acetylornithine aminotransferase [Leptosphaeria maculans 
JN3]
Length=485

 Score =   257 bits (656),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 143/318 (45%), Positives = 200/318 (63%), Gaps = 7/318 (2%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             ++L     G   A R F  NSG+EANEAAIKFARK  +   PD ++   EF++F N FHG
Sbjct  152   IQLTHATGGFESATRTFICNSGSEANEAAIKFARKVGKSISPDTDKH--EFVSFHNSFHG  209

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMG+++ T    Y++PF P++PG  +  + NI+A  +L+ +     V VEPIQGEGG+ 
Sbjct  210   RTMGSLSATPNPKYQTPFSPMVPGFKYGTFNNIEAVRDLV-TESTCGVIVEPIQGEGGVN  268

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAY--GVYPDIMTLAKPLAGG  1122
              AT EFL ALR  C   G++LVFDE+QCGLGRTG  WAH  Y    +PDI+T AK L  G
Sbjct  269   VATPEFLLALRKRCTEVGAVLVFDEIQCGLGRTGQFWAHAGYPRDCHPDIVTTAKALGNG  328

Query  1123  LPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASV-SDkgqylk  1299
              PIGA +V + V   I  GDHG+TF G PL    A  +L ++S+PE L S+ + +  + K
Sbjct  329   FPIGATIVNDFVCNHIKTGDHGTTFGGNPLGSRVASYILSRLSSPEILDSIPAKEQMFRK  388

Query  1300  ellgkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPL  1479
                  K+     +KE+RG GLI+G++LDV  TP+V A +  GLL++T G  N +R VPPL
Sbjct  389   HFEVLKIKYPQEIKEVRGKGLILGLQLDVDPTPIVTAARERGLLIITCGT-NTLRFVPPL  447

Query  1480  IISKQELEQAADVLAACL  1533
             +I++ E+++   +L   +
Sbjct  448   VITESEIDEGMTILGQAM  465



>emb|CEG64595.1| Putative Acetylornithine aminotransferase [Rhizopus microsporus]
Length=444

 Score =   255 bits (652),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 147/324 (45%), Positives = 212/324 (65%), Gaps = 17/324 (5%)
 Frame = +1

Query  592   ELAKRLV------GCSFADRVFFSNSGTEANEAAIKFARKF-QRFSHPDMEQPPVEFIAF  750
             ELAK LV      G  +A ++F SNSGTEANE A+KFARK+ ++FS     Q   E + F
Sbjct  122   ELAKTLVETTKAHGGQWARKLFLSNSGTEANEGALKFARKWGKQFS-----QDKTEIVCF  176

Query  751   SNCFHGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQ  930
             +N FHGR+MG+++ T    Y+ PF P++PG     + ++  A E I + K   V +EPIQ
Sbjct  177   TNAFHGRSMGSLSATYNPKYQKPFAPLVPGFVTSPFNDVHKALESI-TDKTCGVIIEPIQ  235

Query  931   GEGGIYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYG--VYPDIMTLA  1104
             GEGG++ A+++FL ALR  CD   +LL+FDE+QCGLGRTG LW H+ +     PDI+T+A
Sbjct  236   GEGGVHPASEDFLGALRRRCDETNALLIFDEIQCGLGRTGKLWGHQHFKKECVPDILTMA  295

Query  1105  KPLAGGLPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDk  1284
             KPLA G+PIGA+L +EKV   I  GDHG+TF G PL    A+ V+ +I+NPEF+ SV +K
Sbjct  296   KPLANGVPIGAILTSEKVGDLIKIGDHGTTFGGNPLAAAVALNVVNRITNPEFIQSVQEK  355

Query  1285  gqylkellgkklggNNH-VKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVV  1461
             G+Y+K+LL +    +   +K++RG GL+IG+E     +P+++  +  GLL++ AG  N +
Sbjct  356   GEYVKKLLKQIQASHPELIKDVRGKGLLIGVEFTKDPSPIIKMARERGLLIVAAG-CNTI  414

Query  1462  RLVPPLIISKQELEQAADVLAACL  1533
             R+VPPL I+  E  +    LA  +
Sbjct  415   RIVPPLTITPDEAFEGVSKLAGAV  438



>ref|WP_022636951.1| acetyl ornithine aminotransferase [Chitinivibrio alkaliphilus]
 gb|ERP31632.1| acetyl ornithine aminotransferase [Chitinivibrio alkaliphilus 
ACht1]
Length=387

 Score =   253 bits (646),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 144/309 (47%), Positives = 200/309 (65%), Gaps = 5/309 (2%)
 Frame = +1

Query  595   LAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHGRT  774
             LA+ LV  SFADRVFF NSGTEANEAAIKFARK         E      ++F +CFHGRT
Sbjct  80    LARMLVENSFADRVFFCNSGTEANEAAIKFARKKAGMQ----EGSKTGILSFYDCFHGRT  135

Query  775   MGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYSA  954
              GA+  T+++ + + F P+  G  +    +I A  +++ +   AA+ VEP+QGEGG+  A
Sbjct  136   YGAMTATAQKKFHTGFHPIPGGYHYAPLNDIAATEQVLSTADFAAIIVEPVQGEGGLELA  195

Query  955   TKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLPIG  1134
             + EFLQ LR  CD+ G+ LVFDE+QCGLGRTG LWA+E+ GV PDI+T AKPL GGLP+G
Sbjct  196   SPEFLQFLRDYCDSTGTALVFDEIQCGLGRTGSLWAYESCGVTPDILTSAKPLGGGLPLG  255

Query  1135  AVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkellgk  1314
             AVL+ +  AA I+ GDHG+TF G P+ C     VL ++   E L  V  +  YL++ L K
Sbjct  256   AVLLKDAWAAPISPGDHGTTFGGNPVACAGGAVVLSRLVAGELLLLVQQRSSYLQKGLEK  315

Query  1315  klggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIISKQ  1494
              +   + V    G GL+ G+ L+   T ++ A +  GLLV  AGK N +RL+PPLI++++
Sbjct  316   FVRQKDGVLSYCGKGLLAGVRLNYDPTEVLLAARRRGLLVAKAGK-NTLRLIPPLIVTEE  374

Query  1495  ELEQAADVL  1521
              +++A  +L
Sbjct  375   HIDRALQIL  383



>ref|WP_022249920.1| acetylornithine aminotransferase [Clostridium nexile CAG:348]
 emb|CDC23896.1| acetylornithine aminotransferase [Clostridium nexile CAG:348]
Length=394

 Score =   253 bits (646),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 142/313 (45%), Positives = 204/313 (65%), Gaps = 7/313 (2%)
 Frame = +1

Query  598   AKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHGRTM  777
             A+ L   S  DRVFF+NSGTEA E A+K ARK+        +    EFIA ++ FHGR+M
Sbjct  86    AEHLRQVSCMDRVFFTNSGTEAIEGALKAARKYAYTK----QSGRYEFIAMNHSFHGRSM  141

Query  778   GAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYSAT  957
             GA+++T  E YR PFEP++ GV F +Y ++++   L+ S K  A+ +E +QGEGGIY A 
Sbjct  142   GALSVTGTEQYRKPFEPLVEGVKFADYNDLESVKALL-SDKTCAIILETVQGEGGIYPAE  200

Query  958   KEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLPIGA  1137
               FL+ LR  CD    LL+FDE+QCG+GRTG ++A + YGV PDIMT+AK +  G+P+GA
Sbjct  201   TSFLEGLRALCDEQDILLIFDEIQCGMGRTGSMFAWQGYGVKPDIMTMAKAIGNGVPVGA  260

Query  1138  VLVTEKVA-AAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkellgk  1314
               +TEKVA A++  GDHG+T+ G PLVC A  TVL+       L  V +   YL+E L +
Sbjct  261   FAMTEKVAKASLLPGDHGTTYGGNPLVCAAVDTVLQIFEEEHLLEHVKEVSVYLEEQLDQ  320

Query  1315  klggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIISKQ  1494
              +  ++ VKE RG GL+ G+ L+   T ++      GL+ ++AG GNV+RLVPPL+I+K+
Sbjct  321   LVKESSAVKERRGKGLMQGLVLEKPVTEVIRKGMEHGLITISAG-GNVLRLVPPLVITKE  379

Query  1495  ELEQAADVLAACL  1533
              +++  + L+  L
Sbjct  380   HVDEMIEKLSKAL  392



>ref|WP_004611278.1| acetylornithine aminotransferase [Tyzzerella nexilis]
 gb|EEA83746.1| aminotransferase, acetylornithine/succinylornithine family [Tyzzerella 
nexilis DSM 1787]
Length=401

 Score =   253 bits (646),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 142/313 (45%), Positives = 204/313 (65%), Gaps = 7/313 (2%)
 Frame = +1

Query  598   AKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHGRTM  777
             A+ L   S  DRVFF+NSGTEA E A+K ARK+        +    EFIA ++ FHGR+M
Sbjct  93    AEHLRQVSCMDRVFFTNSGTEAIEGALKAARKYAYTK----QSGRYEFIAMNHSFHGRSM  148

Query  778   GAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYSAT  957
             GA+++T  E YR PFEP++ GV F +Y ++++   L+ S K  A+ +E +QGEGGIY A 
Sbjct  149   GALSVTGTEQYRKPFEPLVEGVKFADYNDLESVKALL-SDKTCAIILETVQGEGGIYPAE  207

Query  958   KEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLPIGA  1137
               FL+ LR  CD    LL+FDE+QCG+GRTG ++A + YGV PDIMT+AK +  G+P+GA
Sbjct  208   TSFLEGLRALCDEQDILLIFDEIQCGMGRTGSMFAWQGYGVKPDIMTMAKAIGNGVPVGA  267

Query  1138  VLVTEKVA-AAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkellgk  1314
               +TEKVA A++  GDHG+T+ G PLVC A  TVL+       L  V +   YL+E L +
Sbjct  268   FAMTEKVAKASLLPGDHGTTYGGNPLVCAAVDTVLQIFEEEHLLEHVKEVSVYLEEQLDQ  327

Query  1315  klggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIISKQ  1494
              +  ++ VKE RG GL+ G+ L+   T ++      GL+ ++AG GNV+RLVPPL+I+K+
Sbjct  328   LVKESSAVKERRGKGLMQGLVLEKPVTEVIRKGMEHGLITISAG-GNVLRLVPPLVITKE  386

Query  1495  ELEQAADVLAACL  1533
              +++  + L+  L
Sbjct  387   HVDEMIEKLSKAL  399



>emb|CEJ03623.1| Putative Acetylornithine aminotransferase [Rhizopus microsporus]
Length=444

 Score =   254 bits (649),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 146/324 (45%), Positives = 212/324 (65%), Gaps = 17/324 (5%)
 Frame = +1

Query  592   ELAKRLV------GCSFADRVFFSNSGTEANEAAIKFARKF-QRFSHPDMEQPPVEFIAF  750
             ELAK LV      G  +A ++F SNSGTEANE A+KFARK+ ++FS     +   E + F
Sbjct  122   ELAKTLVETTKAHGGQWARKLFLSNSGTEANEGALKFARKWGKQFS-----EDKTEIVCF  176

Query  751   SNCFHGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQ  930
             +N FHGR+MG+++ T    Y+ PF P++PG     + ++  A E I + K   V +EPIQ
Sbjct  177   TNAFHGRSMGSLSATYNPKYQKPFAPLVPGFVTSPFNDVHKALESI-TDKTCGVIIEPIQ  235

Query  931   GEGGIYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYG--VYPDIMTLA  1104
             GEGG++ A+++FL ALR  CD   +LL+FDE+QCGLGRTG LW H+ +     PDI+T+A
Sbjct  236   GEGGVHPASEDFLGALRRRCDETNALLIFDEIQCGLGRTGKLWGHQHFKKECVPDILTMA  295

Query  1105  KPLAGGLPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDk  1284
             KPLA G+PIGA+L +EKV   I  GDHG+TF G PL    A+ V+ +I+NPEF+ SV +K
Sbjct  296   KPLANGVPIGAILTSEKVGDLIKIGDHGTTFGGNPLAAAVALNVVNRITNPEFIQSVQEK  355

Query  1285  gqylkellgkklggNNH-VKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVV  1461
             G+Y+K+LL +    +   +K++RG GL+IG+E     +P+++  +  GLL++ AG  N +
Sbjct  356   GEYVKKLLKQIQASHPELIKDVRGKGLLIGVEFTKDPSPIIKMARERGLLIVAAG-CNTI  414

Query  1462  RLVPPLIISKQELEQAADVLAACL  1533
             R+VPPL I+  E  +    LA  +
Sbjct  415   RIVPPLTITPDEAFEGVSKLAGAV  438



>ref|WP_027340670.1| acetylornithine aminotransferase [Halonatronum saccharophilum]
Length=396

 Score =   252 bits (644),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 144/310 (46%), Positives = 200/310 (65%), Gaps = 6/310 (2%)
 Frame = +1

Query  592   ELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHGR  771
             +L+K L+  S AD+VF+SNSG EANE AIK A+K+ +    D      E I     FHGR
Sbjct  86    KLSKILIENSCADKVFYSNSGAEANEGAIKLAKKYFKEKGKDR----WEIITAKKSFHGR  141

Query  772   TMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYS  951
             T+  VA T +  Y+ P++P+  G   +EY N++A  E I +   AA+ VEPIQGEGG++ 
Sbjct  142   TLTTVAATGQPKYQKPYQPIPGGFVHVEYNNLEAVREAI-TDNTAAIMVEPIQGEGGVHP  200

Query  952   ATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLPI  1131
             A K +L+ LR  CD  G LL+FDE+Q G+GRTG L+A++ YGV PDI++LAK L  G+PI
Sbjct  201   ADKGYLKGLREICDREGILLIFDEIQTGIGRTGSLFAYQEYGVEPDILSLAKALGNGMPI  260

Query  1132  GAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkellg  1311
             GA L  ++VA A N GDHGSTF G PL C AA   L+ I     L  V +   Y+++ L 
Sbjct  261   GAFLAKDEVAKAFNPGDHGSTFGGNPLACQAAYLTLKIILENNLLEDVKEMSTYMQKRLV  320

Query  1312  kklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIISK  1491
             +     + +KE+RG+GLI+G+EL+V    +V+     GLLVLTAGK  V+R +PPLII+K
Sbjct  321   ELKDKYSFIKELRGMGLILGLELEVEGIDIVKKALGEGLLVLTAGK-KVLRFLPPLIINK  379

Query  1492  QELEQAADVL  1521
               +++A  +L
Sbjct  380   DNVDKAIKIL  389



>gb|ETP39436.1| hypothetical protein, variant 2 [Phytophthora parasitica P10297]
Length=408

 Score =   253 bits (645),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 132/232 (57%), Positives = 163/232 (70%), Gaps = 3/232 (1%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKF-QRFSH-PDMEQPPVEFIAFSNCF  762
             +ELAK LV  S  D+VFF+NSGTEANE A KFAR +  R S    +E    EFI+F + F
Sbjct  115   LELAKNLVDNSRFDKVFFANSGTEANEGAYKFARLYANRVSQGTPLEGKKFEFISFKHGF  174

Query  763   HGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGG  942
             HGRT  A+ LT K   R  F P++PGV + E+ +I++  +LI S K A VF+EP+QGEGG
Sbjct  175   HGRTAAALTLTHKPKIREAFMPLVPGVHYAEFNDIESVKKLI-SDKTAGVFIEPMQGEGG  233

Query  943   IYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGG  1122
             +Y A  EF++ LR  CD   +LL+ DEVQCGLGRTG L+AHE Y V PDIMTLAKPLAGG
Sbjct  234   LYPADPEFMRELRALCDKHDALLITDEVQCGLGRTGKLFAHELYDVTPDIMTLAKPLAGG  293

Query  1123  LPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVS  1278
             LPIGAVL++ KVA+ I  G HG+TF G PLVC  A TVL KI + +FL +V 
Sbjct  294   LPIGAVLMSNKVASGITPGQHGTTFGGNPLVCAVANTVLTKIMDEDFLENVQ  345



>gb|KDE09241.1| hypothetical protein MVLG_00561 [Microbotryum violaceum p1A1 
Lamole]
Length=534

 Score =   256 bits (654),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 148/328 (45%), Positives = 207/328 (63%), Gaps = 24/328 (7%)
 Frame = +1

Query  631   RVFFSNSGTEANEAAIKFARKFQRFSHPDME----------------QPPVEFIAFSNCF  762
             +VFFSNSGTEANE A+KF RK+ + S  +++                   VE ++F + F
Sbjct  204   KVFFSNSGTEANEGALKFVRKYGKGSTGNLKAVTDSRGQKQAKVTGHTDKVEIVSFRDGF  263

Query  763   HGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGG  942
             HGR++GA++ T +E Y++PF P++PG+   +  +I+A   +I   K   V VEPIQGEGG
Sbjct  264   HGRSLGALSATWQEKYQAPFAPLVPGIVPADLNDIEALQTVINE-KTCGVIVEPIQGEGG  322

Query  943   IYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGV--YPDIMTLAKPLA  1116
             I  AT EFL+ALR  CD  G+LL+FDE+QCGLGRTG LWAH +  V  +PDI+T+AKPLA
Sbjct  323   ILEATPEFLKALRKRCDEVGALLIFDEIQCGLGRTGSLWAHGSLPVDCHPDIVTMAKPLA  382

Query  1117  GGLPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqyl  1296
              G+PIGA+L+ +KVA  I +GDHG+TF GGPL    A  VL +IS P FL +V+   + L
Sbjct  383   NGVPIGAILMKDKVADVIKFGDHGTTFGGGPLQTRVAHHVLGRISEPAFLENVTSTSKVL  442

Query  1297  kellgkklggNNHV----KEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVR  1464
             +E L    G    +       RGL + I    D     +++  +  G+L+L  GK + VR
Sbjct  443   RERLATLPGLFPRLIAGPPRGRGLIMGIPFTRDEYVQRVLKLARERGVLLLGCGK-STVR  501

Query  1465  LVPPLIISKQELEQAADVLAACLPVLDK  1548
              VP LII+ +ELE+A DVL +CL V+++
Sbjct  502   FVPSLIITTEELEKAMDVLESCLVVVNR  529



>ref|XP_008894186.1| hypothetical protein, variant 2 [Phytophthora parasitica INRA-310]
 ref|XP_008894187.1| hypothetical protein, variant 3 [Phytophthora parasitica INRA-310]
 gb|ETI41552.1| hypothetical protein, variant 2 [Phytophthora parasitica P1569]
 gb|ETI41553.1| hypothetical protein, variant 3 [Phytophthora parasitica P1569]
 gb|ETL88243.1| hypothetical protein, variant 2 [Phytophthora parasitica]
 gb|ETM41509.1| hypothetical protein, variant 2 [Phytophthora parasitica]
 gb|ETM41510.1| hypothetical protein, variant 3 [Phytophthora parasitica]
 gb|ETN20208.1| hypothetical protein, variant 2 [Phytophthora parasitica INRA-310]
 gb|ETN20209.1| hypothetical protein, variant 3 [Phytophthora parasitica INRA-310]
 gb|ETO70197.1| hypothetical protein, variant 2 [Phytophthora parasitica P1976]
 gb|ETO70198.1| hypothetical protein, variant 3 [Phytophthora parasitica P1976]
 gb|ETP11299.1| hypothetical protein, variant 2 [Phytophthora parasitica CJ01A1]
Length=408

 Score =   253 bits (645),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 132/232 (57%), Positives = 163/232 (70%), Gaps = 3/232 (1%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKF-QRFSH-PDMEQPPVEFIAFSNCF  762
             +ELAK LV  S  D+VFF+NSGTEANE A KFAR +  R S    +E    EFI+F + F
Sbjct  115   LELAKNLVDNSRFDKVFFANSGTEANEGAYKFARLYANRVSQGTPLEGKKFEFISFKHGF  174

Query  763   HGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGG  942
             HGRT  A+ LT K   R  F P++PGV + E+ +I++  +LI S K A VF+EP+QGEGG
Sbjct  175   HGRTAAALTLTHKPKIREAFMPLVPGVHYAEFNDIESVKKLI-SDKTAGVFIEPMQGEGG  233

Query  943   IYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGG  1122
             +Y A  EF++ LR  CD   +LL+ DEVQCGLGRTG L+AHE Y V PDIMTLAKPLAGG
Sbjct  234   LYPADPEFMRELRALCDKHDALLITDEVQCGLGRTGKLFAHELYDVTPDIMTLAKPLAGG  293

Query  1123  LPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVS  1278
             LPIGAVL++ KVA+ I  G HG+TF G PLVC  A TVL KI + +FL +V 
Sbjct  294   LPIGAVLMSNKVASGITPGQHGTTFGGNPLVCAVANTVLTKIMDEDFLENVQ  345



>gb|ETK81596.1| hypothetical protein, variant 2 [Phytophthora parasitica]
 gb|ETK81597.1| hypothetical protein, variant 3 [Phytophthora parasitica]
 gb|ETL35002.1| hypothetical protein, variant 2 [Phytophthora parasitica]
 gb|ETL35003.1| hypothetical protein, variant 3 [Phytophthora parasitica]
Length=408

 Score =   253 bits (645),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 132/231 (57%), Positives = 163/231 (71%), Gaps = 3/231 (1%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKF-QRFSH-PDMEQPPVEFIAFSNCF  762
             +ELAK LV  S  D+VFF+NSGTEANE A KFAR +  R S    +E    EFI+F + F
Sbjct  115   LELAKNLVDNSRFDKVFFANSGTEANEGAYKFARLYANRVSQGTPLEGKKFEFISFKHGF  174

Query  763   HGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGG  942
             HGRT  A+ LT K   R  F P++PGV + E+ +I++  +LI S K A VF+EP+QGEGG
Sbjct  175   HGRTAAALTLTHKPKIREAFMPLVPGVHYAEFNDIESVKKLI-SDKTAGVFIEPMQGEGG  233

Query  943   IYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGG  1122
             +Y A  EF++ LR  CD   +LL+ DEVQCGLGRTG L+AHE Y V PDIMTLAKPLAGG
Sbjct  234   LYPADPEFMRELRALCDKHDALLITDEVQCGLGRTGKLFAHELYDVTPDIMTLAKPLAGG  293

Query  1123  LPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASV  1275
             LPIGAVL++ KVA+ I  G HG+TF G PLVC  A TVL KI + +FL +V
Sbjct  294   LPIGAVLMSNKVASGITPGQHGTTFGGNPLVCAVANTVLTKIMDEDFLENV  344



>ref|XP_007416523.1| hypothetical protein MELLADRAFT_93780 [Melampsora larici-populina 
98AG31]
 gb|EGG00120.1| hypothetical protein MELLADRAFT_93780 [Melampsora larici-populina 
98AG31]
Length=452

 Score =   253 bits (647),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 146/313 (47%), Positives = 208/313 (66%), Gaps = 10/313 (3%)
 Frame = +1

Query  631   RVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHGRTMGAVALTSKEHY  810
             +VFF+NSG EANE A+KFARKF +   P  ++  +  + F + FHGRTMGA+++T +  Y
Sbjct  141   KVFFANSGAEANEGALKFARKFGKVQDPTGKKHGL--VCFGDGFHGRTMGALSVTYQPKY  198

Query  811   RSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYSATKEFLQALRTSC  990
             ++PFEP++PGVT  +  ++ A  +LI + +   V VEPIQGEGGI  A++EFL+ALR  C
Sbjct  199   QAPFEPLIPGVTHGKLNDVAALKDLI-TKETCGVIVEPIQGEGGIMEASEEFLRALRRRC  257

Query  991   DNAGSLLVFDEVQCGLGRTGYLWAHEAYGV--YPDIMTLAKPLAGGLPIGAVLVTEKVAA  1164
             D   ++L+FDE+QCGLGRTGYLWAH ++    +PDI+T+AKPLA G+PIGA+L+  +VA 
Sbjct  258   DEVKAVLIFDEIQCGLGRTGYLWAHASFDTDCHPDILTMAKPLANGIPIGAILMRNEVAN  317

Query  1165  AINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkellgkklggNNHV--  1338
              I  GDHG+TF GGPL  + A  VL++I+  +FLA V   G  LK+ L K       +  
Sbjct  318   VIQLGDHGTTFGGGPLQTSIAHHVLQRIARDDFLARVHHAGALLKDRLTKLSQDFPTLIT  377

Query  1339  KEIRglgliigielDVA--ATPLVEACQNSGLLVLTAGKGNVVRLVPPLIISKQELEQAA  1512
               IRG GL+ G+++  A     +V+ C+  G+LVL+ G  + VR VP LI+  QE+  A 
Sbjct  378   GPIRGRGLMAGMQMKKAEHVNEVVKMCRERGVLVLSCGN-STVRFVPSLIVEDQEIMMAT  436

Query  1513  DVLAACLPVLDKS  1551
             DVL A +  L ++
Sbjct  437   DVLGAVMQELVRT  449



>ref|WP_022206306.1| acetylornithine aminotransferase [Eubacterium sp. CAG:252]
 emb|CDB69131.1| acetylornithine aminotransferase [Eubacterium sp. CAG:252]
Length=393

 Score =   251 bits (641),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 141/323 (44%), Positives = 210/323 (65%), Gaps = 6/323 (2%)
 Frame = +1

Query  553   QTRKYFVHDFM*VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPP  732
              T  YF ++   V  AK L   S  DRVFF+NSGTE+ E AIK A+K+   ++    +  
Sbjct  73    HTSNYFYNEPA-VMAAKALTKASGMDRVFFTNSGTESIEGAIKLAKKY---AYLKTGRTD  128

Query  733   VEFIAFSNCFHGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAV  912
              E IA  + FHGR+MGA+A+T  +HY+  F P++PG+ F  Y ++++  +L+   K  A+
Sbjct  129   SEIIAMHHSFHGRSMGALAVTGNKHYQEAFGPMIPGIKFANYNDLESVKQLVND-KTCAI  187

Query  913   FVEPIQGEGGIYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDI  1092
               E +QGEGGIY AT EF+Q +R  CD  G LL+ DE+QCG+GRTG ++A+E YGV PDI
Sbjct  188   IFETVQGEGGIYPATNEFIQGVRKLCDEKGILLILDEIQCGMGRTGTMFAYEQYGVKPDI  247

Query  1093  MTLAKPLAGGLPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLAS  1272
             +T+AK L  G+PIGA L TE+VA A+  GDHG+T+ G PL C AA  V E       LA+
Sbjct  248   LTVAKALGCGVPIGAFLATEEVAKALVPGDHGTTYGGNPLACAAATKVFELFEKQNILAN  307

Query  1273  VSDkgqylkellgkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKG  1452
             V +   YL++ L + +G  + + E RGLGL+ G+EL ++   ++    ++GL++ +AG  
Sbjct  308   VKEVSAYLEKKLEELVGEYDFIVERRGLGLMQGLELSISPKDVIAKALDNGLILFSAGT-  366

Query  1453  NVVRLVPPLIISKQELEQAADVL  1521
             NV+R+VPPL+I+K ++++  + L
Sbjct  367   NVIRMVPPLVITKSDVDEMIEKL  389



>ref|WP_018250215.1| hypothetical protein [Orenia marismortui]
Length=397

 Score =   251 bits (641),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 143/318 (45%), Positives = 201/318 (63%), Gaps = 6/318 (2%)
 Frame = +1

Query  592   ELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHGR  771
             +L+K L+  S AD+VF+ NSG EANE AIK A+K+ +    +      E I   N FHGR
Sbjct  86    KLSKLLINNSCADKVFYGNSGAEANEGAIKLAKKYFKAKGENR----YEIITTINSFHGR  141

Query  772   TMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYS  951
             T+  +A T +  Y+ PFEP+  G   ++Y N+    E I + + AA+ VEPIQGEGG+  
Sbjct  142   TLTTLAATGQNKYQKPFEPIPTGFKHVDYNNLDMIKEAI-TEQTAAIMVEPIQGEGGVNP  200

Query  952   ATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLPI  1131
             ATK++LQ LR  CD  G +L+FDE+Q G+GRTG L+A+E YGV PDI T+AK L  G+P+
Sbjct  201   ATKKYLQGLREICDKEGIILIFDEIQTGIGRTGSLFAYEEYGVEPDIFTIAKALGNGVPV  260

Query  1132  GAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkellg  1311
              A L  E+VA+A   GDHGSTF G PL C AA T L+ I +   L    + G+Y K+ L 
Sbjct  261   SAFLAKEEVASAFEPGDHGSTFGGNPLACRAAYTTLKVILDQGLLDHTKEIGEYFKQKLL  320

Query  1312  kklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIISK  1491
             +       +KE+RG+GL++G+ELD+    +V      G+LVL+AGK N +R +PPLIISK
Sbjct  321   ELTDKYKFIKELRGMGLMLGLELDIEVKEIVMKLLRKGILVLSAGK-NTLRFLPPLIISK  379

Query  1492  QELEQAADVLAACLPVLD  1545
             + ++Q  +VL      ++
Sbjct  380   KHVDQVIEVLDEVFATIN  397



>gb|EUN23024.1| hypothetical protein COCVIDRAFT_41241 [Bipolaris victoriae FI3]
Length=484

 Score =   253 bits (647),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 139/318 (44%), Positives = 200/318 (63%), Gaps = 7/318 (2%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             ++L     G + A R F  NSG+EANEAAIKFARK  +   P+ ++   EFI+F N FHG
Sbjct  151   IQLTHATGGFASATRTFICNSGSEANEAAIKFARKVGKSISPNKDK--HEFISFHNSFHG  208

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMG+++ T    Y++PF P++PG  + ++ ++ A  EL+ +     V VEPIQGEGG+ 
Sbjct  209   RTMGSLSATPNPKYQTPFSPMIPGFRYGKFNDVDAVNELV-TDATCGVIVEPIQGEGGVN  267

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYG--VYPDIMTLAKPLAGG  1122
              AT EFL ALR  C   G++L+FDE+QCGLGRTG  WAH  Y    +PDI+T AK L  G
Sbjct  268   VATPEFLVALRKRCTEVGAVLIFDEIQCGLGRTGTFWAHGGYPKECHPDIVTTAKALGNG  327

Query  1123  LPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASV-SDkgqylk  1299
              PIGA +V + V   I  GDHG+TF G PL    A  +L ++S+PE L S+ + +  + K
Sbjct  328   FPIGATIVNDYVCDHIKTGDHGTTFGGNPLGSRVASYILSRLSSPEILDSIPAKEQAFRK  387

Query  1300  ellgkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPL  1479
                  +    + +KE+RG GLI+G++LD   TP+V A +  GLL++T G  N +R VPPL
Sbjct  388   HFDALRTRFPSQIKEVRGKGLILGLQLDTDPTPIVTAARERGLLIITCGT-NTLRFVPPL  446

Query  1480  IISKQELEQAADVLAACL  1533
             +I++ ++E+   +L   +
Sbjct  447   VITEAQIEEGMQILEKAM  464



>gb|EKE02225.1| hypothetical protein ACD_20C00410G0011 [uncultured bacterium]
Length=397

 Score =   250 bits (639),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 141/315 (45%), Positives = 202/315 (64%), Gaps = 5/315 (2%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             +ELA  LV  S  D+VFF NSG EA EAA+K ARK+ +  H    +   E I  +  FHG
Sbjct  84    IELADLLVKNSHFDKVFFCNSGAEAIEAALKLARKYGKKVHG---ENCYEIITMNQSFHG  140

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RT GA+  T +E Y+    P++PG+    Y + +A  + + + K  A+ +EPIQGEGGI 
Sbjct  141   RTFGAITATGQEKYQKDLNPLLPGILHTPYNDFEALKQKV-TDKTCAILIEPIQGEGGIR  199

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
              A KEFLQ +R  C     LL++DEVQCG+GRTG L+ +E Y + PD++ LAK L GG P
Sbjct  200   PADKEFLQKVRDLCTQKDILLIYDEVQCGIGRTGKLFGYENYDIPPDVIALAKGLGGGFP  259

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGA++  +KVA + N GDH STF G PL C A  TV+ ++ +   L +   +G+YL+E L
Sbjct  260   IGAMMAVDKVANSFNPGDHASTFGGNPLACTAGKTVMNQLLHKGVLNNAQIQGKYLREEL  319

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
                   +N + +IRGLGL+ GIEL++   P++E C N+GLL++ AG+  V+R VPPLII+
Sbjct  320   ENLKKQHNLIVDIRGLGLMQGIELNIPVKPIIEKCMNNGLLLIGAGE-KVIRFVPPLIIT  378

Query  1489  KQELEQAADVLAACL  1533
               E+++A ++L+  L
Sbjct  379   NNEIDEAMNILSNVL  393



>ref|XP_007706641.1| hypothetical protein COCCADRAFT_369 [Bipolaris zeicola 26-R-13]
 gb|EUC38941.1| hypothetical protein COCCADRAFT_369 [Bipolaris zeicola 26-R-13]
Length=484

 Score =   253 bits (646),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 139/318 (44%), Positives = 201/318 (63%), Gaps = 7/318 (2%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             ++L     G + A R F  NSG+EANEAAIKFARK  +   P+ ++   EFI+F N FHG
Sbjct  151   IQLTHATGGFASATRTFICNSGSEANEAAIKFARKVGKSISPNKDKH--EFISFHNSFHG  208

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMG+++ T    Y++PF P++PG  + ++ ++ A  EL+ +     V VEPIQGEGG+ 
Sbjct  209   RTMGSLSATPNPKYQTPFSPMIPGFRYGKFNDVDAVNELV-TDATCGVIVEPIQGEGGVN  267

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYG--VYPDIMTLAKPLAGG  1122
              AT EFL ALR  C   G++L+FDE+QCGLGRTG  WAH  Y    +PDI+T AK L  G
Sbjct  268   VATPEFLVALRKRCTEVGAVLIFDEIQCGLGRTGTFWAHGGYPKECHPDIVTTAKALGNG  327

Query  1123  LPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASV-SDkgqylk  1299
              PIGA +V + V   I  GDHG+TF G PL    A  +L ++S+PE L S+ + +  + K
Sbjct  328   FPIGATIVNDYVCDHIKTGDHGTTFGGNPLGSRVASYILSRLSSPEILDSIPAKEQAFRK  387

Query  1300  ellgkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPL  1479
                  ++   + +KE+RG GLI+G++LD   TP+V A +  GLL++T G  N +R VPPL
Sbjct  388   HFDALRIRFPSQIKEVRGKGLILGLQLDTDPTPIVTAARERGLLIITCGT-NTLRFVPPL  446

Query  1480  IISKQELEQAADVLAACL  1533
             +I++ ++E+   +L   +
Sbjct  447   VITEAQIEEGMQILEKAM  464



>gb|EMD96040.1| hypothetical protein COCHEDRAFT_1221688 [Bipolaris maydis C5]
 gb|ENI10900.1| hypothetical protein COCC4DRAFT_55562 [Bipolaris maydis ATCC 
48331]
Length=484

 Score =   253 bits (646),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 139/318 (44%), Positives = 199/318 (63%), Gaps = 7/318 (2%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             ++L     G + A R F  NSG+EANEAAIKFARK  +   P+ ++   EF++F N FHG
Sbjct  151   IQLTHATGGFASATRTFICNSGSEANEAAIKFARKVGKSISPNKDK--YEFVSFHNSFHG  208

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMG+++ T    Y++PF P++PG  + ++ ++ A  EL+ +     V VEPIQGEGG+ 
Sbjct  209   RTMGSLSATPNPKYQAPFSPMIPGFRYGKFNDVDAVNELV-TDATCGVIVEPIQGEGGVN  267

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYG--VYPDIMTLAKPLAGG  1122
              AT EFL ALR  C   G++LVFDE+QCGLGRTG  WAH  Y    +PDI+T AK L  G
Sbjct  268   VATPEFLVALRKRCTEVGAVLVFDEIQCGLGRTGTFWAHGGYPKECHPDIVTTAKALGNG  327

Query  1123  LPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASV-SDkgqylk  1299
              PIGA +V + V   I  GDHG+TF G PL    A  +L ++S+PE L S+ + +  + K
Sbjct  328   FPIGATIVNDYVCDHIKTGDHGTTFGGNPLGSRVASYILSRLSSPEILESIPAKEEAFRK  387

Query  1300  ellgkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPL  1479
                  +    + +KE+RG GLI+G++LD   TP+V A +  GLL++T G  N +R VPPL
Sbjct  388   HFDALRTRFPDQIKEVRGKGLILGLQLDTDPTPIVTAARERGLLIITCGT-NTLRFVPPL  446

Query  1480  IISKQELEQAADVLAACL  1533
             +I+  ++E+   +L   +
Sbjct  447   VITGAQIEEGMQILEKAM  464



>emb|CCA20043.1| acetylornithine aminotransferase putative [Albugo laibachii Nc14]
Length=424

 Score =   251 bits (641),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 145/319 (45%), Positives = 193/319 (61%), Gaps = 10/319 (3%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPD--MEQPPVEFIAFSNCF  762
             +ELAK L+  S  D+VFF NSGTEANE A KFAR +         +E   +EFI+F   F
Sbjct  99    LELAKMLIDHSSFDKVFFCNSGTEANEGAYKFARLYANMKAKGTALEGQKMEFISFKGGF  158

Query  763   HGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGG  942
             HGRT  A+ LT K   R  F P++PGV + EY +I     LI S K A V +EPIQGEGG
Sbjct  159   HGRTAAALTLTYKPAIREAFMPLIPGVRYAEYNDIDHVRSLI-SKKTAGVIIEPIQGEGG  217

Query  943   IYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGG  1122
             +  A   FL+ LR  CD   +LL+ DEVQCGLGRTG L+AHE Y V PDIMTLAKPLAGG
Sbjct  218   VVPANASFLKELRALCDENDALLIADEVQCGLGRTGKLFAHEWYEVAPDIMTLAKPLAGG  277

Query  1123  LPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASV-SDkgqylk  1299
             LPIGAVLV + VA  +  G HG+TF G PL+C  A  VL+KI + EFLA+V +      +
Sbjct  278   LPIGAVLVRDHVADVVTPGLHGTTFGGNPLICKVAEVVLKKIKSTEFLANVQARGAYLAQ  337

Query  1300  ellgkklggNNHVKEIRglgliigielDVA----ATPLVE-ACQNSGLLVLTAGKGNVVR  1464
              L   +    + + E+R       + + V       PL + A     LL+++AG+   +R
Sbjct  338   RLEALQAKFPDKITEVRVPLGRQALFMGVECKNPVNPLTKFALMEKNLLLISAGE-KTIR  396

Query  1465  LVPPLIISKQELEQAADVL  1521
             L PPLI+++++++   + +
Sbjct  397   LCPPLIVTEKDIDWVVNTI  415



>ref|XP_008021658.1| hypothetical protein SETTUDRAFT_166841 [Setosphaeria turcica 
Et28A]
 gb|EOA90973.1| hypothetical protein SETTUDRAFT_166841 [Setosphaeria turcica 
Et28A]
Length=484

 Score =   253 bits (645),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 139/318 (44%), Positives = 197/318 (62%), Gaps = 7/318 (2%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             ++L     G + A R F  NSG+EANEAAIKFARK  +   PD ++   EF++F N FHG
Sbjct  151   IQLTHATGGFASATRTFICNSGSEANEAAIKFARKVGKSLSPDKDK--HEFVSFHNSFHG  208

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMG+++ T    Y+ PF P++PG  +  + ++ A  EL+       V +EPIQGEGG+ 
Sbjct  209   RTMGSLSATPNPKYQKPFSPMVPGFRYGTFNDVAAINELVTEA-TCGVIIEPIQGEGGVN  267

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYG--VYPDIMTLAKPLAGG  1122
              AT EFL ALR  C    ++L+FDE+QCGLGRTG  WAH  Y    +PDI+T AK L  G
Sbjct  268   VATPEFLVALRKRCTEVRAVLIFDEIQCGLGRTGTFWAHGGYPKECHPDILTTAKALGNG  327

Query  1123  LPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASV-SDkgqylk  1299
              PIGA +V + V   I  GDHG+TF G PL    A  +L ++S+PE L S+ + +  + K
Sbjct  328   FPIGATIVNDFVCDHIKTGDHGTTFGGNPLGSRVASYILSRLSSPEILDSIPAKEQAFRK  387

Query  1300  ellgkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPL  1479
                  +    +H+KE+RG GLI+G++LD   TP+V A +  GLL++T G  N +R VPPL
Sbjct  388   HFDALRDRFPDHIKEVRGKGLILGLQLDADPTPIVTAARERGLLIITCGT-NTLRFVPPL  446

Query  1480  IISKQELEQAADVLAACL  1533
             +I++ E+E+   +L   +
Sbjct  447   VITEAEIEEGMQILKQAM  464



>ref|XP_001935646.1| acetylornithine aminotransferase, mitochondrial precursor [Pyrenophora 
tritici-repentis Pt-1C-BFP]
 gb|EDU48233.1| acetylornithine aminotransferase, mitochondrial precursor [Pyrenophora 
tritici-repentis Pt-1C-BFP]
Length=484

 Score =   253 bits (645),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 137/318 (43%), Positives = 199/318 (63%), Gaps = 7/318 (2%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             ++L     G + A R F  NSG+EANEAAIKFARK  +   PD ++   EF++F N FHG
Sbjct  151   IQLTHATGGFASASRTFICNSGSEANEAAIKFARKVGKSISPDKDKH--EFVSFHNSFHG  208

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMG+++ T    Y++PF P++PG  +  + ++    +L+ +     V +EPIQGEGG+ 
Sbjct  209   RTMGSLSATPNPKYQTPFSPMVPGFKYGTFNDVNVINDLV-TDATCGVIIEPIQGEGGVN  267

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYG--VYPDIMTLAKPLAGG  1122
              +T EFL ALR  C   G++L+FDE+QCGLGRTG  WAH  Y    +PDI+T AK L  G
Sbjct  268   VSTPEFLLALRKRCTEVGAVLIFDEIQCGLGRTGTFWAHAGYPKECHPDIVTTAKALGNG  327

Query  1123  LPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASV-SDkgqylk  1299
              PIGA +V + V   I  GDHG+TF G PL    A  +L ++S+PE L S+ + +  + K
Sbjct  328   FPIGATIVNDFVCDHIKTGDHGTTFGGNPLGSRVASYILSRLSSPEILDSIPAKEQAFRK  387

Query  1300  ellgkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPL  1479
                  +   +  +KE+RG GLI+G++LDV  TP+V A +  GLL++T G  N +R VPPL
Sbjct  388   HFDALRARFSTQIKEVRGKGLILGLQLDVDPTPIVTAARERGLLIITCGT-NTLRFVPPL  446

Query  1480  IISKQELEQAADVLAACL  1533
             +I++ E+E+   +L   +
Sbjct  447   VITEAEIEEGMRILGQAM  464



>ref|XP_007694616.1| hypothetical protein COCSADRAFT_195071 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD69226.1| hypothetical protein COCSADRAFT_195071 [Bipolaris sorokiniana 
ND90Pr]
Length=484

 Score =   252 bits (644),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 138/318 (43%), Positives = 200/318 (63%), Gaps = 7/318 (2%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             ++L     G + A R F  NSG+EANEAAIKFARK  +   P+ ++   EF++F N FHG
Sbjct  151   IQLTHATGGFASATRTFICNSGSEANEAAIKFARKVGKSVSPNKDKH--EFVSFHNSFHG  208

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMG+++ T    Y++PF P++PG  + ++ ++ A  EL+ +     V VEPIQGEGG+ 
Sbjct  209   RTMGSLSATPNPKYQTPFSPMVPGFRYGKFNDVDAVNELV-TDATCGVIVEPIQGEGGVN  267

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYG--VYPDIMTLAKPLAGG  1122
              AT EFL ALR  C   G++L+FDE+QCGLGRTG  WAH  Y    +PDI+T AK L  G
Sbjct  268   VATPEFLIALRKRCTEVGAVLIFDEIQCGLGRTGTFWAHGGYPKECHPDIVTTAKALGNG  327

Query  1123  LPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASV-SDkgqylk  1299
              PIGA +V + V   I  GDHG+TF G PL    A  +L ++S+PE L S+ + +  + K
Sbjct  328   FPIGATIVNDYVCDHIKTGDHGTTFGGNPLGSRVASYILSRLSSPEILDSIPAKEQAFRK  387

Query  1300  ellgkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPL  1479
                  +    + +KE+RG GLI+G++LD   TP+V A +  GLL++T G  N +R VPPL
Sbjct  388   HFDALRTRFPSQIKEVRGKGLILGLQLDTDPTPIVTAARERGLLIITCGT-NTLRFVPPL  446

Query  1480  IISKQELEQAADVLAACL  1533
             +I++ ++E+   +L   +
Sbjct  447   VITEAQIEEGMQILEKAM  464



>ref|XP_503166.1| YALI0D22847p [Yarrowia lipolytica]
 sp|Q6C846.1|ARGD_YARLI RecName: Full=Acetylornithine aminotransferase, mitochondrial; 
Short=ACOAT; Flags: Precursor [Yarrowia lipolytica CLIB122]
 emb|CAG81366.1| YALI0D22847p [Yarrowia lipolytica CLIB122]
Length=411

 Score =   250 bits (638),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 140/308 (45%), Positives = 195/308 (63%), Gaps = 10/308 (3%)
 Frame = +1

Query  613   GCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHGRTMGAVAL  792
             G   A +VF +NSGTEANEAA+KFARK    S PD      EF+ F   FHGRTMGA+++
Sbjct  106   GMKGARKVFLANSGTEANEAALKFARKVGTLSSPD----KTEFVNFEKAFHGRTMGALSV  161

Query  793   TSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYSATKEFLQ  972
             T    Y++PF P++PGV    Y + +AA  + +  K   V VEP+QGEGG+Y A  EFLQ
Sbjct  162   TPNPKYQAPFAPLVPGVKTGVYNDPKAADLITE--KTCGVIVEPVQGEGGVYKANDEFLQ  219

Query  973   ALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLPIGAVLVTE  1152
             ALR  CD  G++L+FDE+QCGLGRTG LWAH+   V+PDI+T+AK L  G PIGA +VTE
Sbjct  220   ALRNKCDEVGAMLIFDEIQCGLGRTGRLWAHDK--VHPDILTMAKALGNGFPIGATMVTE  277

Query  1153  KVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkellgkklgg-N  1329
              VA  I  GDHG+T+ G PL       VL ++++ E L +V    Q +++ + +      
Sbjct  278   AVADKIAIGDHGTTYGGNPLASRVGHYVLSQVASKEVLDNVKKVSQQIRDAVAEVQEEFP  337

Query  1330  NHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIISKQELEQA  1509
               + E+RG GL++GI+     + +V A + +GLLV+TAG  N VRLVP L I ++ + + 
Sbjct  338   ELITEVRGDGLLLGIQFSKDPSKVVAAARENGLLVITAGT-NTVRLVPALNIDQEAVTEG  396

Query  1510  ADVLAACL  1533
              ++L   +
Sbjct  397   LEILKKAI  404



>ref|WP_038067649.1| acetylornithine aminotransferase [Thermotoga neapolitana]
 gb|KFZ21565.1| acetylornithine aminotransferase [Thermotoga neapolitana LA10]
Length=384

 Score =   249 bits (635),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 147/316 (47%), Positives = 207/316 (66%), Gaps = 8/316 (3%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             +ELA+ L   +F  +VFF+N+GTEANEAAIK ARK+ +       +   + ++  N FHG
Sbjct  73    MELAELLSKNTFGGKVFFANTGTEANEAAIKIARKYGKMKS----EKKFKILSARNSFHG  128

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RT+G++  T +  Y+ PFEP++PG  + E+ NI+   + + S ++ A+F+EPIQGE GI 
Sbjct  129   RTLGSLTATGQPKYQKPFEPLVPGFDYFEFNNIEDLRKKV-SDEVCAIFLEPIQGESGII  187

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
              ATKEFL+  R  CD    LLVFDEVQCG+GRTG L+A++ YGV PDI+T+AK L GG+P
Sbjct  188   PATKEFLEEARRLCDEYDILLVFDEVQCGMGRTGKLFAYQKYGVTPDILTVAKGLGGGVP  247

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGAV+V EK A  +  GDHG+TF G PL C A VTV+++++   FL  V  KG+YL E L
Sbjct  248   IGAVVVNEK-ANVLEPGDHGTTFGGNPLACRAGVTVMKELTKEGFLDEVDRKGRYLLEKL  306

Query  1309  gkklggNNHVKEIRglgliigielD-VAATPLVEACQNSGLLVLTAGKGNVVRLVPPLII  1485
              +     + V+++RG+GL+IGI+   V    +   C   GLLV+ AG  N VRL+PPL +
Sbjct  307   SRMKEKYSAVEDVRGMGLMIGIQFSGVENKNVAMKCFEKGLLVVPAGN-NTVRLLPPLTV  365

Query  1486  SKQELEQAADVLAACL  1533
                E++ A  +L   L
Sbjct  366   EYGEIDTALRILEEVL  381



>ref|XP_007683105.1| hypothetical protein COCMIDRAFT_82121 [Bipolaris oryzae ATCC 
44560]
 gb|EUC50516.1| hypothetical protein COCMIDRAFT_82121 [Bipolaris oryzae ATCC 
44560]
Length=484

 Score =   252 bits (643),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 138/318 (43%), Positives = 198/318 (62%), Gaps = 7/318 (2%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             ++L     G + A R F  NSG+EANEAAIKFARK  +   P+ ++   EF++F N FHG
Sbjct  151   IQLTHATGGFASATRTFICNSGSEANEAAIKFARKVGKSISPNKDK--HEFVSFHNSFHG  208

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMG+++ T    Y++PF P++PG  +  + ++ A  EL+ +     V VEPIQGEGG+ 
Sbjct  209   RTMGSLSATPNPKYQTPFSPMIPGFRYGTFNDVDAVNELV-TDATCGVIVEPIQGEGGVN  267

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYG--VYPDIMTLAKPLAGG  1122
              AT EFL ALR  C   G++L+FDE+QCGLGRTG  WAH  Y    +PDI+T AK L  G
Sbjct  268   VATPEFLVALRKRCTEVGAVLIFDEIQCGLGRTGTFWAHGGYPKECHPDIVTTAKALGNG  327

Query  1123  LPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASV-SDkgqylk  1299
              PIGA +V + V   I  GDHG+TF G PL    A  +L ++S+PE L S+ + +  + K
Sbjct  328   FPIGATIVNDYVCDHIKTGDHGTTFGGNPLGSRVASYILSRLSSPEILESIPAKEQAFRK  387

Query  1300  ellgkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPL  1479
                  +      +KE+RG GLI+G++LD   TP+V A +  GLL++T G  N +R VPPL
Sbjct  388   HFDALRTRFPGQIKEVRGKGLILGLQLDTDPTPIVTAARERGLLIITCGT-NTLRFVPPL  446

Query  1480  IISKQELEQAADVLAACL  1533
             +I++ ++E+   +L   +
Sbjct  447   VITESQIEEGMQILEKAM  464



>ref|XP_011106933.1| hypothetical protein H072_941 [Dactylellina haptotyla CBS 200.50]
 gb|EPS45053.1| hypothetical protein H072_941 [Dactylellina haptotyla CBS 200.50]
Length=469

 Score =   251 bits (642),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 145/307 (47%), Positives = 197/307 (64%), Gaps = 10/307 (3%)
 Frame = +1

Query  625   ADRVFFSNSGTEANEAAIKFARKFQRFS-HPDMEQPPVEFIAFSNCFHGRTMGAVALTSK  801
             A +VF  NSG+EANEAAIKFARK  + S +PD  Q    F++F N FHGRTMG+++ T  
Sbjct  153   ASKVFICNSGSEANEAAIKFARKVGKTSGNPDKTQ----FVSFHNSFHGRTMGSLSATPN  208

Query  802   EHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYSATKEFLQALR  981
               Y+ PF P++PG  +    ++ A  EL+    +  V VEPIQGEGGI++AT+EFL AL+
Sbjct  209   TKYQKPFGPMVPGFKYGNLNDVAAIDELVDE-NVCGVIVEPIQGEGGIHAATEEFLVALK  267

Query  982   TSCDNAGSLLVFDEVQCGLGRTGYLWAHEAY--GVYPDIMTLAKPLAGGLPIGAVLVTEK  1155
               C++ G++L++DE+QCGLGRTG LWAH       +PDIMT AK L  G+P+GA +VTEK
Sbjct  268   KRCEDVGAVLIYDEIQCGLGRTGELWAHSILPKEAHPDIMTTAKALGNGVPVGATIVTEK  327

Query  1156  VAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqy-lkellgkklggNN  1332
             VA  I  GDHG+TF G PL    A  V  ++S+ E L  V  KG     +L   K     
Sbjct  328   VAEKIVIGDHGTTFGGNPLATRVAHHVFSRLSSTEMLREVQRKGDIFKNQLEKMKAKYPG  387

Query  1333  HVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIISKQELEQAA  1512
              + EIRG GLIIG++L      +V  C++ GLL+LTAG  N +R+VPPL+I+ +++ Q  
Sbjct  388   LISEIRGRGLIIGVQLTKEPGNIVTECRDKGLLILTAGT-NTLRIVPPLVITDEQINQGL  446

Query  1513  DVLAACL  1533
             D+L   L
Sbjct  447   DILEGVL  453



>ref|XP_009841736.1| hypothetical protein H257_15347 [Aphanomyces astaci]
 gb|ETV68782.1| hypothetical protein H257_15347 [Aphanomyces astaci]
Length=449

 Score =   251 bits (640),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 148/312 (47%), Positives = 195/312 (63%), Gaps = 9/312 (3%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKF-QRFSH-PDMEQPPVEFIAFSNCF  762
             + LA+ LV  S  D+VFF+NSGTEANE A KFAR +  + SH  ++E      IAF   F
Sbjct  124   LRLAQTLVENSGFDKVFFANSGTEANEGAYKFARLYGNKVSHGTELEGQKNHVIAFKGGF  183

Query  763   HGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGG  942
             HGR+ GA++LT K   R PF P++PGV+F EY N+     LI S +  A+ VEPIQGEGG
Sbjct  184   HGRSSGALSLTYKPAIREPFLPLVPGVSFAEYNNLDDVRRLI-STRTCAIIVEPIQGEGG  242

Query  943   IYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGG  1122
             +  AT  FLQ LR   D   +LL+ DEVQ GLGRTG L+ HE YGV PDIMTLAKPLA G
Sbjct  243   VLPATPGFLQGLRALADEFDALLICDEVQTGLGRTGKLFGHEVYGVQPDIMTLAKPLANG  302

Query  1123  LPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylke  1302
             LPIGAVL + KVA A+  G HG+TF G P+VC AA  V+ ++  P FL  V   G+ L +
Sbjct  303   LPIGAVLTSNKVAEAVPAGAHGTTFGGNPVVCEAANVVVNRLLQPGFLLHVQKMGRLLAQ  362

Query  1303  llgkklggN-NHVKEIRglgliigielDVA----ATPLVEACQNSGLLVLTAGKGNVVRL  1467
              L      + + + EIR      G+   V     A P++    + G+L +TAG+  V+RL
Sbjct  363   GLKSVQAKHPDKIAEIRLPIGEAGLYAGVELVGPAAPIIGDLVDQGVLAITAGE-KVIRL  421

Query  1468  VPPLIISKQELE  1503
              PPL++++ E++
Sbjct  422   CPPLVVTQDEVQ  433



>ref|WP_026485820.1| acetylornithine aminotransferase [Caldanaerobius polysaccharolyticus]
Length=395

 Score =   249 bits (635),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 147/324 (45%), Positives = 206/324 (64%), Gaps = 15/324 (5%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             VELAK LV  SF D+VFF NSG EANEAAIK ARK+ +  + + +      I   + FHG
Sbjct  81    VELAKLLVENSFGDKVFFCNSGAEANEAAIKLARKYSKKKYGEHKYG---IITMQHSFHG  137

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RT+G++  T +  Y   FEP++ G  ++ + +I A  + I      AV +EPIQGEGGIY
Sbjct  138   RTLGSLTATGQTKYHEGFEPLVEGFKYVPFNDIDALKDAIDE-NTCAVMMEPIQGEGGIY  196

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
              A + +L+ +R  CD  G LL+FDEVQCG+GRTG L+A++ YGV PDIMTLAK +AGGLP
Sbjct  197   EADEGYLRKVRELCDEKGLLLIFDEVQCGMGRTGELFAYQHYGVQPDIMTLAKAIAGGLP  256

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             +GA++ T++VA+A   GDH STF G P+ C A V V++     E L  V D  + + E L
Sbjct  257   LGAMIATDEVASAFKPGDHASTFGGNPVACAAGVAVIK-----ELLGGVIDNAREIGEYL  311

Query  1309  gkklggNNH----VKEIRglgliigielDVA-ATPLVEACQNSGLLVLTAGKGNVVRLVP  1473
               +L   N     + E+RG GL++G+E ++     +V      GLLVL+AG   VVR+VP
Sbjct  312   KSRLLELNKTHPVINEVRGRGLMLGVEFNMQEVAEVVNRAMKKGLLVLSAGH-KVVRMVP  370

Query  1474  PLIISKQELEQAADVLAACLPVLD  1545
             PLII+K E+++A ++L   L  ++
Sbjct  371   PLIITKAEVDKAVEILDQVLKEME  394



>gb|EMG45834.1| Acetylornithine aminotransferase, mitochondrial [Candida maltosa 
Xu316]
Length=448

 Score =   250 bits (639),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 142/322 (44%), Positives = 191/322 (59%), Gaps = 17/322 (5%)
 Frame = +1

Query  592   ELAKRLV-------GCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAF  750
             ELA +LV       G   A RVF  NSGTEANEAA+KFARK+ +  +PD      EFI F
Sbjct  124   ELANKLVTKTKEFDGMKDASRVFLCNSGTEANEAALKFARKYGKSKNPDK----YEFITF  179

Query  751   SNCFHGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQ  930
              N FHGRTMGA+++T    Y+ PF P++PGV   +  +I +   LI   K  AV +EPIQ
Sbjct  180   ENSFHGRTMGALSVTPNPKYQEPFSPLIPGVHVAKPNDIDSVKALINKDKTCAVIIEPIQ  239

Query  931   GEGGIYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYG--VYPDIMTLA  1104
             GEGG+     EFL  LR  CD+   LL++DE+QCGLGR+G LWAH   G   +PDI+T+A
Sbjct  240   GEGGVNPVDTEFLVELRKLCDDNDVLLIYDEIQCGLGRSGKLWAHSWLGPDAHPDIVTIA  299

Query  1105  KPLAGGLPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDk  1284
             K L  G PIGA ++TEKV  A++ GDHG+T+ G PL       ++EKI++  FL+ V DK
Sbjct  300   KALGNGFPIGATMITEKVEGALSVGDHGTTYGGNPLASTIGSFIVEKIADEAFLSQVQDK  359

Query  1285  gqylkellgkklggN-NHVKEIRgl--gliigielDVAATPLVEACQNSGLLVLTAGKGN  1455
                  E L +    N   + +++G    L +    D     +VE C+  GLLV+TAG  N
Sbjct  360   SAKFIEGLNEIAEENPEDILKVKGKGLLLGLQFRPDFDINKVVEKCREYGLLVITAGM-N  418

Query  1456  VVRLVPPLIISKQELEQAADVL  1521
              +RLVP L I  + + +   +L
Sbjct  419   TIRLVPALNIPDEAITEGLSIL  440



>ref|WP_022204260.1| acetylornithine aminotransferase [Eubacterium sp. CAG:248]
 emb|CDB66870.1| acetylornithine aminotransferase [Eubacterium sp. CAG:248]
Length=393

 Score =   249 bits (635),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 137/323 (42%), Positives = 208/323 (64%), Gaps = 6/323 (2%)
 Frame = +1

Query  553   QTRKYFVHDFM*VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPP  732
              T  YF ++   V  A+ +   S  DRVFF+NSGTE+ E AIK A+K+   ++    +  
Sbjct  73    HTSNYFYNEPA-VSAAQAITKASGMDRVFFTNSGTESIEGAIKLAKKY---AYLKTGRTD  128

Query  733   VEFIAFSNCFHGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAV  912
              E IA  + FHGR+MGA+A+T  +HY+  F P++PG+ F  Y ++++  +L+   K  A+
Sbjct  129   SEIIAMHHSFHGRSMGALAVTGNKHYQEAFGPMIPGIKFANYNDLESVKQLVND-KTCAI  187

Query  913   FVEPIQGEGGIYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDI  1092
               E +QGEGGIY AT EF+Q +R  CD  G LL+ DE+QCG+GRTG ++A + YGV PDI
Sbjct  188   IFETVQGEGGIYPATNEFIQGVRKLCDEKGILLILDEIQCGMGRTGTMFAFQQYGVKPDI  247

Query  1093  MTLAKPLAGGLPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLAS  1272
             +T+AK L  G+P+GA L TE+VA A+  GDHG+T+ G PL C AA  V E       LA+
Sbjct  248   LTVAKALGCGVPVGAFLATEEVAKALVPGDHGTTYGGNPLACAAATKVFELFEKQNILAN  307

Query  1273  VSDkgqylkellgkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKG  1452
             V +   YL++ L + +   + + E RGLGL+ G+EL ++   ++    ++GL++ +AG  
Sbjct  308   VKEVSAYLEKKLDELVKDYDFIVERRGLGLMQGLELSISPKDVIARALDNGLILFSAGT-  366

Query  1453  NVVRLVPPLIISKQELEQAADVL  1521
             NV+R+VPPL+I+K ++++  D L
Sbjct  367   NVIRMVPPLVITKSDVDEMIDKL  389



>ref|XP_004362086.1| acetylornithine transaminase [Dictyostelium fasciculatum]
 gb|EGG24235.1| acetylornithine transaminase [Dictyostelium fasciculatum]
Length=510

 Score =   251 bits (642),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 141/345 (41%), Positives = 194/345 (56%), Gaps = 48/345 (14%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             +ELA++L+  S  D+ FF+NSGTEANE A+KFAR+     +P+     +  IAF++ F G
Sbjct  179   IELAQKLIAYSSFDKCFFANSGTEANEGALKFARRHGLSKNPN----KINVIAFTHGFSG  234

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             R+MGA++ T K  YR  + P++PG+ F +Y NI +  ELI S    AV +EP+QGEGG+ 
Sbjct  235   RSMGALSCTHKSKYREIYGPLVPGIAFADYNNIDSVRELI-SDNTCAVLIEPVQGEGGLE  293

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             +A  +F+Q L   C    +LL+ DEVQCG+GRTG LWAHE  GV PDIMTLAKPLA GLP
Sbjct  294   AARPDFMQDLEKLCREHDALLIVDEVQCGVGRTGRLWAHERLGVQPDIMTLAKPLANGLP  353

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGA+LV E VA  I  GDHG+T+ GGPLVC  A  V  +I+N +FL  V           
Sbjct  354   IGAILVREHVAQVIGQGDHGTTYGGGPLVCAVANNVFGRIANEDFLREV-----------  402

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLV------------------  1434
                      VK  R +  +  I       P+++     GL V                  
Sbjct  403   --------RVKGARIVTRLTQISKSSHGQPIIDIRTTGGLFVGVEFDHPVKELIAFANTH  454

Query  1435  -----LTAGKGNVVRLVPPLIISKQELEQAADVLAACLPVLDKST  1554
                  ++AG  N +RL P L + +++++ A D + A L   +KS 
Sbjct  455   HKVLFISAGD-NTIRLCPSLTVPQEDIDIAIDAIEAYLKSKEKSN  498



>ref|WP_022360979.1| acetylornithine aminotransferase 1 [Bacteroides pectinophilus 
CAG:437]
 emb|CDD55632.1| acetylornithine aminotransferase 1 [Bacteroides pectinophilus 
CAG:437]
Length=397

 Score =   248 bits (633),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 140/315 (44%), Positives = 199/315 (63%), Gaps = 8/315 (3%)
 Frame = +1

Query  598   AKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHGRTM  777
             AK +   S  DRVFF+NSGTEA E AIK A+K+        +    E IA  + FHGR+M
Sbjct  87    AKAITEVSGMDRVFFTNSGTEAIEGAIKLAKKYAYLKDGSTDH---EIIAMQHSFHGRSM  143

Query  778   GAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYSAT  957
             GA+A+T   HY+  F P++PG+ F +Y N+ +  EL+   K  A+  E +QGEGGIY A 
Sbjct  144   GALAVTGNRHYQEAFGPMIPGIKFAQYNNLASVEELVND-KTCAIIFETVQGEGGIYPAK  202

Query  958   KEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLPIGA  1137
              EF++ +R  CD  G LL+ DE+QCG+GRTG ++A+E YGV PDI+T+AK L  G+P+GA
Sbjct  203   PEFIKGVRKLCDEKGILLILDEIQCGMGRTGTMFAYEQYGVKPDILTVAKALGCGVPVGA  262

Query  1138  VLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkellgkk  1317
              L  E+VA A+  GDHG+T+ G PL C AAV VLE       L +V     YL++ L + 
Sbjct  263   FLAREEVAKALVPGDHGTTYGGNPLACAAAVKVLELFKKQNVLDNVKKVSAYLEKKLDEI  322

Query  1318  lggNNHVKEIRglgliigielDVAATPL---VEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
             +   ++V E RGLGL+ G+E++     L   + AC ++GL++ TAG  NV+R VPPL+IS
Sbjct  323   VAEYDYVVERRGLGLMQGLEINTDVKDLKKVIAACLDNGLILFTAGT-NVIRFVPPLVIS  381

Query  1489  KQELEQAADVLAACL  1533
             + ++++    L   L
Sbjct  382   EADVDEMITKLKKAL  396



>ref|XP_001797854.1| hypothetical protein SNOG_07520 [Phaeosphaeria nodorum SN15]
 gb|EAT84986.2| hypothetical protein SNOG_07520 [Phaeosphaeria nodorum SN15]
Length=401

 Score =   248 bits (632),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 134/318 (42%), Positives = 199/318 (63%), Gaps = 7/318 (2%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             ++L     G   A + F  NSG+EANEAAIKFARK  +   P+ ++   +F++F N FHG
Sbjct  68    IQLTHATGGFESASKTFICNSGSEANEAAIKFARKVGKSISPNKDKH--DFVSFHNSFHG  125

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMG+++ T    Y++PF P++PG  + ++ +I A  +L+       V +EPIQGEGG+ 
Sbjct  126   RTMGSLSATPNPKYQTPFSPMVPGFRYGKFNDIDAINDLVTE-STCGVIIEPIQGEGGVN  184

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAY--GVYPDIMTLAKPLAGG  1122
              AT EFL ALR  C   G++L+ DE+QCGLGRTG  WAH  Y    +PDI+T AK L  G
Sbjct  185   VATPEFLLALRKRCTEVGAVLIHDEIQCGLGRTGRFWAHAGYPKECHPDIVTTAKALGNG  244

Query  1123  LPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASV-SDkgqylk  1299
              PIGA +V + V   I  GDHG+TF G PL    A  +L ++S+PE L S+ + +  + K
Sbjct  245   FPIGATIVNDFVCDHIKTGDHGTTFGGNPLGSRVASYILSRLSSPEILDSIPAKEAAFRK  304

Query  1300  ellgkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPL  1479
                  +   ++ +KE+RG GLI+G++LD   TP++ A +  GLLV++ G  N +R VPPL
Sbjct  305   HFDALRTRFSDQIKEVRGKGLILGLQLDTDPTPIITAARERGLLVISCGT-NTLRFVPPL  363

Query  1480  IISKQELEQAADVLAACL  1533
             +I++ E+E+   +L + +
Sbjct  364   VITEAEIEEGMQILGSAM  381



>ref|XP_007373081.1| acetylornithine aminotransferase [Spathaspora passalidarum NRRL 
Y-27907]
 gb|EGW35669.1| acetylornithine aminotransferase [Spathaspora passalidarum NRRL 
Y-27907]
Length=422

 Score =   248 bits (634),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 144/324 (44%), Positives = 197/324 (61%), Gaps = 19/324 (6%)
 Frame = +1

Query  592   ELAKRLV-------GCSFADRVFFSNSGTEANEAAIKFARKF-QRFSHPDMEQPPVEFIA  747
             ELA +LV       G   A RVF  NSGTEANEAA+KFARK+ ++FS     Q  +E I 
Sbjct  97    ELANKLVEKTKESGGLHNAQRVFLCNSGTEANEAALKFARKYGKQFS-----QDKIEIIT  151

Query  748   FSNCFHGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPI  927
             F N FHGR+MGA+A+T    Y+ PF P++PGV      +I +  +LI   K  AV +EPI
Sbjct  152   FENSFHGRSMGALAVTPNPKYQQPFAPLIPGVQVANTKDISSVEKLISKEKTCAVIIEPI  211

Query  928   QGEGGIYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAY--GVYPDIMTL  1101
             QGEGGI +   EFL  LR  C +   +L++DE+QCGLGRTG LWAH       +PDI+T+
Sbjct  212   QGEGGINTVDAEFLGQLRKLCTDNNVVLIYDEIQCGLGRTGKLWAHSHLPESAHPDIVTM  271

Query  1102  AKPLAGGLPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSD  1281
             AK L  G PIGA L+TE++  A++ GDHG+T+ G PL       V+++ISN EFL  V++
Sbjct  272   AKALGNGFPIGATLITEQIEKALSVGDHGTTYGGNPLGSRIGTYVVDQISNDEFLEGVNE  331

Query  1282  kgqylkellgkklggN-NHVKEIRgl--gliigielDVAATPLVEACQNSGLLVLTAGKG  1452
             K       L K    + +HV E++G    L +  + +V    +V  C+ +GLLV+TAG  
Sbjct  332   KSAKFIAGLTKIAEQHPDHVIEVKGKGLLLGLQFKPEVDIGAIVAKCRENGLLVITAGM-  390

Query  1453  NVVRLVPPLIISKQELEQAADVLA  1524
             NV+RLVP L I    +++   +LA
Sbjct  391   NVIRLVPALNIPNDVIDRGLSILA  414



>ref|XP_004344556.1| acetylornithine and succinylornithine aminotransferase [Capsaspora 
owczarzaki ATCC 30864]
 gb|EFW41803.1| acetylornithine and succinylornithine aminotransferase [Capsaspora 
owczarzaki ATCC 30864]
Length=472

 Score =   249 bits (636),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 142/317 (45%), Positives = 202/317 (64%), Gaps = 11/317 (3%)
 Frame = +1

Query  595   LAKRLV-GCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHGR  771
             LAK LV   ++AD+ FF NSGTEANE A+KFARK+   + P + +   + +AF   FHGR
Sbjct  152   LAKELVTSTAWADKAFFCNSGTEANEGALKFARKWGNTADPSLNKN--QIVAFKGGFHGR  209

Query  772   TMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYS  951
             TMG+++ T    Y++ F+P++P      + ++Q+A++L+ S +  AV VEPIQGEGG+Y 
Sbjct  210   TMGSLSATHNPAYQAAFQPLIPNNLVGTFNDLQSASDLV-SDRTCAVIVEPIQGEGGVYP  268

Query  952   ATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEA---YGVYPDIMTLAKPLAGG  1122
             AT EFL  LR  CD   +LL+FDE+QCG+GRTG+LWAH A    GV PDIMTLAKPLA G
Sbjct  269   ATAEFLAHLRKLCDQHNALLIFDEIQCGVGRTGHLWAHSAPQFNGVQPDIMTLAKPLANG  328

Query  1123  LPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISN--PEFLASVSDkgqyl  1296
             LP+GA+LV ++V+  I  GDHG+TF GGP VCN A  VL ++    P+   ++    + L
Sbjct  329   LPVGAILVRDRVSELIKPGDHGTTFGGGPGVCNVARAVLGEVQQLLPKMQTNIKRFDEIL  388

Query  1297  kellgkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPP  1476
             + L  +       V+ I  L  +       A     EA ++ G++++TAGK NV+RL PP
Sbjct  389   ESLRQQFPKVVLDVRGIGFLRGVELTAEYTAKQVQQEALRH-GIVMITAGK-NVLRLTPP  446

Query  1477  LIISKQELEQAADVLAA  1527
             LI+ + +LE+    L +
Sbjct  447   LIVGEPQLERLRTALTS  463



>ref|XP_009535471.1| hypothetical protein PHYSODRAFT_564720 [Phytophthora sojae]
 gb|EGZ08838.1| hypothetical protein PHYSODRAFT_564720 [Phytophthora sojae]
Length=423

 Score =   248 bits (632),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 150/318 (47%), Positives = 200/318 (63%), Gaps = 25/318 (8%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKF-QRFSH-PDMEQPPVEFIAFSNCF  762
             +ELAK LV  S  D+VFF NSGTEANE A KFAR +  R S    +E   +EFI+F + F
Sbjct  115   LELAKTLVDNSCFDKVFFGNSGTEANEGAYKFARLYANRVSQGTPLEGKKIEFISFKHGF  174

Query  763   HGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGG  942
             HGRT  A+ LT K   R  F P+                +LI S K A VF+EPIQGEGG
Sbjct  175   HGRTAAALTLTHKPKIREAFMPL----------------KLI-SDKTAGVFIEPIQGEGG  217

Query  943   IYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGG  1122
             +Y A  EF++ LR  CD   ++L+ DEVQCGLGRTG L+AHE Y V PDIMTLAKPLAGG
Sbjct  218   LYPADPEFMRELRALCDKHDAMLIVDEVQCGLGRTGKLFAHELYDVTPDIMTLAKPLAGG  277

Query  1123  LPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylke  1302
             LPIGAVL++ KVA+AI  G HG+TF G PLVC  A TVL KI + +FLA+V  +G YL  
Sbjct  278   LPIGAVLMSNKVASAITPGQHGTTFGGNPLVCAVANTVLHKIMDEDFLANVQKRGNYLAS  337

Query  1303  llgkklgg-NNHVKEIRglgliigielDVAAT----PLVEACQNSGLLVLTAGKGNVVRL  1467
              L K      + V ++R      G+ + +  +    PL++   +  +L+++AG+ N +RL
Sbjct  338   RLEKLQQKFPDKVVDVRKPIGKGGLFVALECSKPVGPLIQYALSKQVLIISAGE-NTIRL  396

Query  1468  VPPLIISKQELEQAADVL  1521
              PPL++ +++++Q  +V 
Sbjct  397   CPPLVVDEKDIDQLLEVF  414



>ref|XP_011123454.1| hypothetical protein AOL_s00081g335 [Arthrobotrys oligospora 
ATCC 24927]
 gb|EGX48008.1| hypothetical protein AOL_s00081g335 [Arthrobotrys oligospora 
ATCC 24927]
Length=459

 Score =   249 bits (635),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 145/306 (47%), Positives = 196/306 (64%), Gaps = 8/306 (3%)
 Frame = +1

Query  625   ADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHGRTMGAVALTSKE  804
             A RVF  NSG+EANEAAIKFARK  + S     +  + F++F N FHGRTMG+++ T   
Sbjct  155   ASRVFICNSGSEANEAAIKFARKVGKSSG---NEKKIGFVSFHNSFHGRTMGSLSATPNV  211

Query  805   HYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYSATKEFLQALRT  984
              Y+ PF P++PG ++    ++ A  EL+   +   V VEPIQGEGGI+ AT+EFL AL+ 
Sbjct  212   KYQKPFGPMVPGFSYGNLNDVAAIPELVTE-ETCGVIVEPIQGEGGIHIATEEFLVALKK  270

Query  985   SCDNAGSLLVFDEVQCGLGRTGYLWAHEAY--GVYPDIMTLAKPLAGGLPIGAVLVTEKV  1158
              C   G++L++DE+QCGLGRTG LWAH A     +PDIMT AK L  G+PIGA +VTE+V
Sbjct  271   RCQEVGAVLIYDEIQCGLGRTGELWAHGALPKEAHPDIMTTAKALGNGVPIGATIVTEQV  330

Query  1159  AAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqy-lkellgkklggNNH  1335
             A  I  GDHG+TF G PL    A  VL ++S+ E L  +  KG+    +L   K      
Sbjct  331   AEKIVIGDHGTTFGGNPLAARVAHHVLGRLSSKEMLKEIQRKGEVFKTQLEKLKEKYPGL  390

Query  1336  VKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIISKQELEQAAD  1515
             + EIRG GLIIG++L      +V  C++ GLL+LTAGK N +R+VPP II+ +++ Q  D
Sbjct  391   ISEIRGRGLIIGVQLTKDPAEIVTECRDKGLLILTAGK-NTLRIVPPYIITDEQIHQGLD  449

Query  1516  VLAACL  1533
             +L   L
Sbjct  450   ILEGIL  455



>ref|WP_008119747.1| acetylornithine aminotransferase [[Bacteroides] pectinophilus]
 gb|EEC57831.1| aminotransferase, acetylornithine/succinylornithine family [[Bacteroides] 
pectinophilus ATCC 43243]
Length=397

 Score =   246 bits (629),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 139/315 (44%), Positives = 198/315 (63%), Gaps = 8/315 (3%)
 Frame = +1

Query  598   AKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHGRTM  777
             AK +   S  DRVFF+NSGTEA E AIK A+K+        +    E IA  + FHGR+M
Sbjct  87    AKAITEVSGMDRVFFTNSGTEAIEGAIKLAKKYAYLKDDSTDH---EIIAMQHSFHGRSM  143

Query  778   GAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYSAT  957
             GA+A+T   HY+  F P++PG+ F +Y N+ +  EL+   K  A+  E +QGEGGIY A 
Sbjct  144   GALAVTGNRHYQEAFGPMIPGIKFAQYNNLASVEELVND-KTCAIIFETVQGEGGIYPAK  202

Query  958   KEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLPIGA  1137
              EF++ +R  CD  G LL+ DE+QCG+GRTG ++A+E YGV PDI+T+AK L  G+P+GA
Sbjct  203   PEFIKGVRKLCDEKGILLILDEIQCGMGRTGTMFAYEQYGVKPDILTVAKALGCGVPVGA  262

Query  1138  VLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkellgkk  1317
              L  E+VA A+  GDHG+T+ G PL C AAV  LE       L +V     YL++ L + 
Sbjct  263   FLAREEVAKALVPGDHGTTYGGNPLACAAAVKALELFKKQNVLDNVKKVSAYLEKKLDEI  322

Query  1318  lggNNHVKEIRglgliigielDVAATPL---VEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
             +   ++V E RGLGL+ G+E++     L   + AC ++GL++ TAG  NV+R VPPL+IS
Sbjct  323   VAEYDYVVERRGLGLMQGLEINTDVKDLKKVIAACLDNGLILFTAGT-NVIRFVPPLVIS  381

Query  1489  KQELEQAADVLAACL  1533
             + ++++    L   L
Sbjct  382   EADVDEMITKLKKAL  396



>gb|ESW97296.1| Acetylornithine aminotransferase, mitochondrial [Ogataea parapolymorpha 
DL-1]
Length=432

 Score =   247 bits (631),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 141/321 (44%), Positives = 203/321 (63%), Gaps = 16/321 (5%)
 Frame = +1

Query  592   ELAKRLV-------GCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAF  750
             EL+K+LV       G   A RVF +NSGTEANEAA+KFARK+ + S  D +   +EFI F
Sbjct  109   ELSKQLVSKTLESGGMKNASRVFMANSGTEANEAALKFARKYGK-SFADNK---IEFITF  164

Query  751   SNCFHGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQ  930
              N FHGR+MG++++T    Y+ PF P++PGV   +  +I++   +I S K   V +EP+Q
Sbjct  165   ENSFHGRSMGSLSVTPNPKYQKPFAPLIPGVKVAKPNDIKSVESVI-SDKTCGVIIEPVQ  223

Query  931   GEGGIYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAY--GVYPDIMTLA  1104
             GEGGI+    +F+  LR  C+   +LL++DE+QCGLGR+G LWAH       +PDI+T+A
Sbjct  224   GEGGIFPMNSDFMVQLRELCNKHNALLIYDEIQCGLGRSGRLWAHSKLPESAHPDILTMA  283

Query  1105  KPLAGGLPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDk  1284
             K L  G PIGA +VTE+V  A+  GDHG+T+ G PL     + VL+K+S+PEFL  V  K
Sbjct  284   KALGNGFPIGATMVTEEVEKALKVGDHGTTYGGNPLGARIGLYVLDKVSDPEFLQQVEKK  343

Query  1285  gqy-lkellgkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVV  1461
              +    +L        + +K+IRG GL++G+EL+   +P+V+  +  GLLV+TAG  NV+
Sbjct  344   SELFKVKLSELSEKFPDQIKDIRGEGLLLGVELNQDPSPVVKKARELGLLVITAG-NNVI  402

Query  1462  RLVPPLIISKQELEQAADVLA  1524
             R VP L I   ++    D+L 
Sbjct  403   RFVPALNIEDSDIIDGLDILG  423



>ref|WP_012546465.1| MULTISPECIES: acetylornithine aminotransferase [Thermodesulfovibrio]
 ref|YP_002248513.1| acetylornithine aminotransferase [Thermodesulfovibrio yellowstonii 
DSM 11347]
 gb|ACI21758.1| acetylornithine aminotransferase [Thermodesulfovibrio yellowstonii 
DSM 11347]
Length=401

 Score =   246 bits (628),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 138/315 (44%), Positives = 193/315 (61%), Gaps = 6/315 (2%)
 Frame = +1

Query  595   LAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHGRT  774
             LA+ L+  SFADRVFF NSGTEANE A+K AR + +  +    +   EFI+  N FHGRT
Sbjct  86    LAQILIKNSFADRVFFCNSGTEANEGALKLARIYMKNKYG---KERYEFISAYNSFHGRT  142

Query  775   MGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYSA  954
              G++++T +E Y   FEP++ G+ F+ + +  A    I   K  AV +EPIQ EGGI   
Sbjct  143   FGSLSVTGQEKYHHGFEPLLKGIKFVPFNDPDAIANAITE-KTCAVILEPIQAEGGINVP  201

Query  955   TKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLPIG  1134
              K +L  +R  CD  G LL+ DEVQ G+GRTG L+A+E +G+ PDIMTLAK L GG+PIG
Sbjct  202   DKNYLPKVREICDKKGILLILDEVQTGIGRTGKLFAYEHFGIEPDIMTLAKGLGGGIPIG  261

Query  1135  AVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkellgk  1314
             A+L  E++A+A     H STF G P+ C +AV  LE +    +L     +          
Sbjct  262   AILTKEEIASAFTSKTHASTFGGNPVACASAVATLETVLEDGYLLDYCQRMSKYFMKKLN  321

Query  1315  klggN--NHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              +       +KEIRG+GL+IG+EL  +AT +V+ C   GLL+ TAG G+V+R  PPLII 
Sbjct  322   SIKDKYPEKIKEIRGMGLLIGVELTFSATEIVKKCMEKGLLIGTAGDGSVIRFTPPLIIE  381

Query  1489  KQELEQAADVLAACL  1533
             K+ +++A  ++   L
Sbjct  382   KENIDEAISIVDKAL  396



>gb|KDN46630.1| acetylornithine and succinylornithine aminotransferase [Tilletiaria 
anomala UBC 951]
Length=468

 Score =   248 bits (633),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 138/321 (43%), Positives = 198/321 (62%), Gaps = 13/321 (4%)
 Frame = +1

Query  613   GCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPD-MEQPPVEFIAFSNCFHGRTMGAVA  789
             GC+   +VF +NSGTEANEAA+KFARK+ R +  D +++     ++F+N FHGRTMGA++
Sbjct  143   GCTTELKVFLANSGTEANEAALKFARKYARVTAKDGLKERKNALVSFTNAFHGRTMGALS  202

Query  790   LTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYSATKEFL  969
             +T    Y+ PF P++P V   +Y ++     LI     A V VEP+QGEGGIY A+  FL
Sbjct  203   MTPNPKYKDPFAPLIPNVKTGQYNSVDGLETLIDH-DTAGVIVEPVQGEGGIYPASLSFL  261

Query  970   QALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAY--GVYPDIMTLAKPLAGGLPIGAVL  1143
             QALR  CD  G+LL++DE+QCGL R+G LW H  +    +PD++T+AKPLA G PIGAVL
Sbjct  262   QALRKRCDEVGALLIYDEIQCGLFRSGTLWCHSEFPPDAHPDLVTMAKPLANGFPIGAVL  321

Query  1144  VTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkellgkkl-  1320
             +  KVA AI  GDHG+TF GGPL    A  VLE++SN EF   + +  +YL   L   + 
Sbjct  322   MRNKVADAIVVGDHGTTFGGGPLASRIAHHVLERLSNEEFGKQLKENSEYLFRRLSHLVE  381

Query  1321  ------ggNNHVKEIRglgliigielDVA-ATPLVEACQNSGLLVLTAGKGNVVRLVPPL  1479
                     + H        L+     D + A   ++  +  GL+VL+AG  + +R+ P L
Sbjct  382   MFPDLISTDPHPSPRGKGFLVGISMKDPSNAGKTLKLARERGLIVLSAGS-DTIRIAPSL  440

Query  1480  IISKQELEQAADVLAACLPVL  1542
              +SK+++++A DVL + + VL
Sbjct  441   NVSKEQIDKAVDVLESSMLVL  461



>ref|XP_003287502.1| hypothetical protein DICPUDRAFT_151611 [Dictyostelium purpureum]
 gb|EGC36001.1| hypothetical protein DICPUDRAFT_151611 [Dictyostelium purpureum]
Length=441

 Score =   247 bits (631),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 147/316 (47%), Positives = 209/316 (66%), Gaps = 11/316 (3%)
 Frame = +1

Query  589   VELAKRLVGCS-FADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFH  765
             +ELAK L+  S F D+VFF+N+GTEANEAA+KFA+K      P+      E +AF+N F 
Sbjct  122   IELAKSLIDNSQFFDKVFFANTGTEANEAALKFAKKIGLSKDPN----KTEIVAFTNGFS  177

Query  766   GRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGI  945
             GR+MG++++T K  YR  + P++PGV F +Y +I +  ++I      A+ +EP+QGEGG+
Sbjct  178   GRSMGSLSVTHKAKYREIYGPLVPGVHFAKYNDIDSIQQIINKN-TCAIIIEPVQGEGGL  236

Query  946   YSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVY--PDIMTLAKPLAG  1119
              +AT EF++ L   C     +++ DEVQCG+GRTG LWAH  +  +  PDIMTLAKPLAG
Sbjct  237   EAATPEFMKHLYKLCKKNDVVMIVDEVQCGIGRTGQLWAHSRFAKHFKPDIMTLAKPLAG  296

Query  1120  GLPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylk  1299
             GLPIGAVLV + +AAAI  GDHG+TF GGPLVC AA     KI+  +FL  V +KG+Y+ 
Sbjct  297   GLPIGAVLVNDTIAAAIKPGDHGTTFGGGPLVCAAANYTFNKIAKKKFLEEVREKGKYIT  356

Query  1300  ellgkklggNNHV-KEIRgl-gliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVP  1473
             + L         V  EIR + GL IGI+L   A+ LV+   +  +L+++AG+ +VVRL P
Sbjct  357   DKLEDIKSKYPGVISEIRTVGGLFIGIKLTHPASKLVQFALDRKVLLISAGE-DVVRLCP  415

Query  1474  PLIISKQELEQAADVL  1521
             PL ++  E++Q   ++
Sbjct  416   PLTVTYPEIDQLITII  431



>ref|WP_022239961.1| acetylornithine aminotransferase [Lachnospiraceae bacterium CAG:364]
 emb|CDC08559.1| acetylornithine aminotransferase [Lachnospiraceae bacterium CAG:364]
Length=393

 Score =   246 bits (627),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 140/318 (44%), Positives = 205/318 (64%), Gaps = 13/318 (4%)
 Frame = +1

Query  592   ELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHGR  771
             E A++L   +  D++FF+NSG EA E A+K AR++      + +    +FIA  N FHGR
Sbjct  84    EAAEKLNQYAQMDKIFFTNSGAEAIEGALKTARRYAY----NKKSGKYQFIAMENSFHGR  139

Query  772   TMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYS  951
             T GA+++T  E YR+PFEP++PGV+F E+ NI++  +L+ + +  A+ +EPIQGEGGI+ 
Sbjct  140   TFGALSVTGHEAYRTPFEPLVPGVSFAEFNNIESVKKLV-TDRTCAIILEPIQGEGGIHP  198

Query  952   ATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLPI  1131
             AT+EF++A+R  CD    LL+FDEVQCG+GR+G ++A + YGV PDI+ +AK +  G+P+
Sbjct  199   ATQEFMEAVRKLCDEKDILLIFDEVQCGMGRSGSMFAWQGYGVKPDILAMAKGIGSGIPV  258

Query  1132  GAVLVTEKVAA-AINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             GA  VT+KVA  ++  GDHG+T+ G PL C A  TVL+     + L  V +   YL+  L
Sbjct  259   GAFAVTKKVAENSLKPGDHGATYGGNPLACKAVKTVLDIFEEEDILGHVKEITPYLEAKL  318

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNS---GLLVLTAGKGNVVRLVPPL  1479
                    + V E RG GLI GI   V   P+ E C  +   GLLV+ A +GNV+RLVPPL
Sbjct  319   DSLTEELDCVLERRGKGLIQGI---VLKQPVAEVCTKAMEEGLLVIQA-QGNVLRLVPPL  374

Query  1480  IISKQELEQAADVLAACL  1533
             I+ K+ +++  + L   L
Sbjct  375   IVEKEHVDEMIEKLKKAL  392



>gb|EPB88128.1| hypothetical protein HMPREF1544_05072 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=445

 Score =   247 bits (631),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 134/314 (43%), Positives = 200/314 (64%), Gaps = 15/314 (5%)
 Frame = +1

Query  595   LAKRLVGCS-------FADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFS  753
             LA++LV  +       +A+++F  NSGTEANE A+KFARK+ +    + +    + + F 
Sbjct  119   LAEKLVETTNLYSKQEWANKIFLCNSGTEANEGALKFARKWGKMVGGEKK---TKLVCFK  175

Query  754   NCFHGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQG  933
             N FHGR+MGA+++T  + Y+ P  P++P V+ L + NI      +     A V VEPIQG
Sbjct  176   NAFHGRSMGALSVTPNKKYQDPCAPLIPDVSVLPFNNINEIMHEVDES-TAGVIVEPIQG  234

Query  934   EGGIYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAY--GVYPDIMTLAK  1107
             EGG++ A ++F++ALR  C    SLL++DE+QCGLGR+G +WAH+ Y     PDI+T+AK
Sbjct  235   EGGVHVADRDFIKALRERCTQTNSLLIYDEIQCGLGRSGKMWAHQYYDSSCTPDILTMAK  294

Query  1108  PLAGGLPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkg  1287
             PLA G+PIGA++ T KVA AI  GDHG+TF G PL    A+ V+++I+NP FL  V +  
Sbjct  295   PLANGVPIGALMTTNKVAEAIKIGDHGTTFGGNPLSATVALGVVDRITNPHFLKKVDEVS  354

Query  1288  qylkellgkklggNNH-VKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVR  1464
               +K  L          +KE+RG GL++G+E      P+V+  +  GLL++TAG  N +R
Sbjct  355   HAIKRDLKALQDEYPEIIKEVRGEGLLLGVEFFKNPEPMVKYARERGLLLVTAG-NNTIR  413

Query  1465  LVPPLIISKQELEQ  1506
             ++PPLI++K E  +
Sbjct  414   IIPPLILTKAEARE  427



>ref|WP_037500035.1| acetylornithine aminotransferase [Sphingomonas jaspsi]
Length=395

 Score =   246 bits (627),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 139/314 (44%), Positives = 200/314 (64%), Gaps = 6/314 (2%)
 Frame = +1

Query  592   ELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHGR  771
             + A+RLV  +FAD VFF+NSG EA E AIK AR   R+ H        + I FSN FHGR
Sbjct  77    KFAQRLVDLTFADTVFFTNSGAEAVECAIKTAR---RYHHAKGNAHKHDLITFSNAFHGR  133

Query  772   TMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYS  951
             TM  ++ T++E  R  F P++PG   +E+ N++ A   I     A   +EP+QGEGGI  
Sbjct  134   TMATISATNQEKLRDGFAPLLPGFKVVEFDNLEQALAAIDE-HTAGFLLEPVQGEGGIRP  192

Query  952   ATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLPI  1131
             A+KEF+Q LR +CD+   +LVFDEVQCG+ RTG L+A+E YGV PDIM  AK + GG P+
Sbjct  193   ASKEFVQGLRKACDDNDLMLVFDEVQCGVARTGTLYAYEQYGVTPDIMASAKGIGGGFPM  252

Query  1132  GAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkellg  1311
             GA L +EK AA +  G HGST+ G P    A   V + ++NPEFLA V+  G+ L+  L 
Sbjct  253   GACLASEKAAAGMVVGTHGSTYGGNPFAMAAGEAVFDVVANPEFLAHVTKMGERLRSALE  312

Query  1312  kklggNNHVKE-IRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
             + +  ++H+ E +RG+GL++GI++   +   V   ++ G+L++ AG  NVVR++PPL+I 
Sbjct  313   QMIPNHDHLFESVRGMGLMLGIKMKTDSRAFVNWLRDEGILLVAAGD-NVVRVLPPLVIE  371

Query  1489  KQELEQAADVLAAC  1530
             + ++    D L+A 
Sbjct  372   EADIRTFVDELSAA  385



>gb|KEY75394.1| acetylornithine aminotransferase [Aspergillus fumigatus var. 
RP-2014]
Length=487

 Score =   248 bits (633),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 138/313 (44%), Positives = 193/313 (62%), Gaps = 18/313 (6%)
 Frame = +1

Query  625   ADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHGRTMGAVALTSKE  804
             A +VF SNSGTEANEAAIKFARK  R   P   +   EF++F N FHGRTMGA++ T   
Sbjct  166   ASQVFISNSGTEANEAAIKFARKVGRSLEPSGAKH--EFVSFHNSFHGRTMGALSATPNP  223

Query  805   HYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYSATKEFLQALRT  984
              Y++PF P++PG  +  Y +I+   ELI + K   V VEPIQGEGG+++AT EFL ALR 
Sbjct  224   KYQTPFSPMVPGFKYGNYNDIEQLQELI-TDKTCGVIVEPIQGEGGVHTATPEFLAALRK  282

Query  985   SCDNAGSLLVFDEVQCGLGRTGYLWAH--------EAYGVYPDIMTLAKPLAGGLPIGAV  1140
              CD  G++L+FDE+QCGL RTG  WAH             +PDI+T AK L  G+PIGA 
Sbjct  283   RCDEVGAVLIFDEIQCGLSRTGSFWAHAHPSLKPTSGEAAHPDILTTAKALGNGIPIGAT  342

Query  1141  LVTEK-VAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASV-SDkgqylkellgk  1314
             +V+ K VA  I  GDHG+TF G PL C  A  ++E++++PE   SV +    ++      
Sbjct  343   IVSGKTVAEHIKTGDHGTTFGGNPLACRVAHHIVERLASPELQKSVEAKSLLFVSGFQSL  402

Query  1315  klggNNHVKEIR----glgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLI  1482
             +    + + EIR     LG+ +       A+ LV A +  GLL++TAG+G  +R VPPL 
Sbjct  403   QKKYPDVISEIRGRGLILGVQLSKSHTTKASDLVTAARERGLLIITAGEG-CLRFVPPLT  461

Query  1483  ISKQELEQAADVL  1521
             I++++++ +  +L
Sbjct  462   ITEEQIKTSLKIL  474



>ref|WP_028844494.1| acetylornithine aminotransferase [Thermodesulfovibrio thiophilus]
Length=400

 Score =   245 bits (626),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 136/317 (43%), Positives = 198/317 (62%), Gaps = 6/317 (2%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             + LAK L+  SFADRVFF NSGTEANE A+K AR + +       Q   EFIA  N FHG
Sbjct  84    LNLAKLLIENSFADRVFFCNSGTEANEGALKLARIYMK---NKFGQERFEFIAAENSFHG  140

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             R+ G++++T +  Y   FEP++ G+ F+ + ++ A  + I + K AA+ +EP+Q EGGI 
Sbjct  141   RSFGSLSVTGQAKYHHGFEPLLQGIKFVPFNDVTAMEKTI-TDKTAAIILEPVQAEGGIN  199

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
               +K + + +R  CD    LL+ DEVQ G+GRTG L+A+E +G+ PDIM+LAK L  G+P
Sbjct  200   IPSKNYFKKVRELCDKYNILLILDEVQTGIGRTGKLFAYEHFGIKPDIMSLAKGLGSGIP  259

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGA+L TE++A A+    H STF G P+ C AAV  +E I    +L   + +        
Sbjct  260   IGAILTTEEIAQAMGPKTHASTFGGNPVACAAAVATIETILEDGYLLDYAQRMSKYIVKK  319

Query  1309  gkklggNNH--VKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLI  1482
                L   +   +KEIRG+GL+IG+EL +    +V+ C   GLL+ TAG G+V+R  PPLI
Sbjct  320   LNSLKEKHQEKIKEIRGVGLLIGVELSINGASIVKKCIEKGLLIGTAGDGSVLRFTPPLI  379

Query  1483  ISKQELEQAADVLAACL  1533
             I K+++++A  +L + L
Sbjct  380   IEKEDVDKAIYILNSVL  396



>gb|KDO34595.1| hypothetical protein SPRG_00658 [Saprolegnia parasitica CBS 223.65]
Length=445

 Score =   247 bits (630),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 142/313 (45%), Positives = 197/313 (63%), Gaps = 13/313 (4%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFAR----KFQRFSHPDMEQPPVEFIAFSN  756
             ++LAK+LV  S  D+VFF NSGTEANEAA KFAR    K  + +   +E      IAF  
Sbjct  121   LKLAKKLVEHSTFDKVFFCNSGTEANEAAYKFARLHGNKVAKGT--PLEGKKTHVIAFKG  178

Query  757   CFHGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGE  936
              FHGR+ G+++LT K   R PF P++P +TF EY N+      I S    A+ VEPIQGE
Sbjct  179   GFHGRSSGSLSLTYKPAIREPFLPLVPNITFAEYNNLDDVKAQI-SDHTCAIIVEPIQGE  237

Query  937   GGIYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLA  1116
             GG+  A  +FL+ LR  CD   +LL+ DEVQ GLGRTG L+ HE YG+ PD++TLAKPLA
Sbjct  238   GGVMPAKADFLKGLRELCDAHSALLICDEVQTGLGRTGNLFGHEVYGIQPDLITLAKPLA  297

Query  1117  GGLPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqyl  1296
             GGLPIGAVL T+ VA A+  G HG+TF G P+VC AA  V++++++P FL +V   G+ +
Sbjct  298   GGLPIGAVLTTDHVADAVTPGSHGTTFGGNPIVCAAANVVMDRLTSPNFLFNVQKMGRLM  357

Query  1297  kellgkklggN-NHVKEIRglgliigielDV----AATPLVEACQNSGLLVLTAGKGNVV  1461
                L +    +   +KE+R      G+   V    A  P+V+     G++ +TAG+  V+
Sbjct  358   AHGLKELHAKHPTKIKEVRLPIGEAGLYAGVECHGAVGPIVKDLVTKGVITITAGE-KVL  416

Query  1462  RLVPPLIISKQEL  1500
             RL PPL+I++ ++
Sbjct  417   RLCPPLVITETDV  429



>ref|WP_022098074.1| acetylornithine aminotransferase [Eubacterium eligens CAG:72]
 emb|CDA38417.1| acetylornithine aminotransferase [Eubacterium eligens CAG:72]
Length=393

 Score =   245 bits (625),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 141/333 (42%), Positives = 206/333 (62%), Gaps = 13/333 (4%)
 Frame = +1

Query  553   QTRKYFVHDFM*VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPP  732
              T  YF ++   VE A  L   S  DRVFF+NSGTEA E A+K A+K+    +    +  
Sbjct  73    HTSNYFYNEPA-VEAATALTKASGMDRVFFTNSGTEAIEGAVKLAKKYYYVKNG---KAD  128

Query  733   VEFIAFSNCFHGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAV  912
              E IA  + FHGR+MGA+A+T  +HY+  F P++PG+ F +Y ++ +  EL+   K  A+
Sbjct  129   AEIIAMQHSFHGRSMGALAVTGNKHYQEAFGPMIPGIKFAQYNDLNSVKELVND-KTCAI  187

Query  913   FVEPIQGEGGIYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDI  1092
               E +QGEGGIY ATKEF++ +R  CD  G LL+ DE+QCG+GRTG ++A + YGV PDI
Sbjct  188   IFETVQGEGGIYPATKEFIEGVRKLCDEKGILLILDEIQCGMGRTGSMFAFQQYGVKPDI  247

Query  1093  MTLAKPLAGGLPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLAS  1272
             +T+AK L  G+P+GA   TE+VA A+  GDHG+T+ G PL C AA  V E       L +
Sbjct  248   LTVAKALGCGVPVGAFAATEEVAKALVPGDHGTTYGGNPLACAAATKVFELFEKQHVLDN  307

Query  1273  VSDkgqylkellgkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKG  1452
             V +   Y +E L + +   + V E RG+GL+ G+EL V    ++    ++GL++ +AG  
Sbjct  308   VKEVSAYFEEKLDELVETIDVVVERRGMGLMQGLELSVNPKDVIAKALDNGLILFSAGT-  366

Query  1453  NVVRLVPPLIISKQELEQAADVLAACLPVLDKS  1551
             NV+R VPPL+I+K ++++       C+  L KS
Sbjct  367   NVIRFVPPLVITKADVDE-------CIAKLKKS  392



>ref|WP_026478019.1| acetylornithine aminotransferase [Alkaliphilus transvaalensis]
Length=399

 Score =   245 bits (625),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 140/312 (45%), Positives = 196/312 (63%), Gaps = 7/312 (2%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             V LAK LV  SFAD+ FF NSG EANE AIK ARK+   ++        E IA +  FHG
Sbjct  84    VTLAKILVENSFADKAFFCNSGAEANEGAIKLARKY---AYKKFGNHKHEIIAMTGSFHG  140

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RT+G +A+T  + Y+  + P+  G  F E+ NI++   L+       + VEP+QGEGG+ 
Sbjct  141   RTLGTLAITDNKKYQEGYGPIPEGFKFAEFNNIESVNALVNE-NTCGILVEPVQGEGGVT  199

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
              ATKEFL+AL+  C     LL+FDE+QCG+ RTG L+A++ +GV PDIM+LAK L GG P
Sbjct  200   PATKEFLEALKVLCKEKDILLIFDEIQCGIARTGKLFAYQHFGVEPDIMSLAKALGGGFP  259

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGAV+ TE++AAA   GDHG+TF G PL C + V  L+ + N +        G Y  E L
Sbjct  260   IGAVVATEEIAAAWQPGDHGTTFGGNPLACASGVATLQTVINEKLWEKAETMGSYFAEKL  319

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLV-LTAGKGNVVRLVPPLII  1485
                +     VKE++GLGL++G+EL++    +V+   N G+L+  TAGK  V+R VPPL++
Sbjct  320   QVFVDTYPWVKEVKGLGLMMGLELEIEGASIVQKAFNEGILINCTAGK--VLRFVPPLVV  377

Query  1486  SKQELEQAADVL  1521
              K++++   D L
Sbjct  378   EKEDIDIVIDAL  389



>ref|WP_012981033.1| acetylornithine aminotransferase [Methanocaldococcus sp. FS406-22]
 ref|YP_003458861.1| acetylornithine and succinylornithine aminotransferase [Methanocaldococcus 
sp. FS406-22]
 gb|ADC70125.1| acetylornithine and succinylornithine aminotransferase [Methanocaldococcus 
sp. FS406-22]
Length=398

 Score =   245 bits (625),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 141/320 (44%), Positives = 204/320 (64%), Gaps = 5/320 (2%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             ++LAK+LV  S  DR FF NSG EANE AIKFARK+       + +   E I+  N FHG
Sbjct  84    IKLAKKLVELSGLDRAFFCNSGAEANEGAIKFARKY---VSKILGRDGGEIISMYNAFHG  140

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RT+  +A T K  Y+  F P+ PG  ++ + +I+A  E I + K AA+ +EP+QGEGGI+
Sbjct  141   RTLTTLAATPKPKYQEGFYPLPPGFKYVPFNDIEALKEAI-TNKTAAIMIEPVQGEGGIH  199

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
              A K++L+A+R  CD+   +L+FDEVQCG+GRTG ++A+E YGV PDI+TLAK L GG+P
Sbjct  200   VADKDYLKAVRDLCDDKNIVLIFDEVQCGMGRTGKMFAYEHYGVEPDILTLAKALGGGVP  259

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGAV++ E++A A++YGDHG+TF G PL C+AA+  +E I        V +KG+Y    L
Sbjct  260   IGAVVLKEEIAKALSYGDHGTTFGGNPLACSAALAAIEVIEELIKDDKVIEKGKYFIRKL  319

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
                    N +KE+RGLGL+IG+EL+     +V+     G L+       V+R +PPLI+ 
Sbjct  320   ENLAKKYNFIKEVRGLGLMIGVELEFNGADMVKKMLEKGFLI-NCTSDTVLRFLPPLIVE  378

Query  1489  KQELEQAADVLAACLPVLDK  1548
             K+ ++   + L      ++K
Sbjct  379   KEHIDALVNALDEVFAEINK  398



>ref|WP_012738845.1| acetylornithine aminotransferase [[Eubacterium] eligens]
 ref|YP_002930056.1| acetylornithine aminotransferase [ [[Eubacterium] eligens ATCC 
27750]
 gb|ACR71609.1| acetylornithine aminotransferase [ [[Eubacterium] eligens ATCC 
27750]
Length=405

 Score =   244 bits (624),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 141/333 (42%), Positives = 206/333 (62%), Gaps = 13/333 (4%)
 Frame = +1

Query  553   QTRKYFVHDFM*VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPP  732
              T  YF ++   VE A  L   S  DRVFF+NSGTEA E A+K A+K+    +    +  
Sbjct  85    HTSNYFYNEPA-VEAATALTKASGMDRVFFTNSGTEAIEGAVKLAKKYYYVKNG---KAD  140

Query  733   VEFIAFSNCFHGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAV  912
              E IA  + FHGR+MGA+A+T  +HY+  F P++PG+ F +Y ++ +  EL+   K  A+
Sbjct  141   AEIIAMQHSFHGRSMGALAVTGNKHYQEAFGPMIPGIKFAQYNDLDSVKELVND-KTCAI  199

Query  913   FVEPIQGEGGIYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDI  1092
               E +QGEGGIY ATKEF++ +R  CD  G LL+ DE+QCG+GRTG ++A + YGV PDI
Sbjct  200   IFETVQGEGGIYPATKEFIEGVRKLCDEKGILLILDEIQCGMGRTGSMFAFQQYGVKPDI  259

Query  1093  MTLAKPLAGGLPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLAS  1272
             +T+AK L  G+P+GA   TE+VA A+  GDHG+T+ G PL C AA  V E       L +
Sbjct  260   LTVAKALGCGVPVGAFAATEEVAKALVPGDHGTTYGGNPLACAAATKVFELFEKQHVLDN  319

Query  1273  VSDkgqylkellgkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKG  1452
             V +   Y +E L + +   + V E RG+GL+ G+EL V    ++    ++GL++ +AG  
Sbjct  320   VKEVSAYFEEKLDELVETIDVVVERRGMGLMQGLELSVNPKDVIAKALDNGLILFSAGT-  378

Query  1453  NVVRLVPPLIISKQELEQAADVLAACLPVLDKS  1551
             NV+R VPPL+I+K ++++       C+  L KS
Sbjct  379   NVIRFVPPLVITKADVDE-------CIAKLKKS  404



>ref|XP_755579.1| acetylornithine aminotransferase [Aspergillus fumigatus Af293]
 gb|EAL93541.1| acetylornithine aminotransferase [Aspergillus fumigatus Af293]
 gb|EDP54753.1| acetylornithine aminotransferase [Aspergillus fumigatus A1163]
Length=487

 Score =   247 bits (631),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 138/313 (44%), Positives = 193/313 (62%), Gaps = 18/313 (6%)
 Frame = +1

Query  625   ADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHGRTMGAVALTSKE  804
             A +VF SNSGTEANEAAIKFARK  R   P   +   EF++F N FHGRTMGA++ T   
Sbjct  166   ASQVFISNSGTEANEAAIKFARKVGRSLEPSGAKH--EFVSFHNSFHGRTMGALSATPNP  223

Query  805   HYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYSATKEFLQALRT  984
              Y++PF P++PG  +  Y +I+   ELI + K   V VEPIQGEGG+++AT EFL ALR 
Sbjct  224   KYQTPFSPMVPGFKYGNYNDIEQLQELI-TDKSCGVIVEPIQGEGGVHTATPEFLAALRK  282

Query  985   SCDNAGSLLVFDEVQCGLGRTGYLWAH--------EAYGVYPDIMTLAKPLAGGLPIGAV  1140
              CD  G++L+FDE+QCGL RTG  WAH             +PDI+T AK L  G+PIGA 
Sbjct  283   RCDEVGAVLIFDEIQCGLSRTGSFWAHAHPSLKPTSGEAAHPDILTTAKALGNGIPIGAT  342

Query  1141  LVTEK-VAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASV-SDkgqylkellgk  1314
             +V+ K VA  I  GDHG+TF G PL C  A  ++E++++PE   SV +    ++      
Sbjct  343   IVSGKTVAEHIKTGDHGTTFGGNPLACRVAHHIVERLASPELQKSVEAKSLLFVSGFQSL  402

Query  1315  klggNNHVKEIR----glgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLI  1482
             +    + + EIR     LG+ +       A+ LV A +  GLL++TAG+G  +R VPPL 
Sbjct  403   QKKYPDVISEIRGRGLILGVQLSKSHTTKASDLVTAARERGLLIITAGEG-CLRFVPPLT  461

Query  1483  ISKQELEQAADVL  1521
             I++++++ +  +L
Sbjct  462   ITEEQIKTSLKIL  474



>ref|WP_003019851.1| acetylornithine aminotransferase [Blautia hansenii]
 gb|EEX22185.1| aminotransferase, acetylornithine/succinylornithine family [Blautia 
hansenii DSM 20583]
 gb|EGG80429.1| hypothetical protein HMPREF0992_00392 [Lachnospiraceae bacterium 
6_1_63FAA]
Length=393

 Score =   244 bits (623),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 139/318 (44%), Positives = 205/318 (64%), Gaps = 13/318 (4%)
 Frame = +1

Query  592   ELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHGR  771
             E A++L   +  D++FF+NSG EA E A+K AR++      + +    +FIA  N FHGR
Sbjct  84    EAAEKLNQYAQMDKIFFTNSGAEAIEGALKTARRYAY----NKKSGKYQFIAMENSFHGR  139

Query  772   TMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYS  951
             T GA+++T  E YR+PFEP++PGV+F E+ NI++  +L+ + +  A+ +EPIQGEGGI+ 
Sbjct  140   TFGALSVTGHEAYRTPFEPLVPGVSFAEFNNIESVKKLV-TDRTCAIILEPIQGEGGIHP  198

Query  952   ATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLPI  1131
             AT+EF++ +R  CD    LL+FDEVQCG+GR+G ++A + YGV PDI+ +AK +  G+P+
Sbjct  199   ATQEFMETVRKLCDEKDILLIFDEVQCGMGRSGSMFAWQGYGVKPDILAMAKGIGSGIPV  258

Query  1132  GAVLVTEKVAA-AINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             GA  VT+KVA  ++  GDHG+T+ G PL C A  TVL+     + L  V +   YL++ L
Sbjct  259   GAFAVTKKVAENSLKPGDHGATYGGNPLACKAVKTVLDIFEEEDILGHVKEITPYLEDKL  318

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNS---GLLVLTAGKGNVVRLVPPL  1479
                    + V E RG GLI GI   V   P+ E C  +   GLLV+ A +GNV+RLVPPL
Sbjct  319   DSLTEELDCVLERRGKGLIQGI---VLKQPVAEVCTKAMEEGLLVIQA-QGNVLRLVPPL  374

Query  1480  IISKQELEQAADVLAACL  1533
             I+ K+ +++  + L   L
Sbjct  375   IVEKEHVDEMIEKLKKAL  392



>ref|NP_001054542.2| Os05g0129100 [Oryza sativa Japonica Group]
 dbj|BAF16456.2| Os05g0129100, partial [Oryza sativa Japonica Group]
Length=180

 Score =   237 bits (604),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 154/178 (87%), Gaps = 0/178 (0%)
 Frame = +1

Query  1021  EVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLPIGAVLVTEKVAAAINYGDHGSTFA  1200
             +VQCGLGRTGYLWA+EAYGV PDIMTLAKPLAGGLPIG VLVTEKVA+AIN+GDHG+TF 
Sbjct  2     QVQCGLGRTGYLWAYEAYGVLPDIMTLAKPLAGGLPIGVVLVTEKVASAINFGDHGTTFG  61

Query  1201  GGPLVCNAAVTVLEKISNPEFLASVSDkgqylkellgkklggNNHVKEIRglgliigiel  1380
             GGPLVC AA+T L+KI  P FLA V+ KG+  K+LL  KL GN HVKEIRG+GLI+GIEL
Sbjct  62    GGPLVCQAALTTLDKIQKPGFLAEVAKKGENFKQLLSTKLSGNAHVKEIRGIGLIVGIEL  121

Query  1381  DVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIISKQELEQAADVLAACLPVLDKST  1554
             DV A PLV+AC + G++VLTAGKGNVVRLVPPLIIS++ELEQAA+V+  CLP LD ST
Sbjct  122   DVPAGPLVDACLDRGVIVLTAGKGNVVRLVPPLIISEKELEQAAEVIRDCLPALDAST  179



>ref|XP_002901483.1| acetylornithine aminotransferase, mitochondrial precursor [Phytophthora 
infestans T30-4]
 gb|EEY59010.1| acetylornithine aminotransferase, mitochondrial precursor [Phytophthora 
infestans T30-4]
Length=423

 Score =   245 bits (625),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 151/318 (47%), Positives = 199/318 (63%), Gaps = 25/318 (8%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKF-QRFSH-PDMEQPPVEFIAFSNCF  762
             +ELAK LV  S  D+VFF+NSGTEANE A KFAR +  R S    +E    EFI+F + F
Sbjct  115   LELAKNLVDNSRFDKVFFANSGTEANEGAYKFARLYANRVSQGTPLEGKKFEFISFKHGF  174

Query  763   HGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGG  942
             HGRT  A+ LT K   R  F P+                +LI S K A VF+EP+QGEGG
Sbjct  175   HGRTAAALTLTHKPKIREAFMPL----------------KLI-SDKTAGVFIEPMQGEGG  217

Query  943   IYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGG  1122
             +Y A  EF+  LR  CD   +LL+ DEVQCGLGRTG L+AHE Y V PDIMTLAKPLAGG
Sbjct  218   LYPADPEFMSELRALCDKHDTLLITDEVQCGLGRTGKLFAHELYDVTPDIMTLAKPLAGG  277

Query  1123  LPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylke  1302
             LPIGAVL++ KVA+AI  G HG+TF G PLVC  A TVL KI + +FL +V  +G+YL +
Sbjct  278   LPIGAVLMSNKVASAITPGQHGTTFGGNPLVCAVANTVLTKIMDEDFLDNVQKRGKYLAD  337

Query  1303  llgkklgg-NNHVKEIRglgliigielDVAAT----PLVEACQNSGLLVLTAGKGNVVRL  1467
              L K      N V ++R      G+ + +  +    PL+E   +  +L+++AG+ N +RL
Sbjct  338   GLQKLQQKFPNQVVDVRKPIGKGGLFVALECSKPVGPLIEYALSKQVLLISAGE-NTIRL  396

Query  1468  VPPLIISKQELEQAADVL  1521
              PPL++ + ++++   VL
Sbjct  397   CPPLVVDENDIDKLLAVL  414



>ref|WP_013176319.1| acetylornithine aminotransferase [Syntrophothermus lipocalidus]
 ref|YP_003703482.1| acetylornithine and succinylornithine aminotransferase [Syntrophothermus 
lipocalidus DSM 12680]
 gb|ADI02917.1| acetylornithine and succinylornithine aminotransferase [Syntrophothermus 
lipocalidus DSM 12680]
Length=398

 Score =   244 bits (623),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 150/315 (48%), Positives = 195/315 (62%), Gaps = 6/315 (2%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             V+LA +L   S  D+ FF+NSG E NEAA+K  RK+  FS     +P  E +AF N FHG
Sbjct  84    VQLAAKLCRLSGLDKAFFANSGAEVNEAALKLVRKY--FSLRG--KPGCEIVAFHNSFHG  139

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RT+GA+  T +E Y   FEP++PG  + E+ ++ +  ++I   K  A+ VEP+QGEGGI 
Sbjct  140   RTLGALTATGQEKYHRGFEPLVPGFVYAEFNDLGSVEKVITE-KTGAIIVEPVQGEGGIN  198

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
              AT +FL  LR  C     LLV DEVQ GLGRTG ++A+E YG+ PDI+TLAK L GG P
Sbjct  199   PATSKFLTGLRRLCYEFDLLLVLDEVQTGLGRTGKMFAYEHYGIKPDIVTLAKSLGGGFP  258

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGA+L   +VA A   GDH STF G PL C  A  VL+ +S  E L  ++  G YLK  L
Sbjct  259   IGAMLARAEVAQAFEPGDHASTFGGNPLGCAVANRVLDILSEEEMLNHITRIGDYLKSRL  318

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
                 G    VKE+RGLGL++G+E      PLV+ C   GLLV++AG   V+RLVPPL I+
Sbjct  319   QSMTGKRKDVKEVRGLGLLLGVEFTREVKPLVDICMQKGLLVISAGP-RVLRLVPPLNIA  377

Query  1489  KQELEQAADVLAACL  1533
               E +Q   +L   L
Sbjct  378   LDEADQGLAILNEAL  392



>dbj|GAM20999.1| hypothetical protein SAMD00019534_041740, partial [Acytostelium 
subglobosum LB1]
Length=446

 Score =   245 bits (626),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 147/316 (47%), Positives = 204/316 (65%), Gaps = 11/316 (3%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             + LA+ LVG S  D+VFF+N+GTEANE A+KFARK    + PD      E +AF++ F G
Sbjct  129   IRLAQLLVGNSNFDKVFFANTGTEANEGALKFARKHGMATSPD----KYEIVAFTHGFSG  184

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             R+MGA++ T K  YR  + P++PGV F  Y +I++    I       V VEP+QGEGG+ 
Sbjct  185   RSMGALSCTHKSKYREIYGPLVPGVKFATYNDIESIRNAIGP-NTCGVIVEPVQGEGGLE  243

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
             +AT EF++ L   C    +LL+ DEVQCG+GRTG LWAHE  GV PDIMTLAKPLAGGL 
Sbjct  244   AATPEFMKELERLCRANNALLIADEVQCGIGRTGELWAHERLGVRPDIMTLAKPLAGGLA  303

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGA+LVT+KVA  I  GDHG+TF G PLV      V E+I+N +FL  V  KGQ+L + L
Sbjct  304   IGAILVTDKVAGVIQPGDHGTTFGGSPLVTAVGSHVFERIANDQFLGEVRQKGQHLLKRL  363

Query  1309  gkklggNN--HVKEIRglgli-igielDVAATPLVEACQNS--GLLVLTAGKGNVVRLVP  1473
              +   G+   ++KEIR +G + +G+ELD     L+     +    L ++AG  N +RL P
Sbjct  364   QQIQAGSGKPYIKEIRTVGGLFVGVELDHPVKELISYALGAPHHTLFISAGD-NTLRLCP  422

Query  1474  PLIISKQELEQAADVL  1521
             PL +  +++++A +++
Sbjct  423   PLTVETKDIDKACNII  438



>ref|XP_003049623.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gb|EEU43910.1| predicted protein [Nectria haematococca mpVI 77-13-4]
Length=446

 Score =   245 bits (626),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 137/306 (45%), Positives = 192/306 (63%), Gaps = 7/306 (2%)
 Frame = +1

Query  625   ADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHGRTMGAVALTSKE  804
             A  VF  NSG+EANEAAIKFARK  + + P  E+  VE ++F N FHGRTMG+++ T   
Sbjct  141   AASVFVCNSGSEANEAAIKFARKAGKITDPSGEK--VEIVSFKNGFHGRTMGSLSATPNP  198

Query  805   HYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYSATKEFLQALRT  984
              Y+ PF P++PG     Y +++   EL+   K   V VEPIQGEGG+  AT+EFL AL  
Sbjct  199   KYQKPFAPMVPGFKVGNYNDVEGINELVTE-KTCGVIVEPIQGEGGVTPATEEFLVALAK  257

Query  985   SCDNAGSLLVFDEVQCGLGRTGYLWAHEAY--GVYPDIMTLAKPLAGGLPIGAVLVTEKV  1158
              C   G++L++DE+QCGLGRTG  WAH       +PDI+T AK L  G PIGAVLVT+ V
Sbjct  258   RCREVGAVLIYDEIQCGLGRTGTFWAHGTLPKEAHPDILTTAKALGNGFPIGAVLVTQDV  317

Query  1159  AAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVS-DkgqylkellgkklggNNH  1335
             A  +  GDHG+TF G PL C  A  ++ ++S+ +  ASV+     + +     +      
Sbjct  318   ADKMKVGDHGTTFGGNPLACRLAHYIVGRLSDKQLQASVTAKSEVFRQRFTKLQEKYPEL  377

Query  1336  VKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIISKQELEQAAD  1515
             VKE+RG GLI+G++L    TP+++A +  GLL++TAG  N +R VP L ++ +E+ Q  D
Sbjct  378   VKEVRGRGLILGLQLSEDPTPIIKAARERGLLIITAGT-NTLRFVPSLTVTDEEITQGLD  436

Query  1516  VLAACL  1533
             +L A +
Sbjct  437   ILEAAI  442



>ref|WP_029730714.1| acetylornithine aminotransferase [Dorea sp. AGR2135]
Length=397

 Score =   244 bits (622),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 140/313 (45%), Positives = 200/313 (64%), Gaps = 7/313 (2%)
 Frame = +1

Query  598   AKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHGRTM  777
             AK L+     D+VFF+NSGTEA E A+K ARK+             EFIA  + FHGR+M
Sbjct  91    AKALLKACEMDKVFFTNSGTEAIEGALKAARKYAYKKGTGR----YEFIAMEDSFHGRSM  146

Query  778   GAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYSAT  957
             GA+++T  EHYR+PFEP++PGV F +Y ++ +   L+ S K  A+ +E +QGEGGI  AT
Sbjct  147   GALSVTGTEHYRTPFEPLIPGVKFAKYNDLDSVKALV-SDKTCAIILEALQGEGGITPAT  205

Query  958   KEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLPIGA  1137
              EF++ LR  CD  G LL+ DE+QCG+GRTG ++A + YGV PDIMT+AK +  G+P+GA
Sbjct  206   DEFMKGLRQICDEEGILLICDEIQCGMGRTGSMFAWQGYGVKPDIMTMAKAIGNGVPVGA  265

Query  1138  VLVTEKVAA-AINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkellgk  1314
               +T++VA  ++  GDHG+T+ G PL C A    LE     +  A V + G YL E L +
Sbjct  266   FAMTKEVAEYSLEPGDHGTTYGGNPLACAAVAKTLELFEKYDLTAHVREIGAYLTEKLDE  325

Query  1315  klggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIISKQ  1494
              +  N+ V E RG+GLI GI++      +       GLL+++A KGNV+RLVPPL+I K+
Sbjct  326   LVAANDAVLERRGIGLIQGIKVKKPVGEISSEALKEGLLIISA-KGNVLRLVPPLVIEKE  384

Query  1495  ELEQAADVLAACL  1533
              +++  ++L   L
Sbjct  385   HVDEMLEILKKVL  397



>ref|XP_008879532.1| hypothetical protein H310_13694 [Aphanomyces invadans]
 gb|ETV91895.1| hypothetical protein H310_13694 [Aphanomyces invadans]
Length=450

 Score =   245 bits (626),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 143/312 (46%), Positives = 193/312 (62%), Gaps = 9/312 (3%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKF--QRFSHPDMEQPPVEFIAFSNCF  762
             + LA+ LV  S  D+VFF+NSGTEANE A KFAR +  +     ++E      IAF   F
Sbjct  122   LRLAQTLVENSGFDKVFFANSGTEANEGAYKFARLYANKVTQGTELEGKKNHVIAFKGGF  181

Query  763   HGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGG  942
             HGR+ GA++LT K   R PF P++PGV+F EY N+     LI S +  A+FVEPIQGEGG
Sbjct  182   HGRSSGALSLTYKPAIREPFLPLVPGVSFAEYNNLDDVRNLI-SDRTCAIFVEPIQGEGG  240

Query  943   IYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGG  1122
             +  A  +FL+ LR   +   +LL+ DEVQ GLGRTG L+ HE YGV PDIMTLAKPLA G
Sbjct  241   VLPAKPDFLRGLRAISNEYNALLICDEVQTGLGRTGKLFGHEVYGVQPDIMTLAKPLANG  300

Query  1123  LPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylke  1302
             LPIGAVL   KVA A+  G HG+TF G P+VC AA  V+ ++  P FL +V   G+ L +
Sbjct  301   LPIGAVLTLNKVAEAVPAGAHGTTFGGNPVVCEAANVVVNRLLQPGFLLNVKKMGRLLAQ  360

Query  1303  llgkklggN-NHVKEIRglgliigielDVA----ATPLVEACQNSGLLVLTAGKGNVVRL  1467
              L        N + ++R      G+   V     A P++    N G+L +TAG+  V+RL
Sbjct  361   GLKAVQAKYPNKITQVRLPIGEAGLYAGVELVGPAAPIIGDLVNHGVLAITAGE-TVIRL  419

Query  1468  VPPLIISKQELE  1503
              PPL++++ +++
Sbjct  420   CPPLVVTQDDVQ  431



>ref|WP_033125070.1| acetylornithine aminotransferase [Eubacterium sp. ER2]
Length=392

 Score =   243 bits (621),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 142/315 (45%), Positives = 195/315 (62%), Gaps = 7/315 (2%)
 Frame = +1

Query  592   ELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHGR  771
             E A++L   +  DRVFF+NSGTEA E A+K ARK+             EFIA  + FHGR
Sbjct  84    EAAQKLTKAAQMDRVFFTNSGTEAIEGALKAARKYAYTEGSGR----YEFIAMEHSFHGR  139

Query  772   TMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYS  951
             TMGAVA+T  E YR+PFEP++ GV F  Y ++ +  E + +G   AV +E +QGEGGIY 
Sbjct  140   TMGAVAVTGNEAYRTPFEPLIGGVRFARYNDLDSVKEQM-NGHTCAVIMETLQGEGGIYP  198

Query  952   ATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLPI  1131
                EFLQ +R  CD    LL+ DE+QCG+GRTG ++A + YGV PDIM +AK + GG+P+
Sbjct  199   IDPEFLQGVRKLCDENNVLLILDEIQCGMGRTGTMFAWQDYGVKPDIMAMAKAIGGGVPV  258

Query  1132  GAVLVTEKVA-AAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             GA  +TEKVA  ++  GDHG+T+ G P VC A   VL+     +    V   G YL++ L
Sbjct  259   GAFAMTEKVAEKSLAPGDHGTTYGGNPFVCAAVSAVLDIFEKEKLCDHVKQVGAYLEKQL  318

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
                      VK  RG GL+ G+ L+V    +V   Q  GLLV+TAG GNV+R+VPPL+I+
Sbjct  319   DALAERKESVKLRRGKGLMQGLVLNVPVGEVVVKAQKEGLLVITAG-GNVLRMVPPLVIT  377

Query  1489  KQELEQAADVLAACL  1533
             ++ +++  + L   L
Sbjct  378   EEHVDEMIEKLEKAL  392



>ref|WP_005337071.1| acetylornithine aminotransferase [Dorea formicigenerans]
 gb|EGX77715.1| hypothetical protein HMPREF9457_00552 [Dorea formicigenerans 
4_6_53AFAA]
Length=396

 Score =   244 bits (622),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 140/313 (45%), Positives = 200/313 (64%), Gaps = 7/313 (2%)
 Frame = +1

Query  598   AKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHGRTM  777
             AK L+     D+VFF+NSGTEA E A+K ARK+             EFIA  + FHGR+M
Sbjct  90    AKALLKACEMDKVFFTNSGTEAIEGALKAARKYAYKKGTGR----YEFIAMEDSFHGRSM  145

Query  778   GAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYSAT  957
             GA+++T  EHYR+PFEP++PGV F +Y ++ +   L+ S K  A+ +E +QGEGGI  AT
Sbjct  146   GALSVTGTEHYRTPFEPLIPGVKFAKYNDLDSVKALV-SDKTCAIILEALQGEGGITPAT  204

Query  958   KEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLPIGA  1137
              EF++ LR  CD  G LL+ DE+QCG+GRTG ++A + YGV PDIMT+AK +  G+P+GA
Sbjct  205   DEFMKGLRQICDEEGILLICDEIQCGMGRTGSMFAWQGYGVKPDIMTMAKAIGNGVPVGA  264

Query  1138  VLVTEKVAA-AINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkellgk  1314
               +T++VA  ++  GDHG+T+ G PL C A    LE     +  A V + G YL E L +
Sbjct  265   FAMTKEVAEYSLEPGDHGTTYGGNPLACAAVAKTLELFEKYDLTAHVREIGAYLTEKLDE  324

Query  1315  klggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIISKQ  1494
              +  N+ V E RG+GLI GI++      +       GLL+++A KGNV+RLVPPL+I K+
Sbjct  325   LVAANDAVLERRGIGLIQGIKVKKPVGEISSEALKEGLLIISA-KGNVLRLVPPLVIEKE  383

Query  1495  ELEQAADVLAACL  1533
              +++  ++L   L
Sbjct  384   HVDEMLEILKKVL  396



>ref|WP_022305917.1| acetylornithine aminotransferase [Roseburia sp. CAG:380]
 emb|CDC93079.1| acetylornithine aminotransferase [Roseburia sp. CAG:380]
Length=393

 Score =   243 bits (621),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 133/311 (43%), Positives = 198/311 (64%), Gaps = 5/311 (2%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             V+ A  L   S  DRVFF+NSG EA E A+K ARK+ R  +PD      E IA  + FHG
Sbjct  79    VKAANYLCEASGMDRVFFTNSGAEAIEGALKLARKYARTKNPDNGG---EIIAMEHSFHG  135

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMGA+++T  +HYR PFEP++ GV+F EY N+ +   LI S    A+ +E +QGEGGI+
Sbjct  136   RTMGALSVTGTKHYREPFEPLIGGVSFAEYNNLDSVKALITS-DTCAIIMESLQGEGGIH  194

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
              A+++F++ +R  CD  G LL+ DE+QCG+GRTG ++A + YG+ PDI+T AK L  G+P
Sbjct  195   PASEDFMKGVRALCDEKGILLILDEIQCGMGRTGKMFAFQHYGILPDIITSAKALGCGVP  254

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             +GA    E++A A+  GDHG+T+ G PL   A   V E       +  V++   YL + L
Sbjct  255   VGAFAAKEEIAQALVPGDHGTTYGGNPLATAAVCKVFEIYKKDHIVEHVNELAPYLIDKL  314

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
                   ++ +K++RG+G + GIELDV A  +V A  + GL++++AG  N++R+VPPL+  
Sbjct  315   NALAAKHSCIKDVRGIGFMQGIELDVPAGEIVGAALSKGLILISAGT-NIIRIVPPLVAG  373

Query  1489  KQELEQAADVL  1521
             K+ + +   +L
Sbjct  374   KEHINEMCRIL  384



>ref|XP_002617108.1| hypothetical protein CLUG_02552 [Clavispora lusitaniae ATCC 42720]
 gb|EEQ38426.1| hypothetical protein CLUG_02552 [Clavispora lusitaniae ATCC 42720]
Length=456

 Score =   245 bits (625),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 143/329 (43%), Positives = 204/329 (62%), Gaps = 23/329 (7%)
 Frame = +1

Query  592   ELAKRLV-------GCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAF  750
             ELA  LV       G   A RVF  NSGTEANEAA+KFARK+ +   P       E IAF
Sbjct  126   ELANLLVTKTLEAGGMQEAQRVFLCNSGTEANEAALKFARKYAKSKTP----TKTEIIAF  181

Query  751   SNCFHGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQ  930
             +N FHGRTMGA+++T+   Y+ PF P++PGV   E GNI++  + I   + AAV +EPIQ
Sbjct  182   TNAFHGRTMGALSVTANPKYQEPFSPLIPGVHTAEVGNIESVKQFISKERTAAVIIEPIQ  241

Query  931   GEGGIYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAH-----EAYGVYPDIM  1095
             GEGG+ +   EFL  L+  C+    +L++DE+QCGLGRTG LWAH     EA   +PDI+
Sbjct  242   GEGGVNTVASEFLVELKKLCEENDVVLIYDEIQCGLGRTGKLWAHCDLPKEA---HPDIL  298

Query  1096  TLAKPLAGGLPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASV  1275
             T+AK L  G PIGA ++++K+  A+  GDHG+T+ G PL  +    V+ ++S+ +FL  V
Sbjct  299   TMAKALGNGFPIGATMISDKIENALQVGDHGTTYGGNPLGASIGSYVVSQVSDNDFLKKV  358

Query  1276  -SDkgqylkellgkklggNNHVKEIRglgliigiel--DVAATPLVEACQNSGLLVLTAG  1446
              S    ++  L         HV++++G GL++G++L  +V A  +V  C+  GLLV+TAG
Sbjct  359   ESVSELFVTGLEKMVQEYPEHVEKVKGKGLLLGLQLKPNVDANNVVTKCREYGLLVITAG  418

Query  1447  KGNVVRLVPPLIISKQELEQAADVLAACL  1533
              GNV+RLVP L I    + +  ++LA  +
Sbjct  419   -GNVIRLVPALNIPADVVSKGLEILAKAI  446



>ref|XP_008605392.1| hypothetical protein SDRG_01636 [Saprolegnia diclina VS20]
 gb|EQC41678.1| hypothetical protein SDRG_01636 [Saprolegnia diclina VS20]
Length=445

 Score =   244 bits (624),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 143/313 (46%), Positives = 195/313 (62%), Gaps = 13/313 (4%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFAR----KFQRFSHPDMEQPPVEFIAFSN  756
             ++LAK+LV  S  D+VFF NSGTEANEAA KFAR    K  + +   +E      IAF  
Sbjct  121   LKLAKKLVEHSTFDKVFFCNSGTEANEAAYKFARLHGNKVAKGT--PLEGKKTHVIAFKG  178

Query  757   CFHGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGE  936
              FHGR+ G+++LT K   R PF P++P +TF EY N+      I S    A+ VEPIQGE
Sbjct  179   GFHGRSSGSLSLTYKPAIREPFLPLVPNITFAEYNNLDDVKAQI-SDHTCAIIVEPIQGE  237

Query  937   GGIYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLA  1116
             GG+  A  +FL  LR  CD   +LL+ DEVQ GLGRTG L+ HE YGV PD++TLAKPLA
Sbjct  238   GGVMPAKADFLIGLRELCDAHNALLICDEVQTGLGRTGNLFGHEVYGVQPDLITLAKPLA  297

Query  1117  GGLPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqyl  1296
             GGLPIGAVL  + VA A+  G HG+TF G P+VC AA  V++++++P FL +V   G+ +
Sbjct  298   GGLPIGAVLTKDHVADAVTPGSHGTTFGGNPIVCAAANVVMDRLTSPNFLFNVQKMGRLM  357

Query  1297  kellgkklggN-NHVKEIRglgliigielDV----AATPLVEACQNSGLLVLTAGKGNVV  1461
                L +    +   +KEIR      G+   V    A  P+V+     G++ +TAG+  V+
Sbjct  358   AHGLKELHAKHPTKIKEIRLPIGEAGLYAGVECHGAVGPIVKDLVTKGVITITAGE-KVL  416

Query  1462  RLVPPLIISKQEL  1500
             RL PPL+I++ ++
Sbjct  417   RLCPPLVITETDV  429



>gb|KGK38132.1| hypothetical protein JL09_g2760 [Pichia kudriavzevii]
Length=428

 Score =   244 bits (622),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 139/314 (44%), Positives = 198/314 (63%), Gaps = 9/314 (3%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             V+  K+  G   A RVF  NSGTEANEAA+KFARK  +     +     EFI F   FHG
Sbjct  111   VDKTKKFNGMHDAARVFLCNSGTEANEAALKFARKHGK----SISDSKTEFITFKTSFHG  166

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMGA+++T    Y++P+ P++PGV+     +I++  +LI       V +EPIQGEGG++
Sbjct  167   RTMGALSVTPNPKYQAPYAPLIPGVSVATPNDIESVKKLITEN-TCGVIIEPIQGEGGVH  225

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAY--GVYPDIMTLAKPLAGG  1122
                 EFL  L++ C    +LL++DE+QCGLGRTG LWAH       +PD++T+AK L  G
Sbjct  226   PMNPEFLVELKSLCKEHDALLIYDEIQCGLGRTGSLWAHSKLPKEAHPDVLTMAKALGNG  285

Query  1123  LPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylke  1302
              PIGA ++TE+V   +  GDHG+TF G PL       VL +I++ +FL++V++K   LK 
Sbjct  286   FPIGATMITEEVEKVLKVGDHGTTFGGNPLGSRIGCHVLNRIADNDFLSNVNEKSTLLKS  345

Query  1303  ll-gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPL  1479
             LL G K   + H+ ++RG GLI+G+E     +P+VE  +  GLL++TAG GNV+R VPPL
Sbjct  346   LLCGLKEKYSGHIVDVRGQGLILGLECKEDPSPIVEKARELGLLIITAG-GNVIRFVPPL  404

Query  1480  IISKQELEQAADVL  1521
              I  + LE+   +L
Sbjct  405   TIENETLEEGVRIL  418



>ref|WP_021983718.1| acetylornithine aminotransferase [Eubacterium sp. CAG:603]
 emb|CCZ05386.1| acetylornithine aminotransferase [Eubacterium sp. CAG:603]
Length=300

 Score =   239 bits (611),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 136/302 (45%), Positives = 197/302 (65%), Gaps = 6/302 (2%)
 Frame = +1

Query  628   DRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHGRTMGAVALTSKEH  807
             DRVFF+NSGTEA E AIK ARK+        +    E IA ++ FHGR+MGA+++T    
Sbjct  2     DRVFFTNSGTEAIEGAIKTARKYAYNKDGKNDH---EIIAMNHSFHGRSMGALSVTGNVK  58

Query  808   YRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYSATKEFLQALRTS  987
             Y+  F+P++ GV F +Y ++++   L+ + K  A+ +EP+QGEGGIY AT+EF++ +R  
Sbjct  59    YQEAFKPLIGGVKFADYNDLESVKALV-TDKTCAIILEPVQGEGGIYPATEEFIKGVREI  117

Query  988   CDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLPIGAVLVTEKVAAA  1167
             CD    LL+FDE+QCG+GRTG ++AHE YGV PDI+TLAK L  G+P+GA L  EK AA 
Sbjct  118   CDKNDILLIFDEIQCGMGRTGKMFAHEYYGVKPDILTLAKALGCGIPVGAFLTNEK-AAV  176

Query  1168  INYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkellgkklggNNHVKEI  1347
             +  GDHG+T+ G PL   A   VL+     + L +V + G+YL+  L +        KE 
Sbjct  177   LVPGDHGTTYGGNPLATAAINKVLDLFEETDVLENVCEVGKYLESKLDEVCDKFACAKEH  236

Query  1348  RglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIISKQELEQAADVLAA  1527
             RG GL+ G+ LDV    ++    + GLLV++AG GNV+R+VPPLII+K+ +++  ++L  
Sbjct  237   RGKGLMQGLVLDVPVGEVINKAMDRGLLVISAG-GNVLRMVPPLIITKENVDEMINILTE  295

Query  1528  CL  1533
              L
Sbjct  296   VL  297



>ref|XP_004194670.1| Piso0_005177 [Millerozyma farinosa CBS 7064]
 emb|CCE86674.1| Piso0_005177 [Millerozyma farinosa CBS 7064]
Length=452

 Score =   244 bits (624),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 137/322 (43%), Positives = 200/322 (62%), Gaps = 17/322 (5%)
 Frame = +1

Query  592   ELAKRLV-------GCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAF  750
             ELA++LV       G + A RVFFSNSGTE+NEAAIKFARK+ +     + +   E I+F
Sbjct  122   ELAQKLVEKTIESGGMAEAQRVFFSNSGTESNEAAIKFARKYGK----TLNENKYEIISF  177

Query  751   SNCFHGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQ  930
              N FHGRT+GA+++T  E Y+ PF P++PG    +  +I++   LI   K  AV +EPIQ
Sbjct  178   ENSFHGRTLGALSITPNEKYQKPFSPLLPGCHVAKPNDIKSVENLISKDKTCAVIIEPIQ  237

Query  931   GEGGIYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAY--GVYPDIMTLA  1104
             GEGG+      FL  LR  CD    +L++DE+Q G+GR+G LWAH       +PDI+T A
Sbjct  238   GEGGVNPIEPTFLVELRKLCDANDVILIYDEIQSGMGRSGKLWAHSHLPKEAHPDIITSA  297

Query  1105  KPLAGGLPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDk  1284
             K L  G PIGAV+++EKV  A+N GDHG+TF G  L C     VLE+IS+  F+A V  K
Sbjct  298   KALGNGYPIGAVIISEKVEKALNVGDHGTTFGGNLLACKIGSFVLEEISDKAFMADVQKK  357

Query  1285  gqylkellgkklggN-NHVKEIRglgliigielD--VAATPLVEACQNSGLLVLTAGKGN  1455
                    L +    + NH+ E+RG GL++G++ +  +    +V  C+++GL+ ++AG  N
Sbjct  358   ADLFSTKLAQIAAKHPNHISEVRGKGLLLGVKFNDSIDVAKVVTTCRDNGLIAISAG-SN  416

Query  1456  VVRLVPPLIISKQELEQAADVL  1521
             V+R+VP L I ++ + +  ++L
Sbjct  417   VLRIVPALNIPEETISEGLEIL  438



>ref|WP_022279144.1| acetylornithine aminotransferase [Dorea formicigenerans CAG:28]
 emb|CDC54662.1| acetylornithine aminotransferase [Dorea formicigenerans CAG:28]
Length=396

 Score =   243 bits (619),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 139/313 (44%), Positives = 199/313 (64%), Gaps = 7/313 (2%)
 Frame = +1

Query  598   AKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHGRTM  777
             AK L+     D+VFF+NSGTEA E A+K ARK+             EFIA  + FHGR+M
Sbjct  90    AKALLKACEMDKVFFTNSGTEAIEGALKAARKYAYKKGTGR----YEFIAMEDSFHGRSM  145

Query  778   GAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYSAT  957
             GA+++T  EHYR+PFEP++PGV F +Y ++ +   L+ S K  A+ +E +QGEGGI  AT
Sbjct  146   GALSVTGTEHYRTPFEPLIPGVKFAKYNDLDSVKALV-SDKTCAIILEALQGEGGITPAT  204

Query  958   KEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLPIGA  1137
              EF++ LR  CD  G LL+ DE+QCG+GRTG ++A + YGV PDIMT+AK +  G+P+GA
Sbjct  205   DEFMKGLRQICDEEGILLICDEIQCGMGRTGSMFAWQGYGVKPDIMTMAKAIGNGVPVGA  264

Query  1138  VLVTEKVAA-AINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkellgk  1314
               +T++VA  ++  GDHG+T+ G PL C A    LE     +  A V + G YL E L +
Sbjct  265   FAMTKEVAEYSLEPGDHGTTYGGNPLACAAVAKTLELFEKYDLTAHVREIGAYLTEKLDE  324

Query  1315  klggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIISKQ  1494
              +  N+ V E RG+GLI GI++      +       GLL+++A KGN +RLVPPL+I K+
Sbjct  325   LVAANDAVLERRGIGLIQGIKVKKPVREISSEALKEGLLIISA-KGNALRLVPPLVIEKE  383

Query  1495  ELEQAADVLAACL  1533
              +++  ++L   L
Sbjct  384   HVDEMLEILKKVL  396



>gb|KHC76594.1| acetylornithine/succinylornithine family transaminase [Candida 
albicans SC5314]
 gb|KHC86526.1| acetylornithine/succinylornithine family transaminase [Candida 
albicans SC5314]
Length=455

 Score =   244 bits (623),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 134/317 (42%), Positives = 190/317 (60%), Gaps = 10/317 (3%)
 Frame = +1

Query  598   AKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHGRTM  777
              K   G   A RVF  NSGTEANEAA+KFARK+ +  +P+      EFI F N FHGR+M
Sbjct  140   TKEFDGMKDASRVFLCNSGTEANEAALKFARKYGKSINPE----KYEFITFENSFHGRSM  195

Query  778   GAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYSAT  957
             GA+++T    Y+ PF P++PGV   +  +I++  ++I   K  AV +EP+QGEGG+    
Sbjct  196   GALSVTPNPKYQEPFSPLIPGVKIAKPNDIESVKQVINKDKTCAVIIEPLQGEGGVNIID  255

Query  958   KEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYG--VYPDIMTLAKPLAGGLPI  1131
             + FL  LR  CD    LL++DE+QCGLGRTG LWAH       +PDI+T+AK L  G PI
Sbjct  256   ESFLIELRKLCDENNVLLIYDEIQCGLGRTGKLWAHSWLSPEAHPDIVTIAKALGNGFPI  315

Query  1132  GAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkellg  1311
             GA ++TEKV  ++N GDHG+T+ G PL       +++ I + EFL  V +K Q   E L 
Sbjct  316   GATMITEKVEKSLNVGDHGTTYGGNPLASTVGSYIVDHIGDKEFLQQVENKSQIFLEGLN  375

Query  1312  kklggNNHVKEI---RglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLI  1482
             K    N+++ E    +GL L +  + +V    +V  C+  GLL++TAG  N +RLVP L 
Sbjct  376   KIAEENSNLIEKVKGKGLLLGLQFKENVDIGEIVAKCRQHGLLIITAGM-NTIRLVPALN  434

Query  1483  ISKQELEQAADVLAACL  1533
             I  Q ++   ++L   +
Sbjct  435   IPDQTIKDGLEILTQSI  451



>gb|KGR07191.1| acetylornithine/succinylornithine family transaminase [Candida 
albicans P57072]
 gb|KGR09015.1| acetylornithine/succinylornithine family transaminase [Candida 
albicans P78048]
 gb|KGT67702.1| acetylornithine/succinylornithine family transaminase [Candida 
albicans 12C]
 gb|KGU08537.1| acetylornithine/succinylornithine family transaminase [Candida 
albicans 19F]
 gb|KHC34628.1| acetylornithine/succinylornithine family transaminase [Candida 
albicans P76067]
 gb|KHC60843.1| acetylornithine/succinylornithine family transaminase [Candida 
albicans P75010]
Length=455

 Score =   244 bits (623),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 134/317 (42%), Positives = 190/317 (60%), Gaps = 10/317 (3%)
 Frame = +1

Query  598   AKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHGRTM  777
              K   G   A RVF  NSGTEANEAA+KFARK+ +  +P+      EFI F N FHGR+M
Sbjct  140   TKEFDGMKDASRVFLCNSGTEANEAALKFARKYGKSINPE----KYEFITFENSFHGRSM  195

Query  778   GAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYSAT  957
             GA+++T    Y+ PF P++PGV   +  +I++  ++I   K  AV +EP+QGEGG+    
Sbjct  196   GALSVTPNPKYQEPFSPLIPGVKIAKPNDIESVKQVINKDKTCAVIIEPLQGEGGVNIID  255

Query  958   KEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYG--VYPDIMTLAKPLAGGLPI  1131
             + FL  LR  CD    LL++DE+QCGLGRTG LWAH       +PDI+T+AK L  G PI
Sbjct  256   ESFLIELRKLCDENNVLLIYDEIQCGLGRTGKLWAHSWLSPEAHPDIVTIAKALGNGFPI  315

Query  1132  GAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkellg  1311
             GA ++TEKV  ++N GDHG+T+ G PL       +++ I + EFL  V +K Q   E L 
Sbjct  316   GATMITEKVEKSLNVGDHGTTYGGNPLASTVGSYIVDHIGDKEFLQQVENKSQIFLEGLN  375

Query  1312  kklggNNHVKEI---RglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLI  1482
             K    N+++ E    +GL L +  + +V    +V  C+  GLL++TAG  N +RLVP L 
Sbjct  376   KIAEENSNLIEKVKGKGLLLGLQFKENVDIGEIVAKCRQHGLLIITAGM-NTIRLVPALN  434

Query  1483  ISKQELEQAADVLAACL  1533
             I  Q ++   ++L   +
Sbjct  435   IPDQTIKDGLEILTQSI  451



>gb|KHC34181.1| acetylornithine/succinylornithine family transaminase [Candida 
albicans P76055]
Length=455

 Score =   244 bits (623),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 134/317 (42%), Positives = 190/317 (60%), Gaps = 10/317 (3%)
 Frame = +1

Query  598   AKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHGRTM  777
              K   G   A RVF  NSGTEANEAA+KFARK+ +  +P+      EFI F N FHGR+M
Sbjct  140   TKEFDGMKDASRVFLCNSGTEANEAALKFARKYGKSINPE----KYEFITFENSFHGRSM  195

Query  778   GAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYSAT  957
             GA+++T    Y+ PF P++PGV   +  +I++  ++I   K  AV +EP+QGEGG+    
Sbjct  196   GALSVTPNPKYQEPFSPLIPGVKIAKPNDIESVKQVINKDKTCAVIIEPLQGEGGVNIID  255

Query  958   KEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYG--VYPDIMTLAKPLAGGLPI  1131
             + FL  LR  CD    LL++DE+QCGLGRTG LWAH       +PDI+T+AK L  G PI
Sbjct  256   ESFLIELRKLCDENNVLLIYDEIQCGLGRTGKLWAHSWLSPEAHPDIVTIAKALGNGFPI  315

Query  1132  GAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkellg  1311
             GA ++TEKV  ++N GDHG+T+ G PL       +++ I + EFL  V +K Q   E L 
Sbjct  316   GATMITEKVEKSLNVGDHGTTYGGNPLASTVGSYIVDHIGDKEFLQQVENKSQIFLEGLN  375

Query  1312  kklggNNHVKEI---RglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLI  1482
             K    N+++ E    +GL L +  + +V    +V  C+  GLL++TAG  N +RLVP L 
Sbjct  376   KIAEENSNLIEKVKGKGLLLGLQFKENVDIGEIVAKCRQHGLLIITAGM-NTIRLVPALN  434

Query  1483  ISKQELEQAADVLAACL  1533
             I  Q ++   ++L   +
Sbjct  435   IPDQTIKDGLEILTQSI  451



>ref|XP_003870026.1| Arg8 acetylornithine aminotransferase [Candida orthopsilosis 
Co 90-125]
 emb|CCG23895.1| Arg8 acetylornithine aminotransferase [Candida orthopsilosis]
Length=459

 Score =   244 bits (623),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 138/326 (42%), Positives = 194/326 (60%), Gaps = 16/326 (5%)
 Frame = +1

Query  592   ELAKRLV-------GCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAF  750
             ELA +L+       G   A RVF  NSGTEANEAA+KFARK  +    D +   +EFI F
Sbjct  136   ELASKLIHKTKEHNGLHDASRVFLCNSGTEANEAALKFARKHGKSKGGDNK---IEFITF  192

Query  751   SNCFHGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQ  930
             +N FHGR+MGA+++T    Y+SPF P++PGV   E  NI +  ELI S K   V +EPIQ
Sbjct  193   ANSFHGRSMGALSVTPNPKYQSPFAPLIPGVHIAEPNNIDSVKELISSEKTCGVIIEPIQ  252

Query  931   GEGGIYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHE--AYGVYPDIMTLA  1104
             GEGG+    + FL  LR  C+    LL++DE+QCGLGR+G LWAH       +PD++T+A
Sbjct  253   GEGGVNHVDESFLIELRKLCNEHDVLLIYDEIQCGLGRSGKLWAHSYLPQEAHPDVLTMA  312

Query  1105  KPLAGGLPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDk  1284
             K L  G PIGA ++TEKV  A++ GDHG+T+ G PL       V+++I+   FL SV++K
Sbjct  313   KALGNGFPIGATMITEKVENALSVGDHGTTYGGNPLGARIGSYVVDEITKEPFLQSVNEK  372

Query  1285  gqylkellgkklggNNH-VKEIRgl--gliigielDVAATPLVEACQNSGLLVLTAGKGN  1455
              +     L +    + H V +++G    L +     V    +VE C+ +GLL++TAG  N
Sbjct  373   SERFIAKLNQIAEAHPHRVLKVKGKGLLLGLQFAEGVDINKIVEKCRENGLLIITAGM-N  431

Query  1456  VVRLVPPLIISKQELEQAADVLAACL  1533
              +R VP L I  Q ++    +L  C+
Sbjct  432   TIRFVPALNIPDQAIDDGLTILEHCI  457



>gb|KGQ96127.1| acetylornithine/succinylornithine family transaminase [Candida 
albicans GC75]
 gb|KGU27928.1| acetylornithine/succinylornithine family transaminase [Candida 
albicans P75063]
 gb|KHC37479.1| acetylornithine/succinylornithine family transaminase [Candida 
albicans Ca6]
Length=455

 Score =   244 bits (623),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 133/317 (42%), Positives = 190/317 (60%), Gaps = 10/317 (3%)
 Frame = +1

Query  598   AKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHGRTM  777
              K   G   A RVF  NSGTEANEAA+KFARK+ +  +P+      EFI F N FHGR+M
Sbjct  140   TKEFDGMKDASRVFLCNSGTEANEAALKFARKYGKSINPE----KYEFITFENSFHGRSM  195

Query  778   GAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYSAT  957
             GA+++T    Y+ PF P++PGV   +  +I++  ++I   K  AV +EP+QGEGG+    
Sbjct  196   GALSVTPNPKYQEPFSPLIPGVKIAKPNDIESVKQVINKDKTCAVIIEPLQGEGGVNIIN  255

Query  958   KEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYG--VYPDIMTLAKPLAGGLPI  1131
             + FL  LR  CD    LL++DE+QCGLGRTG LWAH       +PDI+T+AK L  G PI
Sbjct  256   ESFLIELRKLCDENNVLLIYDEIQCGLGRTGKLWAHSWLSPEAHPDIVTIAKALGNGFPI  315

Query  1132  GAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkellg  1311
             GA ++TEKV  ++N GDHG+T+ G PL       +++ I + EFL  V +K Q   E L 
Sbjct  316   GATMITEKVEKSLNVGDHGTTYGGNPLASTVGSYIVDHIGDKEFLQQVENKSQIFLEGLN  375

Query  1312  kklggN-NHVKEIRgl--gliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLI  1482
             K    N N +++++G    L +  + +V    +V  C+  GLL++TAG  N +RLVP L 
Sbjct  376   KIAEENPNLIEKVKGKGLLLGLQFKKNVDIGEIVAKCRQHGLLIITAGM-NTIRLVPALN  434

Query  1483  ISKQELEQAADVLAACL  1533
             I  Q ++   ++L   +
Sbjct  435   IPDQTIKDGLEILTQSI  451



>ref|WP_009617506.1| acetylornithine aminotransferase [Desulfosporosinus sp. OT]
 gb|EGW39820.1| acetylornithine aminotransferase [Desulfosporosinus sp. OT]
Length=401

 Score =   242 bits (618),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 141/311 (45%), Positives = 191/311 (61%), Gaps = 5/311 (2%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             V LA+RLV  SFAD+VFF NSG EANE+AIK ARK+ +    +      E ++F N FHG
Sbjct  88    VALAERLVKHSFADKVFFCNSGAEANESAIKLARKYAK---KNFGAHKCEVVSFKNSFHG  144

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RT+  + LT +  Y+  ++P+  G ++    +I+     +     AAVF+EPIQGEGG+ 
Sbjct  145   RTLATLTLTGQTKYQEGYDPLPSGFSYAALNDIEDLRSKVNE-NTAAVFIEPIQGEGGVI  203

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
              A   FLQA R  CD  G+LL+FDEVQCG+GRTG L+A E  GV PD+MTLAK L GG+P
Sbjct  204   PAETAFLQAARALCDQYGALLIFDEVQCGIGRTGKLFACEWSGVAPDVMTLAKALGGGVP  263

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGA+L  ++VA A   GDH STF G PL   A   VL+ I    FLA V ++  Y ++ L
Sbjct  264   IGAMLARDEVAQAFQPGDHASTFGGNPLATAAGCAVLDVILEEGFLAGVQERSLYFRKGL  323

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
              K          +RG G I+G  +      +VEAC+  GLL+   G G V+R +PPLI+ 
Sbjct  324   EKLAQKYQTGDPVRGQGFILGWPVSKLGPEIVEACRQKGLLINCVG-GQVLRFLPPLIVE  382

Query  1489  KQELEQAADVL  1521
             K E+++A ++L
Sbjct  383   KPEMDKALEIL  393



>ref|XP_007783326.1| hypothetical protein W97_07156 [Coniosporium apollinis CBS 100218]
 gb|EON68009.1| hypothetical protein W97_07156 [Coniosporium apollinis CBS 100218]
Length=506

 Score =   245 bits (626),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 139/316 (44%), Positives = 197/316 (62%), Gaps = 7/316 (2%)
 Frame = +1

Query  613   GCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHGRTMGAVAL  792
             G   A RVF  NSG+EANEAA+KF+RK  +   P   +   E ++F N FHGRTMG+++ 
Sbjct  179   GMHSASRVFICNSGSEANEAALKFSRKVGKTLDPSGSKH--EIVSFHNSFHGRTMGSLSA  236

Query  793   TSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYSATKEFLQ  972
             T    Y+ PF P++PG  +  Y +I +  EL+ + K   V +EPIQGEGG+  A+ +FL 
Sbjct  237   TPNPKYQKPFAPMLPGFRYGTYNDIGSINELV-TEKTCGVIIEPIQGEGGVNVASPDFLL  295

Query  973   ALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAY--GVYPDIMTLAKPLAGGLPIGAVLV  1146
             ALR  C++ G++L++DE+QCGL RTG LWAH A     +PD++T AK L  G PIGA +V
Sbjct  296   ALRRRCNDVGAVLIYDEIQCGLSRTGQLWAHAALPKEAHPDVLTTAKALGNGFPIGATIV  355

Query  1147  TEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASV-SDkgqylkellgkklg  1323
             +E VA+ I  GDHG+TF G PL C  A  VL ++  PE    V + +  + K     +  
Sbjct  356   SESVASKIVTGDHGTTFGGNPLACRVAHYVLSRLCEPELQRGVLAKEKVFRKGFERLRRR  415

Query  1324  gNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIISKQELE  1503
                 V E+RG GLI+G++L    TP+V A +  GLLV+T G  N +R VPPL+IS++E+E
Sbjct  416   FPEVVTEVRGRGLILGLQLSRDPTPVVTAARERGLLVITCGT-NTLRFVPPLVISEEEIE  474

Query  1504  QAADVLAACLPVLDKS  1551
             Q   +L   + V+ K+
Sbjct  475   QGMRILEEAMQVVFKT  490



>ref|WP_036558067.1| acetylornithine aminotransferase [Oceanicola sp. MCTG156(1a)]
Length=393

 Score =   242 bits (617),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 142/322 (44%), Positives = 201/322 (62%), Gaps = 7/322 (2%)
 Frame = +1

Query  595   LAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQ-RFSHPDMEQPPVEFIAFSNCFHGR  771
             LA  LV  +FAD VFF+NSGTEA E AIK ARK+      PD        +AFS  FHGR
Sbjct  77    LADALVDATFADTVFFTNSGTEACELAIKMARKYWYEKGQPDR----TGIVAFSGAFHGR  132

Query  772   TMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYS  951
             +  A+A    E     F P++PG T L++G+++A  E+++   I AV +EPIQGEGGI +
Sbjct  133   SSAAIAAAGTEKMVKGFGPLLPGFTHLDFGDLEALEEVLKDPTIGAVMIEPIQGEGGIRA  192

Query  952   ATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLPI  1131
                  LQ +R  CD+AG+LL+ DEVQCG+GRTG L+AHE  G+ PDIM +AK + GG P+
Sbjct  193   VPDADLQKIRALCDDAGALLILDEVQCGMGRTGRLFAHEWAGITPDIMMVAKGIGGGFPL  252

Query  1132  GAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkellg  1311
             GAVL TE  A+ +  G HGST+ G PL C   + V + +S+P+FLA V+ K    ++ L 
Sbjct  253   GAVLATETAASGMTVGTHGSTYGGNPLGCAVGLKVTQIVSDPDFLADVNRKAGMFRQKLE  312

Query  1312  kklggNNHV-KEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
               +  +  + +E+RG GLI+G++  VA T +V+A  ++ LL + A   NV+RL+P L I+
Sbjct  313   GLVAAHPDIFEEVRGTGLILGLKCKVANTDVVKAGYDAELLTVPAAD-NVIRLLPALNIA  371

Query  1489  KQELEQAADVLAACLPVLDKST  1554
               ++  A D L A    L+ +T
Sbjct  372   DADIATAIDRLDAAARRLETAT  393



>ref|WP_022465018.1| acetylornithine aminotransferase [Clostridium sp. CAG:277]
 emb|CDE70317.1| acetylornithine aminotransferase [Clostridium sp. CAG:277]
Length=393

 Score =   242 bits (617),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 133/311 (43%), Positives = 197/311 (63%), Gaps = 5/311 (2%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             V+ A  L   S  DRVFF+NSG EA E A+K ARK+ R   PD +    E IA  + FHG
Sbjct  79    VKAAGYLCEASGMDRVFFTNSGAEAIEGALKLARKYVRTKTPDNKG---EIIAMEHSFHG  135

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMGA+++T  +HYR PFEP++ GV+F +Y ++ +   LI +    A+ +E +QGEGGI+
Sbjct  136   RTMGALSVTGTKHYREPFEPLIGGVSFAKYNDLDSVKALI-TPDTCAIIMESLQGEGGIH  194

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
              AT+EF++ +R  CD  G +L+ DE+QCG+GRTG ++A + YG+ PDI+T AK L  G+P
Sbjct  195   PATEEFMKGVRALCDENGIVLILDEIQCGMGRTGEMFAFQHYGIQPDIITSAKALGCGVP  254

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             +GA    E++A A+  GDHG+T+ G PL   A   V E       +  V +   YL+E L
Sbjct  255   VGAFAAREEIARALVPGDHGTTYGGNPLATAAVCKVFEIFKKEHIVEHVKELSPYLREKL  314

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
                   +  +KE+RG+G + GIE D+ A  +V A Q  GL++++AG  N++R+VPPLI  
Sbjct  315   ESLAAKHASMKEVRGIGFMQGIESDIPAGDIVGAAQERGLILISAGT-NIIRIVPPLIAE  373

Query  1489  KQELEQAADVL  1521
             K+ +++   +L
Sbjct  374   KEHIDEMCRIL  384



>gb|KEQ83505.1| mitochondrial acetylornithine aminotransferase [Aureobasidium 
pullulans EXF-150]
Length=413

 Score =   242 bits (618),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 140/315 (44%), Positives = 194/315 (62%), Gaps = 7/315 (2%)
 Frame = +1

Query  619   SFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHGRTMGAVALTS  798
             S A R F  NSG+EANEAAIKFARK  R +  D      E ++F N FHGRTMG+++ T 
Sbjct  88    SDAARAFICNSGSEANEAAIKFARKCGRMA--DESGDKHEIVSFHNSFHGRTMGSLSATP  145

Query  799   KEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYSATKEFLQAL  978
                Y+ PF P++PG  +  Y ++ A  +L+   K   V +EPIQGEGG+  AT EFL AL
Sbjct  146   NPKYQKPFGPMVPGFRYGTYNDVSAINDLVTE-KTCGVIIEPIQGEGGVNVATDEFLLAL  204

Query  979   RTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAY--GVYPDIMTLAKPLAGGLPIGAVLVTE  1152
             R  C   G++L+FDE+QCGLGRTG +WAH A     +PDI+T AK L  G PIGA +VTE
Sbjct  205   RRRCTEVGAVLIFDEIQCGLGRTGTMWAHGALPKEAHPDILTTAKALGNGFPIGATIVTE  264

Query  1153  KVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASV-SDkgqylkellgkklggN  1329
              V++ I  GDHG+TF G PL    A  ++ ++S  E    V + +  + K     K    
Sbjct  265   NVSSKIVTGDHGTTFGGNPLGSRLAHYIVGRLSGSEIQDGVLAKEKVFRKRFEQLKQNYP  324

Query  1330  NHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIISKQELEQA  1509
             + + E+RG GL++G++L    TP+V A +  GLL++T G  N +R VPPLIISK E+EQ 
Sbjct  325   DVITEVRGRGLLLGVQLSQDPTPVVTAARERGLLIITCGT-NTLRFVPPLIISKSEIEQG  383

Query  1510  ADVLAACLPVLDKST  1554
              D+L   +  + +++
Sbjct  384   MDILEDAMKAVFRTS  398



>gb|EEQ45002.1| acetylornithine aminotransferase, mitochondrial precursor [Candida 
albicans WO-1]
 gb|KGU07953.1| acetylornithine/succinylornithine family transaminase [Candida 
albicans P87]
 gb|KHC66777.1| acetylornithine/succinylornithine family transaminase [Candida 
albicans P75016]
Length=455

 Score =   243 bits (621),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 133/317 (42%), Positives = 190/317 (60%), Gaps = 10/317 (3%)
 Frame = +1

Query  598   AKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHGRTM  777
              K   G   A RVF  NSGTEANEAA+KFARK+ +  +P+      EFI F N FHGR+M
Sbjct  140   TKEFDGMKDASRVFLCNSGTEANEAALKFARKYGKSINPE----KYEFITFENSFHGRSM  195

Query  778   GAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYSAT  957
             GA+++T    Y+ PF P++PGV   +  +I++  ++I   K  AV +EP+QGEGG+    
Sbjct  196   GALSVTPNPKYQEPFSPLIPGVKIAKPNDIESVKQVINKDKTCAVIIEPLQGEGGVNIID  255

Query  958   KEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYG--VYPDIMTLAKPLAGGLPI  1131
             + FL  LR  CD    LL++DE+QCGLGRTG LWAH       +PDI+T+AK L  G PI
Sbjct  256   ESFLIELRKLCDENNVLLIYDEIQCGLGRTGKLWAHSWLSPEAHPDIVTIAKALGNGFPI  315

Query  1132  GAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkellg  1311
             GA ++TEKV  ++N GDHG+T+ G PL       +++ I + EFL  V +K Q   E L 
Sbjct  316   GATMITEKVEKSLNVGDHGTTYGGNPLASTVGSYIVDHIGDKEFLQQVENKSQIFLEGLN  375

Query  1312  kklggN-NHVKEIRgl--gliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLI  1482
             K    N N +++++G    L +  + +V    +V  C+  GLL++TAG  N +RLVP L 
Sbjct  376   KIAEENPNLIEKVKGKGLLLGLQFKKNVDIGEIVAKCRQHGLLIITAGM-NTIRLVPALN  434

Query  1483  ISKQELEQAADVLAACL  1533
             I  Q ++   ++L   +
Sbjct  435   IPDQTIKDGLEILTQSI  451



>ref|XP_717254.1| hypothetical protein CaO19.11254 [Candida albicans SC5314]
 gb|EAK98281.1| hypothetical protein CaO19.11254 [Candida albicans SC5314]
 gb|KGU08976.1| acetylornithine/succinylornithine family transaminase [Candida 
albicans L26]
 gb|KHC52873.1| acetylornithine/succinylornithine family transaminase [Candida 
albicans P37039]
Length=455

 Score =   243 bits (621),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 133/317 (42%), Positives = 190/317 (60%), Gaps = 10/317 (3%)
 Frame = +1

Query  598   AKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHGRTM  777
              K   G   A RVF  NSGTEANEAA+KFARK+ +  +P+      EFI F N FHGR+M
Sbjct  140   TKEFDGMKDASRVFLCNSGTEANEAALKFARKYGKSINPE----KYEFITFENSFHGRSM  195

Query  778   GAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYSAT  957
             GA+++T    Y+ PF P++PGV   +  +I++  ++I   K  AV +EP+QGEGG+    
Sbjct  196   GALSVTPNPKYQEPFSPLIPGVKIAKPNDIESVKQVINKDKTCAVIIEPLQGEGGVNIID  255

Query  958   KEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYG--VYPDIMTLAKPLAGGLPI  1131
             + FL  LR  CD    LL++DE+QCGLGRTG LWAH       +PDI+T+AK L  G PI
Sbjct  256   ESFLIELRKLCDENNVLLIYDEIQCGLGRTGKLWAHSWLSPEAHPDIVTIAKALGNGFPI  315

Query  1132  GAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkellg  1311
             GA ++TEKV  ++N GDHG+T+ G PL       +++ I + EFL  V +K Q   E L 
Sbjct  316   GATMITEKVEKSLNVGDHGTTYGGNPLASTVGSYIVDHIGDKEFLQQVENKSQIFLEGLN  375

Query  1312  kklggN-NHVKEIRgl--gliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLI  1482
             K    N N +++++G    L +  + +V    +V  C+  GLL++TAG  N +RLVP L 
Sbjct  376   KIAEENPNLIEKVKGKGLLLGLQFKENVDIGEIVAKCRQHGLLIITAGM-NTIRLVPALN  434

Query  1483  ISKQELEQAADVLAACL  1533
             I  Q ++   ++L   +
Sbjct  435   IPDQTIKDGLEILTQSI  451



>ref|XP_458070.1| DEHA2C09042p [Debaryomyces hansenii CBS767]
 sp|Q6BUP9.1|ARGD_DEBHA RecName: Full=Acetylornithine aminotransferase, mitochondrial; 
Short=ACOAT; Flags: Precursor [Debaryomyces hansenii CBS767]
 emb|CAG86141.1| DEHA2C09042p [Debaryomyces hansenii CBS767]
Length=466

 Score =   243 bits (621),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 145/340 (43%), Positives = 208/340 (61%), Gaps = 23/340 (7%)
 Frame = +1

Query  574   HDFM*VELAKRLV-------GCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPP  732
             H+    ELA +LV       G   A RVF  NSGTEANEAA+KFARK+ +    D     
Sbjct  126   HNLYAGELANKLVTNTINSGGMKEAQRVFLCNSGTEANEAALKFARKYGKSFSDD----K  181

Query  733   VEFIAFSNCFHGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAV  912
              E I F N FHGRTMGA+++T  E Y+ PF P++PGV   E  +I +  +LI   K  AV
Sbjct  182   YEMITFKNSFHGRTMGALSVTPNEKYQKPFAPLVPGVKIAEPNDISSVEKLISKEKTCAV  241

Query  913   FVEPIQGEGGIYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAH-----EAYG  1077
              +EPIQGEGG+ +   EFL +L+  C +   +L++DE+QCGLGR+G LWAH     EA  
Sbjct  242   IIEPIQGEGGVNAIDAEFLVSLKKLCVDNEVVLIYDEIQCGLGRSGKLWAHCNLPEEA--  299

Query  1078  VYPDIMTLAKPLAGGLPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNP  1257
              +PDI+T+AK L  G PIGAV+V++K+   +  GDHG+T+ G PL       V++++S+ 
Sbjct  300   -HPDILTMAKALGNGFPIGAVMVSDKIEKVLKVGDHGTTYGGNPLGSKIGSYVVDQVSDK  358

Query  1258  EFLASVSDkgqylkellgkklggN-NHVKEIRglgliigielDVAAT--PLVEACQNSGL  1428
             EFL  V +K +   + L K    + +H+ E++G GL++G++L        +V  C+ +GL
Sbjct  359   EFLLEVEEKSEKFTKGLSKIANKHPDHIGEVKGKGLLLGLQLKGNLDVGDVVAKCRENGL  418

Query  1429  LVLTAGKGNVVRLVPPLIISKQELEQAADVLAACLPVLDK  1548
             LV++AG  NV+R+VP L I  + +E+  DVL  C+  L K
Sbjct  419   LVISAGM-NVLRIVPALNIPNEAIEEGLDVLDKCIDELSK  457



>gb|KGQ85851.1| acetylornithine/succinylornithine family transaminase [Candida 
albicans P94015]
 gb|KGQ88351.1| acetylornithine/succinylornithine family transaminase [Candida 
albicans P37005]
 gb|KGR14773.1| acetylornithine/succinylornithine family transaminase [Candida 
albicans P37037]
 gb|KGU24785.1| acetylornithine/succinylornithine family transaminase [Candida 
albicans P34048]
 gb|KGU29490.1| acetylornithine/succinylornithine family transaminase [Candida 
albicans P57055]
 gb|KHC51031.1| acetylornithine/succinylornithine family transaminase [Candida 
albicans P60002]
Length=455

 Score =   243 bits (620),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 133/317 (42%), Positives = 190/317 (60%), Gaps = 10/317 (3%)
 Frame = +1

Query  598   AKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHGRTM  777
              K   G   A RVF  NSGTEANEAA+KFARK+ +  +P+      EFI F N FHGR+M
Sbjct  140   TKEFDGMKDASRVFLCNSGTEANEAALKFARKYGKSINPE----KYEFITFENSFHGRSM  195

Query  778   GAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYSAT  957
             GA+++T    Y+ PF P++PGV   +  +I++  ++I   K  AV +EP+QGEGG+    
Sbjct  196   GALSVTPNPKYQEPFSPLIPGVKIAKPNDIESVKQVINKDKTCAVIIEPLQGEGGVNIID  255

Query  958   KEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYG--VYPDIMTLAKPLAGGLPI  1131
             + FL  LR  CD    LL++DE+QCGLGRTG LWAH       +PDI+T+AK L  G PI
Sbjct  256   ESFLIELRKLCDENNVLLIYDEIQCGLGRTGKLWAHSWLSPEAHPDIVTIAKALGNGFPI  315

Query  1132  GAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkellg  1311
             GA ++TEKV  ++N GDHG+T+ G PL       +++ I + EFL  V +K Q   E L 
Sbjct  316   GATMITEKVEKSLNVGDHGTTYGGNPLASTVGSYIVDHIGDKEFLQQVENKSQIFLEGLN  375

Query  1312  kklggN-NHVKEIRgl--gliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLI  1482
             K    N N +++++G    L +  + +V    +V  C+  GLL++TAG  N +RLVP L 
Sbjct  376   KIAEENPNLIEKVKGKGLLLGLQFKENVDIGEIVAKCRQHGLLIITAGM-NTIRLVPALN  434

Query  1483  ISKQELEQAADVLAACL  1533
             I  Q ++   ++L   +
Sbjct  435   IPDQTIKDGLEILTQSI  451



>emb|CCH43456.1| Glutamate-1-semialdehyde 2,1-aminomutase [Wickerhamomyces ciferrii]
Length=431

 Score =   242 bits (618),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 140/322 (43%), Positives = 196/322 (61%), Gaps = 13/322 (4%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             VE  K+  G   A RVF +NSGTEANEAA+KFARK+ +       +   EFI F+N FHG
Sbjct  117   VEATKQSGGMHDASRVFLANSGTEANEAALKFARKYGK----SQNENKTEFITFTNSFHG  172

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             R+MGA+++T    Y+ PF P++PGV+  E  N+++ ++LI     A V +EPIQGEGG+ 
Sbjct  173   RSMGALSVTPNPKYQKPFSPLIPGVSVSE-PNLESFSKLINEN-TAGVIIEPIQGEGGVR  230

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAY--GVYPDIMTLAKPLAGG  1122
               +KEFL  L+       +LL+FDE+QCGLGR+G LWAH +     +PDI+T+AK L  G
Sbjct  231   PVSKEFLIELKKLTKKHNALLIFDEIQCGLGRSGNLWAHGSLPKEAHPDIVTMAKALGNG  290

Query  1123  LPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylke  1302
              PIGA ++TE V  A+N GDHG+T+ G PL       VL ++S  EFL  VS+K Q  + 
Sbjct  291   FPIGATMITENVEKALNVGDHGTTYGGNPLGARVGSYVLSQVSEKEFLNKVSEKSQIFRN  350

Query  1303  llgkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLI  1482
              L       N + E+RG GL++G++     + +V+A +  GLLV+TAG GN VR VP L 
Sbjct  351   ELESLKNEINEIVEVRGEGLLLGVQFKSDPSKVVDAARERGLLVITAG-GNTVRFVPALN  409

Query  1483  ISKQELEQA----ADVLAACLP  1536
             I    + +      D + +  P
Sbjct  410   IEDDVIREGLAIFKDAVKSVFP  431



>ref|WP_022747710.1| acetylornithine aminotransferase [Lachnobacterium bovis]
Length=398

 Score =   241 bits (616),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 135/315 (43%), Positives = 202/315 (64%), Gaps = 6/315 (2%)
 Frame = +1

Query  592   ELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHGR  771
             E +K+L+  S  DRVF +NSGTEA E AIK ARK+   ++   ++   E IA  + FHGR
Sbjct  85    EASKKLLKVSQMDRVFLTNSGTEAIEGAIKAARKY---AYKKQKKGCYEIIAMEHSFHGR  141

Query  772   TMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYS  951
             ++GA+++T   HYR PFEP++PGV F ++ +I++  EL+ S K  A+ +E +QGEGGIY 
Sbjct  142   SLGALSVTGNNHYREPFEPLLPGVKFAKFNDIESVKELV-SPKTCAIIMETVQGEGGIYP  200

Query  952   ATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLPI  1131
             A + FL+ ++  C     LL+ DE+QCG+GRTG ++A + YG+ PDIMT AK +  G+P+
Sbjct  201   ADEMFLKEVKQICKENDILLILDEIQCGMGRTGEMFAWQGYGIKPDIMTCAKAIGCGVPV  260

Query  1132  GAVLVTEKVAA-AINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             GA  VTEKVA  ++  GDHG+T+ G P V  A V VL +      LA V D  +YL++ L
Sbjct  261   GAFFVTEKVAQNSLEPGDHGTTYGGNPFVSAAIVEVLRQFEKKNILAHVQDISEYLEDQL  320

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
                +   + + E RG GL+ G+E  V  + + +    +GL+++TAGK NV+R VPPLII+
Sbjct  321   DLLVCEYDFLVERRGKGLMQGVESKVNVSEISKKALENGLILITAGK-NVLRFVPPLIIT  379

Query  1489  KQELEQAADVLAACL  1533
             ++ +++    L   L
Sbjct  380   EENVDEMISKLKQTL  394



>gb|AIJ06020.1| acetylornithine and succinylornithine aminotransferase [Methanocaldococcus 
sp. JH146]
Length=398

 Score =   241 bits (616),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 138/311 (44%), Positives = 200/311 (64%), Gaps = 5/311 (2%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             ++LAK+LV  S  DR FF NSG EANE AIKFARK+   +   + +   E I+  N FHG
Sbjct  84    IKLAKKLVELSGLDRAFFCNSGAEANEGAIKFARKY---ASKILGKDGGEIISMYNAFHG  140

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RT+  +A T K  Y+  F P+ PG  ++ + +I+A  E I + K +A+ +EP+QGEGGI+
Sbjct  141   RTLTTLAATPKPKYQEGFYPLPPGFKYVPFNDIEALKEAI-TNKTSAIIIEPVQGEGGIH  199

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
              A K++L+A+R  CD+   +L+FDEVQCG+GRTG ++A+E Y V PDI+TLAK L GG+P
Sbjct  200   VADKDYLKAVRDLCDDKNIVLIFDEVQCGMGRTGKMFAYEHYDVKPDILTLAKALGGGVP  259

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGAV++ E++A A++YGDHG+TF G PL C+AA+  +E I        V +KG+Y    L
Sbjct  260   IGAVVLKEEIAKALSYGDHGTTFGGNPLACSAALASIEVIEELIKDNKVIEKGKYFIRKL  319

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
                    N +KE+RGLGL+IG EL+     +V+     G L+       V+R +PPLI+ 
Sbjct  320   ENLKEKYNFIKEVRGLGLMIGSELEFNGAEIVKKMLEKGFLI-NCTSDTVLRFLPPLIVE  378

Query  1489  KQELEQAADVL  1521
             K+ ++   + L
Sbjct  379   KEHIDDLINAL  389



>ref|WP_022123702.1| acetylornithine aminotransferase [Clostridium sp. CAG:510]
 emb|CDA69630.1| acetylornithine aminotransferase [Clostridium sp. CAG:510]
Length=403

 Score =   241 bits (616),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 137/316 (43%), Positives = 194/316 (61%), Gaps = 6/316 (2%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             +E AK+L   S  DRVFF+NSG EA E AIK ARK+        +    E IA  + FHG
Sbjct  88    IEAAKKLKAVSGMDRVFFTNSGAEAIEGAIKAARKYAYLKDGTTDH---EIIAMEHSFHG  144

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTMGA+++T   HYR  FEP +  + F    +I +   LI   K  A+ +E +QGEGGI+
Sbjct  145   RTMGALSVTGNPHYREAFEPGIGNIRFATMNDIDSVKALINE-KTCAIIMETVQGEGGIH  203

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
              A + FL+ LR  CD    LL+ DE+QCG+GRTGY++A + YGV PDIMT AK L  G+P
Sbjct  204   PADEAFLRELRKICDEKDILLILDEIQCGMGRTGYMFAWQKYGVKPDIMTTAKALGCGVP  263

Query  1129  IGAVLVTEKVAA-AINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkel  1305
             +GA L+ EKV A ++  GDHG+T+ G PLVC A   VL+       + +V +   YL++ 
Sbjct  264   VGAFLLNEKVGAHSLAAGDHGTTYGGNPLVCAAVNKVLDLFETNHIIENVREVAPYLEKR  323

Query  1306  lgkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLII  1485
             L +     + + + RG GL+ G+E D   TP + +  + GL+++ AG+ +++RLVPPLII
Sbjct  324   LDELKEKYDFIIDRRGAGLMQGLEFDRPVTPYINSALDKGLMLINAGQ-SIIRLVPPLII  382

Query  1486  SKQELEQAADVLAACL  1533
             +KQ ++    VL  CL
Sbjct  383   TKQNVDDMIAVLDTCL  398



>ref|WP_010870226.1| acetylornithine aminotransferase [Methanocaldococcus jannaschii]
 ref|NP_247706.1| acetylornithine aminotransferase [Methanocaldococcus jannaschii 
DSM 2661]
 sp|Q58131.1|ARGD_METJA RecName: Full=Acetylornithine aminotransferase; Short=ACOAT [Methanocaldococcus 
jannaschii DSM 2661]
 gb|AAB98717.1| acetylornithine aminotransferase (argD) [Methanocaldococcus jannaschii 
DSM 2661]
Length=398

 Score =   241 bits (616),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 141/320 (44%), Positives = 202/320 (63%), Gaps = 5/320 (2%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             ++LAK+LV  S  DR FF NSG EANE AIKFARK+       + +   E I+  N FHG
Sbjct  84    IKLAKKLVELSGLDRAFFCNSGAEANEGAIKFARKY---VSKVLGREGGEIISMYNAFHG  140

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RT+  +A T K  Y+  F P+ PG  ++ + +I+A  E I + K AA+ +EP+QGEGGI+
Sbjct  141   RTLTTLAATPKPKYQDGFYPLPPGFKYVPFNDIEALKEAI-TDKTAAIMIEPVQGEGGIH  199

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
              A K++L+A+R  CD+   +L+FDEVQCG+GRTG ++A E YGV PDI+TLAK L GG+P
Sbjct  200   VADKDYLKAVRDLCDDKNIVLIFDEVQCGMGRTGRMFAFEHYGVEPDILTLAKALGGGVP  259

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGAV++ E++A A++YGDHG+TF G PL C+AA+  +E I        V +KG+Y    L
Sbjct  260   IGAVVLKEEIAKALSYGDHGTTFGGNPLACSAALASVEVIEELIKDDKVIEKGKYFIRKL  319

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
                +   N +KE+RGLGL+IG EL+     +V+     G L+       V+R +PPLI+ 
Sbjct  320   ENLIEKYNFIKEVRGLGLMIGAELEFNGADIVKKMLEKGFLI-NCTSDTVLRFLPPLIVE  378

Query  1489  KQELEQAADVLAACLPVLDK  1548
             K+ ++   + L      + K
Sbjct  379   KEHIDALINALDEVFTEIKK  398



>emb|CBX27957.1| Acetylornithine aminotransferase [uncultured Desulfobacterium 
sp.]
Length=392

 Score =   241 bits (615),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 143/315 (45%), Positives = 199/315 (63%), Gaps = 9/315 (3%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             VELA  LV  SFAD+VFF NSG EANEAAIK ARK+  FS  + E+   + I+    FHG
Sbjct  83    VELALWLVENSFADKVFFCNSGAEANEAAIKLARKY--FS-TNNEKERYKIISMERSFHG  139

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RTM  ++ T ++  +  ++P++ G  F+ + +I A    I S    AV +EP+QGEGG++
Sbjct  140   RTMATLSATGQDKVKKGYDPILEGFDFVPFNDIDALANKINSST-CAVLLEPVQGEGGLW  198

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
                  +L+ +R  CD  G+LL+FDE+Q G+GRTG L+A++ +GV PDIMTLAK L  GLP
Sbjct  199   RPAPGYLKEVRKLCDETGALLIFDEIQTGIGRTGKLFAYQHFGVEPDIMTLAKALGNGLP  258

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGA+L  E VA+A  +G H STF G P+V  AA+ VL+ +S  + +      G Y  E L
Sbjct  259   IGAMLAKEHVASAFVHGSHASTFGGTPVVTAAALEVLKVLSEEKVIEHCGRIGAYFMERL  318

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
                   ++ ++++RG+GL++GIELD    P+V  C   G LV    +GNV+R +PPLIIS
Sbjct  319   MWLKSRHSSIRDVRGIGLMLGIELDTEGEPVVNKCLEKGFLV-NCIQGNVIRFIPPLIIS  377

Query  1489  KQELEQAADVLAACL  1533
             KQE+    D L  CL
Sbjct  378   KQEI----DDLVLCL  388



>ref|WP_008601730.1| Acetylornithine aminotransferase [alpha proteobacterium JLT2015]
 gb|EMD83030.1| Acetylornithine aminotransferase [alpha proteobacterium JLT2015]
Length=400

 Score =   241 bits (615),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 141/313 (45%), Positives = 197/313 (63%), Gaps = 8/313 (3%)
 Frame = +1

Query  592   ELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFS-HPDMEQPPVEFIAFSNCFHG  768
             ELA+RLV  +FAD VFF+NSG EA E A K A  +Q  S HP+  +     I F+N FHG
Sbjct  77    ELAQRLVDLTFADTVFFTNSGVEAFECAAKTALAYQHVSGHPERTR----IITFNNAFHG  132

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             R++ A++ T  E  R PFEP+     +  + +++A   LI + K AA+ VEP+QGEGGI 
Sbjct  133   RSIAAISATGSEKLRVPFEPLPDWSDYAPFNDLEATKALI-TDKTAAIMVEPVQGEGGIL  191

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
              AT EFLQ LR  CD    +L+FDEVQCG+ RTG L+AHE YGV PDIM +AK + GG P
Sbjct  192   PATPEFLQGLRALCDEHDLMLIFDEVQCGVARTGTLFAHEQYGVTPDIMAVAKGIGGGFP  251

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             +GA L +EK A  +  G HGST+ G PL   A + VL+ ++ P+FLA+V   G+ L   +
Sbjct  252   LGACLASEKAAVGMTVGTHGSTYGGNPLGMAAGMAVLDVVAEPDFLANVKRLGERLVHAV  311

Query  1309  gkklggNNHV-KEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLII  1485
              + +  ++ +   IRG GL++G+++  A  P V   +  G+L + AG  NVVRL+PPL I
Sbjct  312   EQMIPNHDDLFTGIRGKGLMLGLQMTEATRPFVNFARQYGILTVAAGD-NVVRLLPPLNI  370

Query  1486  SKQELEQAADVLA  1524
              +  +E+A   L+
Sbjct  371   EEPHIEEAVSKLS  383



>gb|KFZ13311.1| hypothetical protein V502_06690 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=474

 Score =   243 bits (620),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 142/313 (45%), Positives = 191/313 (61%), Gaps = 7/313 (2%)
 Frame = +1

Query  613   GCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHGRTMGAVAL  792
             G S    VF  NSG+EANEAAIKFARK  + + P   +   E ++F N FHGRTMG+++ 
Sbjct  161   GMSGVSSVFICNSGSEANEAAIKFARKAGKVADPSGAKH--EIVSFYNSFHGRTMGSLSA  218

Query  793   TSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYSATKEFLQ  972
             T    Y++PF P++PG  +  Y +I    EL+     A V VEPIQGEGG++ AT EFL 
Sbjct  219   TPNPKYQAPFAPMLPGFRYGTYNDIAGIAELVTPA-TAGVIVEPIQGEGGVHVATPEFLI  277

Query  973   ALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAY--GVYPDIMTLAKPLAGGLPIGAVLV  1146
             AL   C   G+LL++DE+QCGL RTG LWAH       +PDI+T AK L  G P+GA LV
Sbjct  278   ALAARCKEVGALLIYDEIQCGLSRTGTLWAHSELPASAHPDILTTAKALGNGFPVGATLV  337

Query  1147  TEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASV-SDkgqylkellgkklg  1323
             T  VA  I  GDHG+TF G PL    A  ++ ++S PE   +V +    ++  +   +  
Sbjct  338   TGSVAEKIAVGDHGTTFGGNPLASRLAHHIVSRLSQPELQEAVAAKSALFVGHMKKLQEK  397

Query  1324  gNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIISKQELE  1503
                 V EIRG GL++G++LD   TP+V A +  GLLV+TAG  N +R VPPL IS+ E+E
Sbjct  398   YPKLVGEIRGKGLLLGLQLDRDPTPIVAAARERGLLVITAGT-NTLRFVPPLTISEAEIE  456

Query  1504  QAADVLAACLPVL  1542
             +   VL A + V+
Sbjct  457   EGFAVLDAVMGVV  469



>gb|EMF17890.1| acetylornithine aminotransferase mitochondrial precursor [Sphaerulina 
musiva SO2202]
Length=487

 Score =   243 bits (621),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 137/309 (44%), Positives = 191/309 (62%), Gaps = 7/309 (2%)
 Frame = +1

Query  604   RLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHGRTMGA  783
             R  G   A RVF  NSG+EANEAAIKFARK+ R   PD  +   E ++F   FHGRTMG+
Sbjct  156   REAGGFDAARVFVCNSGSEANEAAIKFARKYGRSMQPDGSK--YELVSFQGAFHGRTMGS  213

Query  784   VALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYSATKE  963
             ++ T    Y+ PF P++PG  +  Y +I    EL+ + K   V VEPIQGEGG+  A+ E
Sbjct  214   LSATPNPKYQKPFSPMIPGFKYGTYNDIAGINELV-TDKTCGVIVEPIQGEGGVNVASHE  272

Query  964   FLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAY--GVYPDIMTLAKPLAGGLPIGA  1137
             FL ALR  C   G++L+ DE+QCGL RTG LWAH A     +PD++T AK L  G PIGA
Sbjct  273   FLLALRKRCTEVGAVLIHDEIQCGLARTGKLWAHAALPKEAHPDVVTTAKALGNGFPIGA  332

Query  1138  VLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASV-SDkgqylkellgk  1314
              +VTE V++ I  GDHG+T+ G PL C  A  ++ ++++PE    V   + ++ +     
Sbjct  333   TMVTEDVSSKIVTGDHGTTYGGNPLGCRLAHYIVTRLADPELQQDVLKKEARFRQHFTRI  392

Query  1315  klggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIISKQ  1494
                  + V+E+RG GLI+G++L    TP++ A +  GLLV+T G  N +R VPPLIIS  
Sbjct  393   HEAFPDVVQEVRGRGLILGLQLSADPTPVITAARERGLLVITCGT-NTLRFVPPLIISDA  451

Query  1495  ELEQAADVL  1521
             E+++   +L
Sbjct  452   EIDEGMQIL  460



>ref|WP_015326454.1| acetylornithine/succinylornithine aminotransferase [Halobacteroides 
halobius]
 ref|YP_007314822.1| acetylornithine/succinylornithine aminotransferase [Halobacteroides 
halobius DSM 5150]
 gb|AGB40729.1| acetylornithine/succinylornithine aminotransferase [Halobacteroides 
halobius DSM 5150]
Length=397

 Score =   241 bits (614),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 142/318 (45%), Positives = 196/318 (62%), Gaps = 6/318 (2%)
 Frame = +1

Query  592   ELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHGR  771
             +L+K LV  S A++VFF+NSG EANE AIK ARK+  F+    ++  +  IA  + FHGR
Sbjct  86    KLSKLLVENSCANKVFFANSGAEANEGAIKLARKY--FTKQSKDKYKI--IATKDSFHGR  141

Query  772   TMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYS  951
             T+  +A T +E Y+ PF P+  G  F  Y +++A  +LI   K AA+ VEPIQGEGG+  
Sbjct  142   TLATLAATGQEKYQKPFTPLPQGFDFAPYNDLEAVKDLIDE-KTAAIIVEPIQGEGGVNP  200

Query  952   ATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLPI  1131
             ATKE+LQ LR  CD    LL+FDEVQ G+GRTG L+A++ YGV PDI TLAK L  G+PI
Sbjct  201   ATKEYLQGLRELCDQKEILLIFDEVQTGVGRTGSLFAYQEYGVKPDIFTLAKALGNGMPI  260

Query  1132  GAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkellg  1311
              ++L    VA A   GDH STF G PL C AA   L+ I     +  V +   Y +  L 
Sbjct  261   SSILACGDVAEAFEPGDHASTFGGNPLACRAAYATLKIILEENIIDQVKEVANYFQTELA  320

Query  1312  kklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIISK  1491
             K       +K++RG GL+IG+EL V+   +++  +   +L+L AG+ NV+R +PPLII+K
Sbjct  321   KLEDKYAIIKDVRGKGLMIGVELRVSVKQIIKQVREENILILNAGE-NVLRFLPPLIINK  379

Query  1492  QELEQAADVLAACLPVLD  1545
               + +  + L   L  LD
Sbjct  380   DHVTKLIETLDQILSELD  397



>gb|KHC76264.1| acetylornithine/succinylornithine family transaminase [Candida 
albicans P78042]
Length=455

 Score =   243 bits (619),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 132/317 (42%), Positives = 190/317 (60%), Gaps = 10/317 (3%)
 Frame = +1

Query  598   AKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHGRTM  777
              K   G   A RVF  NSGTEANEAA+KFARK+ +  +P+      EFI F N FHGR+M
Sbjct  140   TKEFDGMKDASRVFLCNSGTEANEAALKFARKYGKSINPE----KYEFITFENSFHGRSM  195

Query  778   GAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYSAT  957
             GA+++T    Y+ PF P++PGV   +  +I++  ++I   K  A+ +EP+QGEGG+    
Sbjct  196   GALSVTPNPKYQEPFSPLIPGVKIAKPNDIESVKQVINKDKTCAMIIEPLQGEGGVNIID  255

Query  958   KEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYG--VYPDIMTLAKPLAGGLPI  1131
             + FL  LR  CD    LL++DE+QCGLGRTG LWAH       +PDI+T+AK L  G PI
Sbjct  256   ESFLIELRKLCDENNVLLIYDEIQCGLGRTGKLWAHSWLSPEAHPDIVTIAKALGNGFPI  315

Query  1132  GAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkellg  1311
             GA ++TEKV  ++N GDHG+T+ G PL       +++ I + EFL  V +K Q   E L 
Sbjct  316   GATMITEKVEKSLNVGDHGTTYGGNPLASTVGSYIVDHIGDKEFLQQVENKSQIFLEGLN  375

Query  1312  kklggN-NHVKEIRgl--gliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLI  1482
             K    N N +++++G    L +  + +V    +V  C+  GLL++TAG  N +RLVP L 
Sbjct  376   KIAEENPNLIEKVKGKGLLLGLQFKKNVDIGEIVAKCRQHGLLIITAGM-NTIRLVPALN  434

Query  1483  ISKQELEQAADVLAACL  1533
             I  Q ++   ++L   +
Sbjct  435   IPDQTIKDGLEILTQSI  451



>ref|WP_022502240.1| acetylornithine aminotransferase [Eubacterium sp. CAG:76]
 emb|CDF10551.1| acetylornithine aminotransferase [Eubacterium sp. CAG:76]
Length=393

 Score =   241 bits (614),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 135/318 (42%), Positives = 203/318 (64%), Gaps = 6/318 (2%)
 Frame = +1

Query  553   QTRKYFVHDFM*VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPP  732
              T  YF ++   V  AK L   S  DRVFF+NSGTE+ E AIK A+K+   ++    +  
Sbjct  73    HTSNYFYNEPA-VNAAKALTKASGMDRVFFTNSGTESIEGAIKLAKKY---AYLKTGRTD  128

Query  733   VEFIAFSNCFHGRTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAV  912
              E IA  + FHGR+MGA+A+T  +HY+  F P++PG+ F  Y ++++  +L+   K  A+
Sbjct  129   SEIIAMHHSFHGRSMGALAVTGNKHYQEAFGPMIPGIKFANYNDLESVKQLVND-KTCAI  187

Query  913   FVEPIQGEGGIYSATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDI  1092
               E +QGEGGIY AT EF++ +R  CD  G LL+ DE+QCG+GRTG ++A + YGV PDI
Sbjct  188   IFETVQGEGGIYPATNEFIKGVRQLCDEKGILLILDEIQCGMGRTGTMFAFQQYGVEPDI  247

Query  1093  MTLAKPLAGGLPIGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLAS  1272
             +T+AK L  G+P+GA L  E+VA A+  GDHG+T+ G PL C AA  V E       L +
Sbjct  248   LTVAKALGCGVPVGAFLAKEEVAKALVPGDHGTTYGGNPLACAAATKVFELFEKQHILDN  307

Query  1273  VSDkgqylkellgkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKG  1452
             V +   YL+E L + +   + + E RGLGL+ G+EL +    ++    ++GL++ +AG  
Sbjct  308   VKEVSAYLEEKLDELVAEYDFIIERRGLGLMQGLELSINPKDVIANALDNGLILFSAGT-  366

Query  1453  NVVRLVPPLIISKQELEQ  1506
             NV+R+VPPL+I+K ++++
Sbjct  367   NVIRMVPPLVITKADVDE  384



>ref|WP_005334441.1| acetylornithine aminotransferase [Dorea formicigenerans]
 gb|EDR45882.1| aminotransferase, acetylornithine/succinylornithine family [Dorea 
formicigenerans ATCC 27755]
Length=397

 Score =   241 bits (614),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 139/313 (44%), Positives = 199/313 (64%), Gaps = 7/313 (2%)
 Frame = +1

Query  598   AKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHGRTM  777
             AK L+     D+VFF+NSGTEA E A+K ARK+             EFIA  + FHGR+M
Sbjct  91    AKALLKACEMDKVFFTNSGTEAIEGALKAARKYAYKKGTGR----YEFIAMEDSFHGRSM  146

Query  778   GAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYSAT  957
             GA+++T  EHYR+PFEP++PGV F +Y ++ +   L+ S K  A+ +E +QGEGGI  AT
Sbjct  147   GALSVTGTEHYRTPFEPLIPGVKFAKYNDLDSVKALV-SDKTCAIILEALQGEGGITPAT  205

Query  958   KEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLPIGA  1137
              EF++ LR  CD    LL+ DE+QCG+GRTG ++A + YGV PDIMT+AK +  G+P+GA
Sbjct  206   DEFMKGLRQICDEEEILLICDEIQCGMGRTGSMFAWQGYGVKPDIMTMAKAIGNGVPVGA  265

Query  1138  VLVTEKVAA-AINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkellgk  1314
               +T++VA  ++  GDHG+T+ G PL C A    LE     +  A V + G YL E L +
Sbjct  266   FAMTKEVAEYSLEPGDHGTTYGGNPLACAAVAKTLELFEKYDLTAHVREIGAYLTEKLDE  325

Query  1315  klggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIISKQ  1494
              +  N+ V E RG+GLI GI++      +       GLL+++A KGNV+RLVPPL+I K+
Sbjct  326   LVAANDAVLERRGIGLIQGIKVKKPVGEISSEALKEGLLIISA-KGNVLRLVPPLVIEKE  384

Query  1495  ELEQAADVLAACL  1533
              +++  ++L   L
Sbjct  385   HVDEMLEILKKVL  397



>ref|XP_003857080.1| acetylornithine aminotransferase, mitochondrial [Zymoseptoria 
tritici IPO323]
 gb|EGP92056.1| hypothetical protein MYCGRDRAFT_84117 [Zymoseptoria tritici IPO323]
Length=410

 Score =   241 bits (615),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 136/300 (45%), Positives = 186/300 (62%), Gaps = 7/300 (2%)
 Frame = +1

Query  631   RVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHGRTMGAVALTSKEHY  810
             R F  NSG+EANEAAIKFARK+   + PD  +   E ++F   FHGRTMG+++ T    Y
Sbjct  91    RAFICNSGSEANEAAIKFARKYGHSTQPDGSK--YELVSFHQSFHGRTMGSLSATPNPKY  148

Query  811   RSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYSATKEFLQALRTSC  990
             + PF P++PG  +  Y +I    +L+   K   V +EPIQGEGG+  AT EFL ALR  C
Sbjct  149   QKPFAPMLPGFKYGTYNDIAGINDLVTE-KTCGVIIEPIQGEGGVNIATHEFLLALRKRC  207

Query  991   DNAGSLLVFDEVQCGLGRTGYLWAHE--AYGVYPDIMTLAKPLAGGLPIGAVLVTEKVAA  1164
                G++L+ DE+QCGLGRTG LWAH       +PDI+T AK L  G PIGA LVTE V++
Sbjct  208   TEVGAVLIHDEIQCGLGRTGKLWAHADLPREAHPDIVTTAKALGNGYPIGATLVTEDVSS  267

Query  1165  AINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASV-SDkgqylkellgkklggNNHVK  1341
              I  GDHG+TF G PL C  A  ++ ++S+PE    V   + ++ K          + ++
Sbjct  268   KIVTGDHGTTFGGNPLGCRLAHYIVSRLSDPELQKDVLLKEARFRKHFTRLHEAFPDVIE  327

Query  1342  EIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIISKQELEQAADVL  1521
             E+RG GLI+G++L    TP++ A +  GLLV+T G  N +R VPPLIIS  E++Q   +L
Sbjct  328   EVRGRGLILGLQLKSDPTPVITAARERGLLVITCGT-NTLRFVPPLIISNDEIDQGMGML  386



>ref|WP_022431851.1| acetylornithine aminotransferase [Eubacterium sp. CAG:38]
 emb|CDE36285.1| acetylornithine aminotransferase [Eubacterium sp. CAG:38]
Length=397

 Score =   241 bits (614),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 132/303 (44%), Positives = 196/303 (65%), Gaps = 5/303 (2%)
 Frame = +1

Query  598   AKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHGRTM  777
             AK L   +  DRVFF+NSGTEA E AIK A+K+        +    E IA  + FHGR+M
Sbjct  87    AKMLTKATGMDRVFFTNSGTEAVEGAIKLAKKYAYLKDGSTDH---EIIAMEHSFHGRSM  143

Query  778   GAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYSAT  957
             GA+A+T  +HY+  F P++PG+ F +Y N+++  EL+   K  A+  E +QGEGG+Y A 
Sbjct  144   GALAVTGNKHYQEAFGPMIPGIRFAQYNNLESVKELVNE-KTCAIIFETVQGEGGVYPAK  202

Query  958   KEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLPIGA  1137
             KEF++ +R  CD  G LL+ DE+QCG+GRTG ++A++ YGV PDI+T+AK L  G+P+GA
Sbjct  203   KEFIEGVRKLCDEKGILLILDEIQCGMGRTGSMFAYQQYGVKPDIVTVAKALGCGVPVGA  262

Query  1138  VLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkellgkk  1317
                 ++VA A+  GDHG+T+ G PL C AAV V E   + + L +V + G YL   L K 
Sbjct  263   FAAKDEVAKALVPGDHGTTYGGNPLACAAAVKVFELFDSLKVLDNVKEVGAYLASELDKI  322

Query  1318  lggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIISKQE  1497
             +   +   E RG+GLI G++L V    ++    ++GL++ +AG  NV+R VPPL+I+K +
Sbjct  323   VAEYDIATERRGMGLIQGLQLSVNPKDVIANALDNGLILFSAGT-NVIRFVPPLVITKAD  381

Query  1498  LEQ  1506
             +++
Sbjct  382   VDE  384



>ref|WP_014967991.1| acetylornithine aminotransferase [Gottschalkia acidurici]
 ref|YP_006788702.1| acetylornithine aminotransferase ArgD [ [[Clostridium] acidurici 
9a]
 gb|AFS78855.1| acetylornithine aminotransferase ArgD [ [[Clostridium] acidurici 
9a]
Length=396

 Score =   241 bits (614),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 140/315 (44%), Positives = 200/315 (63%), Gaps = 5/315 (2%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             +ELAK LV  S  D+VFF NSGTE+ EA +K +RK+    +    +   E I   N FHG
Sbjct  84    IELAKMLVENSDFDKVFFCNSGTESVEAGLKLSRKY---GNEKKGKDCYEIITMINSFHG  140

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RT+G++  T ++ Y+  F P++PGV +  Y + +    ++ S K  A+ +E IQGEGG+Y
Sbjct  141   RTLGSITATGQKKYQEGFGPLLPGVKYALYNDFETLESMV-SDKTCAIVLEVIQGEGGVY  199

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
              A KE+LQ +R  CD    +L+FDEVQ G+GRTG L+ ++ +GV PDI+ LAK L GG+P
Sbjct  200   QADKEYLQKVRELCDENDIVLMFDEVQTGIGRTGKLFGYQIHGVKPDIICLAKGLGGGIP  259

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGA++ T+KVA+    G+H STF G P+   A V +L ++ N   L +V  +G+YL+E L
Sbjct  260   IGAMMATDKVASVFEPGNHASTFGGNPIATTAGVNILNRLINDGILQNVEKQGEYLRERL  319

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
                   N  +KEIRG GLI GIELD   + L   C   GLL++ AG  NVVR +PPLII+
Sbjct  320   QGLKENNPAIKEIRGCGLIQGIELDTPGSELTNKCIEKGLLLVGAGP-NVVRFLPPLIIN  378

Query  1489  KQELEQAADVLAACL  1533
              +E+++A  +L + L
Sbjct  379   SKEIDEAISILDSSL  393



>ref|WP_011722448.1| acetylornithine aminotransferase [Clostridium novyi]
 ref|YP_878454.1| acetylornithine aminotransferase [Clostridium novyi NT]
 gb|ABK61708.1| Acetylornithine aminotransferase (ACOAT) [Clostridium novyi NT]
 gb|KEH88181.1| acetylornithine aminotransferase [Clostridium novyi A str. NCTC 
538]
 gb|KEH91308.1| acetylornithine aminotransferase [Clostridium novyi A str. BKT29909]
 gb|KEH93682.1| acetylornithine aminotransferase [Clostridium novyi A str. GD211209]
Length=388

 Score =   240 bits (613),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 129/312 (41%), Positives = 198/312 (63%), Gaps = 6/312 (2%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             + LA++L   S  D+ FF NSGTEA EAAIK ARK+    + +        I   N FHG
Sbjct  76    ISLAEKLCKLSDHDKAFFCNSGTEACEAAIKLARKYGSLINKNKNV----IIHMKNSFHG  131

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RT+GA+++T  E+Y++PF P++  +  +E+ NI    + +   ++  V +EPIQGEGGI 
Sbjct  132   RTLGALSITYNENYKTPFYPLIDRIKTVEFNNIDELKDKMND-EVCGVIIEPIQGEGGIK  190

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
              + K+FL+  R  CD   S+L+FDEVQCG+GRTG L+A++ + V PD++ +AK L GG P
Sbjct  191   VSNKDFLKEARKLCDKFNSVLIFDEVQCGIGRTGKLFAYKNFDVIPDVVCMAKGLGGGFP  250

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGA++   K A A   GDHG+TF G PL C  A+TVL++++    +  +  K  YL + L
Sbjct  251   IGAIIAKNKFANAFKPGDHGNTFGGNPLACTVALTVLKELTENHIIDEIPKKSNYLIQKL  310

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
                      ++EIRG GL++GI++++    +V++C N  LLV++A   NV+RL+PPL +S
Sbjct  311   SLLKDNYKIIEEIRGKGLLLGIKVNINCNKIVDSCFNKKLLVISAN-DNVIRLLPPLNVS  369

Query  1489  KQELEQAADVLA  1524
             K +++ A + L+
Sbjct  370   KDDIDLAINTLS  381



>ref|WP_013908954.1| acetylornithine aminotransferase [Thermodesulfobacterium geofontis]
 ref|YP_004627182.1| acetylornithine/succinyldiaminopimelate aminotransferase [Thermodesulfobacterium 
geofontis OPF15]
 gb|AEH22254.1| Acetylornithine/succinyldiaminopimelate aminotransferase [Thermodesulfobacterium 
geofontis OPF15]
Length=395

 Score =   240 bits (613),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 140/318 (44%), Positives = 201/318 (63%), Gaps = 6/318 (2%)
 Frame = +1

Query  592   ELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHGR  771
             +LAK+LV  SFA++VFF+NSG EA EA +K AR   R+++ +  +   +FIA  N FHGR
Sbjct  83    KLAKKLVELSFAEKVFFANSGAEAIEAGLKLAR---RWAYENFGKEKNQFIALENSFHGR  139

Query  772   TMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYS  951
             T GA+++T +  Y   FEP++PG+ F+   + +A +      K+ A+ +EPIQGEGG+Y 
Sbjct  140   TYGALSVTGQPKYWEGFEPLLPGIIFIPPNDKKALSASFNE-KVCAIILEPIQGEGGVYP  198

Query  952   ATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLPI  1131
               KEF++  +  C    +LL+FDEVQ G+GRTG L+A+E +GV PDIM LAK LA GLP+
Sbjct  199   LDKEFVELAKELCQKYNALLIFDEVQTGIGRTGKLFAYEHFGVEPDIMCLAKALANGLPL  258

Query  1132  GAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVS-Dkgqylkell  1308
              A+L  EKV +A   G H STF G PL C  A+ VLE +SNP FL  V        ++L 
Sbjct  259   SAMLAKEKVMSAFKPGTHASTFGGNPLACAVALKVLEIVSNPSFLKEVDLKGRILKEKLE  318

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
               +    + +KE+RGLGL+IGIE +++A  + +      +LV T  K NV+RL PPLII+
Sbjct  319   KIRKERPDLIKEVRGLGLLIGIEFNISAEKIYQKLLEKKILV-TQPKPNVIRLSPPLIIT  377

Query  1489  KQELEQAADVLAACLPVL  1542
              +E++   +     + VL
Sbjct  378   YREIDFFMETFKEIITVL  395



>ref|WP_007044676.1| acetylornithine aminotransferase [Methanotorris formicicus]
 gb|EHP85763.1| acetylornithine and succinylornithine aminotransferase [Methanotorris 
formicicus Mc-S-70]
Length=397

 Score =   240 bits (613),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 137/311 (44%), Positives = 198/311 (64%), Gaps = 7/311 (2%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             +ELAK+LV  S  +RVFF NSG EANEA IK ARK+ +     + +   E I   N FHG
Sbjct  84    IELAKKLVNLSGLNRVFFCNSGAEANEAGIKLARKYAK---EILGKDGGEIITMENAFHG  140

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RT+  +  T K  Y+  +EP+ PG  ++ + +I+A  E I + K  A+ +EP+QGEGGI+
Sbjct  141   RTITTITATPKPKYQKGYEPLAPGFKYVTFNDIEALKENI-TNKTVAIMIEPVQGEGGIH  199

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
              A KE+L+A+R  CD+   +L+FDEVQCG+GRTG ++A+E YG+ PDI+TLAK L GG+P
Sbjct  200   VADKEYLKAVRDLCDDKNLVLIFDEVQCGMGRTGKMFAYEHYGIEPDILTLAKALGGGVP  259

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGA+L  E+VA A+ YGDHG+TF G PL C++A+  +E I     L  V + G+Y K  L
Sbjct  260   IGAMLSKEEVAKAMGYGDHGTTFGGNPLACSSALATVEVIEG--ILGHVEEMGRYFKGRL  317

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
                      +KE+RGLGL++G+EL+     +V+     G L+       V+R +PPLI+ 
Sbjct  318   ETLKEKYPFIKEVRGLGLMLGMELEFNGGEIVKKMLEKGYLI-NCTSDVVLRFLPPLIVE  376

Query  1489  KQELEQAADVL  1521
             K+ ++   + L
Sbjct  377   KEHIDGLIEAL  387



>ref|WP_007778531.1| acetylornithine aminotransferase [Desulfosporosinus youngiae]
 gb|EHQ87505.1| acetylornithine/succinylornithine aminotransferase [Desulfosporosinus 
youngiae DSM 17734]
Length=402

 Score =   240 bits (613),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 141/315 (45%), Positives = 191/315 (61%), Gaps = 5/315 (2%)
 Frame = +1

Query  589   VELAKRLVGCSFADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHG  768
             V LA+RLV  SFAD+VFF NSG EANEAA K ARK+ +           E ++  N FHG
Sbjct  88    VALAERLVKHSFADKVFFCNSGAEANEAAFKLARKYAK---KKFGVHKYEVVSLENSFHG  144

Query  769   RTMGAVALTSKEHYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIY  948
             RT+  + LT +  Y+  F+P+  G T+    +I A    + S   AAVF+EPIQGEGG+ 
Sbjct  145   RTLATLTLTGQTKYQQGFDPLPLGFTYAALNDIDALRAKV-SNDTAAVFIEPIQGEGGVI  203

Query  949   SATKEFLQALRTSCDNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLP  1128
              A+ EFL+  R  CD  G+LL+FDEVQCG+GRTG L+A+E  GV PDIMTLAK L GG+P
Sbjct  204   PASIEFLREARALCDQYGALLIFDEVQCGVGRTGKLFAYEWSGVVPDIMTLAKALGGGVP  263

Query  1129  IGAVLVTEKVAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVSDkgqylkell  1308
             IGA+L T++VA A   GDH STF G PL   A   VL+ +    FL  V ++  Y ++ L
Sbjct  264   IGAMLATDEVAGAFQPGDHASTFGGNPLATAAGCAVLDIMLEEGFLEGVQERAAYFQQGL  323

Query  1309  gkklggNNHVKEIRglgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLIIS  1488
                +      + +RG G I+G  +      +VEAC  +GLL+   G G ++R +PPL + 
Sbjct  324   ETLVQKYRTGESVRGKGFIVGWPVSKLGPEIVEACLQNGLLINCVG-GKILRFLPPLTVE  382

Query  1489  KQELEQAADVLAACL  1533
             K E+++A  +L   L
Sbjct  383   KTEIDKALGILDEVL  397



>gb|EIT78003.1| acetylornithine aminotransferase [Aspergillus oryzae 3.042]
 gb|KDE79544.1| acetylornithine aminotransferase [Aspergillus oryzae 100-8]
Length=476

 Score =   243 bits (619),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 139/317 (44%), Positives = 190/317 (60%), Gaps = 18/317 (6%)
 Frame = +1

Query  625   ADRVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHGRTMGAVALTSKE  804
             A +VF SNSGTEANEAAIKFARK  +   P   +   EF++F N FHGRTMGA++ T   
Sbjct  157   ASQVFISNSGTEANEAAIKFARKVGKSLDPSGAKH--EFVSFHNSFHGRTMGALSATPNP  214

Query  805   HYRSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYSATKEFLQALRT  984
              Y++PF P++PG  +  Y +++    LI + K   V VEPIQGEGG+  AT EFL ALR 
Sbjct  215   KYQTPFSPMIPGFKYGNYNDVEQLQTLI-TDKTCGVIVEPIQGEGGVNVATPEFLAALRK  273

Query  985   SCDNAGSLLVFDEVQCGLGRTGYLWAH--------EAYGVYPDIMTLAKPLAGGLPIGAV  1140
              CD  G++L+FDE+QCGL RTG  WAH             +PDI+T AK L  G+PIGA 
Sbjct  274   RCDEVGAVLIFDEIQCGLSRTGTFWAHAHPSLAPASGEAAHPDILTSAKALGNGVPIGAT  333

Query  1141  LVTEK-VAAAINYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVS-Dkgqylkellgk  1314
             +V+ K VA  I  GDHG+TF G PLVC  A  ++E+++ PE   SV     + +  L   
Sbjct  334   IVSGKTVAEHIKAGDHGTTFGGNPLVCRVAHHIVERLATPELQNSVEIKSAELISGLKAL  393

Query  1315  klggNNHVKEIR----glgliigielDVAATPLVEACQNSGLLVLTAGKGNVVRLVPPLI  1482
             +    N + EIR     LG  +  +    A+ L+ A +  GLL++TAG G  +R VPPL 
Sbjct  394   QKKYPNVISEIRGRGLILGAQLSQDFTSKASDLITAARERGLLIITAGDG-CLRFVPPLT  452

Query  1483  ISKQELEQAADVLAACL  1533
             I++ +++ A+ +L   L
Sbjct  453   ITEDQIKTASKILEQAL  469



>gb|KEF58276.1| acetylornithine aminotransferase [Exophiala aquamarina CBS 119918]
Length=444

 Score =   241 bits (616),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 142/310 (46%), Positives = 192/310 (62%), Gaps = 10/310 (3%)
 Frame = +1

Query  631   RVFFSNSGTEANEAAIKFARKFQRFSHPDMEQPPVEFIAFSNCFHGRTMGAVALTSKEHY  810
             +VF SNSG+EANEAAIKFARK      P+  Q  +  ++F   FHGRT G+++ T  + Y
Sbjct  120   QVFVSNSGSEANEAAIKFARKVAYAKGPETAQRGI--VSFHGSFHGRTYGSLSATPNKKY  177

Query  811   RSPFEPVMPGVTFLEYGNIQAATELIQSGKIAAVFVEPIQGEGGIYSATKEFLQALRTSC  990
             ++PF P++ G  +  Y ++    +LI +G  A V VEPIQGEGG+  AT EFLQALR  C
Sbjct  178   QAPFGPMLAGFRYGTYNDVGKVKDLI-TGDTAGVIVEPIQGEGGVNVATSEFLQALRKRC  236

Query  991   DNAGSLLVFDEVQCGLGRTGYLWAHEAYGVYPDIMTLAKPLAGGLPIGAVLVTEK-VAAA  1167
             D  G++L+FDE+QCGL RTG LWAH A GV+PDI+T AK L  G+PIGA LV+ + VA  
Sbjct  237   DEVGAVLIFDEIQCGLSRTGDLWAHTASGVHPDILTTAKALGNGIPIGATLVSGRTVAPF  296

Query  1168  INYGDHGSTFAGGPLVCNAAVTVLEKISNPEFLASVS-DkgqylkellgkklggNNHVKE  1344
             I  GDHG+TF G PL C  A  V E+++  +    V      +L             + E
Sbjct  297   IKTGDHGTTFGGNPLACRVAHHVFERLAKSKLQDEVKIKSKLFLTASETLNQKFPGVITE  356

Query  1345  IRglgliigielDVAATP----LVEACQNSGLLVLTAGKGNVVRLVPPLIISKQELEQAA  1512
             +RG GLIIG +L   A P    +V A +  GLLV+TAG G V+R+VPPL+IS+ E+ +  
Sbjct  357   VRGRGLIIGYQLSDEAKPKVTEIVTAARERGLLVITAGDG-VIRIVPPLVISQDEINRGL  415

Query  1513  DVLAACLPVL  1542
              +L   + V+
Sbjct  416   AILEQAMEVV  425



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4968245977748