BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7496_g1_i1 len=1188 path=[3701:0-730 3267:731-1187]

Length=1188
                                                                      Score     E

ref|XP_009610016.1|  PREDICTED: annexin D4-like                         452   6e-155   
ref|XP_006347771.1|  PREDICTED: annexin D4-like isoform X1              451   1e-154   
ref|XP_004230106.1|  PREDICTED: annexin D4-like                         449   9e-154   
ref|XP_009771195.1|  PREDICTED: annexin D4-like                         445   3e-152   
ref|XP_009772051.1|  PREDICTED: annexin D4-like isoform X2              443   1e-151   
ref|XP_009772046.1|  PREDICTED: annexin D4-like isoform X1              443   5e-151   
ref|XP_006347774.1|  PREDICTED: annexin D4-like                         438   2e-149   
ref|XP_009617233.1|  PREDICTED: annexin D4-like                         436   1e-148   
ref|XP_009771176.1|  PREDICTED: annexin D4-like                         435   2e-148   
gb|EYU38266.1|  hypothetical protein MIMGU_mgv1a010378mg                416   1e-140   
ref|XP_006347772.1|  PREDICTED: annexin D4-like isoform X2              414   4e-140   
ref|XP_004230108.1|  PREDICTED: annexin D4-like                         411   6e-139   
ref|XP_011088394.1|  PREDICTED: annexin D4                              406   4e-137   
emb|CDP17930.1|  unnamed protein product                                394   5e-132   
ref|XP_007218708.1|  hypothetical protein PRUPE_ppa008922mg             392   2e-131   
ref|XP_002265000.1|  PREDICTED: annexin D4                              391   4e-131   Vitis vinifera
ref|XP_008245412.1|  PREDICTED: annexin D4                              389   2e-130   
ref|XP_009354447.1|  PREDICTED: annexin D4-like                         389   4e-130   
ref|XP_008354904.1|  PREDICTED: annexin D4-like                         375   4e-125   
ref|XP_008377133.1|  PREDICTED: annexin D4                              375   1e-124   
ref|XP_003627775.1|  Annexin D4                                         373   6e-124   
ref|XP_009361989.1|  PREDICTED: annexin D4-like                         372   1e-123   
ref|XP_004511009.1|  PREDICTED: annexin D4-like                         370   6e-123   
ref|XP_004307133.1|  PREDICTED: annexin D4-like                         370   1e-122   
gb|AFK35988.1|  unknown                                                 367   2e-121   
ref|XP_007133791.1|  hypothetical protein PHAVU_011G209400g             365   7e-121   
ref|XP_003542839.1|  PREDICTED: annexin D4                              364   2e-120   
ref|NP_001241368.1|  annexin D4-like                                    363   3e-120   
gb|ADM34982.1|  annexin-like protein                                    363   5e-120   
ref|XP_010999603.1|  PREDICTED: annexin D4                              360   4e-119   
ref|XP_002299215.1|  annexin 4 family protein                           359   1e-118   Populus trichocarpa [western balsam poplar]
gb|ABK96542.1|  unknown                                                 359   2e-118   Populus trichocarpa x Populus deltoides
ref|XP_010067752.1|  PREDICTED: annexin D4                              357   1e-117   
ref|XP_002513081.1|  annexin, putative                                  357   1e-117   Ricinus communis
ref|XP_010273219.1|  PREDICTED: annexin D4-like                         351   2e-115   
ref|XP_010247045.1|  PREDICTED: annexin D4-like isoform X1              350   5e-115   
gb|KDP40510.1|  hypothetical protein JCGZ_24509                         349   2e-114   
gb|KDO83188.1|  hypothetical protein CISIN_1g021607mg                   348   3e-114   
ref|XP_006438869.1|  hypothetical protein CICLE_v10032182mg             347   6e-114   
ref|XP_006482997.1|  PREDICTED: annexin D4-like                         345   5e-113   
ref|XP_008446930.1|  PREDICTED: annexin D4                              342   7e-112   
ref|XP_002267067.1|  PREDICTED: annexin D4 isoform X1                   341   2e-111   Vitis vinifera
ref|XP_004157512.1|  PREDICTED: LOW QUALITY PROTEIN: annexin D4-like    339   9e-111   
gb|KCW65942.1|  hypothetical protein EUGRSUZ_G03249                     340   1e-110   
ref|XP_004142407.1|  PREDICTED: annexin D4-like                         337   5e-110   
ref|XP_002263771.1|  PREDICTED: annexin D4-like isoform X1              335   4e-109   Vitis vinifera
ref|XP_010670442.1|  PREDICTED: annexin D4                              332   4e-108   
ref|XP_010095948.1|  Annexin D4                                         330   6e-107   
emb|CAN71385.1|  hypothetical protein VITISV_016099                     334   3e-106   Vitis vinifera
ref|XP_010646005.1|  PREDICTED: annexin D4-like                         331   9e-105   
ref|XP_002264833.1|  PREDICTED: annexin D4-like                         322   3e-104   Vitis vinifera
ref|XP_007011154.1|  Annexin 4, putative                                320   5e-103   
ref|XP_002264596.1|  PREDICTED: annexin D4-like                         315   1e-101   Vitis vinifera
ref|XP_010247046.1|  PREDICTED: annexin D4-like isoform X2              312   1e-100   
ref|XP_007011162.1|  Annexin 4, putative                                309   1e-98    
ref|XP_008246073.1|  PREDICTED: annexin D4-like                         295   3e-94    
gb|EPS63392.1|  hypothetical protein M569_11393                         292   2e-93    
ref|XP_007011150.1|  RNA-directed DNA polymerase, putative              318   3e-93    
ref|XP_010938586.1|  PREDICTED: annexin D4                              291   4e-92    
gb|KCW65941.1|  hypothetical protein EUGRSUZ_G03249                     290   5e-92    
ref|XP_010554473.1|  PREDICTED: annexin D4-like                         290   1e-91    
ref|XP_006293497.1|  hypothetical protein CARUB_v10023562mg             291   1e-91    
ref|NP_181409.1|  annexin D4                                            290   2e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010523386.1|  PREDICTED: annexin D4-like                         289   3e-91    
ref|XP_008344590.1|  PREDICTED: annexin D4-like                         285   9e-91    
ref|XP_010645993.1|  PREDICTED: annexin D4 isoform X2                   286   9e-91    
gb|KDO83190.1|  hypothetical protein CISIN_1g021607mg                   285   4e-90    
ref|XP_008813418.1|  PREDICTED: annexin D4-like                         283   1e-88    
ref|XP_010645984.1|  PREDICTED: annexin D4-like isoform X2              280   1e-88    
emb|CDY07704.1|  BnaA03g18070D                                          282   2e-88    
ref|XP_010645983.1|  PREDICTED: annexin D4-like                         283   2e-88    
emb|CDY14436.1|  BnaC03g21590D                                          281   5e-88    
gb|ADD74397.1|  annexin 4                                               281   6e-88    Brassica juncea [brown mustard]
ref|NP_001288920.1|  annexin D4                                         280   8e-88    
gb|KHG21803.1|  Annexin D4 -like protein                                276   8e-87    
ref|XP_009141762.1|  PREDICTED: annexin D4-like                         277   1e-86    
ref|XP_009392678.1|  PREDICTED: annexin D4                              276   3e-86    
ref|XP_002881615.1|  ANNAT4                                             276   4e-86    
emb|CDP17933.1|  unnamed protein product                                271   2e-85    
gb|EMT13324.1|  Annexin D4                                              274   3e-85    
ref|XP_002265896.3|  PREDICTED: annexin D4-like isoform X1              273   2e-84    Vitis vinifera
ref|XP_006411098.1|  hypothetical protein EUTSA_v10016965mg             271   3e-84    
gb|KCW65943.1|  hypothetical protein EUGRSUZ_G03249                     268   5e-84    
ref|XP_010509172.1|  PREDICTED: annexin D4-like                         270   1e-83    
ref|XP_003634961.1|  PREDICTED: annexin D4-like                         270   1e-83    
ref|XP_002270143.3|  PREDICTED: annexin D4-like isoform X1              270   1e-83    Vitis vinifera
ref|XP_008779044.1|  PREDICTED: annexin D4-like                         270   2e-83    
ref|XP_010505529.1|  PREDICTED: annexin D4                              268   6e-83    
ref|XP_010645988.1|  PREDICTED: annexin D4-like isoform X1              267   2e-82    
ref|XP_010517192.1|  PREDICTED: annexin D4-like                         266   4e-82    
gb|KDO83189.1|  hypothetical protein CISIN_1g021607mg                   263   5e-82    
emb|CDX93305.1|  BnaC04g45910D                                          264   2e-81    
ref|XP_002263690.1|  PREDICTED: annexin D4-like                         265   2e-81    Vitis vinifera
emb|CAN65199.1|  hypothetical protein VITISV_022256                     264   3e-81    Vitis vinifera
gb|ACU19707.1|  unknown                                                 258   2e-80    Glycine max [soybeans]
ref|XP_010231454.1|  PREDICTED: annexin D4                              261   4e-80    
ref|XP_004962223.1|  PREDICTED: annexin D4-like isoform X1              262   6e-80    
ref|XP_004962224.1|  PREDICTED: annexin D4-like isoform X2              260   8e-80    
dbj|BAG93789.1|  unnamed protein product                                259   1e-79    Oryza sativa Japonica Group [Japonica rice]
gb|KDO83191.1|  hypothetical protein CISIN_1g021607mg                   254   4e-79    
gb|EMS49319.1|  Annexin D4                                              256   3e-78    
ref|XP_002465256.1|  hypothetical protein SORBIDRAFT_01g035050          254   9e-77    Sorghum bicolor [broomcorn]
gb|AAT38062.1|  unknown protein                                         248   5e-75    Oryza sativa Japonica Group [Japonica rice]
gb|ACF85171.1|  unknown                                                 242   9e-73    Zea mays [maize]
ref|XP_006654341.1|  PREDICTED: annexin D4-like                         239   5e-72    
ref|XP_008647843.1|  PREDICTED: annexin-like protein RJ4 isoform X1     240   1e-71    
ref|XP_010659176.1|  PREDICTED: annexin D4-like isoform X2              235   4e-70    
ref|XP_010646340.1|  PREDICTED: annexin D4-like                         230   3e-69    
ref|XP_003557848.1|  PREDICTED: annexin D4-like                         233   5e-69    
ref|XP_003633532.2|  PREDICTED: annexin D4-like                         229   1e-68    
ref|XP_003634963.2|  PREDICTED: annexin D4-like isoform X1              227   9e-68    
dbj|BAH57010.1|  AT2G38750                                              215   8e-64    Arabidopsis thaliana [mouse-ear cress]
dbj|BAK01609.1|  predicted protein                                      218   2e-63    
ref|XP_003634957.2|  PREDICTED: annexin D4-like                         215   3e-63    
gb|EEE63557.1|  hypothetical protein OsJ_18373                          216   4e-63    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004986983.1|  PREDICTED: annexin D4-like                         218   5e-63    
ref|XP_010659179.1|  PREDICTED: annexin D4-like isoform X1              209   3e-61    
ref|XP_010645980.1|  PREDICTED: annexin D4-like isoform X2              208   7e-61    
emb|CAN71082.1|  hypothetical protein VITISV_042800                     206   6e-59    Vitis vinifera
ref|XP_010268092.1|  PREDICTED: annexin D1                              191   3e-53    
ref|XP_006828500.1|  hypothetical protein AMTR_s00060p00176720          187   6e-52    
ref|XP_006828499.1|  hypothetical protein AMTR_s00060p00176150          186   2e-51    
gb|AGG76002.1|  annexin AnxGb6                                          186   2e-51    
emb|CAA06492.1|  annexin                                                181   2e-51    Cicer arietinum [garbanzo]
gb|AGG76001.1|  annexin AnxGb5                                          185   3e-51    
gb|AGQ56695.1|  cotton annexin 4                                        185   3e-51    
gb|ACJ11719.1|  annexin                                                 184   5e-51    Gossypium hirsutum [American cotton]
gb|AGQ56696.1|  cotton annexin 5                                        184   7e-51    
ref|XP_010647259.1|  PREDICTED: annexin D4-like                         181   8e-51    
gb|KDO83192.1|  hypothetical protein CISIN_1g021607mg                   179   1e-50    
ref|XP_006434000.1|  hypothetical protein CICLE_v10001888mg             183   2e-50    
gb|KDP46839.1|  hypothetical protein JCGZ_24048                         183   2e-50    
ref|XP_007047969.1|  Annexin 2                                          182   4e-50    
gb|KDP41371.1|  hypothetical protein JCGZ_15778                         182   5e-50    
ref|XP_002285795.1|  PREDICTED: annexin D1                              181   6e-50    Vitis vinifera
ref|XP_006839165.1|  hypothetical protein AMTR_s00097p00076000          181   1e-49    
ref|XP_007011125.1|  Annexin-like protein RJ4 isoform 2                 181   2e-49    
ref|XP_004155446.1|  PREDICTED: annexin D2-like                         180   2e-49    
gb|ABB59547.1|  annexin-like protein                                    180   3e-49    Brassica juncea [brown mustard]
gb|KHG08791.1|  Annexin D2 -like protein                                180   4e-49    
gb|ABK22223.1|  unknown                                                 180   4e-49    Picea sitchensis
gb|AAR13288.1|  Anx1                                                    179   4e-49    Gossypium hirsutum [American cotton]
ref|XP_010269245.1|  PREDICTED: annexin D2-like                         179   9e-49    
gb|AGG75998.1|  annexin AnxGb2                                          178   1e-48    
ref|XP_002302291.1|  annexin 1 family protein                           178   1e-48    Populus trichocarpa [western balsam poplar]
ref|XP_010273220.1|  PREDICTED: annexin D3-like                         178   1e-48    
gb|ACZ57338.1|  annexin 1                                               178   1e-48    Cenchrus americanus [bulrush millet]
gb|ABK95721.1|  unknown                                                 178   2e-48    Populus trichocarpa [western balsam poplar]
gb|ADM48798.1|  annexin 1                                               178   2e-48    
ref|XP_007011124.1|  Annexin-like protein RJ4 isoform 1                 180   2e-48    
gb|AGQ56697.1|  cotton annexin 6                                        178   2e-48    
ref|XP_004307132.1|  PREDICTED: annexin-like protein RJ4-like iso...    177   2e-48    
emb|CDP18835.1|  unnamed protein product                                174   3e-48    
ref|XP_004136871.1|  PREDICTED: annexin D2-like                         177   3e-48    
gb|AIU41030.1|  annexin 1                                               177   3e-48    
ref|XP_002513080.1|  annexin, putative                                  177   4e-48    Ricinus communis
gb|ACZ57337.1|  annexin 1                                               177   4e-48    Vigna mungo [urad dal]
gb|AAC33305.1|  fiber annexin                                           177   5e-48    Gossypium hirsutum [American cotton]
ref|XP_011016329.1|  PREDICTED: annexin D1                              176   7e-48    
ref|XP_004307131.1|  PREDICTED: annexin-like protein RJ4-like iso...    176   1e-47    
ref|XP_006289187.1|  hypothetical protein CARUB_v10002628mg             176   1e-47    
ref|NP_174810.1|  annexin 1                                             176   1e-47    Arabidopsis thaliana [mouse-ear cress]
gb|KHG12913.1|  Annexin-like protein RJ4                                176   1e-47    
ref|XP_008455214.1|  PREDICTED: annexin D2-like                         176   1e-47    
ref|XP_010032318.1|  PREDICTED: annexin-like protein RJ4 isoform X2     176   2e-47    
ref|XP_010025469.1|  PREDICTED: annexin D2-like                         175   2e-47    
ref|XP_007227485.1|  hypothetical protein PRUPE_ppa008882mg             175   2e-47    
pdb|1YCN|A  Chain A, X-Ray Structure Of Annexin From Arabidopsis ...    175   2e-47    
gb|AAB67994.1|  annexin                                                 175   2e-47    Gossypium hirsutum [American cotton]
dbj|BAJ92233.1|  predicted protein                                      175   2e-47    
ref|NP_001240889.1|  uncharacterized protein LOC100784252               175   3e-47    
gb|AGG75999.1|  annexin AnxGb3                                          175   3e-47    
gb|KHG15756.1|  Annexin D4 -like protein                                171   3e-47    
ref|XP_010032317.1|  PREDICTED: annexin-like protein RJ4 isoform X1     176   3e-47    
ref|XP_010916889.1|  PREDICTED: annexin D2-like isoform X2              175   3e-47    
emb|CDY41873.1|  BnaA08g06260D                                          175   3e-47    
ref|XP_010926280.1|  PREDICTED: annexin D2-like                         175   3e-47    
ref|XP_010680554.1|  PREDICTED: annexin D2-like                         174   3e-47    
gb|AAB67993.2|  annexin                                                 174   3e-47    Gossypium hirsutum [American cotton]
pdb|1N00|A  Chain A, Annexin Gh1 From Cotton                            175   3e-47    
pdb|3BRX|A  Chain A, Crystal Structure Of Calcium-Bound Cotton An...    174   4e-47    
ref|XP_008786903.1|  PREDICTED: annexin-like protein RJ4                174   4e-47    
gb|AGQ56694.1|  cotton annexin 3                                        174   4e-47    
ref|XP_008782135.1|  PREDICTED: annexin D2-like                         174   4e-47    
gb|KCW62129.1|  hypothetical protein EUGRSUZ_H04787                     174   5e-47    
ref|XP_002309980.1|  annexin-like protein RJ4                           174   5e-47    Populus trichocarpa [western balsam poplar]
ref|XP_004964979.1|  PREDICTED: annexin D2-like                         174   6e-47    
ref|XP_009107912.1|  PREDICTED: annexin D1                              174   6e-47    
dbj|BAJ97416.1|  predicted protein                                      174   6e-47    
gb|ADK13090.1|  annexin 1                                               174   7e-47    
gb|AAC49472.1|  annexin-like protein                                    174   7e-47    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011098465.1|  PREDICTED: annexin D1-like                         174   7e-47    
ref|XP_008219675.1|  PREDICTED: annexin D1                              173   9e-47    
gb|AGG76000.1|  annexin AnxGb4                                          173   1e-46    
emb|CDX91750.1|  BnaC08g06690D                                          173   1e-46    
ref|XP_011074177.1|  PREDICTED: annexin D1-like                         173   1e-46    
gb|KCW62127.1|  hypothetical protein EUGRSUZ_H04787                     173   1e-46    
ref|XP_009337417.1|  PREDICTED: annexin D1-like                         172   2e-46    
ref|XP_003615096.1|  Annexin                                            172   2e-46    
ref|XP_010500052.1|  PREDICTED: annexin D1                              172   2e-46    
gb|AFZ78531.1|  annexin                                                 172   2e-46    
gb|AFK45764.1|  unknown                                                 172   2e-46    
gb|KDP27364.1|  hypothetical protein JCGZ_20188                         172   2e-46    
ref|XP_009145116.1|  PREDICTED: annexin D1                              172   2e-46    
ref|XP_006399755.1|  hypothetical protein EUTSA_v10014146mg             172   2e-46    
ref|XP_010061809.1|  PREDICTED: annexin D1-like                         172   3e-46    
ref|XP_002513910.1|  annexin, putative                                  172   3e-46    Ricinus communis
ref|XP_007199232.1|  hypothetical protein PRUPE_ppa022090mg             172   3e-46    
ref|XP_010453308.1|  PREDICTED: annexin D8                              172   3e-46    
ref|XP_011022789.1|  PREDICTED: annexin D2-like                         172   4e-46    
ref|XP_004516176.1|  PREDICTED: annexin D1-like isoform X1              172   4e-46    
ref|XP_010939631.1|  PREDICTED: annexin D1-like                         171   5e-46    
ref|XP_010931989.1|  PREDICTED: annexin-like protein RJ4                171   5e-46    
gb|KCW62128.1|  hypothetical protein EUGRSUZ_H04787                     171   5e-46    
ref|XP_010032319.1|  PREDICTED: annexin-like protein RJ4 isoform X3     171   6e-46    
ref|XP_004288206.1|  PREDICTED: annexin D1-like                         171   7e-46    
ref|XP_008794526.1|  PREDICTED: annexin D1-like                         171   7e-46    
emb|CDX73353.1|  BnaC05g27530D                                          171   8e-46    
ref|XP_010025470.1|  PREDICTED: annexin D2-like                         171   9e-46    
ref|XP_006305394.1|  hypothetical protein CARUB_v10009786mg             171   9e-46    
gb|KCW62130.1|  hypothetical protein EUGRSUZ_H04787                     171   9e-46    
ref|XP_008795561.1|  PREDICTED: annexin D2-like isoform X1              171   1e-45    
ref|XP_010544079.1|  PREDICTED: annexin D1                              171   1e-45    
ref|XP_007147424.1|  hypothetical protein PHAVU_006G123400g             170   1e-45    
ref|XP_007018794.1|  Annexin 1                                          170   1e-45    
ref|XP_004288207.1|  PREDICTED: annexin D2-like                         170   1e-45    
ref|XP_011088381.1|  PREDICTED: annexin D3                              170   2e-45    
gb|KEH37119.1|  annexin D8                                              170   2e-45    
gb|AIY34672.1|  annexin D2-like protein                                 170   2e-45    
emb|CDP01446.1|  unnamed protein product                                170   2e-45    
gb|AET02255.2|  annexin D8                                              169   2e-45    
ref|XP_010916888.1|  PREDICTED: annexin D1-like isoform X1              170   2e-45    
ref|XP_011097579.1|  PREDICTED: annexin D7                              169   3e-45    
ref|XP_009361986.1|  PREDICTED: annexin-like protein RJ4                169   3e-45    
gb|AAB71830.1|  annexin                                                 169   3e-45    Lavatera thuringiaca
ref|XP_008245413.1|  PREDICTED: annexin-like protein RJ4 isoform X1     169   3e-45    
ref|XP_009123806.1|  PREDICTED: annexin D1-like                         169   4e-45    
ref|XP_002279669.1|  PREDICTED: annexin D8                              169   4e-45    Vitis vinifera
gb|EMS50782.1|  Annexin D1                                              169   4e-45    
gb|KHG14512.1|  Annexin-like protein RJ4                                169   4e-45    
ref|XP_009349785.1|  PREDICTED: annexin D1-like                         169   5e-45    
ref|XP_010095951.1|  Annexin-like protein                               169   5e-45    
sp|P51074.2|ANX4_FRAAN  RecName: Full=Annexin-like protein RJ4          169   5e-45    Fragaria x ananassa
ref|XP_011042167.1|  PREDICTED: annexin-like protein RJ4 isoform X1     169   6e-45    
ref|XP_002306311.2|  annexin-like protein RJ4                           169   6e-45    Populus trichocarpa [western balsam poplar]
ref|XP_007205592.1|  hypothetical protein PRUPE_ppa008881mg             168   8e-45    
ref|XP_008450361.1|  PREDICTED: annexin D8                              168   8e-45    
ref|XP_010273218.1|  PREDICTED: annexin-like protein RJ4                168   1e-44    
ref|XP_009622947.1|  PREDICTED: annexin D1-like                         168   1e-44    
ref|XP_004511012.1|  PREDICTED: annexin-like protein RJ4-like iso...    167   1e-44    
emb|CDP01046.1|  unnamed protein product                                168   1e-44    
gb|KFK23853.1|  hypothetical protein AALP_AAs49431U000100               168   1e-44    
ref|XP_008346978.1|  PREDICTED: annexin-like protein RJ4                167   1e-44    
ref|XP_008375302.1|  PREDICTED: annexin-like protein RJ4 isoform X2     167   1e-44    
ref|XP_010938585.1|  PREDICTED: annexin D3                              167   1e-44    
ref|XP_008233942.1|  PREDICTED: annexin D2-like                         167   1e-44    
ref|XP_010032320.1|  PREDICTED: annexin-like protein RJ4                168   1e-44    
ref|XP_009412819.1|  PREDICTED: annexin D3-like                         168   1e-44    
gb|KFK25510.1|  hypothetical protein AALP_AA8G124300                    167   1e-44    
gb|AFZ78532.1|  annexin                                                 167   2e-44    
ref|XP_011042168.1|  PREDICTED: annexin-like protein RJ4 isoform X2     167   2e-44    
ref|XP_008245414.1|  PREDICTED: annexin-like protein RJ4 isoform X2     167   2e-44    
ref|XP_010227843.1|  PREDICTED: annexin D1-like                         167   2e-44    
ref|XP_011031008.1|  PREDICTED: annexin D2-like                         168   2e-44    
ref|XP_004289606.1|  PREDICTED: annexin D7-like                         167   2e-44    
ref|XP_009413545.1|  PREDICTED: annexin D2-like                         167   2e-44    
gb|KDP40511.1|  hypothetical protein JCGZ_24510                         167   3e-44    
ref|XP_002873444.1|  hypothetical protein ARALYDRAFT_350231             167   3e-44    
ref|XP_004511011.1|  PREDICTED: annexin-like protein RJ4-like iso...    167   3e-44    
ref|XP_003627780.1|  Annexin-like protein                               166   3e-44    
gb|AFK45151.1|  unknown                                                 166   3e-44    
ref|XP_003525057.1|  PREDICTED: annexin D2                              166   3e-44    
ref|XP_004299644.1|  PREDICTED: annexin D1-like                         166   4e-44    
ref|XP_009594353.1|  PREDICTED: annexin D2 isoform X1                   166   4e-44    
ref|XP_003627779.1|  Annexin-like protein                               168   4e-44    
ref|XP_006355349.1|  PREDICTED: annexin D2-like                         166   4e-44    
ref|NP_001234104.1|  annexin p34                                        166   5e-44    
ref|XP_004511010.1|  PREDICTED: annexin-like protein RJ4-like iso...    166   5e-44    
ref|XP_002871524.1|  hypothetical protein ARALYDRAFT_488086             166   5e-44    
ref|XP_006655923.1|  PREDICTED: annexin D1-like                         166   7e-44    
ref|XP_008795562.1|  PREDICTED: annexin D2-like isoform X2              165   8e-44    
ref|XP_008375301.1|  PREDICTED: annexin-like protein RJ4 isoform X1     166   8e-44    
gb|AFK35882.1|  unknown                                                 166   8e-44    
ref|XP_008353937.1|  PREDICTED: annexin D1-like                         166   9e-44    
ref|XP_004137187.1|  PREDICTED: annexin D2-like                         166   9e-44    
ref|NP_568271.2|  annexin D8                                            165   1e-43    
emb|CAN82835.1|  hypothetical protein VITISV_030870                     165   1e-43    
ref|XP_007159652.1|  hypothetical protein PHAVU_002G255700g             165   1e-43    
ref|NP_196585.1|  annexin D7                                            165   1e-43    
ref|NP_001289780.1|  uncharacterized protein LOC104590190               165   1e-43    
ref|XP_008356783.1|  PREDICTED: LOW QUALITY PROTEIN: annexin-like...    165   1e-43    
ref|XP_004511008.1|  PREDICTED: annexin D3-like                         165   1e-43    
gb|ACF81674.1|  unknown                                                 165   1e-43    
ref|NP_001242171.1|  uncharacterized protein LOC100806472               165   1e-43    
ref|NP_001266716.1|  annexin-like protein RJ4                           163   1e-43    
ref|XP_010422874.1|  PREDICTED: annexin D6                              165   2e-43    
ref|XP_010453047.1|  PREDICTED: annexin D6-like                         165   2e-43    
ref|XP_010491679.1|  PREDICTED: annexin D6-like                         165   2e-43    
emb|CAA67608.1|  annexin                                                164   2e-43    
ref|XP_010536110.1|  PREDICTED: annexin D8                              164   2e-43    
emb|CAA75213.1|  annexin                                                164   2e-43    
gb|KDO56580.1|  hypothetical protein CISIN_1g021204mg                   164   2e-43    
ref|NP_001239752.1|  uncharacterized protein LOC100815639               164   3e-43    
ref|XP_006464229.1|  PREDICTED: annexin D2-like                         164   3e-43    
ref|XP_010554472.1|  PREDICTED: annexin D3                              164   3e-43    
ref|XP_009787351.1|  PREDICTED: annexin D1-like                         164   3e-43    
ref|XP_009802682.1|  PREDICTED: annexin D2-like                         164   3e-43    
emb|CAA10261.1|  annexin P38                                            164   3e-43    
ref|XP_006438868.1|  hypothetical protein CICLE_v10032154mg             164   4e-43    
ref|XP_003546292.1|  PREDICTED: annexin D8-like                         164   4e-43    
ref|XP_003627774.1|  Annexin D3                                         164   4e-43    
ref|XP_008237182.1|  PREDICTED: annexin D2-like                         164   4e-43    
ref|XP_009361985.1|  PREDICTED: annexin-like protein RJ4                164   4e-43    
ref|XP_002873445.1|  hypothetical protein ARALYDRAFT_908980             164   4e-43    
ref|XP_009791036.1|  PREDICTED: annexin D2-like                         164   4e-43    
ref|XP_010247043.1|  PREDICTED: annexin D3-like                         163   5e-43    
gb|KHN14285.1|  Annexin D8                                              164   5e-43    
ref|NP_001105728.1|  annexin p33                                        163   5e-43    
gb|AFW76764.1|  annexin p33Annexin-like protein RJ4                     164   6e-43    
ref|XP_002436730.1|  hypothetical protein SORBIDRAFT_10g007760          163   6e-43    
gb|KCW68822.1|  hypothetical protein EUGRSUZ_F02423                     162   7e-43    
ref|XP_006590331.1|  PREDICTED: uncharacterized protein LOC100806...    163   7e-43    
gb|ACV50434.1|  annexin-like protein                                    163   7e-43    
ref|XP_007218219.1|  hypothetical protein PRUPE_ppa007879mg             164   9e-43    
gb|EYU36506.1|  hypothetical protein MIMGU_mgv1a010414mg                162   9e-43    
ref|XP_009339720.1|  PREDICTED: annexin D2-like                         162   9e-43    
emb|CAB92956.1|  annexin p34                                            162   1e-42    
ref|NP_001105475.1|  annexin2                                           162   1e-42    
ref|XP_007141170.1|  hypothetical protein PHAVU_008G173100g             162   2e-42    
ref|XP_006399517.1|  hypothetical protein EUTSA_v10014138mg             162   2e-42    
dbj|BAJ90765.1|  predicted protein                                      162   2e-42    
gb|KHG15758.1|  Annexin D3 -like protein                                162   2e-42    
emb|CDX69852.1|  BnaA10g22010D                                          162   2e-42    
ref|XP_009122074.1|  PREDICTED: annexin D7                              162   2e-42    
ref|XP_010521627.1|  PREDICTED: annexin-like protein RJ4 isoform X2     161   3e-42    
ref|XP_006399516.1|  hypothetical protein EUTSA_v10014136mg             161   3e-42    
ref|XP_004514653.1|  PREDICTED: annexin-like protein RJ4-like           161   3e-42    
ref|XP_007015223.1|  Annexin 8                                          161   3e-42    
gb|ABD47518.1|  annexin 7                                               161   4e-42    
ref|XP_002298480.1|  annexin family protein                             160   5e-42    
ref|NP_196584.1|  annexin D6                                            160   5e-42    
ref|XP_007148975.1|  hypothetical protein PHAVU_005G030100g             160   5e-42    
gb|ABK28695.1|  unknown                                                 160   5e-42    
ref|XP_002527036.1|  annexin, putative                                  160   6e-42    
dbj|BAD43335.1|  annexin -like protein                                  160   6e-42    
dbj|BAN45713.1|  putative annexin                                       160   6e-42    
ref|XP_008813427.1|  PREDICTED: annexin D3-like                         159   6e-42    
ref|XP_007011126.1|  Annexin-like protein RJ4 isoform 3                 160   6e-42    
ref|XP_009380196.1|  PREDICTED: annexin D2-like                         160   7e-42    
gb|KGN52305.1|  hypothetical protein Csa_5G623690                       160   7e-42    
gb|KDO56583.1|  hypothetical protein CISIN_1g021204mg                   160   7e-42    
ref|XP_010521553.1|  PREDICTED: annexin-like protein RJ4 isoform X1     160   7e-42    
emb|CAA63710.1|  annexin                                                160   8e-42    
pdb|1DK5|A  Chain A, Crystal Structure Of Annexin 24(Ca32) From C...    160   8e-42    
ref|XP_004240238.1|  PREDICTED: annexin D2-like                         160   9e-42    
ref|XP_006339971.1|  PREDICTED: annexin-like protein RJ4-like           160   9e-42    
emb|CDP18831.1|  unnamed protein product                                160   1e-41    
ref|NP_001274782.1|  annexin D1-like                                    160   1e-41    
ref|XP_007218704.1|  hypothetical protein PRUPE_ppa008912mg             160   1e-41    
ref|XP_006288241.1|  hypothetical protein CARUB_v10001483mg             160   1e-41    
ref|XP_009589394.1|  PREDICTED: annexin-like protein RJ4                160   1e-41    
gb|AIY34673.1|  annexin4                                                159   1e-41    
ref|XP_010673729.1|  PREDICTED: annexin D8                              159   1e-41    
ref|XP_009765996.1|  PREDICTED: annexin-like protein RJ4                159   1e-41    
ref|XP_007133789.1|  hypothetical protein PHAVU_011G209200g             159   2e-41    
ref|XP_004248844.1|  PREDICTED: annexin-like protein RJ4                159   2e-41    
ref|XP_007218705.1|  hypothetical protein PRUPE_ppa008912mg             159   2e-41    
ref|XP_003598648.1|  Annexin-like protein RJ4                           159   2e-41    
ref|XP_009133293.1|  PREDICTED: annexin D3-like                         159   2e-41    
ref|XP_009354449.1|  PREDICTED: annexin-like protein RJ4 isoform X2     159   2e-41    
ref|XP_010645676.1|  PREDICTED: LOW QUALITY PROTEIN: annexin D3         159   2e-41    
emb|CDX97190.1|  BnaC09g44350D                                          159   2e-41    
ref|XP_008245411.1|  PREDICTED: annexin D3-like                         160   2e-41    
emb|CDX96984.1|  BnaC09g46410D                                          159   3e-41    
ref|XP_009395142.1|  PREDICTED: annexin-like protein RJ4                159   3e-41    
ref|XP_009354448.1|  PREDICTED: annexin-like protein RJ4 isoform X1     159   3e-41    
ref|XP_008446932.1|  PREDICTED: annexin-like protein RJ4                159   3e-41    
ref|XP_009417576.1|  PREDICTED: annexin D7-like isoform X2              159   3e-41    
ref|XP_009121851.1|  PREDICTED: annexin D8                              159   3e-41    
ref|XP_010491680.1|  PREDICTED: annexin D7-like                         158   4e-41    
gb|AAG61156.1|  calcium-binding protein annexin 7                       158   4e-41    
ref|XP_006597033.1|  PREDICTED: uncharacterized protein LOC100794...    158   4e-41    
ref|XP_009417575.1|  PREDICTED: annexin D7-like isoform X1              159   4e-41    
gb|ACK44502.1|  AT5G10230-like protein                                  158   4e-41    
ref|XP_008348392.1|  PREDICTED: annexin-like protein RJ4 isoform X2     158   4e-41    
ref|XP_008348387.1|  PREDICTED: annexin-like protein RJ4 isoform X1     158   4e-41    
ref|NP_201307.1|  annexin 2                                             158   5e-41    
ref|XP_008779043.1|  PREDICTED: annexin D3-like                         156   5e-41    
emb|CAA10210.1|  annexin cap32                                          158   5e-41    
ref|XP_006438877.1|  hypothetical protein CICLE_v10031919mg             158   6e-41    
ref|XP_010422872.1|  PREDICTED: annexin D7-like                         158   6e-41    
ref|XP_011024946.1|  PREDICTED: annexin D8-like                         158   6e-41    
ref|XP_006482991.1|  PREDICTED: annexin D3-like                         158   6e-41    
ref|XP_007133792.1|  hypothetical protein PHAVU_011G209500g             158   6e-41    
ref|XP_006366530.1|  PREDICTED: annexin D2-like                         158   6e-41    
gb|EAZ00194.1|  hypothetical protein OsI_22198                          158   6e-41    
ref|NP_001240999.1|  uncharacterized protein LOC100794511               157   7e-41    
ref|NP_001057176.1|  Os06g0221200                                       157   7e-41    
ref|XP_002513082.1|  annexin, putative                                  157   7e-41    
ref|XP_003546730.1|  PREDICTED: annexin D3 isoform X1                   157   8e-41    
gb|EYU38265.1|  hypothetical protein MIMGU_mgv1a010228mg                157   9e-41    
gb|AAG61155.1|  calcium-binding protein annexin 6                       157   1e-40    
emb|CDX69683.1|  BnaA10g20320D                                          157   1e-40    
emb|CDY14435.1|  BnaC03g21600D                                          157   1e-40    
emb|CAN78302.1|  hypothetical protein VITISV_009774                     151   1e-40    
ref|XP_002452537.1|  hypothetical protein SORBIDRAFT_04g027590          157   1e-40    
ref|XP_010453050.1|  PREDICTED: annexin D7                              157   1e-40    
gb|KGN53652.1|  hypothetical protein Csa_4G096610                       158   1e-40    
ref|XP_004139124.1|  PREDICTED: annexin D8-like                         157   1e-40    
ref|XP_004142392.1|  PREDICTED: annexin A6-like                         162   1e-40    
emb|CDY07703.1|  BnaA03g18080D                                          157   1e-40    
ref|XP_009593609.1|  PREDICTED: annexin D2-like                         157   1e-40    
dbj|BAJ99019.1|  predicted protein                                      157   1e-40    
ref|XP_003542833.1|  PREDICTED: annexin-like protein RJ4-like iso...    157   1e-40    
ref|XP_008245076.1|  PREDICTED: annexin D3-like                         157   2e-40    
ref|XP_002864936.1|  ANNAT2                                             157   2e-40    
ref|XP_009610866.1|  PREDICTED: annexin-like protein RJ4                157   2e-40    
ref|XP_010095947.1|  Annexin D3                                         157   2e-40    
ref|XP_010670441.1|  PREDICTED: annexin D3                              156   2e-40    
gb|ACU23333.1|  unknown                                                 156   2e-40    
ref|XP_003542834.1|  PREDICTED: annexin-like protein RJ4-like iso...    156   2e-40    
ref|XP_009594354.1|  PREDICTED: annexin D2 isoform X2                   156   2e-40    
ref|XP_009361987.1|  PREDICTED: annexin D3-like                         157   2e-40    
ref|XP_004953954.1|  PREDICTED: annexin D7-like                         156   2e-40    
gb|KHN37649.1|  Annexin-like protein RJ4                                156   3e-40    
ref|XP_006288251.1|  hypothetical protein CARUB_v10001496mg             156   3e-40    
ref|XP_008455626.1|  PREDICTED: annexin D2-like isoform X2              155   4e-40    
ref|XP_010087582.1|  Annexin D2                                         155   4e-40    
gb|ABM87934.1|  annexin 6                                               155   4e-40    
ref|XP_007148976.1|  hypothetical protein PHAVU_005G030200g             155   4e-40    
gb|ADN34200.1|  annexin                                                 160   5e-40    
ref|XP_006411099.1|  hypothetical protein EUTSA_v10016949mg             155   5e-40    
ref|XP_004307134.1|  PREDICTED: annexin D3-like                         155   6e-40    
gb|EMT13109.1|  Annexin D1                                              156   6e-40    
ref|XP_010484307.1|  PREDICTED: annexin D2                              155   6e-40    
ref|XP_010523387.1|  PREDICTED: LOW QUALITY PROTEIN: annexin D3-like    155   6e-40    
gb|EMS56517.1|  Annexin D7                                              154   1e-39    
gb|ADO32900.1|  antifungal activity protein                             154   1e-39    
gb|ADT91309.1|  annexin-like protein                                    154   1e-39    
ref|XP_003598649.1|  Annexin                                            154   1e-39    
gb|KDP40509.1|  hypothetical protein JCGZ_24508                         154   1e-39    
emb|CAC42899.1|  annexin-like protein                                   152   1e-39    
ref|XP_002304784.1|  annexin-like protein RJ4                           154   1e-39    
gb|EMT22115.1|  Annexin D7                                              154   2e-39    
gb|ACK44503.1|  AT5G10220-like protein                                  154   2e-39    
ref|XP_004169361.1|  PREDICTED: annexin D2-like isoform 1               154   2e-39    
ref|XP_010444468.1|  PREDICTED: annexin D2-like                         154   2e-39    
ref|XP_004511017.1|  PREDICTED: annexin-like protein RJ4-like           154   2e-39    
emb|CDP18837.1|  unnamed protein product                                154   2e-39    
gb|KGN52304.1|  hypothetical protein Csa_5G623680                       154   2e-39    
ref|XP_010462444.1|  PREDICTED: annexin D2-like                         154   2e-39    
ref|XP_009122077.1|  PREDICTED: annexin D6                              154   2e-39    
ref|XP_003542840.1|  PREDICTED: annexin D3-like isoform X1              154   3e-39    
gb|KFK25346.1|  hypothetical protein AALP_AA8G100700                    153   3e-39    
gb|EAY87564.1|  hypothetical protein OsI_08976                          153   3e-39    
ref|XP_003533096.1|  PREDICTED: annexin D8-like                         153   4e-39    
dbj|BAK02389.1|  predicted protein                                      153   4e-39    
ref|XP_009610017.1|  PREDICTED: annexin D3-like                         153   4e-39    
ref|XP_010527610.1|  PREDICTED: annexin D2-like                         153   4e-39    
ref|XP_006438876.1|  hypothetical protein CICLE_v10031919mg             152   4e-39    
ref|NP_001048149.1|  Os02g0753800                                       152   5e-39    
gb|KDO83197.1|  hypothetical protein CISIN_1g018771mg                   152   5e-39    
ref|XP_009771187.1|  PREDICTED: annexin D3-like                         153   5e-39    
ref|XP_008446931.1|  PREDICTED: annexin-like protein RJ4                152   5e-39    
ref|XP_009782453.1|  PREDICTED: annexin-like protein RJ4                152   6e-39    
ref|XP_006347770.1|  PREDICTED: annexin D3-like                         152   6e-39    
ref|XP_004984332.1|  PREDICTED: annexin D3-like                         152   6e-39    
ref|XP_006279651.1|  hypothetical protein CARUB_v10026799mg             152   6e-39    
ref|XP_004511018.1|  PREDICTED: annexin-like protein RJ4-like           152   7e-39    
ref|XP_006438872.1|  hypothetical protein CICLE_v10031919mg             152   8e-39    
gb|KDO83194.1|  hypothetical protein CISIN_1g018771mg                   152   9e-39    
gb|AIU49186.1|  annexin ANNAT3                                          150   1e-38    
ref|XP_004515568.1|  PREDICTED: annexin-like protein RJ4-like           152   1e-38    
ref|XP_003570621.1|  PREDICTED: annexin D1-like                         152   1e-38    
emb|CBI19153.3|  unnamed protein product                                151   1e-38    
ref|XP_009150578.1|  PREDICTED: annexin D2                              152   1e-38    
ref|XP_007011163.1|  Annexin                                            152   1e-38    
gb|AFL69958.1|  annexin E1                                              152   1e-38    
ref|XP_006644197.1|  PREDICTED: annexin-like protein RJ4-like           152   1e-38    
gb|KHN25117.1|  Annexin-like protein RJ4                                151   1e-38    
ref|XP_010670447.1|  PREDICTED: annexin-like protein RJ4                151   1e-38    
gb|AAA79922.1|  annexin                                                 150   1e-38    
ref|XP_011088404.1|  PREDICTED: annexin-like protein RJ4                151   2e-38    
emb|CDP18832.1|  unnamed protein product                                151   2e-38    
gb|AIU49225.1|  annexin ANNAT3                                          150   2e-38    
ref|XP_003522953.1|  PREDICTED: annexin-like protein RJ4-like iso...    151   2e-38    
ref|XP_010505530.1|  PREDICTED: annexin D3-like isoform X1              151   2e-38    
ref|NP_001234101.1|  annexin p35                                        150   2e-38    
ref|NP_001241261.1|  uncharacterized protein LOC100796092               150   3e-38    
gb|AAX78199.1|  putative annexin                                        150   3e-38    
gb|ABD47519.1|  annexin 2                                               150   3e-38    
ref|XP_009771168.1|  PREDICTED: annexin D3-like isoform X2              150   3e-38    
ref|XP_004230105.1|  PREDICTED: annexin D3-like isoform X2              150   3e-38    
ref|XP_010509173.1|  PREDICTED: annexin D3-like                         150   3e-38    
gb|EEE65351.1|  hypothetical protein OsJ_20631                          149   4e-38    
ref|XP_010517193.1|  PREDICTED: annexin D3                              150   4e-38    
gb|AAX78200.1|  putative annexin                                        150   5e-38    
ref|XP_008373200.1|  PREDICTED: annexin D7-like                         149   5e-38    
ref|XP_009413531.1|  PREDICTED: annexin-like protein RJ4                150   5e-38    
ref|XP_003567741.1|  PREDICTED: annexin-like protein RJ4                150   6e-38    



>ref|XP_009610016.1| PREDICTED: annexin D4-like [Nicotiana tomentosiformis]
Length=313

 Score =   452 bits (1162),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 235/314 (75%), Positives = 263/314 (84%), Gaps = 2/314 (1%)
 Frame = +2

Query  74    MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDH  253
             MA ++ +  LTKAFSGLGVDE  F+S L  WN   R+SYR ST  FF++DERQF+RWDD 
Sbjct  1     MAEANAYAALTKAFSGLGVDENLFISTLGNWNRHQRESYRVSTPGFFKEDERQFQRWDDQ  60

Query  254   HVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALL-KEPQFDLLIETACTRPSEELLGA  430
             H+LQLRQEFLRLKDAVVLY MHPWERDARLFKEALL K PQ  +LIETACTR SEELLGA
Sbjct  61    HILQLRQEFLRLKDAVVLYTMHPWERDARLFKEALLLKVPQLKVLIETACTRSSEELLGA  120

Query  431   RRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKH  610
             RRAYHSLF+HSIEEDIAFHIQTPERKLLVALVSSYRYEGP+V++D+AKSEAKV  NA+K 
Sbjct  121   RRAYHSLFEHSIEEDIAFHIQTPERKLLVALVSSYRYEGPRVNDDLAKSEAKVFVNALKD  180

Query  611   AGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMPQ  790
             A  KNL++DEEIVRILS RSKLHL  LY HYKE+T  +LDEDL   L+LKQ VQCLC PQ
Sbjct  181   A-KKNLIEDEEIVRILSHRSKLHLKVLYSHYKEMTDNYLDEDLDGCLILKQVVQCLCSPQ  239

Query  791   LYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVANG  970
              YFSKIL  SLRL VDE+A+DSVTRVIVTRAD+DMK IK+EF +KYG  L  +I EVANG
Sbjct  240   TYFSKILIESLRLDVDESAKDSVTRVIVTRADDDMKQIKEEFHSKYGTTLPAKIEEVANG  299

Query  971   SYKELLLTLVAKSE  1012
             SYK  LLT+VAKSE
Sbjct  300   SYKNFLLTIVAKSE  313



>ref|XP_006347771.1| PREDICTED: annexin D4-like isoform X1 [Solanum tuberosum]
Length=316

 Score =   451 bits (1160),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 231/316 (73%), Positives = 270/316 (85%), Gaps = 3/316 (1%)
 Frame = +2

Query  74    MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDH  253
             MA ++ +  LTKAFSGLGVDE  F+S L KWN   R+SYR ST  FFR+DERQF+RWDD 
Sbjct  1     MAEANSYAALTKAFSGLGVDENLFISTLGKWNRHQRESYRVSTPGFFREDERQFQRWDDQ  60

Query  254   HVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKE-PQFDLLIETACTRPSEELLGA  430
             H+LQLRQEFLRLKDAVVLY MHPWERDARLFKEALL + P+ D+LIE ACTR SE+LLGA
Sbjct  61    HILQLRQEFLRLKDAVVLYTMHPWERDARLFKEALLLQVPKHDVLIEIACTRSSEDLLGA  120

Query  431   RRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKH  610
             R+AYHSLF+HSIEEDIAFHI++PERKLLVALVSSYRYEGP+V +D+AKSEAK+  NAIK+
Sbjct  121   RKAYHSLFEHSIEEDIAFHIRSPERKLLVALVSSYRYEGPRVSDDLAKSEAKIFVNAIKN  180

Query  611   AGNKNLVD-DEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMP  787
             A  K L+D +EEIVRILSTRSKLHL A+Y HYKEITG FLDEDL   L +KQ VQCLC+P
Sbjct  181   ANKKKLIDEEEEIVRILSTRSKLHLKAIYSHYKEITGNFLDEDLEGDLTMKQVVQCLCVP  240

Query  788   QLYFSKILDASLRLGVDEAARDSVTRVIVTRA-DEDMKHIKQEFKTKYGVALSDRIGEVA  964
             + YFSKIL ASLRL VDE+A+DSVTRVIVTRA D+DMK IK+EF++KYG  L+ +I EVA
Sbjct  241   KAYFSKILIASLRLDVDESAKDSVTRVIVTRADDDDMKQIKEEFQSKYGTTLAAKIAEVA  300

Query  965   NGSYKELLLTLVAKSE  1012
             NGSYK+ LLT++AKS+
Sbjct  301   NGSYKDFLLTIIAKSD  316



>ref|XP_004230106.1| PREDICTED: annexin D4-like [Solanum lycopersicum]
Length=316

 Score =   449 bits (1154),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 229/316 (72%), Positives = 271/316 (86%), Gaps = 3/316 (1%)
 Frame = +2

Query  74    MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDH  253
             MA ++ +  LTKAFSGLGVDE  F+S L KWN   R+SYR ST  FFR+D+RQF+RWDD 
Sbjct  1     MAEANSYAALTKAFSGLGVDENLFISTLGKWNRHQRESYRVSTPGFFREDKRQFQRWDDQ  60

Query  254   HVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKE-PQFDLLIETACTRPSEELLGA  430
             H+LQLRQEFLRLKDAVVLY MHPWERDARLFKEALL + P+ D+LIE ACTR SE+LLGA
Sbjct  61    HILQLRQEFLRLKDAVVLYTMHPWERDARLFKEALLLQVPKHDVLIEIACTRSSEDLLGA  120

Query  431   RRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKH  610
             R+AYHSLF+HSIEEDIAFH+++ ERKLLVALVSSYRYEGP+V++D+AKSEAK+  NAIK+
Sbjct  121   RKAYHSLFEHSIEEDIAFHVRSSERKLLVALVSSYRYEGPRVNDDLAKSEAKIFVNAIKN  180

Query  611   AGNKNLVD-DEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMP  787
             A  K L+D DEEIVRILSTRSKLHL A+Y HYKEITG FLDEDL   L LKQ VQCLC+P
Sbjct  181   ANKKKLIDEDEEIVRILSTRSKLHLKAIYSHYKEITGNFLDEDLECDLTLKQVVQCLCIP  240

Query  788   QLYFSKILDASLRLGVDEAARDSVTRVIVTRA-DEDMKHIKQEFKTKYGVALSDRIGEVA  964
             + YFSKIL ASLRL VDE+A+DSVTRVIV+RA D+DM+ IK+EF++KYG  L+++I EVA
Sbjct  241   KAYFSKILIASLRLDVDESAKDSVTRVIVSRADDDDMQQIKEEFQSKYGTTLAEKIAEVA  300

Query  965   NGSYKELLLTLVAKSE  1012
             NGSYK+ LLT++AKSE
Sbjct  301   NGSYKDFLLTIIAKSE  316



>ref|XP_009771195.1| PREDICTED: annexin D4-like [Nicotiana sylvestris]
Length=313

 Score =   445 bits (1144),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 231/314 (74%), Positives = 262/314 (83%), Gaps = 2/314 (1%)
 Frame = +2

Query  74    MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDH  253
             MA ++ +  LTKAFSGLGVDE  F+S L  WN   R+SYR ST  FF++DERQF+RWDD 
Sbjct  1     MAEANAYAALTKAFSGLGVDENLFISTLGNWNRHQRESYRVSTPGFFKEDERQFQRWDDQ  60

Query  254   HVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALL-KEPQFDLLIETACTRPSEELLGA  430
             H+LQLRQEFLRLKDAVVLY MHPWERDARLFKEALL K PQ ++L ETACTR SEELLGA
Sbjct  61    HILQLRQEFLRLKDAVVLYTMHPWERDARLFKEALLLKIPQLNVLTETACTRSSEELLGA  120

Query  431   RRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKH  610
             RRAYHSLF+HSIEEDIAFHI TPERKLLVAL SSYRYEGP+V++D+AKSEAKV  NA+K 
Sbjct  121   RRAYHSLFEHSIEEDIAFHIHTPERKLLVALASSYRYEGPRVNDDLAKSEAKVFVNALKD  180

Query  611   AGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMPQ  790
                KNL+++EEIV ILS RSKLHL ALY HYKE+TGK+LDEDL  +L+LKQ VQCLC PQ
Sbjct  181   I-KKNLIENEEIVWILSHRSKLHLKALYSHYKEMTGKYLDEDLDGYLILKQVVQCLCSPQ  239

Query  791   LYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVANG  970
              YFSKIL  SLRL VDE+ +DSVTRVIVTRAD+DMK IK+EF +KYG  L  +I EVANG
Sbjct  240   TYFSKILIESLRLDVDESVKDSVTRVIVTRADDDMKQIKEEFHSKYGTTLPAKIEEVANG  299

Query  971   SYKELLLTLVAKSE  1012
             SYK  LLT+VAKSE
Sbjct  300   SYKNFLLTIVAKSE  313



>ref|XP_009772051.1| PREDICTED: annexin D4-like isoform X2 [Nicotiana sylvestris]
Length=315

 Score =   443 bits (1140),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 223/314 (71%), Positives = 262/314 (83%), Gaps = 2/314 (1%)
 Frame = +2

Query  74    MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDH  253
             MA S++ K L+KAFSGLGVDEK+F+++L KW+ K RQ YRK+T +FF++DERQFERWD+ 
Sbjct  1     MATSNEFKALSKAFSGLGVDEKSFITILGKWDTKQRQFYRKNTQEFFKEDERQFERWDEA  60

Query  254   HVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKE--PQFDLLIETACTRPSEELLG  427
             HVLQ+RQEFLRLKDAVV+Y MHPWERDARL KEAL+KE  PQ  ++IETA TR SE+LLG
Sbjct  61    HVLQVRQEFLRLKDAVVVYTMHPWERDARLIKEALVKEAQPQHHIIIETAATRSSEQLLG  120

Query  428   ARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIK  607
             ARRAYHSLF+HSIEEDIA HI TPER LLV LVSSYRYEGP+V E++AKSEAK    AIK
Sbjct  121   ARRAYHSLFEHSIEEDIASHIHTPERNLLVGLVSSYRYEGPRVDEELAKSEAKEFLKAIK  180

Query  608   HAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMP  787
              +G K L++DEEIVRILSTRSKLHL ALY +YK+I+G + DE+L   L+LKQTV+CLC P
Sbjct  181   DSGKKELIEDEEIVRILSTRSKLHLKALYSYYKQISGNYFDEELGGSLILKQTVECLCTP  240

Query  788   QLYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVAN  967
             Q YFSKILDASLRL VDE ARDSVTRVI TR DED+K I QEF  + G  L+++I E+AN
Sbjct  241   QTYFSKILDASLRLDVDEPARDSVTRVIATRVDEDIKQIAQEFHKRNGTTLTNKIEEIAN  300

Query  968   GSYKELLLTLVAKS  1009
             GSYKE LL LVAKS
Sbjct  301   GSYKEFLLALVAKS  314



>ref|XP_009772046.1| PREDICTED: annexin D4-like isoform X1 [Nicotiana sylvestris]
Length=338

 Score =   443 bits (1139),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 223/318 (70%), Positives = 262/318 (82%), Gaps = 2/318 (1%)
 Frame = +2

Query  62    NSSKMAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFER  241
             N  + A S++   LTKAFSGLGVDEK+F+++L KW+ K RQ YRK+T +FF++DERQFER
Sbjct  20    NGQQKATSNEFHALTKAFSGLGVDEKSFITILGKWDTKQRQFYRKNTQEFFKEDERQFER  79

Query  242   WDDHHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKE--PQFDLLIETACTRPSE  415
             WD+ HVLQ+RQEFLRLKDAVV+Y MHPWERDARL KEAL+KE  PQ  ++IETA TR SE
Sbjct  80    WDEAHVLQVRQEFLRLKDAVVVYTMHPWERDARLIKEALVKEAQPQHHIIIETAATRSSE  139

Query  416   ELLGARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLA  595
             +LLGARRAYHSLF+HSIEEDIA HI TPER LLV LVSSYRYEGP+V E++AKSEAK   
Sbjct  140   QLLGARRAYHSLFEHSIEEDIASHIHTPERNLLVGLVSSYRYEGPRVDEELAKSEAKEFL  199

Query  596   NAIKHAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQC  775
              AIK +G K L++DEEIVRILSTRSKLHL ALY +YK+I+G + DE+L   L+LKQTV+C
Sbjct  200   KAIKDSGKKELIEDEEIVRILSTRSKLHLKALYSYYKQISGNYFDEELGGSLILKQTVEC  259

Query  776   LCMPQLYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIG  955
             LC PQ YFSKILDASLRL VDE ARDSVTRVI TR DED+K I QEF  + G  L+++I 
Sbjct  260   LCTPQTYFSKILDASLRLDVDEPARDSVTRVIATRVDEDIKQIAQEFHKRNGTTLTNKIE  319

Query  956   EVANGSYKELLLTLVAKS  1009
             E+ANGSYKE LL LVAKS
Sbjct  320   EIANGSYKEFLLALVAKS  337



>ref|XP_006347774.1| PREDICTED: annexin D4-like [Solanum tuberosum]
Length=315

 Score =   438 bits (1126),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 225/315 (71%), Positives = 265/315 (84%), Gaps = 2/315 (1%)
 Frame = +2

Query  74    MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDH  253
             M+ +++   +TKAFSGLGVDE  F+S L +WN   R+SYR ST  FF +DERQF+RW DH
Sbjct  1     MSEANEFAAVTKAFSGLGVDENLFISSLGRWNRYQRESYRVSTPGFFNEDERQFQRWSDH  60

Query  254   HVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALL-KEPQFDLLIETACTRPSEELLGA  430
             H+LQLRQEFLRLKDAVVLY MHPWERDARLFKEALL K PQ D+LIETACTR SE+LLGA
Sbjct  61    HILQLRQEFLRLKDAVVLYTMHPWERDARLFKEALLLKIPQQDVLIETACTRSSEDLLGA  120

Query  431   RRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKH  610
             R+AYHSLF+HSIEEDIA HI+  ERKLLVALVS+YRYEGPKV++D+AKSEAKV  NA+K 
Sbjct  121   RKAYHSLFEHSIEEDIAHHIKAHERKLLVALVSTYRYEGPKVNDDLAKSEAKVFVNALKD  180

Query  611   AGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMPQ  790
             A  KNL++DEEIVRILS RSKLHL A+  HYKE+TG FLDEDL   L+LKQ VQCLC PQ
Sbjct  181   AKKKNLIEDEEIVRILSIRSKLHLKAICSHYKEMTGNFLDEDLDGDLILKQVVQCLCSPQ  240

Query  791   LYFSKILDASLRLGVDEAARDSVTRVIVTRADE-DMKHIKQEFKTKYGVALSDRIGEVAN  967
              YFSKIL +SL L V+E+A+DSVTRVIVTRADE DMK IK+EF++KYG  L+ +I EVAN
Sbjct  241   TYFSKILISSLSLDVEESAKDSVTRVIVTRADENDMKLIKEEFQSKYGSTLAAKIQEVAN  300

Query  968   GSYKELLLTLVAKSE  1012
             GSY++ LLT++AKS+
Sbjct  301   GSYRDFLLTIIAKSD  315



>ref|XP_009617233.1| PREDICTED: annexin D4-like [Nicotiana tomentosiformis]
Length=313

 Score =   436 bits (1121),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 225/314 (72%), Positives = 261/314 (83%), Gaps = 2/314 (1%)
 Frame = +2

Query  74    MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDH  253
             M+ ++ +  LTKAFSGLGVDE  F+S L KWN   R+ YR ST  FF++DERQF+RWDDH
Sbjct  1     MSEANAYAALTKAFSGLGVDENLFISTLGKWNRHQREIYRVSTPGFFKEDERQFQRWDDH  60

Query  254   HVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALL-KEPQFDLLIETACTRPSEELLGA  430
             H+LQLRQEFLRLKDAVV+Y MHPWERD RLFKEALL K PQ ++LIETACTR SEELLGA
Sbjct  61    HILQLRQEFLRLKDAVVIYTMHPWERDGRLFKEALLLKVPQLNVLIETACTRSSEELLGA  120

Query  431   RRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKH  610
             RRAYHSLFDHSIEEDIA  +Q PERKLLVALV+S+RYEGP+V++D+AK+EAKV  NA+K 
Sbjct  121   RRAYHSLFDHSIEEDIAHRLQNPERKLLVALVTSHRYEGPRVNDDLAKAEAKVFVNALKD  180

Query  611   AGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMPQ  790
             A  KNL++DEEIVRILS RSKLHL ALY HYKE+TG +LDEDL   L LKQ VQCLC PQ
Sbjct  181   A-KKNLIEDEEIVRILSHRSKLHLKALYSHYKEMTGNYLDEDLDGELTLKQVVQCLCSPQ  239

Query  791   LYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVANG  970
              YFS IL ASLRL VDE+A+DS TRVIVTRAD DMK IK+EF +KYG  L  +I EVANG
Sbjct  240   AYFSNILIASLRLDVDESAKDSATRVIVTRADVDMKQIKEEFHSKYGTTLPAKIEEVANG  299

Query  971   SYKELLLTLVAKSE  1012
             SYK+ LLT+++KS+
Sbjct  300   SYKDFLLTIISKSD  313



>ref|XP_009771176.1| PREDICTED: annexin D4-like [Nicotiana sylvestris]
Length=313

 Score =   435 bits (1119),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 224/314 (71%), Positives = 261/314 (83%), Gaps = 2/314 (1%)
 Frame = +2

Query  74    MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDH  253
             M+ ++ +  LTKAFSGLGVDE  F+S L KWN   R+ YR ST  FF++DERQF+RWDDH
Sbjct  1     MSEANAYAALTKAFSGLGVDENLFISTLGKWNRHQREIYRVSTPGFFKEDERQFQRWDDH  60

Query  254   HVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALL-KEPQFDLLIETACTRPSEELLGA  430
             H+LQLRQEFLRLKDAVV+Y MHPWERD RLFKEALL K PQ ++LIETACTR SEELLGA
Sbjct  61    HILQLRQEFLRLKDAVVIYTMHPWERDGRLFKEALLLKVPQLNVLIETACTRSSEELLGA  120

Query  431   RRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKH  610
             RRAYHSLFDHSIEEDIA  +Q PERKLLVALVSS+RYEGP+V++D+AKSE K+  NA+K 
Sbjct  121   RRAYHSLFDHSIEEDIAHRLQNPERKLLVALVSSHRYEGPRVNDDLAKSETKIFVNALKD  180

Query  611   AGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMPQ  790
             A  KNL++D+EIVRILS RSKLHL ALY HYKE+TG +LDEDL+  L LKQ VQCLC PQ
Sbjct  181   A-KKNLIEDDEIVRILSHRSKLHLKALYNHYKEMTGNYLDEDLNGELTLKQVVQCLCSPQ  239

Query  791   LYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVANG  970
              YFS IL ASLRL VDE+A+DS TRVIVTRAD DMK IK+EF +KYG  L  +I EVANG
Sbjct  240   SYFSNILIASLRLDVDESAKDSATRVIVTRADVDMKQIKEEFHSKYGTTLPAKIEEVANG  299

Query  971   SYKELLLTLVAKSE  1012
             SYK+ LLT+++KS+
Sbjct  300   SYKDFLLTIISKSD  313



>gb|EYU38266.1| hypothetical protein MIMGU_mgv1a010378mg [Erythranthe guttata]
Length=314

 Score =   416 bits (1068),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 208/315 (66%), Positives = 262/315 (83%), Gaps = 3/315 (1%)
 Frame = +2

Query  74    MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDH  253
             MA SDDH  LT+AFSG GVDEKAFV++L KW+P+ RQS+RK +  FF +DERQFERWDD 
Sbjct  1     MAASDDHGSLTRAFSGFGVDEKAFVTILGKWHPEERQSFRKKSGDFFVEDERQFERWDDR  60

Query  254   HVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFDLLIETACTRPSEELLGAR  433
             H+LQLR EFLRLKDA+VL+ MHPWERDARL KEAL K PQ+++LIE ACTR SEELLGAR
Sbjct  61    HILQLRNEFLRLKDAIVLWTMHPWERDARLLKEALYKGPQYNVLIEIACTRSSEELLGAR  120

Query  434   RAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHA  613
             RAYHSLFDHSIEED+A HI+TPE+KLLVAL+SSYRYEGPKV +++AK EA+ ++N  K  
Sbjct  121   RAYHSLFDHSIEEDVASHIRTPEKKLLVALLSSYRYEGPKVSDEIAKLEAETISNVTK-K  179

Query  614   GNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDED--LHAHLLLKQTVQCLCMP  787
             G+ ++++D++IVRILSTRSKLHL+ALYKHYK+ITG +LDED  L  +  LK T QCLC P
Sbjct  180   GDNSVIEDDDIVRILSTRSKLHLVALYKHYKQITGNYLDEDIALGGNSHLKATTQCLCTP  239

Query  788   QLYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVAN  967
               YFS++LDASL+  VDE  +++VTR+IVTRAD DMK IK+E+   +GV LS +I ++AN
Sbjct  240   PTYFSQVLDASLKYDVDEITKEAVTRIIVTRADADMKQIKEEYNKTFGVHLSHKIEDLAN  299

Query  968   GSYKELLLTLVAKSE  1012
             G+Y++ LLTL+A+ +
Sbjct  300   GNYRDFLLTLIARGD  314



>ref|XP_006347772.1| PREDICTED: annexin D4-like isoform X2 [Solanum tuberosum]
Length=310

 Score =   414 bits (1064),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 220/305 (72%), Positives = 254/305 (83%), Gaps = 6/305 (2%)
 Frame = +2

Query  74   MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDH  253
            MA ++ +  LTKAFSGLGVDE  F+S L KWN   R+SYR ST  FFR+DERQF+RWDD 
Sbjct  1    MAEANSYAALTKAFSGLGVDENLFISTLGKWNRHQRESYRVSTPGFFREDERQFQRWDDQ  60

Query  254  HVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKE-PQFDLLIETACTRPSEELLGA  430
            H+LQLRQEFLRLKDAVVLY MHPWERDARLFKEALL + P+ D+LIE ACTR SE+LLGA
Sbjct  61   HILQLRQEFLRLKDAVVLYTMHPWERDARLFKEALLLQVPKHDVLIEIACTRSSEDLLGA  120

Query  431  RRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKH  610
            R+AYHSLF+HSIEEDIAFHI++PERKLLVALVSSYRYEGP+V +D+AKSEAK+  NAIK+
Sbjct  121  RKAYHSLFEHSIEEDIAFHIRSPERKLLVALVSSYRYEGPRVSDDLAKSEAKIFVNAIKN  180

Query  611  AGNKNLVD-DEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMP  787
            A  K L+D +EEIVRILSTRSKLHL A+Y HYKEITG FLDEDL   L +KQ VQCLC+P
Sbjct  181  ANKKKLIDEEEEIVRILSTRSKLHLKAIYSHYKEITGNFLDEDLEGDLTMKQVVQCLCVP  240

Query  788  QLYFSKILDASLRLGVDEAARDSVTRVIVTRA-DEDMKHIKQEFKTKYGVALS---DRIG  955
            + YFSKIL ASLRL VDE+A+DSVTRVIVTRA D+DMK IK+EF++KY   L     +I 
Sbjct  241  KAYFSKILIASLRLDVDESAKDSVTRVIVTRADDDDMKQIKEEFQSKYVNYLGCKPAKIE  300

Query  956  EVANG  970
            EVA G
Sbjct  301  EVAIG  305



>ref|XP_004230108.1| PREDICTED: annexin D4-like [Solanum lycopersicum]
Length=313

 Score =   411 bits (1056),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 223/315 (71%), Positives = 264/315 (84%), Gaps = 4/315 (1%)
 Frame = +2

Query  74    MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDH  253
             M+ +++   +TKAFSGLGVDE  F+S L +WN   R+SYR ST  FF++DERQF+RW DH
Sbjct  1     MSEANEFAAVTKAFSGLGVDENLFISSLGRWNRYQRESYRVSTPGFFKEDERQFQRWSDH  60

Query  254   HVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEA-LLKEPQFDLLIETACTRPSEELLGA  430
             H+LQLRQEFLRLKDAVVLY MHPWERDARLFKEA LLK PQ D+LIETACTR SE+LLGA
Sbjct  61    HILQLRQEFLRLKDAVVLYTMHPWERDARLFKEALLLKIPQHDVLIETACTRSSEDLLGA  120

Query  431   RRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKH  610
             R+AYHSLF+HSIEEDIA HI+  ERKLLVALVSSYRYEG KV+ED+AKSEAK+ ANA+  
Sbjct  121   RKAYHSLFEHSIEEDIAHHIKAHERKLLVALVSSYRYEGAKVNEDLAKSEAKMFANAL--  178

Query  611   AGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMPQ  790
             A   NL++DE+IVRILS RSK HL A+Y HYKE+TG FLDEDL   LLLKQ VQCLC PQ
Sbjct  179   AKKTNLIEDEDIVRILSIRSKHHLKAIYSHYKEMTGNFLDEDLDGDLLLKQVVQCLCSPQ  238

Query  791   LYFSKILDASLRLGVDEAARDSVTRVIVTRADE-DMKHIKQEFKTKYGVALSDRIGEVAN  967
              YFSKIL +SL L V+E+A+DSVTRVIVTRADE DMK IK+EF++KYG  L+ +I +VAN
Sbjct  239   TYFSKILISSLSLDVEESAKDSVTRVIVTRADENDMKLIKEEFQSKYGSTLAAKIQQVAN  298

Query  968   GSYKELLLTLVAKSE  1012
             GSY++ LLT++AKS+
Sbjct  299   GSYRDFLLTIIAKSD  313



>ref|XP_011088394.1| PREDICTED: annexin D4 [Sesamum indicum]
Length=313

 Score =   406 bits (1044),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 203/312 (65%), Positives = 255/312 (82%), Gaps = 1/312 (0%)
 Frame = +2

Query  74    MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDH  253
             MA SDD + L +AFSG+GVDE+A +SVL KW+P+ RQ +RK+T  FF +DERQFERW+D 
Sbjct  1     MAASDDVESLARAFSGVGVDEQALISVLGKWHPEQRQHFRKATRDFFVEDERQFERWNDR  60

Query  254   HVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFDLLIETACTRPSEELLGAR  433
             H+LQLR EFLRLKDA+V + MHPWERDARL KEAL K PQ+++LIE ACTR SEELLGAR
Sbjct  61    HILQLRHEFLRLKDAIVAWTMHPWERDARLLKEALYKGPQYNVLIEIACTRSSEELLGAR  120

Query  434   RAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHA  613
             RAYHSLF HSIEED+AFH+ TPE++LLVA++SSYRYEGPKV E+ AK EAK L++ I   
Sbjct  121   RAYHSLFHHSIEEDVAFHVHTPEKELLVAVLSSYRYEGPKVDEETAKLEAKTLSDVIGKK  180

Query  614   GNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMPQL  793
             G  N  D++ ++RILSTRSKLHL A+YKHYK ITG +LDED+     LK+TVQCLC P+ 
Sbjct  181   G-LNKEDEDVVIRILSTRSKLHLKAIYKHYKAITGNYLDEDIEGDSRLKETVQCLCTPEK  239

Query  794   YFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVANGS  973
             YFS++LDASLR   DE ++++++RVIVTRAD DMK IK+E+  KYGV+L  +I EVANG+
Sbjct  240   YFSQVLDASLRYNADEISKEALSRVIVTRADADMKQIKEEYHGKYGVSLGKKIEEVANGN  299

Query  974   YKELLLTLVAKS  1009
             Y++ LLTL+A+S
Sbjct  300   YRDFLLTLIARS  311



>emb|CDP17930.1| unnamed protein product [Coffea canephora]
Length=314

 Score =   394 bits (1011),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 206/312 (66%), Positives = 242/312 (78%), Gaps = 1/312 (0%)
 Frame = +2

Query  74    MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDH  253
             MA   +   L KAF+GLGVDEK  +S+L KW+P    SYRK+T  FF +DERQFERW D 
Sbjct  1     MAHPKEISALNKAFTGLGVDEKTSISILTKWHPHQLHSYRKATPDFFIEDERQFERWSDP  60

Query  254   HVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFDLLIETACTRPSEELLGAR  433
              VLQLRQEF+R KDAVVL  MHPWERDARLFKEAL   P+ D++IETACTR SE+LLGAR
Sbjct  61    RVLQLRQEFIRFKDAVVLRTMHPWERDARLFKEALQMGPRIDIIIETACTRSSEDLLGAR  120

Query  434   RAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHA  613
             RAYHSLF  SIEEDIA  I T ERKLLVALVS+YRYEGP V E+ AKSEA+VL NAIK  
Sbjct  121   RAYHSLFHRSIEEDIASQIHTSERKLLVALVSAYRYEGPHVQEERAKSEAEVLYNAIKAV  180

Query  614   GNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMPQL  793
               KN  ++EE++ IL+TRSK H+ A+YK+ +EI+G  L +D      LKQTVQCLC P  
Sbjct  181   AKKNPTENEEVIMILATRSKSHIKAVYKYCEEISGNHLQQDPDGDWALKQTVQCLCTPHA  240

Query  794   YFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKY-GVALSDRIGEVANG  970
             YFSKILDASLR  VDEAARDSVTRVI+TRAD D+K IK+EF+ K+ GV+LS RI EVANG
Sbjct  241   YFSKILDASLRTDVDEAARDSVTRVILTRADVDIKQIKEEFQHKFSGVSLSKRIEEVANG  300

Query  971   SYKELLLTLVAK  1006
             +Y++ LL LV+K
Sbjct  301   NYRDFLLALVSK  312



>ref|XP_007218708.1| hypothetical protein PRUPE_ppa008922mg [Prunus persica]
 gb|EMJ19907.1| hypothetical protein PRUPE_ppa008922mg [Prunus persica]
Length=314

 Score =   392 bits (1006),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 193/313 (62%), Positives = 249/313 (80%), Gaps = 1/313 (0%)
 Frame = +2

Query  74    MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDH  253
             MA++D+ + L KAFSG+G+DE + +S+L KW+P+ R+S+RK T  FF+ DER FERWDD 
Sbjct  1     MALTDEFQALNKAFSGVGIDENSLISILGKWHPEERKSFRKGTPHFFKQDERNFERWDDL  60

Query  254   HVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQ-FDLLIETACTRPSEELLGA  430
             HV  L+ EF+R K+AVVL+ MH WERDARL KEAL K PQ + +L+E ACTR +EELLGA
Sbjct  61    HVKLLKHEFMRFKNAVVLWTMHSWERDARLVKEALKKGPQTYSVLVEIACTRSAEELLGA  120

Query  431   RRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKH  610
             R+AYHSLFDHSIEED+A+HI  PE KLLVALVS+YRYEGPKV +D AKSEAK LA+AIK+
Sbjct  121   RKAYHSLFDHSIEEDVAYHIDGPEGKLLVALVSAYRYEGPKVKDDTAKSEAKTLAHAIKN  180

Query  611   AGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMPQ  790
             A  +N ++D+E++RILSTRSK HL  +YKHY+EI+G  +DEDL   L LK+TVQCLC P 
Sbjct  181   ADKRNPIEDDEVIRILSTRSKPHLKEIYKHYQEISGHNIDEDLDDALRLKETVQCLCTPH  240

Query  791   LYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVANG  970
              YF ++L+ SLR GVD+  +  +TRVIVTRAD DMK IK+E++  YGV+L+++I   ANG
Sbjct  241   TYFGQVLEISLRNGVDKNIKKGLTRVIVTRADADMKEIKEEYQNLYGVSLTEKIEATANG  300

Query  971   SYKELLLTLVAKS  1009
             +YK+ LLTL A+ 
Sbjct  301   NYKDFLLTLAARG  313



>ref|XP_002265000.1| PREDICTED: annexin D4 [Vitis vinifera]
 emb|CAN79077.1| hypothetical protein VITISV_016344 [Vitis vinifera]
 emb|CBI17723.3| unnamed protein product [Vitis vinifera]
Length=314

 Score =   391 bits (1005),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 199/314 (63%), Positives = 251/314 (80%), Gaps = 1/314 (0%)
 Frame = +2

Query  74    MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDH  253
             MA+S + + LTK+FSG GVDEK+ +S+L KW+   R+SYRK   QFF  D+R FE+WDD 
Sbjct  1     MALSHEFQALTKSFSGFGVDEKSMISILGKWHQDDRKSYRKGCPQFFTQDDRLFEKWDDR  60

Query  254   HVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQ-FDLLIETACTRPSEELLGA  430
             HV  L+ EFLRLK+AVVL+ MHPWERDARL KEAL+K PQ + ++IE A TR SE+LLGA
Sbjct  61    HVAFLKHEFLRLKNAVVLWTMHPWERDARLMKEALVKGPQAYAVIIEVASTRSSEQLLGA  120

Query  431   RRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKH  610
             RRAYHSLFDHSIEED+A+HI    RKLLV LVSSYRYEGPKV+E++AKSEAK L  AIK+
Sbjct  121   RRAYHSLFDHSIEEDVAYHINDSCRKLLVGLVSSYRYEGPKVNEEIAKSEAKTLFAAIKN  180

Query  611   AGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMPQ  790
             A  KN ++DEE+VRIL+TRSK HL A++KHYKEI GK +DEDL   L L +T+QCLC PQ
Sbjct  181   ADKKNPIEDEEVVRILTTRSKPHLKAIFKHYKEINGKNIDEDLDDELSLDETMQCLCTPQ  240

Query  791   LYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVANG  970
              YFSK+L A+ +   DE A++++TRVIVTRAD+DMK IK+E++ KYGV+LS +I +  NG
Sbjct  241   TYFSKVLGAAFQNDADEHAKEALTRVIVTRADDDMKEIKEEYQKKYGVSLSKKIEDAVNG  300

Query  971   SYKELLLTLVAKSE  1012
             +YK+ LLTL+A+ E
Sbjct  301   NYKDFLLTLIARGE  314



>ref|XP_008245412.1| PREDICTED: annexin D4 [Prunus mume]
Length=314

 Score =   389 bits (1000),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 193/313 (62%), Positives = 249/313 (80%), Gaps = 1/313 (0%)
 Frame = +2

Query  74    MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDH  253
             MA++D+ + L KAFSG+G+DE + +S+L KW+P+ R+S+RK T  FF+ DER FERWDD 
Sbjct  1     MALTDEFQALNKAFSGVGIDENSLISILGKWHPEERKSFRKGTPHFFKQDERNFERWDDL  60

Query  254   HVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQ-FDLLIETACTRPSEELLGA  430
             HV  L+ EF+R K+AVVL+ MH WERDARL KEAL K PQ + +L+E ACTR +EELLGA
Sbjct  61    HVKLLKHEFMRFKNAVVLWTMHSWERDARLVKEALKKGPQTYSVLVEIACTRSAEELLGA  120

Query  431   RRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKH  610
             R+AYHSLFDHSIEED+A+HI  PE KLLVALVS+YRYEGPKV +D AKSEAK LA+AIK+
Sbjct  121   RKAYHSLFDHSIEEDVAYHIDGPEGKLLVALVSAYRYEGPKVKDDTAKSEAKTLAHAIKN  180

Query  611   AGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMPQ  790
             A  +N ++D+E++RILSTRSK HL  +YKHY+EI+G  +DEDL   L LK+TVQ LC P 
Sbjct  181   ADKRNPIEDDEVIRILSTRSKPHLKEIYKHYQEISGHNIDEDLDDALRLKETVQSLCTPH  240

Query  791   LYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVANG  970
              YFS++L+ SLR GVD+  +  +TRVIVTRAD DMK IK+E++  YGV+L+++I   ANG
Sbjct  241   AYFSQVLEVSLRNGVDKNIKKGLTRVIVTRADADMKEIKEEYQNLYGVSLTEKIEATANG  300

Query  971   SYKELLLTLVAKS  1009
             +YK+ LLTL A+ 
Sbjct  301   NYKDFLLTLAARG  313



>ref|XP_009354447.1| PREDICTED: annexin D4-like [Pyrus x bretschneideri]
Length=314

 Score =   389 bits (998),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 199/313 (64%), Positives = 251/313 (80%), Gaps = 1/313 (0%)
 Frame = +2

Query  74    MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDH  253
             MA++ + + LTKAFSGLGVDEKA V+ L K +P+ RQS+RK+T  FF+ DER FERWDDH
Sbjct  1     MALTPELQTLTKAFSGLGVDEKALVATLGKSHPEERQSFRKATPHFFKVDERSFERWDDH  60

Query  254   HVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQ-FDLLIETACTRPSEELLGA  430
             HV  L+ EFLR K+AVVL+ MHPWERDARL KEAL K P+ + +L+E ACTR SEELLGA
Sbjct  61    HVKLLKHEFLRFKNAVVLWTMHPWERDARLAKEALKKGPESYGILVEIACTRSSEELLGA  120

Query  431   RRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKH  610
             R+AYHSLFDHSIEED+A+HI  PE KLLVALVS+YRYEG KV +D AKSEAK L NAI+H
Sbjct  121   RKAYHSLFDHSIEEDVAYHIHGPEGKLLVALVSAYRYEGSKVKDDTAKSEAKTLVNAIQH  180

Query  611   AGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMPQ  790
             A  ++  +D+E++RILSTRSK HL  +YKHYKEI+G  +DEDL   + LK+TVQCLC P+
Sbjct  181   ADKRHPNEDDEVIRILSTRSKPHLKEVYKHYKEISGHNIDEDLDHAVRLKETVQCLCTPE  240

Query  791   LYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVANG  970
              YFSK+L+ SLR  V + ++  +TRVIVTRAD DM+ IK+EFK  +GV+L ++I E+ANG
Sbjct  241   KYFSKVLEVSLRTDVHKHSKKGLTRVIVTRADSDMREIKEEFKNHHGVSLVEKIEEMANG  300

Query  971   SYKELLLTLVAKS  1009
             +YK+ LLTL+A+ 
Sbjct  301   NYKDFLLTLLARG  313



>ref|XP_008354904.1| PREDICTED: annexin D4-like, partial [Malus domestica]
Length=306

 Score =   375 bits (964),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 192/299 (64%), Positives = 239/299 (80%), Gaps = 1/299 (0%)
 Frame = +2

Query  116   SGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVLQLRQEFLRLKD  295
             +GLGVDEKA V+ L K +P+ RQS+RK+T  FF+ DER FERWDDHHV  L+ EFLR K+
Sbjct  7     AGLGVDEKALVATLGKSHPEERQSFRKATPHFFKVDERSFERWDDHHVKLLKHEFLRFKN  66

Query  296   AVVLYMMHPWERDARLFKEALLKEPQ-FDLLIETACTRPSEELLGARRAYHSLFDHSIEE  472
             AVVL+ MHPWERDARL KEAL K P+ + +L+E ACTR SEELLGAR+AYHSLFDHSIEE
Sbjct  67    AVVLWTMHPWERDARLAKEALKKGPESYGILVEIACTRSSEELLGARKAYHSLFDHSIEE  126

Query  473   DIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGNKNLVDDEEIVR  652
             D+A+HI  PE KLLVALVS+YRYEG KV +D AKSEAK L NAI+HA  +N  +D+E++R
Sbjct  127   DVAYHIDGPEGKLLVALVSAYRYEGSKVKDDTAKSEAKTLVNAIQHADKRNPNEDDEVIR  186

Query  653   ILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMPQLYFSKILDASLRLG  832
             ILSTRSK HL  +YKHYKEI+G  +DEDL   + LK+TVQCLC P  YFSK+L+ SLR  
Sbjct  187   ILSTRSKPHLKEVYKHYKEISGHNIDEDLDHAVRLKETVQCLCTPDKYFSKVLEVSLRTD  246

Query  833   VDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVANGSYKELLLTLVAKS  1009
             V + ++  +TRVIVTRAD DM+ IK+EFK  +GV+L ++I E+ANG+YK+ LLTL+A+ 
Sbjct  247   VHKHSKKGLTRVIVTRADSDMREIKEEFKNHHGVSLVEKIEEMANGNYKDFLLTLLARG  305



>ref|XP_008377133.1| PREDICTED: annexin D4 [Malus domestica]
Length=315

 Score =   375 bits (962),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 194/314 (62%), Positives = 245/314 (78%), Gaps = 2/314 (1%)
 Frame = +2

Query  74    MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRK-STHQFFRDDERQFERWDD  250
             MA++ + + LTKAFSGLGVDEKA V++L K +P+ RQS+RK +T  FF++DER FERWDD
Sbjct  1     MALTPELQALTKAFSGLGVDEKALVAILGKSHPEERQSFRKATTPHFFKEDERSFERWDD  60

Query  251   HHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQ-FDLLIETACTRPSEELLG  427
             HH+  L+ EFLR K+AVVL+ MHPWERDARL KEAL K P+ + +L+E ACTR SEELLG
Sbjct  61    HHIKLLKHEFLRFKNAVVLWTMHPWERDARLAKEALKKGPESYGILVEIACTRSSEELLG  120

Query  428   ARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIK  607
             AR+AYHS FDHSIEED+A+HI  PE KLLVALVSSYRYEG KV +D AKSEAK L NAIK
Sbjct  121   ARKAYHSJFDHSIEEDVAYHIDGPEGKLLVALVSSYRYEGSKVXDDTAKSEAKTLVNAIK  180

Query  608   HAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMP  787
                 ++  +D+E++RILSTRSK HL  + KHYKEI+G  +DEDL   + LK+TVQCLC P
Sbjct  181   DVDKRHPNEDDEVIRILSTRSKPHLKEVSKHYKEISGHDIDEDLDHAVRLKETVQCLCTP  240

Query  788   QLYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVAN  967
             + YFSK+L+ SLR  V +  +  +TRVIVTRA  DM  IK+EF+  +GV+L ++I E AN
Sbjct  241   EKYFSKVLEDSLRTDVHKHTKKGLTRVIVTRAHSDMMEIKEEFENHHGVSLVEKIEEXAN  300

Query  968   GSYKELLLTLVAKS  1009
             G+YK+ LLTL+A+ 
Sbjct  301   GNYKDFLLTLLARG  314



>ref|XP_003627775.1| Annexin D4 [Medicago truncatula]
 gb|AET02251.1| annexin D8 [Medicago truncatula]
 gb|KEH19108.1| annexin D8 [Medicago truncatula]
Length=314

 Score =   373 bits (957),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 197/314 (63%), Positives = 250/314 (80%), Gaps = 3/314 (1%)
 Frame = +2

Query  74    MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDD-ERQFERWDD  250
             MA + + + +T+AFSG GVDEK+ ++VL KW+P  R++YRK T  FF +D ERQF+RW+D
Sbjct  1     MAFNQELEAITQAFSGHGVDEKSLIAVLGKWDPLERETYRKKTSHFFIEDHERQFQRWND  60

Query  251   HHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEP-QFDLLIETACTRPSEELLG  427
             H V  L+ EF+R K+AVVL+ MHPWERDARL KEAL K    + +LIE ACTR SEELLG
Sbjct  61    HCVRLLKHEFVRFKNAVVLWSMHPWERDARLAKEALKKGSISYGVLIEIACTRSSEELLG  120

Query  428   ARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIK  607
             AR+AYHSLFDHSIEED+A HI   +RKLLVALVS+YRYEG KV +D AKSEAK L+NAIK
Sbjct  121   ARKAYHSLFDHSIEEDVASHIHGNDRKLLVALVSAYRYEGTKVKDDTAKSEAKTLSNAIK  180

Query  608   HAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMP  787
             +A NK +V+D+E++RIL+TRSKLHL A+YKHYKEI+GK L+EDL+  L  K+TVQCLC P
Sbjct  181   NAQNKPIVEDDEVIRILATRSKLHLQAVYKHYKEISGKNLEEDLN-DLRFKETVQCLCTP  239

Query  788   QLYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVAN  967
             Q+YFSK+LDA+L+  V++  + S+TRVIVTRAD DMK IK E+   YGV+L  +I E A 
Sbjct  240   QVYFSKVLDAALKNDVNKNIKKSLTRVIVTRADIDMKEIKAEYNNLYGVSLPQKIEETAK  299

Query  968   GSYKELLLTLVAKS  1009
             G+YK+ LLTL+A+ 
Sbjct  300   GNYKDFLLTLIARG  313



>ref|XP_009361989.1| PREDICTED: annexin D4-like [Pyrus x bretschneideri]
Length=315

 Score =   372 bits (955),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 194/314 (62%), Positives = 243/314 (77%), Gaps = 2/314 (1%)
 Frame = +2

Query  74    MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRK-STHQFFRDDERQFERWDD  250
             MA++ + + LTKAFSGLGVDE A V++L K +P+ RQS+RK +T  FF++DER FERWDD
Sbjct  1     MALTPELQTLTKAFSGLGVDETALVAILGKSHPEERQSFRKATTPHFFKEDERSFERWDD  60

Query  251   HHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQ-FDLLIETACTRPSEELLG  427
             HH+  L+ EFLR K+AVVL+ MHPWERDARL KEAL K P+ + +L+E ACTR SEELLG
Sbjct  61    HHIKLLKHEFLRFKNAVVLWTMHPWERDARLAKEALKKGPESYGILVEIACTRSSEELLG  120

Query  428   ARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIK  607
             AR+AYHSLFDHSIEED+A+HI  PE KLLVALVSSYRYEG KV +D AKSEAK L NAIK
Sbjct  121   ARKAYHSLFDHSIEEDVAYHIDGPEGKLLVALVSSYRYEGSKVKDDTAKSEAKTLVNAIK  180

Query  608   HAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMP  787
                 +   + +E++RILSTRSK HL  + KHYKEI+G  +DEDL   + LK+TVQCLC P
Sbjct  181   DVDKRQPNEGDEVIRILSTRSKPHLKEVSKHYKEISGHDIDEDLDHAVRLKETVQCLCTP  240

Query  788   QLYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVAN  967
             + YFSK+L+ SLR  V +  +  +TRVIVTRA  DM  IK+EF+  +GV+L ++I E AN
Sbjct  241   EKYFSKVLEDSLRTDVHKHTKKGLTRVIVTRAHSDMVEIKEEFENHHGVSLVEKIEETAN  300

Query  968   GSYKELLLTLVAKS  1009
             G+YK+ LLTL+AK 
Sbjct  301   GNYKDFLLTLLAKG  314



>ref|XP_004511009.1| PREDICTED: annexin D4-like [Cicer arietinum]
Length=314

 Score =   370 bits (950),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 193/314 (61%), Positives = 246/314 (78%), Gaps = 3/314 (1%)
 Frame = +2

Query  74    MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDD-ERQFERWDD  250
             MA + + + +T AFSG GVDEK+  ++L KWNP  R+ YRK+T  FF +D ER+F+RW+D
Sbjct  1     MAFNQELEAITHAFSGHGVDEKSLTTILGKWNPLERELYRKNTPHFFVEDHERKFQRWND  60

Query  251   HHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQ-FDLLIETACTRPSEELLG  427
             H V  L+ EF+R K+AVVL+ MHPWERDARL KEAL K P  + +LIE ACTR SEELLG
Sbjct  61    HCVRLLKHEFVRFKNAVVLWSMHPWERDARLAKEALKKGPSSYGILIEIACTRSSEELLG  120

Query  428   ARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIK  607
             AR+AYHSLFDHSIEED+A HI   +RKLLVALVS+YRYEG KV +D AKSEAK L+NAIK
Sbjct  121   ARKAYHSLFDHSIEEDVASHIHGIDRKLLVALVSAYRYEGSKVKDDTAKSEAKTLSNAIK  180

Query  608   HAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMP  787
             +   K +V+D+E++RIL+TRSK HL  ++KHYKEI+GK L+EDL+  L  K+TV+CLC P
Sbjct  181   NVHKKPIVEDDEVIRILATRSKAHLQQVHKHYKEISGKNLEEDLN-DLRFKETVECLCTP  239

Query  788   QLYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVAN  967
             Q+YFSK+LDASL++ VD+  + S+TRVIVTRAD DMK IK E+   YGV+L  +I E A 
Sbjct  240   QVYFSKVLDASLKIDVDKNIKKSLTRVIVTRADIDMKEIKGEYNNLYGVSLQQKIEETAK  299

Query  968   GSYKELLLTLVAKS  1009
             G+YK+ LLTL+A+ 
Sbjct  300   GNYKDFLLTLIARG  313



>ref|XP_004307133.1| PREDICTED: annexin D4-like [Fragaria vesca subsp. vesca]
Length=313

 Score =   370 bits (949),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 186/313 (59%), Positives = 242/313 (77%), Gaps = 1/313 (0%)
 Frame = +2

Query  74    MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDH  253
             MA +D+   L  AFSGLGVDEK+ +S+L   +P+ R+ +RK T   F++DER FERW+D 
Sbjct  1     MAFTDELNTLNNAFSGLGVDEKSLISILGNSHPEERKCFRKGTPHLFKEDERLFERWNDE  60

Query  254   HVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQF-DLLIETACTRPSEELLGA  430
              V  L+ EF+R K+AVVL+ MHPWERDARL KEAL K  +   +++E ACTR SEELLGA
Sbjct  61    RVRLLKHEFMRFKNAVVLWAMHPWERDARLVKEALKKGTEVHGVIVEIACTRSSEELLGA  120

Query  431   RRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKH  610
             R+AYHSLFDHSIEED+A+HI  PE KLLVALVS+YRYEG KV++  AKSEA+ L + IK+
Sbjct  121   RKAYHSLFDHSIEEDVAYHIDGPESKLLVALVSAYRYEGAKVNDATAKSEAQTLYHVIKN  180

Query  611   AGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMPQ  790
               N N ++D+E++RILSTRSK HL  +YKHYKEI+G  ++EDL A L LK+TVQCLC P 
Sbjct  181   TDNTNPIEDDEVIRILSTRSKAHLQVVYKHYKEISGNNMNEDLGADLRLKETVQCLCTPH  240

Query  791   LYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVANG  970
              YFSK+L+ +LR  VD+  +  +TRVIVTRAD DMK IK+E++ +YGV+LS +I E A+G
Sbjct  241   TYFSKVLEVALRNDVDKNTKKGLTRVIVTRADTDMKQIKEEYQNQYGVSLSSKIEETAHG  300

Query  971   SYKELLLTLVAKS  1009
             +YK+ LLTLVA++
Sbjct  301   NYKDFLLTLVART  313



>gb|AFK35988.1| unknown [Lotus japonicus]
Length=314

 Score =   367 bits (941),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 192/313 (61%), Positives = 248/313 (79%), Gaps = 3/313 (1%)
 Frame = +2

Query  74    MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDD-ERQFERWDD  250
             MA++ + + +T+AFSG GVDEK+ V++L KW+ + R+++RK+T  FF +D ER F+RWDD
Sbjct  1     MALNQELQAVTEAFSGHGVDEKSLVTLLGKWDHQERETFRKNTPPFFTEDHERNFQRWDD  60

Query  251   HHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQ-FDLLIETACTRPSEELLG  427
             H V  L+ EF+R K+AVV + MHPWERDARL KEAL K P  + +LIE ACTR SEELLG
Sbjct  61    HSVRLLKHEFVRFKNAVVPWTMHPWERDARLVKEALKKGPNAYGVLIEIACTRSSEELLG  120

Query  428   ARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIK  607
             AR+AYHSLFDHSIEED+A HI   ERKLLVALVS+YRYEG KV +D AKSEAK ++NAIK
Sbjct  121   ARKAYHSLFDHSIEEDVASHIHGIERKLLVALVSAYRYEGSKVKDDTAKSEAKTISNAIK  180

Query  608   HAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMP  787
             +A  K +++D+E +RI +TRSKLHL A+YKHYKEI+GK LDEDL + L  KQTVQCLC P
Sbjct  181   NAQKKPIIEDDEAIRIFATRSKLHLQAIYKHYKEISGKNLDEDL-SDLRFKQTVQCLCTP  239

Query  788   QLYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVAN  967
             Q+YFSK+LD +L++ V +  +  +TRV+VTRAD DMK IK E++  YGV+L+ +I E A 
Sbjct  240   QIYFSKVLDGALKIDVHKNTKKDLTRVVVTRADIDMKEIKAEYQNLYGVSLTQKIEETAK  299

Query  968   GSYKELLLTLVAK  1006
             G+YK+ LLTLVA+
Sbjct  300   GNYKDFLLTLVAR  312



>ref|XP_007133791.1| hypothetical protein PHAVU_011G209400g [Phaseolus vulgaris]
 gb|ESW05785.1| hypothetical protein PHAVU_011G209400g [Phaseolus vulgaris]
Length=314

 Score =   365 bits (937),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 193/314 (61%), Positives = 246/314 (78%), Gaps = 3/314 (1%)
 Frame = +2

Query  74    MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKST-HQFFRDDERQFERWDD  250
             MA + + + +T+AFSG GVDEK+ V+ L KW+P  R+S+RK T H F  D ER F+RWDD
Sbjct  1     MAFNQELEAITQAFSGHGVDEKSLVTTLGKWDPLERESFRKKTPHLFTEDHERHFQRWDD  60

Query  251   HHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLK-EPQFDLLIETACTRPSEELLG  427
             H+V  L+ EF+R K+AVVL+ MHPWERDAR  KEAL K +  + +LIE ACTR SEELLG
Sbjct  61    HYVHLLKHEFVRFKNAVVLWSMHPWERDARFVKEALKKGQNAYGVLIEVACTRSSEELLG  120

Query  428   ARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIK  607
             AR+AYHSLFDHSIEED+A HI   ERKLL+AL+S+YRYEG KV +D AKSEAKVL+NAIK
Sbjct  121   ARKAYHSLFDHSIEEDVASHIHGIERKLLIALLSAYRYEGKKVKDDTAKSEAKVLSNAIK  180

Query  608   HAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMP  787
             +A  K + +D+E++RIL+TRSKLHL A+YKHYKEI+GK LDEDL   L  K+TVQCLC P
Sbjct  181   NAHKKPINEDDEVIRILATRSKLHLQAVYKHYKEISGKNLDEDL-DDLRFKETVQCLCTP  239

Query  788   QLYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVAN  967
             Q+YFSK+L+ +LR+ VD+  + S+TRVIVTRAD DMK IK ++   YGV+LS ++ EVA 
Sbjct  240   QIYFSKVLNEALRIDVDKNTKKSLTRVIVTRADIDMKEIKAQYHNLYGVSLSQKVEEVAR  299

Query  968   GSYKELLLTLVAKS  1009
             G+YK+ LL L+ + 
Sbjct  300   GNYKDFLLNLIVRG  313



>ref|XP_003542839.1| PREDICTED: annexin D4 [Glycine max]
 gb|KHN37644.1| Annexin D4 [Glycine soja]
Length=314

 Score =   364 bits (934),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 192/314 (61%), Positives = 245/314 (78%), Gaps = 3/314 (1%)
 Frame = +2

Query  74    MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKST-HQFFRDDERQFERWDD  250
             MA + + + +T+AFSG GVDEK+ V++L KW+P  R+S+RK T H F  D ER F+RWDD
Sbjct  1     MAFNQELEAVTQAFSGHGVDEKSLVTLLGKWDPLERESFRKKTPHLFSEDHERHFQRWDD  60

Query  251   HHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEP-QFDLLIETACTRPSEELLG  427
              +V  L+ EF+R K+AVVL+ MHPWERDARL KEAL K P ++ +LIE ACTR SEELLG
Sbjct  61    QYVRLLKHEFVRFKNAVVLWTMHPWERDARLVKEALKKGPNEYGVLIEVACTRSSEELLG  120

Query  428   ARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIK  607
             AR+AYHSLFDHSIEED+A HI   ERKLLVAL+S+YRYEG KV +D AKSEAK L+NAIK
Sbjct  121   ARKAYHSLFDHSIEEDVASHIHGIERKLLVALLSAYRYEGTKVKDDTAKSEAKTLSNAIK  180

Query  608   HAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMP  787
             +A  K L +D+E++RIL+TRSKLH+ A+ KHYKEI+GK LDEDL   L  K+ VQCLC P
Sbjct  181   NAHKKPLNEDDEVIRILATRSKLHIQAVCKHYKEISGKNLDEDLD-DLRFKEAVQCLCTP  239

Query  788   QLYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVAN  967
             Q+YFSK+L+A+L++ VD+  + S+TRVIVTRAD DMK IK ++   YGV+L  ++ EVA 
Sbjct  240   QIYFSKVLNAALKIDVDKNTKKSLTRVIVTRADIDMKDIKADYHNLYGVSLPQKVEEVAR  299

Query  968   GSYKELLLTLVAKS  1009
             GSYK+ LL L+ + 
Sbjct  300   GSYKDFLLNLIVRG  313



>ref|NP_001241368.1| annexin D4-like [Glycine max]
 gb|ADG59899.1| annexin 11 [Glycine max]
 gb|KHN25119.1| Annexin D4 [Glycine soja]
Length=314

 Score =   363 bits (932),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 193/314 (61%), Positives = 245/314 (78%), Gaps = 3/314 (1%)
 Frame = +2

Query  74    MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKST-HQFFRDDERQFERWDD  250
             MA + + + +T+AFSG GVDEK+ V++L KW+P  R+S+RK T H F  D ER F+RWDD
Sbjct  1     MAFNQELEAVTQAFSGHGVDEKSLVTLLGKWDPLERESFRKKTPHLFSEDHERHFQRWDD  60

Query  251   HHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQ-FDLLIETACTRPSEELLG  427
              +V  L+ EF+R K+AVVL+ MHPWERDARL KEAL K P  + +LIE +CTR SEELLG
Sbjct  61    QYVRLLKHEFVRFKNAVVLWSMHPWERDARLVKEALKKGPNAYGVLIEVSCTRSSEELLG  120

Query  428   ARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIK  607
             AR+AYHSLFDHSIEED+A HI   ERKLLVAL+S+YRYEG KV +D AKSEAK+L+NAIK
Sbjct  121   ARKAYHSLFDHSIEEDVASHIHGIERKLLVALLSAYRYEGTKVKDDTAKSEAKILSNAIK  180

Query  608   HAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMP  787
             +A  K + +D+E++RIL+TRSKLHL A+YKHYKEI+GK LDEDL   L  K+ VQCLC P
Sbjct  181   NAHKKPINEDDEVIRILATRSKLHLQAVYKHYKEISGKNLDEDLD-DLRFKEAVQCLCTP  239

Query  788   QLYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVAN  967
             Q YFSK+L+A+LR+ VD+  + S+TRV+VTRAD DMK IK E+   YGV+L  ++ EVA 
Sbjct  240   QTYFSKVLNAALRIDVDKNTKKSLTRVVVTRADIDMKDIKAEYHNLYGVSLPQKVEEVAR  299

Query  968   GSYKELLLTLVAKS  1009
             GSYK+ LL L+ + 
Sbjct  300   GSYKDFLLNLIVRG  313



>gb|ADM34982.1| annexin-like protein [Glycine soja]
Length=314

 Score =   363 bits (931),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 193/314 (61%), Positives = 243/314 (77%), Gaps = 3/314 (1%)
 Frame = +2

Query  74    MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKST-HQFFRDDERQFERWDD  250
             MA + + + +T+AFSG GVDEK+ V++L KW+P  R+S+RK T H F  D ER F+RWDD
Sbjct  1     MAFNQELEAVTQAFSGHGVDEKSLVTLLGKWDPLERESFRKKTPHLFSEDHERHFQRWDD  60

Query  251   HHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQ-FDLLIETACTRPSEELLG  427
              +V  L+ EF+R K+AVVL+ MHPWERDARL KEAL K P  + +LIE +CTR SEELLG
Sbjct  61    QYVCLLKHEFVRFKNAVVLWSMHPWERDARLVKEALKKGPNAYGVLIEVSCTRSSEELLG  120

Query  428   ARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIK  607
             AR+AYHSLFDHSIEED+A HI   ERKLLVAL+S+YRYEG KV +D AKSEAK+L+NAIK
Sbjct  121   ARKAYHSLFDHSIEEDVASHIHGIERKLLVALLSAYRYEGTKVKDDTAKSEAKILSNAIK  180

Query  608   HAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMP  787
             +A  K + +D+E+ RIL+TRSKLHL A+YKHYKEI+GK LDEDL   L  K+ VQCLC P
Sbjct  181   NAHKKPISEDDEVTRILATRSKLHLQAVYKHYKEISGKNLDEDLD-DLRFKEAVQCLCTP  239

Query  788   QLYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVAN  967
             Q YFSK+L+A+LR+ VD+  + S+TR +VTRAD DMK IK EF   YGV+L  ++ EVA 
Sbjct  240   QTYFSKVLNAALRIDVDKNTKKSLTRAVVTRADIDMKDIKAEFHNLYGVSLPQKVEEVAR  299

Query  968   GSYKELLLTLVAKS  1009
             GSYK+ LL L+ + 
Sbjct  300   GSYKDFLLNLIVRG  313



>ref|XP_010999603.1| PREDICTED: annexin D4 [Populus euphratica]
Length=312

 Score =   360 bits (925),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 185/304 (61%), Positives = 235/304 (77%), Gaps = 2/304 (1%)
 Frame = +2

Query  101   LTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVLQLRQEF  280
             L KAF+GLGVDEK+ +  L K +P+HR  +RK T Q F +DER FERW+DH V  L+ EF
Sbjct  7     LAKAFTGLGVDEKSLIENLGKSHPEHRTLFRKKTPQLFIEDERSFERWNDHCVRLLKHEF  66

Query  281   LRLKDAVVLYMMHPWERDARLFKEALLKEPQ-FDLLIETACTRPSEELLGARRAYHSLFD  457
             +R K+A+VL+ MHPWERDARL KEAL K PQ + ++ E ACTR SEELLGAR+AYHSLFD
Sbjct  67    VRFKNALVLWAMHPWERDARLVKEALKKGPQSYGVIGEIACTRSSEELLGARKAYHSLFD  126

Query  458   HSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGNKNLVDD  637
              SIEED+A HI   ERKLLVALVS+YRYEGPKV ED AKSEAK+LANAIK+   KN ++D
Sbjct  127   QSIEEDVATHIHGSERKLLVALVSAYRYEGPKVKEDAAKSEAKILANAIKNGNKKNPIED  186

Query  638   EEIVRILSTRSklhllalykhykEITGKFLDEDLHAH-LLLKQTVQCLCMPQLYFSKILD  814
             EE++RILSTRSK HL  +YKHYKE++G  + EDL A  L+LK+TV+CLC P  YFSK+LD
Sbjct  187   EEVIRILSTRSKAHLKVVYKHYKEVSGNSIHEDLDASDLILKETVECLCTPHAYFSKVLD  246

Query  815   ASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVANGSYKELLLT  994
              ++     + ++  +TRVIVTRAD DMK IK+E+   +GV+LS +I E ANG+Y++ L+T
Sbjct  247   EAMSSDAHKNSKKGLTRVIVTRADVDMKEIKEEYMNLFGVSLSKKIEEKANGNYRDFLVT  306

Query  995   LVAK  1006
             L+ +
Sbjct  307   LITR  310



>ref|XP_002299215.1| annexin 4 family protein [Populus trichocarpa]
 gb|EEE84020.1| annexin 4 family protein [Populus trichocarpa]
Length=312

 Score =   359 bits (922),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 184/304 (61%), Positives = 234/304 (77%), Gaps = 2/304 (1%)
 Frame = +2

Query  101   LTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVLQLRQEF  280
             L KAF+GLGVDEK+ +  L K +P+ R  +RK T Q F +DER FERW+DH V  L+ EF
Sbjct  7     LAKAFTGLGVDEKSLIENLGKSHPEQRTLFRKKTPQLFIEDERSFERWNDHCVRLLKHEF  66

Query  281   LRLKDAVVLYMMHPWERDARLFKEALLKEPQ-FDLLIETACTRPSEELLGARRAYHSLFD  457
             +R K+A+VL+ MHPWERDARL KEAL K PQ + +++E ACTR SEELLGAR+AYHSLFD
Sbjct  67    VRFKNALVLWAMHPWERDARLVKEALKKGPQSYGVIVEIACTRSSEELLGARKAYHSLFD  126

Query  458   HSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGNKNLVDD  637
              SIEED+A HI   ERKLLVALVS+YRYEGPKV ED AKSEAK+LANAIK+   KN ++D
Sbjct  127   QSIEEDVATHIHGSERKLLVALVSAYRYEGPKVKEDAAKSEAKILANAIKNGNKKNPIED  186

Query  638   EEIVRILSTRSklhllalykhykEITGKFLDEDLHAH-LLLKQTVQCLCMPQLYFSKILD  814
             EE++RILSTRSK HL  +YKHYKE++G  + EDL A  L+LK+TV+CLC P  YFSK+LD
Sbjct  187   EEVIRILSTRSKAHLKVVYKHYKEVSGNNIHEDLDASDLILKETVECLCTPHAYFSKVLD  246

Query  815   ASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVANGSYKELLLT  994
              ++     +  +  +TRVIVTRAD DMK IK+E+   +GV+LS +I E ANG+Y++ L+T
Sbjct  247   EAMSSDAHKNTKKGLTRVIVTRADVDMKEIKEEYMNLFGVSLSKKIEEKANGNYRDFLVT  306

Query  995   LVAK  1006
             L+ +
Sbjct  307   LITR  310



>gb|ABK96542.1| unknown [Populus trichocarpa x Populus deltoides]
Length=312

 Score =   359 bits (921),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 182/304 (60%), Positives = 232/304 (76%), Gaps = 2/304 (1%)
 Frame = +2

Query  101   LTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVLQLRQEF  280
             L KAF+GLGVDEK+ +  L K +P+ R  +RK T Q F +DER FERW+DH V  L+ EF
Sbjct  7     LAKAFTGLGVDEKSLIENLGKSHPEQRTLFRKKTPQLFIEDERSFERWNDHCVRLLKHEF  66

Query  281   LRLKDAVVLYMMHPWERDARLFKEALLKEPQ-FDLLIETACTRPSEELLGARRAYHSLFD  457
             +R K+A+VL+ MHPWERDARL KEAL K PQ + +++E ACTR SEELLGAR+AYHSLFD
Sbjct  67    VRFKNALVLWAMHPWERDARLVKEALKKGPQSYGVIVEIACTRSSEELLGARKAYHSLFD  126

Query  458   HSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGNKNLVDD  637
              SIEED+A HI   ERKLLVALVS+YRYEGPKV ED AKSEAK+LANAIK+   KN ++D
Sbjct  127   QSIEEDVATHIHGSERKLLVALVSAYRYEGPKVKEDAAKSEAKILANAIKNGNKKNPIED  186

Query  638   EEIVRILSTRSklhllalykhykEITGKFLDEDLH-AHLLLKQTVQCLCMPQLYFSKILD  814
             EE++RILSTRSK HL    KHYKE++G  + EDL  + L+LK+TV+CLC P  YFSK+LD
Sbjct  187   EEVIRILSTRSKAHLKVACKHYKEVSGNNIHEDLDPSDLILKETVECLCTPHAYFSKVLD  246

Query  815   ASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVANGSYKELLLT  994
              ++     +  +  +TRVIVTRAD DMK IK+E+   +GV+LS +I E ANG+Y++ L+T
Sbjct  247   EAMSSNAHKNTKKGLTRVIVTRADVDMKEIKEEYMNLFGVSLSKKIEEKANGNYRDFLVT  306

Query  995   LVAK  1006
             L+ +
Sbjct  307   LITR  310



>ref|XP_010067752.1| PREDICTED: annexin D4 [Eucalyptus grandis]
 gb|KCW65940.1| hypothetical protein EUGRSUZ_G03249 [Eucalyptus grandis]
Length=329

 Score =   357 bits (917),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 182/314 (58%), Positives = 239/314 (76%), Gaps = 3/314 (1%)
 Frame = +2

Query  74    MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDH  253
             MA SD+ + LTKAFSG GVDE   ++VL K +P+ R+++RK    FF++DER FERWDDH
Sbjct  18    MAQSDELEALTKAFSGHGVDETTLIAVLGKSHPEKRKAFRKGNPHFFKEDERSFERWDDH  77

Query  254   HVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEP-QFDLLIETACTRPSEELLGA  430
              +  L++EF R K+AVVL+ MHPWERDARL KEAL + P  +++LIE ACTR SEELLGA
Sbjct  78    RIKLLKREFSRFKNAVVLWAMHPWERDARLMKEALKEGPDSYNVLIEVACTRSSEELLGA  137

Query  431   RRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKH  610
             RRAYHSL++HSIEED+A H+  PER+LLVALVS+YRYEG K  ED AK+EAK + N IK 
Sbjct  138   RRAYHSLYEHSIEEDVASHVHGPERRLLVALVSAYRYEGTKPKEDNAKAEAKTILNVIKS  197

Query  611   AGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMPQ  790
                K   D+EE++RIL+TRSKL L A+YK Y+EI+G  LDEDL +   L++TVQCLC P+
Sbjct  198   GEKK--TDNEEVIRILTTRSKLLLKAVYKDYQEISGSNLDEDLKSDSRLQETVQCLCTPE  255

Query  791   LYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVANG  970
              YFS++LD +L +  D++ + ++TRVIVTRAD D+K I +EF   YGV L+ +I + ANG
Sbjct  256   RYFSQVLDLALEIDADKSTKKALTRVIVTRADVDVKEIDEEFNKMYGVRLTKKIEDTANG  315

Query  971   SYKELLLTLVAKSE  1012
             +YK+ LL L+AK +
Sbjct  316   NYKDFLLRLIAKGD  329



>ref|XP_002513081.1| annexin, putative [Ricinus communis]
 gb|EEF49584.1| annexin, putative [Ricinus communis]
Length=315

 Score =   357 bits (915),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 181/313 (58%), Positives = 242/313 (77%), Gaps = 2/313 (1%)
 Frame = +2

Query  74    MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDH  253
             MA  ++ + LTKAFSGLGVDEK+ +S+L K +P+HR+S+RK +   F +DER FERWDD 
Sbjct  1     MAHPEELEALTKAFSGLGVDEKSLISILGKSHPEHRKSFRKGSPHLFIEDERSFERWDDD  60

Query  254   HVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQ-FDLLIETACTRPSEELLGA  430
              V  LRQEF R ++A+V++ MHPWERDARL  EAL + PQ + +++E ACTR SEELLGA
Sbjct  61    SVHLLRQEFARFENALVIWAMHPWERDARLIYEALREGPQSYGVIVEIACTRSSEELLGA  120

Query  431   RRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKH  610
             R+AYHSLFDHSIEED+A HI   ERKLLVAL S+YRYEGPKV ED AK EAK+ ANA+K+
Sbjct  121   RKAYHSLFDHSIEEDVATHISGTERKLLVALASAYRYEGPKVKEDSAKFEAKIFANAVKN  180

Query  611   AGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLH-AHLLLKQTVQCLCMP  787
                 N ++D+E++RILSTRSK HL A+YKHYKEI+G  + EDL  A+L+LK+TV+CLC P
Sbjct  181   GDKTNPIEDDEVIRILSTRSKPHLKAVYKHYKEISGNGIIEDLGAANLILKETVECLCTP  240

Query  788   QLYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVAN  967
               +FSK+LD ++R   D   + ++TRVIVT+AD D+K I +++ + YG+ LS ++ E AN
Sbjct  241   HAFFSKVLDKAMRKDADHNTKKALTRVIVTQADIDLKEISEQYNSLYGIPLSKKVEETAN  300

Query  968   GSYKELLLTLVAK  1006
             G+YK+ LL L+++
Sbjct  301   GNYKDFLLALISR  313



>ref|XP_010273219.1| PREDICTED: annexin D4-like [Nelumbo nucifera]
Length=311

 Score =   351 bits (901),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 178/312 (57%), Positives = 235/312 (75%), Gaps = 2/312 (1%)
 Frame = +2

Query  74    MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDH  253
             MA   D   LTKAFSG GVDE A + +L KW P+ R+S+RK   QFF +DER FERWDD+
Sbjct  1     MAFPQDIDALTKAFSGFGVDENAIIWILGKWYPEQRRSFRKGCSQFFWEDERLFERWDDN  60

Query  254   HVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFDLLIETACTRPSEELLGAR  433
             H+  L +EFLR K+A+VL+++HPWERDAR+ KEA LK  ++D+LIE ACTR SEELLG R
Sbjct  61    HIAFLEREFLRFKNAMVLWILHPWERDARMAKEA-LKNREYDILIEIACTRSSEELLGTR  119

Query  434   RAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHA  613
             RAYHSLFDHSIEED+A+ +    R LLVALVSSYRYEGPKV+E++AK EAK L  A K+ 
Sbjct  120   RAYHSLFDHSIEEDVAYSVHDNNRNLLVALVSSYRYEGPKVNEEIAKKEAKTLWEAFKNV  179

Query  614   GNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMPQL  793
              NKN ++D E+VRI++TRSKLHL +++ HYK ++GK ++EDL     LK  +QCL  P+ 
Sbjct  180   -NKNPIEDGEVVRIITTRSKLHLKSVFNHYKVVSGKNIEEDLEEDSSLKDAIQCLSSPKA  238

Query  794   YFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVANGS  973
             YFS+ILD ++  G DE  ++++TR+IVT+AD  MK I +E+  +YGV+LS +I E   G+
Sbjct  239   YFSRILDIAMMGGADEKHKEALTRIIVTQADAYMKEIAEEYLQQYGVSLSQKIEETTKGN  298

Query  974   YKELLLTLVAKS  1009
             YK+ LLTLV++ 
Sbjct  299   YKDFLLTLVSRG  310



>ref|XP_010247045.1| PREDICTED: annexin D4-like isoform X1 [Nelumbo nucifera]
Length=311

 Score =   350 bits (898),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 177/313 (57%), Positives = 238/313 (76%), Gaps = 2/313 (1%)
 Frame = +2

Query  74    MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDH  253
             MA+  D   LTKAFSG GVDE + +S+L KW+P+ R+S+RK   QFFR+D+R FERWD+ 
Sbjct  1     MALPGDLDALTKAFSGFGVDENSIISILGKWHPEQRKSFRKGFPQFFREDKRLFERWDER  60

Query  254   HVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFDLLIETACTRPSEELLGAR  433
             H+  L  EFLR K+A+VL+ +HPWERDARL KEAL K   +D+L+E ACTR SEELLGAR
Sbjct  61    HIAFLEHEFLRFKNAMVLWTLHPWERDARLAKEALAK-GDYDILVEIACTRSSEELLGAR  119

Query  434   RAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHA  613
             RAYHSLFDHSIEED+A+ +    R LLVALVSSYRYEG +V+E++A++EAK L+ AIK+A
Sbjct  120   RAYHSLFDHSIEEDVAYSVNDSNRNLLVALVSSYRYEGARVNEEIAETEAKTLSEAIKNA  179

Query  614   GNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMPQL  793
               K  +++EE+VRI++TRSKLHL A++ +YKEI+G   +EDL     L  T+QC+  P+ 
Sbjct  180   -EKRPIENEEVVRIITTRSKLHLKAVFNYYKEISGTTTEEDLEEGSSLSYTIQCISSPKT  238

Query  794   YFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVANGS  973
             YFSKIL ++L+   DE  + ++TRVIVT+AD  MK I +E+  ++GV+LS +I E  NG+
Sbjct  239   YFSKILASALKGSADEKNKQALTRVIVTQADSYMKEISEEYHKQHGVSLSQKIEETTNGN  298

Query  974   YKELLLTLVAKSE  1012
             YK+ LLTLVA+ +
Sbjct  299   YKDFLLTLVARGD  311



>gb|KDP40510.1| hypothetical protein JCGZ_24509 [Jatropha curcas]
Length=315

 Score =   349 bits (895),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 174/313 (56%), Positives = 240/313 (77%), Gaps = 2/313 (1%)
 Frame = +2

Query  74    MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDH  253
             MA  ++ + L+KAFSGLGVDE + +S+L K +P+HR+++RK T   F +DER FERWD H
Sbjct  1     MAHPEELEALSKAFSGLGVDENSLISILGKSHPEHRRTFRKGTPHLFIEDERSFERWDSH  60

Query  254   HVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQ-FDLLIETACTRPSEELLGA  430
              +  LR EF+R ++A+VL+ MHPWERDARL  E+L + PQ + +++E ACTR SE+LLGA
Sbjct  61    RMNLLRHEFVRFENALVLWAMHPWERDARLIYESLKEGPQSYGVIVEIACTRSSEDLLGA  120

Query  431   RRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKH  610
             R+AYHSLFDHSIEE +A H+ T ERKLLVALVS+YRYEGP V E+ AK EAK+ AN IK+
Sbjct  121   RKAYHSLFDHSIEEHVAAHVTTSERKLLVALVSAYRYEGPMVKEETAKFEAKIFANGIKN  180

Query  611   AGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLH-AHLLLKQTVQCLCMP  787
                KN ++DEE++RILSTRSKLH+ A+Y+HYKE++GK ++E L  A L+LK+T++CLC P
Sbjct  181   GDKKNPMEDEEVIRILSTRSKLHIQAIYRHYKEVSGKSINEALEGADLILKETIECLCTP  240

Query  788   QLYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVAN  967
             Q YF K++D ++R   D   +  +TRVIV+RAD D+K I +++   YG+ALS +I E AN
Sbjct  241   QAYFCKVVDEAMRNDADHQTKMGLTRVIVSRADVDLKEIDEDYNKLYGIALSKKINETAN  300

Query  968   GSYKELLLTLVAK  1006
             G+Y++ LL L+ +
Sbjct  301   GNYRDFLLALITR  313



>gb|KDO83188.1| hypothetical protein CISIN_1g021607mg [Citrus sinensis]
Length=310

 Score =   348 bits (892),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 176/304 (58%), Positives = 234/304 (77%), Gaps = 2/304 (1%)
 Frame = +2

Query  101   LTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVLQLRQEF  280
             L KAFSG GVDEK  +S+L    P+HRQ++RK    FF +DER+FERW+DHHV  L+ EF
Sbjct  7     LIKAFSGHGVDEKTVISILGNSQPEHRQAFRKEG-GFFAEDERRFERWNDHHVKLLKHEF  65

Query  281   LRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGARRAYHSLFD  457
             +R K+AVVL+ MHPWERDARL KEAL K P  + +++E A TR S+ELLGAR+AYHSLF+
Sbjct  66    MRFKNAVVLWAMHPWERDARLIKEALKKGPNSNSVIVEIASTRSSDELLGARKAYHSLFE  125

Query  458   HSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGNKNLVDD  637
             HSIEED+A HI   E+KLLVALVS+YRYEGPKV EDVAKSEAK L +A+K+A  +N +++
Sbjct  126   HSIEEDVASHIHGKEKKLLVALVSAYRYEGPKVKEDVAKSEAKALISAVKNAEKQNPIEN  185

Query  638   EEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMPQLYFSKILDA  817
             +E+VRILSTRSK HL +++KHYKEI G+  +++L  HL+L+  VQCL  PQ YFS++LD 
Sbjct  186   DEVVRILSTRSKPHLKSVFKHYKEIAGQHFEDELDVHLILQAAVQCLITPQSYFSRVLDE  245

Query  818   SLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVANGSYKELLLTL  997
             ++R G D+  +  +TRV+VTRAD D++ I  +++  Y + L+D+I   A GSYKE LLTL
Sbjct  246   AMRDGADKNTKKGLTRVLVTRADVDIRAISDDYRNHYAIPLADKIEAKAKGSYKEFLLTL  305

Query  998   VAKS  1009
             +A+ 
Sbjct  306   MARG  309



>ref|XP_006438869.1| hypothetical protein CICLE_v10032182mg [Citrus clementina]
 gb|ESR52109.1| hypothetical protein CICLE_v10032182mg [Citrus clementina]
Length=310

 Score =   347 bits (890),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 175/304 (58%), Positives = 234/304 (77%), Gaps = 2/304 (1%)
 Frame = +2

Query  101   LTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVLQLRQEF  280
             L KAFSG GVDEK  +S+L    P+HRQ++RK    FF +DER+FERW+DHHV  L+ EF
Sbjct  7     LIKAFSGHGVDEKTVISILGNSQPEHRQAFRKEG-GFFAEDERRFERWNDHHVKLLKHEF  65

Query  281   LRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGARRAYHSLFD  457
             +R K+AVVL+ MHPWERDARL KEAL K P  + +++E A TR S+ELLGAR+AYHSLF+
Sbjct  66    MRFKNAVVLWAMHPWERDARLIKEALKKGPNSNSVIVEIASTRSSDELLGARKAYHSLFE  125

Query  458   HSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGNKNLVDD  637
             HSIEED+A HI   E+KLLVALVS+YRYEGPK+ EDVAKSEAK L +A+K+A  +N +++
Sbjct  126   HSIEEDVASHIHGKEKKLLVALVSAYRYEGPKIKEDVAKSEAKALISAVKNAEKQNPIEN  185

Query  638   EEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMPQLYFSKILDA  817
             +E+VRILSTRSK HL +++KHYKEI G+  +++L  HL+L+  VQCL  PQ YFS++LD 
Sbjct  186   DEVVRILSTRSKPHLKSVFKHYKEIAGQHFEDELDVHLILQAAVQCLITPQSYFSRVLDE  245

Query  818   SLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVANGSYKELLLTL  997
             ++R G D+  +  +TRV+VTRAD D++ I  +++  Y + L+D+I   A GSYKE LLTL
Sbjct  246   AMRDGADKNTKKGLTRVLVTRADVDIRAISDDYRNHYAIPLADKIEAKAKGSYKEFLLTL  305

Query  998   VAKS  1009
             +A+ 
Sbjct  306   MARG  309



>ref|XP_006482997.1| PREDICTED: annexin D4-like [Citrus sinensis]
Length=310

 Score =   345 bits (884),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 174/304 (57%), Positives = 233/304 (77%), Gaps = 2/304 (1%)
 Frame = +2

Query  101   LTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVLQLRQEF  280
             L KA SG GVDEK  +S+L    P+HRQ++RK    FF +DER+FERW+DHHV  L+ EF
Sbjct  7     LIKALSGHGVDEKTVISILGNSQPEHRQAFRKEG-GFFAEDERRFERWNDHHVKLLKHEF  65

Query  281   LRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGARRAYHSLFD  457
             +R K+AVVL+ MHPWERDARL KEAL K P  + +++E A TR S+ELLGAR+AYHSLF+
Sbjct  66    MRFKNAVVLWAMHPWERDARLIKEALKKGPNSNSVIVEIASTRSSDELLGARKAYHSLFE  125

Query  458   HSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGNKNLVDD  637
             HSIEED+A HI   E+KLLVALVS+YRYEGPK+ EDVAKSEAK L +A+K+A  +N +++
Sbjct  126   HSIEEDVASHIHGKEKKLLVALVSAYRYEGPKIKEDVAKSEAKALISAVKNAEKQNPIEN  185

Query  638   EEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMPQLYFSKILDA  817
             +E+VRILSTRSK HL +++KHYKEI G+  +++L  HL+L+  VQCL  PQ YFS++LD 
Sbjct  186   DEVVRILSTRSKPHLKSVFKHYKEIAGQHFEDELDVHLILQAAVQCLITPQSYFSRVLDE  245

Query  818   SLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVANGSYKELLLTL  997
             ++R G D+  +  +TRV+VTRAD D++ I  +++  Y + L+D+I   A GSYKE LLTL
Sbjct  246   AMRDGADKNTKKGLTRVLVTRADVDIRAISDDYRNHYAIPLADKIEAKAKGSYKEFLLTL  305

Query  998   VAKS  1009
             +A+ 
Sbjct  306   MARG  309



>ref|XP_008446930.1| PREDICTED: annexin D4 [Cucumis melo]
 gb|ADN34201.1| annexin [Cucumis melo subsp. melo]
Length=318

 Score =   342 bits (877),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 179/312 (57%), Positives = 238/312 (76%), Gaps = 6/312 (2%)
 Frame = +2

Query  95    KILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVLQLRQ  274
             ++LT+A SG G++E A +  L KWN + ++ +RK +  FF +DER FERW++H +  L+ 
Sbjct  7     EVLTRALSGHGINENAMIETLGKWNHEEKKLFRKKSSHFFSEDERSFERWEEHGMRLLKH  66

Query  275   EFLRLKDAVVLYMMHPWERDARLFKEALLKE---PQFDLLIETACTRPSEELLGARRAYH  445
             EF+R K+AVVL+  HPWERDARL KEAL K       ++LIE ACTR S+ELLGAR+AYH
Sbjct  67    EFMRFKNAVVLWTTHPWERDARLVKEALSKGHHGQNINILIEVACTRTSDELLGARKAYH  126

Query  446   SLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGNK-  622
             SLFDHSIEED+A H+  PERKLLVAL+S+YRYEGPK  E++AKSEAK  A++IK A +K 
Sbjct  127   SLFDHSIEEDVASHLNGPERKLLVALMSAYRYEGPKYKEEIAKSEAKKFAHSIKEANSKK  186

Query  623   -NLVDDEEIVRILSTRSklhllalykhykEIT-GKFLDEDLHAHLLLKQTVQCLCMPQLY  796
              +L++DEEIVRILSTRSK  L ALYKHY EI+ G+ +DEDLH  L L++ V CL  P  Y
Sbjct  187   SSLIEDEEIVRILSTRSKHFLHALYKHYNEISAGRSIDEDLHGDLRLQEAVLCLTNPVKY  246

Query  797   FSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVANGSY  976
             F+++LD SL+   D+  +  +TRV+VTRAD DMK IK EFK ++GV+L+++IG V NGSY
Sbjct  247   FTQLLDVSLKADADKKIKKVLTRVVVTRADNDMKEIKVEFKKQFGVSLAEKIGSVCNGSY  306

Query  977   KELLLTLVAKSE  1012
             K+ L+TL+A+S+
Sbjct  307   KDFLITLLARSD  318



>ref|XP_002267067.1| PREDICTED: annexin D4 isoform X1 [Vitis vinifera]
Length=313

 Score =   341 bits (874),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 179/310 (58%), Positives = 236/310 (76%), Gaps = 2/310 (1%)
 Frame = +2

Query  74   MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDH  253
            M   +D + LTKAFSG GVDE + VS+L KW+ +H +S+RK T +FF +DER FERWDDH
Sbjct  1    MDPPNDFEALTKAFSGFGVDEDSMVSILGKWHSEHLESFRKRTPKFFLEDERLFERWDDH  60

Query  254  HVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQ-FDLLIETACTRPSEELLGA  430
            H+  L +EFLR KD VV ++MHPWERDARL  EA+ K PQ + LLIE ACTR SEELLGA
Sbjct  61   HIACLTKEFLRFKDIVVQWIMHPWERDARLVHEAISKGPQAYGLLIEIACTRSSEELLGA  120

Query  431  RRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKH  610
            R+AY SLFD SI ED+A  ++  ERKLLVALVSSYRYEG +V+E +A+SEA  LA A+K+
Sbjct  121  RKAYQSLFDQSI-EDVASRLEGIERKLLVALVSSYRYEGLRVNEGIARSEAMTLAIAVKN  179

Query  611  AGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMPQ  790
               KN ++D+ IVRIL+TRSKLHL A+ K+YKEI GK +DEDL   + LK+T+QCLC PQ
Sbjct  180  VDKKNPIEDDAIVRILTTRSKLHLKAVVKYYKEIYGKNIDEDLDTLMSLKETLQCLCNPQ  239

Query  791  LYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVANG  970
             YFSK+L+ + +   DE  ++++TRVI+TR++ DMK I +EF  +Y V L+ +I +VA G
Sbjct  240  AYFSKVLNNAFKDDADENTKEALTRVIMTRSNVDMKEIIEEFDKQYKVPLTQKIEDVALG  299

Query  971  SYKELLLTLV  1000
            +YK+ L++L+
Sbjct  300  NYKDFLVSLI  309



>ref|XP_004157512.1| PREDICTED: LOW QUALITY PROTEIN: annexin D4-like [Cucumis sativus]
Length=318

 Score =   339 bits (870),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 175/312 (56%), Positives = 238/312 (76%), Gaps = 6/312 (2%)
 Frame = +2

Query  95    KILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVLQLRQ  274
             ++LT+A SG G++E A +  L KW+ + ++ +RK +  FF +DER FERW++H +  L+ 
Sbjct  7     EVLTRALSGHGINENAMIETLGKWDHEEKKLFRKKSSHFFSEDERSFERWEEHGMRLLKH  66

Query  275   EFLRLKDAVVLYMMHPWERDARLFKEALLKE---PQFDLLIETACTRPSEELLGARRAYH  445
             EF+R K+AVVL+  HPWERDARL KEAL K       ++LIE ACTR S+ELLGAR+AYH
Sbjct  67    EFMRFKNAVVLWTTHPWERDARLVKEALSKGHHGQNINILIEVACTRTSDELLGARKAYH  126

Query  446   SLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGNK-  622
             SLFDHSIEED+A H+  PERKLLVAL+S+YRYEGPK  ED+AKSEAK  A++IK A +K 
Sbjct  127   SLFDHSIEEDVASHLNGPERKLLVALMSAYRYEGPKYKEDIAKSEAKKFAHSIKEANSKK  186

Query  623   -NLVDDEEIVRILSTRSklhllalykhykEIT-GKFLDEDLHAHLLLKQTVQCLCMPQLY  796
              +L++DEEIVRILSTRSK  L AL+KHY EI+ G+ +DEDLH  L L++ V CL  P  Y
Sbjct  187   XSLIEDEEIVRILSTRSKHFLHALHKHYNEISAGRSIDEDLHGDLRLQEAVLCLTNPVKY  246

Query  797   FSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVANGSY  976
             F+++L+ SL+   D+  +  +TR++VTRAD DMK IK EFK ++G++L+++IG V NGSY
Sbjct  247   FTQLLNVSLKADADKKIKKVLTRIVVTRADNDMKEIKVEFKKQFGISLAEKIGSVCNGSY  306

Query  977   KELLLTLVAKSE  1012
             K+ L+TL+A+S+
Sbjct  307   KDFLITLLARSD  318



>gb|KCW65942.1| hypothetical protein EUGRSUZ_G03249 [Eucalyptus grandis]
Length=342

 Score =   340 bits (872),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 173/300 (58%), Positives = 228/300 (76%), Gaps = 3/300 (1%)
 Frame = +2

Query  116   SGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVLQLRQEFLRLKD  295
             SG GVDE   ++VL K +P+ R+++RK    FF++DER FERWDDH +  L++EF R K+
Sbjct  45    SGHGVDETTLIAVLGKSHPEKRKAFRKGNPHFFKEDERSFERWDDHRIKLLKREFSRFKN  104

Query  296   AVVLYMMHPWERDARLFKEALLKEP-QFDLLIETACTRPSEELLGARRAYHSLFDHSIEE  472
             AVVL+ MHPWERDARL KEAL + P  +++LIE ACTR SEELLGARRAYHSL++HSIEE
Sbjct  105   AVVLWAMHPWERDARLMKEALKEGPDSYNVLIEVACTRSSEELLGARRAYHSLYEHSIEE  164

Query  473   DIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGNKNLVDDEEIVR  652
             D+A H+  PER+LLVALVS+YRYEG K  ED AK+EAK + N IK    K   D+EE++R
Sbjct  165   DVASHVHGPERRLLVALVSAYRYEGTKPKEDNAKAEAKTILNVIKSGEKK--TDNEEVIR  222

Query  653   ILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMPQLYFSKILDASLRLG  832
             IL+TRSKL L A+YK Y+EI+G  LDEDL +   L++TVQCLC P+ YFS++LD +L + 
Sbjct  223   ILTTRSKLLLKAVYKDYQEISGSNLDEDLKSDSRLQETVQCLCTPERYFSQVLDLALEID  282

Query  833   VDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVANGSYKELLLTLVAKSE  1012
              D++ + ++TRVIVTRAD D+K I +EF   YGV L+ +I + ANG+YK+ LL L+AK +
Sbjct  283   ADKSTKKALTRVIVTRADVDVKEIDEEFNKMYGVRLTKKIEDTANGNYKDFLLRLIAKGD  342



>ref|XP_004142407.1| PREDICTED: annexin D4-like [Cucumis sativus]
 gb|KGN52303.1| Annexin 11 [Cucumis sativus]
Length=318

 Score =   337 bits (865),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 174/312 (56%), Positives = 238/312 (76%), Gaps = 6/312 (2%)
 Frame = +2

Query  95    KILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVLQLRQ  274
             ++LT+A SG G++E A +  L KW+ + ++ +RK +  FF +DER FERW++H +  L+ 
Sbjct  7     EVLTRALSGHGINENAMIETLGKWDHEEKKLFRKKSSHFFSEDERSFERWEEHGMRLLKH  66

Query  275   EFLRLKDAVVLYMMHPWERDARLFKEALLKE---PQFDLLIETACTRPSEELLGARRAYH  445
             EF+R K+AVVL+  HPWERDARL KEAL K       ++LIE ACTR S+ELLGAR+AYH
Sbjct  67    EFMRFKNAVVLWTTHPWERDARLVKEALSKGHHGQNINILIEVACTRTSDELLGARKAYH  126

Query  446   SLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGNK-  622
             SLFDHSIEED+A H+  PERKLLVAL+S+YRYEGPK  E++AKSEAK  A++IK A +K 
Sbjct  127   SLFDHSIEEDVASHLNGPERKLLVALMSAYRYEGPKYKEEIAKSEAKKFAHSIKEANSKK  186

Query  623   -NLVDDEEIVRILSTRSklhllalykhykEIT-GKFLDEDLHAHLLLKQTVQCLCMPQLY  796
              +L++DEEIVRILSTRSK  L AL+KHY EI+ G+ +DEDLH  L L++ V CL  P  Y
Sbjct  187   SSLIEDEEIVRILSTRSKHFLHALHKHYNEISAGRSIDEDLHGDLRLQEAVLCLTNPVKY  246

Query  797   FSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVANGSY  976
             F+++L+ SL+   D+  +  +TR++VTRAD DMK IK EFK ++G++L+++IG V NGSY
Sbjct  247   FTQLLNVSLKADADKKIKKVLTRIVVTRADNDMKEIKVEFKKQFGISLAEKIGSVCNGSY  306

Query  977   KELLLTLVAKSE  1012
             K+ L+TL+A+S+
Sbjct  307   KDFLITLLARSD  318



>ref|XP_002263771.1| PREDICTED: annexin D4-like isoform X1 [Vitis vinifera]
Length=312

 Score =   335 bits (859),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 177/310 (57%), Positives = 237/310 (76%), Gaps = 3/310 (1%)
 Frame = +2

Query  74   MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDH  253
            M   +D + LTKAFSG GVDE + VS+L KW+ +H +S+RK T +FF +DER FERWDDH
Sbjct  1    MDPPNDFEALTKAFSGFGVDEDSMVSILGKWHLEHLESFRKRTPKFFLEDERLFERWDDH  60

Query  254  HVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQ-FDLLIETACTRPSEELLGA  430
            H+  L +EF+R KD VV ++MHPWERDARL  EA+ K PQ + LLIE ACTR SEELLGA
Sbjct  61   HIACLTKEFMRFKDIVVQWIMHPWERDARLVHEAISKGPQAYGLLIEIACTRSSEELLGA  120

Query  431  RRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKH  610
            R+AY SLFD SI ED+A  ++  ERKLLVALVSSYRYEG +V+E +A+SEA  LA A+K+
Sbjct  121  RKAYQSLFDQSI-EDVASRLEGIERKLLVALVSSYRYEGLRVNEGIARSEAMTLAIAVKN  179

Query  611  AGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMPQ  790
              +KN ++D+ IVRIL+TRSKLHL A+ K+YKEI GK +DEDL   + LK+T+QCLC PQ
Sbjct  180  V-DKNPIEDDAIVRILTTRSKLHLKAVVKYYKEIFGKNIDEDLDTLMSLKETLQCLCNPQ  238

Query  791  LYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVANG  970
             YFSK+L+ + +   DE  ++++TRVI+TR++ DMK I +EF  +Y + L+ +I +VA G
Sbjct  239  AYFSKVLNNAFKDDADENTKEALTRVIMTRSNVDMKEIIEEFDKQYKIPLTQKIEDVALG  298

Query  971  SYKELLLTLV  1000
            +YK+ L++L+
Sbjct  299  NYKDFLVSLI  308



>ref|XP_010670442.1| PREDICTED: annexin D4 [Beta vulgaris subsp. vulgaris]
Length=312

 Score =   332 bits (852),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 177/313 (57%), Positives = 234/313 (75%), Gaps = 6/313 (2%)
 Frame = +2

Query  80    VSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHV  259
             +S +H  LTKAFSGLGVDEKA +S++  W    + S+RK++   F  DERQFE+W++  V
Sbjct  4     LSHEHGALTKAFSGLGVDEKALISIVGNWQHDQKHSFRKASPHHFLADERQFEKWNEQQV  63

Query  260   LQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQ-FDLLIETACTRPSEELLGARR  436
               ++ E LR K AVVL+ MHPWERDARLFKEAL K P  + L+IE ACTR SEELLGAR+
Sbjct  64    ELIKHEVLRFKSAVVLWTMHPWERDARLFKEALTKGPDGYSLIIEVACTRSSEELLGARK  123

Query  437   AYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAG  616
             AYHSLFD S+EED+A H+   ERKLLVALVS+YRYEG +VH++ AKSEA+ L +AIK   
Sbjct  124   AYHSLFDSSVEEDVASHVHGHERKLLVALVSAYRYEGSRVHDESAKSEAEALHHAIK---  180

Query  617   NKNL-VDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMPQL  793
              KNL V+DEE+VRILSTRSKLHL A++ HYKE+ GK LDE+ H    LK  +QCL +P++
Sbjct  181   -KNLPVEDEEVVRILSTRSKLHLKAIFSHYKELFGKDLDEEFHGFWSLKVALQCLVIPEV  239

Query  794   YFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVANGS  973
             YFS++LD +LR G +E  ++++TRVIV++AD  MK I+  +  ++G  LS +I E   G+
Sbjct  240   YFSEVLDVALRKGANEFTQEALTRVIVSQADVYMKEIQAVYYKRFGANLSQKIEETCLGN  299

Query  974   YKELLLTLVAKSE  1012
             +K+ LLTLVA+ +
Sbjct  300   FKDFLLTLVARGD  312



>ref|XP_010095948.1| Annexin D4 [Morus notabilis]
 gb|EXB62641.1| Annexin D4 [Morus notabilis]
Length=338

 Score =   330 bits (847),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 183/315 (58%), Positives = 234/315 (74%), Gaps = 6/315 (2%)
 Frame = +2

Query  74   MAVSDDHKILTKAFS---GLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERW  244
            MA+SD  + L+KAFS   GLGVDEK+ +  L KW  + R+S+ K+    F  DER FER 
Sbjct  1    MALSDVVQNLSKAFSDECGLGVDEKSLIENLGKWKAEERKSFWKANRNCFVQDERLFERC  60

Query  245  DDHHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQ---FDLLIETACTRPSE  415
            D+ HV +L +EFLR K AVVL  MHPWERDARL K AL          +LIE ACTR S+
Sbjct  61   DEDHVKRLEKEFLRFKGAVVLRAMHPWERDARLVKRALKNGSSPGSLGVLIEIACTRSSD  120

Query  416  ELLGARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLA  595
            ELLGARRAYHSLFD SIEED A HI+ PERKLLVAL+S+YRYEGPKV +D  KS+ K LA
Sbjct  121  ELLGARRAYHSLFDRSIEEDAAHHIKGPERKLLVALLSAYRYEGPKVKDDNVKSDVKELA  180

Query  596  NAIKHAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQC  775
            NAIK+A  K+L+ D+E++RILSTRS+ HL  +Y  Y + +GK LDED+ A   L++TVQC
Sbjct  181  NAIKNADKKSLLQDDEVIRILSTRSRAHLKEVYDQYHKNSGKNLDEDIGADSRLQETVQC  240

Query  776  LCMPQLYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIG  955
            LC+PQ YF+K+LDA+L+   D+ A+ ++TRVIVTRAD DMK I++EF+ +YGV+LS +I 
Sbjct  241  LCVPQKYFTKVLDAALKKDADKKAKKALTRVIVTRADADMKQIREEFQNQYGVSLSKKIE  300

Query  956  EVANGSYKELLLTLV  1000
            + ANG+YK+ LL L+
Sbjct  301  DAANGNYKDFLLALL  315



>emb|CAN71385.1| hypothetical protein VITISV_016099 [Vitis vinifera]
Length=494

 Score =   334 bits (856),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 177/306 (58%), Positives = 231/306 (75%), Gaps = 2/306 (1%)
 Frame = +2

Query  74   MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDH  253
            M   +D + LTKAFSG GVDE + VS+L KW+ +H +S+RK T +FF +DER FERWDDH
Sbjct  1    MDPPNDFEALTKAFSGFGVDEDSMVSILGKWHSEHLESFRKRTPKFFLEDERLFERWDDH  60

Query  254  HVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQ-FDLLIETACTRPSEELLGA  430
            H+  L +EFLR KD VV ++MHPWERDARL  EA+ K PQ + LLIE ACTR SEELLGA
Sbjct  61   HIACLTKEFLRFKDIVVQWIMHPWERDARLVHEAISKGPQAYGLLIEIACTRSSEELLGA  120

Query  431  RRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKH  610
            R+AY SLFD SI ED+A  ++  E KLLVALVSSYRYEG +V+E +A+SEA  LA A+K+
Sbjct  121  RKAYQSLFDQSI-EDVASRLEGIEXKLLVALVSSYRYEGLRVNEGIARSEAMTLAIAVKN  179

Query  611  AGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMPQ  790
               KN ++D+ IVRIL+TRSKLHL A+ K+YKEI GK +DEDL   + LK+T+QCLC PQ
Sbjct  180  VDKKNPIEDDAIVRILTTRSKLHLKAVVKYYKEIYGKNIDEDLDTLMSLKETLQCLCNPQ  239

Query  791  LYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVANG  970
             YFSK+L+ + +   DE  ++++TRVI+TR++ DMK I +EF  +Y V L+ +I +VA G
Sbjct  240  AYFSKVLNNAFKDDADENTKEALTRVIMTRSNVDMKEIIEEFDKQYKVPLTQKIEDVALG  299

Query  971  SYKELL  988
            +YK+ L
Sbjct  300  NYKDFL  305



>ref|XP_010646005.1| PREDICTED: annexin D4-like [Vitis vinifera]
Length=531

 Score =   331 bits (849),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 178/331 (54%), Positives = 240/331 (73%), Gaps = 5/331 (2%)
 Frame = +2

Query  11   RQPYMSVSMTAPTLNSANSSKMAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSY  190
            RQP     M A       ++K+   +D + LTKAFSG GVDE + VS+L KW+ +H +S+
Sbjct  201  RQPD---GMAAAADFRIKTTKIDPPNDFEALTKAFSGFGVDEDSMVSILGKWHSEHLESF  257

Query  191  RKSTHQFFRDDERQFERWDDHHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEP  370
            RK T +FF +DER FERWDDHH+  L +EFLR KD VV ++MHPWERDARL  EA+ K P
Sbjct  258  RKRTPKFFLEDERLFERWDDHHIACLTKEFLRFKDIVVQWIMHPWERDARLVHEAISKGP  317

Query  371  Q-FDLLIETACTRPSEELLGARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEG  547
            Q + LLIE ACTR SEELLGAR+AY SLFD SI ED+A  ++  +RKLLVALVSSYRYEG
Sbjct  318  QAYGLLIEIACTRSSEELLGARKAYQSLFDQSI-EDVASRLEGIKRKLLVALVSSYRYEG  376

Query  548  PKVHEDVAKSEAKVLANAIKHAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFL  727
             +V+E +A+ EA  LA  +K+   KN ++D+ IVRIL+TRSK HL A+ K+YK+I GK +
Sbjct  377  LRVNEGIARLEAMTLAIVVKNVDKKNPIEDDGIVRILTTRSKFHLKAVVKYYKKIYGKNI  436

Query  728  DEDLHAHLLLKQTVQCLCMPQLYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIK  907
            DEDL   + LK+T+QCLC PQ YFSK+L+ + +   DE  ++++TRVI+T ++ DMK I 
Sbjct  437  DEDLDTLMSLKETLQCLCNPQSYFSKVLNNAFKDDADENTKEALTRVIMTWSNVDMKEII  496

Query  908  QEFKTKYGVALSDRIGEVANGSYKELLLTLV  1000
            +EF  +Y V L+ +I +VA G+YK+ L++L+
Sbjct  497  EEFDKQYKVPLTQKIEDVALGNYKDFLVSLI  527



>ref|XP_002264833.1| PREDICTED: annexin D4-like [Vitis vinifera]
Length=312

 Score =   322 bits (826),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 173/310 (56%), Positives = 232/310 (75%), Gaps = 3/310 (1%)
 Frame = +2

Query  74   MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDH  253
            M   +D + LT+AFSG GVDE +  S+L KW+ +H +S+RK T +FF +DER FERWDDH
Sbjct  1    MDPPNDFEALTEAFSGFGVDEDSMASILGKWHLEHLESFRKRT-KFFLEDERLFERWDDH  59

Query  254  HVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQ-FDLLIETACTRPSEELLGA  430
            H+  L +EFLR KD VV ++MHPWERDARL  EA+ K PQ + LLIE ACTR SEELLGA
Sbjct  60   HIGCLTKEFLRFKDIVVQWIMHPWERDARLVHEAITKGPQAYGLLIEIACTRSSEELLGA  119

Query  431  RRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKH  610
            R+AY SLF+ SI ED+A  ++  E KLLVALVSSYRYEG +V++  A+SEA  LA A+K+
Sbjct  120  RKAYQSLFNQSI-EDVASRLEGIECKLLVALVSSYRYEGSRVNDGTARSEATTLAIAVKN  178

Query  611  AGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMPQ  790
               KN ++D+ IVRIL+TRSKLHL A+ K+YKEI GK +DEDL   + LK+T+QCLC PQ
Sbjct  179  VDKKNPIEDDGIVRILTTRSKLHLKAVVKYYKEIYGKNIDEDLDTLMSLKETLQCLCNPQ  238

Query  791  LYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVANG  970
             +FSK+L+ + +   DE  ++++TRVIVTR + DMK I +EF  +Y + L+ +I +VA G
Sbjct  239  AHFSKVLNDAFKDDADENTKEALTRVIVTRFNVDMKEIIEEFDKQYKIPLTQKIEDVALG  298

Query  971  SYKELLLTLV  1000
            +YK+ L++L+
Sbjct  299  NYKDFLVSLI  308



>ref|XP_007011154.1| Annexin 4, putative [Theobroma cacao]
 gb|EOY19964.1| Annexin 4, putative [Theobroma cacao]
Length=323

 Score =   320 bits (819),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 168/318 (53%), Positives = 228/318 (72%), Gaps = 21/318 (7%)
 Frame = +2

Query  98    ILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVLQLRQE  277
             +L+KA SG+GVDEK+ VS+L K + +H++S R+   QFF +DERQFERW+D  +  L+ E
Sbjct  9     VLSKALSGIGVDEKSLVSILNKSHHEHKRSIRRGCSQFFFEDERQFERWNDDAIKTLKGE  68

Query  278   FLRLKDAVVLYMMHPWERDARLFKEALLKEPQ-FDLLIETACTRPSEELLGARRAYHSLF  454
             F R KDAVVL +MHPWERDARL K+AL K PQ + +++E ACTR SE+LLGAR+AYHSLF
Sbjct  69    FKRFKDAVVLSLMHPWERDARLLKKALKKGPQQYGVIVEIACTRSSEQLLGARKAYHSLF  128

Query  455   DHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGNKNLVD  634
             + SIEED+A HI+  ERKLLVALVS+YRYEGPKV ED AKSEAK L NAIK+A  + L++
Sbjct  129   ERSIEEDLAAHIKGSERKLLVALVSAYRYEGPKVKEDTAKSEAKALLNAIKNADKRRLIE  188

Query  635   DEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMPQLYFSK---  805
             DEE++RIL+TRSK HL  +Y+ YK+I+GK + ED  A L LK+T++CLC P  YF+K   
Sbjct  189   DEEVIRILTTRSKPHLKEVYEQYKKISGKSITEDFEAELFLKETIECLCTPHTYFTKQEN  248

Query  806   ---------ILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGE  958
                      + D +LR+  +E A+ ++TR+I T+     K +     TK+   + DR+  
Sbjct  249   LSIDCLSFQVFDTALRVDANEDAKKALTRLITTQEAGYFKGV----STKFAHKIEDRV--  302

Query  959   VANGSYKELLLTLVAKSE  1012
                G+YKE+LL ++A+ E
Sbjct  303   --KGAYKEVLLGVLARGE  318



>ref|XP_002264596.1| PREDICTED: annexin D4-like [Vitis vinifera]
Length=306

 Score =   315 bits (808),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 174/310 (56%), Positives = 228/310 (74%), Gaps = 9/310 (3%)
 Frame = +2

Query  74   MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDH  253
            M   +D + LTKAFSGLGVD     SVL KW+ +H +S+RK T +FF DDER FERWDDH
Sbjct  1    MDPPNDFEALTKAFSGLGVDGDLIASVLGKWHSEHLESFRKRT-KFFLDDERLFERWDDH  59

Query  254  HVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQ-FDLLIETACTRPSEELLGA  430
            H+  L +EFLR KD VV ++MHPWERDARL  EA+ K PQ + LLIE ACTR SEELL A
Sbjct  60   HIACLTKEFLRFKDIVVQWIMHPWERDARLVHEAITKGPQAYGLLIEIACTRSSEELLEA  119

Query  431  RRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKH  610
            R+AY SLFD SI+ D+A       RKLLVALVSSY+YEG +V+E  A+S+A   A A+K+
Sbjct  120  RKAYQSLFDQSIK-DVA------SRKLLVALVSSYKYEGFRVNEGTARSKAMTFAIAVKN  172

Query  611  AGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMPQ  790
               KN ++D+ IVRIL+TRSKLHL A+ K+YKEI GK +DEDL   + LK+T+QCLC PQ
Sbjct  173  IDKKNPIEDDGIVRILTTRSKLHLKAMVKYYKEIYGKNIDEDLDTLMSLKETLQCLCNPQ  232

Query  791  LYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVANG  970
             YFSK+L+ + +  VD+  ++++TRVIVTR++ DMK I +EF  +Y + L  +I +VA G
Sbjct  233  AYFSKVLNDAFKDDVDKNTKEALTRVIVTRSNVDMKEIIEEFDKQYKIPLIQKIEDVALG  292

Query  971  SYKELLLTLV  1000
            +YK+ L++L+
Sbjct  293  NYKDFLVSLI  302



>ref|XP_010247046.1| PREDICTED: annexin D4-like isoform X2 [Nelumbo nucifera]
Length=287

 Score =   312 bits (799),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 166/313 (53%), Positives = 224/313 (72%), Gaps = 26/313 (8%)
 Frame = +2

Query  74    MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDH  253
             MA+  D   LTKAFSG GVDE + +S+L KW+P+ R+S+RK   QFFR+D+R FERWD+ 
Sbjct  1     MALPGDLDALTKAFSGFGVDENSIISILGKWHPEQRKSFRKGFPQFFREDKRLFERWDER  60

Query  254   HVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFDLLIETACTRPSEELLGAR  433
             H+  L  EFLR K+A+VL+ +HPWERDARL KEAL K   +D+L+E ACTR SEELLGAR
Sbjct  61    HIAFLEHEFLRFKNAMVLWTLHPWERDARLAKEALAK-GDYDILVEIACTRSSEELLGAR  119

Query  434   RAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHA  613
             RAYHSLFDHSIEED+A+ +    R LLVALVSSYRYEG +V+E++A++EAK L+ AIK+A
Sbjct  120   RAYHSLFDHSIEEDVAYSVNDSNRNLLVALVSSYRYEGARVNEEIAETEAKTLSEAIKNA  179

Query  614   GNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMPQL  793
               K  +++EE+VRI++TRSKLHL A++ +YKEI+G   +E                    
Sbjct  180   -EKRPIENEEVVRIITTRSKLHLKAVFNYYKEISGTTTEE--------------------  218

Query  794   YFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVANGS  973
                 IL ++L+   DE  + ++TRVIVT+AD  MK I +E+  ++GV+LS +I E  NG+
Sbjct  219   ----ILASALKGSADEKNKQALTRVIVTQADSYMKEISEEYHKQHGVSLSQKIEETTNGN  274

Query  974   YKELLLTLVAKSE  1012
             YK+ LLTLVA+ +
Sbjct  275   YKDFLLTLVARGD  287



>ref|XP_007011162.1| Annexin 4, putative [Theobroma cacao]
 gb|EOY19972.1| Annexin 4, putative [Theobroma cacao]
Length=336

 Score =   309 bits (791),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 167/328 (51%), Positives = 235/328 (72%), Gaps = 14/328 (4%)
 Frame = +2

Query  32    SMTAPTLNSANSSKMAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQF  211
             ++   TL+  +  +MA   D + L KAFSG+GVDE + +S+LA  N +H++S RK   +F
Sbjct  21    TLKFSTLHYRDHQRMA---DLEALIKAFSGIGVDENSLISILANSNHEHKKSLRKGYSKF  77

Query  212   FRDDERQFERWDDHHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQ-FDLLI  388
             F +DE  FER     +  L+ EF R +DAVVL ++HPWERDARL ++A+ K P+ + +++
Sbjct  78    FIEDENGFERLHQSTIKNLKLEFKRFRDAVVLSLLHPWERDARLIEKAMKKGPRHYSVIV  137

Query  389   ETACTRPSEELLGARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDV  568
             E ACTR S ELLGAR+AYHSLFDHSIEED+A HI+  ERKLLVALVS+YRYEGPKV++DV
Sbjct  138   EIACTRSSNELLGARKAYHSLFDHSIEEDLASHIKGSERKLLVALVSAYRYEGPKVNDDV  197

Query  569   AKSEAKVLANAIKHAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAH  748
             AKSEA++L+NAIK+A  +  ++DE+ + ILSTRSK HL A+Y+HY +I GK + EDL A 
Sbjct  198   AKSEAEILSNAIKNADKRKPIEDEDAIMILSTRSKPHLQAVYEHYNKICGKTITEDLEAE  257

Query  749   LLLKQTVQCLCMPQLYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKY  928
              +LK TV+CLC P  YF+++LDA+L +  DE ++ ++TRVIVT         ++E + K 
Sbjct  258   GILKDTVECLCTPATYFTRVLDAALTVDADEESKKALTRVIVT---------QKELREKE  308

Query  929   GVALSDRIGEVANGSYKELLLTLVAKSE  1012
             G  + ++I  +  GSYK+ +L LVA+ E
Sbjct  309   GY-VPNKIQGILTGSYKDFILGLVARGE  335



>ref|XP_008246073.1| PREDICTED: annexin D4-like, partial [Prunus mume]
Length=251

 Score =   295 bits (754),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 152/241 (63%), Positives = 194/241 (80%), Gaps = 1/241 (0%)
 Frame = +2

Query  290   KDAVVLYMMHPWERDARLFKEALLKEPQ-FDLLIETACTRPSEELLGARRAYHSLFDHSI  466
             ++AVVL+ MH WERDARL KEAL K PQ + +L+E ACTR +EELLGAR+AYHSLFDHSI
Sbjct  10    QNAVVLWTMHSWERDARLVKEALKKGPQTYSVLVEIACTRSAEELLGARKAYHSLFDHSI  69

Query  467   EEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGNKNLVDDEEI  646
             EED+A+HI  PE KLLVALVS+YRYEGPKV +D AKSEAK LA+AIK+A  +N ++D+E+
Sbjct  70    EEDVAYHIDGPEGKLLVALVSAYRYEGPKVKDDTAKSEAKTLAHAIKNADKRNPIEDDEV  129

Query  647   VRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMPQLYFSKILDASLR  826
             +RILSTRSK HL  +YKHY+EI+G  +DEDL   L LK+TVQ LC P  YFS++L+ SLR
Sbjct  130   IRILSTRSKPHLKEIYKHYQEISGHNIDEDLDDALRLKETVQSLCTPHTYFSQVLEVSLR  189

Query  827   LGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVANGSYKELLLTLVAK  1006
              GVD+  +  +TRVIVTRAD DMK IK+E++  YGV+L+++I   ANG++K+ LLTL A+
Sbjct  190   NGVDKNIKKGLTRVIVTRADADMKEIKEEYQNLYGVSLTEKIEATANGNFKDFLLTLAAR  249

Query  1007  S  1009
              
Sbjct  250   G  250



>gb|EPS63392.1| hypothetical protein M569_11393, partial [Genlisea aurea]
Length=247

 Score =   292 bits (748),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 154/247 (62%), Positives = 192/247 (78%), Gaps = 2/247 (1%)
 Frame = +2

Query  74   MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDH  253
            MA +DD   LT+AFSGLGVDEKA +S+L + +  HR+  RK +  FF +DERQFERW++ 
Sbjct  1    MASTDDLHSLTRAFSGLGVDEKALISLLGRSHSDHRRQLRKVSRDFFTEDERQFERWNER  60

Query  254  HVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFDLLIETACTRPSEELLGAR  433
            H+LQLRQEFLR+K+A+VLY+MHPWERDARL KEAL K+ Q+ +LIE A TR SEELLGAR
Sbjct  61   HILQLRQEFLRVKEAIVLYLMHPWERDARLIKEALHKDIQYSVLIEVAGTRSSEELLGAR  120

Query  434  RAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHA  613
            RAYHSLF+ SIEED+ FHI+ P  KL + L+SSYRYEGPKV+E+ AKSEAK ++ A+K A
Sbjct  121  RAYHSLFERSIEEDVLFHIRGPYAKLFLGLLSSYRYEGPKVNEESAKSEAKSISEAVKGA  180

Query  614  G--NKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMP  787
                K L++ E+IVRILSTRSK HL  +Y HYKEITG  LDEDL +   LK+ VQCL  P
Sbjct  181  SPHGKVLIEAEDIVRILSTRSKPHLKVVYHHYKEITGHNLDEDLASDAHLKEAVQCLITP  240

Query  788  QLYFSKI  808
            + YF ++
Sbjct  241  RTYFVEV  247



>ref|XP_007011150.1| RNA-directed DNA polymerase, putative [Theobroma cacao]
 gb|EOY19960.1| RNA-directed DNA polymerase, putative [Theobroma cacao]
Length=2200

 Score =   318 bits (816),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 163/299 (55%), Positives = 222/299 (74%), Gaps = 9/299 (3%)
 Frame = +2

Query  119   GLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVLQLRQEFLRLKDA  298
             G+GVDEK+ VS+L K + +H++S R+   QFF +DERQFERW+D  +  L+ EF R KDA
Sbjct  1905  GIGVDEKSLVSILTKSHHEHKRSIRRGCSQFFFEDERQFERWNDDAIKTLKGEFKRFKDA  1964

Query  299   VVLYMMHPWERDARLFKEALLKEPQ-FDLLIETACTRPSEELLGARRAYHSLFDHSIEED  475
             VVL +MHPWERDARL K+AL K PQ + +++E ACTR SE+LLGAR+AYHSLF+ SIEED
Sbjct  1965  VVLSLMHPWERDARLLKKALKKGPQQYGVIVEIACTRSSEQLLGARKAYHSLFERSIEED  2024

Query  476   IAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGNKNLVDDEEIVRI  655
             +A HI+  ERKLLVALVS+YRYEGPKV ED AKSEAK L NAIK+A  + L++DEE++RI
Sbjct  2025  LAAHIKDSERKLLVALVSAYRYEGPKVKEDTAKSEAKALLNAIKNADKRRLIEDEEVIRI  2084

Query  656   LSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMPQLYFSKILDASLRLGV  835
             L+TRSK HL  +Y+ YK+I+GK + ED  A L LK+TV+CLC P  YF+K+ D +LR+  
Sbjct  2085  LTTRSKPHLKEVYEQYKKISGKSITEDFEAELFLKETVECLCTPHTYFTKVFDTALRVDA  2144

Query  836   DEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVANGSYKELLLTLVAKSE  1012
             +E A+ ++TR+I T+   + K +  +F        + +I E   G+YK++LL ++A+ E
Sbjct  2145  NEDAKKALTRLITTQEAGNFKGVSAKF--------AHKIEERVKGAYKDVLLGVLARGE  2195



>ref|XP_010938586.1| PREDICTED: annexin D4 [Elaeis guineensis]
Length=318

 Score =   291 bits (746),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 157/313 (50%), Positives = 219/313 (70%), Gaps = 6/313 (2%)
 Frame = +2

Query  83    SDDHKILTKAFSGLG---VDEKAFVSVLAKW--NPKHRQSYRKSTHQFFRDDERQFERWD  247
             +++ + +T+AFSGLG   VDE+A VS L KW   P+ R   RKS   FF  D   FER++
Sbjct  7     AEECEAITRAFSGLGGLGVDEEALVSALGKWRHQPEKRAQLRKSFAGFFTAD-GGFERFE  65

Query  248   DHHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFDLLIETACTRPSEELLG  427
             D ++  L+ EF R K+ +VL+ MHPWERDAR   + L K   FD+++E ACTR SEELLG
Sbjct  66    DDYIHYLKIEFARFKNIMVLWAMHPWERDARWANDVLHKAHPFDIIVEIACTRSSEELLG  125

Query  428   ARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIK  607
             AR AYH+LF  S+EED+A+H++     LLV LVS+YRYEG  ++E++AKSEAK L  AIK
Sbjct  126   ARIAYHALFHRSLEEDVAYHVRENFSNLLVGLVSAYRYEGDSINEEMAKSEAKTLGTAIK  185

Query  608   HAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMP  787
              AG +NLV++ E++RIL+TRSK HL   +K+Y+E+ GK ++EDL   L L++TVQCL  P
Sbjct  186   SAGVRNLVENGEVIRILTTRSKPHLRVTFKYYREMYGKSIEEDLGDELCLQETVQCLDSP  245

Query  788   QLYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVAN  967
               YFSK++D +L+ G D+  +D++TRVIV+RAD DM+ IK  +  +YG  L D I     
Sbjct  246   PKYFSKVMDETLKDGADKNTKDALTRVIVSRADVDMEEIKAAYHEQYGAQLEDVIAMKTL  305

Query  968   GSYKELLLTLVAK  1006
             G+Y++ LL+LV +
Sbjct  306   GNYRDALLSLVGQ  318



>gb|KCW65941.1| hypothetical protein EUGRSUZ_G03249 [Eucalyptus grandis]
Length=283

 Score =   290 bits (742),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 149/247 (60%), Positives = 191/247 (77%), Gaps = 3/247 (1%)
 Frame = +2

Query  74   MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDH  253
            MA SD+ + LTKAFSG GVDE   ++VL K +P+ R+++RK    FF++DER FERWDDH
Sbjct  18   MAQSDELEALTKAFSGHGVDETTLIAVLGKSHPEKRKAFRKGNPHFFKEDERSFERWDDH  77

Query  254  HVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEP-QFDLLIETACTRPSEELLGA  430
             +  L++EF R K+AVVL+ MHPWERDARL KEAL + P  +++LIE ACTR SEELLGA
Sbjct  78   RIKLLKREFSRFKNAVVLWAMHPWERDARLMKEALKEGPDSYNVLIEVACTRSSEELLGA  137

Query  431  RRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKH  610
            RRAYHSL++HSIEED+A H+  PER+LLVALVS+YRYEG K  ED AK+EAK + N IK 
Sbjct  138  RRAYHSLYEHSIEEDVASHVHGPERRLLVALVSAYRYEGTKPKEDNAKAEAKTILNVIKS  197

Query  611  AGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMPQ  790
               K   D+EE++RIL+TRSKL L A+YK Y+EI+G  LDEDL +   L++TVQCLC P+
Sbjct  198  GEKK--TDNEEVIRILTTRSKLLLKAVYKDYQEISGSNLDEDLKSDSRLQETVQCLCTPE  255

Query  791  LYFSKIL  811
             YFS+++
Sbjct  256  RYFSQVI  262



>ref|XP_010554473.1| PREDICTED: annexin D4-like [Tarenaya hassleriana]
Length=325

 Score =   290 bits (743),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 158/315 (50%), Positives = 219/315 (70%), Gaps = 3/315 (1%)
 Frame = +2

Query  74    MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDH  253
             M VS D ++L+ A SGLGVDEK+ VS+L   + +HR+S+RK   +FF +DER FER +D 
Sbjct  1     MDVSLDLEVLSNAISGLGVDEKSLVSILGNSHLEHRRSFRKENPKFFVEDERGFERCEDQ  60

Query  254   HVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQ-FDLLIETACTRPSEELLGA  430
              ++ L+QEF R  +AV ++ MH WERDAR+ K+AL K P+ ++L++E  CTR S ELLGA
Sbjct  61    FLMHLKQEFTRFNNAVAMWTMHAWERDARMVKKALEKGPKSYNLIVEVTCTRSSHELLGA  120

Query  431   RRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKH  610
             RRAYHSLFD S+EED+A H+  P RKLLV LVS+YRYEG +V+E  AKSEA+ LA  I  
Sbjct  121   RRAYHSLFDRSMEEDVASHVHGPPRKLLVGLVSAYRYEGNRVNEKTAKSEAEALAETIGR  180

Query  611   AGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMPQ  790
              G+   ++++E+VRIL+TRSKLHL  ++  Y EI+   + ED     +L  T  CL  P 
Sbjct  181   EGHL-AIENDELVRILTTRSKLHLRHVFDLYSEISRAEIAEDATGSSVLSDTFLCLSRPS  239

Query  791   LYFSKILDASLRLGVDEAARDSVTRVIVTRADE-DMKHIKQEFKTKYGVALSDRIGEVAN  967
              YFSK+LD SL    D+ A+  +TRVIVTRAD  DM+   +E+   +G +L+++I     
Sbjct  240   AYFSKLLDESLSEEADKKAKKWLTRVIVTRADHADMRETIEEYHRLFGQSLAEKIETRTK  299

Query  968   GSYKELLLTLVAKSE  1012
             G+YK+ LLTL+A+S+
Sbjct  300   GNYKDFLLTLLARSD  314



>ref|XP_006293497.1| hypothetical protein CARUB_v10023562mg, partial [Capsella rubella]
 gb|EOA26395.1| hypothetical protein CARUB_v10023562mg, partial [Capsella rubella]
Length=342

 Score =   291 bits (745),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 168/341 (49%), Positives = 232/341 (68%), Gaps = 8/341 (2%)
 Frame = +2

Query  11    RQPYMSVSMTAPTLNSANSSKMAVSDDHKILTKAFSG---LGVDEKAFVSVLAKWNPKHR  181
             ++P  S         SA   KMA+  D + LT+A SG   +GVDE A +S L K +  HR
Sbjct  3     QKPNQSREEKKRKTKSARRRKMALPLDLESLTEALSGNLGMGVDENALISKLGKSHKDHR  62

Query  182   QSYRKSTHQFF-RDDERQFERWDDHHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEAL  358
             + +RK++  FF  D+ER FE+  DH V  L+ EF R  +AVV++ MHPWERDARL K+AL
Sbjct  63    KLFRKASKSFFVEDEERAFEKCHDHFVRHLKLEFSRFNNAVVMWAMHPWERDARLVKKAL  122

Query  359   LK-EPQFDLLIETACTRPSEELLGARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSY  535
              K E  ++L++E +CTR +E+LLGAR+AYHSLFD S+EEDIA H+  P RKLLV LVS+Y
Sbjct  123   KKGEEAYNLIVEVSCTRSAEDLLGARKAYHSLFDQSMEEDIASHVHGPHRKLLVGLVSAY  182

Query  536   RYEGPKVHEDVAKSEAKVLANAIKHAGNKNLVDDEEIVRILSTRSklhllalykhykEIT  715
             RYEG KV +D AKSEAK LA A+  +G++ +V+ +E+VRIL+TRSKLHL  +Y H+ +I 
Sbjct  183   RYEGNKVKDDSAKSEAKFLAEAVASSGDE-VVEKDEVVRILTTRSKLHLQHVYNHFNDIK  241

Query  716   GKFLDEDLHAHLLLKQTVQCLCMPQLYFSKILDASLRLGVDEAARDSVTRVIVTRAD--E  889
             G  L   +    LL + + CL  P +YFSKILDASL    D+  +  +TRV+VTRAD  +
Sbjct  242   GSDLLGGVSHSSLLNEALICLLKPAVYFSKILDASLNKDADKTTKKWLTRVLVTRADHSD  301

Query  890   DMKHIKQEFKTKYGVALSDRIGEVANGSYKELLLTLVAKSE  1012
             ++K IK+E+   YG  L+ RI +   G+Y++ LLTL++KS+
Sbjct  302   EIKDIKEEYNNLYGETLAQRIQDKIKGNYRDFLLTLLSKSD  342



>ref|NP_181409.1| annexin D4 [Arabidopsis thaliana]
 sp|Q9ZVJ6.1|ANXD4_ARATH RecName: Full=Annexin D4; AltName: Full=AnnAt4 [Arabidopsis thaliana]
 gb|AAF14581.1|AF188363_1 AnnAt4 [Arabidopsis thaliana]
 gb|AAC67343.1| putative annexin [Arabidopsis thaliana]
 gb|AAK68775.1| putative annexin [Arabidopsis thaliana]
 gb|AAM10045.1| putative annexin [Arabidopsis thaliana]
 gb|AAM64750.1| putative annexin [Arabidopsis thaliana]
 gb|AEC09580.1| annexin D4 [Arabidopsis thaliana]
Length=319

 Score =   290 bits (742),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 166/320 (52%), Positives = 223/320 (70%), Gaps = 8/320 (3%)
 Frame = +2

Query  74    MAVSDDHKILTKAFS---GLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFF-RDDERQFER  241
             MA+  + + LT+A S   G+GVDE A +S L K   +HR+ +RK++  FF  D+ER FE+
Sbjct  1     MALPLELESLTEAISAGMGMGVDENALISTLGKSQKEHRKLFRKASKSFFVEDEERAFEK  60

Query  242   WDDHHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLK-EPQFDLLIETACTRPSEE  418
               DH V  L+ EF R   AVV++ MHPWERDARL K+AL K E  ++L++E +CTR +E+
Sbjct  61    CHDHFVRHLKLEFSRFNTAVVMWAMHPWERDARLVKKALKKGEEAYNLIVEVSCTRSAED  120

Query  419   LLGARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLAN  598
             LLGAR+AYHSLFD S+EEDIA H+  P+RKLLV LVS+YRYEG KV +D AKS+AK+LA 
Sbjct  121   LLGARKAYHSLFDQSMEEDIASHVHGPQRKLLVGLVSAYRYEGNKVKDDSAKSDAKILAE  180

Query  599   AIKHAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCL  778
             A+  +G +  V+ +E+VRIL+TRSKLHL  LYKH+ EI G  L   +    LL + + CL
Sbjct  181   AVASSG-EEAVEKDEVVRILTTRSKLHLQHLYKHFNEIKGSDLLGGVSKSSLLNEALICL  239

Query  779   CMPQLYFSKILDASLRLGVDEAARDSVTRVIVTRAD--EDMKHIKQEFKTKYGVALSDRI  952
               P LYFSKILDASL    D+  +  +TRV VTRAD  ++M  IK+E+   YG  L+ RI
Sbjct  240   LKPALYFSKILDASLNKDADKTTKKWLTRVFVTRADHSDEMNEIKEEYNNLYGETLAQRI  299

Query  953   GEVANGSYKELLLTLVAKSE  1012
              E   G+Y++ LLTL++KS+
Sbjct  300   QEKIKGNYRDFLLTLLSKSD  319



>ref|XP_010523386.1| PREDICTED: annexin D4-like [Tarenaya hassleriana]
Length=314

 Score =   289 bits (740),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 161/315 (51%), Positives = 223/315 (71%), Gaps = 3/315 (1%)
 Frame = +2

Query  74    MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDH  253
             M V  D + L+ A SG+GVDEK+ VS+L  ++ +HR+++R++   FF +DER FER +DH
Sbjct  1     MNVFLDLEALSNALSGMGVDEKSLVSILGNFHVEHRRTFRRANPSFFVEDERDFERCEDH  60

Query  254   HVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLK-EPQFDLLIETACTRPSEELLGA  430
              +  L++EF R  +AVV++ MH WERDARL K+AL K E  +++++E ACTR S  LLGA
Sbjct  61    FLRHLKREFTRFNNAVVMWAMHAWERDARLVKKALRKGEDSYNVIVEVACTRSSHHLLGA  120

Query  431   RRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKH  610
             RRAYHSLFD S+EED+A HI  P RKLLV LVS+YRYEG K+ E   K EA++LA AI  
Sbjct  121   RRAYHSLFDQSMEEDVASHIHGPHRKLLVGLVSAYRYEGSKITEAATKLEAEILAEAIA-  179

Query  611   AGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMPQ  790
             +  +  V+++E+VRIL+TRSKLHL  +YKHY EIT   +  DL    +L  T+ CL  P 
Sbjct  180   SHREQAVENDEVVRILTTRSKLHLKHVYKHYMEITDTDISADLADSSVLSDTLLCLFRPS  239

Query  791   LYFSKILDASLRLGVDEAARDSVTRVIVTRADE-DMKHIKQEFKTKYGVALSDRIGEVAN  967
              YFSK+L+ASL    D+ A+  +TRVIVTRAD  DMK + +E++  +G +L ++I    N
Sbjct  240   AYFSKLLNASLSNDSDKKAKKWLTRVIVTRADHADMKEMIEEYRRLFGESLDEKIRARTN  299

Query  968   GSYKELLLTLVAKSE  1012
             G+Y++ LLTL+AKS+
Sbjct  300   GNYRDFLLTLLAKSD  314



>ref|XP_008344590.1| PREDICTED: annexin D4-like [Malus domestica]
Length=224

 Score =   285 bits (728),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 149/221 (67%), Positives = 180/221 (81%), Gaps = 1/221 (0%)
 Frame = +2

Query  74   MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDH  253
            MA++ + + LTKAFSGLGVDEKA V+ L K +P+ RQS+RK+T  FF+ DER FERWDDH
Sbjct  1    MALTPELQTLTKAFSGLGVDEKALVATLGKSHPEERQSFRKATPHFFKVDERSFERWDDH  60

Query  254  HVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQ-FDLLIETACTRPSEELLGA  430
            HV  L+ EFLR K+AVVL+ MHPWERDARL KEAL K P+ + +L+E ACTR SEELLGA
Sbjct  61   HVKLLKHEFLRFKNAVVLWTMHPWERDARLAKEALKKGPESYGILVEIACTRSSEELLGA  120

Query  431  RRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKH  610
            R+AYHSLFDHSIEED+A+HI  PE KLLVALVS+YRYEG KV +D AKSEAK L NAI+H
Sbjct  121  RKAYHSLFDHSIEEDVAYHIDGPEGKLLVALVSAYRYEGSKVKDDTAKSEAKTLVNAIQH  180

Query  611  AGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDE  733
            A  +N  +D+E++RILSTRSK HL  +YKHYKEI+G  +DE
Sbjct  181  ADKRNPNEDDEVIRILSTRSKPHLKEVYKHYKEISGHNIDE  221



>ref|XP_010645993.1| PREDICTED: annexin D4 isoform X2 [Vitis vinifera]
Length=251

 Score =   286 bits (731),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 153/245 (62%), Positives = 189/245 (77%), Gaps = 2/245 (1%)
 Frame = +2

Query  74   MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDH  253
            M   +D + LTKAFSG GVDE + VS+L KW+ +H +S+RK T +FF +DER FERWDDH
Sbjct  1    MDPPNDFEALTKAFSGFGVDEDSMVSILGKWHSEHLESFRKRTPKFFLEDERLFERWDDH  60

Query  254  HVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQ-FDLLIETACTRPSEELLGA  430
            H+  L +EFLR KD VV ++MHPWERDARL  EA+ K PQ + LLIE ACTR SEELLGA
Sbjct  61   HIACLTKEFLRFKDIVVQWIMHPWERDARLVHEAISKGPQAYGLLIEIACTRSSEELLGA  120

Query  431  RRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKH  610
            R+AY SLFD SI ED+A  ++  ERKLLVALVSSYRYEG +V+E +A+SEA  LA A+K+
Sbjct  121  RKAYQSLFDQSI-EDVASRLEGIERKLLVALVSSYRYEGLRVNEGIARSEAMTLAIAVKN  179

Query  611  AGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMPQ  790
               KN ++D+ IVRIL+TRSKLHL A+ K+YKEI GK +DEDL   + LK+T+QCLC PQ
Sbjct  180  VDKKNPIEDDAIVRILTTRSKLHLKAVVKYYKEIYGKNIDEDLDTLMSLKETLQCLCNPQ  239

Query  791  LYFSK  805
             YFSK
Sbjct  240  AYFSK  244



>gb|KDO83190.1| hypothetical protein CISIN_1g021607mg [Citrus sinensis]
Length=261

 Score =   285 bits (728),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 146/237 (62%), Positives = 188/237 (79%), Gaps = 2/237 (1%)
 Frame = +2

Query  101  LTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVLQLRQEF  280
            L KAFSG GVDEK  +S+L    P+HRQ++RK    FF +DER+FERW+DHHV  L+ EF
Sbjct  7    LIKAFSGHGVDEKTVISILGNSQPEHRQAFRKEG-GFFAEDERRFERWNDHHVKLLKHEF  65

Query  281  LRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGARRAYHSLFD  457
            +R K+AVVL+ MHPWERDARL KEAL K P  + +++E A TR S+ELLGAR+AYHSLF+
Sbjct  66   MRFKNAVVLWAMHPWERDARLIKEALKKGPNSNSVIVEIASTRSSDELLGARKAYHSLFE  125

Query  458  HSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGNKNLVDD  637
            HSIEED+A HI   E+KLLVALVS+YRYEGPKV EDVAKSEAK L +A+K+A  +N +++
Sbjct  126  HSIEEDVASHIHGKEKKLLVALVSAYRYEGPKVKEDVAKSEAKALISAVKNAEKQNPIEN  185

Query  638  EEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMPQLYFSKI  808
            +E+VRILSTRSK HL +++KHYKEI G+  +++L  HL+L+  VQCL  PQ YFS++
Sbjct  186  DEVVRILSTRSKPHLKSVFKHYKEIAGQHFEDELDVHLILQAAVQCLITPQSYFSRV  242



>ref|XP_008813418.1| PREDICTED: annexin D4-like [Phoenix dactylifera]
Length=318

 Score =   283 bits (723),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 156/314 (50%), Positives = 216/314 (69%), Gaps = 6/314 (2%)
 Frame = +2

Query  80    VSDDHKILTKAFSGLG---VDEKAFVSVLAKW--NPKHRQSYRKSTHQFFRDDERQFERW  244
             V+++ + + +AFSGLG   VDEKA VS L KW   P+ R   RKS   FF  D   FER 
Sbjct  6     VTEECEAVIRAFSGLGGLGVDEKALVSALGKWRRQPEKRAQLRKSFVGFFTADG-SFERC  64

Query  245   DDHHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFDLLIETACTRPSEELL  424
             +D ++  L+ EF R K+ +VL+ MHPWERDAR     L K    D+++E ACTR SEELL
Sbjct  65    EDDYIRYLKNEFARFKNIMVLWAMHPWERDARWVHHVLHKPLPLDIIVEIACTRSSEELL  124

Query  425   GARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAI  604
             GAR+AYH+LF HS+EED+A+H++     LLV LVS+YRYEG ++++++A SEA+ L  AI
Sbjct  125   GARKAYHALFHHSLEEDVAYHVRENYSNLLVRLVSAYRYEGNRINKEMATSEAEALYRAI  184

Query  605   KHAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCM  784
             K  G K LV++EE++RIL+TRSK HL   +KHYKE  GK ++E L   L L++TVQCL  
Sbjct  185   KTPGVKKLVENEEVIRILTTRSKPHLRVTFKHYKEKYGKSIEEHLGDELCLRETVQCLDS  244

Query  785   PQLYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVA  964
             P  YFSK+++ +L+ G D+  +D++TRVIV+RAD DMK IK+ +  +YG  L D I +  
Sbjct  245   PPKYFSKVINKALKDGADKNTKDALTRVIVSRADVDMKEIKEAYHQQYGAELEDVISKNT  304

Query  965   NGSYKELLLTLVAK  1006
              GSY++ LL+L  +
Sbjct  305   LGSYRDALLSLAGQ  318



>ref|XP_010645984.1| PREDICTED: annexin D4-like isoform X2 [Vitis vinifera]
Length=250

 Score =   280 bits (717),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 152/245 (62%), Positives = 190/245 (78%), Gaps = 3/245 (1%)
 Frame = +2

Query  74   MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDH  253
            M   +D + LTKAFSG GVDE + VS+L KW+ +H +S+RK T +FF +DER FERWDDH
Sbjct  1    MDPPNDFEALTKAFSGFGVDEDSMVSILGKWHLEHLESFRKRTPKFFLEDERLFERWDDH  60

Query  254  HVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQ-FDLLIETACTRPSEELLGA  430
            H+  L +EF+R KD VV ++MHPWERDARL  EA+ K PQ + LLIE ACTR SEELLGA
Sbjct  61   HIACLTKEFMRFKDIVVQWIMHPWERDARLVHEAISKGPQAYGLLIEIACTRSSEELLGA  120

Query  431  RRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKH  610
            R+AY SLFD SI ED+A  ++  ERKLLVALVSSYRYEG +V+E +A+SEA  LA A+K+
Sbjct  121  RKAYQSLFDQSI-EDVASRLEGIERKLLVALVSSYRYEGLRVNEGIARSEAMTLAIAVKN  179

Query  611  AGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMPQ  790
              +KN ++D+ IVRIL+TRSKLHL A+ K+YKEI GK +DEDL   + LK+T+QCLC PQ
Sbjct  180  V-DKNPIEDDAIVRILTTRSKLHLKAVVKYYKEIFGKNIDEDLDTLMSLKETLQCLCNPQ  238

Query  791  LYFSK  805
             YFSK
Sbjct  239  AYFSK  243



>emb|CDY07704.1| BnaA03g18070D [Brassica napus]
Length=315

 Score =   282 bits (722),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 159/315 (50%), Positives = 219/315 (70%), Gaps = 4/315 (1%)
 Frame = +2

Query  74    MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFF-RDDERQFERWDD  250
             MA + D + +TKA SG+GV+E A +S L   +  HR+ +RK++  FF  D+ER FE+  D
Sbjct  1     MAHTLDLEGITKAISGMGVEEGALISTLGNSHKDHRKLFRKASKSFFVEDEERAFEKCHD  60

Query  251   HHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLK-EPQFDLLIETACTRPSEELLG  427
             H V  L+ EF R  +AVV++ MHPWERDARL K+AL K +  ++L++E +CTR SE+LLG
Sbjct  61    HFVKHLKIEFSRFTNAVVMWSMHPWERDARLVKKALKKGDEAYNLIVEVSCTRSSEDLLG  120

Query  428   ARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIK  607
             AR+AYHSLFD S+EEDIA H+   +RKLLV LVS+YRYEG +V E  AKS+AK+LA A+ 
Sbjct  121   ARKAYHSLFDQSMEEDIASHVHGSQRKLLVGLVSAYRYEGKEVKESSAKSDAKILAEAVA  180

Query  608   HAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMP  787
              +G +  ++++E+VRILSTRSKLHL  LYKH+ +I G  L   +    L+ + + CL  P
Sbjct  181   SSG-EGAIENDEVVRILSTRSKLHLEHLYKHFNQIKGSDLLGGVSESSLINEALLCLLKP  239

Query  788   QLYFSKILDASLRLGVDEAARDSVTRVIVTRAD-EDMKHIKQEFKTKYGVALSDRIGEVA  964
              +YFSKIL+ASL    D+  +  +TRV VTRAD  DMK I +E+   YG  L+  I E  
Sbjct  240   SVYFSKILNASLNKDADKGTKKWLTRVFVTRADHSDMKEIAEEYNQLYGEPLAQTIQEKI  299

Query  965   NGSYKELLLTLVAKS  1009
              G+Y++ LLTL++KS
Sbjct  300   KGNYRDFLLTLLSKS  314



>ref|XP_010645983.1| PREDICTED: annexin D4-like [Vitis vinifera]
Length=344

 Score =   283 bits (723),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 155/323 (48%), Positives = 225/323 (70%), Gaps = 5/323 (2%)
 Frame = +2

Query  53    NSANSSKMAVSDDHKILTKAFSG-LGVDEKAFVSVLAKWNPKHRQSYR-KSTHQFFRDDE  226
             N      M++ ++ + LTKAFSG LGVDEK+ + +L KW+P+   ++R +++  F +D  
Sbjct  22    NEEGRKIMSLPNESRTLTKAFSGILGVDEKSMMEILVKWHPEDLTTFRNENSSIFLKDKY  81

Query  227   RQFERWDDHHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQ-FDLLIETACT  403
               FERW D+H+  L +EFLR +D VV + MHPWERDAR+ ++AL   PQ + LLIE ACT
Sbjct  82    FLFERWQDYHIAFLVKEFLRFQDVVVQWTMHPWERDARMARKALDGHPQAYGLLIELACT  141

Query  404   RPSEELLGARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEA  583
             R S+ELLGAR+AY SL+  SIEED+A  ++  ER+LLVALVS+YRYEG ++++   ++EA
Sbjct  142   RSSDELLGARKAYQSLYGESIEEDVASRVEGIERQLLVALVSTYRYEGSRINDVAVRAEA  201

Query  584   KVLANAI-KHAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLK  760
               L   I +H   K L  DEE VRIL+TRSK HL A++K YKE   K ++EDL     LK
Sbjct  202   IKLGITINRHGDKKKLFKDEETVRILATRSKPHLKAVFKCYKETFNKNIEEDLD-ETSLK  260

Query  761   QTVQCLCMPQLYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVAL  940
              T+ CL  P +YFSKILD++++   +E  ++++TRVIVTRA+ D+K I +++  +YG  L
Sbjct  261   DTIYCLYAPSMYFSKILDSAMKANANEDEKEALTRVIVTRANVDIKDIAEKYNKQYGTPL  320

Query  941   SDRIGEVANGSYKELLLTLVAKS  1009
             + +I +VA G+YK+ L+TLV ++
Sbjct  321   TKKIEDVALGNYKDFLVTLVQRA  343



>emb|CDY14436.1| BnaC03g21590D [Brassica napus]
Length=315

 Score =   281 bits (719),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 158/315 (50%), Positives = 219/315 (70%), Gaps = 4/315 (1%)
 Frame = +2

Query  74    MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFF-RDDERQFERWDD  250
             MA + D + +TKA SG+GV+E A +S L   +  HR+ +R+++  FF  D+ER FE+  D
Sbjct  1     MAHTLDLEGITKAISGMGVEEGALISTLGNSHKDHRKLFRRASKSFFVEDEERAFEKCHD  60

Query  251   HHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLK-EPQFDLLIETACTRPSEELLG  427
             H V  L+ EF R  +AVV++ MHPWERDARL K+AL K +  ++L++E +CTR SE+LLG
Sbjct  61    HFVKHLKIEFSRFTNAVVMWSMHPWERDARLVKKALKKGDEAYNLIVEVSCTRSSEDLLG  120

Query  428   ARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIK  607
             AR+AYHSLFD S+EEDIA H+   +RKLLV LVS+YRYEG +V E  AKS+AK+LA A+ 
Sbjct  121   ARKAYHSLFDQSMEEDIASHVHGSQRKLLVGLVSAYRYEGKEVKESSAKSDAKILAEAVA  180

Query  608   HAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMP  787
              +G +  ++++E+VRILSTRSKLHL  LYKH+ +I G  L   +    L+ + + CL  P
Sbjct  181   SSG-EGAIENDEVVRILSTRSKLHLEHLYKHFNQIQGSDLLGGVSESSLINEALLCLLKP  239

Query  788   QLYFSKILDASLRLGVDEAARDSVTRVIVTRADE-DMKHIKQEFKTKYGVALSDRIGEVA  964
              +YFSKIL+ASL    D+  +  +TRV VTRAD  DMK I +E+   YG  L+  I E  
Sbjct  240   SVYFSKILNASLNKDADKGTKKWLTRVFVTRADHGDMKEIAEEYNQLYGEPLAQTIQEKI  299

Query  965   NGSYKELLLTLVAKS  1009
              G+Y++ LLTL++KS
Sbjct  300   KGNYRDFLLTLLSKS  314



>gb|ADD74397.1| annexin 4 [Brassica juncea]
Length=315

 Score =   281 bits (718),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 159/315 (50%), Positives = 218/315 (69%), Gaps = 4/315 (1%)
 Frame = +2

Query  74    MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFF-RDDERQFERWDD  250
             MA + D + +TKA SG+GV+E A +S L   +  HR+ +RK++  FF  D+ER FE+  D
Sbjct  1     MAHTLDLEGITKAISGMGVEEGALISTLGNSHKDHRKLFRKASKSFFVEDEERAFEKCHD  60

Query  251   HHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLK-EPQFDLLIETACTRPSEELLG  427
             H V  L+ EF R  +AVV++ MHPWERDARL K+AL K +  ++L++E +CTR SE+LLG
Sbjct  61    HFVKHLKIEFSRFTNAVVMWSMHPWERDARLVKKALKKGDEAYNLIVEVSCTRSSEDLLG  120

Query  428   ARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIK  607
             AR+AYHSLFD S+EEDIA HI   +RKLLV LVS+YRYEG +V E  AKS+AK+LA A+ 
Sbjct  121   ARKAYHSLFDQSMEEDIASHIHGSQRKLLVGLVSAYRYEGKEVKESSAKSDAKILAEAVA  180

Query  608   HAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMP  787
              +G +  ++++E+VRILSTRSKLHL  LYKH+ +  G  L   +    L+ + + CL  P
Sbjct  181   SSG-EGAIENDEVVRILSTRSKLHLEHLYKHFNQTKGSDLLGGVSESSLINEALLCLLKP  239

Query  788   QLYFSKILDASLRLGVDEAARDSVTRVIVTRAD-EDMKHIKQEFKTKYGVALSDRIGEVA  964
              +YFSKIL+ASL    D+  +  +TRV VTRAD  DMK I +E+   YG  L+  I E  
Sbjct  240   SVYFSKILNASLNKDADKGTKKWLTRVFVTRADHSDMKEIAEEYNQLYGEPLAQTIQEKI  299

Query  965   NGSYKELLLTLVAKS  1009
              G+Y++ LLTL++KS
Sbjct  300   KGNYRDFLLTLLSKS  314



>ref|NP_001288920.1| annexin D4 [Brassica rapa]
 gb|AHV84995.1| annexin protein 4 [Brassica rapa]
Length=315

 Score =   280 bits (717),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 158/315 (50%), Positives = 218/315 (69%), Gaps = 4/315 (1%)
 Frame = +2

Query  74    MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFF-RDDERQFERWDD  250
             MA + D + +TKA SG+GV+E A +S L   +  HR+ +RK++  FF  D+ER FE+  D
Sbjct  1     MAHTLDLEGITKAISGMGVEEGALISTLGNSHKDHRKLFRKASKSFFVEDEERAFEKCHD  60

Query  251   HHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLK-EPQFDLLIETACTRPSEELLG  427
             H V  L+ EF R  +AVV++ MHPWERDARL K+AL K +  ++L++E +C R SE+LLG
Sbjct  61    HFVKHLKIEFSRFTNAVVMWSMHPWERDARLVKKALKKGDEAYNLIVEVSCARSSEDLLG  120

Query  428   ARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIK  607
             AR+AYHSLFD S+EEDIA H+   +RKLLV LVS+YRYEG +V E  AKS+AK+LA A+ 
Sbjct  121   ARKAYHSLFDQSMEEDIASHVHGSQRKLLVGLVSAYRYEGKEVRESSAKSDAKILAEAVA  180

Query  608   HAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMP  787
              +G +  ++++E+VRILSTRSKLHL  LYKH+ +I G  L   +    L+ + + CL  P
Sbjct  181   SSG-EGAIENDEVVRILSTRSKLHLEHLYKHFNQIKGSDLLGGVSESSLINEALLCLLKP  239

Query  788   QLYFSKILDASLRLGVDEAARDSVTRVIVTRAD-EDMKHIKQEFKTKYGVALSDRIGEVA  964
              +YFSKIL+ASL    D+  +  +TRV VTRAD  DMK I +E+   YG  L+  I E  
Sbjct  240   SVYFSKILNASLNKDADKGTKKWLTRVFVTRADHSDMKEIAEEYNQLYGEPLAQTIQEKI  299

Query  965   NGSYKELLLTLVAKS  1009
              G+Y++ LLTL++KS
Sbjct  300   KGNYRDFLLTLLSKS  314



>gb|KHG21803.1| Annexin D4 -like protein [Gossypium arboreum]
Length=272

 Score =   276 bits (707),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 145/275 (53%), Positives = 198/275 (72%), Gaps = 12/275 (4%)
 Frame = +2

Query  191   RKSTHQFFRDDERQFERWDDHHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLK-E  367
             RK   +FF +DERQFERW+D  +  L+ EF   KD VVL +MHPWERDARL K+AL K  
Sbjct  2     RKGCSKFFLEDERQFERWNDSAIKSLKAEFKLFKDVVVLSLMHPWERDARLLKKALKKGP  61

Query  368   PQFDLLIETACTRPSEELLGARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEG  547
             P +++++E ACTR S++LLGAR+AYHSLFD SIEED+A H++  ERKLLVALVS+YRYEG
Sbjct  62    PHYNVIVEIACTRSSDQLLGARKAYHSLFDRSIEEDLASHVKGSERKLLVALVSAYRYEG  121

Query  548   PKVHEDVAKSEAKVLANAIKHAGN---KNLVDDEEIVRILSTRSklhllalykhykEITG  718
             PKV ED AKSEAK L NAIK+      K  ++++E++ IL+TRSK HL  +Y+ YK+I+ 
Sbjct  122   PKVKEDAAKSEAKALLNAIKNNNGDHKKAAMEEDEVIWILTTRSKPHLKVVYEQYKKISA  181

Query  719   KFLDEDLHAHLLLKQTVQCLCMPQLYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMK  898
             K + EDL   LLLK+TV+CLC PQ YF+++ D +LR    E A+ ++TR++ T+ D D+K
Sbjct  182   KTITEDLEVELLLKETVECLCTPQTYFTRVFDTALREDAKEDAKKALTRLVATQEDVDLK  241

Query  899   HIKQEFKTKYGVALSDRIGEVANGSYKELLLTLVA  1003
              I  +F+        D+I E   G+YK++LL ++A
Sbjct  242   GIATKFE--------DKIKERVKGAYKDVLLGVLA  268



>ref|XP_009141762.1| PREDICTED: annexin D4-like [Brassica rapa]
 emb|CDY18369.1| BnaA04g22180D [Brassica napus]
Length=320

 Score =   277 bits (709),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 158/320 (49%), Positives = 220/320 (69%), Gaps = 9/320 (3%)
 Frame = +2

Query  74    MAVSDDHKILTKAFSG----LGVDEKAFVSVLAKWNPKHRQSYRKSTHQFF-RDDERQFE  238
             MA + D + + +AFSG    +GVDEKA +S L   +  HR+ +RK++  FF  D+ER FE
Sbjct  1     MAHTLDLESIVEAFSGKNVGMGVDEKALISTLGNSHKDHRKLFRKASKSFFVEDEERAFE  60

Query  239   RWDDHHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQ-FDLLIETACTRPSE  415
             +  D  V  L+ EF R  +AVV++ MHPWERDAR+ K+AL K  + + L++E ACTR S+
Sbjct  61    KCHDQFVKHLKLEFSRFNNAVVMWSMHPWERDARVVKKALKKGDECYSLIVEVACTRSSD  120

Query  416   ELLGARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLA  595
             +LLGAR+AYHSLFD S+EEDIA +I    RKLLV LVS+YRYEG KV++D+AKS+AK+LA
Sbjct  121   DLLGARKAYHSLFDQSMEEDIASNIHGSRRKLLVGLVSAYRYEGNKVNDDLAKSDAKILA  180

Query  596   NAIKHAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQC  775
              A+   G K  ++++E+VRILSTRSKLH+  LYKH+ +I G  L   +    +L   + C
Sbjct  181   EAVASPGEK-AIENDEVVRILSTRSKLHIQQLYKHFNQINGSDLLGGVSDSSILNDALLC  239

Query  776   LCMPQLYFSKILDASLRLGVDEAARDSVTRVIVTRAD--EDMKHIKQEFKTKYGVALSDR  949
             L  P +YFSKIL+ASL    D+  +  +TRV VTRAD  ++MK I +E+  +YG  L+  
Sbjct  240   LLKPSVYFSKILNASLNKDADKGTKKWLTRVFVTRADHSDEMKEIAEEYNQRYGETLAQN  299

Query  950   IGEVANGSYKELLLTLVAKS  1009
             I E   G+Y++ LLTL++KS
Sbjct  300   IQEKIRGNYRDFLLTLLSKS  319



>ref|XP_009392678.1| PREDICTED: annexin D4 [Musa acuminata subsp. malaccensis]
Length=309

 Score =   276 bits (705),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 145/310 (47%), Positives = 213/310 (69%), Gaps = 4/310 (1%)
 Frame = +2

Query  80    VSDDHKILTKAFSGLGVDEKAFVSVLAKW--NPKHRQSYRKSTHQFFRDDERQFERWDDH  253
             ++++H+ LT AFSGLGVDE + ++V+ KW   P+ R+ +R S+  FF+     FER +D 
Sbjct  1     MAEEHEALTSAFSGLGVDESSLLTVITKWRKQPEKRRGFRSSS-PFFKP-HGSFERCEDD  58

Query  254   HVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFDLLIETACTRPSEELLGAR  433
              V  L+ EF R K+  VL+ MHPWERDAR     L K   F++++E ACTR S+ELLGAR
Sbjct  59    FVRSLKVEFARFKNVTVLWAMHPWERDARWIHHVLHKAHPFNIIVEIACTRSSDELLGAR  118

Query  434   RAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHA  613
             +AYH+LF HSIEED+A+ ++     LLV LVS+YRYEG +V ED+AKSEAK L +AIK+A
Sbjct  119   KAYHALFHHSIEEDVAYRVKENYCSLLVGLVSAYRYEGSRVDEDIAKSEAKALGHAIKNA  178

Query  614   GNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMPQL  793
             G K+ V++ E++RIL+TRSK HL   ++HY  I G+ +++D      L +TV+CL     
Sbjct  179   GTKDPVENYEVIRILTTRSKTHLKETFRHYSGIYGQSIEQDFADESCLGETVRCLGSSAS  238

Query  794   YFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVANGS  973
             YFSK++D +     D+ A+D++TRV+V+R+D DM+ IK  ++ +Y   L D+I +   G+
Sbjct  239   YFSKVIDKAFGEEADKNAKDALTRVVVSRSDVDMEEIKAVYEKQYKAKLEDKIVKNTRGN  298

Query  974   YKELLLTLVA  1003
             Y++ LL+LV 
Sbjct  299   YRDALLSLVG  308



>ref|XP_002881615.1| ANNAT4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57874.1| ANNAT4 [Arabidopsis lyrata subsp. lyrata]
Length=316

 Score =   276 bits (706),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 167/317 (53%), Positives = 222/317 (70%), Gaps = 5/317 (2%)
 Frame = +2

Query  74    MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFF-RDDERQFERWDD  250
             MA+  + + LT+A SG+GVDE A +S L K   +HR+ +RK++  FF  D+ER FE+  D
Sbjct  1     MALPLEFESLTEAISGMGVDENALISTLGKSQKEHRKLFRKASKSFFVEDEERAFEKCHD  60

Query  251   HHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLK-EPQFDLLIETACTRPSEELLG  427
             H V  L+ EF R  +AVV++ MHPWERDARL K+AL K E  ++L++E +CTR +E+LLG
Sbjct  61    HFVRHLKLEFSRFNNAVVMWAMHPWERDARLVKKALKKGEEAYNLIVEVSCTRSAEDLLG  120

Query  428   ARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIK  607
             AR+AYHSLFD S+EEDIA H+  P RKLLV LVS+YRYEG KV +D AKSEAK+LA A+ 
Sbjct  121   ARKAYHSLFDQSMEEDIASHVHGPHRKLLVGLVSAYRYEGNKVKDDSAKSEAKILAEAVA  180

Query  608   HAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMP  787
              +G + +   +E+VRIL+TRSKLHL  LYKH+ EI G  L   +    LL + + CL  P
Sbjct  181   SSGEEVVE-KDEVVRILTTRSKLHLQHLYKHFNEIKGSDLLGGVSQSSLLNEALLCLLKP  239

Query  788   QLYFSKILDASLRLGVDEAARDSVTRVIVTRAD--EDMKHIKQEFKTKYGVALSDRIGEV  961
              LYFSKILDASL    D+  +  +TRV VTRAD  ++M  IK+EF   YG  L+ RI E 
Sbjct  240   ALYFSKILDASLNKDADKTTKKWLTRVFVTRADHSDEMNEIKEEFNNLYGETLAQRIQEK  299

Query  962   ANGSYKELLLTLVAKSE  1012
               G+Y++ LLTL++KS+
Sbjct  300   IKGNYRDFLLTLLSKSD  316



>emb|CDP17933.1| unnamed protein product [Coffea canephora]
Length=235

 Score =   271 bits (694),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 144/233 (62%), Positives = 186/233 (80%), Gaps = 1/233 (0%)
 Frame = +2

Query  314   MHPWERDARLFKEALLKEPQFDLLIETACTRPSEELLGARRAYHSLFDHSIEEDIAFHIQ  493
             MHPWERDARL +EA+ K P + +L+E ACTR SEELLGARRA+HSLF+HSIEEDIAFHI 
Sbjct  1     MHPWERDARLLREAVYKGPNYGILVEIACTRSSEELLGARRAFHSLFEHSIEEDIAFHIH  60

Query  494   TPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGNKNLVDDEEIVRILSTRSk  673
               E+KLLV LVS+YRY+GPK  E+VAKSEAK+L N IK  G K L ++EEIVRIL+TRSK
Sbjct  61    GFEKKLLVGLVSAYRYKGPKYSEEVAKSEAKILKNVIKD-GAKKLHEEEEIVRILTTRSK  119

Query  674   lhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMPQLYFSKILDASLRLGVDEAARD  853
             LHL A++KHYKE +G +LDE  +  L+LKQTVQCLC P+ YF+ +LD SL+    + A++
Sbjct  120   LHLKAVFKHYKETSGNYLDEVRNLLLILKQTVQCLCKPETYFTDVLDVSLKGIGHDFAKE  179

Query  854   SVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVANGSYKELLLTLVAKSE  1012
             ++TRVIVTRAD D+K IK+E+    GV LS +I E+ANG++K+ +LTL+A+ +
Sbjct  180   ALTRVIVTRADVDLKLIKEEYHQLSGVTLSHKIEEIANGNFKDFMLTLIARGD  232



>gb|EMT13324.1| Annexin D4 [Aegilops tauschii]
Length=315

 Score =   274 bits (700),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 147/313 (47%), Positives = 212/313 (68%), Gaps = 7/313 (2%)
 Frame = +2

Query  80   VSDDHKILTKAFSGLG---VDEKAFVSVLAKW--NPKHRQSYRKSTHQFFRDDERQFERW  244
            ++D+ + LTKAFSGLG   VDE   V+ LA W   P+ R  +RKS    F+      ER 
Sbjct  1    MADEVQALTKAFSGLGGLGVDEPTMVAALANWRRQPEKRSGFRKSFPGLFKQ-HGVIERC  59

Query  245  DDHHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFDLLIETACTRPSEELL  424
            +D ++L L  EF R K+ +VL+ MHPWERDARL    L +     +++E ACTR +EELL
Sbjct  60   EDEYMLHLAAEFSRFKNLMVLWAMHPWERDARLAHHVLHQAHPAAIVVEVACTRSAEELL  119

Query  425  GARRAYHSLFDHSIEEDIAFHIQ-TPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANA  601
            GAR+AY +LF HS+EED+A+  +  P   LLV LVS+YRYEGPKV +D AK+EAK L  A
Sbjct  120  GARKAYMALFHHSLEEDVAYRAKDKPYCSLLVGLVSAYRYEGPKVSDDTAKAEAKALGAA  179

Query  602  IKHAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLC  781
            +K AG   LV++EE+VRIL+TRSK HL+  +K+YKE+ GK+++EDL +   L++ VQCL 
Sbjct  180  VKSAGGGKLVENEEVVRILTTRSKPHLVQTFKYYKELHGKYIEEDLGSEEALREAVQCLA  239

Query  782  MPQLYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEV  961
             P+ YFS+++ A+LR G D   ++++ RV VTR+D DM  I+  ++ ++G  L D +   
Sbjct  240  TPERYFSQVMAAALREGADHHGKEALARVAVTRSDVDMDGIRAAYQEQFGAKLEDAVAGS  299

Query  962  ANGSYKELLLTLV  1000
            A+G +K+ L++L+
Sbjct  300  AHGHFKDALVSLI  312



>ref|XP_002265896.3| PREDICTED: annexin D4-like isoform X1 [Vitis vinifera]
Length=350

 Score =   273 bits (697),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 157/335 (47%), Positives = 221/335 (66%), Gaps = 10/335 (3%)
 Frame = +2

Query  26    SVSMTAPTLNSANSSKMAVSDDHKILTKAFS----GL-GVDEKAFVSVLAKWNPKHRQSY  190
             SV       N    + M+ SD    L K+FS    G+ GVDEK+ + +L KW P+   ++
Sbjct  13    SVKRRKKQTNKEGKTIMSSSD---ALAKSFSVSHSGIFGVDEKSMLEILVKWQPEQLSTF  69

Query  191   RKSTHQFFRDDER-QFERWDDHHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKE  367
             R  T + F  DER  FE+ ++  +  L++EF R KDAVV + MHPWERDAR+ ++AL + 
Sbjct  70    RNETSRIFLKDERFPFEKCEEFLLKFLKREFKRFKDAVVQWTMHPWERDARMARKALKRG  129

Query  368   PQ-FDLLIETACTRPSEELLGARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYE  544
              Q + LLIE ACTR S+ELLGARRAY SL+  SIEED+A  +   ER+LLVALVSSYRY+
Sbjct  130   RQAYGLLIELACTRSSDELLGARRAYQSLYSESIEEDVASRVDGIERQLLVALVSSYRYD  189

Query  545   GPKVHEDVAKSEAKVLANAIKHAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKF  724
             G K ++   K + + L  AI     K L+ DEEIVRIL+TRSK+HL+A+ K Y+E   K 
Sbjct  190   GSKTNDQAIKLDTQKLEKAISIGDKKQLIKDEEIVRILTTRSKIHLIAVIKCYQETFNKN  249

Query  725   LDEDLHAHLLLKQTVQCLCMPQLYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHI  904
             + EDL     LK T+ CLC+P  YFSKILD++++   ++  ++++TRVIVTRA+ DMK I
Sbjct  250   IIEDLDEESSLKDTIYCLCVPSQYFSKILDSAMKANANKNEKEALTRVIVTRANVDMKDI  309

Query  905   KQEFKTKYGVALSDRIGEVANGSYKELLLTLVAKS  1009
              +E+  +Y   L+ +I +VA G+YK+ L+TLV ++
Sbjct  310   AEEYDRQYKTPLTQKIEDVALGNYKDFLVTLVQRA  344



>ref|XP_006411098.1| hypothetical protein EUTSA_v10016965mg [Eutrema salsugineum]
 gb|ESQ52551.1| hypothetical protein EUTSA_v10016965mg [Eutrema salsugineum]
Length=315

 Score =   271 bits (693),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 159/315 (50%), Positives = 217/315 (69%), Gaps = 4/315 (1%)
 Frame = +2

Query  74    MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFF-RDDERQFERWDD  250
             MA + D + +T+A SG+GVDEKA +S L   +  HR+ +RK++  +F  D+ER FE+  D
Sbjct  1     MAQTMDLEAITEAISGMGVDEKALISTLGNSHKDHRRLFRKASKSYFVEDEERAFEKCHD  60

Query  251   HHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLK-EPQFDLLIETACTRPSEELLG  427
               V  L+ EF R  +AVV++ MHPWERDARL K+AL K +  ++L++E +CTR SE+LLG
Sbjct  61    QFVKHLKLEFSRFNNAVVMWSMHPWERDARLVKKALKKGDESYNLIVEVSCTRSSEDLLG  120

Query  428   ARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIK  607
             AR+AYHSLFD S+EEDIA HI    RKLLV LVS+YRYEG KV ED AKS+AK+LA A+ 
Sbjct  121   ARKAYHSLFDQSMEEDIASHIHGSHRKLLVGLVSAYRYEGTKVKEDSAKSDAKILAEALA  180

Query  608   HAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMP  787
              +G + +  D E++RILSTRSKLHL  L+KH+ +I G  L   +    LL   + CL  P
Sbjct  181   SSGEEAMEKD-EVIRILSTRSKLHLQHLHKHFNQIKGSDLLGGVSESSLLNDALLCLLKP  239

Query  788   QLYFSKILDASLRLGVDEAARDSVTRVIVTRADE-DMKHIKQEFKTKYGVALSDRIGEVA  964
              +YFSK+L+ASL    D+  +  +TRV+VTRAD  +MK I +E+   YG  L+  I E  
Sbjct  240   SVYFSKVLNASLNKDADKGTKKWLTRVLVTRADHGEMKEIAEEYNQLYGETLAQTIQEKI  299

Query  965   NGSYKELLLTLVAKS  1009
              G+Y++ LLTL++KS
Sbjct  300   KGNYRDFLLTLLSKS  314



>gb|KCW65943.1| hypothetical protein EUGRSUZ_G03249 [Eucalyptus grandis]
Length=232

 Score =   268 bits (684),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 139/234 (59%), Positives = 180/234 (77%), Gaps = 3/234 (1%)
 Frame = +2

Query  314   MHPWERDARLFKEALLKEP-QFDLLIETACTRPSEELLGARRAYHSLFDHSIEEDIAFHI  490
             MHPWERDARL KEAL + P  +++LIE ACTR SEELLGARRAYHSL++HSIEED+A H+
Sbjct  1     MHPWERDARLMKEALKEGPDSYNVLIEVACTRSSEELLGARRAYHSLYEHSIEEDVASHV  60

Query  491   QTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGNKNLVDDEEIVRILSTRS  670
               PER+LLVALVS+YRYEG K  ED AK+EAK + N IK    K   D+EE++RIL+TRS
Sbjct  61    HGPERRLLVALVSAYRYEGTKPKEDNAKAEAKTILNVIKSGEKK--TDNEEVIRILTTRS  118

Query  671   klhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMPQLYFSKILDASLRLGVDEAAR  850
             KL L A+YK Y+EI+G  LDEDL +   L++TVQCLC P+ YFS++LD +L +  D++ +
Sbjct  119   KLLLKAVYKDYQEISGSNLDEDLKSDSRLQETVQCLCTPERYFSQVLDLALEIDADKSTK  178

Query  851   DSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVANGSYKELLLTLVAKSE  1012
              ++TRVIVTRAD D+K I +EF   YGV L+ +I + ANG+YK+ LL L+AK +
Sbjct  179   KALTRVIVTRADVDVKEIDEEFNKMYGVRLTKKIEDTANGNYKDFLLRLIAKGD  232



>ref|XP_010509172.1| PREDICTED: annexin D4-like [Camelina sativa]
Length=319

 Score =   270 bits (690),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 166/320 (52%), Positives = 222/320 (69%), Gaps = 8/320 (3%)
 Frame = +2

Query  74    MAVSDDHKILTKAFSG---LGVDEKAFVSVLAKWNPKHRQSYRKSTHQFF-RDDERQFER  241
             MA+  D + LT+AFSG   +GVDE A +S L K +  HR+ +RK++  FF  D+ER FE+
Sbjct  1     MALPLDLESLTEAFSGNLGMGVDENALISTLGKSHKDHRKLFRKASKGFFVEDEERAFEK  60

Query  242   WDDHHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLK-EPQFDLLIETACTRPSEE  418
               DH V  L+ EF R  +AVV++ MHPWERDARL K+AL K E  ++L++E ACTR SE+
Sbjct  61    CHDHFVRHLKLEFSRFNNAVVMWAMHPWERDARLVKKALKKGEEAYNLIVEVACTRSSED  120

Query  419   LLGARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLAN  598
             LLGAR+AYHSLFD S+EEDIA H+  P RKLLV LVS+YRYEG KV ED AKSEAK LA 
Sbjct  121   LLGARKAYHSLFDQSMEEDIASHVHGPNRKLLVGLVSAYRYEGNKVKEDSAKSEAKTLAE  180

Query  599   AIKHAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCL  778
             A+   G + +   +E+VRIL+TRSK HL  +YKH+ +I G  L   +    LL + + CL
Sbjct  181   AVASPGEEVVE-KDEVVRILTTRSKPHLQHVYKHFNDIKGSDLVRGVSHSSLLNEALLCL  239

Query  779   CMPQLYFSKILDASLRLGVDEAARDSVTRVIVTRAD--EDMKHIKQEFKTKYGVALSDRI  952
               P +YFSKILDASL    D+  +  +TRV+VTRAD  ++MK IK+E+   YGV L+  I
Sbjct  240   LKPAVYFSKILDASLNKEADKTTKKWLTRVLVTRADHSDEMKEIKEEYNKLYGVTLAQII  299

Query  953   GEVANGSYKELLLTLVAKSE  1012
              +   G+Y++ L+TL++KS+
Sbjct  300   QDKIKGNYRDFLITLLSKSD  319



>ref|XP_003634961.1| PREDICTED: annexin D4-like [Vitis vinifera]
Length=322

 Score =   270 bits (689),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 149/310 (48%), Positives = 213/310 (69%), Gaps = 7/310 (2%)
 Frame = +2

Query  101   LTKAFS----GL-GVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDER-QFERWDDHHVL  262
             L K+FS    G+ GVDEK+ + +L KW P+H  ++R  T   F  DER  FE+ ++  + 
Sbjct  7     LAKSFSVSHSGIFGVDEKSMLEILVKWQPEHLSTFRNETSSIFLKDERFPFEKCEEILLK  66

Query  263   QLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQ-FDLLIETACTRPSEELLGARRA  439
              L++EF R KDAVV + MHPWERDAR+ ++AL +  Q + LLIE ACTR S+ELLGARRA
Sbjct  67    FLKREFKRFKDAVVQWTMHPWERDARMARKALKRGSQAYGLLIELACTRSSDELLGARRA  126

Query  440   YHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGN  619
             Y SL+  SIEED+A  ++  +R+ LVALVSSYRYEG + ++   +S+A+ L  AI++   
Sbjct  127   YQSLYSESIEEDVACRVEGIQRQFLVALVSSYRYEGSQKNDVAIESDAQKLNKAIRNGDK  186

Query  620   KNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMPQLYF  799
               L+ DEEIVRIL+TRSK HL+ ++K Y +   K + EDL     LK T+ CLC P +YF
Sbjct  187   TMLIKDEEIVRILTTRSKPHLVEVFKCYYDDFDKDIVEDLSEESSLKDTIYCLCAPPVYF  246

Query  800   SKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVANGSYK  979
             SKILD++++    +  ++++TRVIVTR D DMK I +E+  +YG  L+ +I +VA G+YK
Sbjct  247   SKILDSAMKANATKNEKEALTRVIVTRTDVDMKDIAEEYNKQYGTPLAKKIEDVALGNYK  306

Query  980   ELLLTLVAKS  1009
             + L+TLV ++
Sbjct  307   DFLVTLVQRA  316



>ref|XP_002270143.3| PREDICTED: annexin D4-like isoform X1 [Vitis vinifera]
Length=322

 Score =   270 bits (689),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 152/310 (49%), Positives = 212/310 (68%), Gaps = 7/310 (2%)
 Frame = +2

Query  101   LTKAFS----GL-GVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDER-QFERWDDHHVL  262
             L K+FS    G+ GVDEK+ + +L KW P+   ++R  T   F  DER  FE+ ++  + 
Sbjct  7     LAKSFSVSHSGIFGVDEKSMLEILVKWQPEQLSTFRNETSGIFLKDERFPFEKCEEFLLK  66

Query  263   QLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQ-FDLLIETACTRPSEELLGARRA  439
              L++EF R KDAVV + MHPWERDAR+ ++AL +  Q + LLIE ACTR S+ELLGARRA
Sbjct  67    FLKREFKRFKDAVVQWTMHPWERDARMARKALKRGRQAYGLLIELACTRSSDELLGARRA  126

Query  440   YHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGN  619
             Y SL+  SIEED+A  +   ER+LLVALVSSYRY+G K ++   K +A+ L  AI     
Sbjct  127   YQSLYSESIEEDVASRVDGIERQLLVALVSSYRYDGSKTNDRAIKLDAQKLEKAISIGDK  186

Query  620   KNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMPQLYF  799
             K L+ DEEIVRIL+TRSK+HL+A+ K Y+E   K + EDL     LK T+ CLC P  YF
Sbjct  187   KQLIKDEEIVRILTTRSKIHLMAVIKCYQETFNKNIIEDLDEESSLKDTIYCLCAPPQYF  246

Query  800   SKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVANGSYK  979
             SKILD++++   ++  ++++TRVIVTRA+ DMK I +E+  +Y   L+ +I +VA G+YK
Sbjct  247   SKILDSAMKANANKNEKEALTRVIVTRANVDMKDIAEEYDRQYKTPLTQKIEDVALGNYK  306

Query  980   ELLLTLVAKS  1009
             + L+TLV ++
Sbjct  307   DFLVTLVQRA  316



>ref|XP_008779044.1| PREDICTED: annexin D4-like [Phoenix dactylifera]
Length=348

 Score =   270 bits (691),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 158/336 (47%), Positives = 221/336 (66%), Gaps = 10/336 (3%)
 Frame = +2

Query  17    PYMSVSMTAPTLNSANSSKMA-VSDDHKILTKAFSGLG---VDEKAFVSVLAKW--NPKH  178
             PY+  S+    +  A    +  V+++ + + +AFSGLG   VDEKA VS L KW   PK 
Sbjct  17    PYLLPSILYSVVLLAKQMALPLVAEECEAVIRAFSGLGGLGVDEKALVSTLGKWRRQPKK  76

Query  179   RQSYRKSTHQFFRDDERQFERWDDHHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEAL  358
             R   RKS   FF  D   FER +  +   L  EF R K+ +VL+ MHPWERDA      L
Sbjct  77    RAQLRKSFAGFFTAD-GSFERCEYDY---LEIEFDRFKNIMVLWAMHPWERDAWWAHLVL  132

Query  359   LKEPQFDLLIETACTRPSEELLGARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYR  538
              +   FD+++E A TR SEEL+GAR+AYH+LF HS+EED+A+H++     LLV LVS+YR
Sbjct  133   EEGHPFDIMVEIAWTRSSEELIGARKAYHALFHHSLEEDVAYHVRENYSNLLVGLVSAYR  192

Query  539   YEGPKVHEDVAKSEAKVLANAIKHAGNKNLVDDEEIVRILSTRSklhllalykhykEITG  718
             Y+G  + E++AKSEAK L +AIK AG K LV++EE++RIL+TRSK HL   +K+Y+E+ G
Sbjct  193   YKGYWIDEEMAKSEAKTLGSAIKIAGVKKLVENEEVIRILTTRSKPHLKVTFKYYREMYG  252

Query  719   KFLDEDLHAHLLLKQTVQCLCMPQLYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMK  898
             K + EDL   L L++TVQCL  P  YFSK++D +L+   DE  ++++TRVIV+RAD DM+
Sbjct  253   KSIKEDLGDELCLRETVQCLDSPPEYFSKVIDEALKDEADEKTKNALTRVIVSRADVDME  312

Query  899   HIKQEFKTKYGVALSDRIGEVANGSYKELLLTLVAK  1006
              IK+ +  +YG  L D I +   GSY++ LL+L  +
Sbjct  313   EIKEAYHQQYGAELEDVISKNTFGSYRDALLSLAGQ  348



>ref|XP_010505529.1| PREDICTED: annexin D4 [Camelina sativa]
Length=319

 Score =   268 bits (685),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 164/320 (51%), Positives = 222/320 (69%), Gaps = 8/320 (3%)
 Frame = +2

Query  74    MAVSDDHKILTKAFSG---LGVDEKAFVSVLAKWNPKHRQSYRKSTHQFF-RDDERQFER  241
             MA+  D + LT+AFSG   +GVDE A +S L K +  HR+ +RK++  FF  D+ER FE+
Sbjct  1     MALPLDLESLTEAFSGNLGMGVDENALISTLGKSHKDHRKLFRKASKGFFVEDEERAFEK  60

Query  242   WDDHHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLK-EPQFDLLIETACTRPSEE  418
               DH V  L+ EF R  +AVV++ MHPWERDARL K+AL K E  ++L++E ACTR +E+
Sbjct  61    CHDHFVRHLKLEFSRFNNAVVMWAMHPWERDARLMKKALKKGEEAYNLIVEVACTRSAED  120

Query  419   LLGARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLAN  598
             LLGAR+AYHSLFD S+EEDIA H+  P RKLLV LVS+YRYEG KV +D AKSEAK+LA 
Sbjct  121   LLGARKAYHSLFDQSMEEDIASHVHGPNRKLLVGLVSAYRYEGNKVKDDSAKSEAKILAE  180

Query  599   AIKHAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCL  778
             A+   G + +   +E+VRIL+TRSK HL  +YKH+ +I G  L   +    LL + + CL
Sbjct  181   AVASPGEEVVE-KDEVVRILTTRSKPHLQHVYKHFNDIKGSDLLGGVSHSSLLNEALLCL  239

Query  779   CMPQLYFSKILDASLRLGVDEAARDSVTRVIVTRAD--EDMKHIKQEFKTKYGVALSDRI  952
               P +YFSKILDASL    D+  +  +TRV VTRAD  ++MK IK+E+   YG  L+ RI
Sbjct  240   LKPAVYFSKILDASLNNEADKTTKKWLTRVFVTRADHSDEMKEIKEEYNKLYGETLAQRI  299

Query  953   GEVANGSYKELLLTLVAKSE  1012
              +   G+Y++ L+TL++KS+
Sbjct  300   QDKIKGNYRDFLITLLSKSD  319



>ref|XP_010645988.1| PREDICTED: annexin D4-like isoform X1 [Vitis vinifera]
Length=322

 Score =   267 bits (682),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 152/316 (48%), Positives = 215/316 (68%), Gaps = 4/316 (1%)
 Frame = +2

Query  74    MAVSDD-HKILTKAFSGL-GVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDER-QFERW  244
             M++SD   K  + + SG+ GVDEK+ + +L KW P+H  ++R  T   F  DER  FE+ 
Sbjct  1     MSLSDAVAKSFSVSHSGIFGVDEKSMLEILVKWQPEHLSTFRNETSSIFLKDERFPFEKC  60

Query  245   DDHHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQ-FDLLIETACTRPSEEL  421
             ++  +  L++EF R KDAVV + MHPWERDAR+ ++AL +  Q + LLIE ACTR S+EL
Sbjct  61    EEILLKFLKREFKRFKDAVVQWTMHPWERDARMARKALKRGRQAYGLLIELACTRSSDEL  120

Query  422   LGARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANA  601
             LGARRAY SL+  SIEED+A  +   ER+LLVALVSSYRY+G K ++   K + + L  +
Sbjct  121   LGARRAYQSLYSESIEEDVASQVDGIERQLLVALVSSYRYDGSKTNDRAIKLDTQKLEKS  180

Query  602   IKHAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLC  781
             I     K L+ DEEIVRIL+TRSK+HL+A+ K Y+E   K + EDL     LK T+ CLC
Sbjct  181   ISIGDKKQLIKDEEIVRILTTRSKIHLMAVIKCYQETFNKNIIEDLDEESSLKDTIYCLC  240

Query  782   MPQLYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEV  961
              P  YFSKILD++ +   ++  ++++TRVIVTRA+ DMK I +E+  +Y   L+ +I +V
Sbjct  241   DPPQYFSKILDSATKANANKNEKEALTRVIVTRANVDMKDIAEEYDRQYKTPLAQKIEDV  300

Query  962   ANGSYKELLLTLVAKS  1009
             A G+YK+ L+TLV ++
Sbjct  301   ALGNYKDFLVTLVQRA  316



>ref|XP_010517192.1| PREDICTED: annexin D4-like [Camelina sativa]
Length=319

 Score =   266 bits (679),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 164/320 (51%), Positives = 220/320 (69%), Gaps = 8/320 (3%)
 Frame = +2

Query  74    MAVSDDHKILTKAFSG---LGVDEKAFVSVLAKWNPKHRQSYRKSTHQFF-RDDERQFER  241
             MA+  D + LT+AFSG   +GVDE A +S L K +  HR+ +RK++  FF  D+ER FE+
Sbjct  1     MALPLDLESLTEAFSGNLGMGVDENALISTLGKSHKDHRKLFRKASKGFFVEDEERAFEK  60

Query  242   WDDHHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLK-EPQFDLLIETACTRPSEE  418
               DH V  L+ EF R  +AVV++ MHPWERDARL K+AL K E  ++L++E ACTR +E+
Sbjct  61    CHDHFVRHLKLEFSRFNNAVVMWAMHPWERDARLMKKALKKGEEAYNLIVEVACTRSAED  120

Query  419   LLGARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLAN  598
             LLGAR+AYHSLFD S+EEDIA H+  P RKLLV LVS+YRYEG KV +D AKSEAK LA 
Sbjct  121   LLGARKAYHSLFDQSMEEDIASHVHGPNRKLLVGLVSAYRYEGNKVKDDSAKSEAKTLAE  180

Query  599   AIKHAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCL  778
             A+   G + +   +E+VRIL+TRSK HL  +YKH+ +I G  L   +    LL + + CL
Sbjct  181   AVASRGEEVVE-KDEVVRILTTRSKPHLQHVYKHFNDIKGSDLLGGVSHSSLLNEALLCL  239

Query  779   CMPQLYFSKILDASLRLGVDEAARDSVTRVIVTRAD--EDMKHIKQEFKTKYGVALSDRI  952
               P +YFSKILDASL    D+  +  +TRV VTRAD  ++MK IK+E+   YG  L  RI
Sbjct  240   LKPAVYFSKILDASLNNEADKTTKKWLTRVFVTRADHSDEMKEIKEEYNKLYGETLPQRI  299

Query  953   GEVANGSYKELLLTLVAKSE  1012
              +   G+Y++ L+TL++KS+
Sbjct  300   QDKIKGNYRDFLITLLSKSD  319



>gb|KDO83189.1| hypothetical protein CISIN_1g021607mg [Citrus sinensis]
Length=234

 Score =   263 bits (671),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 135/233 (58%), Positives = 181/233 (78%), Gaps = 1/233 (0%)
 Frame = +2

Query  314   MHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGARRAYHSLFDHSIEEDIAFHI  490
             MHPWERDARL KEAL K P  + +++E A TR S+ELLGAR+AYHSLF+HSIEED+A HI
Sbjct  1     MHPWERDARLIKEALKKGPNSNSVIVEIASTRSSDELLGARKAYHSLFEHSIEEDVASHI  60

Query  491   QTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGNKNLVDDEEIVRILSTRS  670
                E+KLLVALVS+YRYEGPKV EDVAKSEAK L +A+K+A  +N ++++E+VRILSTRS
Sbjct  61    HGKEKKLLVALVSAYRYEGPKVKEDVAKSEAKALISAVKNAEKQNPIENDEVVRILSTRS  120

Query  671   klhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMPQLYFSKILDASLRLGVDEAAR  850
             K HL +++KHYKEI G+  +++L  HL+L+  VQCL  PQ YFS++LD ++R G D+  +
Sbjct  121   KPHLKSVFKHYKEIAGQHFEDELDVHLILQAAVQCLITPQSYFSRVLDEAMRDGADKNTK  180

Query  851   DSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVANGSYKELLLTLVAKS  1009
               +TRV+VTRAD D++ I  +++  Y + L+D+I   A GSYKE LLTL+A+ 
Sbjct  181   KGLTRVLVTRADVDIRAISDDYRNHYAIPLADKIEAKAKGSYKEFLLTLMARG  233



>emb|CDX93305.1| BnaC04g45910D [Brassica napus]
Length=320

 Score =   264 bits (674),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 161/320 (50%), Positives = 218/320 (68%), Gaps = 9/320 (3%)
 Frame = +2

Query  74    MAVSDDHKILTKAFSG----LGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDE-RQFE  238
             MA + D + + +AFSG    +GVDEKA +S L   +  HR+ +RK++  FF +DE R FE
Sbjct  1     MAHTLDLESIVEAFSGKNVGMGVDEKALISTLGNSHKDHRKLFRKASKNFFVEDEQRAFE  60

Query  239   RWDDHHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQ-FDLLIETACTRPSE  415
             +  D  V  L+ EF R  +AVV++ MHPWERDAR+ K+AL K  + + L++E ACTR SE
Sbjct  61    KCHDQFVKHLKLEFSRFNNAVVMWSMHPWERDARVVKKALKKGDECYSLIVEVACTRSSE  120

Query  416   ELLGARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLA  595
             +LLGAR+AYHSLFD S+EEDIA +I    RKLLV LVS+YRYEG KV +D AKS+AK+LA
Sbjct  121   DLLGARKAYHSLFDQSMEEDIASNIHGSRRKLLVGLVSAYRYEGNKVKDDSAKSDAKILA  180

Query  596   NAIKHAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQC  775
              A+   G K  ++++E+VRILSTRSKLHL  LYKH+ +I G  L   +    LL   + C
Sbjct  181   EAVASPGEK-AIENDEVVRILSTRSKLHLQQLYKHFNQIKGSDLLVGVSDSSLLNDALLC  239

Query  776   LCMPQLYFSKILDASLRLGVDEAARDSVTRVIVTRAD--EDMKHIKQEFKTKYGVALSDR  949
             L  P +YFSKIL+ASL    D+  +  +TRV VTRAD  ++MK I +E+  +YG  L+  
Sbjct  240   LLKPSVYFSKILNASLNKDADKGTKKWLTRVFVTRADHSDEMKDIAEEYNQRYGETLAQN  299

Query  950   IGEVANGSYKELLLTLVAKS  1009
             I E   G+Y++ LLTL++KS
Sbjct  300   IQEKIRGNYRDFLLTLLSKS  319



>ref|XP_002263690.1| PREDICTED: annexin D4-like [Vitis vinifera]
Length=349

 Score =   265 bits (677),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 152/326 (47%), Positives = 218/326 (67%), Gaps = 10/326 (3%)
 Frame = +2

Query  53    NSANSSKMAVSDDHKILTKAFS----GL-GVDEKAFVSVLAKWNPKHRQSYRKSTHQFFR  217
             N    + M+ SD   ++ K+FS    G+ GVDEK+ + +L KW P+H  ++R  T   F 
Sbjct  21    NKEGKTIMSSSD---VVAKSFSVSHSGIFGVDEKSMLEILVKWQPEHLSTFRNETSSIFL  77

Query  218   DDER-QFERWDDHHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQ-FDLLIE  391
              DER  FE++++  +  L++EF R KDAVV + MHPWERDAR+ ++AL +  Q + LLIE
Sbjct  78    KDERFPFEKYEEILLKFLKREFKRFKDAVVQWTMHPWERDARMARKALKRGRQAYGLLIE  137

Query  392   TACTRPSEELLGARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVA  571
              ACTR  +ELLGARRAY SL+  SIEED+A  +   ER+LLVALVSSYRY+G K ++   
Sbjct  138   LACTRSLDELLGARRAYQSLYSESIEEDVASQVDGIERQLLVALVSSYRYDGSKTNDRAI  197

Query  572   KSEAKVLANAIKHAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHL  751
             K + + L  +I     K L+ DEEIVRIL+TRSK+HL+A+ K Y+E   K + EDL    
Sbjct  198   KLDTQKLEKSISIGDKKQLIKDEEIVRILTTRSKIHLMAVIKCYQETFNKNIIEDLDEES  257

Query  752   LLKQTVQCLCMPQLYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYG  931
              LK T+ CLC P  YFSKILD++ +   ++  ++++TRVIVTRA+ DMK I +E+  +Y 
Sbjct  258   SLKDTIYCLCDPPQYFSKILDSATKANANKNEKEALTRVIVTRANVDMKDIAKEYDRQYK  317

Query  932   VALSDRIGEVANGSYKELLLTLVAKS  1009
               L+ +I +VA G++K+ L+TLV ++
Sbjct  318   TPLTQKIEDVALGNHKDFLVTLVQRA  343



>emb|CAN65199.1| hypothetical protein VITISV_022256 [Vitis vinifera]
Length=338

 Score =   264 bits (675),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 149/319 (47%), Positives = 210/319 (66%), Gaps = 9/319 (3%)
 Frame = +2

Query  59    ANSSKMAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDER-QF  235
             A +++  V DD  I        GVDEK+ + +L KW P+   ++R  T   F  DER  F
Sbjct  21    AMATEFTVGDDQGIF-------GVDEKSMLEILVKWQPEXLSTFRNETSXIFLKDERFPF  73

Query  236   ERWDDHHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQ-FDLLIETACTRPS  412
             E+ ++  +  L++EF R KDAVV + MHPWERDAR+ ++AL +  Q + LLIE ACTR S
Sbjct  74    EKCEEXLLKFLKREFKRFKDAVVQWTMHPWERDARMARKALKRGRQAYGLLIELACTRSS  133

Query  413   EELLGARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVL  592
             +ELLGARRAY SL+  SIEED+A  +   ER+LLVALVSSYRY+G K ++   K + + L
Sbjct  134   DELLGARRAYQSLYSESIEEDVASXVDGIERQLLVALVSSYRYDGSKTNDRAIKLDTQKL  193

Query  593   ANAIKHAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQ  772
               +I     K L+ DEEIVRIL+TRSK+HL+A+ K Y+E   K + EDL     LK T+ 
Sbjct  194   XKSISIGDKKQLIKDEEIVRILTTRSKIHLMAVIKCYQETFNKNIIEDLDEESSLKDTIY  253

Query  773   CLCMPQLYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRI  952
             CLC P  YFSKILD++++   ++  ++++TRVIVTRA+ DMK I  E+  +Y   L+ +I
Sbjct  254   CLCXPPQYFSKILDSAMKANANKNEKEALTRVIVTRANVDMKDIAXEYDRQYKTXLTQKI  313

Query  953   GEVANGSYKELLLTLVAKS  1009
              +VA G+ K+ L+TLV ++
Sbjct  314   EDVALGNXKDFLVTLVQRA  332



>gb|ACU19707.1| unknown [Glycine max]
Length=220

 Score =   258 bits (659),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 138/218 (63%), Positives = 175/218 (80%), Gaps = 2/218 (1%)
 Frame = +2

Query  74   MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKST-HQFFRDDERQFERWDD  250
            MA + + + +T+AFSG GVDEK+ V++L KW+P  R+S+RK T H F  D ER F+RWDD
Sbjct  1    MAFNQELEAVTQAFSGHGVDEKSLVTLLGKWDPLERESFRKKTPHLFSEDHERHFQRWDD  60

Query  251  HHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEP-QFDLLIETACTRPSEELLG  427
             +V  L+ EF+R K+AVVL+ MHPWERDARL KEAL K P ++ +LIE ACTR SEELLG
Sbjct  61   QYVRLLKHEFVRFKNAVVLWTMHPWERDARLVKEALKKGPNEYGVLIEVACTRSSEELLG  120

Query  428  ARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIK  607
            AR+AYHSLFDHSIEED+A HI   ERKLLVAL+S+YRYEG KV +D AKSEAK L+NAI+
Sbjct  121  ARKAYHSLFDHSIEEDVASHIHGIERKLLVALLSAYRYEGTKVKDDTAKSEAKTLSNAIR  180

Query  608  HAGNKNLVDDEEIVRILSTRSklhllalykhykEITGK  721
            +A  K L +D+E++RIL+TRSKLH+ A+ KHYKEI+G+
Sbjct  181  NAHKKPLNEDDEVIRILATRSKLHIQAVCKHYKEISGR  218



>ref|XP_010231454.1| PREDICTED: annexin D4 [Brachypodium distachyon]
Length=316

 Score =   261 bits (666),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 149/318 (47%), Positives = 214/318 (67%), Gaps = 9/318 (3%)
 Frame = +2

Query  80    VSDDHKILTKAFSGLG---VDEKAFVSVLAKW--NPKHRQSYRKSTHQFFRDDERQFERW  244
             ++D+ + LTKAFSGLG   VDE   VS LA+W   P+ R  +RKS    F++     ER 
Sbjct  1     MADEVQALTKAFSGLGGLGVDETTMVSTLAQWRKQPEKRSGFRKSFRGLFKE-HGVIERC  59

Query  245   DDHHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFDLLIETACTRPSEELL  424
             +D ++L L  EF R K+ +VL+ MHPWERDARL    L +     + +E ACTR +E+LL
Sbjct  60    EDEYMLHLAAEFSRFKNLMVLWAMHPWERDARLAHHVLHQAHPPAIAVEIACTRSAEDLL  119

Query  425   GARRAYHSLFDHSIEEDIAFHIQ-TPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANA  601
             GAR+AY +LF HS+EED+AFH +  P   LLV LVS+YRYEGPKV+ED AK+EAK L  A
Sbjct  120   GARKAYQALFHHSLEEDVAFHAKDKPYCSLLVGLVSAYRYEGPKVNEDTAKAEAKALGAA  179

Query  602   IKHAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHA-HLLLKQTVQCL  778
             +K       V++ E+VRIL+TRSK HL+  +KHYKE+ GK + EDL +   L+++ VQCL
Sbjct  180   LKKK-EAAAVENGEVVRILTTRSKPHLVETFKHYKELHGKHIHEDLGSEETLIREAVQCL  238

Query  779   CMPQLYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGE  958
               P++YFS++++A+LR G D   ++++ RV VTR+D DM  I+  ++ ++G  L D +  
Sbjct  239   AAPEMYFSQVMEAALREGADHHGKEALARVAVTRSDVDMDGIRAAYQEQFGARLEDAVAA  298

Query  959   VANGSYKELLLTLVAKSE  1012
              A+G +K+ LL+L+A  +
Sbjct  299   CAHGHFKDALLSLIAGGK  316



>ref|XP_004962223.1| PREDICTED: annexin D4-like isoform X1 [Setaria italica]
Length=371

 Score =   262 bits (669),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 148/322 (46%), Positives = 217/322 (67%), Gaps = 12/322 (4%)
 Frame = +2

Query  65    SSKMAVSDDHKILTKAFSGLG---VDEKAFVSVLAKW--NPKHRQSYRKSTHQFFRDDER  229
             ++  A+ D+ + LT+AFSGLG   VDE   VS LA+W   P+ R  +RK    FF+    
Sbjct  48    TTNEAMEDEVQQLTRAFSGLGGLGVDEPTMVSALARWRRQPEKRSGFRKGFPGFFKS-HG  106

Query  230   QFERWDDHHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFDLLIETACTRP  409
             + +R ++ ++L L  EF R K+ +VL+ MHPWERDARL    L +     +++E ACTR 
Sbjct  107   EIDRCEEEYMLHLAAEFARFKNLMVLWAMHPWERDARLAHHVLHQHHPSAIVVEVACTRS  166

Query  410   SEELLGARRAYHSLFDHSIEEDIAFHIQ-TPERKLLVALVSSYRYEGPKVHEDVAKSEAK  586
             ++ELLGARRAY +LF HS+EED+A+  +  P   LLV LVS+YRYEGP+V+E+VA++EAK
Sbjct  167   ADELLGARRAYQALFHHSLEEDVAYRARDKPYCNLLVGLVSAYRYEGPRVNEEVARAEAK  226

Query  587   VLANAIKHAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHL---LL  757
              L  A+K AG K L +++E+VRIL+TRSK HL+  +K+YKE+ G+ ++EDL AH     L
Sbjct  227   ALGAAVKSAGGK-LAENDEVVRILTTRSKPHLVETFKYYKEMHGRRIEEDL-AHGNEETL  284

Query  758   KQTVQCLCMPQLYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVA  937
              +TV CL  P  YFS++++ +LR G D   ++++TRV VTR+D DM  I+  ++ ++G  
Sbjct  285   LETVLCLAAPAKYFSQVMEGALRDGADHHGKEALTRVAVTRSDHDMDEIRAAYQEQFGAK  344

Query  938   LSDRIGEVANGSYKELLLTLVA  1003
             L D I   A+G Y++ LL+LV 
Sbjct  345   LEDAIAAKAHGHYRDALLSLVG  366



>ref|XP_004962224.1| PREDICTED: annexin D4-like isoform X2 [Setaria italica]
Length=319

 Score =   260 bits (664),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 147/317 (46%), Positives = 214/317 (68%), Gaps = 12/317 (4%)
 Frame = +2

Query  80    VSDDHKILTKAFSGLG---VDEKAFVSVLAKW--NPKHRQSYRKSTHQFFRDDERQFERW  244
             + D+ + LT+AFSGLG   VDE   VS LA+W   P+ R  +RK    FF+    + +R 
Sbjct  1     MEDEVQQLTRAFSGLGGLGVDEPTMVSALARWRRQPEKRSGFRKGFPGFFKS-HGEIDRC  59

Query  245   DDHHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFDLLIETACTRPSEELL  424
             ++ ++L L  EF R K+ +VL+ MHPWERDARL    L +     +++E ACTR ++ELL
Sbjct  60    EEEYMLHLAAEFARFKNLMVLWAMHPWERDARLAHHVLHQHHPSAIVVEVACTRSADELL  119

Query  425   GARRAYHSLFDHSIEEDIAFHIQ-TPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANA  601
             GARRAY +LF HS+EED+A+  +  P   LLV LVS+YRYEGP+V+E+VA++EAK L  A
Sbjct  120   GARRAYQALFHHSLEEDVAYRARDKPYCNLLVGLVSAYRYEGPRVNEEVARAEAKALGAA  179

Query  602   IKHAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHL---LLKQTVQ  772
             +K AG K L +++E+VRIL+TRSK HL+  +K+YKE+ G+ ++EDL AH     L +TV 
Sbjct  180   VKSAGGK-LAENDEVVRILTTRSKPHLVETFKYYKEMHGRRIEEDL-AHGNEETLLETVL  237

Query  773   CLCMPQLYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRI  952
             CL  P  YFS++++ +LR G D   ++++TRV VTR+D DM  I+  ++ ++G  L D I
Sbjct  238   CLAAPAKYFSQVMEGALRDGADHHGKEALTRVAVTRSDHDMDEIRAAYQEQFGAKLEDAI  297

Query  953   GEVANGSYKELLLTLVA  1003
                A+G Y++ LL+LV 
Sbjct  298   AAKAHGHYRDALLSLVG  314



>dbj|BAG93789.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96853.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87291.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC79129.1| hypothetical protein OsI_19777 [Oryza sativa Indica Group]
Length=319

 Score =   259 bits (663),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 146/319 (46%), Positives = 214/319 (67%), Gaps = 8/319 (3%)
 Frame = +2

Query  80    VSDDHKILTKAFSGLG---VDEKAFVSVLAKW--NPKHRQSYRKSTHQFFRDDERQFERW  244
             ++D+ + LT+AFSGLG   VDE A VS LAKW   P+    +RKS + FF+D     E+ 
Sbjct  1     MADEIQHLTRAFSGLGGLGVDEPAMVSALAKWRRQPEKLSGFRKSFNGFFKDHGGVIEKC  60

Query  245   DDHHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFDLLIETACTRPSEELL  424
             ++ ++L L  EF R K+ +V++ MHPWERDARL    L +     +++E ACTR +EELL
Sbjct  61    EEEYMLHLAAEFSRFKNLMVMWAMHPWERDARLAHHVLHQAHPAAIVVEIACTRTAEELL  120

Query  425   GARRAYHSLFDHSIEEDIAFHIQ-TPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANA  601
             GAR+AY +LF HS+EED+A+  +  P   LLV LVS+YRYEGP+V E+ A++EAK L  A
Sbjct  121   GARKAYQALFHHSLEEDVAYRARDKPYCGLLVGLVSAYRYEGPRVSEETARAEAKALVAA  180

Query  602   IKHAGN--KNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQC  775
             +K AG+    LV+++++VRIL+TRSK HL+  +KHYKEI G+ ++EDL     L++   C
Sbjct  181   VKSAGHAAAKLVENDDVVRILTTRSKPHLVETFKHYKEIHGRHIEEDLGHEETLREAALC  240

Query  776   LCMPQLYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIG  955
             L  P  YFS+++ A++  G D  A++++TRV VTRAD DM  I+  +  ++G  L D + 
Sbjct  241   LATPARYFSEVVAAAVSDGADHHAKEALTRVAVTRADVDMDAIRAAYHEQFGGRLEDAVA  300

Query  956   EVANGSYKELLLTLVAKSE  1012
               A+G Y++ LL+LVA  +
Sbjct  301   GKAHGYYRDALLSLVAGGK  319



>gb|KDO83191.1| hypothetical protein CISIN_1g021607mg [Citrus sinensis]
Length=219

 Score =   254 bits (650),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 133/212 (63%), Positives = 170/212 (80%), Gaps = 2/212 (1%)
 Frame = +2

Query  101  LTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVLQLRQEF  280
            L KAFSG GVDEK  +S+L    P+HRQ++RK    FF +DER+FERW+DHHV  L+ EF
Sbjct  7    LIKAFSGHGVDEKTVISILGNSQPEHRQAFRKEG-GFFAEDERRFERWNDHHVKLLKHEF  65

Query  281  LRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGARRAYHSLFD  457
            +R K+AVVL+ MHPWERDARL KEAL K P  + +++E A TR S+ELLGAR+AYHSLF+
Sbjct  66   MRFKNAVVLWAMHPWERDARLIKEALKKGPNSNSVIVEIASTRSSDELLGARKAYHSLFE  125

Query  458  HSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGNKNLVDD  637
            HSIEED+A HI   E+KLLVALVS+YRYEGPKV EDVAKSEAK L +A+K+A  +N +++
Sbjct  126  HSIEEDVASHIHGKEKKLLVALVSAYRYEGPKVKEDVAKSEAKALISAVKNAEKQNPIEN  185

Query  638  EEIVRILSTRSklhllalykhykEITGKFLDE  733
            +E+VRILSTRSK HL +++KHYKEI G+  ++
Sbjct  186  DEVVRILSTRSKPHLKSVFKHYKEIAGQHFED  217



>gb|EMS49319.1| Annexin D4 [Triticum urartu]
Length=315

 Score =   256 bits (653),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 145/313 (46%), Positives = 212/313 (68%), Gaps = 7/313 (2%)
 Frame = +2

Query  80   VSDDHKILTKAFSGLG---VDEKAFVSVLAKW--NPKHRQSYRKSTHQFFRDDERQFERW  244
            ++D+ + LTKAFSGLG   VDE   V+ LA W   P+ R  +R+S    F++ +   ER 
Sbjct  1    MADEVQALTKAFSGLGGLGVDEPTMVAALANWRRQPEKRSGFRRSFPGLFKE-QGVIERC  59

Query  245  DDHHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFDLLIETACTRPSEELL  424
            +D ++L+L  EF R K+ +VL+ MHPWERDARL    L +     +L+E ACTR +EELL
Sbjct  60   EDEYMLRLAAEFSRFKNLMVLWAMHPWERDARLAHHVLHQAHPAAILVEVACTRSAEELL  119

Query  425  GARRAYHSLFDHSIEEDIAFHIQ-TPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANA  601
            GAR+AY +LF HS+EED+A+  +  P   LLV LVS+YRYEGPKV +D AK+EAK L  A
Sbjct  120  GARKAYMALFHHSLEEDVAYRAKDKPYCSLLVGLVSAYRYEGPKVSDDTAKAEAKALGAA  179

Query  602  IKHAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLC  781
            +K A    LV++EE+VRIL+TRSK HL+  +K+YKE+ GK + EDL +   L++ V+CL 
Sbjct  180  VKGAAGGRLVENEEVVRILTTRSKPHLVQTFKYYKELHGKHIQEDLGSEEALREAVRCLA  239

Query  782  MPQLYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEV  961
             P+ YFS+++ A+LR G D   ++++ RV VTR+D DM  I+  ++ ++G  L D +   
Sbjct  240  TPERYFSQVMAAALREGADHHGKEALARVAVTRSDVDMDAIRAAYQEQFGAKLEDAVAGS  299

Query  962  ANGSYKELLLTLV  1000
            A+G +K+ L++L+
Sbjct  300  AHGHFKDALVSLI  312



>ref|XP_002465256.1| hypothetical protein SORBIDRAFT_01g035050 [Sorghum bicolor]
 gb|EER92254.1| hypothetical protein SORBIDRAFT_01g035050 [Sorghum bicolor]
Length=370

 Score =   254 bits (648),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 144/329 (44%), Positives = 208/329 (63%), Gaps = 8/329 (2%)
 Frame = +2

Query  44    PTLNSANSSKMAVSDDHKILTKAFSGLG---VDEKAFVSVLAKW--NPKHRQSYRKSTHQ  208
             P      +   A++D+H+ LT+AF+GLG   VDE A VSVL +W   P+ R  +R+    
Sbjct  42    PQSKEKEAPPAAMADEHQDLTRAFAGLGGLGVDETALVSVLGRWRRQPEKRAQFRRGFLG  101

Query  209   FFRDDERQ---FERWDDHHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD  379
             FF          ER +D ++L L+ EF R KDA VL+ MHPWERDAR     L K     
Sbjct  102   FFSASAGAGAGIERCEDEYLLHLKAEFARFKDAAVLWAMHPWERDARWAHHVLHKAHPPQ  161

Query  380   LLIETACTRPSEELLGARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVH  559
             +L+E ACTR +++LLGARRAY +L+  S+EED+A+ ++     LLV LVS+YRYEG +V 
Sbjct  162   VLVEVACTRAADDLLGARRAYQALYHRSLEEDVAYRVRDANASLLVGLVSAYRYEGARVS  221

Query  560   EDVAKSEAKVLANAIKHAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDL  739
             ED+A  EAK LA A++ A    LV +E++VR+L+TRSK  L A ++ Y E+ GK L+EDL
Sbjct  222   EDLATEEAKALAAAVRAAPAAKLVQNEQVVRVLATRSKPQLRATFRVYMELHGKPLEEDL  281

Query  740   HAHLLLKQTVQCLCMPQLYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFK  919
              A   L++ V+CL  P  YFS+++  + R   D  A+ ++TRV+V+RAD DM+ IK  + 
Sbjct  282   AAEPCLREAVKCLDSPPRYFSEVISRAFRDDADRQAKAALTRVVVSRADTDMEDIKDAYA  341

Query  920   TKYGVALSDRIGEVANGSYKELLLTLVAK  1006
              +YG  L+D + +  +G YK+ LL ++ K
Sbjct  342   RQYGAKLADAVAKNTHGHYKDALLAIIGK  370



>gb|AAT38062.1| unknown protein [Oryza sativa Japonica Group]
Length=336

 Score =   248 bits (633),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 146/336 (43%), Positives = 215/336 (64%), Gaps = 25/336 (7%)
 Frame = +2

Query  80    VSDDHKILTKAFSGLG---VDEKAFVSVLAKW--NPKHRQSYRKSTHQFFRDDERQFERW  244
             ++D+ + LT+AFSGLG   VDE A VS LAKW   P+    +RKS + FF+D     E+ 
Sbjct  1     MADEIQHLTRAFSGLGGLGVDEPAMVSALAKWRRQPEKLSGFRKSFNGFFKDHGGVIEKC  60

Query  245   DDHHVLQLRQEFLRL-----------------KDAVVLYMMHPWERDARLFKEALLKEPQ  373
             ++ ++L L  EF RL                 ++ +V++ MHPWERDARL    L +   
Sbjct  61    EEEYMLHLAAEFSRLSMEMELIGLLWLCLFTVQNLMVMWAMHPWERDARLAHHVLHQAHP  120

Query  374   FDLLIETACTRPSEELLGARRAYHSLFDHSIEEDIAFHIQ-TPERKLLVALVSSYRYEGP  550
               +++E ACTR +EELLGAR+AY +LF HS+EED+A+  +  P   LLV LVS+YRYEGP
Sbjct  121   AAIVVEIACTRTAEELLGARKAYQALFHHSLEEDVAYRARDKPYCGLLVGLVSAYRYEGP  180

Query  551   KVHEDVAKSEAKVLANAIKHAGNK--NLVDDEEIVRILSTRSklhllalykhykEITGKF  724
             +V E+ A++EAK L  A+K AG+    LV+++++VRIL+TRSK HL+  +KHYKEI G+ 
Sbjct  181   RVSEETARAEAKALVAAVKSAGHAAAKLVENDDVVRILTTRSKPHLVETFKHYKEIHGRH  240

Query  725   LDEDLHAHLLLKQTVQCLCMPQLYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHI  904
             ++EDL     L++   CL  P  YFS+++ A++  G D  A++++TRV VTRAD DM  I
Sbjct  241   IEEDLGHEETLREAALCLATPARYFSEVVAAAVSDGADHHAKEALTRVAVTRADVDMDAI  300

Query  905   KQEFKTKYGVALSDRIGEVANGSYKELLLTLVAKSE  1012
             +  +  ++G  L D +   A+G Y++ LL+LVA  +
Sbjct  301   RAAYHEQFGGRLEDAVAGKAHGYYRDALLSLVAGGK  336



>gb|ACF85171.1| unknown [Zea mays]
 gb|ACF85861.1| unknown [Zea mays]
 gb|AFW77830.1| hypothetical protein ZEAMMB73_290811 [Zea mays]
Length=324

 Score =   242 bits (617),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 141/320 (44%), Positives = 203/320 (63%), Gaps = 10/320 (3%)
 Frame = +2

Query  80    VSDDHKILTKAFSGLG---VDEKAFVSVLAKW--NPKHRQSYRKSTHQFFRDDERQFERW  244
             ++D+ + LT+AFSGLG   VDE A VS LA+W   P+ R ++RK    FF       +R 
Sbjct  1     MADEVQQLTRAFSGLGGLGVDEPAMVSALARWRGQPEKRSAFRKGFPGFFSSHGGDMDRR  60

Query  245   DDHHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFDLLI--ETACTRPSEE  418
             ++ ++L L  EF R +D VVL+  HPWERDARL    L         +  E AC R ++E
Sbjct  61    EEEYMLHLAAEFARFRDLVVLWATHPWERDARLAHHVLHHHHHHPPAVVVEVACARSADE  120

Query  419   LLGARRAYHSLFDHSIEEDIAFHIQ-TPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLA  595
             LLGARRAY +LF  S+EED+A   +  P   LLV LVS+YRYEGP+V ++VAK+EA+ L 
Sbjct  121   LLGARRAYQALFHRSLEEDVAHRARDKPYCSLLVGLVSAYRYEGPRVDKEVAKAEAEALG  180

Query  596   NAIKHAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDL--HAHLLLKQTV  769
              A+K AGN  LV+++E++RIL+TRSK HL+  + +YKE+ G+ ++EDL       L +TV
Sbjct  181   AAVKRAGNGKLVENDEVLRILTTRSKPHLVQTFMYYKEMHGRHVEEDLRQRGEETLLETV  240

Query  770   QCLCMPQLYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDR  949
              CL  P  YFS++++ +LR   D   ++++TRV VTR+D DM  I+  +  ++G  L D 
Sbjct  241   LCLVAPAKYFSQVIEGALRDSADHHGKEALTRVAVTRSDHDMDDIRAAYHQQFGAKLEDV  300

Query  950   IGEVANGSYKELLLTLVAKS  1009
             I   A+G Y++ LL+LV   
Sbjct  301   IAAKAHGHYRDALLSLVGAG  320



>ref|XP_006654341.1| PREDICTED: annexin D4-like [Oryza brachyantha]
Length=319

 Score =   239 bits (611),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 143/319 (45%), Positives = 207/319 (65%), Gaps = 8/319 (3%)
 Frame = +2

Query  80    VSDDHKILTKAFSGLG---VDEKAFVSVLAKW--NPKHRQSYRKSTHQFFRDDERQFERW  244
             ++D+ + LT+AFSGLG   VDE A VS LAKW   P+    +RKS +  F+D     ER 
Sbjct  1     MADEIQHLTRAFSGLGGLGVDEPAMVSALAKWRRQPEKLSGFRKSFNGLFKDHAGVIERC  60

Query  245   DDHHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFDLLIETACTRPSEELL  424
             ++ ++L L  EF R K+ +V++ MHPWERDARL    L +     +++E ACTR +EELL
Sbjct  61    EEEYMLHLAAEFSRFKNLMVMWAMHPWERDARLAHHVLHQAHPAAIVVEVACTRTAEELL  120

Query  425   GARRAYHSLFDHSIEEDIAFHIQ-TPERKLLVALVSSYRYEGPKVHEDV--AKSEAKVLA  595
             GAR+AY +LF HS+EED+A+  +  P   LLV LVS+YRYEGP+V E+   A+++A   A
Sbjct  121   GARKAYQALFHHSLEEDVAYRARDKPYCGLLVGLVSAYRYEGPRVSEETARAEAKALAAA  180

Query  596   NAIKHAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQC  775
                       LV+++E+VRIL+TRSK HL+  +KHYKEI G+ ++EDL     L++ V C
Sbjct  181   VKGAGGAAAKLVENDEVVRILTTRSKPHLVETFKHYKEIHGRHIEEDLGHEETLREAVLC  240

Query  776   LCMPQLYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIG  955
             L  P  YFS+++ A+L  G D  A++++TRV VTRAD DM  I+  +  ++G  L D + 
Sbjct  241   LATPAKYFSQVMAAALSDGADHHAKEALTRVAVTRADVDMDGIRAAYHEQFGGKLEDAVA  300

Query  956   EVANGSYKELLLTLVAKSE  1012
               A+G Y++ LL+LVA  +
Sbjct  301   GKAHGYYRDALLSLVAGGK  319



>ref|XP_008647843.1| PREDICTED: annexin-like protein RJ4 isoform X1 [Zea mays]
 tpg|DAA45431.1| TPA: hypothetical protein ZEAMMB73_023532 [Zea mays]
Length=365

 Score =   240 bits (612),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 140/326 (43%), Positives = 205/326 (63%), Gaps = 8/326 (2%)
 Frame = +2

Query  53    NSANSSKMAVSDDHKILTKAFSGLG---VDEKAFVSVLAKW--NPKHRQSYRKSTHQFFR  217
             N    +   ++D+H+ LT+AF+GLG   VDE A VS L +W   P+ R  +R+    FF 
Sbjct  40    NKEKEAPPPMADEHQDLTRAFAGLGGLGVDETALVSALGRWRREPEKRAQFRRGFPGFFS  99

Query  218   DDERQ-FERWDDHHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFDLLIET  394
                    ER +D ++L L+ EF R KDA VL+ MHPWERDAR     L K     +L+E 
Sbjct  100   SSAGAGIERCEDEYLLHLKAEFARFKDAAVLWAMHPWERDARWAHHVLHKAHPPHILVEV  159

Query  395   ACTRPSEELLGARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAK  574
             ACTR +++LLGARRAY +L+  S+EED+A+ ++     LL+ LVS+YRYEG +V+ED+A 
Sbjct  160   ACTRTADDLLGARRAYQALYHRSLEEDVAYRVRDANASLLLGLVSAYRYEGARVNEDLAT  219

Query  575   SEAKVLANAIKHAGNK--NLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAH  748
              EAK LA A++ A      LV +E++VR+L TRSK  L A ++ Y E+ GK L+E+L A 
Sbjct  220   EEAKALAAAVRAAPAAATKLVQNEQVVRVLVTRSKPQLGATFRVYMELHGKPLEEELPAE  279

Query  749   LLLKQTVQCLCMPQLYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKY  928
               L++ V+CL  P  YFS+++  +     D  A+ ++TRV+V+RAD DM+ IK  +  +Y
Sbjct  280   PCLREAVRCLDSPPKYFSEVIHRAFSDDADRQAKAALTRVLVSRADTDMEDIKDAYTRQY  339

Query  929   GVALSDRIGEVANGSYKELLLTLVAK  1006
             G  L+D + +  +G YKE LL ++ K
Sbjct  340   GTKLADAVAKNTHGHYKEALLAIIGK  365



>ref|XP_010659176.1| PREDICTED: annexin D4-like isoform X2 [Vitis vinifera]
Length=331

 Score =   235 bits (600),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 144/335 (43%), Positives = 206/335 (61%), Gaps = 29/335 (9%)
 Frame = +2

Query  26    SVSMTAPTLNSANSSKMAVSDDHKILTKAFS----GL-GVDEKAFVSVLAKWNPKHRQSY  190
             SV       N    + M+ SD    L K+FS    G+ GVDEK+ + +L KW P+   ++
Sbjct  13    SVKRRKKQTNKEGKTIMSSSD---ALAKSFSVSHSGIFGVDEKSMLEILVKWQPEQLSTF  69

Query  191   RKSTHQFFRDDER-QFERWDDHHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKE  367
             R  T + F  DER  FE+ ++  +  L++EF R KDAVV + MHPWERDAR+ ++AL + 
Sbjct  70    RNETSRIFLKDERFPFEKCEEFLLKFLKREFKRFKDAVVQWTMHPWERDARMARKALKRG  129

Query  368   PQ-FDLLIETACTRPSEELLGARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYE  544
              Q + LLIE ACTR S+ELLGARRAY SL+  SIEED+A  +   ER+ +          
Sbjct  130   RQAYGLLIELACTRSSDELLGARRAYQSLYSESIEEDVASRVDGIERQAI----------  179

Query  545   GPKVHEDVAKSEAKVLANAIKHAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKF  724
                      K + + L  AI     K L+ DEEIVRIL+TRSK+HL+A+ K Y+E   K 
Sbjct  180   ---------KLDTQKLEKAISIGDKKQLIKDEEIVRILTTRSKIHLIAVIKCYQETFNKN  230

Query  725   LDEDLHAHLLLKQTVQCLCMPQLYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHI  904
             + EDL     LK T+ CLC+P  YFSKILD++++   ++  ++++TRVIVTRA+ DMK I
Sbjct  231   IIEDLDEESSLKDTIYCLCVPSQYFSKILDSAMKANANKNEKEALTRVIVTRANVDMKDI  290

Query  905   KQEFKTKYGVALSDRIGEVANGSYKELLLTLVAKS  1009
              +E+  +Y   L+ +I +VA G+YK+ L+TLV ++
Sbjct  291   AEEYDRQYKTPLTQKIEDVALGNYKDFLVTLVQRA  325



>ref|XP_010646340.1| PREDICTED: annexin D4-like [Vitis vinifera]
Length=247

 Score =   230 bits (586),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 122/244 (50%), Positives = 173/244 (71%), Gaps = 1/244 (0%)
 Frame = +2

Query  281   LRLKDAVVLYMMHPWERDARLFKEALLKEPQ-FDLLIETACTRPSEELLGARRAYHSLFD  457
             +R KDAVV + MHPWERDAR+ ++AL +  Q + LLIE ACTR S+ELLGARRAY SL+ 
Sbjct  1     MRFKDAVVQWTMHPWERDARMARKALKRGSQAYGLLIELACTRSSDELLGARRAYQSLYS  60

Query  458   HSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGNKNLVDD  637
              SIEED+A  ++  +R+ LVALVSSYRYEG + ++   +S+A+ L  A+++     L+ D
Sbjct  61    ESIEEDVACRVEGIQRQFLVALVSSYRYEGSRKNDAAIESDAQKLNKAVRNGDKTMLIKD  120

Query  638   EEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMPQLYFSKILDA  817
             EEIVRIL+TRSK HL  ++K Y     + + EDL     LK T+ CLC PQ+YFSKILD+
Sbjct  121   EEIVRILTTRSKPHLKEVFKCYYYDFDRDIVEDLGEESGLKDTIYCLCAPQVYFSKILDS  180

Query  818   SLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVANGSYKELLLTL  997
             +++    +  ++++TRVIVTR D DMK I +E+  +YG  L+ +I +VA G+YK+ L+TL
Sbjct  181   AMKANATKNEQEALTRVIVTRTDVDMKDIAEEYNKQYGTPLAKKIEDVAIGNYKDFLVTL  240

Query  998   VAKS  1009
             V ++
Sbjct  241   VQRA  244



>ref|XP_003557848.1| PREDICTED: annexin D4-like [Brachypodium distachyon]
Length=362

 Score =   233 bits (595),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 138/336 (41%), Positives = 205/336 (61%), Gaps = 26/336 (8%)
 Frame = +2

Query  53    NSANSSKMAVSDDHKILTKAFSGLG---VDEKAFVSVLAKW--NPKHRQSYRKSTHQFFR  217
              S N    A++D+ + LT+AFSGLG   V+E A VS L +W   P+ R S+R+    FF 
Sbjct  35    QSVNKEAAAMADEQQELTRAFSGLGGLGVEETALVSALGRWRKQPEKRASFRRGFPGFFS  94

Query  218   ------DDERQFERWDDHHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD  379
                         ER +D +V  L+ EF R K+ +VL+ MHPWERDAR    AL K  +  
Sbjct  95    PAPTASGGAITIERCEDEYVRHLKTEFSRFKNLMVLWAMHPWERDARWAHRALHKHKKHQ  154

Query  380   ----LLIETACTRPSEELLGARRAYHSLFDHSIEEDIAFHI-QTPERKLLVALVSSYRYE  544
                 +L+E ACTR +EELLGARRAYH+L+  S+EED+A+ + +T    LLV LV++YRYE
Sbjct  155   GSGCILVELACTRSAEELLGARRAYHALYSRSLEEDVAYRLKETEHAGLLVGLVAAYRYE  214

Query  545   GPKVHEDVAKSEAKVLANAIKHAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKF  724
             G +V ED+A  EA    NAI      N    E + R+L+TRSK  L A ++ Y+EI GK 
Sbjct  215   GARVSEDLATEEA----NAISAKPGNN----EVLARVLATRSKPQLRATFRIYREIHGKP  266

Query  725   LDEDLHA--HLLLKQTVQCLCMPQLYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMK  898
             L+EDL A   + L++ V+CL  P  YF +++  + + G D+ A+ ++TRV+V+R++ DM+
Sbjct  267   LEEDLIAVGGICLQEAVRCLDAPAKYFGEVIAGAFKEGADKQAKAALTRVVVSRSEADME  326

Query  899   HIKQEFKTKYGVALSDRIGEVANGSYKELLLTLVAK  1006
              IK+ +  ++G  L D + +  +G Y++ LL ++ K
Sbjct  327   EIKEAYVKQHGAKLVDAVAKNTHGHYRDALLAMIGK  362



>ref|XP_003633532.2| PREDICTED: annexin D4-like [Vitis vinifera]
Length=264

 Score =   229 bits (584),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 131/260 (50%), Positives = 180/260 (69%), Gaps = 5/260 (2%)
 Frame = +2

Query  74   MAVSDDHKILTKAFSG-LGVDEKAFVSVLAKWNPKHRQSYR-KSTHQFFRDDERQFERWD  247
            M++ +  + L KAFSG LGVDEK+ + +L KW+P+   ++R +S+  F +D    FERW 
Sbjct  1    MSLPNKSRTLAKAFSGILGVDEKSMMEILVKWHPEDLTTFRNESSSIFLKDKYFLFERWQ  60

Query  248  DHHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQ-FDLLIETACTRPSEELL  424
            D+H+  L +EFLR +D VV + MHPWERDAR+ ++AL   PQ + LLIE ACTR S+ELL
Sbjct  61   DYHIAFLVKEFLRFQDVVVQWTMHPWERDARMARKALDGRPQAYGLLIELACTRSSDELL  120

Query  425  GARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAI  604
            GAR+AY SL+  SIEEDIA  ++  ER+LLVALVS+YRYEG ++++   +SEA  L   I
Sbjct  121  GARKAYQSLYVESIEEDIASRVEGIERQLLVALVSTYRYEGSRINDVAVRSEAIKLGITI  180

Query  605  -KHAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLC  781
             +H   K L  DEEIVRIL+TRSK HL A++K YKE   K ++EDL     LK  + CL 
Sbjct  181  NRHGDKKKLFKDEEIVRILATRSKPHLKAVFKCYKETFNKNIEEDLD-ETSLKDIIYCLY  239

Query  782  MPQLYFSKILDASLRLGVDE  841
             P +YFSKILD++++   ++
Sbjct  240  APPMYFSKILDSTMKANANK  259



>ref|XP_003634963.2| PREDICTED: annexin D4-like isoform X1 [Vitis vinifera]
Length=272

 Score =   227 bits (579),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 129/266 (48%), Positives = 180/266 (68%), Gaps = 7/266 (3%)
 Frame = +2

Query  101  LTKAFS----GL-GVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDER-QFERWDDHHVL  262
            L K+FS    GL GVDEK+ + +L KW P+H  ++R  T   F  DER  FE+ ++  + 
Sbjct  7    LAKSFSVSHSGLFGVDEKSILEILVKWQPEHLSTFRNETSSIFLKDERFSFEKCEEILLK  66

Query  263  QLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQ-FDLLIETACTRPSEELLGARRA  439
             L++EF R KD VV + MHPWERDA   ++AL +  Q + LLIE ACTR S+ELLGARRA
Sbjct  67   FLKREFKRFKDVVVQWTMHPWERDALKARKALKRGNQAYGLLIELACTRSSDELLGARRA  126

Query  440  YHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGN  619
            Y SL+  SIEED+A  ++  +R+ LVALVSSYRYEG ++++   +S+A+ L  AI++   
Sbjct  127  YQSLYSESIEEDVACRVEGIQRQFLVALVSSYRYEGSRMNDVAIESDAQKLNKAIRNGDK  186

Query  620  KNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMPQLYF  799
              L+ DEEIVRIL+TRSK HL A++K Y +  GK + EDL     LK T+ CLC P  YF
Sbjct  187  TMLIKDEEIVRILTTRSKPHLEAVFKCYYDDFGKDIAEDLGEESGLKDTIYCLCAPPTYF  246

Query  800  SKILDASLRLGVDEAARDSVTRVIVT  877
            SKILD++++    +  ++++TRVI+T
Sbjct  247  SKILDSTMKANASKNEKEALTRVIIT  272



>dbj|BAH57010.1| AT2G38750 [Arabidopsis thaliana]
Length=226

 Score =   215 bits (548),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 122/220 (55%), Positives = 162/220 (74%), Gaps = 6/220 (3%)
 Frame = +2

Query  74   MAVSDDHKILTKAFS---GLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFF-RDDERQFER  241
            MA+  + + LT+A S   G+GVDE A +S L K   +HR+ +RK++  FF  D+ER FE+
Sbjct  1    MALPLELESLTEAISAGMGMGVDENALISTLGKSQKEHRKLFRKASKSFFVEDEERAFEK  60

Query  242  WDDHHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLK-EPQFDLLIETACTRPSEE  418
              DH V  L+ EF R   AVV++ MHPWERDARL K+AL K E  ++L++E +CTR +E+
Sbjct  61   CHDHFVRHLKLEFSRFNTAVVMWAMHPWERDARLVKKALKKGEEAYNLIVEVSCTRSAED  120

Query  419  LLGARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLAN  598
            LLGAR+AYHSLFD S+EEDIA H+  P+RKLLV LVS+YRYEG KV +D AKS+AK+LA 
Sbjct  121  LLGARKAYHSLFDQSMEEDIASHVHGPQRKLLVGLVSAYRYEGNKVKDDSAKSDAKILAE  180

Query  599  AIKHAGNKNLVDDEEIVRILSTRSklhllalykhykEITG  718
            A+  +G +  V+ +E+VRIL+TRSKLHL  LYKH+ EI G
Sbjct  181  AVASSGEEA-VEKDEVVRILTTRSKLHLQHLYKHFNEIKG  219



>dbj|BAK01609.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=363

 Score =   218 bits (556),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 133/333 (40%), Positives = 202/333 (61%), Gaps = 20/333 (6%)
 Frame = +2

Query  44    PTLNSANSSKMAVSDDHKILTKAFSG---LGVDEKAFVSVLAKW--NPKHRQSYRKSTHQ  208
             P+  +    +  ++D+H+ LTKAFSG   LGV+E A VS L +W   P+ R  +R+    
Sbjct  39    PSQTTVKDKEATMADEHQELTKAFSGMGGLGVEETALVSALGRWRKQPEKRAQFRRGFPG  98

Query  209   FF----RDDERQFERWDDHHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQ-  373
             FF           ER  D +V  L+ EF R K  +VL+ MHPWERDAR    AL K+   
Sbjct  99    FFTPAAAAGAGAIERCSDDYVSHLKTEFARFKSLMVLWAMHPWERDARWAHRALHKKHHP  158

Query  374   FDLLIETACTRPSEELLGARRAYHSLFDHSIEEDIAFHIQTPE-RKLLVALVSSYRYEGP  550
               +L+E ACTR ++ELLGARRAYH+L+  S+EED+A+ ++  +  +LLV LVS+YRYEGP
Sbjct  159   ASVLVELACTRTADELLGARRAYHALYHRSLEEDVAYRVKDADANRLLVGLVSAYRYEGP  218

Query  551   KVHEDVAKSEAKVLANAIKHAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLD  730
             +V E +A+ EA  LA A   +        E + R+L+TRSK  L A ++ Y+E+ GK L+
Sbjct  219   RVDEGLAREEAAALAGAKAQS--------ELVARVLATRSKPQLRATFRLYRELHGKPLE  270

Query  731   EDLHAHL-LLKQTVQCLCMPQLYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIK  907
             E+       L++ V+CL  P  YF +++D + + G D+ A+ ++TRV+V+R+D DM+ IK
Sbjct  271   EEFGGEAPCLREAVRCLESPARYFGEVIDGAFKEGADKQAKAALTRVVVSRSDADMEEIK  330

Query  908   QEFKTKYGVALSDRIGEVANGSYKELLLTLVAK  1006
               +   +G  L D + +  +G Y++ LL ++ K
Sbjct  331   DAYLKHHGAKLVDAVAKNTHGHYRDALLAMIGK  363



>ref|XP_003634957.2| PREDICTED: annexin D4-like [Vitis vinifera]
Length=265

 Score =   215 bits (547),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 122/249 (49%), Positives = 170/249 (68%), Gaps = 7/249 (3%)
 Frame = +2

Query  101  LTKAFS----GL-GVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDER-QFERWDDHHVL  262
            L K+FS    G+ GVDEK+ + +L KW P+H  ++R  T   F  DER  FE+ ++  + 
Sbjct  7    LAKSFSVSHSGIFGVDEKSMLEILVKWQPEHLSTFRNETSSIFLKDERFPFEKCEEILLK  66

Query  263  QLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQ-FDLLIETACTRPSEELLGARRA  439
             L++EF R KDAVV + MHPWERDAR+ ++AL +  Q + LLIE ACTR S+ELLGARRA
Sbjct  67   FLKREFKRFKDAVVQWTMHPWERDARMARKALKRGSQAYGLLIELACTRSSDELLGARRA  126

Query  440  YHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGN  619
            Y SL+  SIEED+A  ++  +R+ LVALVSSYRYEG + ++   +S+A+ L  AI++   
Sbjct  127  YQSLYSESIEEDVACRVEGIQRQFLVALVSSYRYEGSRKNDVAIESDAQKLNKAIRNGDK  186

Query  620  KNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMPQLYF  799
              L+ DEEIVRIL+TRSK HL+ ++K Y +   K + EDL     LK T+ CLC   +YF
Sbjct  187  TMLIKDEEIVRILTTRSKSHLVEVFKCYYDDFDKDIAEDLGEESGLKDTIYCLCAAPVYF  246

Query  800  SKILDASLR  826
            SKILD++++
Sbjct  247  SKILDSAMK  255



>gb|EEE63557.1| hypothetical protein OsJ_18373 [Oryza sativa Japonica Group]
Length=307

 Score =   216 bits (551),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 128/336 (38%), Positives = 191/336 (57%), Gaps = 54/336 (16%)
 Frame = +2

Query  80    VSDDHKILTKAFSGLG---VDEKAFVSVLAKW--NPKHRQSYRKSTHQFFRDDERQFERW  244
             ++D+ + LT+AFSGLG   VDE A VS LAKW   P+    +RKS + FF+D     E+ 
Sbjct  1     MADEIQHLTRAFSGLGGLGVDEPAMVSALAKWRRQPEKLSGFRKSFNGFFKDHGGVIEKC  60

Query  245   DDHHVLQLRQEFLRL-----------------KDAVVLYMMHPWERDARLFKEALLKEPQ  373
             ++ ++L L  EF RL                 ++ +V++ MHPWERDARL    L +   
Sbjct  61    EEEYMLHLAAEFSRLSMEMELIGLLWLCLFTVQNLMVMWAMHPWERDARLAHHVLHQAHP  120

Query  374   FDLLIETACTRPSEELLGARRAYHSLFDHSIEEDIAFHIQ-TPERKLLVALVSSYRYEGP  550
               +++E ACTR +EELLGAR+AY +LF HS+EED+A+  +  P   LLV LVS+YRYEGP
Sbjct  121   AAIVVEIACTRTAEELLGARKAYQALFHHSLEEDVAYRARDKPYCGLLVGLVSAYRYEGP  180

Query  551   KVHEDVAKSEAKVLANAIKHAGN--KNLVDDEEIVRILSTRSklhllalykhykEITGKF  724
             +V E+ A++EAK L  A+K AG+    LV+++++                          
Sbjct  181   RVSEETARAEAKALVAAVKSAGHAAAKLVENDDV--------------------------  214

Query  725   LDEDLHAHLLLKQTVQCLCMPQLYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHI  904
                DL     L++   CL  P  YFS+++ A++  G D  A++++TRV VTRAD DM  I
Sbjct  215   ---DLGHEETLREAALCLATPARYFSEVVAAAVSDGADHHAKEALTRVAVTRADVDMDAI  271

Query  905   KQEFKTKYGVALSDRIGEVANGSYKELLLTLVAKSE  1012
             +  +  ++G  L D +   A+G Y++ LL+LVA  +
Sbjct  272   RAAYHEQFGGRLEDAVAGKAHGYYRDALLSLVAGGK  307



>ref|XP_004986983.1| PREDICTED: annexin D4-like [Setaria italica]
Length=367

 Score =   218 bits (554),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 135/329 (41%), Positives = 204/329 (62%), Gaps = 11/329 (3%)
 Frame = +2

Query  50    LNSANSSKMAVSDDHKILTKAFSGLG---VDEKAFVSVLAKW--NPKHRQSYRKS---TH  205
             +  A    MA +D+ + LT+AF+GLG   VDE A VS L +W   P+ R  +R+      
Sbjct  40    IREAPPPTMA-ADEQQDLTRAFAGLGGLGVDEAALVSALGRWRRQPERRAQFRRGFPGFF  98

Query  206   QFFRDDERQFERWDDHHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQF--D  379
                       ER +D ++  L  EF RLKDA VL+ +HPWERDAR     L         
Sbjct  99    SASAGAAAGIERCEDEYLRHLEDEFARLKDAAVLWALHPWERDARWAHHVLHGGDGHPPG  158

Query  380   LLIETACTRPSEELLGARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVH  559
             +L+E ACTR +++LLGARRAY +L+  S+EED+A+ +      LLV LV++YRYEG +V 
Sbjct  159   VLVEVACTRAADDLLGARRAYQALYHRSLEEDVAYRVNDATAALLVGLVTAYRYEGARVS  218

Query  560   EDVAKSEAKVLANAIKHAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDL  739
             +++A  EAK LA A++ A    LV +E++VRIL+TRSK  L A +K YKE+ GK L+ED 
Sbjct  219   DELAAEEAKALAAAVRAAPAARLVQNEQVVRILATRSKPQLRATFKIYKELHGKPLEEDF  278

Query  740   HAHLLLKQTVQCLCMPQLYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFK  919
                  L++TV+CL  P  +F++++  +LR   D+ A+ ++TRV+V+RAD DM+ +K+ + 
Sbjct  279   AGEPCLQETVRCLDSPPKFFAEVIGRALRGDADKQAKAALTRVVVSRADVDMEEMKETYA  338

Query  920   TKYGVALSDRIGEVANGSYKELLLTLVAK  1006
              ++G  L+D + +  +G YK+ LL ++ K
Sbjct  339   KQHGAKLADAVAKNTHGHYKDALLAMIGK  367



>ref|XP_010659179.1| PREDICTED: annexin D4-like isoform X1 [Vitis vinifera]
Length=251

 Score =   209 bits (533),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 123/243 (51%), Positives = 162/243 (67%), Gaps = 7/243 (3%)
 Frame = +2

Query  101  LTKAFS----GL-GVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDER-QFERWDDHHVL  262
            L K+FS    G+ GVDEK+ + +L KW P+   ++R  T   F  DER  FE+ ++  + 
Sbjct  7    LAKSFSVSHSGIFGVDEKSMLEILVKWQPERLSTFRNETSGIFLQDERFPFEKCEEFLLK  66

Query  263  QLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQ-FDLLIETACTRPSEELLGARRA  439
             L++EF R KDAVV + MHPWERDAR+ ++AL +  Q + LLIE ACTR S+ELLGARRA
Sbjct  67   FLKREFKRFKDAVVQWTMHPWERDARMARKALKRGRQAYGLLIELACTRSSDELLGARRA  126

Query  440  YHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGN  619
            Y SL+  SIEED+A  +   ER+LLVALVSSYRY+G K ++   K +A+ L  AI     
Sbjct  127  YQSLYSESIEEDVASRVDGIERQLLVALVSSYRYDGSKTNDRAIKLDAQKLEKAISIGDK  186

Query  620  KNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMPQLYF  799
            K L+ DEEIVRIL+TRSK+HL+A+ K Y+E     + EDL     LK T+ CLC P  YF
Sbjct  187  KQLIKDEEIVRILTTRSKIHLMAVIKCYQETFNNNIIEDLDEESSLKDTIYCLCAPPQYF  246

Query  800  SKI  808
            +KI
Sbjct  247  NKI  249



>ref|XP_010645980.1| PREDICTED: annexin D4-like isoform X2 [Vitis vinifera]
Length=251

 Score =   208 bits (530),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 122/243 (50%), Positives = 163/243 (67%), Gaps = 7/243 (3%)
 Frame = +2

Query  101  LTKAFS----GL-GVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDER-QFERWDDHHVL  262
            L K+FS    GL GVDEK+ + +L KW P+H  ++R  T   F  DER  FE+ ++  + 
Sbjct  7    LAKSFSVSHSGLFGVDEKSILEILVKWQPEHLSTFRNETSSIFLKDERFSFEKCEEILLK  66

Query  263  QLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQ-FDLLIETACTRPSEELLGARRA  439
             L++EF R KD VV + MHPWERDA   ++AL +  Q + LLIE ACTR S+ELLGARRA
Sbjct  67   FLKREFKRFKDVVVQWTMHPWERDALKARKALKRGNQAYGLLIELACTRSSDELLGARRA  126

Query  440  YHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGN  619
            Y SL+  SIEED+A  ++  +R+ LVALVSSYRYEG ++++   +S+A+ L  AI++   
Sbjct  127  YQSLYSESIEEDVACRVEGIQRQFLVALVSSYRYEGSRMNDVAIESDAQKLNKAIRNGDK  186

Query  620  KNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMPQLYF  799
              L+ DEEIVRIL+TRSK HL A++K Y +  GK + EDL     LK T+ CLC P  YF
Sbjct  187  TMLIKDEEIVRILTTRSKPHLEAVFKCYYDDFGKDIAEDLGEESGLKDTIYCLCAPPTYF  246

Query  800  SKI  808
            SKI
Sbjct  247  SKI  249



>emb|CAN71082.1| hypothetical protein VITISV_042800 [Vitis vinifera]
Length=332

 Score =   206 bits (524),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 132/329 (40%), Positives = 183/329 (56%), Gaps = 64/329 (19%)
 Frame = +2

Query  74   MAVSDDHKILTKAFSG---------------------------------LGVDEKAFVSV  154
            M++ ++ + LTKAFSG                                 LGV+EK+ + +
Sbjct  28   MSLPNESRTLTKAFSGSFSFSLDFIFSKSQTTAFFYIQXVYSSCTYCGILGVNEKSMMEI  87

Query  155  LAKWNPKHRQSYR-KSTHQFFRDDERQFERWDDHHVLQLRQEFLRLKDAVVLYMMHPWER  331
            L KW PK   ++R +S+  F +D    FER  D+ +  L +EFLR +D VV + MHP ER
Sbjct  88   LVKWRPKVLTTFRNESSSIFLKDKYFLFERXQDYXIAFLVKEFLRFQDVVVQWTMHPXER  147

Query  332  DARLFKEALLKEPQ-FDLLIETACTRPSEELLGARRAYHSLFDHSIEEDIAFHIQTPERK  508
            DAR+ ++AL   PQ + LLIE AC + S+ LLGAR+AY SL+  SIEED+A  ++  +R+
Sbjct  148  DARMARKALDXHPQAYGLLIELACIKSSDGLLGARKAYQSLYGESIEEDVASRVEGIKRQ  207

Query  509  LLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAG-NKNLVDDEEIVRILSTRSklhll  685
            LLVALVS+YRYEG ++ +   +SEA  L   I   G  K L  DEEIVRIL+TRSK  L 
Sbjct  208  LLVALVSTYRYEGSRISDVAVRSEAVKLGITINRQGYKKKLFKDEEIVRILATRSKPQL-  266

Query  686  alykhykEITGKFLDEDLHAHLLLKQTVQCLCMPQLYFSKILDASLRLGVDEAARDSVTR  865
                       K LDE       LK T+ CL    +YFSK           E  ++++TR
Sbjct  267  -----------KDLDET-----SLKNTIYCLYAHLMYFSK-----------EDXKEALTR  299

Query  866  VIVTRADEDMKHIKQEFKTKYGVALSDRI  952
            VIVTRA+ D+K I +E+  +YG  L+ +I
Sbjct  300  VIVTRANVDIKDIAEEYNKQYGTPLTKKI  328



>ref|XP_010268092.1| PREDICTED: annexin D1 [Nelumbo nucifera]
Length=316

 Score =   191 bits (484),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 126/319 (39%), Positives = 187/319 (59%), Gaps = 28/319 (9%)
 Frame = +2

Query  86    DDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDE-RQFERWDDHHVL  262
             +D + L KAF G G +EK  +S+LA  N   R+  R++  + + +D  +  ER       
Sbjct  15    EDCEQLRKAFQGWGTNEKLIISILAHRNAAQRKIIRQTYAEKYGEDLLKSLER-------  67

Query  263   QLRQEFLRLKDAVVLYMMHPWERDARLFKEALLK-EPQFDLLIETACTRPSEELLGARRA  439
             +L  +F   +  V+L+ + P +RDA L  EA  K +    +L+E ACTR S ELL AR+A
Sbjct  68    ELTSDF---EIVVLLWTLDPTDRDAFLANEATRKWKATNQVLLEIACTRTSNELLSARQA  124

Query  440   YHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGN  619
             YH+ F  S+EED+A+H     RKLLV LVSSYRYEGP+V+  +AKSEAK+L   IK    
Sbjct  125   YHARFKRSLEEDVAYHTTGDFRKLLVPLVSSYRYEGPEVNTTLAKSEAKILHEKIKEKA-  183

Query  620   KNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHA------HLLLKQTVQCLC  781
                 + E+++RIL+TRSK  L+A + +Y    G  +++DL A         L+  V+CL 
Sbjct  184   ---YNHEDVIRILTTRSKEQLIATFNNYNNDFGNAINKDLKADPKDEFQAALRALVKCLT  240

Query  782   MPQLYFSKILDASLRLGVDEAARD--SVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIG  955
              P+ YF K    +LRL +++   D  ++TR++ TRA  DMK IK+E++ +  V L   IG
Sbjct  241   RPEKYFEK----ALRLAINKNGTDEFALTRIVTTRAGVDMKKIKEEYQRRNSVPLERAIG  296

Query  956   EVANGSYKELLLTLVAKSE  1012
                +G Y+E+LL L+   E
Sbjct  297   SDTSGHYEEMLLALIGHGE  315



>ref|XP_006828500.1| hypothetical protein AMTR_s00060p00176720 [Amborella trichopoda]
 gb|ERM95916.1| hypothetical protein AMTR_s00060p00176720 [Amborella trichopoda]
Length=316

 Score =   187 bits (475),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 130/315 (41%), Positives = 181/315 (57%), Gaps = 24/315 (8%)
 Frame = +2

Query  83    SDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVL  262
             +DD + L  AF+G G +EK  +S+L       RQ  RK+  + + +D    +  D     
Sbjct  14    ADDCEQLRVAFAGWGTNEKLIISILGHRTATQRQLIRKTYFELYGED--LLKSLDS----  67

Query  263   QLRQEFLRLKDAVVLYMMHPWERDARLFKEALLK-EPQFDLLIETACTRPSEELLGARRA  439
             ++  +F R   A++L+ + P ERDA +  +AL +  P+  +LIE AC R SEELL  RRA
Sbjct  68    EVSGDFER---ALLLWTLDPAERDALMANQALRRWNPEDRVLIEIACARSSEELLLIRRA  124

Query  440   YHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGN  619
             YH+ F  S+EED+A H     RKLLV LVSSYRY+G +V+  +AK EAK L + IK    
Sbjct  125   YHARFKRSLEEDVAQHTTGDFRKLLVPLVSSYRYDGQEVNGHLAKLEAKTLKDVIKDKA-  183

Query  620   KNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHA------HLLLKQTVQCLC  781
                 + EE+VRILSTRSK  L A   +YK+ +G  +++DL           ++  V+C+ 
Sbjct  184   ---FNHEELVRILSTRSKAQLNATLNNYKDGSGMQINKDLKGDAEDKFQSAVRAVVKCIT  240

Query  782   MPQLYFSKILD-ASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGE  958
              PQ YF K L  A ++LG DE A   +TRV+VTRAD DMK IK E+  +    L   I  
Sbjct  241   KPQSYFEKTLRLAIVKLGTDEVA---LTRVVVTRADVDMKDIKAEYHKRNSTPLDRAIAS  297

Query  959   VANGSYKELLLTLVA  1003
               +G YK LLLTL+ 
Sbjct  298   DTSGDYKNLLLTLIG  312



>ref|XP_006828499.1| hypothetical protein AMTR_s00060p00176150 [Amborella trichopoda]
 gb|ERM95915.1| hypothetical protein AMTR_s00060p00176150 [Amborella trichopoda]
Length=316

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 129/315 (41%), Positives = 178/315 (57%), Gaps = 24/315 (8%)
 Frame = +2

Query  83    SDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVL  262
             +DD + L  AF+G G +EK  +S+L       RQ  RK+  + + +D    +  D     
Sbjct  14    ADDCEQLRVAFAGWGTNEKLIISILGHRTATQRQLIRKTYFELYGED--LLKSLDS----  67

Query  263   QLRQEFLRLKDAVVLYMMHPWERDARLFKEALLK-EPQFDLLIETACTRPSEELLGARRA  439
             +L  +F R   A++L+ + P ERDA +  +AL +  P+  +LIE AC R SEEL   RRA
Sbjct  68    ELSGDFER---ALLLWTLDPAERDALMANQALRRWNPEDRVLIEIACARSSEELFFIRRA  124

Query  440   YHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGN  619
             YH+ F  S EED+A H     RKLLV LVSSYRY+GP+V+  +AK EAK + + I    N
Sbjct  125   YHARFKRSFEEDVAQHTTGDFRKLLVPLVSSYRYDGPEVNMHMAKLEAKTMKDVI----N  180

Query  620   KNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHA------HLLLKQTVQCLC  781
                 + EE++RILSTRSK  L A   +YK+  G  ++ DL           ++  V+C+ 
Sbjct  181   DKAFNHEELIRILSTRSKAQLNATLNNYKDEFGMQINNDLKGDPEEKFQSAVRAVVKCIT  240

Query  782   MPQLYFSKILD-ASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGE  958
              PQ YF K L  A ++LG DE A   +TRV+VTRAD DMK IK E+  +    L   I  
Sbjct  241   KPQNYFEKTLRLAIVKLGTDEVA---LTRVVVTRADVDMKDIKVEYHKRNSTPLDRAIAS  297

Query  959   VANGSYKELLLTLVA  1003
               +G YK LLLTL+ 
Sbjct  298   DTSGDYKNLLLTLIG  312



>gb|AGG76002.1| annexin AnxGb6 [Gossypium barbadense]
Length=314

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 126/322 (39%), Positives = 195/322 (61%), Gaps = 24/322 (7%)
 Frame = +2

Query  71    KMAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDD  250
             +++V  D + L KA  G G DEKA +SVL   N   R+  R +    +++D    +R + 
Sbjct  9     QVSVLADAEALRKACKGWGTDEKAIISVLGHRNAVQRKQIRLAYEDLYQED--LIKRLES  66

Query  251   HHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLK-EPQFDLLIETACTRPSEELLG  427
                 +L  +F   ++AV  +++ P +RDA L   A+ K  P   +++E +CTR  EELL 
Sbjct  67    ----ELSGDF---EEAVYRWILDPADRDAVLANVAIKKLSPDHHVIVEISCTRSPEELLA  119

Query  428   ARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIK  607
              RRAY + + HS+EED+A H +   RKLLVALVS++RY+G +++  VA SEAKVL  A+K
Sbjct  120   VRRAYQARYKHSLEEDVAAHTKGDTRKLLVALVSAFRYDGEEINTRVANSEAKVLHEAVK  179

Query  608   HAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHL------LLKQTV  769
                +K   + EEI+RILSTRSK+ L+A +  Y++  G  + ++L           L+ T+
Sbjct  180   ---DKEF-NHEEIIRILSTRSKMQLMATFNRYRDDHGTTITKNLEGDSGDEFLKTLRPTI  235

Query  770   QCLCMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSD  946
             +CL  P+ YF K+L  S+ R+G DE   D++TRVIVTRA++D+K +K+ +  +  V L  
Sbjct  236   RCLNDPKKYFEKVLRNSIRRVGTDE---DALTRVIVTRAEKDLKDVKELYYKRNSVPLDQ  292

Query  947   RIGEVANGSYKELLLTLVAKSE  1012
              + +  +G YK LLLTL+ K +
Sbjct  293   AVAKDTSGDYKALLLTLLGKED  314



>emb|CAA06492.1| annexin [Cicer arietinum]
Length=163

 Score =   181 bits (458),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 98/163 (60%), Positives = 129/163 (79%), Gaps = 1/163 (1%)
 Frame = +2

Query  521   LVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGNKNLVDDEEIVRILSTRSklhllalykh  700
             LVS+YRYEG KV +D AKSEAK L+NAIK+   K +V+D+E++RIL+TRSK HL  ++KH
Sbjct  1     LVSAYRYEGSKVKDDTAKSEAKTLSNAIKNVHKKPIVEDDEVIRILATRSKAHLQQVHKH  60

Query  701   ykEITGKFLDEDLHAHLLLKQTVQCLCMPQLYFSKILDASLRLGVDEAARDSVTRVIVTR  880
             YKEI+GK L+EDL+  L  K+TV+CLC PQ+YFSK+LDASL++ VD+  + S+TRVIVTR
Sbjct  61    YKEISGKNLEEDLN-DLRFKETVECLCTPQVYFSKVLDASLKIDVDKNIKKSLTRVIVTR  119

Query  881   ADEDMKHIKQEFKTKYGVALSDRIGEVANGSYKELLLTLVAKS  1009
             AD DMK IK E+   YGV+L  +I E A G+YK+ LLTL+A+ 
Sbjct  120   ADIDMKEIKGEYNNLYGVSLQQKIEETAKGNYKDFLLTLIARG  162



>gb|AGG76001.1| annexin AnxGb5 [Gossypium barbadense]
Length=314

 Score =   185 bits (470),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 125/322 (39%), Positives = 195/322 (61%), Gaps = 24/322 (7%)
 Frame = +2

Query  71    KMAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDD  250
             +++V  D + L KA  G G DEKA +SVL   N   R+  R +    +++D    +R + 
Sbjct  9     QVSVLADAEALRKACKGWGTDEKAIISVLGHRNAVQRKQIRLAYEDLYQED--LIKRLES  66

Query  251   HHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLK-EPQFDLLIETACTRPSEELLG  427
                 +L  +F   + AV  +++ P +RDA L   A+ K  P   +++E +CTR  EELL 
Sbjct  67    ----ELSGDF---EKAVYRWILDPADRDAVLANVAIKKLSPDHHVIVEISCTRSPEELLA  119

Query  428   ARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIK  607
              RRAY + + HS+EED+A H +   RKLLV+LVS++RY+G +++  VA SEAK+L  A+K
Sbjct  120   VRRAYQARYKHSLEEDVAAHTKGDTRKLLVSLVSAFRYDGEEINTRVANSEAKILHEAVK  179

Query  608   HAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHL------LLKQTV  769
                +K   + EEI+RILSTRSK+ L+A +  Y++  G  + ++L           L+ T+
Sbjct  180   ---DKEF-NHEEIIRILSTRSKMQLMATFNRYRDDHGTTITKNLEGDSGDEFLKTLRATI  235

Query  770   QCLCMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSD  946
             +CL  P+ YF K+L  S+ R+G DE   D++TRVIVTRA++D+K IK+ +  +  V+L  
Sbjct  236   RCLNDPKKYFEKVLRNSIRRVGTDE---DALTRVIVTRAEKDLKDIKELYYKRNSVSLDQ  292

Query  947   RIGEVANGSYKELLLTLVAKSE  1012
              + +  +G YK LLLTL+ K +
Sbjct  293   AVAKDTSGDYKALLLTLLGKED  314



>gb|AGQ56695.1| cotton annexin 4 [Gossypium hirsutum]
Length=314

 Score =   185 bits (470),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 125/322 (39%), Positives = 195/322 (61%), Gaps = 24/322 (7%)
 Frame = +2

Query  71    KMAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDD  250
             +++V  D + L KA  G G DEKA +SVL   N   R+  R +    +++D    +R + 
Sbjct  9     QVSVLADAEALRKACKGWGTDEKAIISVLGHRNAVQRKQIRLAYEDLYQED--LIKRLES  66

Query  251   HHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLK-EPQFDLLIETACTRPSEELLG  427
                 +L  +F   + AV  +++ P +RDA L   A+ K  P   +++E +CTR  EELL 
Sbjct  67    ----ELSGDF---EKAVYRWVLDPADRDAVLANVAIKKLSPDHHVIVEISCTRSPEELLA  119

Query  428   ARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIK  607
              RRAY + + HS+EED+A H +   RKLLV+LVS++RY+G +++  VA SEAK+L  A+K
Sbjct  120   VRRAYQARYKHSLEEDVAAHTKGDTRKLLVSLVSAFRYDGEEINTRVANSEAKILHEAVK  179

Query  608   HAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHL------LLKQTV  769
                +K   + EEI+RILSTRSK+ L+A +  Y++  G  + ++L           L+ T+
Sbjct  180   ---DKEF-NHEEIIRILSTRSKMQLMATFNRYRDDHGTTITKNLEGDSGDEFLKTLRATI  235

Query  770   QCLCMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSD  946
             +CL  P+ YF K+L  S+ R+G DE   D++TRVIVTRA++D+K IK+ +  +  V+L  
Sbjct  236   RCLNDPKKYFEKVLRNSIRRVGTDE---DALTRVIVTRAEKDLKDIKELYYKRNSVSLDQ  292

Query  947   RIGEVANGSYKELLLTLVAKSE  1012
              + +  +G YK LLLTL+ K +
Sbjct  293   AVAKDTSGDYKALLLTLLGKED  314



>gb|ACJ11719.1| annexin [Gossypium hirsutum]
Length=314

 Score =   184 bits (468),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 124/322 (39%), Positives = 191/322 (59%), Gaps = 24/322 (7%)
 Frame = +2

Query  71    KMAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDD  250
             +++V  D + L KA  G G DEKA +SVL   N   R+  R +    +++D    +R + 
Sbjct  9     QVSVLADAEALRKACKGWGTDEKAIISVLGHRNAVQRKQIRLAYEDLYQED--LIKRLES  66

Query  251   HHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLK-EPQFDLLIETACTRPSEELLG  427
                 +L  +F   + AV  +++ P +RDA L   A+ K  P   +++E +CTR  EELL 
Sbjct  67    ----ELSGDF---EKAVYRWILDPADRDAVLANVAIKKLSPDHHVIVEISCTRSPEELLA  119

Query  428   ARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIK  607
              RRAY + + HS+EED+A H +   RKLLVALVS++RY+G +++  VA SEAK+L  A+K
Sbjct  120   VRRAYQARYKHSLEEDVAAHTKGDTRKLLVALVSAFRYDGEEINTRVANSEAKILHEAVK  179

Query  608   HAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHL------LLKQTV  769
                     + EEI+RILSTRSK+ L+A +  Y++  G  + ++L           L+ T+
Sbjct  180   DKE----FNHEEIIRILSTRSKMQLMATFNRYRDDHGTTITKNLEGDSGDEFLKTLRPTI  235

Query  770   QCLCMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSD  946
             +CL  P+ YF K+L  S+ R+G DE   D++TRVIVTRA++D+K +K+ +  +  V L  
Sbjct  236   RCLNDPKKYFEKVLRNSIRRVGTDE---DALTRVIVTRAEKDLKDVKELYYKRNSVPLDQ  292

Query  947   RIGEVANGSYKELLLTLVAKSE  1012
              + +   G YK LLLTL+ K +
Sbjct  293   AVAKDTTGDYKALLLTLLGKED  314



>gb|AGQ56696.1| cotton annexin 5 [Gossypium hirsutum]
Length=314

 Score =   184 bits (467),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 126/320 (39%), Positives = 189/320 (59%), Gaps = 25/320 (8%)
 Frame = +2

Query  77    AVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHH  256
             AV D  K L KA  G G DEKA +SVL   N   R+  R +    +++D    +R +   
Sbjct  12    AVEDAEK-LQKACKGWGTDEKAIISVLGHRNAVQRKQIRLAYEDLYQED--LIKRLES--  66

Query  257   VLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLK-EPQFDLLIETACTRPSEELLGAR  433
               +L  +F   + AV  +++ P +RDA L   A+ K  P   +++E +CTR  EELL  R
Sbjct  67    --ELSGDF---EKAVYRWILDPADRDAVLANVAIKKLSPDHHVIVEISCTRSPEELLAVR  121

Query  434   RAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHA  613
             RAY + + HS+EED+A H +   RKLLVALVS++RY+G +++  VA SEAK+L  A+K  
Sbjct  122   RAYQARYKHSLEEDVAAHTKGDTRKLLVALVSAFRYDGEEINTRVANSEAKILHEAVKDK  181

Query  614   GNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHL------LLKQTVQC  775
                   + EEI+RILSTRSK+ L+A +  Y++  G  + ++L           L+ T++C
Sbjct  182   E----FNHEEIIRILSTRSKMQLMATFNRYRDDHGTTITKNLEGDSGDEFLKTLRPTIRC  237

Query  776   LCMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRI  952
             L  P+ YF K+L  S+ R+G DE   D++TRVIVTRA++D+K +K+ +  +  V L   +
Sbjct  238   LNDPKKYFEKVLRNSIRRVGTDE---DALTRVIVTRAEKDLKDVKELYYKRNSVPLDQAV  294

Query  953   GEVANGSYKELLLTLVAKSE  1012
              +   G YK LLLTL+ K +
Sbjct  295   AKDTTGDYKALLLTLLGKED  314



>ref|XP_010647259.1| PREDICTED: annexin D4-like [Vitis vinifera]
Length=210

 Score =   181 bits (458),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 101/235 (43%), Positives = 147/235 (63%), Gaps = 31/235 (13%)
 Frame = +2

Query  314   MHPWERDARLFKEALLKEPQ-FDLLIETACTRPSEELLGARRAYHSLFDHSIEEDIAFHI  490
             MHPWERDAR+ ++AL +  Q + LLIE ACTR S+ELLGARRAY SL+  SIEED+A  +
Sbjct  1     MHPWERDARMARKALKRGSQAYGLLIELACTRSSDELLGARRAYQSLYSESIEEDVACQV  60

Query  491   QTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGNKNLVDDEEIVRILSTRS  670
             +  +R+ LVALVSSYRYEG + ++   +S+A+ L  A+++     L+ DEEIVRIL+TRS
Sbjct  61    EGIQRQFLVALVSSYRYEGSRKNDAAIESDAQKLNKAVRNGDKTMLIKDEEIVRILTTRS  120

Query  671   klhllalykhykEITGKFLDEDLHAHLLLKQTVQCLCMPQLYFSK--ILDASLRLGVDEA  844
                                      H  LK+  +C       F +  ILD++++    + 
Sbjct  121   -----------------------KPH--LKEVFKCYYYD---FDRDIILDSAMKANATKN  152

Query  845   ARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVANGSYKELLLTLVAKS  1009
              ++++TRVIVTR D DMK I +E+  +YG  L+ +I +VA G+YK+ L+TLV ++
Sbjct  153   EQEALTRVIVTRTDVDMKDIAEEYNKQYGTPLAKKIEDVAIGNYKDFLVTLVQRA  207



>gb|KDO83192.1| hypothetical protein CISIN_1g021607mg [Citrus sinensis]
 gb|KDO83193.1| hypothetical protein CISIN_1g021607mg [Citrus sinensis]
Length=174

 Score =   179 bits (454),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 113/147 (77%), Gaps = 4/147 (3%)
 Frame = +2

Query  101  LTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVLQLRQEF  280
            L KAFSG GVDEK  +S+L    P+HRQ++RK    FF +DER+FERW+DHHV  L+ EF
Sbjct  7    LIKAFSGHGVDEKTVISILGNSQPEHRQAFRKEG-GFFAEDERRFERWNDHHVKLLKHEF  65

Query  281  LRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGARRAYHSLFD  457
            +R K+AVVL+ MHPWERDARL KEAL K P  + +++E A TR S+ELLGAR+AYHSLF+
Sbjct  66   MRFKNAVVLWAMHPWERDARLIKEALKKGPNSNSVIVEIASTRSSDELLGARKAYHSLFE  125

Query  458  HSIEEDIAFHIQTPERKL--LVALVSS  532
            HSIEED+A HI   E+K+  + +L++S
Sbjct  126  HSIEEDVASHIHGKEKKVHYIASLIAS  152



>ref|XP_006434000.1| hypothetical protein CICLE_v10001888mg [Citrus clementina]
 gb|ESR47240.1| hypothetical protein CICLE_v10001888mg [Citrus clementina]
 gb|KDO80945.1| hypothetical protein CISIN_1g035973mg [Citrus sinensis]
Length=316

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 124/317 (39%), Positives = 190/317 (60%), Gaps = 24/317 (8%)
 Frame = +2

Query  77    AVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHH  256
             +V++D + L KAF G G +E+  +S+LA  N   R+  R++    + +D    +  D   
Sbjct  12    SVTEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGED--LLKSLDK--  67

Query  257   VLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGAR  433
               +L  +F R+   V+L+ + P ERDA L  EA  +    + +L+E ACTR S++LL AR
Sbjct  68    --ELTNDFERV---VMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEAR  122

Query  434   RAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHA  613
             +AYH+ F  S+EED+ +H     RKLL+ LV++YRYEG +V+  +AKSEAK+L   I   
Sbjct  123   QAYHARFKKSLEEDVGYHTNGDFRKLLLPLVTAYRYEGDEVNITLAKSEAKILHEKI---  179

Query  614   GNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHL------LLKQTVQC  775
              NK   +DE+++RIL+TRSK  + A    YK + G  +D+DL A        LL+ TVQC
Sbjct  180   SNKT-YNDEDLIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQC  238

Query  776   LCMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRI  952
             L  P+ YF KIL  ++ + G DE A   +TRV+ TRA+ D+K IK E++ +  V L   +
Sbjct  239   LVRPEHYFEKILRLAINKQGTDEGA---LTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAV  295

Query  953   GEVANGSYKELLLTLVA  1003
              +  +G Y+++LL L+ 
Sbjct  296   VKDTSGDYEKMLLALLG  312



>gb|KDP46839.1| hypothetical protein JCGZ_24048 [Jatropha curcas]
Length=316

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 125/317 (39%), Positives = 182/317 (57%), Gaps = 24/317 (8%)
 Frame = +2

Query  77    AVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHH  256
             A S+D + L KAF G G +E   +S+LA  N   R   R++  + + +D    +  D   
Sbjct  12    APSEDAEQLHKAFEGWGTNEALIISILAHRNAAQRNLIRQTYAEAYGED--LLKALDK--  67

Query  257   VLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGAR  433
               +L  +F R   AV+L+ + P ERDA L  EA  K    + +LIE AC+R S +L   R
Sbjct  68    --ELSSDFER---AVLLWTLDPAERDAYLANEATKKFTSSNWVLIEIACSRSSLDLFKVR  122

Query  434   RAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHA  613
             +AYH+ F  S+EED+A+H     RKLLV LVS++RYEG +V+  +AKSEAK+L   I H 
Sbjct  123   QAYHARFKKSLEEDVAYHTTGDFRKLLVPLVSAFRYEGDEVNMTLAKSEAKILHEKISHK  182

Query  614   GNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHL------LLKQTVQC  775
                    DEEI+RI++TRSK  L A   HY    G  +++DL          LL+ T++C
Sbjct  183   A----YSDEEIIRIIATRSKAQLNATLNHYNNAFGNAINKDLKGDPKDEFLNLLRATIKC  238

Query  776   LCMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRI  952
             L  P+ YF K+L  ++ +LG DE A   +TRV+ TRA+ DM+ IK+E+  +  V L   I
Sbjct  239   LTTPEKYFEKVLRLAINKLGTDELA---LTRVVTTRAEVDMQRIKEEYHRRNSVTLDRAI  295

Query  953   GEVANGSYKELLLTLVA  1003
                 +G Y+++LL L+ 
Sbjct  296   SGDTSGDYEKMLLALIG  312



>ref|XP_007047969.1| Annexin 2 [Theobroma cacao]
 gb|EOX92126.1| Annexin 2 [Theobroma cacao]
Length=316

 Score =   182 bits (463),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 127/319 (40%), Positives = 184/319 (58%), Gaps = 28/319 (9%)
 Frame = +2

Query  77    AVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHH  256
             A S+D + L KAF G G +E+  + VLA  N   R   R S  + + +D    +  D   
Sbjct  12    APSEDAEQLRKAFEGWGTNEQLIIDVLAHRNAAQRNLIRISYGEAYGED--LLKSLDK--  67

Query  257   VLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGAR  433
               +L  +F R   AV+L+ + P ERDA L  EA  +    + +L+E ACTR S EL   R
Sbjct  68    --ELSSDFER---AVLLFTLDPAERDAYLANEATKRFTSSNWVLMEIACTRSSYELFNVR  122

Query  434   RAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAI--K  607
             +AYH+ +  S+EED+A H     RKLLV LVS++RYEG +V+  +AKSEAK+L + I  K
Sbjct  123   KAYHARYKKSLEEDVAHHTTGDYRKLLVPLVSAFRYEGEEVNMTLAKSEAKILRDKISDK  182

Query  608   HAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAH------LLLKQTV  769
             H       +DEE++RIL+TRSK  L A   HY    G  +++DL A        LL+  +
Sbjct  183   H------YNDEEVIRILTTRSKAQLNATLNHYNTAFGNAINKDLKADPNDEFLKLLRAAI  236

Query  770   QCLCMPQLYFSKIL-DASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSD  946
             +CL +P+ YF K+L  A ++LG DE+A   +TRV+ TRA+ DM  IK+E++ +  V L  
Sbjct  237   KCLTVPEKYFEKLLRQAIVKLGTDESA---LTRVVTTRAEVDMVRIKEEYQRRNSVTLEK  293

Query  947   RIGEVANGSYKELLLTLVA  1003
              I    +G Y+ +LL L+ 
Sbjct  294   AIAGDTSGDYERMLLALIG  312



>gb|KDP41371.1| hypothetical protein JCGZ_15778 [Jatropha curcas]
Length=316

 Score =   182 bits (462),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 125/320 (39%), Positives = 187/320 (58%), Gaps = 26/320 (8%)
 Frame = +2

Query  80    VSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDE-RQFERWDDHH  256
             VSDD + L KAF G G +E   +S+L   N   R+  R++ ++ + DD  +  E+     
Sbjct  13    VSDDCEQLKKAFEGWGTNEDLIISILGHRNAAQRKQIRETYYEMYGDDLLKTLEK-----  67

Query  257   VLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGAR  433
               +L  +F RL   V+L+++ P ERDA L  EA+ K    + +L+E ACTR + +L  AR
Sbjct  68    --ELTSDFERL---VLLWILGPAERDAVLANEAIKKWTSSNQILMEIACTRSANDLFHAR  122

Query  434   RAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHA  613
             +AYH+ +  S+EED+A+H     RKLL  LV SYRYEG  V   +AK+EAK++   I   
Sbjct  123   QAYHARYKKSLEEDVAYHTTGDFRKLLFPLVCSYRYEGDDVDMSLAKTEAKLIHEKI---  179

Query  614   GNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAH------LLLKQTVQC  775
              +K    D++ +RIL+TRSK  + A   HYK   GK +++DL A        L++ TV+C
Sbjct  180   -SKKAYSDDDFIRILATRSKAQINATLNHYKNDFGKDINKDLKADPKDEFLQLVRATVKC  238

Query  776   LCMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRI  952
             L  P+ YF K+L  ++ R G DE A   +TRV+ TRA+ D+K IK E++ +  V L   I
Sbjct  239   LTRPEKYFEKVLRLAINRTGTDEGA---LTRVVSTRAEVDLKVIKDEYQQRNSVPLDRAI  295

Query  953   GEVANGSYKELLLTLVAKSE  1012
              +  +G Y+++LL LV   E
Sbjct  296   IKDTHGDYEKMLLALVGYKE  315



>ref|XP_002285795.1| PREDICTED: annexin D1 [Vitis vinifera]
 emb|CAN81470.1| hypothetical protein VITISV_020506 [Vitis vinifera]
Length=309

 Score =   181 bits (460),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 121/321 (38%), Positives = 191/321 (60%), Gaps = 26/321 (8%)
 Frame = +2

Query  68    SKMAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDE-RQFERW  244
             + ++V++D + L KAF+G G +E   +S+LA  N    +S R++  Q + +D  +   + 
Sbjct  2     ATLSVTEDCEQLRKAFAGWGTNEGLIISILAHRNAAQIKSIRQTYAQTYGEDLLKDLNK-  60

Query  245   DDHHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEEL  421
                   +L  +F R+   V+L+ + P ERDA L  EA  +    + +L+E ACTR S++L
Sbjct  61    ------ELSNDFERV---VLLWTLDPAERDAFLANEATKRWTSSNQVLVEIACTRTSQQL  111

Query  422   LGARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANA  601
             L A++AYH+ F  S+EED+A+H     RKLLV LV +YRYEG +V+  +AKSEAK+L   
Sbjct  112   LLAKQAYHARFKRSLEEDVAYHTSGDFRKLLVPLVGTYRYEGEEVNMTLAKSEAKILHEK  171

Query  602   IKHAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAH------LLLKQ  763
             I    ++   + E+++RIL+TRSK  + A   HYK   G  +++DL          +L+ 
Sbjct  172   I----SEKAYNHEDVIRILATRSKAQINATLNHYKNEFGNDINKDLKTDPKDEFLAILRA  227

Query  764   TVQCLCMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVAL  940
             TV+CL  P+ YF K+L  ++ + G DE A   +TRV+ TRA+ DMK IK+E+  +  V L
Sbjct  228   TVKCLTRPEKYFEKVLRLAINKRGTDEGA---LTRVVTTRAEIDMKIIKEEYHKRNSVTL  284

Query  941   SDRIGEVANGSYKELLLTLVA  1003
                IG+   G Y+++LL L+ 
Sbjct  285   DHAIGKDTTGDYEKMLLALIG  305



>ref|XP_006839165.1| hypothetical protein AMTR_s00097p00076000 [Amborella trichopoda]
 gb|ERN01734.1| hypothetical protein AMTR_s00097p00076000 [Amborella trichopoda]
Length=316

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 118/318 (37%), Positives = 184/318 (58%), Gaps = 26/318 (8%)
 Frame = +2

Query  77    AVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHH  256
             + +DD + L +AF G G D+K  +S+L   N   R+  R++  + +++D           
Sbjct  12    SATDDSEKLREAFEGWGSDKKTIISILGHRNASQRKLIREAYAEIYKED----------L  61

Query  257   VLQLRQEFLR-LKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGA  430
               +L  E +R  + A++L+ + P ERDA L   AL K    D +++E AC R +EELL  
Sbjct  62    CKRLEYELIRHFERAMLLWALDPAERDAVLANGALRKGETCDRVVLEIACARSAEELLMV  121

Query  431   RRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKH  610
             RRAYH  F  S+EEDIA H     RKLLVA+VSSYRYEGP+V+  +A  EA+ L +AI+ 
Sbjct  122   RRAYHERFKRSLEEDIASHTTGDIRKLLVAMVSSYRYEGPEVNASLASKEAQALNDAIQ-  180

Query  611   AGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAH------LLLKQTVQ  772
                 N  +DEE++RILS+RSK  L A    YK+  G  + ++L +         ++  ++
Sbjct  181   ---SNCFNDEEVIRILSSRSKHQLNATLNKYKDYFGTHIIKNLKSSPEDKFIPAIRIMIR  237

Query  773   CLCMPQLYFSKILD-ASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDR  949
             C+  PQ YF K++  A + LG DE   + +TR I+TRA+ D++ IK+ ++ +   +L   
Sbjct  238   CIYSPQKYFEKVIRHAIVGLGTDE---EMLTRAIITRAEVDLREIKEAYQKRNSKSLEKA  294

Query  950   IGEVANGSYKELLLTLVA  1003
             + +  +G YK+ LLTL+ 
Sbjct  295   VADDTSGDYKDFLLTLLG  312



>ref|XP_007011125.1| Annexin-like protein RJ4 isoform 2 [Theobroma cacao]
 gb|EOY19935.1| Annexin-like protein RJ4 isoform 2 [Theobroma cacao]
Length=314

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 124/317 (39%), Positives = 188/317 (59%), Gaps = 24/317 (8%)
 Frame = +2

Query  86    DDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVLQ  265
             +D + L KA  G G DEKA +SVL   N   R+  R +  + +++D    +R +     +
Sbjct  14    EDAEALQKACKGWGTDEKAIISVLGHRNAAQRKQIRLAYEELYQED--LIKRLES----E  67

Query  266   LRQEFLRLKDAVVLYMMHPWERDARLFKEALLK-EPQFDLLIETACTRPSEELLGARRAY  442
             L  +F   + AV  +++ P +RDA L   A+ K  P   ++IE +CTR  EELL  RRAY
Sbjct  68    LSGDF---EKAVYRWVLDPADRDAVLANVAIKKISPDHHVVIEISCTRSPEELLAVRRAY  124

Query  443   HSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGNK  622
              + + HS+EED+A H +   RKLLVALVS++RY+G +++  +A SEA +L +AIK     
Sbjct  125   QARYKHSLEEDVAAHTKGDIRKLLVALVSAFRYDGEEINTRLANSEANILHDAIKDKA--  182

Query  623   NLVDDEEIVRILSTRSklhllalykhykE-----ITGKFLDEDLHAHLL-LKQTVQCLCM  784
                + EE+VRILSTRSK+ L+A +  Y++     IT K L E     L+ L+  V+C   
Sbjct  183   --FNHEEVVRILSTRSKMQLMATFNRYRDDQGTTITKKLLGESGDEFLVALRTAVRCFND  240

Query  785   PQLYFSKILDASLR-LGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEV  961
             P+ YF K+L  S++ +G DE   D++TRVIVTRA++D+K IK  +  +  + L   + + 
Sbjct  241   PKKYFEKVLRNSIKGIGTDE---DALTRVIVTRAEKDLKEIKDLYHKRNSMPLEQVVAKD  297

Query  962   ANGSYKELLLTLVAKSE  1012
              +G YK  LLTL+ K +
Sbjct  298   TSGDYKAFLLTLLGKED  314



>ref|XP_004155446.1| PREDICTED: annexin D2-like [Cucumis sativus]
Length=314

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 124/316 (39%), Positives = 181/316 (57%), Gaps = 24/316 (8%)
 Frame = +2

Query  80    VSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHV  259
             V++D   L  AF G G DE A VS+LA  N K R   R++  + + +D    +  D    
Sbjct  13    VAEDCDRLHSAFQGWGTDEGAIVSILAHRNAKQRSLIRQTYAETYGED--LLKALDK---  67

Query  260   LQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFDLLIETACTRPSEELLGARRA  439
              +L  +F R   AV+L+  HP ERDA L  EA+ K   F +++E ACTR   +LL  +  
Sbjct  68    -ELSSDFER---AVLLWTFHPAERDALLANEAIRKLKHF-VVLEIACTRTPRDLLLVKEE  122

Query  440   YHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGN  619
             YH+ F  SIEED+A +     R+LLV LV++YRY GP+V+  +A SEAK+L + I     
Sbjct  123   YHARFKRSIEEDVAHYTTGDFRRLLVPLVTAYRYGGPEVNATLATSEAKILHDKI----T  178

Query  620   KNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHL------LLKQTVQCLC  781
             +   +DEE++RI+STRSK  L A + HY +  G  + +DL          LL+  ++CL 
Sbjct  179   EKAYNDEELIRIISTRSKAQLNATFNHYNDQFGNAISKDLKTDPNDNYLKLLRSAIKCLT  238

Query  782   MPQLYFSKILDASLR-LGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGE  958
              P+ YF K+L  +++ LG DE A   +TRV+VTRA+ DMK I +E+  +  V L   I  
Sbjct  239   WPEKYFEKVLRLAIKGLGTDEEA---LTRVVVTRAEVDMKRIAEEYYRRNSVPLGQAIKG  295

Query  959   VANGSYKELLLTLVAK  1006
               +G Y+ +LL L+ K
Sbjct  296   DTSGDYESMLLALIGK  311



>gb|ABB59547.1| annexin-like protein [Brassica juncea]
 gb|ABB59550.1| annexin-like protein [Brassica juncea]
 gb|AAR10457.2| annexin [Brassica juncea]
 gb|ABD74418.1| annexin 1 [Brassica juncea]
Length=317

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 120/319 (38%), Positives = 189/319 (59%), Gaps = 27/319 (8%)
 Frame = +2

Query  86    DDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDE-RQFERWDDHHVL  262
             +D + L  AF G G +E+  +S+LA  + + R+  R++ H+ F +D  +  E+       
Sbjct  15    EDAEQLKSAFDGWGTNEELIISILAHRSAEQRKLIRQTYHESFGEDLLKSLEK-------  67

Query  263   QLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGARRA  439
             +L  +F R   A++L+ + P ERDA L  EA  +    + +L+E ACTR S +LL AR+A
Sbjct  68    ELTSDFER---AILLWTLEPGERDALLVNEATKRWTSSNQVLMEVACTRTSTQLLHARQA  124

Query  440   YHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGN  619
             YH+ F  SIEED+A H     RKLLV+LVSSYRYEG +V+  +AK EAK++   IK    
Sbjct  125   YHARFKKSIEEDVAHHTTGDFRKLLVSLVSSYRYEGEEVNMTLAKQEAKLIHEKIKDKH-  183

Query  620   KNLVDDEEIVRILSTRSklhllalykhykEITGKFL-------DEDLHAHLLLKQTVQCL  778
                 +DE+ +RILSTRSK  + A +  Y++  G+ +       DED     LL+ T+QCL
Sbjct  184   ---YNDEDFIRILSTRSKAQINATFNRYQDNHGEEILKSLEEGDEDDKFLGLLRSTIQCL  240

Query  779   CMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIG  955
               P+LYF  +L +++ + G DE A   +TR++ TRA+ D+K I QE++ +  + L   I 
Sbjct  241   TRPELYFVDVLRSAINKTGTDEGA---LTRIVTTRAEIDLKVIGQEYQRRNSIPLEKAIT  297

Query  956   EVANGSYKELLLTLVAKSE  1012
             +   G Y+++L+ L+ + +
Sbjct  298   KDTRGDYEKMLIALLGEDD  316



>gb|KHG08791.1| Annexin D2 -like protein [Gossypium arboreum]
Length=316

 Score =   180 bits (456),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 123/319 (39%), Positives = 185/319 (58%), Gaps = 26/319 (8%)
 Frame = +2

Query  83    SDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDE-RQFERWDDHHV  259
             SDD + L KAF G G +E+  + +LA  N   R S RK   + + +D  +  E+      
Sbjct  14    SDDAEQLRKAFEGWGTNEQLIIDILAHRNAAQRNSIRKVYGEAYGEDLLKCLEK------  67

Query  260   LQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGARR  436
              +L  +F R   AV+L+ + P ERDA L  EA  K    + +L+E AC+R S ELL  ++
Sbjct  68    -ELTSDFER---AVLLFTLDPAERDAHLANEATKKFTSSNWILMEIACSRSSHELLNVKK  123

Query  437   AYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAG  616
             AYH+ +  S+EED+A H     RKLLV LVS++RYEG +V+  +AKSEAK+L + I    
Sbjct  124   AYHARYKKSLEEDVAHHTTGEYRKLLVPLVSAFRYEGEEVNMTLAKSEAKILHDKI---S  180

Query  617   NKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHL------LLKQTVQCL  778
             +K+  DD E++RI+STRSK  L A   HY    G  +++DL A        LL+  ++CL
Sbjct  181   DKHYTDD-EVIRIVSTRSKAQLNATLNHYNTSFGNAINKDLKADPSDEFLKLLRAVIKCL  239

Query  779   CMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIG  955
               P+ YF K+L  ++ +LG DE A   +TRV+ TRA+ DM  IK+ ++ +  + L   I 
Sbjct  240   TTPEQYFEKVLRQAINKLGSDEWA---LTRVVTTRAEVDMVRIKEAYQRRNSIPLEQAIA  296

Query  956   EVANGSYKELLLTLVAKSE  1012
             +  +G Y++ LL L+   +
Sbjct  297   KDTSGDYEKFLLALIGAGD  315



>gb|ABK22223.1| unknown [Picea sitchensis]
 gb|ABK26348.1| unknown [Picea sitchensis]
Length=316

 Score =   180 bits (456),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 122/318 (38%), Positives = 181/318 (57%), Gaps = 26/318 (8%)
 Frame = +2

Query  86    DDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVLQ  265
             +D + L KAF G G +EK  + +L       R++ R++  Q + +D           + +
Sbjct  15    EDSESLRKAFEGWGTNEKLIIEILGHRTAAQRRAIRQAYTQLYEED----------FLKR  64

Query  266   LRQEFLR-LKDAVVLYMMHPWERDARLFKEALLK-EPQFDLLIETACTRPSEELLGARRA  439
             L+ E  R  + A+ L+ + P ERDA L  E++ K  P+   LIE +C R S EL   R+A
Sbjct  65    LQSELTREFERALFLWSLDPPERDALLAHESIKKWSPKNRSLIEISCARSSSELWLVRQA  124

Query  440   YHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGN  619
             YH  +  S+EEDIA H Q   RKLLV LVSSYRYEGP+V   +AKSEAK L  AI+    
Sbjct  125   YHVRYKKSLEEDIASHTQGDFRKLLVQLVSSYRYEGPEVDMRLAKSEAKQLHEAIEDKAF  184

Query  620   KNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLL------LKQTVQCLC  781
              N    EE +RI++TRSK  L A + +YK+  G  +++DL           L+  ++C+C
Sbjct  185   GN----EEFIRIITTRSKAQLNATFNNYKDEYGHHINKDLKNEKPEEFLESLRVVIKCIC  240

Query  782   MPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGE  958
              P+ YF+K+L  ++ +LG +E A   + RV+VTRA+ DM +IK+E+  +    L   I  
Sbjct  241   FPERYFAKVLRLAIDKLGTEEEA---LIRVVVTRAETDMNNIKEEYHKRTSKTLEHAIAA  297

Query  959   VANGSYKELLLTLVAKSE  1012
               +G Y+E LLTL+ K +
Sbjct  298   DTSGYYEEFLLTLIGKEQ  315



>gb|AAR13288.1| Anx1 [Gossypium hirsutum]
 gb|AGG75997.1| annexin AnxGb1 [Gossypium barbadense]
 gb|KHG05039.1| Annexin D2 -like protein [Gossypium arboreum]
Length=316

 Score =   179 bits (455),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 122/320 (38%), Positives = 184/320 (58%), Gaps = 24/320 (8%)
 Frame = +2

Query  77    AVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHH  256
             A S+D + L KAF G G +E+  + +LA  N   R   RK+  + + +D    +  D+  
Sbjct  12    APSEDAEQLRKAFEGWGTNEQLIIDILAHRNAAQRNLIRKTYREAYGED--LLKSLDE--  67

Query  257   VLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLK-EPQFDLLIETACTRPSEELLGAR  433
               +L  +F R   AVVL+ + P ERDA L  EA  +      +L+E ACTR S EL   R
Sbjct  68    --ELSSDFER---AVVLFTLDPAERDAFLAHEATKRFTSSHWVLMEIACTRSSHELFNVR  122

Query  434   RAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHA  613
             +AYH L+  S+EED+A H +   RKLLV LVS++RY+G +V+  +A+SEAK+L   I   
Sbjct  123   KAYHDLYKKSLEEDVAHHTKGDYRKLLVPLVSAFRYQGEEVNMTLARSEAKILREKI---  179

Query  614   GNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAH------LLLKQTVQC  775
              +     DEE++RI++TRSK  L A   HY    G  +++DL A        LL+  ++C
Sbjct  180   -SDKQYSDEEVIRIVTTRSKAQLNATLNHYNTAFGNAINKDLKADPEDEFLKLLRAAIKC  238

Query  776   LCMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRI  952
             L +P+ YF K+L  ++ +LG DE A   +TRV+ TRA+ DM  IK+E++ +  V L   I
Sbjct  239   LTVPEKYFEKVLRQAINKLGTDEWA---LTRVVATRAEVDMVRIKEEYQRRNSVTLEKAI  295

Query  953   GEVANGSYKELLLTLVAKSE  1012
                 +G Y+++LL L+   +
Sbjct  296   AGDTSGDYEKMLLALIGAGD  315



>ref|XP_010269245.1| PREDICTED: annexin D2-like [Nelumbo nucifera]
Length=317

 Score =   179 bits (453),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 121/317 (38%), Positives = 183/317 (58%), Gaps = 26/317 (8%)
 Frame = +2

Query  77   AVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHH  256
            +V++D + L KAF+G G +E+  + +LA  N   R+  RK+  + + +D           
Sbjct  12   SVTEDCEQLRKAFAGWGTNERLIIDILAHRNAAQRKLIRKTYAETYGED----------L  61

Query  257  VLQLRQEFLR-LKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGA  430
            ++ L +E     + AV+++ + P ERDA    EA  +    + +L+E ACTR S+EL   
Sbjct  62   LISLDKELSSDFEKAVLMWTLDPAERDAFFANEATRRWTSNNWVLLEIACTRTSQELFLV  121

Query  431  RRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKH  610
            R+AYH+ F  S+EED+A+H     RKLLV LVSSYRYEG +V+  +AKSEAKVL   I  
Sbjct  122  RQAYHARFKRSLEEDVAYHTTGDFRKLLVPLVSSYRYEGQEVNMTLAKSEAKVLHQKISE  181

Query  611  AGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAH------LLLKQTVQ  772
                   +DE+++RIL+TRSK+ L A   HY +  G  +++DL A         L+  V+
Sbjct  182  KA----YNDEDLIRILTTRSKIQLNATLNHYNDEFGNPINKDLKADPKDQFLAALRAAVK  237

Query  773  CLCMPQLYFSKILDASLR-LGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDR  949
            CL  P+ YF K+L  ++  LG DE A   +TRV+ TR++ DMK IK+E+  +  V L   
Sbjct  238  CLTYPEKYFEKVLRLAINGLGTDEWA---LTRVVTTRSEVDMKQIKEEYYRRNSVTLERA  294

Query  950  IGEVANGSYKELLLTLV  1000
            I    +G Y+ +LL L+
Sbjct  295  ISGDTSGDYEAMLLALI  311



>gb|AGG75998.1| annexin AnxGb2 [Gossypium barbadense]
Length=316

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 121/320 (38%), Positives = 183/320 (57%), Gaps = 24/320 (8%)
 Frame = +2

Query  77    AVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHH  256
             A S+D + L KAF G G +E+  + +LA  N   R   RK+  + + +D    +  D+  
Sbjct  12    APSEDAEQLRKAFEGWGTNEQLIIDILAHRNAAQRNLIRKTYREAYGED--LLKSLDE--  67

Query  257   VLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLK-EPQFDLLIETACTRPSEELLGAR  433
               +L  +F R   AVVL+ + P ERDA L  EA  +      +L+E ACTR S EL   R
Sbjct  68    --ELSSDFER---AVVLFTLDPAERDAFLAHEATKRFTSSHWVLMEIACTRSSHELFNVR  122

Query  434   RAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHA  613
             +AYH L+  S+EED+A H +   RK LV LVS++RY+G +V+  +A+SEAK+L   I   
Sbjct  123   KAYHDLYKKSLEEDVAHHTKGGYRKFLVPLVSAFRYQGEEVNMTLARSEAKILREKI---  179

Query  614   GNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAH------LLLKQTVQC  775
              +     DEE++RI++TRSK  L A   HY    G  +++DL A        LL+  ++C
Sbjct  180   -SDKQYSDEEVIRIVTTRSKAQLNATLNHYNTAFGNAINKDLKADPEDEFLKLLRAAIKC  238

Query  776   LCMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRI  952
             L +P+ YF K+L  ++ +LG DE A   +TRV+ TRA+ DM  IK+E++ +  V L   I
Sbjct  239   LTVPEKYFEKVLRQAINKLGTDEWA---LTRVVATRAEVDMVRIKEEYQRRNSVTLEKAI  295

Query  953   GEVANGSYKELLLTLVAKSE  1012
                 +G Y+++LL L+   +
Sbjct  296   AGDTSGDYEKMLLALIGAGD  315



>ref|XP_002302291.1| annexin 1 family protein [Populus trichocarpa]
 gb|ABK93242.1| unknown [Populus trichocarpa]
 gb|EEE81564.1| annexin 1 family protein [Populus trichocarpa]
Length=316

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 125/316 (40%), Positives = 184/316 (58%), Gaps = 24/316 (8%)
 Frame = +2

Query  80    VSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHV  259
             VS+D + L KAFSG G +E   +S+L   N   R+  R++  + + +D    +  D    
Sbjct  13    VSEDVEQLRKAFSGWGTNEGLIISILGHRNAAQRKLIRQAYAEAYGED--LLKALDK---  67

Query  260   LQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGARR  436
              +L  +F R+   ++L+ + P ERDA L  EA  +    + +L+E ACTR S ELL AR+
Sbjct  68    -ELSNDFERV---LLLWTLDPAERDAALANEATKRWTSSNQVLMEIACTRSSNELLLARQ  123

Query  437   AYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAG  616
             AYH+ F  S+EED+A H     RKLL  LVSSYRY+G +V+  +AKSEAK+L   I +  
Sbjct  124   AYHARFKKSLEEDVAHHTSGDFRKLLFPLVSSYRYDGDEVNMTLAKSEAKMLHEKISNKA  183

Query  617   NKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAH------LLLKQTVQCL  778
                   DEE++RIL+TRSK  + A    YK   G  +++DL A        LL+ TV+CL
Sbjct  184   ----YSDEELIRILATRSKAQINATLNQYKNEFGNDINKDLKADPNDEFLALLRATVKCL  239

Query  779   CMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIG  955
               P+ YF K+L  ++ + G +E A   +TRV+ TRA+ DMK IK E++ +  + L   I 
Sbjct  240   TRPEKYFEKVLRLAINKRGTNEGA---LTRVVATRAEIDMKLIKDEYQRRNSIPLDRAIV  296

Query  956   EVANGSYKELLLTLVA  1003
             +  +G Y++LLL LV 
Sbjct  297   KDTDGEYEKLLLELVG  312



>ref|XP_010273220.1| PREDICTED: annexin D3-like [Nelumbo nucifera]
Length=318

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 124/330 (38%), Positives = 184/330 (56%), Gaps = 28/330 (8%)
 Frame = +2

Query  47    TLNSANSSKMAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDE  226
             TL   +++     D  K L KAF GLG DEKA + +L   N   R+  R +  + +    
Sbjct  3     TLKVPDTAPSPTQDSEK-LKKAFHGLGTDEKAIIWILGHRNASQRKKIRYTYQELYN---  58

Query  227   RQFERWDDHHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQ----FDLLIET  394
                E   D    +L  +F   K AV+L+ M P ERDA++  +AL  + +      ++IE 
Sbjct  59    ---ESLIDRLKSELSGDF---KKAVILWTMDPPERDAKMANKALQSKDKGIDHLKVIIEI  112

Query  395   ACTRPSEELLGARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAK  574
             ACT     L+  R AY S++D S+EEDIA  +  P R+LLV LVSSYRY+   V E VAK
Sbjct  113   ACTTSPHHLMAVREAYCSMYDCSLEEDIACRVTPPLRQLLVGLVSSYRYDKEVVDEIVAK  172

Query  575   SEAKVLANAIKHAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHA---  745
             SEA  L +AI+    +  +DD+++V IL TR+   L A ++ Y++I G  +D+D+     
Sbjct  173   SEAAKLRDAIE----RKQLDDDDVVWILCTRNVFQLRATFECYRQIYGNPIDQDIKCCGT  228

Query  746   ---HLLLKQTVQCLCMPQLYFSKILDAS-LRLGVDEAARDSVTRVIVTRADEDMKHIKQE  913
                  +L+  + C+  P+ YFSK+L AS + LG +E   DS+TR IVTRA+ D+  IK+E
Sbjct  229   GNLESVLQMVIWCIDSPEKYFSKVLRASVVGLGTEE---DSLTRAIVTRAEVDLMKIKEE  285

Query  914   FKTKYGVALSDRIGEVANGSYKELLLTLVA  1003
             +   +  +L D I    +G YK+ L TL+ 
Sbjct  286   YFNMHKTSLDDAIVGDTSGDYKDFLTTLLG  315



>gb|ACZ57338.1| annexin 1 [Cenchrus americanus]
Length=314

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 120/317 (38%), Positives = 186/317 (59%), Gaps = 27/317 (9%)
 Frame = +2

Query  86    DDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDE-RQFERWDDHHVL  262
             +D + L  AF G G +E+  +S+LA  + + R+  R++ H+ F +D  +  E+       
Sbjct  15    EDAEQLKSAFDGWGTNEELIISILAHRSAEQRKLIRQTYHESFGEDLLKSLEK-------  67

Query  263   QLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGARRA  439
              L  +F R   A++L+ + P ERDA L  EA  +    + +L+E ACTR S +LL AR+A
Sbjct  68    GLTSDFER---AILLWTLEPGERDALLVNEATKRWTSSNQVLMEVACTRTSTQLLHARQA  124

Query  440   YHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGN  619
             YH+ F  SIEED+A H     RKLLV+LVSSYRYEG +V+  +AK EAK++   IK    
Sbjct  125   YHARFKKSIEEDVAHHTTGNFRKLLVSLVSSYRYEGEEVNMTLAKQEAKLIHEKIKDKH-  183

Query  620   KNLVDDEEIVRILSTRSklhllalykhykEITGKFL-------DEDLHAHLLLKQTVQCL  778
                 +DE+ +RILSTRSK  + A +  Y++  G+ +       DED     LL+ T+QCL
Sbjct  184   ---YNDEDFIRILSTRSKAQINATFNRYQDNHGEEILKSLEEGDEDDKFLGLLRSTIQCL  240

Query  779   CMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIG  955
               P+LYF  +L +++ + G DE A   +TR++ TRA+ D+K I QE++ +  + L   I 
Sbjct  241   TRPELYFVDVLRSAINKTGTDEGA---LTRIVATRAEIDLKVIGQEYQRRNSIPLEKAIT  297

Query  956   EVANGSYKELLLTLVAK  1006
             +   G Y ++L+ L+ +
Sbjct  298   KDTRGDYGKMLIALLGE  314



>gb|ABK95721.1| unknown [Populus trichocarpa]
Length=316

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 125/316 (40%), Positives = 183/316 (58%), Gaps = 24/316 (8%)
 Frame = +2

Query  80    VSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHV  259
             VS+D + L KAFSG G +E   +S+L   N   R+  R++  + + +D    +  D    
Sbjct  13    VSEDVEQLRKAFSGWGTNEGLIISILGHRNAAQRKLIRQAYAEAYGED--LLKALDK---  67

Query  260   LQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGARR  436
              +L  +F R+   ++L+ + P ERDA L  EA  +    + +L+E ACTR S ELL AR+
Sbjct  68    -ELSNDFERV---LLLWTLDPAERDAALANEATKRWTSSNQVLMEIACTRSSNELLLARQ  123

Query  437   AYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAG  616
             AYH+ F  S+EED+A H     RKLL  LVSSYRY+G +V+  +AKSEAK+L   I +  
Sbjct  124   AYHARFKKSLEEDVAHHTSGDFRKLLFPLVSSYRYDGDEVNMTLAKSEAKMLHEKISNKA  183

Query  617   NKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAH------LLLKQTVQCL  778
                   DEE++RIL+TRSK  + A    YK   G  +++DL A        LL+ TV+CL
Sbjct  184   ----YSDEELIRILATRSKAQINATLNQYKNEFGNDINKDLKADPNDEFLALLRATVKCL  239

Query  779   CMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIG  955
               P+ YF K+L  ++ + G +E A   +TRV+ TRA+ DMK IK E++ +  + L   I 
Sbjct  240   TRPEKYFEKVLRLAINKRGTNEGA---LTRVVATRAEIDMKLIKDEYQRRNSIPLDRAIV  296

Query  956   EVANGSYKELLLTLVA  1003
             +  +G Y +LLL LV 
Sbjct  297   KDTDGEYGKLLLELVG  312



>gb|ADM48798.1| annexin 1 [Vigna mungo]
Length=314

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 121/317 (38%), Positives = 190/317 (60%), Gaps = 27/317 (9%)
 Frame = +2

Query  86    DDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDE-RQFERWDDHHVL  262
             +D + L  AF G G +E+  +S+LA  + + R+  R++ H+ F +D  +  E+       
Sbjct  15    EDAEQLKSAFDGWGTNEELIISILAHRSAEQRKLIRQTYHESFGEDLLKGLEK-------  67

Query  263   QLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGARRA  439
             +L  +F R   A++L+ + P ERDA L  EA  +    + +L+E ACTR S +LL AR+A
Sbjct  68    ELTSDFER---AILLWTLEPGERDALLVNEATKRWTSSNQVLMEVACTRTSTQLLHARQA  124

Query  440   YHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGN  619
             YH+ F  SIEED+A H     RKLLV+LVSSYRYEG +V+  +AK EAK++   IK   +
Sbjct  125   YHARFKKSIEEDVAHHTTGDFRKLLVSLVSSYRYEGEEVNMTLAKQEAKLIHEKIK---D  181

Query  620   KNLVDDEEIVRILSTRSklhllalykhykEITGKFL-------DEDLHAHLLLKQTVQCL  778
             K+  +DE+ +RILSTRSK  + A +  Y++  G+ +       DED     LL+ T+QCL
Sbjct  182   KH-YNDEDFIRILSTRSKAQINATFNRYQDNHGEEILKSLEEGDEDDKFLGLLRSTIQCL  240

Query  779   CMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIG  955
               P+LYF  +L +++ + G DE A   +TR++ TRA+ D+K I QE++    + L   I 
Sbjct  241   TRPELYFVDVLRSAINKTGTDEGA---LTRIVATRAEIDLKVIGQEYQRGNSIPLEKAIT  297

Query  956   EVANGSYKELLLTLVAK  1006
             +   G Y+++L+ L+ +
Sbjct  298   KDTRGDYEKMLIALLGE  314



>ref|XP_007011124.1| Annexin-like protein RJ4 isoform 1 [Theobroma cacao]
 gb|EOY19934.1| Annexin-like protein RJ4 isoform 1 [Theobroma cacao]
Length=387

 Score =   180 bits (456),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 124/317 (39%), Positives = 188/317 (59%), Gaps = 24/317 (8%)
 Frame = +2

Query  86    DDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVLQ  265
             +D + L KA  G G DEKA +SVL   N   R+  R +  + +++D    +R +     +
Sbjct  87    EDAEALRKACQGWGTDEKAIISVLGHRNAAQRKQIRLAYEELYQED--LIKRLES----E  140

Query  266   LRQEFLRLKDAVVLYMMHPWERDARLFKEALLK-EPQFDLLIETACTRPSEELLGARRAY  442
             L  +F   + AV  +++ P +RDA L   A+ K  P   ++IE +CTR  EELL  RRAY
Sbjct  141   LSGDF---EKAVYRWVLDPADRDAVLANVAIKKISPDHHVVIEISCTRSPEELLAVRRAY  197

Query  443   HSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGNK  622
              + + HS+EED+A H +   RKLLVALVS++RY+G +++  +A SEA +L +AIK     
Sbjct  198   QARYKHSLEEDVAAHTKGDIRKLLVALVSAFRYDGEEINTRLANSEANILHDAIKDKA--  255

Query  623   NLVDDEEIVRILSTRSklhllalykhykE-----ITGKFLDEDLHAHLL-LKQTVQCLCM  784
                + EE+VRILSTRSK+ L+A +  Y++     IT K L E     L+ L+  V+C   
Sbjct  256   --FNHEEVVRILSTRSKMQLMATFNRYRDDQGTTITKKLLGESGDEFLVALRTAVRCFND  313

Query  785   PQLYFSKILDASLR-LGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEV  961
             P+ YF K+L  S++ +G DE   D++TRVIVTRA++D+K IK  +  +  + L   + + 
Sbjct  314   PKKYFEKVLRNSIKGIGTDE---DALTRVIVTRAEKDLKEIKDLYHKRNSMPLEQVVAKD  370

Query  962   ANGSYKELLLTLVAKSE  1012
              +G YK  LLTL+ K +
Sbjct  371   TSGDYKAFLLTLLGKED  387



>gb|AGQ56697.1| cotton annexin 6 [Gossypium hirsutum]
Length=316

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 123/321 (38%), Positives = 184/321 (57%), Gaps = 30/321 (9%)
 Frame = +2

Query  83    SDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDE-RQFERWDDHHV  259
             S+D + L KAF G G +E+  + +LA  N   R S RK   + + +D  +  E+      
Sbjct  14    SEDAEQLRKAFEGWGTNEQLIIDILAHRNAAQRNSIRKVYGEAYGEDLLKCLEK------  67

Query  260   LQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGARR  436
              +L  +F R   AV+L+ + P ERDA L  EA  K    + +L+E AC+R S ELL  ++
Sbjct  68    -ELTSDFER---AVLLFTLDPAERDAHLANEATKKFTSSNWILMEIACSRSSHELLNVKK  123

Query  437   AYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAI--KH  610
             AYH+ +  S+EED+A H     RKLLV LVS++RYEG +V+  +AKSEAK+L + I  KH
Sbjct  124   AYHARYKKSLEEDVAHHTTGEYRKLLVPLVSAFRYEGEEVNMTLAKSEAKILHDKISDKH  183

Query  611   AGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHL------LLKQTVQ  772
                     DEE++RI+STRSK  L A   HY    G  +++DL A        LL+  ++
Sbjct  184   ------YTDEEVIRIVSTRSKAQLNATLNHYNTSFGNAINKDLKADPSDEFLKLLRAVIK  237

Query  773   CLCMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDR  949
             CL  P+ YF K+L  ++ +LG DE A   +TRV+ TRA+ DM  IK+ ++ +  + L   
Sbjct  238   CLTTPEQYFEKVLRQAINKLGSDEWA---LTRVVTTRAEVDMVRIKEAYQRRNSIPLEQA  294

Query  950   IGEVANGSYKELLLTLVAKSE  1012
             I +  +G Y++ LL L+   +
Sbjct  295   IAKDTSGDYEKFLLALIGAGD  315



>ref|XP_004307132.1| PREDICTED: annexin-like protein RJ4-like isoform 2 [Fragaria 
vesca subsp. vesca]
Length=313

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 125/334 (37%), Positives = 188/334 (56%), Gaps = 30/334 (9%)
 Frame = +2

Query  32    SMTAPTLNSANSSKMAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQF  211
             S+  P   SAN        D + L KA  G G +EKA +S+L   N   R+  R +  Q 
Sbjct  3     SLITPDQFSANQ-------DAEALRKACQGWGTNEKAVISILGHRNAGQRKEIRAAYEQL  55

Query  212   FRDDERQFERWDDHHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFDLLIE  391
             +++D    +R +     +L  +F   + AV  +++ P +RDA L   A+ K   ++++IE
Sbjct  56    YQED--LLKRLES----ELSGDF---EKAVYRWILDPADRDAVLANVAIKKSTDYNVIIE  106

Query  392   TACTRPSEELLGARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVA  571
              +C    EELL  RRAY   + HS+EED+A H     RKLLVALV++YRY+G +++  +A
Sbjct  107   ISCIHSPEELLAVRRAYQLRYKHSVEEDLAAHTTGDIRKLLVALVTAYRYDGHEINAKLA  166

Query  572   KSEAKVLANAIKHAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDL----  739
              SEA +L +AIK     NL   EEI+RILSTRSK  L+A +  Y++  G  + ++L    
Sbjct  167   NSEADILQDAIKDKAF-NL---EEIIRILSTRSKTQLMATFNKYRDDQGISISKNLLEEG  222

Query  740   --HAHLLLKQTVQCLCMPQLYFSKIL-DASLRLGVDEAARDSVTRVIVTRADEDMKHIKQ  910
                    L   ++CL  P+ YF K+L +A  R+G DE   D++TRVIVTRA+ D++ IK+
Sbjct  223   ANDFQKALHTAIRCLNDPKKYFEKVLRNAIKRVGTDE---DALTRVIVTRAERDLRDIKE  279

Query  911   EFKTKYGVALSDRIGEVANGSYKELLLTLVAKSE  1012
              +  K  V L   + +  +G YK  LLTL+ K +
Sbjct  280   VYYKKNSVPLEQAVAKDTSGDYKAFLLTLLGKED  313



>emb|CDP18835.1| unnamed protein product [Coffea canephora]
Length=195

 Score =   174 bits (440),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 100/170 (59%), Positives = 132/170 (78%), Gaps = 1/170 (1%)
 Frame = +2

Query  503   RKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGNKNLVDDEEIVRILSTRSklhl  682
             R LLV LVS+YRYEGP   E+VAKSEAK+L N IK  G K L ++E+IVRIL+TRSKLHL
Sbjct  24    RILLVGLVSAYRYEGPNYSEEVAKSEAKILKNVIKD-GAKKLHEEEQIVRILTTRSKLHL  82

Query  683   lalykhykEITGKFLDEDLHAHLLLKQTVQCLCMPQLYFSKILDASLRLGVDEAARDSVT  862
              A++KHYKE +G +LDEDL  HL+LKQTVQCLC P+ YF++ILD SL+    + A++++T
Sbjct  83    KAVFKHYKETSGNYLDEDLGDHLILKQTVQCLCKPETYFTEILDVSLKGIGHDFAKEALT  142

Query  863   RVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVANGSYKELLLTLVAKSE  1012
             RVIVTRAD D+K IK+E+    G  LS +I E+ANG++K+ LL L+A+ +
Sbjct  143   RVIVTRADVDLKLIKEEYYHLSGFTLSHKIEEIANGNFKDFLLALIARGD  192



>ref|XP_004136871.1| PREDICTED: annexin D2-like [Cucumis sativus]
 gb|KGN43712.1| hypothetical protein Csa_7G062780 [Cucumis sativus]
Length=314

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 123/316 (39%), Positives = 180/316 (57%), Gaps = 24/316 (8%)
 Frame = +2

Query  80    VSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHV  259
             V++D   L  AF G G DE A VS+LA  N K R   R++  + + +D    +  D    
Sbjct  13    VAEDCDRLHSAFQGWGTDEGAIVSILAHRNAKQRSLIRQTYAETYGED--LLKALDK---  67

Query  260   LQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFDLLIETACTRPSEELLGARRA  439
              +L  +F R   AV+L+  HP ERDA L  EA+ K   F +++E ACTR   +LL  +  
Sbjct  68    -ELSSDFER---AVLLWTFHPAERDALLANEAIRKLKHF-VVLEIACTRTPRDLLLVKEE  122

Query  440   YHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGN  619
             YH+ F  SIEED+A +     R+LLV LV++YRY GP+V+  +A SEAK+L + I     
Sbjct  123   YHARFKRSIEEDVAHYTTGDFRRLLVPLVTAYRYGGPEVNATLATSEAKILHDKI----T  178

Query  620   KNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHL------LLKQTVQCLC  781
             +   +DEE++RI+STRSK  L A + HY +  G  + +DL          LL+  ++CL 
Sbjct  179   EKAYNDEELIRIISTRSKAQLNATFNHYNDQFGNAISKDLKTDPNDNYLKLLRSAIKCLT  238

Query  782   MPQLYFSKILDASLR-LGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGE  958
               + YF K+L  +++ LG DE A   +TRV+VTRA+ DMK I +E+  +  V L   I  
Sbjct  239   WSEKYFEKVLRLAIKGLGTDEEA---LTRVVVTRAEVDMKRIAEEYYRRNSVPLGQAIKG  295

Query  959   VANGSYKELLLTLVAK  1006
               +G Y+ +LL L+ K
Sbjct  296   DTSGDYESMLLALIGK  311



>gb|AIU41030.1| annexin 1 [Gossypium hirsutum]
Length=316

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 129/335 (39%), Positives = 193/335 (58%), Gaps = 30/335 (9%)
 Frame = +2

Query  32    SMTAPTLNSANSSKMAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQF  211
             ++T PT      +  +VS+D + L KAFSG G +E   + +L   N + R   RK+  + 
Sbjct  3     TLTVPT------TVPSVSEDCEQLRKAFSGWGTNEGLIIDILGHRNAEQRNLIRKTYAET  56

Query  212   FRDDERQFERWDDHHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLK-EPQFDLLI  388
             + +D    +  D     +L  +F RL   V+L+ + P ERDA L  EA  +   +  +L+
Sbjct  57    YGED--LLKALDK----ELSNDFERL---VLLWALDPAERDALLANEATKRWTSRNQVLM  107

Query  389   ETACTRPSEELLGARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDV  568
             E ACTR + +LL AR+AYH+ +  S+EED+A H     RKLL+ LVSSYRYEG +V+  +
Sbjct  108   EIACTRSANQLLHARQAYHARYKKSLEEDVAHHTTGDFRKLLLPLVSSYRYEGEEVNMTL  167

Query  569   AKSEAKVLANAIKHAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAH  748
             AK+EAK+L   I    NK   DD +++R+L+TRSK  + A   HYK   G  +++DL A 
Sbjct  168   AKTEAKLLHEKI---SNKAYSDD-DVIRVLATRSKAQINATLNHYKNEYGNDINKDLKAD  223

Query  749   ------LLLKQTVQCLCMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIK  907
                    LL+ TV+CL  P+ YF K+L  ++ R G DE A   +TRV+ TRA+ D+K I 
Sbjct  224   PKDEFLALLRSTVKCLVYPEKYFEKVLRLAINRRGTDEGA---LTRVVCTRAEVDLKIIA  280

Query  908   QEFKTKYGVALSDRIGEVANGSYKELLLTLVAKSE  1012
              E++ +  V L+  I +  +G Y++LLL L    E
Sbjct  281   DEYQRRNSVPLTRAIVKDTHGDYEKLLLVLAGHVE  315



>ref|XP_002513080.1| annexin, putative [Ricinus communis]
 gb|EEF49583.1| annexin, putative [Ricinus communis]
Length=314

 Score =   177 bits (448),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 120/316 (38%), Positives = 182/316 (58%), Gaps = 24/316 (8%)
 Frame = +2

Query  89    DHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVLQL  268
             D + L KAF G G +EKA +SVL   N   R+  R++    ++  E   +R +     +L
Sbjct  15    DAETLYKAFKGWGTNEKAVISVLGHRNAAQRKQIRQAYWDLYQ--EELVKRLES----EL  68

Query  269   RQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFDLLIETACTRPSEELLGARRAYHS  448
               +F R   AV  +++ P +RDA L   AL K   + ++IE AC R +EELL  RRAY +
Sbjct  69    TGDFER---AVYRWILDPEDRDAVLANVALRKSGDYHVIIEIACVRSAEELLTVRRAYQA  125

Query  449   LFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGNKNL  628
              + HS+EED+A H     RKLLV LV+++RYEG +++  +AKSEA +L +AIK       
Sbjct  126   RYKHSLEEDVAAHTTGDVRKLLVGLVTAFRYEGAEINTRLAKSEADILQDAIKDKA----  181

Query  629   VDDEEIVRILSTRSklhllalykhykE-----ITGKFLDE--DLHAHLLLKQTVQCLCMP  787
              + +E++RIL+TRSK  L+A +  +K+     IT   L E  D     LL+  ++C+  P
Sbjct  182   FNHDEVIRILTTRSKTQLMATFNTFKDDQGTSITKMLLGESADNEFKTLLRIAIRCINEP  241

Query  788   QLYFSKILDASLR-LGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVA  964
               Y+ K+L  ++R +G DE   D++TRVIVTRA++D+  IK  +  +  VAL   +    
Sbjct  242   LKYYEKVLRNAIRKVGTDE---DALTRVIVTRAEKDLLDIKDLYYKRNSVALDHAVANET  298

Query  965   NGSYKELLLTLVAKSE  1012
             +G YK  LL L+ K +
Sbjct  299   SGDYKHFLLALLGKED  314



>gb|ACZ57337.1| annexin 1 [Vigna mungo]
Length=310

 Score =   177 bits (448),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 119/312 (38%), Positives = 185/312 (59%), Gaps = 27/312 (9%)
 Frame = +2

Query  86   DDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDE-RQFERWDDHHVL  262
            +D + L  AF G G +E+  +S+LA  + + R+  R++ H+ F +D  +  E+       
Sbjct  15   EDAEQLKSAFDGWGTNEELIISILAHRSAEQRKLIRQTYHESFGEDLLKGLEK-------  67

Query  263  QLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGARRA  439
            +L  +F R   A++L+ + P ERDA L  EA  +    + +L+E ACTR S +LL AR+A
Sbjct  68   ELTSDFER---AILLWTLEPGERDALLVNEATKRWTSSNQVLMEVACTRTSTQLLHARQA  124

Query  440  YHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGN  619
            YH+ F  SIEED+A H     RKLLV+LVSSYRYEG +V+  +AK EAK++   IK    
Sbjct  125  YHARFKKSIEEDVAHHTTGDFRKLLVSLVSSYRYEGEEVNMTLAKQEAKLIHEKIKDKH-  183

Query  620  KNLVDDEEIVRILSTRSklhllalykhykEITGKFL-------DEDLHAHLLLKQTVQCL  778
                +DE+ +RILSTRSK  + A +  Y++  G+ +       DED     LL+ T+QCL
Sbjct  184  ---YNDEDFIRILSTRSKAQINATFNRYQDNHGEEILKSLEEGDEDDKFLGLLRSTIQCL  240

Query  779  CMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIG  955
              P+LYF  +L +++ + G DE A   +TR++ TRA+ D+K I QE++ +  + L   I 
Sbjct  241  TRPELYFVDVLRSAINKTGTDEGA---LTRIVATRAEIDLKVIGQEYQRRNSIPLEKAIT  297

Query  956  EVANGSYKELLL  991
            +   G Y+++L+
Sbjct  298  KDTRGDYEKMLI  309



>gb|AAC33305.1| fiber annexin [Gossypium hirsutum]
Length=316

 Score =   177 bits (448),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 126/335 (38%), Positives = 192/335 (57%), Gaps = 30/335 (9%)
 Frame = +2

Query  32    SMTAPTLNSANSSKMAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQF  211
             ++T PT      +  +VS+D + L KAFSG G +E   + +L   N + R   RK+  + 
Sbjct  3     TLTVPT------TVPSVSEDCEQLRKAFSGWGTNEGLIIDILGHRNAEQRNLIRKTYAET  56

Query  212   FRDDERQFERWDDHHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLI  388
             + +D    +  D     +L  +F RL   V+L+ + P ERDA L  EA  +    + +L+
Sbjct  57    YGED--LLKALDK----ELSNDFERL---VLLWALDPAERDALLANEATKRWTSSNQVLM  107

Query  389   ETACTRPSEELLGARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDV  568
             E ACTR + +LL AR+AYH+ +  S+EED+A H     RKLL+ LVSSYRYEG +V+ ++
Sbjct  108   EIACTRSANQLLHARQAYHARYKKSLEEDVAHHTTGDFRKLLLPLVSSYRYEGEEVNMNL  167

Query  569   AKSEAKVLANAIKHAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAH  748
             AK+EAK+L   I          D++++R+L+TRSK  + A   HYK   G  +++DL A 
Sbjct  168   AKTEAKLLHEKISDKA----YSDDDVIRVLATRSKAQINATLNHYKNEYGNDINKDLKAD  223

Query  749   ------LLLKQTVQCLCMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIK  907
                    LL+ TV+CL  P+ YF K+L  ++ R G DE A   +TRV+ TRA+ D+K I 
Sbjct  224   PKDEFLALLRSTVKCLVYPEKYFEKVLRLAINRRGTDEGA---LTRVVCTRAEVDLKIIA  280

Query  908   QEFKTKYGVALSDRIGEVANGSYKELLLTLVAKSE  1012
              E++ +  V L+  I +  +G Y++LLL L    E
Sbjct  281   DEYQRRNSVPLTRAIVKDTHGDYEKLLLVLAGHVE  315



>ref|XP_011016329.1| PREDICTED: annexin D1 [Populus euphratica]
Length=316

 Score =   176 bits (447),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 125/316 (40%), Positives = 183/316 (58%), Gaps = 24/316 (8%)
 Frame = +2

Query  80    VSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHV  259
             VS+D + L KAFSG G +E   +S+L   N   R+  R++  + + +D    +  D    
Sbjct  13    VSEDVEQLRKAFSGWGTNEGLIISILGHRNAAQRKLIRQAYAEAYGED--LLKALDK---  67

Query  260   LQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGARR  436
              +L  +F R+   ++L+ + P ERDA L  EA  +    + +L+E ACTR S ELL AR+
Sbjct  68    -ELSNDFERV---LLLWTLDPAERDAALANEATKRWTSSNQVLMEIACTRSSNELLLARQ  123

Query  437   AYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAG  616
             AYH+ F  S+EED+A H     RKLL  LVSSYRY G +V+  +AKSEAK+L   I +  
Sbjct  124   AYHARFKKSLEEDVAHHTIGDFRKLLFPLVSSYRYNGDEVNMTLAKSEAKMLHEKISNKA  183

Query  617   NKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAH------LLLKQTVQCL  778
                   DEE++RIL+TRSK  + A    YK   G  +++DL A        LL+ TV+CL
Sbjct  184   ----YSDEELIRILATRSKAQINATLNQYKNEFGNDINKDLKADPNDEFLALLRATVKCL  239

Query  779   CMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIG  955
               P+ YF K+L  ++ + G +E A   +TRV+ TRA+ DMK IK E++ +  + L   I 
Sbjct  240   TRPEKYFEKVLRLAINKRGTNEGA---LTRVVATRAEIDMKLIKDEYQRRNSIPLDRAIV  296

Query  956   EVANGSYKELLLTLVA  1003
             +  +G Y++LLL LV 
Sbjct  297   KDTHGEYEKLLLELVG  312



>ref|XP_004307131.1| PREDICTED: annexin-like protein RJ4-like isoform 1 [Fragaria 
vesca subsp. vesca]
Length=313

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 119/320 (37%), Positives = 184/320 (58%), Gaps = 23/320 (7%)
 Frame = +2

Query  74    MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDH  253
                ++D + L K+  G G +EKA +S+L   N   R+  R +  Q +++D    +R +  
Sbjct  10    FCANEDAEALRKSVKGWGTNEKAVISILGHRNAGQRKEIRAAYEQLYQED--LLKRLES-  66

Query  254   HVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFDLLIETACTRPSEELLGAR  433
                +L  +F   + AV  +++ P +RDA L   A+ K   ++++IE +C    EELL  R
Sbjct  67    ---ELSGDF---EKAVYRWILDPADRDAVLANVAIKKSTDYNVIIEISCIHSPEELLAVR  120

Query  434   RAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHA  613
             RAY   + HS+EED+A H     RKLLVALV++YRY+G +++  +A SEA +L +AIK  
Sbjct  121   RAYQLRYKHSVEEDLAAHTTGDIRKLLVALVTAYRYDGHEINAKLANSEADILQDAIKDK  180

Query  614   GNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDL------HAHLLLKQTVQC  775
                NL   EEI+RILSTRSK  L+A +  Y++  G  + ++L           L   ++C
Sbjct  181   AF-NL---EEIIRILSTRSKTQLMATFNKYRDDQGISISKNLLEEGANDFQKALHTAIRC  236

Query  776   LCMPQLYFSKIL-DASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRI  952
             L  P+ YF K+L +A  R+G DE   D++TRVIVTRA+ D++ IK+ +  K  V L   +
Sbjct  237   LNDPKKYFEKVLRNAIKRVGTDE---DALTRVIVTRAERDLRDIKEVYYKKNSVPLEQAV  293

Query  953   GEVANGSYKELLLTLVAKSE  1012
              +  +G YK  LLTL+ K +
Sbjct  294   AKDTSGDYKAFLLTLLGKED  313



>ref|XP_006289187.1| hypothetical protein CARUB_v10002628mg [Capsella rubella]
 gb|EOA22085.1| hypothetical protein CARUB_v10002628mg [Capsella rubella]
Length=315

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 120/318 (38%), Positives = 183/318 (58%), Gaps = 26/318 (8%)
 Frame = +2

Query  86    DDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVLQ  265
             +D + + KA  G G DEKA +S+L   N   R+  R++  + + +D           + Q
Sbjct  14    EDAENIKKACQGWGTDEKAIISILGHRNLFQRKLIRQAYQEIYHED----------LIHQ  63

Query  266   LRQEFLR-LKDAVVLYMMHPWERDARLFKEALLKE-PQFDLLIETACTRPSEELLGARRA  439
             L+ E     + AV L+++ P ERDA L   AL K  P + +L+E AC R  E+LL ARRA
Sbjct  64    LKSELSGDFERAVCLWVLDPPERDALLANLALQKPIPDYKVLVEIACMRSPEDLLAARRA  123

Query  440   YHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGN  619
             Y  L+  S+EED+A H     R+LLVA+VS+Y+Y+G ++ E +AKSEA +L + I   G 
Sbjct  124   YRCLYKRSLEEDLASHTIGDIRRLLVAMVSAYKYDGDEIDEMLAKSEAAILHDEI--LGK  181

Query  620   KNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLL------LKQTVQCLC  781
                VD EE +R+LSTRS + L A++  YK+I GK + +DL  H        L+  ++C+ 
Sbjct  182   P--VDHEETIRVLSTRSSMQLSAIFNSYKDIFGKSITKDLLKHQTNEYLSALRAAIRCIK  239

Query  782   MPQLYFSKILDASLR-LGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGE  958
              P  Y++K+L  S+  +G DE   D++ RVIVTRA++D+K I + +  +  V+    I +
Sbjct  240   NPTRYYAKVLRNSINTVGTDE---DALNRVIVTRAEKDLKKITELYLKRNNVSFDQAIAK  296

Query  959   VANGSYKELLLTLVAKSE  1012
               +G YK  LL L+   E
Sbjct  297   ETSGDYKGFLLALLGHGE  314



>ref|NP_174810.1| annexin 1 [Arabidopsis thaliana]
 ref|XP_002891204.1| ANNAT1 [Arabidopsis lyrata subsp. lyrata]
 sp|Q9SYT0.1|ANXD1_ARATH RecName: Full=Annexin D1; AltName: Full=AnnAt1; AltName: Full=Annexin 
A1 [Arabidopsis thaliana]
 gb|AAD34236.1|AF083913_1 annexin [Arabidopsis thaliana]
 gb|AAF79882.1|AC021198_2 Identical to annexin (AnnAt1) mRNA from Arabidopsis thaliana 
gb|AF083913. It contains an annexin domain PF|00191. ESTs gb|H76460, 
gb|Z18518, gb|Z26190, gb|N96455, gb|Z47714, gb|T41940, 
gb|T43657, gb|N95995, gb|R30014, gb|T22046, gb|H37398, gb|H77008, 
gb|R29768, gb|H36260, gb|Z17514, gb|W43175, gb|T76739, 
gb|AA712753, gb|H76134, gb|T42209, gb|H36536, gb|AI998553, 
gb|Z32565, gb|AA597533, gb|AI100145 and gb|AI100054 come 
from this gene [Arabidopsis thaliana]
 gb|AAG48798.1|AF332435_1 putative Ca2+-dependent membrane-binding protein annexin [Arabidopsis 
thaliana]
 gb|AAL61954.1| Ca2+-dependent membrane-binding protein annexin [Arabidopsis 
thaliana]
 gb|AAM63633.1| Ca2+-dependent membrane-binding protein annexin [Arabidopsis 
thaliana]
 gb|AAO29977.1| Ca2+-dependent membrane-binding protein annexin [Arabidopsis 
thaliana]
 gb|EFH67463.1| ANNAT1 [Arabidopsis lyrata subsp. lyrata]
 gb|AEE31825.1| annexin 1 [Arabidopsis thaliana]
Length=317

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 117/321 (36%), Positives = 190/321 (59%), Gaps = 25/321 (8%)
 Frame = +2

Query  77    AVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHH  256
             A SDD + L  AF G G +E   +S+LA  + + R+  R++ H+ + +D    +  D   
Sbjct  12    APSDDAEQLRTAFEGWGTNEDLIISILAHRSAEQRKVIRQAYHETYGED--LLKTLDK--  67

Query  257   VLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGAR  433
               +L  +F R   A++L+ + P ERDA L  EA  +    + +L+E ACTR S +LL AR
Sbjct  68    --ELSNDFER---AILLWTLEPGERDALLANEATKRWTSSNQVLMEVACTRTSTQLLHAR  122

Query  434   RAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHA  613
             +AYH+ +  S+EED+A H     RKLLV+LV+SYRYEG +V+  +AK EAK++   IK  
Sbjct  123   QAYHARYKKSLEEDVAHHTTGDFRKLLVSLVTSYRYEGDEVNMTLAKQEAKLVHEKIKDK  182

Query  614   GNKNLVDDEEIVRILSTRSklhllalykhykEITGKFL-------DEDLHAHLLLKQTVQ  772
                   +DE+++RILSTRSK  + A +  Y++  G+ +       D+D     LL+ T+Q
Sbjct  183   H----YNDEDVIRILSTRSKAQINATFNRYQDDHGEEILKSLEEGDDDDKFLALLRSTIQ  238

Query  773   CLCMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDR  949
             CL  P+LYF  +L +++ + G DE A   +TR++ TRA+ D+K I +E++ +  + L   
Sbjct  239   CLTRPELYFVDVLRSAINKTGTDEGA---LTRIVTTRAEIDLKVIGEEYQRRNSIPLEKA  295

Query  950   IGEVANGSYKELLLTLVAKSE  1012
             I +   G Y+++L+ L+ + +
Sbjct  296   ITKDTRGDYEKMLVALLGEDD  316



>gb|KHG12913.1| Annexin-like protein RJ4 [Gossypium arboreum]
Length=314

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 117/320 (37%), Positives = 187/320 (58%), Gaps = 26/320 (8%)
 Frame = +2

Query  71    KMAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDD  250
             +++V +D + L KA  G G DEKA ++VL + N   R+  R    + +++D         
Sbjct  9     QVSVKEDAEALRKACQGWGTDEKAIIAVLGRRNAAQRRQIRHVYEEIYQED---------  59

Query  251   HHVLQLRQEFL-RLKDAVVLYMMHPWERDARLFKEALLKEP-QFDLLIETACTRPSEELL  424
               + +L  E     + AV  +++ P +RDA L    L K   +  +++E +CT+  EELL
Sbjct  60    -LIKRLESELSGHFEKAVYRWILDPPDRDAVLANVELKKSGDEHHVIVEISCTKNPEELL  118

Query  425   GARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAI  604
               RRAYH+ +  S+EED+A+H +   R+LLVALVS++RY G +++  +AKSEAK L  A+
Sbjct  119   DIRRAYHARYKRSLEEDVAYHTKGDTRRLLVALVSAFRYYGEEINTTLAKSEAKKLHEAV  178

Query  605   KHAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAH------LLLKQT  766
             K   NK    +E+++RILSTRS   L A +  Y+E  G  + ++L           L+  
Sbjct  179   K---NKKF-GNEDVIRILSTRSIAQLQATFNCYREEEGTSITKNLPKDSSDEYIATLRMA  234

Query  767   VQCLCMPQLYFSKILDASLR-LGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALS  943
             V+CL  P+ YF K+L  S+  +G DE   D++TRVIVTRA++D+K IK+ ++ +  V L 
Sbjct  235   VRCLKDPKKYFEKVLRRSIEGIGTDE---DALTRVIVTRAEKDLKEIKELYRKRNNVPLD  291

Query  944   DRIGEVANGSYKELLLTLVA  1003
               + +  +G YK++LLTL+ 
Sbjct  292   KAVDKEISGDYKDMLLTLLG  311



>ref|XP_008455214.1| PREDICTED: annexin D2-like [Cucumis melo]
Length=314

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 120/316 (38%), Positives = 179/316 (57%), Gaps = 24/316 (8%)
 Frame = +2

Query  80    VSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHV  259
             V++D   L  AF G G DE A +S+LA  N K R   R++  + + +D    +  D    
Sbjct  13    VAEDCDRLHNAFQGWGTDEGAIISILAHRNAKQRSLIRQTYAETYGED--LLKSLDK---  67

Query  260   LQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFDLLIETACTRPSEELLGARRA  439
              +L  +F R   AV+L+ +HP ERDA L  EA+ K   F +++E AC+R   +L   +  
Sbjct  68    -ELSSDFER---AVLLWTLHPAERDALLANEAIRKLKHF-VVLEIACSRTPRDLFLVKEE  122

Query  440   YHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGN  619
             YH+ F  SIEED+A +     R+LLV LV++YRY+GP+V+  +A SEA++L   I     
Sbjct  123   YHARFKRSIEEDVAQYTTGDFRRLLVPLVTAYRYDGPEVNATLATSEARILHEKITEKA-  181

Query  620   KNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHL------LLKQTVQCLC  781
                 +DEE++RI+STRSK  L A + HY +  G  + +DL          LL+  ++CL 
Sbjct  182   ---YNDEELIRIISTRSKAQLNATFNHYNDQFGNAISKDLKTDPNDNYLKLLRSAIKCLT  238

Query  782   MPQLYFSKILDASLR-LGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGE  958
              P+ YF K+L  +++ LG DE A   +TRV+VTRA+ DMK I +E+  +  V     I  
Sbjct  239   WPEKYFEKVLRLAIKGLGTDEEA---LTRVVVTRAEVDMKRIVEEYYRRNSVPFGQAIKG  295

Query  959   VANGSYKELLLTLVAK  1006
               +G Y+ +LL LV K
Sbjct  296   DTSGDYESMLLALVGK  311



>ref|XP_010032318.1| PREDICTED: annexin-like protein RJ4 isoform X2 [Eucalyptus grandis]
Length=334

 Score =   176 bits (445),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 117/322 (36%), Positives = 177/322 (55%), Gaps = 26/322 (8%)
 Frame = +2

Query  74    MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDH  253
              + ++D + L KAF G G +EKA + VL   N   R+  R++  Q + +D          
Sbjct  30    FSATEDAETLRKAFEGFGTNEKAIIEVLGHRNAAQRKQIRQAYEQLYEED----------  79

Query  254   HVLQLRQEFLR-LKDAVVLYMMHPWERDARLFKEALLK-EPQFDLLIETACTRPSEELLG  427
              V +L  E  R  + AV  +++ P +RDA L   AL K  P + ++IE +C R  +ELL 
Sbjct  80    LVKRLESELTRDFEKAVYRWILDPADRDAVLANVALKKSNPDYPVIIEISCIRTPDELLE  139

Query  428   ARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIK  607
              R+AY   +  S+EED+A H     RKLLV LVS+YRY+G +++  +A SEA ++ +AIK
Sbjct  140   VRKAYQLRYKRSLEEDVAAHTTGDIRKLLVGLVSAYRYQGEEINARLANSEADLIHDAIK  199

Query  608   HAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAH------LLLKQTV  769
                       +E++RIL+TRSK  L A +  Y+E  G  + ++L         + L+ T+
Sbjct  200   DKA----FSHDEVIRILTTRSKAQLRATFNRYQEDQGTSITKNLLVENPDEILVALRTTI  255

Query  770   QCLCMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSD  946
             + L  P  YF K+L   + R G DE   D +TRVIVTRA++D+K IK+E+  K  V+L  
Sbjct  256   RGLNDPNKYFVKVLSNGIKRAGTDE---DDLTRVIVTRAEKDLKEIKEEYYKKNSVSLDQ  312

Query  947   RIGEVANGSYKELLLTLVAKSE  1012
              + +   G YK  LL L+   E
Sbjct  313   AVAKDTTGDYKAFLLALLGNEE  334



>ref|XP_010025469.1| PREDICTED: annexin D2-like [Eucalyptus grandis]
 gb|KCW62131.1| hypothetical protein EUGRSUZ_H04787 [Eucalyptus grandis]
Length=316

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 118/315 (37%), Positives = 184/315 (58%), Gaps = 24/315 (8%)
 Frame = +2

Query  83    SDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVL  262
             ++D + L KAF+G G +E   +S+LA  N   R+  R++  + + +D    +  D     
Sbjct  14    AEDAEQLQKAFAGWGTNEDLIISILAHRNAAQRKVIRQTYAETYGED--LLKALDK----  67

Query  263   QLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGARRA  439
             +L  +F R   +V+L+ + P ERDA L  EA  +    + +L+E ACTR S EL   R+A
Sbjct  68    ELSSDFER---SVLLWTLDPAERDAFLSNEATKRLTSSNWVLMEIACTRSSMELFMVRQA  124

Query  440   YHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGN  619
             YH+ +  S+EEDIA+H      KLLV L S++RYEGP+V+  +A+SEAK+L   I    +
Sbjct  125   YHARYKKSLEEDIAYHTTGDFHKLLVPLASTFRYEGPEVNMTLARSEAKILHEKI----H  180

Query  620   KNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHL------LLKQTVQCLC  781
             K   + +E++RI++TRSK  L A   +Y    G  +++DL A        LL+  ++CL 
Sbjct  181   KKAYNHDELIRIVTTRSKAQLNATLNYYNNEFGNAINKDLKADPNDEFLKLLRSAIKCLT  240

Query  782   MPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGE  958
              P+ YF K+L  ++ +LG DE A   +TRV+ TRA+ DM+ IK+++  +  V L   I  
Sbjct  241   YPEKYFEKVLRLAINKLGTDEWA---LTRVVTTRAEVDMQRIKEQYHKRNSVPLDRAIAN  297

Query  959   VANGSYKELLLTLVA  1003
               +G YK++LLTLV 
Sbjct  298   DTSGDYKKMLLTLVG  312



>ref|XP_007227485.1| hypothetical protein PRUPE_ppa008882mg [Prunus persica]
 gb|EMJ28684.1| hypothetical protein PRUPE_ppa008882mg [Prunus persica]
Length=316

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 122/318 (38%), Positives = 184/318 (58%), Gaps = 28/318 (9%)
 Frame = +2

Query  80    VSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDE-RQFERWDDHH  256
              S+D + L KAF G G +E   +S+L   N   R+  R++  + + +D  ++ E+     
Sbjct  13    ASEDCEQLKKAFKGWGTNEDLIISILGHRNAPQRKVIRQTYAEAYGEDLLKELEK-----  67

Query  257   VLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGAR  433
               +L  +F R   +++L+ + P ERDA L  EA  K  + + +L E AC+R S ELL AR
Sbjct  68    --ELTSDFER---SILLWTLDPAERDAFLANEATKKWTKSNQVLAEIACSRSSHELLMAR  122

Query  434   RAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHA  613
             +AYHS +  S+EED+A H     RKLL  LVSSYRYEG +V+  +AKSEAK+L   I   
Sbjct  123   QAYHSRYKKSLEEDVAHHTTGDFRKLLAPLVSSYRYEGDEVNLTLAKSEAKLLHEKISDK  182

Query  614   GNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAH------LLLKQTVQC  775
                   +DE+I+RIL+TRSK  + A   HYK   G  +++DL A        +L+ T++C
Sbjct  183   A----YNDEDIIRILATRSKAQINATLNHYKNEFGNDINKDLKADPKDEYLAILRATIKC  238

Query  776   LCMPQLYFSKILDASLRLGVDEAARD--SVTRVIVTRADEDMKHIKQEFKTKYGVALSDR  949
             L  P+ YF K    SLRL +++   D  +++RV+ TRA+ DMK IK+++  +  V L   
Sbjct  239   LVRPEKYFEK----SLRLAINKRGTDEGALSRVVTTRAEVDMKLIKEQYHKRNSVTLDQA  294

Query  950   IGEVANGSYKELLLTLVA  1003
             I +   G Y+++LL LV 
Sbjct  295   IKKDTTGDYEKMLLALVG  312



>pdb|1YCN|A Chain A, X-Ray Structure Of Annexin From Arabidopsis Thaliana 
Gene At1g35720
 pdb|1YCN|B Chain B, X-Ray Structure Of Annexin From Arabidopsis Thaliana 
Gene At1g35720
 pdb|2Q4C|A Chain A, Ensemble Refinement Of The Protein Crystal Structure 
Of Annexin From Arabidopsis Thaliana Gene At1g35720
 pdb|2Q4C|B Chain B, Ensemble Refinement Of The Protein Crystal Structure 
Of Annexin From Arabidopsis Thaliana Gene At1g35720
Length=317

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 117/321 (36%), Positives = 190/321 (59%), Gaps = 25/321 (8%)
 Frame = +2

Query  77    AVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHH  256
             A SDD + L  AF G G +E   +S+LA  + + R+  R++ H+ + +D    +  D   
Sbjct  12    APSDDAEQLRTAFEGWGTNEDLIISILAHRSAEQRKVIRQAYHETYGED--LLKTLDK--  67

Query  257   VLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGAR  433
               +L  +F R   A++L+ + P ERDA L  EA  +    + +L+E ACTR S +LL AR
Sbjct  68    --ELSNDFER---AILLWTLEPGERDALLANEATKRWTSSNQVLMEVACTRTSTQLLHAR  122

Query  434   RAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHA  613
             +AYH+ +  S+EED+A H     RKLLV+LV+SYRYEG +V+  +AK EAK++   IK  
Sbjct  123   QAYHARYKKSLEEDVAHHTTGDFRKLLVSLVTSYRYEGDEVNMTLAKQEAKLVHEKIKDK  182

Query  614   GNKNLVDDEEIVRILSTRSklhllalykhykEITGKFL-------DEDLHAHLLLKQTVQ  772
                   +DE+++RILSTRSK  + A +  Y++  G+ +       D+D     LL+ T+Q
Sbjct  183   H----YNDEDVIRILSTRSKAQINATFNRYQDDHGEEILKSLEEGDDDDKFLALLRSTIQ  238

Query  773   CLCMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDR  949
             CL  P+LYF  +L +++ + G DE A   +TR++ TRA+ D+K I +E++ +  + L   
Sbjct  239   CLTRPELYFVDVLRSAINKTGTDEGA---LTRIVTTRAEIDLKVIGEEYQRRNSIPLEKA  295

Query  950   IGEVANGSYKELLLTLVAKSE  1012
             I +   G Y+++L+ L+ + +
Sbjct  296   ITKDTRGDYEKMLVALLGEDD  316



>gb|AAB67994.1| annexin, partial [Gossypium hirsutum]
Length=315

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 121/315 (38%), Positives = 180/315 (57%), Gaps = 30/315 (10%)
 Frame = +2

Query  101   LTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDE-RQFERWDDHHVLQLRQE  277
             L KAF G G +E+  + +LA  N   R S RK   + + +D  +  E+       +L  +
Sbjct  19    LRKAFEGWGTNEQLIIDILAHRNAAQRNSIRKVYGEAYGEDLLKCLEK-------ELTSD  71

Query  278   FLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGARRAYHSLF  454
             F R   AV+L+ + P ERDA L  EA  K    + +L+E AC+R S ELL  ++AYH+ +
Sbjct  72    FER---AVLLFTLDPAERDAHLANEATKKFTSSNWILMEIACSRSSHELLNVKKAYHARY  128

Query  455   DHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAI--KHAGNKNL  628
               S+EED+A H     RKLLV LVS++RYEG +V+  +AKSEAK+L + I  KH      
Sbjct  129   KKSLEEDVAHHTTGEYRKLLVPLVSAFRYEGEEVNMTLAKSEAKILHDKISDKH------  182

Query  629   VDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHL------LLKQTVQCLCMPQ  790
               DEE++RI+STRSK  L A   HY    G  +++DL A        LL+  ++CL  P+
Sbjct  183   YTDEEVIRIVSTRSKAQLNATLNHYNTSFGNAINKDLKADPSDEFLKLLRAVIKCLTTPE  242

Query  791   LYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVAN  967
              YF K+L  ++ +LG DE A   +TRV+ TRA+ DM  IK+ ++ +  + L   I +  +
Sbjct  243   QYFEKVLRQAINKLGSDEWA---LTRVVTTRAEVDMVRIKEAYQRRNSIPLEQAIAKDTS  299

Query  968   GSYKELLLTLVAKSE  1012
             G Y++ LL L+   +
Sbjct  300   GDYEKFLLALIGAGD  314



>dbj|BAJ92233.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=314

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 120/330 (36%), Positives = 175/330 (53%), Gaps = 40/330 (12%)
 Frame = +2

Query  65    SSKMAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERW  244
             S+  A++DD   L KAF G G +E   +S+L   +   R++ RK                
Sbjct  8     SNVPALADDCDNLRKAFQGWGTNEALIISILGHRDAAQRRAIRK----------------  51

Query  245   DDHHVLQLRQEFLR---------LKDAVVLYMMHPWERDARLFKEALLK-EPQFDLLIET  394
               H+     +E LR          + AV+L+ + P ERDA L  E   K  P   +L+E 
Sbjct  52    --HYADTYGEELLRSITDEISGDFERAVILWTLDPAERDAVLANETAKKWHPGNPVLVEI  109

Query  395   ACTRPSEELLGARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAK  574
             AC+R S +L   R+AYH  F  S+EED+A H+    RKLLV LVSSYRYEGP+V+  +A 
Sbjct  110   ACSRGSAQLFAVRQAYHDRFKRSLEEDVAAHVTGDFRKLLVPLVSSYRYEGPEVNTRLAH  169

Query  575   SEAKVLANAIKHAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHL-  751
             SEAK+L   I+H        D+EI+RIL+TRSK  LLA   +Y +  G  + +DL A   
Sbjct  170   SEAKILHEKIEHKA----YGDDEIIRILTTRSKAQLLATLNNYNDTFGHPITKDLKADPK  225

Query  752   -----LLKQTVQCLCMPQLYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEF  916
                   L+  ++C   P  YF K+  A L +  +    +S+TRVI TRA+ D+K IK+ +
Sbjct  226   DEFLKTLRAVIRCFTCPDRYFEKV--ARLAIAGNGTDENSLTRVITTRAEVDLKLIKEAY  283

Query  917   KTKYGVALSDRIGEVANGSYKELLLTLVAK  1006
             + +  V L   + +  +G Y+ +LL L+ K
Sbjct  284   QKRNSVPLEKAVADDTSGDYETMLLALLGK  313



>ref|NP_001240889.1| uncharacterized protein LOC100784252 [Glycine max]
 gb|AEO21434.1| annexin [Glycine max]
 gb|KHN44786.1| Annexin D1 [Glycine soja]
Length=316

 Score =   175 bits (443),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 122/316 (39%), Positives = 187/316 (59%), Gaps = 24/316 (8%)
 Frame = +2

Query  80    VSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHV  259
             V+DD + L KAFSG G +E+  VS+LA  N   R+  R++  Q + +D    +  D    
Sbjct  13    VADDCEQLRKAFSGWGTNEELIVSILAHRNAAQRKLIRETYAQTYGED--LLKALDK---  67

Query  260   LQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGARR  436
              +L  +F RL   V L+ +   ERDA L  EA  K    + +L+E ACTR SE+L  AR+
Sbjct  68    -ELTSDFERL---VHLWTLDSAERDAFLANEATKKWTSSNQVLVEIACTRSSEQLFAARK  123

Query  437   AYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAG  616
             AYH L+  S+EED+A H     RKL++ LVSSYRYEG +V+  +AK+EAK+L   I +  
Sbjct  124   AYHVLYKKSLEEDVAHHTTGDFRKLILPLVSSYRYEGDEVNLTLAKTEAKLLHEKISNKA  183

Query  617   NKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAH------LLLKQTVQCL  778
                  +D++ +RIL+TRS+  + A   HYK+  G+ +++DL A        LL+ TV+CL
Sbjct  184   ----YNDDDFIRILATRSRAQINATLNHYKDAFGQDINKDLKADPKDEFLSLLRATVKCL  239

Query  779   CMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIG  955
               P+ YF K++  ++ + G DE A   +TRV+ TRA+ D+K+I  E++ +  V L   I 
Sbjct  240   IRPEKYFEKVVRLAINKRGTDEGA---LTRVVATRAEVDLKNIADEYQRRSSVPLERAIV  296

Query  956   EVANGSYKELLLTLVA  1003
             +   G Y+++L+ L+ 
Sbjct  297   KDTTGDYEKMLVALLG  312



>gb|AGG75999.1| annexin AnxGb3 [Gossypium barbadense]
Length=315

 Score =   175 bits (443),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 126/335 (38%), Positives = 191/335 (57%), Gaps = 30/335 (9%)
 Frame = +2

Query  32    SMTAPTLNSANSSKMAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQF  211
             ++T PT      +  +VS+D + L KAFSG G +E   + +L   N + R   RK+  + 
Sbjct  3     TLTVPT------TVPSVSEDCEQLRKAFSGWGANEGLIIDILGHRNAEQRNLIRKTYAET  56

Query  212   FRDDERQFERWDDHHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLI  388
             + +D    +  D     +L  +F RL   V+L+ + P ERDA L  EA  +    + +L+
Sbjct  57    YGED--LLKALDK----ELSNDFERL---VLLWALDPAERDALLANEATKRWTSSNQVLM  107

Query  389   ETACTRPSEELLGARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDV  568
             E ACTR + +LL AR+AYH+ +  S+EED+A H     RKLL+ LVSSYRYEG +V+  +
Sbjct  108   EIACTRSANQLLHARQAYHARYKKSLEEDVAHHTTGDFRKLLLPLVSSYRYEGEEVNMTL  167

Query  569   AKSEAKVLANAIKHAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAH  748
             AK+EAK+L   I          D++++R+L+TRSK  + A   HYK   G  +++DL A 
Sbjct  168   AKTEAKLLHEKISDKA----YSDDDVIRVLATRSKAQINATLNHYKNEYGNDINKDLKAD  223

Query  749   ------LLLKQTVQCLCMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIK  907
                    LL+ TV+CL  P+ YF K+L  ++ R G DE A   +TRV+ TRA+ D+K I 
Sbjct  224   PKDEFLALLRSTVKCLVYPEKYFEKVLRLAINRRGTDEGA---LTRVVCTRAEVDLKIIA  280

Query  908   QEFKTKYGVALSDRIGEVANGSYKELLLTLVAKSE  1012
              E++ +  V L+  I +  +G Y++LLL L    E
Sbjct  281   DEYQRRNSVPLTRAIVKDTHGDYEKLLLVLAGHVE  315



>gb|KHG15756.1| Annexin D4 -like protein [Gossypium arboreum]
Length=199

 Score =   171 bits (433),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 98/206 (48%), Positives = 144/206 (70%), Gaps = 10/206 (5%)
 Frame = +2

Query  395   ACTRPSEELLGARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAK  574
             ACTR S++LLGAR+AYHSLF HSIEE +  HI+  ERKLLVALVS+YR++GP V+EDVAK
Sbjct  2     ACTRSSDQLLGARKAYHSLFHHSIEEHLVTHIKGRERKLLVALVSAYRFDGPGVNEDVAK  61

Query  575   SEAKVLANAIKHAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLL  754
             SEA++L  AI +     L+D E+ + IL+TRSK HL ALY+HY +   K L +DL    +
Sbjct  62    SEAQILYEAINNGEKNKLLDHEDAIMILATRSKQHLQALYQHYNQSYDKTLAQDLEGEGI  121

Query  755   LKQTVQCLCMPQLYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGV  934
             LK TV+CLC PQ YF+++L+A+++   DE ++ ++TRVIVT+ ++    +K+ F      
Sbjct  122   LKDTVECLCTPQTYFTRVLEAAVKEDADEESKRALTRVIVTQKEQ---LVKEGF------  172

Query  935   ALSDRIGEVANGSYKELLLTLVAKSE  1012
              + ++I ++  G YK+ +L  +A  +
Sbjct  173   -VPNKIQDILLGLYKDFMLASIASGD  197



>ref|XP_010032317.1| PREDICTED: annexin-like protein RJ4 isoform X1 [Eucalyptus grandis]
Length=348

 Score =   176 bits (445),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 117/322 (36%), Positives = 178/322 (55%), Gaps = 26/322 (8%)
 Frame = +2

Query  74    MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDH  253
              + ++D + L KAF G G +EKA + VL   N   R+  R++  Q + +D          
Sbjct  44    FSATEDAETLRKAFEGFGTNEKAIIEVLGHRNAAQRKQIRQAYEQLYEED----------  93

Query  254   HVLQLRQEFLR-LKDAVVLYMMHPWERDARLFKEALLK-EPQFDLLIETACTRPSEELLG  427
              V +L  E  R  + AV  +++ P +RDA L   AL K  P + ++IE +C R  +ELL 
Sbjct  94    LVKRLESELTRDFEKAVYRWILDPADRDAVLANVALKKSNPDYPVIIEISCIRTPDELLE  153

Query  428   ARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIK  607
              R+AY   +  S+EED+A H     RKLLV LVS+YRY+G +++  +A SEA ++ +AIK
Sbjct  154   VRKAYQLRYKRSLEEDVAAHTTGDIRKLLVGLVSAYRYQGEEINARLANSEADLIHDAIK  213

Query  608   HAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAH------LLLKQTV  769
                  +    +E++RIL+TRSK  L A +  Y+E  G  + ++L         + L+ T+
Sbjct  214   DKAFSH----DEVIRILTTRSKAQLRATFNRYQEDQGTSITKNLLVENPDEILVALRTTI  269

Query  770   QCLCMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSD  946
             + L  P  YF K+L   + R G DE   D +TRVIVTRA++D+K IK+E+  K  V+L  
Sbjct  270   RGLNDPNKYFVKVLSNGIKRAGTDE---DDLTRVIVTRAEKDLKEIKEEYYKKNSVSLDQ  326

Query  947   RIGEVANGSYKELLLTLVAKSE  1012
              + +   G YK  LL L+   E
Sbjct  327   AVAKDTTGDYKAFLLALLGNEE  348



>ref|XP_010916889.1| PREDICTED: annexin D2-like isoform X2 [Elaeis guineensis]
Length=315

 Score =   175 bits (443),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 125/319 (39%), Positives = 181/319 (57%), Gaps = 32/319 (10%)
 Frame = +2

Query  86    DDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVLQ  265
             DD + L KAF G G +E   +++LA  +   R+  R +  Q + +D           +L+
Sbjct  15    DDSEQLRKAFEGWGTNEGLIIAILAHRSAAQRRQIRDAYAQAYGED-----------ILK  63

Query  266   -LRQEFLR-LKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGARR  436
              L +E  R  + AV+L+M+ P ERDA L  EAL K    +  LIE + TR S+E+   RR
Sbjct  64    ALEKELTRHFEKAVLLWMLDPPERDAVLANEALKKWSSGNRALIEISVTRTSDEMFAVRR  123

Query  437   AYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAI--KH  610
             AYH+ F  S+EED+A H     RKLLV LVSSYRYEG +V+  +AKSEAK+L   I  K 
Sbjct  124   AYHARFKRSLEEDVAVHTSGDFRKLLVPLVSSYRYEGLEVNASLAKSEAKMLHEKINDKD  183

Query  611   AGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAH------LLLKQTVQ  772
              GN      EEI+RIL+TRSK  LLA +  Y    G  +++DL A         L+  ++
Sbjct  184   YGN------EEIIRILTTRSKAQLLATFNDYNNEFGHPINKDLKADPKDDFLFALRSIIR  237

Query  773   CLCMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDR  949
             C+  P+ YF K++  ++ ++G DE A   +TRVI TRA+ +MK IK+ +  +  V L   
Sbjct  238   CIICPEKYFEKVIRLAINKMGTDEYA---LTRVITTRAEVNMKQIKEIYYKRNSVPLERA  294

Query  950   IGEVANGSYKELLLTLVAK  1006
             I +   G Y++ LL L+ +
Sbjct  295   IKKDTTGDYEDFLLALIGE  313



>emb|CDY41873.1| BnaA08g06260D [Brassica napus]
Length=317

 Score =   175 bits (443),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 120/318 (38%), Positives = 189/318 (59%), Gaps = 25/318 (8%)
 Frame = +2

Query  86    DDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVLQ  265
             +D + L  AF G G +E   +S+LA  + + R+  R++ H+ F +D    +  D     +
Sbjct  15    EDAEQLKTAFEGWGTNEDLIISILAHRSAEQRKLIRQTYHEVFGED--LLKSLDK----E  68

Query  266   LRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGARRAY  442
             L  +F R   A++L+ + P ERDA L  EA  +    + +L+E ACTR S +LL AR+AY
Sbjct  69    LSSDFER---AILLWTLEPGERDALLANEATKRWTSSNQVLMEVACTRTSTQLLHARQAY  125

Query  443   HSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGNK  622
             H+ F  SIEED+A H     RKLLV+LVSSYRYEG +V+  +AK EAK++   IK   +K
Sbjct  126   HARFKKSIEEDVAHHTTGDFRKLLVSLVSSYRYEGDEVNMTLAKQEAKLIHERIK---DK  182

Query  623   NLVDDEEIVRILSTRSklhllalykhykEITGKFL-------DEDLHAHLLLKQTVQCLC  781
             +   DEE++RILSTRSK  + A +  Y++  G+ +       D D     LL+ T+QCL 
Sbjct  183   H-YSDEEVIRILSTRSKAQINATFNRYQDDHGEEILKSLEEGDGDDKFLELLRSTIQCLT  241

Query  782   MPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGE  958
              P+LYF  +L +++ + G DE A   +TR++ TRA+ D+K I +E++ +  + L   I +
Sbjct  242   RPELYFVDVLRSAINKTGTDEGA---LTRIVTTRAEIDLKVIGEEYQRRNSIPLEKAITK  298

Query  959   VANGSYKELLLTLVAKSE  1012
                G Y+++L+ L+ + +
Sbjct  299   DTRGDYEKMLVALLGEDD  316



>ref|XP_010926280.1| PREDICTED: annexin D2-like [Elaeis guineensis]
Length=315

 Score =   175 bits (443),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 122/317 (38%), Positives = 180/317 (57%), Gaps = 26/317 (8%)
 Frame = +2

Query  83    SDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVL  262
             ++D + L KAF G G +E + +S+LA  +   R+  R S  Q + +D  +          
Sbjct  14    AEDCEQLRKAFQGWGTNEGSIISILAHRSGAQRRQIRDSYAQAYGEDLLKV---------  64

Query  263   QLRQEFLR-LKDAVVLYMMHPWERDARLFKEALLK-EPQFDLLIETACTRPSEELLGARR  436
              L +E  R  + AV+L+++ P ERDA L  EAL K  P    LIE A TR ++E+   RR
Sbjct  65    -LDKELTRDFEKAVLLWILDPPERDAVLANEALKKWSPNNRALIEIAMTRTADEMFAVRR  123

Query  437   AYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAG  616
             AY   F  S+EED+A H     RKLLV LVSSYRYEGP+V+  +AKSEAK+L   I+   
Sbjct  124   AYRGRFKRSLEEDVAVHTNGDFRKLLVPLVSSYRYEGPEVNASLAKSEAKILHEKIEEKA  183

Query  617   NKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAH------LLLKQTVQCL  778
               +    EEI+RIL+TRSK HLLA +  Y    G  +++DL +         L+  V+C+
Sbjct  184   YGH----EEIIRILTTRSKEHLLATFNDYNNEFGHPINKDLKSDPKDDFLFALRAIVRCI  239

Query  779   CMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIG  955
               P+ Y  K++  ++ ++G DE A   +TRVI TRA+ +MKHIK+ +  +  V L   + 
Sbjct  240   ICPERYLEKVIRLAINKMGTDECA---LTRVITTRAEVNMKHIKEIYYKRNSVRLDHALK  296

Query  956   EVANGSYKELLLTLVAK  1006
             +   G Y++ LL L+ +
Sbjct  297   KDTTGDYEDFLLALIGQ  313



>ref|XP_010680554.1| PREDICTED: annexin D2-like [Beta vulgaris subsp. vulgaris]
Length=316

 Score =   174 bits (442),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 122/317 (38%), Positives = 184/317 (58%), Gaps = 26/317 (8%)
 Frame = +2

Query  80    VSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRK-STHQFFRDDERQFERWDDHH  256
             V++D + L KAFSG G +E   +++LA  N   R+  R+  T  +  D  +  ++     
Sbjct  13    VAEDVEQLHKAFSGWGTNEDLIITILAHRNACQRKLIRELYTSTYGEDLLKTLDK-----  67

Query  257   VLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGAR  433
               +L  +F   + AV L+ + P ERDA L  EA  K    + +LIE ACTR S++L  AR
Sbjct  68    --ELSSDF---EKAVHLFTLDPPERDAHLANEATKKFTSSNWVLIEVACTRSSDDLFSAR  122

Query  434   RAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHA  613
             RAYH+ +  S+EED+A H     RKLLV LVSS+RYEGP+V+  +AKSEAK+L   I   
Sbjct  123   RAYHARYKKSLEEDVAQHTTGDFRKLLVPLVSSFRYEGPEVNTHLAKSEAKILHEKI---  179

Query  614   GNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHL------LLKQTVQC  775
              +K   DD + +RI++TRSK  L A    Y    G  + +DL          LL+ T++C
Sbjct  180   SDKAYADD-DFIRIIATRSKAQLSATLNTYNNDYGHAITKDLKEDPKDDYLKLLRATIKC  238

Query  776   LCMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRI  952
             L  P+ Y+ K+L  ++ ++G DE+A   +TRV+ TRA+ DM+ IK+E+  +  V L   I
Sbjct  239   LTCPEKYYEKLLRLAINKMGTDESA---LTRVVTTRAEVDMQRIKEEYYRRNSVPLDHAI  295

Query  953   GEVANGSYKELLLTLVA  1003
              +  +G Y+++L+ LV 
Sbjct  296   AKDTHGDYEKMLIELVG  312



>gb|AAB67993.2| annexin [Gossypium hirsutum]
Length=315

 Score =   174 bits (442),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 128/335 (38%), Positives = 192/335 (57%), Gaps = 30/335 (9%)
 Frame = +2

Query  32    SMTAPTLNSANSSKMAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQF  211
             ++T PT      +  +VS+D + L KAFSG G +E   + +L   N + R   RK+  + 
Sbjct  2     TLTVPT------TVPSVSEDCEQLRKAFSGWGTNEGLIIDILGHRNAEQRNLIRKTYAET  55

Query  212   FRDDERQFERWDDHHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLI  388
             + +D    +  D     +L  +F RL   V+L+ + P ERDA L  EA  +    + +L+
Sbjct  56    YGED--LLKALDK----ELSNDFERL---VLLWALDPAERDALLANEATKRWTSSNQVLM  106

Query  389   ETACTRPSEELLGARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDV  568
             E ACTR + +LL AR+AYH+ +  S+EED+A H      KLL+ LVSSYRYEG +V+  +
Sbjct  107   EIACTRSANQLLHARQAYHARYKKSLEEDVAHHTTGDFHKLLLPLVSSYRYEGEEVNMTL  166

Query  569   AKSEAKVLANAIKHAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAH  748
             AK+EAK+L   I    NK   DD +++R+L+TRSK  + A   HYK   G  +++DL A 
Sbjct  167   AKTEAKLLHEKI---SNKAYSDD-DVIRVLATRSKAQINATLNHYKNEYGNDINKDLKAD  222

Query  749   ------LLLKQTVQCLCMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIK  907
                    LL+ TV+CL  P+ YF K+L  ++ R G DE A   +TRV+ TRA+ D+K I 
Sbjct  223   PKDEFLALLRSTVKCLVYPEKYFEKVLRLAINRRGTDEGA---LTRVVCTRAEVDLKVIA  279

Query  908   QEFKTKYGVALSDRIGEVANGSYKELLLTLVAKSE  1012
              E++ +  V L+  I +  +G Y++LLL L    E
Sbjct  280   DEYQRRNSVPLTRAIVKDTHGDYEKLLLVLAGHVE  314



>pdb|1N00|A Chain A, Annexin Gh1 From Cotton
Length=321

 Score =   175 bits (443),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 129/344 (38%), Positives = 192/344 (56%), Gaps = 34/344 (10%)
 Frame = +2

Query  5     HSRQPYMSVSMTAPTLNSANSSKMAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQ  184
             H     ++V  T P+          VS+D + L KAFSG G +E   + +L   N + R 
Sbjct  3     HHHHATLTVPTTVPS----------VSEDCEQLRKAFSGWGTNEGLIIDILGHRNAEQRN  52

Query  185   SYRKSTHQFFRDDERQFERWDDHHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLK  364
               RK+  + + +D    +  D     +L  +F RL   V+L+ + P ERDA L  EA  +
Sbjct  53    LIRKTYAETYGED--LLKALDK----ELSNDFERL---VLLWALDPAERDALLANEATKR  103

Query  365   EPQFD-LLIETACTRPSEELLGARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRY  541
                 + +L+E ACTR + +LL AR+AYH+ +  S+EED+A H      KLL+ LVSSYRY
Sbjct  104   WTSSNQVLMEIACTRSANQLLHARQAYHARYKKSLEEDVAHHTTGDFHKLLLPLVSSYRY  163

Query  542   EGPKVHEDVAKSEAKVLANAIKHAGNKNLVDDEEIVRILSTRSklhllalykhykEITGK  721
             EG +V+  +AK+EAK+L   I    NK   DD +++R+L+TRSK  + A   HYK   G 
Sbjct  164   EGEEVNMTLAKTEAKLLHEKI---SNKAYSDD-DVIRVLATRSKAQINATLNHYKNEYGN  219

Query  722   FLDEDLHAH------LLLKQTVQCLCMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTR  880
              +++DL A        LL+ TV+CL  P+ YF K+L  ++ R G DE A   +TRV+ TR
Sbjct  220   DINKDLKADPKDEFLALLRSTVKCLVYPEKYFEKVLRLAINRRGTDEGA---LTRVVCTR  276

Query  881   ADEDMKHIKQEFKTKYGVALSDRIGEVANGSYKELLLTLVAKSE  1012
             A+ D+K I  E++ +  V L+  I +  +G Y++LLL L    E
Sbjct  277   AEVDLKVIADEYQRRNSVPLTRAIVKDTHGDYEKLLLVLAGHVE  320



>pdb|3BRX|A Chain A, Crystal Structure Of Calcium-Bound Cotton Annexin Gh1
Length=317

 Score =   174 bits (442),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 128/335 (38%), Positives = 192/335 (57%), Gaps = 30/335 (9%)
 Frame = +2

Query  32    SMTAPTLNSANSSKMAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQF  211
             ++T PT      +  +VS+D + L KAFSG G +E   + +L   N + R   RK+  + 
Sbjct  4     TLTVPT------TVPSVSEDCEQLRKAFSGWGTNEGLIIDILGHRNAEQRNLIRKTYAET  57

Query  212   FRDDERQFERWDDHHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLI  388
             + +D    +  D     +L  +F RL   V+L+ + P ERDA L  EA  +    + +L+
Sbjct  58    YGED--LLKALDK----ELSNDFERL---VLLWALDPAERDALLANEATKRWTSSNQVLM  108

Query  389   ETACTRPSEELLGARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDV  568
             E ACTR + +LL AR+AYH+ +  S+EED+A H      KLL+ LVSSYRYEG +V+  +
Sbjct  109   EIACTRSANQLLHARQAYHARYKKSLEEDVAHHTTGDFHKLLLPLVSSYRYEGEEVNMTL  168

Query  569   AKSEAKVLANAIKHAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAH  748
             AK+EAK+L   I    NK   DD +++R+L+TRSK  + A   HYK   G  +++DL A 
Sbjct  169   AKTEAKLLHEKI---SNKAYSDD-DVIRVLATRSKAQINATLNHYKNEYGNDINKDLKAD  224

Query  749   ------LLLKQTVQCLCMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIK  907
                    LL+ TV+CL  P+ YF K+L  ++ R G DE A   +TRV+ TRA+ D+K I 
Sbjct  225   PKDEFLALLRSTVKCLVYPEKYFEKVLRLAINRRGTDEGA---LTRVVCTRAEVDLKVIA  281

Query  908   QEFKTKYGVALSDRIGEVANGSYKELLLTLVAKSE  1012
              E++ +  V L+  I +  +G Y++LLL L    E
Sbjct  282   DEYQRRNSVPLTRAIVKDTHGDYEKLLLVLAGHVE  316



>ref|XP_008786903.1| PREDICTED: annexin-like protein RJ4 [Phoenix dactylifera]
Length=310

 Score =   174 bits (441),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 117/313 (37%), Positives = 181/313 (58%), Gaps = 23/313 (7%)
 Frame = +2

Query  83    SDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVL  262
             ++D + L KAF G G DEKA +++LA  +   R+  R +  + ++  E    R +     
Sbjct  14    AEDAEKLRKAFQGWGTDEKAVIAILAHRDAAQREQIRLAYEELYK--ENLITRLES----  67

Query  263   QLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFDLLIETACTRPSEELLGARRAY  442
             +L   F R   AV  ++  P ER+A +   AL K   + ++IE AC    +ELL  ++AY
Sbjct  68    ELSGHFER---AVYRWIFDPVEREAIMANVALKKNVDYQVIIEIACVNSPKELLAVKQAY  124

Query  443   HSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGNK  622
             H+ + HS+EED+A +     RKLLVALVS+YRY+G + +  +AKSEAK+L + I+    +
Sbjct  125   HARYKHSLEEDVASNTIGDFRKLLVALVSTYRYDGEETNTGLAKSEAKILHDVIE----Q  180

Query  623   NLVDDEEIVRILSTRSklhllalykhykE----ITGKFLDEDLHAH-LLLKQTVQCLCMP  787
              + +D+E++RILSTRSK  L A +  YK+    IT     E  +   L L+  ++C+  P
Sbjct  181   KIFNDDEVIRILSTRSKAQLTATFNCYKDEYGSITKALAGESPNEFALALRIAIRCITSP  240

Query  788   QLYFSKILDASLRLGVDEAA-RDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVA  964
             + YF+K+    LR GVD  A  D++TRVIV  A++D+K IK+ F  +   AL   + +V 
Sbjct  241   KKYFAKV----LRHGVDSGADEDALTRVIVMHAEKDLKEIKEMFHKRTNAALGHAVAKVT  296

Query  965   NGSYKELLLTLVA  1003
             +G YK  LL L+ 
Sbjct  297   SGDYKSFLLALIG  309



>gb|AGQ56694.1| cotton annexin 3 [Gossypium hirsutum]
Length=316

 Score =   174 bits (442),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 128/335 (38%), Positives = 192/335 (57%), Gaps = 30/335 (9%)
 Frame = +2

Query  32    SMTAPTLNSANSSKMAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQF  211
             ++T PT      +  +VS+D + L KAFSG G +E   + +L   N + R   RK+  + 
Sbjct  3     TLTVPT------TVPSVSEDCEQLRKAFSGWGTNEGLIIDILGHRNAEQRNLIRKTYAET  56

Query  212   FRDDERQFERWDDHHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLI  388
             + +D    +  D     +L  +F RL   V+L+ + P ERDA L  EA  +    + +L+
Sbjct  57    YGED--LLKALDK----ELSNDFERL---VLLWALDPAERDALLANEATKRWTSSNQVLM  107

Query  389   ETACTRPSEELLGARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDV  568
             E ACTR + +LL AR+AYH+ +  S+EED+A H      KLL+ LVSSYRYEG +V+  +
Sbjct  108   EIACTRSANQLLHARQAYHARYKKSLEEDVAHHTTGDFHKLLLPLVSSYRYEGEEVNMTL  167

Query  569   AKSEAKVLANAIKHAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAH  748
             AK+EAK+L   I    NK   DD +++R+L+TRSK  + A   HYK   G  +++DL A 
Sbjct  168   AKTEAKLLHEKI---SNKAYSDD-DVIRVLATRSKAQINATLNHYKNEYGNDINKDLKAD  223

Query  749   ------LLLKQTVQCLCMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIK  907
                    LL+ TV+CL  P+ YF K+L  ++ R G DE A   +TRV+ TRA+ D+K I 
Sbjct  224   PKDEFLALLRSTVKCLVYPEKYFEKVLRLAINRRGTDEGA---LTRVVCTRAEVDLKIIA  280

Query  908   QEFKTKYGVALSDRIGEVANGSYKELLLTLVAKSE  1012
              E++ +  V L+  I +  +G Y++LLL L    E
Sbjct  281   DEYQRRNSVPLTRAIVKDTHGDYEKLLLVLAGHVE  315



>ref|XP_008782135.1| PREDICTED: annexin D2-like [Phoenix dactylifera]
Length=315

 Score =   174 bits (441),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 121/337 (36%), Positives = 185/337 (55%), Gaps = 36/337 (11%)
 Frame = +2

Query  23    MSVSMTAPTLNSANSSKMAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKST  202
             +SV+++ P+           ++D + L KAF G G +E   +S+LA  +   R+  R + 
Sbjct  4     ISVAVSVPS----------PAEDCEQLRKAFQGWGTNEGLIISILAHRSAAQRRQIRDAY  53

Query  203   HQFFRDDERQFERWDDHHVLQLRQEFLR-LKDAVVLYMMHPWERDARLFKEALLK-EPQF  376
              Q + +D           +  L +E  R  + AV+L+++ P ERDA L  EAL K  P  
Sbjct  54    AQAYSED----------LLKALDKELTRDFEKAVLLWILDPPERDAVLANEALKKWSPGN  103

Query  377   DLLIETACTRPSEELLGARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKV  556
               LIE A TR ++E+   RRAY   F  S+EED+A H     RKLLV LVSSYRYEGP+V
Sbjct  104   RALIEIAVTRTADEMFAVRRAYQGRFKRSLEEDVAAHTNGDFRKLLVPLVSSYRYEGPEV  163

Query  557   HEDVAKSEAKVLANAIKHAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDED  736
             +  +AKSEAK+L   I    N+     EEI+RIL+TRSK  L A +  Y    G  +++D
Sbjct  164   NASLAKSEAKILHEKI----NEKAYGHEEIIRILTTRSKAQLFATFNDYNNGFGHPINKD  219

Query  737   LHAH------LLLKQTVQCLCMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDM  895
             L +         L+  ++C+  P+ Y  K++  ++ ++G DE A   +TRVI TRA+ +M
Sbjct  220   LKSDPKDDFLFALRAIIRCIICPERYLEKVIRLAINKMGTDECA---LTRVITTRAEANM  276

Query  896   KHIKQEFKTKYGVALSDRIGEVANGSYKELLLTLVAK  1006
             KHIK+ +  +  V L   + +   G Y++ L+ L+ +
Sbjct  277   KHIKEIYYKRNSVRLDHALKKDTTGDYEDFLVALIGQ  313



>gb|KCW62129.1| hypothetical protein EUGRSUZ_H04787 [Eucalyptus grandis]
Length=316

 Score =   174 bits (441),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 117/315 (37%), Positives = 184/315 (58%), Gaps = 24/315 (8%)
 Frame = +2

Query  83    SDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVL  262
             ++D + L KAF+G G +E   +S+LA  N   R+  R++  + + +D    +  D     
Sbjct  14    AEDAEQLQKAFAGWGTNEDLIISILAHRNAAQRKVIRQTYAETYGED--LLKALDK----  67

Query  263   QLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGARRA  439
             +L  +F R   +V+L+ + P ERDA L  EA  +    + +L+E ACTR S EL   R+A
Sbjct  68    ELSSDFER---SVLLWTLDPAERDAFLSNEATKRLTSSNWVLMEIACTRSSMELFMVRQA  124

Query  440   YHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGN  619
             YH+ +  S+EEDIA+H     RKLLV L S++RYEGP+V+  +A+SEAK+L   I    +
Sbjct  125   YHARYKKSLEEDIAYHTTGDFRKLLVPLASTFRYEGPEVNMTLARSEAKILHEKI----H  180

Query  620   KNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHL------LLKQTVQCLC  781
             +   + +E++RI++TRSK  L A   +Y    G  +++DL A        LL+  ++CL 
Sbjct  181   EKAYNHDELIRIVTTRSKAQLNATLNYYNNEFGNAINKDLKADPNDEFLKLLRSAIKCLT  240

Query  782   MPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGE  958
              P+ YF K+L  ++ +LG DE A   +TRV+ TRA+ DM+ IK+++  +  V L   I  
Sbjct  241   YPEKYFEKVLRLAINKLGTDEWA---LTRVVTTRAEVDMQRIKEQYHKRNSVPLDRAIAN  297

Query  959   VANGSYKELLLTLVA  1003
               +G YK++LL LV 
Sbjct  298   DTSGDYKKMLLALVG  312



>ref|XP_002309980.1| annexin-like protein RJ4 [Populus trichocarpa]
 gb|EEE90430.1| annexin-like protein RJ4 [Populus trichocarpa]
Length=316

 Score =   174 bits (441),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 122/314 (39%), Positives = 176/314 (56%), Gaps = 24/314 (8%)
 Frame = +2

Query  86    DDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVLQ  265
             +D + L KAF G G +E   +S+LA  N   R   RK   + +  D    +  D     +
Sbjct  15    EDAEQLHKAFEGWGTNEGLIISILAHRNAAQRNLIRKVYAEAYGQD--LLKDLDK----E  68

Query  266   LRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGARRAY  442
             L  +F R   AV+L+ + P ERDA L  EA  +    + +L+E ACTR S +L   R+AY
Sbjct  69    LSSDFER---AVLLWTLDPAERDAYLANEATKRFTSSNWVLMEIACTRSSHDLFKVRQAY  125

Query  443   HSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGNK  622
             H+ +  S+EED+A+H     RKLLV LVS++RYEG +V+  +AKSEAK+L   I      
Sbjct  126   HARYKKSLEEDVAYHTTGDFRKLLVPLVSAFRYEGEEVNTILAKSEAKILHEKISDKA--  183

Query  623   NLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHL------LLKQTVQCLCM  784
                 DEEI+RIL+TRSK  L A   HY    G  ++++L          LL+ T++CL  
Sbjct  184   --YSDEEIIRILTTRSKAQLNATLNHYNNAFGNAINKNLKEEADNDFLKLLRATIKCLTY  241

Query  785   PQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEV  961
             P+ YF K+L  S+ +LG DE A   +TRV+ TRA+ DM+ IK+E+  +  V L   I   
Sbjct  242   PEKYFEKLLRLSIKKLGTDERA---LTRVVTTRAEVDMERIKEEYHRRNSVTLERDIAGD  298

Query  962   ANGSYKELLLTLVA  1003
              +G Y+ +LL L+ 
Sbjct  299   TSGDYERMLLALIG  312



>ref|XP_004964979.1| PREDICTED: annexin D2-like [Setaria italica]
Length=314

 Score =   174 bits (441),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 123/318 (39%), Positives = 184/318 (58%), Gaps = 24/318 (8%)
 Frame = +2

Query  77    AVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHH  256
             AV+DD + L KAF G G +E   +S+L   +   R++ R++  + +   E       D  
Sbjct  12    AVADDCEQLRKAFQGWGTNEALIISILGHRDAAQRRAIRRAYAETY--GEELLRSITD--  67

Query  257   VLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLK-EPQFDLLIETACTRPSEELLGAR  433
               ++  +F R   AV+L+ + P ERDA L  EA  K +P   +L+E ACTR S +L   R
Sbjct  68    --EISGDFER---AVILWTLDPAERDAVLANEAARKWQPGNRVLVEIACTRGSAQLFAVR  122

Query  434   RAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHA  613
             +AYH  F  S+EEDIA H+    RKLLV LVS+YRY+GP+V+  +A SEAK+L   I H 
Sbjct  123   QAYHERFKRSLEEDIAAHVTGDFRKLLVPLVSAYRYDGPEVNTRLAHSEAKMLHEKIHHK  182

Query  614   GNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHL------LLKQTVQC  775
                    D+EI+RIL+TRSK  LLA + +Y +  G  +++DL A         L+  ++C
Sbjct  183   A----YSDDEIIRILTTRSKAQLLATFNYYNDAFGHPINKDLKADPKDEYLKTLRAIIRC  238

Query  776   LCMPQLYFSKILDASLR-LGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRI  952
             L  P  YF K++  ++  LG DE+   S+TRVI TRA+ D+KHIK+ ++ +  V L   +
Sbjct  239   LTCPDRYFEKVVRQAIAGLGTDES---SLTRVITTRAEVDLKHIKEAYQKRNSVPLERAV  295

Query  953   GEVANGSYKELLLTLVAK  1006
                 +G Y+ +LL L+ +
Sbjct  296   AGDTSGDYESMLLALLGQ  313



>ref|XP_009107912.1| PREDICTED: annexin D1 [Brassica rapa]
Length=317

 Score =   174 bits (441),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 120/323 (37%), Positives = 189/323 (59%), Gaps = 35/323 (11%)
 Frame = +2

Query  86    DDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVL-  262
             +D + L  AF G G +E   +S+LA  + + R+  R++ H+ F +           H+L 
Sbjct  15    EDAEQLKTAFEGWGTNEDLIISILAHRSAEQRKLIRQTYHEVFGE-----------HLLK  63

Query  263   ----QLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLG  427
                 +L  +F R   A++L+ + P ERDA L  EA  +    + +L+E ACTR S +LL 
Sbjct  64    SLDKELSSDFER---AILLWTLEPGERDALLANEATKRWTSSNQVLMEVACTRTSTQLLH  120

Query  428   ARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIK  607
             AR+AYH+ F  SIEED+A H     RKLLV+LVSSYRYEG +V+  +AK EAK++   IK
Sbjct  121   ARQAYHARFKKSIEEDVAHHTTGDFRKLLVSLVSSYRYEGDEVNMTLAKQEAKLIHERIK  180

Query  608   HAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFL-------DEDLHAHLLLKQT  766
                +K+   DEE++RILSTRSK  + A +  Y++  G+ +       D D     LL+ T
Sbjct  181   ---DKH-YSDEEVIRILSTRSKAQINATFNRYQDDHGEEILKSLEEGDGDDKFLELLRST  236

Query  767   VQCLCMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALS  943
             +QCL  P+LYF  +L +++ + G DE A   +TR++ TRA+ D+K I +E++ +  + L 
Sbjct  237   IQCLTRPELYFVDVLRSAINKTGTDEGA---LTRIVTTRAEIDLKVIGEEYQRRNSIPLE  293

Query  944   DRIGEVANGSYKELLLTLVAKSE  1012
               I +   G Y+++L+ L+ + +
Sbjct  294   KAITKDTRGDYEKMLVALLGEDD  316



>dbj|BAJ97416.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=314

 Score =   174 bits (440),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 120/330 (36%), Positives = 174/330 (53%), Gaps = 40/330 (12%)
 Frame = +2

Query  65    SSKMAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERW  244
             S+  A++DD   L KAF G G +E   +S+L   +   R++ RK                
Sbjct  8     SNVPALADDCDNLRKAFQGWGTNEALIISILGHRDAAQRRAIRK----------------  51

Query  245   DDHHVLQLRQEFLR---------LKDAVVLYMMHPWERDARLFKEALLK-EPQFDLLIET  394
               H+     +E LR          + AV+L+ + P ERDA L  E   K  P   +L+E 
Sbjct  52    --HYADTYGEELLRSITDEISGDFERAVILWTLDPAERDAVLANETAKKWHPGNPVLVEI  109

Query  395   ACTRPSEELLGARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAK  574
             AC+R S +L   R+AYH  F  S+EED+A H+    RKLLV LVSSYRYEGP+V+  +A 
Sbjct  110   ACSRGSAQLFAVRQAYHDRFKRSLEEDVAAHVTGDFRKLLVPLVSSYRYEGPEVNTRLAH  169

Query  575   SEAKVLANAIKHAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHL-  751
             SEAK+L   I+H        D+EI+RIL+TRSK  LLA   +Y +  G  + +DL A   
Sbjct  170   SEAKILHEKIEHKA----YGDDEIIRILTTRSKAQLLATLNNYNDTFGHPITKDLKADPK  225

Query  752   -----LLKQTVQCLCMPQLYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEF  916
                   L+  ++C   P  YF K+  A L +  +    +S+TRVI TRA+ D+K IK+ +
Sbjct  226   DEFLKTLRAVIRCFTCPDRYFEKV--ARLAIAGNGTDENSLTRVITTRAEVDLKLIKEAY  283

Query  917   KTKYGVALSDRIGEVANGSYKELLLTLVAK  1006
             + +  V L   +    +G Y+ +LL L+ K
Sbjct  284   QKRNSVPLEKAVAGDTSGDYETMLLALLGK  313



>gb|ADK13090.1| annexin 1 [Brassica napus]
Length=317

 Score =   174 bits (440),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 119/319 (37%), Positives = 191/319 (60%), Gaps = 25/319 (8%)
 Frame = +2

Query  83    SDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVL  262
             S+D + L  AF G G +E   +S+LA  + + R+  R++ H+   +D    +  D     
Sbjct  14    SEDAEQLKSAFDGWGTNEDLIISILAHRSAEQRKLIRQTYHEACGED--LLKTLDK----  67

Query  263   QLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGARRA  439
             +L  +F R   A++L+ + P ERDA L  EA  +    + +L+E ACTR S +LL AR+A
Sbjct  68    ELTSDFER---AILLWTLEPGERDALLANEATKRWTSSNQVLMEVACTRTSTQLLHARQA  124

Query  440   YHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGN  619
             YH+ +  SIEED+A H  +  RKLLV+LVSSYRYEG +V+  +AK EAK++   IK   +
Sbjct  125   YHARYKKSIEEDVAHHTTSDFRKLLVSLVSSYRYEGDEVNMTLAKQEAKLIHEKIK---D  181

Query  620   KNLVDDEEIVRILSTRSklhllalykhykEITGKFL-------DEDLHAHLLLKQTVQCL  778
             K+   DE+++RILSTRSK  + A +  Y++  G+ +       DED     LL+ T+QCL
Sbjct  182   KH-YSDEDVIRILSTRSKAQINATFNRYQDEHGEEILKSLEEGDEDDKFLGLLRSTIQCL  240

Query  779   CMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIG  955
               P+LYF  +L +++ + G DE A   +TR++ TRA+ D+K I +E++ +  + L   I 
Sbjct  241   TRPELYFVDVLRSAINKTGTDEGA---LTRIVTTRAEIDLKVIGEEYQRRNSIPLEKAIT  297

Query  956   EVANGSYKELLLTLVAKSE  1012
             +   G Y+++L+ L+ + +
Sbjct  298   KDTRGDYEKMLVALLGEDD  316



>gb|AAC49472.1| annexin-like protein [Arabidopsis thaliana]
Length=317

 Score =   174 bits (440),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 115/322 (36%), Positives = 190/322 (59%), Gaps = 27/322 (8%)
 Frame = +2

Query  77    AVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFF-RDDERQFERWDDH  253
             A SDD + L  AF G G +E   +S+LA  + + R+  R++ H+ + +D  +  ++    
Sbjct  12    APSDDAEQLRTAFEGWGTNEDLIISILAHRSAEQRKVIRQAYHETYGKDLLKTLDK----  67

Query  254   HVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGA  430
                +L  +F R   A++L+ + P ERDA L  EA  +    + +L+E ACTR S +LL A
Sbjct  68    ---ELSNDFER---AILLWTLEPGERDALLANEATKRWTSSNQVLMEVACTRTSTQLLHA  121

Query  431   RRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKH  610
             R+AYH+ +  S+EED+A H     RKLLV+LV+SYRYEG +V+  +AK EAK++   IK 
Sbjct  122   RQAYHARYKKSLEEDVAHHTTGDFRKLLVSLVTSYRYEGDEVNMTLAKQEAKLVHEKIKD  181

Query  611   AGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFL-------DEDLHAHLLLKQTV  769
                    +DE+++RILSTRSK  + A +  Y++  G+ +       D+D      L+ T+
Sbjct  182   KH----YNDEDVIRILSTRSKAQINATFNRYQDDHGEEILKSLEEGDDDDKLPCTLRSTI  237

Query  770   QCLCMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSD  946
             QCL  P+LYF  +L +++ + G DE A   +TR++ TRA+ D+K I +E++ +  + L  
Sbjct  238   QCLTRPELYFVDVLRSAINKTGTDEGA---LTRIVTTRAEIDLKVIGEEYQRRNSIPLEK  294

Query  947   RIGEVANGSYKELLLTLVAKSE  1012
              I +   G Y+++L+ L+ + +
Sbjct  295   AITKDTRGDYEKMLVALLGEDD  316



>ref|XP_011098465.1| PREDICTED: annexin D1-like [Sesamum indicum]
Length=316

 Score =   174 bits (440),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 123/319 (39%), Positives = 183/319 (57%), Gaps = 28/319 (9%)
 Frame = +2

Query  77    AVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHH  256
             +V++D + L KAF+G G +E   +S+L   N   R+  R+   + + +D  +        
Sbjct  12    SVAEDCEQLRKAFAGWGTNEGLIISILGHRNAAQRKLIRQVYAETYGEDLLK--------  63

Query  257   VL--QLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLG  427
             VL  +L  +F R+   V L+ + P ERDA L  EA+ K    + +L+E AC R  +ELL 
Sbjct  64    VLDKELTSDFERV---VKLWTLDPAERDAFLANEAIKKWTSSNKVLVEIACARSPKELLL  120

Query  428   ARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIK  607
             AR AYH+ F  S+EED+A+H     RKLLV LVSSYRY G  V+  +AK+EAK+L   I 
Sbjct  121   AREAYHACFKRSLEEDVAYHTSGDFRKLLVPLVSSYRYGGDDVNLTLAKTEAKLLHQKIS  180

Query  608   HAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAH------LLLKQTV  769
                     DD  I+RIL+TRSK  + A    YK   G  ++++L A        LL+ T+
Sbjct  181   EKAYS--CDD--IIRILTTRSKAQINATLNQYKNEFGSDINKNLKADPKDEFLALLRATI  236

Query  770   QCLCMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSD  946
             +CL  P+ YF+K+L  S+ +LG +E A   +TRV+ TRA+ DMK IK  ++ +  V L  
Sbjct  237   KCLVCPEQYFAKVLRLSINKLGTEEGA---LTRVVATRAEVDMKVIKDAYQKRSSVPLEQ  293

Query  947   RIGEVANGSYKELLLTLVA  1003
              I +  +G Y+++LLTL+ 
Sbjct  294   AIAKDTSGDYEKMLLTLIG  312



>ref|XP_008219675.1| PREDICTED: annexin D1 [Prunus mume]
Length=316

 Score =   173 bits (439),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 122/318 (38%), Positives = 183/318 (58%), Gaps = 28/318 (9%)
 Frame = +2

Query  80    VSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDE-RQFERWDDHH  256
              S+D   L KAF G G +E   +S+L   N   R+  R++  + + +D  ++ E+     
Sbjct  13    ASEDCDQLKKAFKGWGTNEDLIISILGHRNAAQRKVIRQTYAEAYGEDLLKELEK-----  67

Query  257   VLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGAR  433
               +L  +F R   +++L+ + P ERDA L  EA  K  + + +L E AC+R S ELL AR
Sbjct  68    --ELTSDFER---SILLWTLDPAERDAFLANEATKKWTKSNQVLAEIACSRSSHELLMAR  122

Query  434   RAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHA  613
             +AYHS +  S+EED+A H     RKLL  LVSSYRYEG +V+  +AKSEAK+L   I   
Sbjct  123   QAYHSRYKKSLEEDVAHHTTGDFRKLLAPLVSSYRYEGDEVNLTLAKSEAKLLHEKISDK  182

Query  614   GNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAH------LLLKQTVQC  775
                   +DE+I+RIL+TRSK  + A   HYK   G  +++DL A        +L+ T++C
Sbjct  183   A----YNDEDIIRILATRSKAQINATLNHYKNEFGNDINKDLKADPKDEYLAILRATIKC  238

Query  776   LCMPQLYFSKILDASLRLGVDEAARD--SVTRVIVTRADEDMKHIKQEFKTKYGVALSDR  949
             L  P+ YF K    SLRL +++   D  +++RV+ TRA+ DMK IK+++  +  V L   
Sbjct  239   LVRPEKYFEK----SLRLAINKRGTDEGALSRVVTTRAEVDMKLIKEQYHKRNSVTLDQA  294

Query  950   IGEVANGSYKELLLTLVA  1003
             I +   G Y+++LL LV 
Sbjct  295   IKKDTIGDYEKMLLALVG  312



>gb|AGG76000.1| annexin AnxGb4 [Gossypium barbadense]
Length=315

 Score =   173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 128/335 (38%), Positives = 191/335 (57%), Gaps = 30/335 (9%)
 Frame = +2

Query  32    SMTAPTLNSANSSKMAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQF  211
             ++T PT      +  +VS+D + L KAFSG G +E   + +L   N + R   RK+  + 
Sbjct  3     TLTVPT------TVPSVSEDCEQLRKAFSGWGTNEGLIIDILGHRNAEQRNLIRKTYAET  56

Query  212   FRDDERQFERWDDHHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLI  388
             + +D    +  D     +L  +F RL   V+L+ + P ERDA L  EA  +    + +L+
Sbjct  57    YGED--LLKALDK----ELSNDFERL---VLLWALDPAERDALLANEATKRWTSSNQVLM  107

Query  389   ETACTRPSEELLGARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDV  568
             E ACTR + +LL AR+AYH+ +  S+EE +A H      KLL+ LVSSYRYEG +V+  +
Sbjct  108   EIACTRSANQLLHARQAYHARYKKSLEEGVAHHTTGDFHKLLLPLVSSYRYEGEEVNMTL  167

Query  569   AKSEAKVLANAIKHAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAH  748
             AK+EAK+L   I    NK   DD +++R+L+TRSK  + A   HYK   G  +D+DL A 
Sbjct  168   AKTEAKLLHEKI---SNKAYSDD-DVIRVLATRSKAQINATLNHYKNEYGNDIDKDLKAD  223

Query  749   ------LLLKQTVQCLCMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIK  907
                    LL+ TV+CL  P+ YF K+L  ++ R G DE A   +TRV+ TRA+ D+K I 
Sbjct  224   PKDEFLALLRSTVKCLVYPEKYFEKVLRLAINRRGTDEGA---LTRVVCTRAEVDLKIIA  280

Query  908   QEFKTKYGVALSDRIGEVANGSYKELLLTLVAKSE  1012
              E++ +  V L+  I +  +G Y++LLL L    E
Sbjct  281   DEYQRRNSVPLTRAIVKDTHGDYEKLLLVLAGHVE  315



>emb|CDX91750.1| BnaC08g06690D [Brassica napus]
Length=317

 Score =   173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 117/318 (37%), Positives = 186/318 (58%), Gaps = 25/318 (8%)
 Frame = +2

Query  86    DDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVLQ  265
             +D + L  AF G G +E   +S+LA  + + R   R++ H+ F +D    +  D     +
Sbjct  15    EDAEQLKTAFEGWGTNEDLIISILAHRSAEQRTLIRQTYHEVFGED--LLKSLDK----E  68

Query  266   LRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGARRAY  442
             L  +F R   A++L+ + P ERDA L  EA  +    + +L+E ACTR S +LL AR+AY
Sbjct  69    LSSDFER---AILLWTLEPGERDALLANEATKRWTSSNQVLMEVACTRTSTQLLHARQAY  125

Query  443   HSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGNK  622
             H+ F  SIEED+A H     RKLLV+LVSSYRYEG +V+  +AK EAK++   IK     
Sbjct  126   HARFKKSIEEDVAHHTTGDFRKLLVSLVSSYRYEGDEVNMTLAKQEAKLIHERIKDKH--  183

Query  623   NLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHL-------LLKQTVQCLC  781
                 DEE++RILSTRSK  + A +  Y++  G+ + + L           LL+ T+QCL 
Sbjct  184   --YSDEEVIRILSTRSKAQINATFNRYQDDHGEEILKSLEEGYGDDKFLELLRSTIQCLT  241

Query  782   MPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGE  958
              P+LYF  +L +++ ++G +E A   +TR++ TRA+ D+K I +E++ +  + L   I +
Sbjct  242   RPELYFVDVLRSAINKIGTNEGA---LTRIVTTRAEIDLKVIGEEYQRRNSIPLEKAITK  298

Query  959   VANGSYKELLLTLVAKSE  1012
                G Y+++L+ L+ + +
Sbjct  299   DTRGDYEKMLVALLGEDD  316



>ref|XP_011074177.1| PREDICTED: annexin D1-like [Sesamum indicum]
Length=316

 Score =   173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 124/320 (39%), Positives = 181/320 (57%), Gaps = 24/320 (8%)
 Frame = +2

Query  77    AVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHH  256
             +V++D + L KAFSG G +E   +S+L   N   R+  R+   + + +D    +  D   
Sbjct  12    SVAEDCEQLHKAFSGWGTNEDLIISILGHRNATQRKLIRQVYAETYGED--LLKALDK--  67

Query  257   VLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGAR  433
               +L  +F R+   V+L+ + P ERDA L  EA  K    + +L+E ACTR  +ELL AR
Sbjct  68    --ELTNDFERV---VLLWTLDPPERDAYLANEATKKWTSSNQVLVEIACTRSPKELLLAR  122

Query  434   RAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHA  613
              AYH+ F  S+EED+A+H     RKLLV LVSSYRY G +V+  +AK+EAK+L   I   
Sbjct  123   EAYHARFKKSLEEDVAYHTSGDFRKLLVPLVSSYRYSGDEVNLTLAKTEAKLLHEKISEK  182

Query  614   GNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHL------LLKQTVQC  775
                   DD  ++RIL+TRSK  + A    YK   G  +++DL A        +L+ TV+C
Sbjct  183   AYS--CDD--VIRILTTRSKAQINATLNQYKNEFGNDINKDLKADPKDEFLDILRATVKC  238

Query  776   LCMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRI  952
             L  P+ YF K+L  ++ R G DE A   +TRV+ TRA+ D+K IK E+  +  V L   I
Sbjct  239   LVCPEKYFEKVLRLAINRRGTDEGA---LTRVVATRAEVDLKIIKDEYHKRNSVPLDRAI  295

Query  953   GEVANGSYKELLLTLVAKSE  1012
              +   G Y+++LL L+   E
Sbjct  296   AKDTTGDYEKMLLALIGHEE  315



>gb|KCW62127.1| hypothetical protein EUGRSUZ_H04787 [Eucalyptus grandis]
Length=316

 Score =   173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 117/315 (37%), Positives = 183/315 (58%), Gaps = 24/315 (8%)
 Frame = +2

Query  83    SDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVL  262
             ++D + L KAF+G G +E   +S+LA  N   R+  R++  + + +D    +  D     
Sbjct  14    AEDAEQLQKAFAGWGTNEDLIISILAHRNAAQRKVIRQTYAETYGED--LLKALDK----  67

Query  263   QLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGARRA  439
             +L  +F R   +V+L+ + P ERDA L  EA  +    + +L+E ACTR S EL   R+A
Sbjct  68    ELSSDFER---SVLLWTLDPAERDAFLSNEATKRLTSSNWVLMEIACTRSSMELFMVRQA  124

Query  440   YHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGN  619
             YH+ +  S+EEDIA+H      KLLV L S++RYEGP+V+  +A+SEAK+L   I    +
Sbjct  125   YHARYKKSLEEDIAYHTTGDFHKLLVPLASTFRYEGPEVNMTLARSEAKILHEKI----H  180

Query  620   KNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHL------LLKQTVQCLC  781
             K   + +E++RI++TRSK  L A   +Y    G  +++DL A        LL+  ++CL 
Sbjct  181   KKAYNHDELIRIVTTRSKAQLNATLNYYNNEFGNAINKDLKADPNDEFLKLLRSAIKCLT  240

Query  782   MPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGE  958
              P+ YF K+L  ++ +LG DE A   +TRV+ TRA+ DM+ IK+++  +  V L   I  
Sbjct  241   YPEKYFEKVLRLAINKLGTDEWA---LTRVVTTRAEVDMQRIKEQYHKRNSVPLDRAIAN  297

Query  959   VANGSYKELLLTLVA  1003
               +G YK++LL LV 
Sbjct  298   DTSGDYKKMLLALVG  312



>ref|XP_009337417.1| PREDICTED: annexin D1-like [Pyrus x bretschneideri]
 ref|XP_009337424.1| PREDICTED: annexin D1-like [Pyrus x bretschneideri]
Length=316

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 123/319 (39%), Positives = 181/319 (57%), Gaps = 28/319 (9%)
 Frame = +2

Query  77    AVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDE-RQFERWDDH  253
             A S+D + L KAF G G +E   +S+L   N   R++ RK+    + +D  ++ E+    
Sbjct  12    AASEDSEQLKKAFKGWGTNEDLVISILGHRNAAQRKAIRKTYADAYGEDLLKELEK----  67

Query  254   HVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGA  430
                +L  +F R+   V L+ + P ERDA L  EA  K  + + +L E AC+R + ELL A
Sbjct  68    ---ELTSDFERI---VWLWTLDPAERDAFLANEATKKWTKSNQVLAEIACSRSAHELLSA  121

Query  431   RRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKH  610
             R+AYHS +  S+EED+A H     RKLL  LVSSYRYEG +V+  +AKSEAK+L   I  
Sbjct  122   RQAYHSRYKKSLEEDVAHHTTGDFRKLLAPLVSSYRYEGDEVNLPLAKSEAKLLHEKISD  181

Query  611   AGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAH------LLLKQTVQ  772
                    +D++I+RIL+TRSK  + A   HYK   G  +++DL A        +L+ T++
Sbjct  182   KA----YNDDDIIRILATRSKAQINATLNHYKNEFGNDINKDLKADPKDEYLAILRATIK  237

Query  773   CLCMPQLYFSKILDASLRLGVDEAARD--SVTRVIVTRADEDMKHIKQEFKTKYGVALSD  946
             CL  P+ YF K    SLRL +++   D  ++TRV+ TRA+ DM  IK  +  +  V L  
Sbjct  238   CLVRPEKYFEK----SLRLAINKRGTDEGALTRVVATRAEVDMMIIKDLYHKRNSVPLDQ  293

Query  947   RIGEVANGSYKELLLTLVA  1003
              I +   G Y+++LL LV 
Sbjct  294   AIKKDTTGDYEKMLLALVG  312



>ref|XP_003615096.1| Annexin [Medicago truncatula]
 gb|AES98054.1| annexin D8 [Medicago truncatula]
 gb|AFK41639.1| unknown [Medicago truncatula]
Length=316

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 121/320 (38%), Positives = 192/320 (60%), Gaps = 26/320 (8%)
 Frame = +2

Query  80    VSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDE-RQFERWDDHH  256
             VSDD + L KAFSG G +E   +S+L   N   R+  R++  + + +D  +   +     
Sbjct  13    VSDDVEQLRKAFSGWGTNENLIISILGHRNEVQRKVIREAYAKTYEEDLIKALNK-----  67

Query  257   VLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGAR  433
               +L  +F RL   V L+ +   ERDA L  EA  +    + +L+E ACTR S++L  A+
Sbjct  68    --ELTSDFERL---VHLWTLESAERDAFLANEATKRWTSSNQVLVELACTRSSDQLFFAK  122

Query  434   RAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHA  613
             +AYH+L   S+EED+A+H     RKLL+ LVSSYRYEG +V+  +AK+EAK+L   I   
Sbjct  123   KAYHALHKKSLEEDVAYHTTGDFRKLLLPLVSSYRYEGDEVNLTIAKAEAKILHEKI---  179

Query  614   GNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDL-----HAHL-LLKQTVQC  775
              +K   +D++ +RIL+TRSK  + A   HYK+  GK +++DL     + +L LL+ TV+C
Sbjct  180   -SKKAYNDDDFIRILATRSKAQINATLNHYKDAFGKDINKDLKEDPKNEYLSLLRSTVKC  238

Query  776   LCMPQLYFSKIL-DASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRI  952
             L  P+ YF+KI+ +A  + G DE A   +TRV+ TRA+ D+K I +E++ +  + L   I
Sbjct  239   LVFPERYFAKIIREAINKRGTDEGA---LTRVVATRAEIDLKIIAEEYQRRNSIPLDRAI  295

Query  953   GEVANGSYKELLLTLVAKSE  1012
              +   G Y+++LL ++  ++
Sbjct  296   VKDTTGDYEKMLLAILGHND  315



>ref|XP_010500052.1| PREDICTED: annexin D1 [Camelina sativa]
 ref|XP_010461335.1| PREDICTED: annexin D1 [Camelina sativa]
 ref|XP_010478957.1| PREDICTED: annexin D1 [Camelina sativa]
Length=317

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 117/321 (36%), Positives = 190/321 (59%), Gaps = 25/321 (8%)
 Frame = +2

Query  77    AVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHH  256
             A S+D + L  AF G G +E   +S+L   + + R+  R+S H+ + +D    +  D   
Sbjct  12    APSEDAEQLRTAFEGWGTNEDLIISILGHRSAEQRKQIRQSYHETYGED--LLKTLDK--  67

Query  257   VLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGAR  433
               +L  +F R   A++L+ + P ERDA L  EA  +    + +L+E ACTR S +LL AR
Sbjct  68    --ELSNDFER---AILLWTLEPAERDALLTNEATKRWTSSNQVLMEVACTRTSTQLLHAR  122

Query  434   RAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHA  613
             +AYH+ +  S+EED+A H     RKLLV LV+SYRYEG +V+  +AK EAK++   IK  
Sbjct  123   QAYHARYKKSLEEDVAHHTTGDFRKLLVPLVTSYRYEGDEVNMTLAKQEAKLIHEKIK--  180

Query  614   GNKNLVDDEEIVRILSTRSklhllalykhykEITGKFL-------DEDLHAHLLLKQTVQ  772
              +K+   DE+++RILSTRSK  + A +  Y++  G+ +       D+D     LL+ T+Q
Sbjct  181   -DKHYT-DEDVIRILSTRSKAQINATFNRYQDDHGEEILKSLEEGDDDDKFLSLLRSTIQ  238

Query  773   CLCMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDR  949
             CL  P+LYF  +L +++ + G DE A   +TR++ TRA+ D+K I +E++ +  + L   
Sbjct  239   CLTRPELYFVDVLRSAINKTGTDEGA---LTRIVTTRAEIDLKVIGEEYQRRNSIPLEKA  295

Query  950   IGEVANGSYKELLLTLVAKSE  1012
             I +   G Y+++L+ L+ + +
Sbjct  296   ITKDTRGDYEKMLVALLGEDD  316



>gb|AFZ78531.1| annexin [Populus tomentosa]
Length=316

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 120/314 (38%), Positives = 177/314 (56%), Gaps = 24/314 (8%)
 Frame = +2

Query  86    DDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVLQ  265
             +D + L KAF G G +E   +S+LA  N   R   RK   + +  D    +  D     +
Sbjct  15    EDAEQLHKAFEGWGTNEGLIISILAHRNAAQRNLIRKVYAEAYGQD--LLKDLDK----E  68

Query  266   LRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGARRAY  442
             L  +F R   AV+L+ + P ERDA L  EA  +    + +L+E AC+R S +L   R+AY
Sbjct  69    LSSDFER---AVLLWTLDPAERDAYLANEATKRFSSSNWVLMEIACSRSSHDLFKVRQAY  125

Query  443   HSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGNK  622
             H+ +  S+EED+A+H     RKLLV LVS++RYEG +V+  +AKSEAK+L   I    + 
Sbjct  126   HARYKKSLEEDVAYHTTGDFRKLLVPLVSAFRYEGEEVNTILAKSEAKILHEKI----SA  181

Query  623   NLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHL------LLKQTVQCLCM  784
                 DEEI+RIL+TRSK  + A   HY    G  ++++L          LL+ T++CL  
Sbjct  182   KAYSDEEIIRILTTRSKAQVNATLNHYNNAFGNAINKNLKEEADNDFLKLLRATIKCLTY  241

Query  785   PQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEV  961
             P+ YF K+L  S+ +LG DE A   +TRV+ TRA+ DM+ IK+E+  +  V L   I   
Sbjct  242   PEKYFEKLLRLSIKKLGTDERA---LTRVVTTRAEVDMERIKEEYHRRNSVTLDRDIAGD  298

Query  962   ANGSYKELLLTLVA  1003
              +G Y+ +LL L+ 
Sbjct  299   TSGDYERMLLALIG  312



>gb|AFK45764.1| unknown [Lotus japonicus]
Length=316

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 120/316 (38%), Positives = 184/316 (58%), Gaps = 24/316 (8%)
 Frame = +2

Query  80    VSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHV  259
             V+DD + L KAFSG G +E   +S+L   N   R+  R++  + + +D    +  D    
Sbjct  13    VADDCEQLRKAFSGWGTNEDLIISILGHRNAAQRKLIRETYAETYGED--LLKALDK---  67

Query  260   LQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGARR  436
              +L  +F RL   V L+ +   ERDA L  EA  +    + +L+E ACTR SE++   R+
Sbjct  68    -ELTSDFERL---VHLWALDSAERDAFLANEATKRWTSSNQVLVEIACTRSSEQMFAVRK  123

Query  437   AYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAG  616
             AYH+L+  S+EED+A H     RKLL+ L+SSYRYEG +V+  +AKSEAK+L   I    
Sbjct  124   AYHALYKKSLEEDVAHHTTGDFRKLLLPLMSSYRYEGDEVNLTLAKSEAKLLHEKITDKA  183

Query  617   NKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAH------LLLKQTVQCL  778
                  +D++++RIL+TRS+  + A   HYK+  GK +++DL A        LL+ TV+CL
Sbjct  184   ----YNDDDLIRILATRSRAQINATLNHYKDAFGKDINKDLKAEPKDEYLSLLRATVKCL  239

Query  779   CMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIG  955
               P+ YF K +  S+ + G DE A   +TRV+ TRA+ D+K I  E++ +  + L   I 
Sbjct  240   VRPEKYFEKFIRLSINKRGTDEGA---LTRVVATRAEIDLKIIANEYQRRSSIPLDRAII  296

Query  956   EVANGSYKELLLTLVA  1003
             +  NG Y+++LL L+ 
Sbjct  297   KDTNGDYEKMLLALLG  312



>gb|KDP27364.1| hypothetical protein JCGZ_20188 [Jatropha curcas]
Length=296

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 115/307 (37%), Positives = 177/307 (58%), Gaps = 26/307 (8%)
 Frame = +2

Query  110   AFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDE-RQFERWDDHHVLQLRQEFLR  286
             +  G G+D  A +S+L   +   R+  R++  Q +++D  +  E+        L  +F R
Sbjct  3     SLEGWGIDRGAIISILGNRSAAQRKLIREAYAQTYKEDLLKALEK-------GLSGDFER  55

Query  287   LKDAVVLYMMHPWERDARLFKEALLKE-PQFDLLIETACTRPSEELLGARRAYHSLFDHS  463
             +   V+L+ + P ERDA    E   K+   + +++E AC R S+ELL AR+AY + F+ S
Sbjct  56    I---VLLWTLDPAERDASFANEITRKKNGSYYVIMEIACARTSDELLLARKAYLNRFNKS  112

Query  464   IEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGNKNLVDDEE  643
             +EED+A H     RKLLV LV++YRYEG +V+  +AKSEAK+L   I    +K     EE
Sbjct  113   LEEDLACHTTGDFRKLLVPLVTAYRYEGGEVNMGLAKSEAKILHEKI----SKKAFSAEE  168

Query  644   IVRILSTRSklhllalykhykEITGKFLDEDLHAH------LLLKQTVQCLCMPQLYFSK  805
             +  ILSTRSK  + A    Y +  G  +++DL +        LL+ T++CL  P+ YF K
Sbjct  169   LTSILSTRSKAQINATLNCYNDQFGNSINKDLRSKENEEYLALLRATIKCLKCPEKYFEK  228

Query  806   ILDASLR-LGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVANGSYKE  982
             +L  S++ +G DE   +++TRV+VTRAD DMK IK+E+  +  V L D I    +  Y +
Sbjct  229   VLRLSMKGIGTDE---ETLTRVVVTRADVDMKRIKEEYYKRNSVTLEDAIKGDTSFDYAK  285

Query  983   LLLTLVA  1003
             +LLTL+ 
Sbjct  286   MLLTLIG  292



>ref|XP_009145116.1| PREDICTED: annexin D1 [Brassica rapa]
 gb|AHN63213.1| annexin 1 [Brassica rapa subsp. rapa]
 emb|CDY37093.1| BnaAnng04520D [Brassica napus]
Length=317

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 119/319 (37%), Positives = 190/319 (60%), Gaps = 25/319 (8%)
 Frame = +2

Query  83    SDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVL  262
             S+D + L  AF G G +E   +S+LA  + + R+  R++ H+   +D    +  D     
Sbjct  14    SEDAEQLKSAFDGWGTNEDLIISILAHRSAEQRKLIRQAYHEACGED--LLKTLDK----  67

Query  263   QLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGARRA  439
             +L  +F R   A++L+ + P ERDA L  EA  +    + +L+E ACTR S +LL AR+A
Sbjct  68    ELTSDFER---AILLWTLEPGERDALLANEATKRWTSSNQVLMEVACTRTSTQLLHARQA  124

Query  440   YHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGN  619
             YH+ +  SIEED+A H     RKLLV+LVSSYRYEG +V+  +AK EAK++   IK   +
Sbjct  125   YHARYKKSIEEDVAHHTTGDFRKLLVSLVSSYRYEGDEVNMTLAKQEAKLIHEKIK---D  181

Query  620   KNLVDDEEIVRILSTRSklhllalykhykEITGKFL-------DEDLHAHLLLKQTVQCL  778
             K+   DE+++RILSTRSK  + A +  Y++  G+ +       DED     LL+ T+QCL
Sbjct  182   KH-YSDEDVIRILSTRSKAQINATFNRYQDEHGEEILKSLEEGDEDDKFLGLLRSTIQCL  240

Query  779   CMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIG  955
               P+LYF  +L +++ + G DE A   +TR++ TRA+ D+K I +E++ +  + L   I 
Sbjct  241   TRPELYFVDVLRSAINKTGTDEGA---LTRIVTTRAEIDLKVIGEEYQRRNSIPLEKAIT  297

Query  956   EVANGSYKELLLTLVAKSE  1012
             +   G Y+++L+ L+ + +
Sbjct  298   KDTRGDYEKMLVALLGEDD  316



>ref|XP_006399755.1| hypothetical protein EUTSA_v10014146mg [Eutrema salsugineum]
 gb|ESQ41208.1| hypothetical protein EUTSA_v10014146mg [Eutrema salsugineum]
Length=315

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 116/318 (36%), Positives = 183/318 (58%), Gaps = 28/318 (9%)
 Frame = +2

Query  89    DHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVLQL  268
             D + + KA  G G DEK  +S+L   N   R+  R++  + + +D           + QL
Sbjct  15    DAESIKKACQGWGTDEKTIISILGHRNLFQRKLIRQAYQEIYHED----------LIHQL  64

Query  269   RQEFLR-LKDAVVLYMMHPWERDARLFKEALLKEPQFD--LLIETACTRPSEELLGARRA  439
             + E     + A+ L+++ P ERDA L   AL K P  D  +L+E AC R  E+LL ARRA
Sbjct  65    KSELSGDFERAICLWVLDPPERDAHLANLALQK-PGLDYKVLVEIACMRSPEDLLAARRA  123

Query  440   YHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGN  619
             Y  L+  S+EED+A       RKLLVA+ ++Y+Y+G +V E +A+SEA +L + I+    
Sbjct  124   YRCLYKRSLEEDLASRTTGDIRKLLVAMATAYKYDGEEVDEVLAQSEASILHDEIR----  179

Query  620   KNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLL------LKQTVQCLC  781
              N VD EE + +LSTRS + L A++  YK+I G+ + +DL  H        L+  ++C+ 
Sbjct  180   GNAVDHEETISVLSTRSSVQLSAIFNSYKDIYGRSITKDLLKHPTNEYLSALRAAIRCIK  239

Query  782   MPQLYFSKILDASLR-LGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGE  958
              P  Y++K+L  ++  +G DE   D++TRVIVTRA++D+K I + ++ +  V+L   I +
Sbjct  240   NPNRYYAKVLRNAINTVGTDE---DALTRVIVTRAEKDLKKITELYRKRNNVSLDQAIAK  296

Query  959   VANGSYKELLLTLVAKSE  1012
               +G YK  LL L+  +E
Sbjct  297   ETSGDYKTFLLALLGHAE  314



>ref|XP_010061809.1| PREDICTED: annexin D1-like [Eucalyptus grandis]
 gb|KCW68821.1| hypothetical protein EUGRSUZ_F02423 [Eucalyptus grandis]
Length=316

 Score =   172 bits (436),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 119/320 (37%), Positives = 184/320 (58%), Gaps = 26/320 (8%)
 Frame = +2

Query  80    VSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDE-RQFERWDDHH  256
             V+DD + L  AF+G G +EK  +S+L   N   R+  R++  + + +D  +  +R     
Sbjct  13    VADDCEQLRTAFAGWGTNEKLIISILGHRNAAQRKLIRQTYAETYGEDLLKALDR-----  67

Query  257   VLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGAR  433
               +L  +F RL   VVL+ + P ERDA L  EA  +    + +L+E ACTR  ++LL AR
Sbjct  68    --ELTNDFERL---VVLWSLDPAERDAYLANEATKRWTSSNQVLMEIACTRSPQQLLMAR  122

Query  434   RAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHA  613
             +AYH+ +  S+EED+  H     RKLLV LVSSYRY+G +V+  +AK+EAK+L   I   
Sbjct  123   QAYHARYKKSLEEDVGHHTTGDFRKLLVPLVSSYRYDGDEVNMTLAKAEAKILHEKISEK  182

Query  614   GNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAH------LLLKQTVQC  775
                +    E+++RIL+TRSK  + A   HYK   G  +++DL          +L+ TV+C
Sbjct  183   AYGH----EDLIRILATRSKAQVNATLNHYKNEFGNDINKDLKTDPKDEFLTILRATVKC  238

Query  776   LCMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRI  952
             L  P+ YF K+L  ++ + G DE A   +TRV+ TRA+ DMK I +E++ +  + L   I
Sbjct  239   LTRPEKYFEKVLRLAINKRGTDEGA---LTRVVATRAEVDMKFISEEYQRRNSIPLDRAI  295

Query  953   GEVANGSYKELLLTLVAKSE  1012
              +   G Y+++LL L+   E
Sbjct  296   VKDTTGDYEKMLLALIGHVE  315



>ref|XP_002513910.1| annexin, putative [Ricinus communis]
 gb|EEF48493.1| annexin, putative [Ricinus communis]
Length=315

 Score =   172 bits (436),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 125/319 (39%), Positives = 181/319 (57%), Gaps = 24/319 (8%)
 Frame = +2

Query  80    VSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHV  259
             VSDD + L KAFSG G +E   +S+L   N   R+  R++  + + +D    +  D    
Sbjct  13    VSDDCEQLRKAFSGWGTNEGLIISILGHRNAAQRKLIRQTYAETYGED--LLKALDK---  67

Query  260   LQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLK-EPQFDLLIETACTRPSEELLGARR  436
              +L  +F R+   V+L+++ P ERDA L  EA  +      +L+E ACTR S ELL  R+
Sbjct  68    -ELSNDFERV---VMLWILDPHERDAFLANEATKRWTSNNQVLMEIACTRSSNELLHIRQ  123

Query  437   AYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAG  616
             AYH+ +  S+EED+A H     RKLL  LV SYRYEG +V+  +AK+EAK+L   I +  
Sbjct  124   AYHARYKKSLEEDVAHHTTGDFRKLLFPLVCSYRYEGDEVNLTLAKTEAKLLHEKISNKA  183

Query  617   NKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAH------LLLKQTVQCL  778
                   DE+++RIL+TRSK  + A   HYK   G  +++DL          LL+ TV+CL
Sbjct  184   ----YSDEDLIRILATRSKAQINATLNHYKNEFGNDINKDLKTDPKDEFLALLRATVKCL  239

Query  779   CMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIG  955
                + YF K+L  ++ R G DE A   +TR+I TRA+ DMK IK  F+ +  V L   I 
Sbjct  240   TRSEKYFEKLLRLAINRRGTDEGA---LTRIIATRAEVDMKIIKDVFQQRNTVPLDRAIA  296

Query  956   EVANGSYKELLLTLVAKSE  1012
             +  +G Y+++LL LV   E
Sbjct  297   KDTHGDYEKMLLALVGHEE  315



>ref|XP_007199232.1| hypothetical protein PRUPE_ppa022090mg [Prunus persica]
 gb|EMJ00431.1| hypothetical protein PRUPE_ppa022090mg [Prunus persica]
Length=319

 Score =   172 bits (436),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 125/321 (39%), Positives = 180/321 (56%), Gaps = 27/321 (8%)
 Frame = +2

Query  80    VSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHV  259
             V++D + L KA  G G DE A +S+L   N + R   R++  + + +D   F+   D   
Sbjct  13    VAEDCERLRKAMQGWGTDENAIISILTHRNARQRCLIRQTYAEKYGED--FFKPLQD---  67

Query  260   LQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD----LLIETACTRPSEELLG  427
              +L  +FLR   AV+L+  HP ERDA L  E   K+        +++E ACTR S EL  
Sbjct  68    -ELSGDFLR---AVLLWTPHPAERDALLANEVTKKKHSAAHNHLVIMEIACTRTSRELFQ  123

Query  428   ARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIK  607
              R  YH+ +  S+EEDIA+H     RKLLV LVS+YRYEG +V   VA SEA +L   I 
Sbjct  124   VREDYHARYKRSLEEDIAYHTTGDFRKLLVPLVSTYRYEGGEVDMTVANSEANILQEKI-  182

Query  608   HAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHL------LLKQTV  769
                ++   + +E++RIL+TRSK  L A +K Y +  G  L++DL          L++ TV
Sbjct  183   ---SEKAYNHDELIRILTTRSKAQLNATFKVYNDQFGHPLNKDLKKKPKDEYLGLVRATV  239

Query  770   QCLCMPQLYFSKILDASLR-LGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSD  946
             QCL  P+ Y+ K L  S++ LG  E   +++TRV+VTRA+ DMK I ++++ K  V L  
Sbjct  240   QCLTCPEKYYEKALRLSMKGLGTTE---ETLTRVVVTRAEVDMKSIMEQYQLKNSVPLVQ  296

Query  947   RIGEVANGSYKELLLTLVAKS  1009
              I    +G Y   LL LV +S
Sbjct  297   DIKSDTSGDYLATLLALVGQS  317



>ref|XP_010453308.1| PREDICTED: annexin D8 [Camelina sativa]
Length=315

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 118/318 (37%), Positives = 181/318 (57%), Gaps = 26/318 (8%)
 Frame = +2

Query  86    DDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVLQ  265
             +D + + KA  G G DEKA +S+L   N   R+  R++  + + +D           + Q
Sbjct  14    EDAENIKKACQGWGTDEKAIISILGHRNLFQRKLIRQAYQEIYHED----------LIHQ  63

Query  266   LRQEFLR-LKDAVVLYMMHPWERDARLFKEALLKE-PQFDLLIETACTRPSEELLGARRA  439
             L+ E     + AV L+++ P ERDA L   AL K  P + +L+E AC R  E+LL ARRA
Sbjct  64    LKSELSGDFERAVCLWVLDPPERDALLANLALQKPIPDYKVLVEIACMRSPEDLLAARRA  123

Query  440   YHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGN  619
             Y  L+  S+EED+A       RKLLVAL S+Y+Y+G ++ E +A+SEA +L + I     
Sbjct  124   YRCLYKRSLEEDLASRTIGDIRKLLVALASAYKYDGEEIDEMLAQSEAGILHDEILGKA-  182

Query  620   KNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLL------LKQTVQCLC  781
                V+ EE +R+LSTRS + L A++  YK+I G+ + +DL  H        L+  ++C+ 
Sbjct  183   ---VEHEETIRVLSTRSNMQLSAIFNRYKDIYGRSITKDLLNHPTNEYLSALRAAIRCIK  239

Query  782   MPQLYFSKILDASLR-LGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGE  958
              P  Y+SK+L  S+  +G DE   D++ RVIVTRA++D+K I + +  +  V+L   I +
Sbjct  240   NPTRYYSKVLRNSINTVGTDE---DALNRVIVTRAEKDLKKISELYLKRNDVSLDQAIAK  296

Query  959   VANGSYKELLLTLVAKSE  1012
               +G YK  LL L+   E
Sbjct  297   ETSGDYKSFLLALLGHGE  314



>ref|XP_011022789.1| PREDICTED: annexin D2-like [Populus euphratica]
Length=316

 Score =   172 bits (435),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 122/314 (39%), Positives = 176/314 (56%), Gaps = 24/314 (8%)
 Frame = +2

Query  86    DDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVLQ  265
             +D + L KAF G G +E   +S+LA  N   R   RK   + +  D    +  D     +
Sbjct  15    EDAEQLHKAFEGWGTNEGLIISILAHRNAAQRNLIRKVYAEAYGQD--LLKDLDK----E  68

Query  266   LRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGARRAY  442
             L  +F R   AV+L+ + P ERDA L  EA  +    + +L+E ACTR S +L   R+AY
Sbjct  69    LSSDFER---AVLLWTLDPAERDAYLANEATKRFTSSNWVLMEIACTRSSHDLFKVRQAY  125

Query  443   HSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGNK  622
             H+ +  S+EED+A H     RKLLV LVS++RYEG +V+  +AKSEAK+L   I    + 
Sbjct  126   HARYKKSLEEDVAHHTTGDFRKLLVPLVSAFRYEGEEVNTMLAKSEAKILHEKI----SA  181

Query  623   NLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHL------LLKQTVQCLCM  784
                 DEEI+RIL+TRSK  L A   HY    G  ++++L          LL+ T++CL  
Sbjct  182   KAYSDEEIIRILTTRSKAQLNATLNHYNNAFGNAINKNLKEEADNDFLKLLRATIKCLTY  241

Query  785   PQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEV  961
             P+ YF K+L  S+ +LG DE A   +TRV+ TRA+ DM+ IK+E+  +  V L   I   
Sbjct  242   PEKYFEKLLRLSIKKLGTDERA---LTRVVTTRAEVDMERIKEEYHRRNSVTLDRDIAGD  298

Query  962   ANGSYKELLLTLVA  1003
              +G Y+ +LL L+ 
Sbjct  299   TSGDYERMLLALIG  312



>ref|XP_004516176.1| PREDICTED: annexin D1-like isoform X1 [Cicer arietinum]
 ref|XP_004516177.1| PREDICTED: annexin D1-like isoform X2 [Cicer arietinum]
 ref|XP_004516178.1| PREDICTED: annexin D1-like isoform X3 [Cicer arietinum]
Length=316

 Score =   172 bits (435),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 119/317 (38%), Positives = 184/317 (58%), Gaps = 26/317 (8%)
 Frame = +2

Query  80    VSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDE-RQFERWDDHH  256
             V+DD + L KAFSG G +E   VS+L   N   R+  R++  + + +D  +   +     
Sbjct  13    VADDCEQLRKAFSGWGTNEGLIVSILGHRNASQRKIIRETYAETYGEDLLKALNK-----  67

Query  257   VLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGAR  433
               +L  +F RL   V L+ +   ERDA L  EA  +    + +L+E ACTR S++L  AR
Sbjct  68    --ELTSDFERL---VHLWTLETAERDAFLANEATKRWTSSNQVLVEIACTRSSDQLFAAR  122

Query  434   RAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHA  613
             +AYH+L   S+EED+A H     RKLL+ LVSSYRYEG +V+  +AK+EAK+L   I + 
Sbjct  123   KAYHALHKKSLEEDVAHHTTADFRKLLLPLVSSYRYEGDEVNLTLAKAEAKILHEKISNK  182

Query  614   GNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAH------LLLKQTVQC  775
                   +D++++RI +TRSK  + A   HYK++ G  +++DL A        LL+ TV+C
Sbjct  183   A----YNDDDLIRIFATRSKAQVNATLNHYKDVFGNDINKDLKAEPTDEFLSLLRSTVKC  238

Query  776   LCMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRI  952
             L  P+ YF K++  S+ + G DE A   +TRV+ TRA+ D+K I  E++ +  V L   I
Sbjct  239   LTRPERYFEKVVRLSINKRGTDEGA---LTRVVATRAEIDLKIIADEYQRRNSVPLDRAI  295

Query  953   GEVANGSYKELLLTLVA  1003
              +   G Y+++LL ++ 
Sbjct  296   VKDTTGDYEKMLLAILG  312



>ref|XP_010939631.1| PREDICTED: annexin D1-like [Elaeis guineensis]
Length=315

 Score =   171 bits (434),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 115/317 (36%), Positives = 183/317 (58%), Gaps = 24/317 (8%)
 Frame = +2

Query  83    SDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVL  262
             S+D + L KAF G G +E   +S+L       R++ R++  Q + +D    +  D     
Sbjct  14    SEDAEQLRKAFEGWGTNEALIISILGHRTADQRRAIRQAYRQAYNED--LLKSLDG----  67

Query  263   QLRQEFLRLKDAVVLYMMHPWERDARLFKEALLK-EPQFDLLIETACTRPSEELLGARRA  439
             ++  +F R+   V+L+ +   ERDA L  EA+ K  P   +LIE AC R S+EL   R+A
Sbjct  68    EISGDFERV---VLLWTLDSAERDAWLANEAVRKWRPGNRVLIEIACARSSKELFAVRQA  124

Query  440   YHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGN  619
             YHS F  S+EED+A H     RKLLV LVS++RYEGP+++  +AKSEAK+L   I     
Sbjct  125   YHSRFKRSLEEDVAVHTTGDFRKLLVPLVSAFRYEGPEINLTLAKSEAKMLREKISDKA-  183

Query  620   KNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAH------LLLKQTVQCLC  781
                 + EE++RIL+TRSK  L+A + HY +  G  +++DL +         L+ T++C+C
Sbjct  184   ---YNHEELIRILTTRSKAQLVATFNHYNDAFGNPVNKDLKSDPKDEFLAALRATIRCIC  240

Query  782   MPQLYFSKILDASLR-LGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGE  958
              P+ YF K++  ++  LG DE   +++TRVI TRA+ D+K + + ++ +  + L   I  
Sbjct  241   CPERYFEKVIRLAINGLGTDE---NALTRVIATRAEVDLKVVAEVYQKRNSMPLERAIKG  297

Query  959   VANGSYKELLLTLVAKS  1009
               +G Y+ +LL L+ + 
Sbjct  298   DTSGDYEAMLLALLGQG  314



>ref|XP_010931989.1| PREDICTED: annexin-like protein RJ4 [Elaeis guineensis]
Length=311

 Score =   171 bits (434),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 118/311 (38%), Positives = 181/311 (58%), Gaps = 22/311 (7%)
 Frame = +2

Query  86   DDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVLQ  265
            +D + L KAF G G DEKA +++LA  +   R+  R +  + ++  E   +R +     +
Sbjct  15   EDAERLRKAFQGWGTDEKAVIAILAHRDAAQRKQIRLAYEELYK--ENLIKRLES----E  68

Query  266  LRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFDLLIETACTRPSEELLGARRAYH  445
            L  +F R   AV  +M  P ER+A +   AL K   + ++IE AC    +ELL  ++AYH
Sbjct  69   LSGDFER---AVYRWMFDPVEREAIMANVALKKNVDYQVIIEIACVNSPKELLVVKQAYH  125

Query  446  SLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGNKN  625
              + HS+EED+A       RKLLVALVS+YRY+G ++   +AKSEAK+L + I+    + 
Sbjct  126  GRYKHSLEEDVASKTIGDFRKLLVALVSTYRYDGEEIDTGLAKSEAKILHDVIE----QK  181

Query  626  LVDDEEIVRILSTRSklhllalykhykE----ITGKFLDEDLHAH-LLLKQTVQCLCMPQ  790
            + +DEEI+RILSTRSK  L A +  YK+    IT     E  +   L L+  ++C+  P+
Sbjct  182  IFNDEEIIRILSTRSKAQLNATFNCYKDEYGSITKALASESPNEFALALRIAIRCITSPK  241

Query  791  LYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVAN  967
             YF+K+L  ++ + G DE   D++TRVIV  A++D+K IK+ F  +  VAL   + +  +
Sbjct  242  KYFAKVLRHAVDKSGTDE---DALTRVIVMHAEKDLKEIKEMFHERTNVALEHAVAKQTS  298

Query  968  GSYKELLLTLV  1000
            G YK  LL L+
Sbjct  299  GDYKSFLLALI  309



>gb|KCW62128.1| hypothetical protein EUGRSUZ_H04787 [Eucalyptus grandis]
Length=316

 Score =   171 bits (434),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 116/315 (37%), Positives = 183/315 (58%), Gaps = 24/315 (8%)
 Frame = +2

Query  83    SDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVL  262
             ++D + L KAF+G G +E   +S+LA  N   R+  R++  + + +D    +  D     
Sbjct  14    AEDAEQLQKAFAGWGTNEDLIISILAHRNAAQRKVIRQTYAETYGED--LLKALDK----  67

Query  263   QLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGARRA  439
             +L  +F R   +V+L+ + P ERDA L  EA  +    + +L+E ACTR S EL   R+A
Sbjct  68    ELSSDFER---SVLLWTLDPAERDAFLSNEATKRLTSSNWVLMEIACTRSSMELFMVRQA  124

Query  440   YHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGN  619
             YH+ +  S+EEDIA+H      KLLV L S++RYEGP+V+  +A+SEAK+L   I    +
Sbjct  125   YHARYKKSLEEDIAYHTTGDFHKLLVPLASTFRYEGPEVNMTLARSEAKILHEKI----H  180

Query  620   KNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHL------LLKQTVQCLC  781
             +   + +E++RI++TRSK  L A   +Y    G  +++DL A        LL+  ++CL 
Sbjct  181   EKAYNHDELIRIVTTRSKAQLNATLNYYNNEFGNAINKDLKADPNDEFLKLLRSAIKCLT  240

Query  782   MPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGE  958
              P+ YF K+L  ++ +LG DE A   +TRV+ TRA+ DM+ IK+++  +  V L   I  
Sbjct  241   YPEKYFEKVLRLAINKLGTDEWA---LTRVVTTRAEVDMQRIKEQYHKRNSVPLDRAIAN  297

Query  959   VANGSYKELLLTLVA  1003
               +G YK++LL LV 
Sbjct  298   DTSGDYKKMLLALVG  312



>ref|XP_010032319.1| PREDICTED: annexin-like protein RJ4 isoform X3 [Eucalyptus grandis]
 gb|KCW51731.1| hypothetical protein EUGRSUZ_J01193 [Eucalyptus grandis]
Length=314

 Score =   171 bits (434),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 116/319 (36%), Positives = 174/319 (55%), Gaps = 26/319 (8%)
 Frame = +2

Query  83    SDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVL  262
             ++D   L KA  G G +EKA + VL   N   R+  R++  Q + +D           V 
Sbjct  13    TEDAAALQKACKGFGTNEKAIIEVLGHRNAAQRKQIRQAYEQLYEED----------LVK  62

Query  263   QLRQEFLR-LKDAVVLYMMHPWERDARLFKEALLK-EPQFDLLIETACTRPSEELLGARR  436
             +L  E  R  + AV  +++ P +RDA L   AL K  P + ++IE +C R  +ELL  R+
Sbjct  63    RLESELTRDFEKAVYRWILDPADRDAVLANVALKKSNPDYPVIIEISCIRTPDELLEVRK  122

Query  437   AYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAG  616
             AY   +  S+EED+A H     RKLLV LVS+YRY+G +++  +A SEA ++ +AIK   
Sbjct  123   AYQLRYKRSLEEDVAAHTTGDIRKLLVGLVSAYRYQGEEINARLANSEADLIHDAIKDKA  182

Query  617   NKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAH------LLLKQTVQCL  778
                    +E++RIL+TRSK  L A +  Y+E  G  + ++L         + L+ T++ L
Sbjct  183   ----FSHDEVIRILTTRSKAQLRATFNRYQEDQGTSITKNLLVENPDEILVALRTTIRGL  238

Query  779   CMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIG  955
               P  YF K+L   + R G DE   D +TRVIVTRA++D+K IK+E+  K  V+L   + 
Sbjct  239   NDPNKYFVKVLSNGIKRAGTDE---DDLTRVIVTRAEKDLKEIKEEYYKKNSVSLDQAVA  295

Query  956   EVANGSYKELLLTLVAKSE  1012
             +   G YK  LL L+   E
Sbjct  296   KDTTGDYKAFLLALLGNEE  314



>ref|XP_004288206.1| PREDICTED: annexin D1-like [Fragaria vesca subsp. vesca]
Length=316

 Score =   171 bits (433),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 121/319 (38%), Positives = 182/319 (57%), Gaps = 26/319 (8%)
 Frame = +2

Query  83    SDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKS-THQFFRDDERQFERWDDHHV  259
             ++D + L KAF G G +E   +S+LA  N   R+  +++ T  +  D  +  ++      
Sbjct  14    AEDAEQLKKAFEGWGTNEGLLISILAHRNADQRRLIQQTYTETYGEDLLKALDK------  67

Query  260   LQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGARR  436
              +L   F R   A++L+ +HP ERDA L  EA+ +    + +L+E AC+R S EL   ++
Sbjct  68    -ELSSNFER---ALLLWTLHPSERDAVLANEAIKRFTSSNWVLMEIACSRSSHELHMVKQ  123

Query  437   AYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAG  616
             AYH+ F  S+EED+AFH     RKLLV LVS++RYEG +V+  VAK EAK+L   IK   
Sbjct  124   AYHAKFKKSLEEDVAFHTSGDFRKLLVPLVSAFRYEGDEVNVTVAKREAKLLHEKIKDKH  183

Query  617   NKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAH------LLLKQTVQCL  778
                  +DEE++RI+STRSK  L A +  Y    G  + +DL A        LL+ T + L
Sbjct  184   ----YNDEELIRIISTRSKAQLNATFNQYNNEFGNAITKDLKADKDDEFLKLLRATTKLL  239

Query  779   CMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIG  955
               P+ YF K+L   + +LG DE A   +TRV+ TRA+ D+  IK+E++ +  V L+  I 
Sbjct  240   TYPEKYFEKLLRLCINKLGTDEGA---LTRVVTTRAEVDLHRIKEEYQRRNSVTLAHAIQ  296

Query  956   EVANGSYKELLLTLVAKSE  1012
             +   G Y+ LLL L+  S+
Sbjct  297   KDTRGDYENLLLELIGHSD  315



>ref|XP_008794526.1| PREDICTED: annexin D1-like [Phoenix dactylifera]
Length=315

 Score =   171 bits (433),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 116/316 (37%), Positives = 184/316 (58%), Gaps = 24/316 (8%)
 Frame = +2

Query  83    SDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVL  262
             S+D + L KAF G G +E   +S+L   +   R++ R++  Q +  DE   +  D     
Sbjct  14    SEDAEQLRKAFEGWGTNEGLIISILGHRSAAQRRAIRQAYRQSY--DEELLKALDG----  67

Query  263   QLRQEFLRLKDAVVLYMMHPWERDARLFKEALLK-EPQFDLLIETACTRPSEELLGARRA  439
             ++  +F R   AV+L+ + P ERDA L  EA+ K  P+  +LIE AC R S EL   R+A
Sbjct  68    EISGDFER---AVLLWTLDPAERDAWLANEAVRKWRPENRVLIEIACARSSGELFAVRQA  124

Query  440   YHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGN  619
             YH+ F  S+EED+A H     RKLLV LVS+YRYEG +++  +AKSEA++L   I    +
Sbjct  125   YHARFKRSLEEDVAAHTTGDFRKLLVPLVSAYRYEGEEINLTLAKSEARMLHEKI----S  180

Query  620   KNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAH------LLLKQTVQCLC  781
                 + EE++RIL+TRSK  L+  + HY +  GK +++DL +         L+ T++C+C
Sbjct  181   DKAYNHEELIRILTTRSKAQLIKTFNHYNDEFGKPVNKDLKSDPKDDFLAALRATIRCIC  240

Query  782   MPQLYFSKILDASLR-LGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGE  958
              P+ YF K++  ++  LG DE   +++TRVI  RA+ D+K I + ++ +  + L   I  
Sbjct  241   CPERYFEKVIRLAINGLGTDE---NALTRVITIRAEVDLKVIAEVYQKRNSMPLERAIKG  297

Query  959   VANGSYKELLLTLVAK  1006
               +G Y+ +LL L+ +
Sbjct  298   DTSGDYEAMLLALLGQ  313



>emb|CDX73353.1| BnaC05g27530D [Brassica napus]
Length=317

 Score =   171 bits (433),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 118/319 (37%), Positives = 189/319 (59%), Gaps = 25/319 (8%)
 Frame = +2

Query  83    SDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVL  262
             S+D + L  AF G G +E   +S+LA  + + R+  R++ H+   +D    +  D     
Sbjct  14    SEDAEQLKSAFDGWGTNEDLIISILAHRSAEQRKLIRQTYHEACGED--LLKTLDK----  67

Query  263   QLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGARRA  439
             +L  +F R   A++L+ + P ERDA L  EA  +    + +L+E ACTR S +LL AR+A
Sbjct  68    ELTSDFER---AILLWTLEPGERDALLANEATKRWTSSNQVLMEVACTRTSTQLLHARQA  124

Query  440   YHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGN  619
             YH+ +  SIEED+A H     RKLLV+LVSSYRYEG +V+  +A  EAK++   IK   +
Sbjct  125   YHARYKKSIEEDVAHHTTGDFRKLLVSLVSSYRYEGDEVNMTLATQEAKLIHEKIK---D  181

Query  620   KNLVDDEEIVRILSTRSklhllalykhykEITGKFL-------DEDLHAHLLLKQTVQCL  778
             K+   DE+++RILSTRSK  + A +  Y++  G+ +       DED     LL+ T+QCL
Sbjct  182   KH-YSDEDVIRILSTRSKAQINATFNRYQDEHGEEILKSLEEGDEDDKFLGLLRSTIQCL  240

Query  779   CMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIG  955
               P+LYF  +L +++ + G DE A   +TR++ TRA+ D+K I +E++ +  + L   I 
Sbjct  241   TRPELYFVDVLRSAINKTGTDEGA---LTRIVTTRAEIDLKVIGEEYQRRNSIPLEKAIT  297

Query  956   EVANGSYKELLLTLVAKSE  1012
             +   G Y+++L+ L+ + +
Sbjct  298   KDTRGDYEKMLVALLGEDD  316



>ref|XP_010025470.1| PREDICTED: annexin D2-like [Eucalyptus grandis]
Length=316

 Score =   171 bits (432),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 115/315 (37%), Positives = 183/315 (58%), Gaps = 24/315 (8%)
 Frame = +2

Query  83    SDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVL  262
             ++D + L KAF+G G +E   +S+L   N   R+  R++  + + +D    +  D     
Sbjct  14    AEDAEQLQKAFAGWGTNEDLIISILPHRNAAQRKVIRQTYAETYGED--LLKALDK----  67

Query  263   QLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGARRA  439
             +L  +F R   +V+L+ + P ERDA L  EA  +    + +L+E ACTR S EL   ++A
Sbjct  68    ELSSDFER---SVLLWTLDPAERDAFLSSEATKRLTSSNWVLMEIACTRSSMELFMVKQA  124

Query  440   YHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGN  619
             YH+ +  S+EEDIA+H     RKLLV L S++RYEGP+V+  +A+SEAK+L   I    +
Sbjct  125   YHARYKKSLEEDIAYHTTGDFRKLLVPLASTFRYEGPEVNMTLARSEAKILHEKI----H  180

Query  620   KNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHL------LLKQTVQCLC  781
             +   + +E++RI++TRSK  L A   +Y    G  +++DL A        LL+  ++CL 
Sbjct  181   EKAYNHDELIRIVTTRSKAQLNATLNYYNNEFGNAINKDLKADPNDEFLKLLRSAIKCLT  240

Query  782   MPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGE  958
              P+ YF K+L  ++ +LG DE A   +TRV+ TRA+ DM+ IK+++  +  V L   I  
Sbjct  241   YPEKYFEKVLRLAINKLGTDEWA---LTRVVTTRAEVDMQRIKEQYHKRNSVPLDRAIAN  297

Query  959   VANGSYKELLLTLVA  1003
               +G YK++LL LV 
Sbjct  298   DTSGDYKKMLLALVG  312



>ref|XP_006305394.1| hypothetical protein CARUB_v10009786mg [Capsella rubella]
 gb|EOA38292.1| hypothetical protein CARUB_v10009786mg [Capsella rubella]
Length=317

 Score =   171 bits (432),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 115/319 (36%), Positives = 190/319 (60%), Gaps = 25/319 (8%)
 Frame = +2

Query  83    SDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVL  262
             S+D + L  AF G G +E   +S+LA  + + R+  R++ H+ + +D    +  D     
Sbjct  14    SEDAEQLRTAFEGWGTNEDLIISILAHRSAEQRKQIRQAYHETYGED--LLKTLDK----  67

Query  263   QLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGARRA  439
             +L  +F R   A++L+ + P ERDA L  EA  +    + +L+E ACTR S +LL AR+A
Sbjct  68    ELSNDFER---AILLWTLEPAERDALLTNEATKRWTSSNQVLMEVACTRTSTQLLHARQA  124

Query  440   YHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGN  619
             YH+ +  S+EED+A H     RKLLV LV+S+RYEG +V+  +AK EAK++   IK   +
Sbjct  125   YHARYKKSLEEDVAHHTTGEFRKLLVPLVTSFRYEGDEVNMTLAKQEAKLIHEKIK---D  181

Query  620   KNLVDDEEIVRILSTRSklhllalykhykEITGKFL-------DEDLHAHLLLKQTVQCL  778
             K+   DE+++RILSTRSK  + A +  Y++  G+ +       D+D     LL+ T+QCL
Sbjct  182   KHYT-DEDVIRILSTRSKAQINATFNRYQDDHGEEILKSLEEGDDDDKFLALLRSTIQCL  240

Query  779   CMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIG  955
               P+LYF  +L +++ + G DE A   +TR++ TRA+ D+K I +E++ +  + L   I 
Sbjct  241   TRPELYFVDVLRSAINKTGTDEGA---LTRIVTTRAEIDLKVIGEEYQRRNSIPLEKAIT  297

Query  956   EVANGSYKELLLTLVAKSE  1012
             +   G Y+++L+ L+ + +
Sbjct  298   KDTRGDYEKMLVALLGEDD  316



>gb|KCW62130.1| hypothetical protein EUGRSUZ_H04787 [Eucalyptus grandis]
Length=316

 Score =   171 bits (432),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 115/315 (37%), Positives = 183/315 (58%), Gaps = 24/315 (8%)
 Frame = +2

Query  83    SDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVL  262
             ++D + L KAF+G G +E   +S+L   N   R+  R++  + + +D    +  D     
Sbjct  14    AEDAEQLQKAFAGWGTNEDLIISILPHRNAAQRKVIRQTYAETYGED--LLKALDK----  67

Query  263   QLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGARRA  439
             +L  +F R   +V+L+ + P ERDA L  EA  +    + +L+E ACTR S EL   ++A
Sbjct  68    ELSSDFER---SVLLWTLDPAERDAFLSSEATKRLTSSNWVLMEIACTRSSMELFMVKQA  124

Query  440   YHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGN  619
             YH+ +  S+EEDIA+H     RKLLV L S++RYEGP+V+  +A+SEAK+L   I    +
Sbjct  125   YHARYKKSLEEDIAYHTTGDFRKLLVPLASTFRYEGPEVNMTLARSEAKILHEKI----H  180

Query  620   KNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHL------LLKQTVQCLC  781
             +   + +E++RI++TRSK  L A   +Y    G  +++DL A        LL+  ++CL 
Sbjct  181   EKAYNHDELIRIVTTRSKAQLNATLNYYNNEFGNAINKDLKADPNDEFLKLLRSAIKCLT  240

Query  782   MPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGE  958
              P+ YF K+L  ++ +LG DE A   +TRV+ TRA+ DM+ IK+++  +  V L   I  
Sbjct  241   YPEKYFEKVLRLAINKLGTDEWA---LTRVVTTRAEVDMQRIKEQYHKRNSVPLDRAIAN  297

Query  959   VANGSYKELLLTLVA  1003
               +G YK++LL LV 
Sbjct  298   DTSGDYKKMLLALVG  312



>ref|XP_008795561.1| PREDICTED: annexin D2-like isoform X1 [Phoenix dactylifera]
Length=315

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 125/316 (40%), Positives = 178/316 (56%), Gaps = 26/316 (8%)
 Frame = +2

Query  86    DDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDD-ERQFERWDDHHVL  262
             DD + L KAF G G +E   +S++A  +   R+  R +  Q + +D  +  ER       
Sbjct  15    DDSEQLRKAFEGWGTNEGLIISIVAHRSAAQRRQIRDAYAQAYGEDILKALER-------  67

Query  263   QLRQEFLRLKDAVVLYMMHPWERDARLFKEALLK-EPQFDLLIETACTRPSEELLGARRA  439
             +L ++F   + AV+L+M+ P ERDA L  EAL K  P    LIE A TR ++EL   RRA
Sbjct  68    ELTRDF---EKAVLLWMLDPPERDAVLANEALKKWSPGNRALIEIAATRTADELFAVRRA  124

Query  440   YHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGN  619
             YH+ F  S+EED+A H     RKLLV LVSSYRYEG +V+  +AKSEAKVL   I    N
Sbjct  125   YHARFKRSLEEDVAAHTSGDFRKLLVPLVSSYRYEGLEVNASLAKSEAKVLHEKI----N  180

Query  620   KNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHL------LLKQTVQCLC  781
                   EEI+RIL+TRSK  LLA +  Y    G  +++DL A         L+  V+C+ 
Sbjct  181   DKDYGHEEIIRILTTRSKAQLLATFNDYNNEFGHPINKDLKADPKDDFLSALRSIVRCII  240

Query  782   MPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGE  958
              P+ Y  K++  ++ ++G DE A   +TRVI T A+ +MK IK+ +  +  V L   I +
Sbjct  241   CPERYLEKVIRLAINKVGTDEYA---LTRVITTHAEVNMKPIKEIYYKRNSVPLERAIKK  297

Query  959   VANGSYKELLLTLVAK  1006
                G Y++ LL L+ +
Sbjct  298   DTTGDYEDFLLALIGE  313



>ref|XP_010544079.1| PREDICTED: annexin D1 [Tarenaya hassleriana]
Length=316

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 117/318 (37%), Positives = 184/318 (58%), Gaps = 24/318 (8%)
 Frame = +2

Query  83    SDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVL  262
             S+D + L  AF G G +E   +S+L   N   R+  R+  H+    D    +  D     
Sbjct  14    SEDAEQLRTAFEGWGTNEHLIISILGHRNAAQRKQIREIYHELHGQD--LLKALDK----  67

Query  263   QLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGARRA  439
             +L  +F R   A++L+   P ERDA L  EA  +    + +L+E ACTR S++LL AR+A
Sbjct  68    ELSNDFER---AILLWTHEPAERDAYLANEATKRWTSSNQVLMEIACTRTSDQLLHARQA  124

Query  440   YHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGN  619
             YH+ +  S+EED+A H     RKLLV LV+SYRYEGP+V+  +AK E K++   IK    
Sbjct  125   YHARYKKSLEEDVAHHTTGDFRKLLVPLVTSYRYEGPEVNMTLAKQECKLIHEKIK----  180

Query  620   KNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAH------LLLKQTVQCLC  781
                  DE+++RILSTRSK  + A + HY++  G  + +DL          LL+ T++CL 
Sbjct  181   DKHYSDEDVIRILSTRSKAQINATFNHYQDEHGHEILKDLGGDSDDEFLALLRSTIECLT  240

Query  782   MPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGE  958
              P+LYF K+L +++ + G DE     +TRV+ TRA+ D++ I +E++ +  V L+  I +
Sbjct  241   RPELYFEKVLRSAINKRGTDEG---DLTRVVTTRAEIDLQVIGEEYQRRNSVPLAKAITK  297

Query  959   VANGSYKELLLTLVAKSE  1012
               +G Y+++LL L+ + +
Sbjct  298   DTHGDYEKMLLALLGEDD  315



>ref|XP_007147424.1| hypothetical protein PHAVU_006G123400g [Phaseolus vulgaris]
 gb|ESW19418.1| hypothetical protein PHAVU_006G123400g [Phaseolus vulgaris]
Length=313

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 116/330 (35%), Positives = 181/330 (55%), Gaps = 26/330 (8%)
 Frame = +2

Query  44    PTLNSANSSKMAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDD  223
              TL +AN S  +  +D + +  A  G G DE A +S+LA  N   R+  R +  + + +D
Sbjct  2     TTLIAANDS--SPIEDAENIKNACKGFGTDEAALISILAHRNVTERKLVRMAYEEIYHED  59

Query  224   ERQFERWDDHHVLQLRQEFL-RLKDAVVLYMMHPWERDARLFKEALLKEP-QFDLLIETA  397
               Q          QL+ E     +  +  + M P ERDA   KE L KE   + ++IE A
Sbjct  60    LIQ----------QLKSELSGSFQRGMCKWTMDPAERDAAFIKETLKKETVDYKVIIEIA  109

Query  398   CTRPSEELLGARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKS  577
             CTR SEE L  +R+Y  L+ HS+EED+A       R+LLVA+VS+YRYEG +  E +A  
Sbjct  110   CTRTSEEFLAVKRSYQLLYKHSLEEDVASKTIGDIRRLLVAVVSTYRYEGEEFDESLANL  169

Query  578   EAKVLANAIKHAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAH---  748
             EA +L  AI+    K +  D+EI+RILSTRSK  L A +  ++   G  + + L +    
Sbjct  170   EANILHQAIE----KKVFCDDEIIRILSTRSKKQLFATFSTFRNTYGTTITKGLSSDSSD  225

Query  749   ---LLLKQTVQCLCMPQLYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFK  919
                + L+ T++C+  P+ Y +K++  +L   V  A   +++RVI+TRA++D+  I   + 
Sbjct  226   EYMVTLRTTIRCIKNPKRYLAKVICYALNDLV--AEEHALSRVIITRAEKDLNEISDLYF  283

Query  920   TKYGVALSDRIGEVANGSYKELLLTLVAKS  1009
              + GV L + + E  +G+YK  LL L+ K+
Sbjct  284   KRNGVTLQNSVAEKTSGNYKTFLLALLGKN  313



>ref|XP_007018794.1| Annexin 1 [Theobroma cacao]
 gb|EOY16019.1| Annexin 1 [Theobroma cacao]
Length=316

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 121/338 (36%), Positives = 192/338 (57%), Gaps = 34/338 (10%)
 Frame = +2

Query  23    MSVSMTAPTLNSANSSKMAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKST  202
             ++V  T P++N          +D + L KAFSG G +E   +++L   N + R+  R++ 
Sbjct  4     LTVPATVPSVN----------EDCEQLRKAFSGWGTNEGLIIAILGHRNAEQRKLIRQTY  53

Query  203   HQFFRDDERQFERWDDHHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-  379
              + + +D    +  D     +L  +F R+   V+++ + P ERDA L  EA  +    + 
Sbjct  54    AETYGED--LLKALDK----ELSDDFERV---VLVWTLDPAERDAFLANEATKRWTSSNQ  104

Query  380   LLIETACTRPSEELLGARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVH  559
             +L+E ACTR + +LL AR+AYH+ +  S+EED+A H     RKLL+ LV SYRYEG +V+
Sbjct  105   VLMEIACTRSANQLLHARQAYHARYKKSLEEDVAHHTTGDFRKLLLPLVCSYRYEGDEVN  164

Query  560   EDVAKSEAKVLANAIKHAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDL  739
               +AKSEAK+L   I +       +D++++R+L+TRSK  + A   HYK   G  +++DL
Sbjct  165   MTLAKSEAKLLHEKISNKA----YNDDDLIRVLATRSKAQINATLNHYKNEYGNDINKDL  220

Query  740   HAH------LLLKQTVQCLCMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMK  898
              A        LL+ TV+CL  P+ YF K+L  ++ R G DE A   +TRV+ TRA+ D+K
Sbjct  221   KADPKDEFLALLRATVKCLVRPESYFEKVLRLAINRRGTDEGA---LTRVVTTRAEVDLK  277

Query  899   HIKQEFKTKYGVALSDRIGEVANGSYKELLLTLVAKSE  1012
              I  E++ +  V L   I +  +G Y+++LL L    E
Sbjct  278   IIADEYQRRNSVPLDRAIAKDTHGDYEKMLLALAGHVE  315



>ref|XP_004288207.1| PREDICTED: annexin D2-like [Fragaria vesca subsp. vesca]
Length=316

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 121/318 (38%), Positives = 181/318 (57%), Gaps = 24/318 (8%)
 Frame = +2

Query  83    SDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVL  262
             ++D + L KAF G G +E    S+LA  N   R+  +++  + + +D    +  D     
Sbjct  14    AEDSEQLRKAFEGWGTNEALITSILAHRNADQRRLIQQTYAETYGED--LLKSLDK----  67

Query  263   QLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGARRA  439
             +L  +F R   AV+L+ +HP ERDA L  EA  +    + +L+E AC+R S ELL  ++A
Sbjct  68    ELSSDFER---AVMLWTLHPSERDAVLANEATKRFTSSNWVLMEIACSRSSYELLQVKQA  124

Query  440   YHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGN  619
             YH+ F  S+EED+AFH     RKLLV LVS++RYEG +V+  VAK EAK+L   IK    
Sbjct  125   YHAKFKKSLEEDVAFHTSGDFRKLLVPLVSAFRYEGDEVNVTVAKREAKILHEKIKDKH-  183

Query  620   KNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHL------LLKQTVQCLC  781
                 +DEE++RI +TRSK  L A +  Y    G  + +DL A        LL+ T + L 
Sbjct  184   ---YNDEELIRIFTTRSKAQLNATFNQYNNEFGNAITKDLKADQDDEFLKLLRATAKLLT  240

Query  782   MPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGE  958
              P+ YF K+L   + +LG DE A   +TRVI TRA+ D+  IK+E++ +  V L   I +
Sbjct  241   FPEKYFEKLLRLCINKLGTDEGA---LTRVITTRAEVDLHRIKEEYQRRNSVPLDRAIEK  297

Query  959   VANGSYKELLLTLVAKSE  1012
               +G Y++ LL L+ + +
Sbjct  298   DTSGDYEKFLLALLGQGD  315



>ref|XP_011088381.1| PREDICTED: annexin D3 [Sesamum indicum]
Length=318

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 111/318 (35%), Positives = 179/318 (56%), Gaps = 27/318 (8%)
 Frame = +2

Query  83    SDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVL  262
             ++D + L  AF GLG DEKA + +L + N   R+  R++  Q +       +   D  + 
Sbjct  14    AEDCERLNNAFQGLGTDEKAVIRILGRRNAGQRKKIRETYQQLYN------KSLIDCLIS  67

Query  263   QLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEP----QFDLLIETACTRPSEELLGA  430
             +L  +F   + AV+L+   P ERDARL  EAL        Q  +++E AC      L+  
Sbjct  68    ELSGDF---RKAVILWTYDPAERDARLANEALKSRKKSIIQLQVIVEIACASSPHHLVAV  124

Query  431   RRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKH  610
             R+AY SLF+ S+EEDI  ++  P +K+LV+LVSSYRY+   V  D+A  EA +L  AI+ 
Sbjct  125   RQAYCSLFNCSLEEDIISNVSPPVQKILVSLVSSYRYDKEHVDYDMANMEAAILRKAIEA  184

Query  611   AGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHA------HLLLKQTVQ  772
                   +DD+E+VR+LSTR+   L   +  YK   GK +D+++ A        ++K  V 
Sbjct  185   KK----LDDDEVVRVLSTRNMFQLAQTFLCYKNNYGKSIDQEIMACGKGILESVMKVVVW  240

Query  773   CLCMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDR  949
             C+  P+ +F++++ AS+  LG DE   DS+TR IV RA+ D+ +++ E+      ++ + 
Sbjct  241   CIDSPEKHFAEVIKASIVGLGTDE---DSLTRAIVCRAEIDLMNVRAEYFNTNKSSMDNA  297

Query  950   IGEVANGSYKELLLTLVA  1003
             I +  +G YK+ L+TL+ 
Sbjct  298   IIDDTSGDYKDFLVTLLG  315



>gb|KEH37119.1| annexin D8 [Medicago truncatula]
Length=313

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 115/327 (35%), Positives = 178/327 (54%), Gaps = 29/327 (9%)
 Frame = +2

Query  65    SSKMAVSD-----DHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDER  229
             +S +AV D     D + +  A  G G DE A +SVLA  N   R+  R +  + +  D  
Sbjct  2     ASLLAVKDFSPIEDAETIKNACKGFGTDETAIISVLAHRNEAQRKLVRLAYQEIYHQD--  59

Query  230   QFERWDDHHVLQLRQEFL-RLKDAVVLYMMHPWERDARLFKEALLK-EPQFDLLIETACT  403
                      + QL+ E     + A+  ++M P ERDA L  EAL K  P + ++IE  CT
Sbjct  60    --------LIEQLKTELSGNFERAISHWIMDPAERDATLINEALKKATPDYKVIIEIVCT  111

Query  404   RPSEELLGARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEA  583
             R SEELL  +R+YHSL+ H +EED+A       RKLLVA++S+Y+Y+G +  E+VA SEA
Sbjct  112   RNSEELLALKRSYHSLYKHCLEEDVASQTTGDIRKLLVAVISTYKYDGDEFDENVAHSEA  171

Query  584   KVLANAIKHAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHLL---  754
              +    I+    K   +D++IVRILSTRSK  L   +  +K++ G  +++ L    +   
Sbjct  172   TIFHQLIE----KKAFNDDDIVRILSTRSKKQLCVTFNIFKDLYGTTINKGLSGGTIDEY  227

Query  755   ---LKQTVQCLCMPQLYFSKILDASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTK  925
                L+ +V+C+   + Y +K+L  +L    +E   D+++RVIVTRA++D+K I   F  +
Sbjct  228   IGALRTSVRCIDDSRRYLAKVLSHALNDLANE--EDALSRVIVTRAEKDLKEINDHFLKR  285

Query  926   YGVALSDRIGEVANGSYKELLLTLVAK  1006
               V + D +     G YK  +L L+  
Sbjct  286   NNVTIHDSVARKTWGIYKTFILELLGN  312



>gb|AIY34672.1| annexin D2-like protein [Galtonia saundersiae]
Length=316

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 120/318 (38%), Positives = 175/318 (55%), Gaps = 24/318 (8%)
 Frame = +2

Query  83    SDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVL  262
             S+D   L KAF G G +E   +S+L   N   R+  R++    F +D    +  D     
Sbjct  14    SEDADQLRKAFGGWGTNEGLIISILTHRNAAQRKQIRQAYADLFGED--LLKALDK----  67

Query  263   QLRQEFLRLKDAVVLYMMHPWERDARLFKEALLK-EPQFDLLIETACTRPSEELLGARRA  439
             +L ++F R+   V+++ + P ERDA L  E+  K  P    LIE ACTR S+ELL  R+A
Sbjct  68    ELTRDFERV---VLIWTLDPPERDALLAYESAKKGSPSDRALIEIACTRTSDELLLIRKA  124

Query  440   YHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGN  619
             YH+ +  S EED+A H +   RKLLV LVS+ RYEGP+V+  +A SEAK+L   I     
Sbjct  125   YHARYKRSFEEDVAAHTKENFRKLLVPLVSALRYEGPEVNASLANSEAKLLHGKIAEKA-  183

Query  620   KNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHL------LLKQTVQCLC  781
                  DEE++RIL+TRSK  LLA +  Y    G  + +DL A         L+  ++C  
Sbjct  184   ---YSDEEVIRILTTRSKAQLLATFNEYNNDFGNPISKDLKADPKDEFLSALRAVIKCFT  240

Query  782   MPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGE  958
              P+ Y+ KI+  ++ ++G DE A   +TRVI TRA+ DMK IK  +  +  V L   I +
Sbjct  241   YPEKYYEKIIRLAINKMGTDEGA---LTRVIATRAEVDMKLIKDAYYKRNSVPLERAIKK  297

Query  959   VANGSYKELLLTLVAKSE  1012
                G Y++ LL L+ + +
Sbjct  298   DTTGDYEDFLLALIGQDD  315



>emb|CDP01446.1| unnamed protein product [Coffea canephora]
Length=316

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 119/314 (38%), Positives = 178/314 (57%), Gaps = 24/314 (8%)
 Frame = +2

Query  86    DDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVLQ  265
             +D   L KAF+G G +E   + +LA  N   R+  R+     + DD    +  D     +
Sbjct  15    EDCGQLRKAFAGWGTNEALIIQILAHRNAAQRKLIREVYAATYGDD--LLKDLD----AE  68

Query  266   LRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFDLLI-ETACTRPSEELLGARRAY  442
             L  +F R   AV+L+ + P ERDA L  EA  +    + +I E ACTR S++L  AR+AY
Sbjct  69    LSSDFQR---AVLLWTLDPAERDALLAYEATKRLTASNWVIMEIACTRSSQDLFKARQAY  125

Query  443   HSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGNK  622
             H+ +  SIEED+A+H     RKLLV LV+++RYEG  V+  +AKSEAK+L   I      
Sbjct  126   HARYKRSIEEDVAYHTAGDFRKLLVPLVTAFRYEGDDVNMTLAKSEAKLLHEKISEKAYN  185

Query  623   NLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLH-----AHL-LLKQTVQCLCM  784
             N    +EI+RIL+TRSK  L A    Y    G  ++++L       +L LL+ T++CL  
Sbjct  186   N----DEIIRILTTRSKAQLNATLNQYNNEFGNAINKNLKDDPKDEYLKLLRATIKCLTS  241

Query  785   PQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEV  961
             P+ YF K+L  ++ R+G DE A   +TRV+ TRA+ D++H+K+E+  +  V L   I   
Sbjct  242   PERYFEKVLRLAINRVGTDEWA---LTRVVTTRAEVDLQHVKEEYHKRNSVPLDRAIAGD  298

Query  962   ANGSYKELLLTLVA  1003
              +G Y+++LL L  
Sbjct  299   TSGDYEKMLLALTG  312



>gb|AET02255.2| annexin D8 [Medicago truncatula]
Length=313

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 125/334 (37%), Positives = 192/334 (57%), Gaps = 33/334 (10%)
 Frame = +2

Query  44    PTLNSANSSKMAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDD  223
              TL +  SS +   +D + L KAF G G DEK+ +++L   N   RQ  RKS  + +++D
Sbjct  2     ATLVTIKSSPV---EDAEALQKAFKGWGTDEKSVITILGHRNVYQRQQIRKSYQEIYQED  58

Query  224   ERQFERWDDHHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQ-FDLLIETAC  400
                 +R +     +L  +F R   AV  +M+ P +RDA L   A+    + + ++IE   
Sbjct  59    --ILKRLES----ELSGDFER---AVYRWMLEPADRDAVLANVAIKDGSKSYHVIIEIVS  109

Query  401   TRPSEELLGARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSE  580
                 EE+L  RRAYH+ + HS+EED+A H     R+LLV LV+S+RY G +++  +AK+E
Sbjct  110   VLSPEEVLAMRRAYHNRYKHSLEEDLAAHTTGHLRQLLVGLVTSFRYGGAEINPKLAKTE  169

Query  581   AKVLANAIKH-AGNKNLVDDEEIVRILSTRSklhllalykhykE-----ITGKFLD---E  733
             A +L  +IK   GN      EE +RIL+TRSK  LLA +  Y++     IT K LD   +
Sbjct  170   ADILHESIKEKKGNH-----EEAIRILTTRSKTQLLATFNRYRDDHGISITKKLLDNASD  224

Query  734   DLHAHLLLKQTVQCLCMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQ  910
             D H    L  T++C+   + Y+ KIL  +L R+G DE   D +TRV+VTRA++D+K IK+
Sbjct  225   DFHK--ALHTTIRCINDHKKYYEKILRGALKRVGTDE---DGLTRVVVTRAEKDLKDIKE  279

Query  911   EFKTKYGVALSDRIGEVANGSYKELLLTLVAKSE  1012
              +  +  V L D + +  +G YK+ +LTL+ K +
Sbjct  280   LYYKRNSVHLEDAVAKEISGDYKKFILTLLGKQD  313



>ref|XP_010916888.1| PREDICTED: annexin D1-like isoform X1 [Elaeis guineensis]
Length=344

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 128/337 (38%), Positives = 181/337 (54%), Gaps = 39/337 (12%)
 Frame = +2

Query  86    DDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDD---------ERQFE  238
             DD + L KAF G G +E   +++LA  +   R+  R +  Q + +D          R FE
Sbjct  15    DDSEQLRKAFEGWGTNEGLIIAILAHRSAAQRRQIRDAYAQAYGEDILKALEKELTRHFE  74

Query  239   RWDDHHVLQLRQE----------FLRLKD-AVVLYMMHPWERDARLFKEALLKEPQFD-L  382
              +        R            FL  K  AV+L+M+ P ERDA L  EAL K    +  
Sbjct  75    VFSVSCFFSQRSLSFCSFSSLICFLIWKQKAVLLWMLDPPERDAVLANEALKKWSSGNRA  134

Query  383   LIETACTRPSEELLGARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHE  562
             LIE + TR S+E+   RRAYH+ F  S+EED+A H     RKLLV LVSSYRYEG +V+ 
Sbjct  135   LIEISVTRTSDEMFAVRRAYHARFKRSLEEDVAVHTSGDFRKLLVPLVSSYRYEGLEVNA  194

Query  563   DVAKSEAKVLANAI--KHAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDED  736
              +AKSEAK+L   I  K  GN      EEI+RIL+TRSK  LLA +  Y    G  +++D
Sbjct  195   SLAKSEAKMLHEKINDKDYGN------EEIIRILTTRSKAQLLATFNDYNNEFGHPINKD  248

Query  737   LHAH------LLLKQTVQCLCMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDM  895
             L A         L+  ++C+  P+ YF K++  ++ ++G DE A   +TRVI TRA+ +M
Sbjct  249   LKADPKDDFLFALRSIIRCIICPEKYFEKVIRLAINKMGTDEYA---LTRVITTRAEVNM  305

Query  896   KHIKQEFKTKYGVALSDRIGEVANGSYKELLLTLVAK  1006
             K IK+ +  +  V L   I +   G Y++ LL L+ +
Sbjct  306   KQIKEIYYKRNSVPLERAIKKDTTGDYEDFLLALIGE  342



>ref|XP_011097579.1| PREDICTED: annexin D7 [Sesamum indicum]
 ref|XP_011097580.1| PREDICTED: annexin D7 [Sesamum indicum]
Length=318

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 117/316 (37%), Positives = 182/316 (58%), Gaps = 26/316 (8%)
 Frame = +2

Query  86    DDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDE-RQFERWDDHHVL  262
             +D + L KAF+G G DE+  V + A  N   R+  R++    + +D  ++ E+       
Sbjct  15    EDAEKLHKAFAGWGTDEEGIVGIFAHRNGAQRKLIREAYAAAYGEDLLKELEK-------  67

Query  263   QLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFDLLI-ETACTRPSEELLGARRA  439
             +L  +FLR   A++L+ + P ERDA L  EA+ K    +L+I E ACTR S +L   R+A
Sbjct  68    ELSGDFLR---AILLWTLDPAERDAYLANEAIKKLTASNLVIMEIACTRSSYDLFKIRQA  124

Query  440   YHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGN  619
             YH+ +  S+EED+A++     RKLLV LVS++RYEG +V   +AKSEAK+L   I    +
Sbjct  125   YHACYKKSLEEDVAYYTTGDFRKLLVPLVSAFRYEGDEVDMILAKSEAKILHEKI----S  180

Query  620   KNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAH------LLLKQTVQCLC  781
                  DEE++RIL+TRSK  L A +  Y +  G  + +DL A         L+ T++CL 
Sbjct  181   GKACADEELIRILTTRSKAQLNATFNQYNDHFGNAISKDLKADPKDEYLRFLRATIKCLT  240

Query  782   MPQLYFSKILDASLR-LGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGE  958
              P+ Y+ K L  ++  LG DE A   +TRV+VT+A+ +++ IK+E+  +  + L   +  
Sbjct  241   SPEKYYEKTLRLAITGLGTDEWA---LTRVVVTQAEVNLQRIKEEYHKRNSMTLVHAVAG  297

Query  959   VANGSYKELLLTLVAK  1006
               +G Y++ LL LV K
Sbjct  298   DTSGDYEKFLLALVGK  313



>ref|XP_009361986.1| PREDICTED: annexin-like protein RJ4 [Pyrus x bretschneideri]
Length=314

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 117/317 (37%), Positives = 184/317 (58%), Gaps = 24/317 (8%)
 Frame = +2

Query  86    DDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVLQ  265
             DD ++L K+  G G DEKA +S+L   N   R+  R +  Q +++D    +R +     +
Sbjct  14    DDAEVLRKSVKGWGTDEKAIISILGHRNAAQRKQIRLAYEQSYQED--LLKRLES----E  67

Query  266   LRQEFLRLKDAVVLYMMHPWERDARLFKEALLK-EPQFDLLIETACTRPSEELLGARRAY  442
             L  +F   + A+  +++ P +RDA L   A+ K E  ++++IE A     EELL  R+AY
Sbjct  68    LSGDF---EKAMYRWILDPADRDAVLAHVAIKKSECNYNVIIENATILSPEELLAVRKAY  124

Query  443   HSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGNK  622
                + HS+EED+A H     RKLLVALV++YRY+G +++  +A SEA +L +AIK     
Sbjct  125   QVRYKHSLEEDLAAHTTGDIRKLLVALVTAYRYDGCEINAKLANSEADILHDAIKDKA--  182

Query  623   NLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDL------HAHLLLKQTVQCLCM  784
                + +E++RILSTRSK  L+A +  Y++  G  + + L           L   ++CL  
Sbjct  183   --FNHDEVIRILSTRSKTQLMATFNRYRDDHGTSISKSLLEEGGDGLQKALHVAIRCLND  240

Query  785   PQLYFSKIL-DASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEV  961
             P+ YF K+L +A  R+G DE   D++TRVIVTRA+ D+K IK+ +  K  V+L   + + 
Sbjct  241   PKKYFEKVLRNAIKRVGTDE---DALTRVIVTRAERDLKDIKEVYYKKNNVSLDHTVAKE  297

Query  962   ANGSYKELLLTLVAKSE  1012
              +G YK+ LLTL+ K +
Sbjct  298   TSGDYKDFLLTLLGKED  314



>gb|AAB71830.1| annexin [Lavatera thuringiaca]
Length=316

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 126/336 (38%), Positives = 190/336 (57%), Gaps = 32/336 (10%)
 Frame = +2

Query  32    SMTAPTLNSANSSKMAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKS-THQ  208
             ++T P      S+  +VS+D + L KAFSG G +E   +++L   N   R S RK+ T  
Sbjct  3     TLTVP------STLPSVSEDCEQLRKAFSGWGTNEDLIINILGHRNADERNSIRKAYTET  56

Query  209   FFRDDERQFERWDDHHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LL  385
                D  +  ++       +L  +F RL   V+L+ + P ERDA L  EA  +    + ++
Sbjct  57    HGEDLLKALDK-------ELSNDFERL---VLLWTLDPPERDALLANEATKRWTSSNQVI  106

Query  386   IETACTRPSEELLGARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHED  565
             +E AC   S++LL AR+AYH  +  S+EED+A H     RKLL+ LVSSYRYEG +V+  
Sbjct  107   MEIACRSSSDQLLRARQAYHVRYKKSLEEDVAHHTTGDFRKLLLPLVSSYRYEGDEVNMT  166

Query  566   VAKSEAKVLANAIKHAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHA  745
             +AK+EAK+L   I    NK   DD +++R+L+TRSK  +     HYK      +++DL A
Sbjct  167   LAKTEAKLLHEKI---SNKAYSDD-DVIRVLATRSKSQINERLNHYKNEYATDINKDLKA  222

Query  746   H------LLLKQTVQCLCMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHI  904
                     LL+ TV+CL  P+ YF K+L  ++ + G DE A   +TRV+ TRA+ D+K I
Sbjct  223   DPKDEFLALLRSTVKCLVYPEKYFEKVLRLAINKRGTDEGA---LTRVVSTRAEVDLKII  279

Query  905   KQEFKTKYGVALSDRIGEVANGSYKELLLTLVAKSE  1012
               E++ +  V L+  I +  NG Y++LLL L  + E
Sbjct  280   ADEYQRRNSVPLTRAIVKDTNGDYEKLLLVLAGEVE  315



>ref|XP_008245413.1| PREDICTED: annexin-like protein RJ4 isoform X1 [Prunus mume]
Length=314

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 120/326 (37%), Positives = 188/326 (58%), Gaps = 28/326 (9%)
 Frame = +2

Query  65    SSKMAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERW  244
             S   + ++D ++L ++  G G DEKA +S+LA  N   R   R +    +R+D    +R 
Sbjct  7     SENFSPTEDAEVLRRSVKGWGTDEKAVISILAHRNAAQRYEIRLAYEGLYRED--LIKRL  64

Query  245   DDHHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLK-EPQFDLLIETACTRPSEEL  421
             +     +L  +F   + AV  +++ P +R A L   A+ K E  +++++E +CT   EEL
Sbjct  65    ES----ELSGDF---EKAVYRWILDPTDRYAVLAHVAIKKSETDYNVIVEISCTLSPEEL  117

Query  422   LGARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANA  601
             L  RRAY   + HS+EED+A H     RKLLVALV++YRY+G +++  VAKSEA +L +A
Sbjct  118   LAVRRAYQLRYKHSLEEDLAAHTTGDIRKLLVALVTTYRYDGGEINAKVAKSEADILHDA  177

Query  602   IKHAGNKNLVDDEEIVRILSTRSklhllalykhykE-----ITGKFLD---EDLHAHLLL  757
             IK        + EE++RILSTRSK  L+A +  Y++     I+   LD   +D    L +
Sbjct  178   IKDKA----FNHEEVIRILSTRSKTQLMATFNRYRDDHGISISKNLLDDGADDFQKALHV  233

Query  758   KQTVQCLCMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGV  934
                ++CL  P+ YF K+L  ++ R G DE   D++TRVIVTRA+ D+K IK+ +  K  V
Sbjct  234   --VIRCLNDPKKYFEKVLRQAIKRAGTDE---DALTRVIVTRAERDLKDIKELYYKKNSV  288

Query  935   ALSDRIGEVANGSYKELLLTLVAKSE  1012
              L   + +  +G YK  L+TL+ + +
Sbjct  289   HLEHAVAKETSGDYKAFLVTLLGQED  314



>ref|XP_009123806.1| PREDICTED: annexin D1-like [Brassica rapa]
Length=298

 Score =   169 bits (427),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 114/295 (39%), Positives = 176/295 (60%), Gaps = 27/295 (9%)
 Frame = +2

Query  86   DDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDE-RQFERWDDHHVL  262
            +D + L  AF G G +E+  +S+LA  + + R+  R++ H+ F +D  +  E+       
Sbjct  15   EDAEQLKSAFDGWGTNEELIISILAHRSAEQRKLIRQTYHESFGEDLLKSLEK-------  67

Query  263  QLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGARRA  439
            +L  +F R   A++L+ + P ERDA L  EA  +    + +L+E ACTR S +LL AR+A
Sbjct  68   ELTSDFER---AILLWTLEPGERDALLVNEATKRWTSSNQVLMEVACTRTSTQLLHARQA  124

Query  440  YHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGN  619
            YH+ +  SIEED+A H     RKLLV+LVSSYRYEG +V+  +AK EAK++   IK    
Sbjct  125  YHARYKKSIEEDVAHHTTGDFRKLLVSLVSSYRYEGEEVNMTLAKQEAKLIHEKIKDKH-  183

Query  620  KNLVDDEEIVRILSTRSklhllalykhykEITGKFL-------DEDLHAHLLLKQTVQCL  778
                +DE+ +RILSTRSK  + A +  Y++  G+ +       DED     LL+ T+QCL
Sbjct  184  ---YNDEDFIRILSTRSKPQINATFNRYQDNHGEEILKSLEEGDEDDKFLGLLRSTIQCL  240

Query  779  CMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVAL  940
              P+LYF  +L +++ + G DE A   +TR++ TRA+ D+K I QE++ +  + L
Sbjct  241  TRPELYFVDVLRSAIKKTGTDEGA---LTRIVTTRAEIDLKVIGQEYQRRNSIPL  292



>ref|XP_002279669.1| PREDICTED: annexin D8 [Vitis vinifera]
 emb|CBI24222.3| unnamed protein product [Vitis vinifera]
Length=321

 Score =   169 bits (428),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 113/319 (35%), Positives = 177/319 (55%), Gaps = 26/319 (8%)
 Frame = +2

Query  83    SDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVL  262
              +D   + +A  G G DEKA +S+L   N   R+  R +  + + +D  +          
Sbjct  19    GEDALAINRACQGWGTDEKAIISILGHRNAAQRKQIRLAYQEIYLEDLTK----------  68

Query  263   QLRQEFLR-LKDAVVLYMMHPWERDARLFKEALLK-EPQFDLLIETACTRPSEELLGARR  436
             QL+ E    L+ A+  +++ P ERDA L  EAL K  P + +++ETA  +  EELL  +R
Sbjct  69    QLKSELSGDLERAICHWILDPVERDAVLANEALKKARPDYRVILETAYMKSPEELLAVKR  128

Query  437   AYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAG  616
             AY  L+  S+EED+A H     R+LL+A+VS YRYEG ++ E VA SEA +L + ++   
Sbjct  129   AYQFLYKRSLEEDVASHTTGDMRRLLIAVVSVYRYEGEEIDEGVAHSEANILGDEMQGGA  188

Query  617   NKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHA------HLLLKQTVQCL  778
              K     EEI+RILSTRSK  L+A + +YK+I G  + + L           L+  ++C+
Sbjct  189   LKG----EEIIRILSTRSKAQLIATFNNYKQIHGTSITKSLRGDPTEEFSAALRAAIRCI  244

Query  779   CMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIG  955
               P+ Y  K+L   +  +G DE   D+++RVI+TRA++D+K +K+ +  +   +L D + 
Sbjct  245   RNPKKYLQKLLCNVINNMGTDE---DTLSRVIITRAEKDLKEMKELYLERNSRSLEDAVS  301

Query  956   EVANGSYKELLLTLVAKSE  1012
                 G YK  LLTL+   E
Sbjct  302   SETTGDYKAFLLTLLGNQE  320



>gb|EMS50782.1| Annexin D1 [Triticum urartu]
Length=314

 Score =   169 bits (428),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 119/331 (36%), Positives = 176/331 (53%), Gaps = 42/331 (13%)
 Frame = +2

Query  65    SSKMAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERW  244
             S+  A++DD   L KAF G G +E   +S+L   +   R++ RK                
Sbjct  8     SNVPALADDCDNLRKAFQGWGTNEALIISILGHRDASQRRAIRK----------------  51

Query  245   DDHHVLQLRQEFLR---------LKDAVVLYMMHPWERDARLFKEALLK-EPQFDLLIET  394
               H+     +E LR          + AV+L+ + P ERDA L  E   K  P   +L+E 
Sbjct  52    --HYADTYGEELLRSITDEISGDFERAVILWTLDPAERDAVLANETARKWHPGNPVLVEI  109

Query  395   ACTRPSEELLGARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAK  574
             AC R S++L   R+AYH  F  S+EED+A H+    RKLLV LVSS+RYEGP+V+  +A 
Sbjct  110   ACARGSKQLFAVRQAYHDRFKRSLEEDVASHVTGDFRKLLVPLVSSHRYEGPEVNTRLAH  169

Query  575   SEAKVLANAIKHAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHL-  751
             SEAK+L   I+H        D+E++RIL+TRSK  LLA + +Y +  G  + +DL A   
Sbjct  170   SEAKLLHEKIEHKAYA----DDEVIRILTTRSKAQLLATFNNYNDTFGHPITKDLKADPK  225

Query  752   -----LLKQTVQCLCMPQLYFSKILDASLRL-GVDEAARDSVTRVIVTRADEDMKHIKQE  913
                   L+  ++C   P  YF K+   ++   G DE   +S+TRVI TRA+ D+K IK+ 
Sbjct  226   DEFLKTLRAVIRCFTCPDRYFEKVARVAIAGNGTDE---NSLTRVITTRAEVDLKLIKEA  282

Query  914   FKTKYGVALSDRIGEVANGSYKELLLTLVAK  1006
             ++ +  V L   +    +G Y+ +LL L+ K
Sbjct  283   YQKRNSVPLEKAVAGDTSGDYESMLLALLGK  313



>gb|KHG14512.1| Annexin-like protein RJ4 [Gossypium arboreum]
Length=303

 Score =   169 bits (427),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 120/322 (37%), Positives = 187/322 (58%), Gaps = 35/322 (11%)
 Frame = +2

Query  71    KMAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDD  250
             +++V  D + L KA  G G DEKA +SVL   N   R+  R +    +++D    +R + 
Sbjct  9     QVSVLADAEALRKACKGWGTDEKAIISVLGHRNAVQRKQIRLAYEDLYQED--LIKRLES  66

Query  251   HHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLK-EPQFDLLIETACTRPSEELLG  427
                 +L  +F   + AV  +++ P +RDA L   A+ K  P   +++E +CTR  EELL 
Sbjct  67    ----ELSGDF---EKAVYRWILDPADRDAVLANVAIKKLSPDHHVIVEISCTRSPEELLA  119

Query  428   ARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIK  607
              RRAY + + HS+EED           LLV+LVS++RY+G +++  VA SEAK+L  A+K
Sbjct  120   VRRAYQARYKHSLEED-----------LLVSLVSAFRYDGEEINTRVANSEAKILHEAVK  168

Query  608   HAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHL------LLKQTV  769
                     + EEI+RILSTRSK+ L+A +  Y++  G  + ++L           L+ T+
Sbjct  169   DKE----FNHEEIIRILSTRSKMQLMATFNRYRDDHGTTITKNLEGDSGDEFLKTLRATI  224

Query  770   QCLCMPQLYFSKILDASLR-LGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSD  946
             +CL  P+ YF K+L  S+R +G DE   D++TRVIVTRA++D+K IK+ +  +  V+L  
Sbjct  225   RCLNDPKKYFEKVLRNSIRRVGTDE---DALTRVIVTRAEKDLKDIKELYYKRNSVSLDQ  281

Query  947   RIGEVANGSYKELLLTLVAKSE  1012
              + +  +G YK LLLTL+ K +
Sbjct  282   AVAKDTSGDYKALLLTLLGKED  303



>ref|XP_009349785.1| PREDICTED: annexin D1-like [Pyrus x bretschneideri]
Length=316

 Score =   169 bits (427),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 122/319 (38%), Positives = 180/319 (56%), Gaps = 28/319 (9%)
 Frame = +2

Query  77    AVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDE-RQFERWDDH  253
             A S+D + L KAF G G +E   +S+L   N   R++ RK+    + +D  ++ E+    
Sbjct  12    AASEDSEQLKKAFKGWGTNEDLVISILGHRNAAQRKAIRKTYADAYGEDLLKELEK----  67

Query  254   HVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGA  430
                +L  +F R+   V L+ +   ERDA L  EA  K  + + +L E AC+R + ELL A
Sbjct  68    ---ELTSDFERI---VWLWTLDXAERDAFLANEATKKWTKSNQVLAEIACSRSAHELLSA  121

Query  431   RRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKH  610
             R+AYHS +  S+EED+A H     RKLL  LVSSYRYEG +V+  +AKSEAK+L   I  
Sbjct  122   RQAYHSRYKKSLEEDVAHHTTGDFRKLLAPLVSSYRYEGDEVNLALAKSEAKLLHEKISD  181

Query  611   AGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAH------LLLKQTVQ  772
                    +D++I+RIL+TRSK  + A   HYK   G  +++DL A        +L+ T++
Sbjct  182   KA----YNDDDIIRILATRSKAQINATLNHYKNEFGNDINKDLKADPKDEYLAILRATIK  237

Query  773   CLCMPQLYFSKILDASLRLGVDEAARD--SVTRVIVTRADEDMKHIKQEFKTKYGVALSD  946
             CL  P+ YF K    SLRL +++   D  ++TRV+ TRA+ DM  IK  +  +  V L  
Sbjct  238   CLVRPEKYFEK----SLRLAINKRGTDEGALTRVVATRAEVDMMIIKDLYHKRNSVPLDQ  293

Query  947   RIGEVANGSYKELLLTLVA  1003
              I +   G Y+++LL LV 
Sbjct  294   AIKKDTTGDYEKMLLALVG  312



>ref|XP_010095951.1| Annexin-like protein [Morus notabilis]
 gb|EXB62644.1| Annexin-like protein [Morus notabilis]
Length=314

 Score =   169 bits (427),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 121/322 (38%), Positives = 176/322 (55%), Gaps = 26/322 (8%)
 Frame = +2

Query  74    MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDD-ERQFERWDD  250
             ++V +D + L KA  G G DEKA + VL   N   R+  R+S  Q F +D  ++ E    
Sbjct  10    LSVVEDAEALRKACQGWGTDEKAIIKVLGHRNASQRKQIRESYEQLFEEDLVKRLES---  66

Query  251   HHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLK-EPQFDLLIETACTRPSEELLG  427
                 +L  +F +   AV  +++ P +RDA L   AL K E  F  +IE +C    EELLG
Sbjct  67    ----ELSGDFEK---AVYRWVLEPEDRDAVLANVALRKSETDFKAIIELSCILSPEELLG  119

Query  428   ARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIK  607
              +RAY +   HS+EED+A       +K  ++   +YRY G +V+  +A SEA +L  AIK
Sbjct  120   VKRAYQNRNKHSLEEDVAARTTGDLQKACISYTFTYRYNGEEVNARLASSEADILHEAIK  179

Query  608   HAGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHA------HLLLKQTV  769
                  N    EE++RILSTRSK  L A + HY+++    + +DL           L  TV
Sbjct  180   DKAFNN----EEVIRILSTRSKAQLNATFNHYRDVNKTSITKDLLGESANDFQKALHTTV  235

Query  770   QCLCMPQLYFSKIL-DASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSD  946
             +C   P  Y++K+L D   R G DE   DSVTRVIVTRA++D+K IK+ +  K  ++L D
Sbjct  236   RCTNDPLKYYAKLLCDGIKRFGTDE---DSVTRVIVTRAEKDLKDIKEVYYKKNSISLDD  292

Query  947   RIGEVANGSYKELLLTLVAKSE  1012
              + +  +G YK  LL L+ K +
Sbjct  293   AVAKETSGDYKAFLLALLGKED  314



>sp|P51074.2|ANX4_FRAAN RecName: Full=Annexin-like protein RJ4 [Fragaria x ananassa]
 gb|AAF01250.1| annexin [Fragaria x ananassa]
Length=314

 Score =   169 bits (427),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 117/318 (37%), Positives = 180/318 (57%), Gaps = 26/318 (8%)
 Frame = +2

Query  86    DDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDE-RQFERWDDHHVL  262
             +D + L K+  G G +EKA +S+L   N   R+  R +  Q +++D  +  E        
Sbjct  14    EDAEALRKSVKGWGTNEKAIISILGHRNAGQRKEIRAAYEQLYQEDLLKPLES-------  66

Query  263   QLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQ-FDLLIETACTRPSEELLGARRA  439
             +L  +F   + AV  + + P +RDA L   A+ K    ++++IE +C    EELL  RRA
Sbjct  67    ELSGDF---EKAVYRWTLDPADRDAVLANVAIKKSTDVYNVIIEISCIHSPEELLAVRRA  123

Query  440   YHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGN  619
             Y   + HS+EED+A H     RKLLVALV++YRY+G +++  +A SEA +L +AIK    
Sbjct  124   YQLRYKHSVEEDLAAHTTGDIRKLLVALVTAYRYDGHEINAKLANSEADILHDAIKDKA-  182

Query  620   KNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDL------HAHLLLKQTVQCLC  781
                 + EEI+RILSTRSK  L+A +  Y++  G  + ++L           L   ++CL 
Sbjct  183   ---FNHEEIIRILSTRSKTQLMATFNKYRDDQGISISKNLLEEGANDFQKALHTAIRCLN  239

Query  782   MPQLYFSKIL-DASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGE  958
              P+ YF K+L +A  R+G DE   D++TRVIVTRA+ D++ IK+ +  K  V L   + +
Sbjct  240   DPKKYFEKVLRNAIKRVGTDE---DALTRVIVTRAERDLRDIKEVYYKKNSVPLEQAVAK  296

Query  959   VANGSYKELLLTLVAKSE  1012
               +G YK  LLTL+ K +
Sbjct  297   DTSGDYKAFLLTLLGKED  314



>ref|XP_011042167.1| PREDICTED: annexin-like protein RJ4 isoform X1 [Populus euphratica]
Length=313

 Score =   169 bits (427),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 113/321 (35%), Positives = 181/321 (56%), Gaps = 25/321 (8%)
 Frame = +2

Query  74    MAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDH  253
             ++  DD + L KA  G G +EKA +S+L   N   R+  R +  + F++D          
Sbjct  10    VSCVDDAQALQKACQGWGTNEKAIISILGHRNAAQRKQIRLAYSELFQED----------  59

Query  254   HVLQLRQEFLR-LKDAVVLYMMHPWERDARLFKEALLKEPQFDLLIETACTRPSEELLGA  430
              V +L  E     + AV  +++ P +RDA L   A+ K   + +++E AC   SEELL  
Sbjct  60    LVKRLESELTGDFEKAVYRWVLDPEDRDAVLANVAIRKSGDYHVIVEIACVLSSEELLAV  119

Query  431   RRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKH  610
             RRAYH+ + HS+EED+A       RKLLV LV+++RYEG +++  +A SEA +L +AIK 
Sbjct  120   RRAYHARYKHSLEEDLAARTTGDIRKLLVGLVTAFRYEGDEINTRLANSEADILHDAIKG  179

Query  611   AGNKNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDL------HAHLLLKQTVQ  772
                    + E+++RIL+TRSK  L+A +  Y++  G  + +DL          +L+  ++
Sbjct  180   KA----FNHEDVIRILTTRSKAQLMATFNRYRDDHGSSITKDLLEEPADEFKTVLRTAIR  235

Query  773   CLCMPQLYFSKIL-DASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDR  949
             CL   + Y+ KIL +A  ++G DE   D++TRVIVTRA++D+  IK+ +  +  V L   
Sbjct  236   CLNDHKKYYEKILRNAIKKVGTDE---DALTRVIVTRAEKDLNDIKEIYYKRNSVPLDQA  292

Query  950   IGEVANGSYKELLLTLVAKSE  1012
             + +  +G YK  LL L+ + E
Sbjct  293   VAKDTSGDYKAFLLALLGEEE  313



>ref|XP_002306311.2| annexin-like protein RJ4 [Populus trichocarpa]
 gb|EEE93307.2| annexin-like protein RJ4 [Populus trichocarpa]
Length=316

 Score =   169 bits (427),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 117/315 (37%), Positives = 178/315 (57%), Gaps = 26/315 (8%)
 Frame = +2

Query  86    DDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDE-RQFERWDDHHVL  262
             +D + L KAF G G +E   +S+LA  N   R   R+   + +  D  +  ++       
Sbjct  15    EDAEQLNKAFKGWGTNEGLIMSILAHRNAAQRNLIRQVYAEAYGQDLLKDLDK-------  67

Query  263   QLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGARRA  439
             +L  +F R+   V+L+ +   ERDA L  EA  +    + +L+E ACTR S +L  AR+A
Sbjct  68    ELSSDFERV---VLLWTLDLAERDAYLANEATKRFTSSNWVLMEIACTRSSHDLFKARQA  124

Query  440   YHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGN  619
             YH+ +  S+EED+A+H     RKLLV LVS++RYEG +V+  +AKSEAK+L   I     
Sbjct  125   YHARYKKSLEEDVAYHTTGDFRKLLVPLVSAFRYEGEEVNTMLAKSEAKILHEKISDKA-  183

Query  620   KNLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAHL------LLKQTVQCLC  781
                  D+EI+RIL+TRSK  L A   HY    G  ++++L          LL+ T++CL 
Sbjct  184   ---YSDDEIIRILTTRSKAQLNATLNHYNNAFGNAINKNLKEDADNEFLKLLRATIKCLT  240

Query  782   MPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGE  958
              P+ YF K+L  ++ ++G DE A   +TRV+ TRA+ DM+ IK+E+  +  V L   I  
Sbjct  241   YPEKYFEKLLRLAIKKIGTDEGA---LTRVVTTRAEVDMERIKEEYHRRNSVTLDHDIAG  297

Query  959   VANGSYKELLLTLVA  1003
              A+G Y+ +LL L+ 
Sbjct  298   EASGDYERMLLALIG  312



>ref|XP_007205592.1| hypothetical protein PRUPE_ppa008881mg [Prunus persica]
 gb|EMJ06791.1| hypothetical protein PRUPE_ppa008881mg [Prunus persica]
Length=316

 Score =   168 bits (426),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 120/314 (38%), Positives = 179/314 (57%), Gaps = 24/314 (8%)
 Frame = +2

Query  86    DDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVLQ  265
             +D + L KAF G G +E   +S+L   N   R+  +++  + +   E   +  D     +
Sbjct  15    EDAEQLRKAFEGWGTNEALIISILTHRNAAQRKLIQQAYAETY--GEELLKSLDK----E  68

Query  266   LRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGARRAY  442
             L  EF R   AV+L+ + P ERDA L  EA  +    + +L+E A TR S +LL  ++AY
Sbjct  69    LSSEFER---AVLLWTLVPAERDAFLANEATKRFTSSNKVLLEIATTRSSHDLLLVKQAY  125

Query  443   HSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGNK  622
             H+ F  S+EED+A+H     RKLLV L+S+YRYEG ++   +AK EAK+L   I      
Sbjct  126   HARFKKSLEEDVAYHTSGDLRKLLVPLLSTYRYEGDEISVPLAKKEAKILHEKISDKA--  183

Query  623   NLVDDEEIVRILSTRSklhllalykhykEITGKFLDEDLHAH------LLLKQTVQCLCM  784
                +DEE++RILSTRSK  L A   HY    G  +++DL A       LLL+QT++ L +
Sbjct  184   --YNDEELIRILSTRSKAQLNATLNHYNNEFGNAINKDLKADKDDEFLLLLRQTIKSLTV  241

Query  785   PQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEV  961
             P+ YF K+L  ++ +LG DE A   +TRV+ TRA+ D+  IKQE+  +  V L   I + 
Sbjct  242   PEKYFEKVLRLAINKLGTDEGA---LTRVVTTRAEVDLHRIKQEYHRRNSVPLDQAIVKD  298

Query  962   ANGSYKELLLTLVA  1003
              +G Y++ L+ LV 
Sbjct  299   TSGDYEKFLVELVG  312



>ref|XP_008450361.1| PREDICTED: annexin D8 [Cucumis melo]
Length=300

 Score =   168 bits (425),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 113/309 (37%), Positives = 172/309 (56%), Gaps = 31/309 (10%)
 Frame = +2

Query  113   FSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVLQLRQEFLR-L  289
             F GLG DE A +S+L   N   R+  R +  + + +D  Q          QL  E     
Sbjct  2     FEGLGTDENAIISILGHRNANQRKLIRLAYEEIYNEDLIQ----------QLNSELCGDF  51

Query  290   KDAVVLYMMHPWERDARLFKEAL-LKEPQFDLLIETACTRPSEELLGARRAYHSLFDHSI  466
             + A+  + + P +RDA L   AL    P + ++IE AC R +E+LL  +RAY   F HS+
Sbjct  52    ERAISHWTLDPADRDAILANNALKASTPDYRVIIEIACVRSAEDLLAVKRAYRFRFKHSL  111

Query  467   EEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAGNKNLVDDEEI  646
             EED+A       RKLLV +VS+YR EG ++ E++A+ EA ++ + IK  G KN   +EEI
Sbjct  112   EEDVASCTTKDMRKLLVGVVSAYRCEGNEIDENMAELEANIIDDEIKGKGCKN---NEEI  168

Query  647   VRILSTRSklhllalykhykEITGKFL---------DEDLHAHLLLKQTVQCLCMPQLYF  799
             +RI+STRSK  L A +  Y++I G  +         DE L A   LK  ++C+  P+ Y+
Sbjct  169   IRIVSTRSKPQLNATFNRYRDIHGTSITKGLIGDSSDEYLAA---LKTVIRCIRDPKKYY  225

Query  800   SKIL-DASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIGEVANGSY  976
             +K+L +A   +GVD   RD ++RVIVTRA++D+K I + +  +  ++L + +     G Y
Sbjct  226   AKVLRNAMNTIGVD---RDGISRVIVTRAEKDLKEIMEMYLKRNNISLEEAVSREIGGDY  282

Query  977   KELLLTLVA  1003
             K  LL L+ 
Sbjct  283   KAFLLALLG  291



>ref|XP_010273218.1| PREDICTED: annexin-like protein RJ4 [Nelumbo nucifera]
Length=315

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 120/319 (38%), Positives = 178/319 (56%), Gaps = 30/319 (9%)
 Frame = +2

Query  89    DHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDERQFERWDDHHVLQL  268
             D + L KA  G G DEKA + +L   N   R   RK+  + ++  E   +R +     +L
Sbjct  15    DAESLRKACQGWGTDEKAIIQILGHRNAVQRNQIRKAYEELYQ--ENLIKRLES----EL  68

Query  269   RQEFLRLKDAVVLYMMHPWERDARL----FKEALLKEPQFDLLIETACTRPSEELLGARR  436
               +F   + AV  +++ P ERDA L     K+++L    +  +IE AC R SEELL  +R
Sbjct  69    SGDF---EKAVYRWLLDPAERDAVLAHVAVKDSML---DYQTIIEIACVRSSEELLAVKR  122

Query  437   AYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKHAG  616
             AYH  + HS++ED+A H     RKLLVALVS++RY+G +++  +A+SEAK+L   IK   
Sbjct  123   AYHLRYKHSLDEDVASHTTGDFRKLLVALVSTFRYDGDEINVSLAESEAKLLHEVIKGKA  182

Query  617   NKNLVDDEEIVRILSTRSklhllalykhykE-----ITGKFLDEDLHAHL-LLKQTVQCL  778
                    EEI+RILSTRSK  L A +  Y++     IT   LD+     L  L+  ++C+
Sbjct  183   ----FSHEEIIRILSTRSKSQLNATFNCYRDAHGTSITKSLLDDPADEFLAALRMAIRCI  238

Query  779   CMPQLYFSKILDASLRLG-VDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIG  955
               PQ YF K+L  ++  G  DE   D++TRVIVTRA++D+  IK+ +  +   +L   I 
Sbjct  239   TFPQKYFEKVLRNAVNKGRTDE---DALTRVIVTRAEKDLNDIKELYHKRNNASLEHAIN  295

Query  956   EVANGSYKELLLTLVAKSE  1012
             +  +G YK  LL L+   E
Sbjct  296   KHTSGDYKAFLLALLGDKE  314



>ref|XP_009622947.1| PREDICTED: annexin D1-like [Nicotiana tomentosiformis]
Length=314

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 123/319 (39%), Positives = 182/319 (57%), Gaps = 24/319 (8%)
 Frame = +2

Query  77    AVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDDE-RQFERWDDH  253
             +V++D + L  AF G G +EK  +S+LA  N   R+  +++    F +D  ++ +R    
Sbjct  12    SVAEDCEQLRSAFKGWGTNEKLIISILAHRNAAQRKLIQQTYADTFGEDLLKELDR----  67

Query  254   HVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQFD-LLIETACTRPSEELLGA  430
                +L  +F +L   VV++ + P ERDA L KEA  +  + + +L+E ACTR  +EL+ A
Sbjct  68    ---ELTNDFEKL---VVVWTLDPSERDAYLAKEATKRWTKSNFVLVEIACTRSPKELVLA  121

Query  431   RRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSEAKVLANAIKH  610
             R AYH+ F  S+EED+A+H     RKLLV LVSSYRY G +V   +AK+EAK+L   I  
Sbjct  122   REAYHARFKKSLEEDVAYHTTGEHRKLLVPLVSSYRYGGDEVDLRLAKAEAKILHQKI--  179

Query  611   AGNKNLVDDEEIVRILSTRSklhllalyk----hykEITGKFLDEDLHAHLLLKQTVQCL  778
               +     D+E++RIL+TRSK  + A        Y+E   K L+E      LL+ T++ L
Sbjct  180   --SDKAYSDDEVIRILATRSKAQINATLNHYKDEYEEDILKQLEEGDEFVGLLRATIKGL  237

Query  779   CMPQLYFSKIL-DASLRLGVDEAARDSVTRVIVTRADEDMKHIKQEFKTKYGVALSDRIG  955
               P+ YF  +L DA  R G DE   D +TRVI TRA+ DMK I  E++ +  V L   I 
Sbjct  238   VYPEHYFVDVLRDAINRRGTDE---DHLTRVIATRAEVDMKIIADEYQKRDSVPLGRAIA  294

Query  956   EVANGSYKELLLTLVAKSE  1012
             +   G Y+ +LL L+ + E
Sbjct  295   KDTRGDYESMLLALLGQEE  313



>ref|XP_004511012.1| PREDICTED: annexin-like protein RJ4-like isoform X3 [Cicer arietinum]
Length=311

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 121/332 (36%), Positives = 189/332 (57%), Gaps = 33/332 (10%)
 Frame = +2

Query  44    PTLNSANSSKMAVSDDHKILTKAFSGLGVDEKAFVSVLAKWNPKHRQSYRKSTHQFFRDD  223
              TL +  SS +   +D + L KAF G G DEK+ + +L   N   RQ  RKS  + +++D
Sbjct  2     ATLVTKKSSPI---EDSEALQKAFKGWGTDEKSVIEILGHRNVYQRQQIRKSYQEIYQED  58

Query  224   ERQFERWDDHHVLQLRQEFLRLKDAVVLYMMHPWERDARLFKEALLKEPQ-FDLLIETAC  400
                 +R +     +L  +F R   AV  +M+ P +RDA L   A+    + +++++E  C
Sbjct  59    --ILKRLES----ELSGDFER---AVYRWMLEPADRDAVLVNVAIKDGNKGYNVIVEIVC  109

Query  401   TRPSEELLGARRAYHSLFDHSIEEDIAFHIQTPERKLLVALVSSYRYEGPKVHEDVAKSE  580
                 EE+L  RRAY + + HS+EED+A H     R+LLV LV S+RY G +++  +AK+E
Sbjct  110   VLSPEEVLAMRRAYQNRYKHSLEEDVAAHTTGHLRQLLVGLVGSFRYGGDEINPRLAKTE  169

Query  581   AKVLANAIKH-AGNKNLVDDEEIVRILSTRSklhllalykhykE-----ITGKFLD---E  733
             A +L  +IK   GN      EE +RI++TRSK  LLA    Y++     IT K LD   +
Sbjct  170   ADILHESIKEKKGNY-----EEAIRIITTRSKTQLLATLNRYRDDHGTSITKKLLDNASD  224

Query  734   DLHAHLLLKQTVQCLCMPQLYFSKILDASL-RLGVDEAARDSVTRVIVTRADEDMKHIKQ  910
             D H    L   ++C+   + Y+ K++ ++L R+G DE   D +TRV+VTRA++D+K IK+
Sbjct  225   DFHK--ALHTAIRCINDHKKYYEKVMRSALKRVGTDE---DGLTRVVVTRAEKDLKDIKE  279

Query  911   EFKTKYGVALSDRIGEVANGSYKELLLTLVAK  1006
              +  +  V L D + +  +G YK+ LLTL+ K
Sbjct  280   LYYKRNSVHLEDEVAKEISGDYKKFLLTLLGK  311



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2941102238830