BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7482_g1_i2 len=1473 path=[1451:0-453 1905:454-1472]

Length=1473
                                                                      Score     E

ref|XP_006343754.1|  PREDICTED: WAT1-related protein At2g39510-like     348   3e-112   
ref|XP_009601954.1|  PREDICTED: WAT1-related protein At2g39510-li...    344   2e-110   
ref|XP_004240770.1|  PREDICTED: WAT1-related protein At2g39510          343   2e-110   
ref|XP_009798285.1|  PREDICTED: WAT1-related protein At2g39510-like     343   3e-110   
ref|XP_009601955.1|  PREDICTED: WAT1-related protein At2g39510-li...    337   4e-108   
ref|XP_011072605.1|  PREDICTED: WAT1-related protein At2g39510-li...    324   9e-103   
ref|XP_010253282.1|  PREDICTED: WAT1-related protein At2g39510-like     322   1e-101   
emb|CDP05672.1|  unnamed protein product                                321   2e-101   
ref|XP_010534481.1|  PREDICTED: WAT1-related protein At2g39510-like     320   3e-101   
ref|XP_011080962.1|  PREDICTED: WAT1-related protein At2g39510-like     319   9e-101   
ref|XP_009625314.1|  PREDICTED: WAT1-related protein At2g39510-like     319   1e-100   
ref|XP_011072598.1|  PREDICTED: WAT1-related protein At2g39510-li...    318   2e-100   
ref|XP_009798400.1|  PREDICTED: WAT1-related protein At2g39510          318   3e-100   
gb|EYU38348.1|  hypothetical protein MIMGU_mgv1a009263mg                315   2e-99    
ref|XP_010669871.1|  PREDICTED: WAT1-related protein At2g39510          315   2e-99    
ref|XP_009143306.1|  PREDICTED: WAT1-related protein At2g39510-like     313   2e-98    
ref|XP_007162672.1|  hypothetical protein PHAVU_001G170400g             312   5e-98    
ref|XP_008447554.1|  PREDICTED: WAT1-related protein At2g37460-like     312   6e-98    
ref|XP_009614496.1|  PREDICTED: WAT1-related protein At2g37460-li...    311   9e-98    
emb|CDY20446.1|  BnaC04g05980D                                          311   1e-97    
emb|CDY53594.1|  BnaA05g34670D                                          311   1e-97    
gb|KDO67719.1|  hypothetical protein CISIN_1g042257mg                   311   2e-97    
ref|XP_006436052.1|  hypothetical protein CICLE_v10031808mg             310   3e-97    
ref|XP_009778852.1|  PREDICTED: WAT1-related protein At2g37460-li...    310   4e-97    
ref|XP_002528467.1|  Auxin-induced protein 5NG4, putative               310   6e-97    Ricinus communis
gb|KHN02414.1|  Auxin-induced protein 5NG4-like protein                 309   8e-97    
ref|XP_007009428.1|  Nodulin MtN21 /EamA-like transporter family ...    308   1e-96    
ref|XP_003553527.1|  PREDICTED: WAT1-related protein At2g37460-like     308   1e-96    
ref|XP_010067380.1|  PREDICTED: WAT1-related protein At2g39510-like     308   1e-96    
ref|XP_010509005.1|  PREDICTED: WAT1-related protein At2g39510-like     308   2e-96    
ref|XP_010505629.1|  PREDICTED: WAT1-related protein At2g39510-like     308   2e-96    
ref|XP_002315243.2|  hypothetical protein POPTR_0010s21630g             308   2e-96    Populus trichocarpa [western balsam poplar]
ref|XP_004142085.1|  PREDICTED: auxin-induced protein 5NG4-like         308   2e-96    
gb|KHG26265.1|  Auxin-induced 5NG4                                      307   4e-96    
ref|XP_010517305.1|  PREDICTED: WAT1-related protein At2g39510          307   4e-96    
ref|XP_002284091.1|  PREDICTED: WAT1-related protein At2g39510          307   5e-96    Vitis vinifera
ref|XP_006296517.1|  hypothetical protein CARUB_v10025706mg             307   5e-96    
ref|XP_010260186.1|  PREDICTED: WAT1-related protein At2g39510-like     306   1e-95    
emb|CDP00045.1|  unnamed protein product                                306   1e-95    
ref|XP_004246473.1|  PREDICTED: WAT1-related protein At2g37460-like     306   1e-95    
ref|XP_008369847.1|  PREDICTED: WAT1-related protein At2g37460-like     305   2e-95    
ref|XP_010037869.1|  PREDICTED: WAT1-related protein At2g37460-like     306   2e-95    
ref|XP_006411179.1|  hypothetical protein EUTSA_v10016823mg             305   2e-95    
ref|XP_003521346.1|  PREDICTED: WAT1-related protein At2g37460-like     305   3e-95    
gb|KCW49646.1|  hypothetical protein EUGRSUZ_K03164                     307   4e-95    
ref|XP_008461645.1|  PREDICTED: WAT1-related protein At2g39510-like     305   4e-95    
ref|XP_009141815.1|  PREDICTED: WAT1-related protein At2g39510          304   5e-95    
ref|XP_009377106.1|  PREDICTED: WAT1-related protein At2g37460-like     304   5e-95    
ref|XP_004493898.1|  PREDICTED: WAT1-related protein At2g37460-li...    303   1e-94    
ref|XP_004167778.1|  PREDICTED: auxin-induced protein 5NG4-like         303   1e-94    
gb|KCW65509.1|  hypothetical protein EUGRSUZ_G02914                     303   2e-94    
ref|XP_006436050.1|  hypothetical protein CICLE_v10031857mg             302   3e-94    
ref|XP_006341065.1|  PREDICTED: WAT1-related protein At2g37460-like     302   3e-94    
gb|KFK36842.1|  hypothetical protein AALP_AA4G179000                    302   4e-94    
ref|XP_007009429.1|  Nodulin MtN21 /EamA-like transporter family ...    303   6e-94    
gb|KHN09434.1|  Auxin-induced protein 5NG4                              301   7e-94    
ref|XP_003625520.1|  Auxin-induced protein 5NG4                         301   7e-94    
gb|AFK37217.1|  unknown                                                 301   7e-94    
ref|XP_011027136.1|  PREDICTED: WAT1-related protein At2g39510-like     301   8e-94    
ref|XP_004161682.1|  PREDICTED: auxin-induced protein 5NG4-like         300   1e-93    
ref|XP_004147717.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-induce...    300   2e-93    
ref|XP_010039216.1|  PREDICTED: WAT1-related protein At2g37460-like     301   2e-93    
ref|XP_010684183.1|  PREDICTED: WAT1-related protein At2g37460-like     300   2e-93    
ref|XP_007027104.1|  Nodulin MtN21 /EamA-like transporter family ...    300   3e-93    
emb|CDY07016.1|  BnaA04g22990D                                          300   4e-93    
ref|XP_002274909.2|  PREDICTED: WAT1-related protein At2g37460-like     300   7e-93    Vitis vinifera
ref|NP_181483.1|  nodulin MtN21-like transporter family protein         298   1e-92    Arabidopsis thaliana [mouse-ear cress]
gb|KHG24903.1|  Auxin-induced 5NG4                                      298   1e-92    
gb|KCW49650.1|  hypothetical protein EUGRSUZ_K03168                     301   1e-92    
ref|XP_002881660.1|  nodulin MtN21 family protein                       298   1e-92    
emb|CDX93255.1|  BnaC04g46410D                                          298   2e-92    
gb|EYU28266.1|  hypothetical protein MIMGU_mgv1a008729mg                297   2e-92    
ref|XP_004236759.1|  PREDICTED: WAT1-related protein At2g39510          297   4e-92    
ref|XP_006365719.1|  PREDICTED: WAT1-related protein At2g39510-like     296   5e-92    
ref|XP_011019904.1|  PREDICTED: WAT1-related protein At2g37460-li...    296   5e-92    
ref|XP_010039215.1|  PREDICTED: WAT1-related protein At2g37460-like     297   6e-92    
ref|XP_008241503.1|  PREDICTED: WAT1-related protein At2g37460-like     296   7e-92    
ref|XP_007009430.1|  Nodulin MtN21 /EamA-like transporter family ...    296   9e-92    
ref|XP_002312071.1|  nodulin MtN21 family protein                       296   1e-91    Populus trichocarpa [western balsam poplar]
ref|XP_010554592.1|  PREDICTED: WAT1-related protein At2g39510-like     295   1e-91    
ref|XP_011094815.1|  PREDICTED: WAT1-related protein At2g37460-like     295   2e-91    
ref|XP_007205382.1|  hypothetical protein PRUPE_ppa007333mg             295   2e-91    
ref|XP_004307548.1|  PREDICTED: auxin-induced protein 5NG4-like         294   2e-91    
ref|XP_010554433.1|  PREDICTED: WAT1-related protein At2g39510-like     294   3e-91    
ref|XP_011019905.1|  PREDICTED: WAT1-related protein At2g37460-li...    292   5e-91    
ref|XP_004302750.1|  PREDICTED: auxin-induced protein 5NG4-like         293   5e-91    
emb|CBI32681.3|  unnamed protein product                                293   8e-91    
ref|XP_011077436.1|  PREDICTED: WAT1-related protein At2g37460-like     293   1e-90    
ref|XP_011023754.1|  PREDICTED: LOW QUALITY PROTEIN: WAT1-related...    292   2e-90    
gb|KCW49647.1|  hypothetical protein EUGRSUZ_K03165                     296   2e-90    
gb|AFK37263.1|  unknown                                                 293   2e-90    
ref|XP_002308146.2|  hypothetical protein POPTR_0006s08270g             293   3e-90    Populus trichocarpa [western balsam poplar]
ref|XP_006294412.1|  hypothetical protein CARUB_v10023430mg             292   4e-90    
ref|XP_003590513.1|  Auxin-induced protein 5NG4                         291   4e-90    
gb|EYU28757.1|  hypothetical protein MIMGU_mgv1a023410mg                289   5e-90    
gb|KDP35589.1|  hypothetical protein JCGZ_09027                         291   7e-90    
ref|XP_008371417.1|  PREDICTED: WAT1-related protein At2g39510-like     290   8e-90    
ref|XP_009614497.1|  PREDICTED: WAT1-related protein At2g37460-li...    289   2e-89    
ref|XP_006429015.1|  hypothetical protein CICLE_v10012001mg             289   4e-89    
gb|KDO67718.1|  hypothetical protein CISIN_1g043160mg                   287   5e-89    
gb|KHG03072.1|  Auxin-induced 5NG4                                      289   8e-89    
ref|XP_008370940.1|  PREDICTED: WAT1-related protein At2g39510-like     287   8e-89    
ref|XP_009778858.1|  PREDICTED: WAT1-related protein At2g37460-li...    288   9e-89    
ref|XP_008233581.1|  PREDICTED: WAT1-related protein At2g39510-li...    287   9e-89    
ref|XP_004141853.1|  PREDICTED: auxin-induced protein 5NG4-like         288   1e-88    
ref|XP_010529854.1|  PREDICTED: WAT1-related protein At2g37460-like     288   1e-88    
ref|XP_009347454.1|  PREDICTED: WAT1-related protein At2g39510-like     287   1e-88    
ref|XP_009347451.1|  PREDICTED: WAT1-related protein At2g39510-like     286   2e-88    
ref|XP_004142736.1|  PREDICTED: auxin-induced protein 5NG4-like         287   2e-88    
ref|XP_006436051.1|  hypothetical protein CICLE_v10033577mg             286   2e-88    
gb|KHG11891.1|  Auxin-induced 5NG4                                      287   4e-88    
ref|XP_008463583.1|  PREDICTED: WAT1-related protein At2g39510-like     288   6e-88    
ref|XP_007009431.1|  Nodulin MtN21 /EamA-like transporter family ...    285   7e-88    
ref|XP_004166081.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-induce...    286   8e-88    
ref|XP_004494995.1|  PREDICTED: WAT1-related protein At2g37460-li...    283   9e-88    
ref|XP_008371332.1|  PREDICTED: WAT1-related protein At2g39510-like     284   1e-87    
ref|XP_006486497.1|  PREDICTED: WAT1-related protein At2g39510-like     284   1e-87    
gb|KCW65508.1|  hypothetical protein EUGRSUZ_G02912                     285   1e-87    
emb|CDY18444.1|  BnaA04g21430D                                          285   2e-87    
ref|XP_010517017.1|  PREDICTED: WAT1-related protein At2g37460          285   2e-87    
ref|XP_007218251.1|  hypothetical protein PRUPE_ppa008064mg             283   4e-87    
emb|CDY07788.1|  BnaA03g17230D                                          283   5e-87    
ref|XP_006410933.1|  hypothetical protein EUTSA_v10016799mg             283   7e-87    
ref|XP_010505334.1|  PREDICTED: WAT1-related protein At2g37460-like     283   9e-87    
ref|XP_009133180.1|  PREDICTED: WAT1-related protein At2g37460-like     282   9e-87    
gb|KDP29854.1|  hypothetical protein JCGZ_18429                         282   1e-86    
ref|XP_008461650.1|  PREDICTED: WAT1-related protein At2g39510-li...    283   1e-86    
ref|NP_181282.1|  nodulin MtN21-like transporter family protein         283   1e-86    Arabidopsis thaliana [mouse-ear cress]
emb|CDX79734.1|  BnaC03g20700D                                          281   2e-86    
ref|XP_006289509.1|  hypothetical protein CARUB_v10003044mg             282   2e-86    
ref|XP_009357771.1|  PREDICTED: WAT1-related protein At2g39510-like     280   2e-86    
emb|CDY65991.1|  BnaA10g29860D                                          282   3e-86    
ref|XP_010509331.1|  PREDICTED: WAT1-related protein At2g37460-like     281   4e-86    
gb|KFK36632.1|  hypothetical protein AALP_AA4G149800                    281   5e-86    
ref|XP_004493899.1|  PREDICTED: WAT1-related protein At2g37460-li...    280   6e-86    
ref|XP_010419959.1|  PREDICTED: WAT1-related protein At5g13670-like     280   1e-85    
ref|XP_010274315.1|  PREDICTED: WAT1-related protein At1g21890          280   1e-85    
ref|XP_010492134.1|  PREDICTED: WAT1-related protein At5g13670 is...    280   2e-85    
ref|XP_010492135.1|  PREDICTED: WAT1-related protein At5g13670 is...    280   2e-85    
emb|CDX93378.1|  BnaC04g45180D                                          279   2e-85    
ref|XP_006397315.1|  hypothetical protein EUTSA_v10028726mg             279   3e-85    
emb|CDX85633.1|  BnaA02g01800D                                          279   3e-85    
ref|XP_009121742.1|  PREDICTED: WAT1-related protein At5g13670          279   8e-85    
gb|AAM62850.1|  nodulin-like protein                                    277   8e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003537193.1|  PREDICTED: WAT1-related protein At2g37460-li...    278   8e-85    
ref|XP_010419331.1|  PREDICTED: LOW QUALITY PROTEIN: WAT1-related...    278   9e-85    
ref|XP_009141663.1|  PREDICTED: WAT1-related protein At2g37460          277   1e-84    
gb|KHN05928.1|  Auxin-induced protein 5NG4                              278   1e-84    
emb|CDY09817.1|  BnaC09g43440D                                          276   1e-84    
ref|XP_006399861.1|  hypothetical protein EUTSA_v10013837mg             277   1e-84    
ref|XP_002873622.1|  nodulin MtN21 family protein                       277   2e-84    
ref|XP_009125930.1|  PREDICTED: WAT1-related protein At5g13670-like     277   2e-84    
emb|CDX91104.1|  BnaC02g04930D                                          276   3e-84    
gb|KGN51272.1|  hypothetical protein Csa_5G505820                       275   7e-84    
ref|XP_010999362.1|  PREDICTED: WAT1-related protein At4g08290 is...    274   1e-83    
ref|XP_004149823.1|  PREDICTED: auxin-induced protein 5NG4-like         275   1e-83    
ref|XP_002284452.2|  PREDICTED: WAT1-related protein At4g08290          275   1e-83    Vitis vinifera
ref|XP_010939363.1|  PREDICTED: WAT1-related protein At1g21890 is...    275   1e-83    
ref|XP_010553301.1|  PREDICTED: WAT1-related protein At2g37460-like     275   1e-83    
ref|XP_008461649.1|  PREDICTED: WAT1-related protein At2g39510-li...    275   2e-83    
ref|XP_007144467.1|  hypothetical protein PHAVU_007G158600g             274   2e-83    
ref|XP_002306625.2|  hypothetical protein POPTR_0005s15820g             274   2e-83    Populus trichocarpa [western balsam poplar]
ref|XP_010453454.1|  PREDICTED: WAT1-related protein At5g13670-like     275   2e-83    
ref|NP_196871.1|  nodulin MtN21-like transporter UMAMIT 15              274   2e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009337582.1|  PREDICTED: WAT1-related protein At2g39510          273   3e-83    
ref|XP_010096638.1|  Auxin-induced protein 5NG4                         273   3e-83    
emb|CDX75163.1|  BnaC09g25190D                                          274   3e-83    
ref|XP_008463490.1|  PREDICTED: WAT1-related protein At2g39510-li...    273   8e-83    
emb|CDY29141.1|  BnaA09g53940D                                          273   8e-83    
ref|XP_002312070.1|  hypothetical protein POPTR_0008s05130g             272   9e-83    Populus trichocarpa [western balsam poplar]
ref|XP_009151422.1|  PREDICTED: WAT1-related protein At4g08290          272   2e-82    
ref|XP_006294396.1|  hypothetical protein CARUB_v10023413mg             272   2e-82    
ref|XP_011023643.1|  PREDICTED: WAT1-related protein At5g13670-like     270   8e-82    
gb|KDO40045.1|  hypothetical protein CISIN_1g019311mg                   268   1e-81    
ref|XP_010999363.1|  PREDICTED: WAT1-related protein At4g08290 is...    268   1e-81    
ref|XP_010097389.1|  Auxin-induced protein 5NG4                         269   2e-81    
ref|XP_010534299.1|  PREDICTED: WAT1-related protein At2g39510-like     270   2e-81    
emb|CDP06652.1|  unnamed protein product                                268   2e-81    
ref|XP_008233582.1|  PREDICTED: WAT1-related protein At2g39510-li...    267   2e-81    
ref|XP_002284458.1|  PREDICTED: WAT1-related protein At4g08290 is...    269   3e-81    Vitis vinifera
ref|XP_009143490.1|  PREDICTED: WAT1-related protein At2g37460-like     269   3e-81    
ref|XP_010438422.1|  PREDICTED: WAT1-related protein At4g08290-like     269   3e-81    
ref|XP_004167845.1|  PREDICTED: auxin-induced protein 5NG4-like         268   3e-81    
ref|XP_006289117.1|  hypothetical protein CARUB_v10002538mg             268   5e-81    
ref|XP_002872388.1|  hypothetical protein ARALYDRAFT_489740             268   5e-81    
ref|XP_006655900.1|  PREDICTED: WAT1-related protein At1g21890-like     268   6e-81    
ref|XP_003542469.1|  PREDICTED: WAT1-related protein At2g37460-like     267   9e-81    
ref|XP_010421738.1|  PREDICTED: WAT1-related protein At4g08290          268   1e-80    
ref|XP_010455250.1|  PREDICTED: WAT1-related protein At4g08290-like     267   2e-80    
ref|XP_008461651.1|  PREDICTED: WAT1-related protein At2g39510-li...    266   2e-80    
ref|NP_192569.1|  nodulin MtN21 /EamA-like transporter family pro...    266   2e-80    Arabidopsis thaliana [mouse-ear cress]
gb|KFK32145.1|  hypothetical protein AALP_AA6G204100                    266   3e-80    
ref|XP_004494994.1|  PREDICTED: WAT1-related protein At2g37460-li...    264   4e-80    
ref|XP_003570554.1|  PREDICTED: WAT1-related protein At1g44800-like     266   4e-80    
ref|XP_004983289.1|  PREDICTED: WAT1-related protein At4g08290-like     265   5e-80    
gb|KHN48995.1|  Auxin-induced protein 5NG4                              265   6e-80    
gb|EEC66707.1|  hypothetical protein OsI_33030                          265   6e-80    Oryza sativa Indica Group [Indian rice]
gb|EMS60728.1|  Auxin-induced protein 5NG4                              266   6e-80    
emb|CBI19038.3|  unnamed protein product                                268   7e-80    
gb|AAM65570.1|  nodulin-like protein                                    265   1e-79    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007220060.1|  hypothetical protein PRUPE_ppa025780mg             264   1e-79    
ref|XP_006661686.1|  PREDICTED: WAT1-related protein At4g08290-like     264   2e-79    
gb|ABB47055.1|  nodulin MtN21 family protein, putative, expressed       261   2e-79    Oryza sativa Japonica Group [Japonica rice]
gb|ABR16695.1|  unknown                                                 265   3e-79    Picea sitchensis
ref|NP_001064323.1|  Os10g0210500                                       263   3e-79    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010664225.1|  PREDICTED: WAT1-related protein At4g08290 is...    262   4e-79    
ref|XP_010272782.1|  PREDICTED: WAT1-related protein At1g21890-like     263   5e-79    
dbj|BAC43205.1|  putative nodulin                                       263   6e-79    Arabidopsis thaliana [mouse-ear cress]
gb|ABK25095.1|  unknown                                                 263   1e-78    Picea sitchensis
ref|XP_002454615.1|  hypothetical protein SORBIDRAFT_04g034330          261   2e-78    Sorghum bicolor [broomcorn]
ref|XP_010558786.1|  PREDICTED: WAT1-related protein At5g13670          261   3e-78    
ref|XP_009409675.1|  PREDICTED: WAT1-related protein At1g21890-like     260   4e-78    
gb|EYU41683.1|  hypothetical protein MIMGU_mgv1a009185mg                259   4e-78    
emb|CDY18443.1|  BnaA04g21440D                                          260   4e-78    
ref|XP_009141664.1|  PREDICTED: WAT1-related protein At2g37460-li...    260   5e-78    
ref|XP_008233580.1|  PREDICTED: WAT1-related protein At2g39510-like     260   7e-78    
emb|CDX93377.1|  BnaC04g45190D                                          259   1e-77    
ref|XP_008785769.1|  PREDICTED: WAT1-related protein At1g21890-like     267   1e-77    
gb|EMS48876.1|  Auxin-induced protein 5NG4                              259   2e-77    
gb|EMT04611.1|  Auxin-induced protein 5NG4                              259   2e-77    
ref|XP_006399183.1|  hypothetical protein EUTSA_v10015938mg             259   3e-77    
gb|AFK35983.1|  unknown                                                 258   3e-77    
ref|XP_010063373.1|  PREDICTED: WAT1-related protein At4g08300-like     258   3e-77    
ref|NP_001137108.1|  hypothetical protein                               258   3e-77    Zea mays [maize]
dbj|BAK04730.1|  predicted protein                                      258   4e-77    
ref|XP_010664224.1|  PREDICTED: WAT1-related protein At1g21890          258   8e-77    
ref|XP_006349970.1|  PREDICTED: WAT1-related protein At2g37460-like     258   2e-76    
dbj|BAJ98418.1|  predicted protein                                      256   3e-76    
ref|XP_010063981.1|  PREDICTED: WAT1-related protein At4g08290-like     255   4e-76    
gb|EMS46274.1|  Auxin-induced protein 5NG4                              256   4e-76    
ref|XP_010096633.1|  Auxin-induced protein 5NG4                         255   5e-76    
ref|XP_010544709.1|  PREDICTED: WAT1-related protein At4g08290 is...    255   5e-76    
ref|XP_010063982.1|  PREDICTED: WAT1-related protein At4g08290-like     254   6e-76    
ref|XP_009340891.1|  PREDICTED: WAT1-related protein At4g08290-like     255   6e-76    
ref|XP_008646318.1|  PREDICTED: WAT1-related protein At1g44800-like     255   8e-76    
dbj|BAK04850.1|  predicted protein                                      255   8e-76    
ref|XP_002873292.1|  hypothetical protein ARALYDRAFT_487525             255   1e-75    
gb|ABR18253.1|  unknown                                                 256   1e-75    Picea sitchensis
gb|EAZ36228.1|  hypothetical protein OsJ_20548                          254   1e-75    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ00107.1|  hypothetical protein OsI_22111                          254   2e-75    Oryza sativa Indica Group [Indian rice]
dbj|BAD35697.1|  putative MtN21                                         254   2e-75    Oryza sativa Japonica Group [Japonica rice]
gb|KHG18008.1|  Auxin-induced 5NG4                                      254   2e-75    
gb|KFK25097.1|  hypothetical protein AALP_AA8G066000                    254   2e-75    
ref|XP_004253170.1|  PREDICTED: WAT1-related protein At2g37460-like     254   2e-75    
gb|KHG29314.1|  Auxin-induced 5NG4                                      250   3e-75    
emb|CDX70003.1|  BnaA10g23520D                                          254   3e-75    
ref|XP_006482028.1|  PREDICTED: WAT1-related protein At5g07050-like     253   5e-75    
ref|XP_008391905.1|  PREDICTED: LOW QUALITY PROTEIN: WAT1-related...    252   6e-75    
ref|XP_002489200.1|  hypothetical protein SORBIDRAFT_0012s002110        252   7e-75    Sorghum bicolor [broomcorn]
gb|KHG29659.1|  Auxin-induced 5NG4                                      252   7e-75    
ref|XP_004249118.1|  PREDICTED: WAT1-related protein At5g07050          252   8e-75    
ref|NP_001148990.1|  nodulin protein                                    252   8e-75    Zea mays [maize]
ref|XP_004294697.1|  PREDICTED: auxin-induced protein 5NG4-like         252   8e-75    
ref|XP_004290852.1|  PREDICTED: auxin-induced protein 5NG4-like         251   8e-75    
ref|XP_007019025.1|  Nodulin MtN21 /EamA-like transporter family ...    251   1e-74    
ref|XP_003601062.1|  Auxin-induced protein 5NG4                         252   1e-74    
emb|CDP06236.1|  unnamed protein product                                252   1e-74    
ref|XP_009403831.1|  PREDICTED: WAT1-related protein At5g07050-like     253   1e-74    
gb|KHG16518.1|  Auxin-induced 5NG4                                      251   2e-74    
ref|XP_009390255.1|  PREDICTED: WAT1-related protein At1g21890-like     250   3e-74    
ref|XP_006649078.1|  PREDICTED: WAT1-related protein At1g21890-like     249   3e-74    
gb|KHN09193.1|  Auxin-induced protein 5NG4                              251   3e-74    
ref|XP_009122385.1|  PREDICTED: WAT1-related protein At5g07050          251   3e-74    
ref|XP_010423261.1|  PREDICTED: WAT1-related protein At5g07050          251   4e-74    
ref|XP_004151019.1|  PREDICTED: auxin-induced protein 5NG4-like         249   5e-74    
ref|XP_009344114.1|  PREDICTED: WAT1-related protein At4g08300-like     249   6e-74    
ref|XP_009340894.1|  PREDICTED: WAT1-related protein At1g21890-like     249   6e-74    
gb|ABS52574.1|  nodulin family protein                                  250   6e-74    Gossypium hirsutum [American cotton]
ref|XP_004955229.1|  PREDICTED: WAT1-related protein At1g21890-like     250   7e-74    
ref|XP_007223359.1|  hypothetical protein PRUPE_ppa007464mg             249   7e-74    
ref|XP_010938846.1|  PREDICTED: WAT1-related protein At5g07050-like     250   7e-74    
gb|EMT33815.1|  Auxin-induced protein 5NG4                              249   9e-74    
gb|EYU26922.1|  hypothetical protein MIMGU_mgv1a007458mg                250   1e-73    
ref|XP_010673090.1|  PREDICTED: WAT1-related protein At5g07050          250   1e-73    
gb|EMT31802.1|  Auxin-induced protein 5NG4                              249   1e-73    
ref|XP_008802062.1|  PREDICTED: WAT1-related protein At1g21890-like     249   1e-73    
ref|NP_001048238.1|  Os02g0768300                                       249   1e-73    Oryza sativa Japonica Group [Japonica rice]
gb|EEC74071.1|  hypothetical protein OsI_09081                          249   2e-73    Oryza sativa Indica Group [Indian rice]
ref|XP_002436678.1|  hypothetical protein SORBIDRAFT_10g006950          249   2e-73    Sorghum bicolor [broomcorn]
ref|XP_010456426.1|  PREDICTED: WAT1-related protein At5g07050-like     249   2e-73    
gb|KHN33864.1|  Auxin-induced protein 5NG4                              248   2e-73    
ref|XP_011069552.1|  PREDICTED: WAT1-related protein At1g21890-like     248   2e-73    
ref|XP_010244423.1|  PREDICTED: WAT1-related protein At5g07050          249   2e-73    
ref|XP_002517269.1|  Auxin-induced protein 5NG4, putative               248   3e-73    
ref|XP_003601058.1|  Auxin-induced protein 5NG4                         247   3e-73    
ref|XP_003527931.1|  PREDICTED: WAT1-related protein At4g08290-like     248   4e-73    
gb|KHG10291.1|  Auxin-induced 5NG4                                      248   4e-73    
ref|XP_004290853.1|  PREDICTED: auxin-induced protein 5NG4-like         248   4e-73    
ref|XP_003566095.1|  PREDICTED: WAT1-related protein At5g07050-like     248   5e-73    
ref|XP_008463487.1|  PREDICTED: WAT1-related protein At2g39510-like     246   5e-73    
ref|XP_003544679.1|  PREDICTED: WAT1-related protein At4g08290-like     248   5e-73    
ref|XP_006604312.1|  PREDICTED: WAT1-related protein At5g07050-like     247   6e-73    
gb|AFK39842.1|  unknown                                                 246   7e-73    
ref|XP_009391606.1|  PREDICTED: WAT1-related protein At5g07050-like     247   7e-73    
ref|XP_004290851.1|  PREDICTED: auxin-induced protein 5NG4-like         247   8e-73    
emb|CDM84603.1|  unnamed protein product                                247   8e-73    
ref|XP_008219763.1|  PREDICTED: WAT1-related protein At4g08300          246   9e-73    
ref|XP_008810183.1|  PREDICTED: WAT1-related protein At5g07050-like     247   1e-72    
gb|AFW82369.1|  hypothetical protein ZEAMMB73_445023                    247   1e-72    
ref|XP_008788560.1|  PREDICTED: WAT1-related protein At5g07050-like     247   1e-72    
gb|KDP32785.1|  hypothetical protein JCGZ_12077                         246   1e-72    
gb|KDP40571.1|  hypothetical protein JCGZ_24570                         247   1e-72    
ref|NP_001141126.1|  uncharacterized protein LOC100273211               246   1e-72    
ref|XP_011027560.1|  PREDICTED: WAT1-related protein At4g08300-like     246   1e-72    
ref|XP_006289728.1|  hypothetical protein CARUB_v10003296mg             246   1e-72    
ref|XP_003560938.1|  PREDICTED: WAT1-related protein At1g44800-like     246   1e-72    
ref|XP_003601053.1|  Auxin-induced protein 5NG4                         246   1e-72    
gb|EMS60727.1|  Auxin-induced protein 5NG4                              246   2e-72    
ref|NP_196322.3|  nodulin MtN21 /EamA-like transporter family pro...    246   2e-72    
gb|KHG29332.1|  Auxin-induced 5NG4                                      245   2e-72    
ref|XP_006364778.1|  PREDICTED: WAT1-related protein At5g07050-like     245   3e-72    
dbj|BAK02715.1|  predicted protein                                      246   3e-72    
ref|XP_008445949.1|  PREDICTED: WAT1-related protein At5g07050          245   3e-72    
gb|EYU23896.1|  hypothetical protein MIMGU_mgv1a008243mg                245   3e-72    
ref|XP_006430497.1|  hypothetical protein CICLE_v10012013mg             244   3e-72    
ref|XP_011020462.1|  PREDICTED: WAT1-related protein At5g07050          246   4e-72    
ref|XP_010906409.1|  PREDICTED: WAT1-related protein At5g07050-like     245   4e-72    
gb|KHG23400.1|  Auxin-induced 5NG4                                      245   4e-72    
ref|XP_002267371.1|  PREDICTED: WAT1-related protein At5g07050          245   5e-72    
ref|XP_011074856.1|  PREDICTED: WAT1-related protein At1g44800-like     245   6e-72    
emb|CAH58631.1|  nodulin-like protein                                   244   6e-72    
gb|KGN54575.1|  hypothetical protein Csa_4G365050                       244   7e-72    
ref|XP_010091380.1|  Auxin-induced protein 5NG4                         245   7e-72    
ref|XP_006434165.1|  hypothetical protein CICLE_v10001460mg             244   8e-72    
gb|EEC79453.1|  hypothetical protein OsI_20446                          245   8e-72    
ref|NP_001055921.1|  Os05g0493800                                       245   8e-72    
ref|XP_010055591.1|  PREDICTED: WAT1-related protein At5g07050-like     245   8e-72    
ref|XP_008444144.1|  PREDICTED: WAT1-related protein At1g44800-like     244   8e-72    
ref|XP_006472756.1|  PREDICTED: WAT1-related protein At1g21890-like     244   8e-72    
gb|AFK34273.1|  unknown                                                 244   9e-72    
ref|XP_002302243.2|  nodulin MtN21 family protein                       244   1e-71    
ref|XP_010096006.1|  Auxin-induced protein 5NG4                         244   1e-71    
ref|XP_011085946.1|  PREDICTED: WAT1-related protein At5g07050          244   1e-71    
ref|XP_010111209.1|  Auxin-induced protein 5NG4                         244   1e-71    
ref|XP_010916579.1|  PREDICTED: WAT1-related protein At1g21890-like     243   1e-71    
ref|XP_010495095.1|  PREDICTED: WAT1-related protein At5g07050-like     244   2e-71    
ref|XP_007019030.1|  Nodulin MtN21 /EamA-like transporter family ...    243   2e-71    
ref|XP_004151540.1|  PREDICTED: auxin-induced protein 5NG4-like         243   2e-71    
ref|XP_009620098.1|  PREDICTED: WAT1-related protein At5g07050-like     243   2e-71    
ref|NP_001242267.1|  uncharacterized protein LOC100811617               243   2e-71    
ref|XP_010067382.1|  PREDICTED: WAT1-related protein At2g39510-like     241   2e-71    
ref|XP_008219662.1|  PREDICTED: WAT1-related protein At1g21890-like     243   2e-71    
ref|XP_007162036.1|  hypothetical protein PHAVU_001G118300g             244   2e-71    
ref|XP_010064999.1|  PREDICTED: WAT1-related protein At4g08300-like     243   3e-71    
ref|XP_009788498.1|  PREDICTED: WAT1-related protein At5g07050-like     243   3e-71    
ref|XP_008466700.1|  PREDICTED: WAT1-related protein At4g08290          243   3e-71    
emb|CDY00403.1|  BnaC07g14230D                                          243   3e-71    
ref|XP_002303952.2|  hypothetical protein POPTR_0003s19170g             243   4e-71    
ref|XP_009620096.1|  PREDICTED: WAT1-related protein At5g07050-like     243   4e-71    
ref|XP_008443233.1|  PREDICTED: WAT1-related protein At5g07050-like     243   4e-71    
gb|EMT18779.1|  Auxin-induced protein 5NG4                              242   5e-71    
ref|XP_004144320.1|  PREDICTED: auxin-induced protein 5NG4-like         244   6e-71    
ref|XP_010926422.1|  PREDICTED: WAT1-related protein At1g21890-like     241   7e-71    
ref|XP_008463485.1|  PREDICTED: WAT1-related protein At2g39510-li...    241   7e-71    
ref|XP_010091381.1|  Auxin-induced protein 5NG4                         241   8e-71    
ref|XP_008795134.1|  PREDICTED: WAT1-related protein At5g07050-like     241   1e-70    
ref|XP_006471332.1|  PREDICTED: WAT1-related protein At5g07050-like     242   1e-70    
gb|KDP22890.1|  hypothetical protein JCGZ_01964                         240   1e-70    
ref|XP_007019027.1|  Nodulin MtN21 /EamA-like transporter family ...    241   1e-70    
ref|XP_002441090.1|  hypothetical protein SORBIDRAFT_09g020200          241   1e-70    
ref|XP_003545806.1|  PREDICTED: WAT1-related protein At5g07050-like     241   2e-70    
ref|XP_006432378.1|  hypothetical protein CICLE_v10001335mg             241   2e-70    
ref|XP_002306626.2|  hypothetical protein POPTR_0005s15810g             241   2e-70    
ref|XP_002299181.1|  hypothetical protein POPTR_0001s06980g             241   2e-70    
ref|XP_004167156.1|  PREDICTED: auxin-induced protein 5NG4-like         241   2e-70    
ref|XP_009790909.1|  PREDICTED: WAT1-related protein At5g07050-li...    241   3e-70    
ref|XP_009390894.1|  PREDICTED: WAT1-related protein At1g21890-like     240   3e-70    
gb|KEH40540.1|  auxin-induced 5NG4-like protein                         240   3e-70    
gb|AGZ85011.1|  hypothetical protein 6                                  240   3e-70    
gb|EMS57240.1|  Auxin-induced protein 5NG4                              238   4e-70    
ref|XP_011070079.1|  PREDICTED: WAT1-related protein At5g07050-like     240   5e-70    
ref|XP_006644860.1|  PREDICTED: WAT1-related protein At5g07050-like     240   5e-70    
ref|XP_004136769.1|  PREDICTED: auxin-induced protein 5NG4-like         240   5e-70    
gb|KGN59418.1|  hypothetical protein Csa_3G818270                       240   6e-70    
gb|KFK44291.1|  hypothetical protein AALP_AA1G239100                    239   6e-70    
ref|XP_008455745.1|  PREDICTED: WAT1-related protein At5g07050-like     241   7e-70    
ref|XP_002323220.2|  hypothetical protein POPTR_0016s03120g             239   7e-70    
ref|XP_011015432.1|  PREDICTED: WAT1-related protein At5g07050-like     239   1e-69    
ref|XP_006654584.1|  PREDICTED: WAT1-related protein At5g07050-like     239   1e-69    
ref|XP_004145365.1|  PREDICTED: auxin-induced protein 5NG4-like         238   1e-69    
ref|NP_001239827.1|  uncharacterized protein LOC100804390               239   1e-69    
ref|XP_009800321.1|  PREDICTED: WAT1-related protein At5g07050-like     239   1e-69    
dbj|BAJ92223.1|  predicted protein                                      239   1e-69    
ref|XP_002308862.2|  hypothetical protein POPTR_0006s03200g             239   2e-69    
ref|XP_003564421.1|  PREDICTED: WAT1-related protein At5g07050          238   2e-69    
ref|XP_009361913.1|  PREDICTED: WAT1-related protein At5g07050-like     238   2e-69    
ref|XP_009610629.1|  PREDICTED: WAT1-related protein At5g07050-li...    238   2e-69    
ref|XP_008375333.1|  PREDICTED: WAT1-related protein At5g07050-like     238   3e-69    
ref|XP_010999364.1|  PREDICTED: WAT1-related protein At4g08300-like     238   3e-69    
gb|ACD56621.1|  putative nodulin-like protein                           238   3e-69    
gb|KGN61714.1|  hypothetical protein Csa_2G231960                       238   3e-69    
ref|XP_009621489.1|  PREDICTED: WAT1-related protein At5g07050-li...    238   3e-69    
ref|XP_004493329.1|  PREDICTED: WAT1-related protein At5g07050-li...    235   4e-69    
ref|XP_004964911.1|  PREDICTED: WAT1-related protein At1g44800-like     237   4e-69    
ref|XP_004164556.1|  PREDICTED: auxin-induced protein 5NG4-like         235   4e-69    
emb|CDP15800.1|  unnamed protein product                                237   4e-69    
ref|XP_009370627.1|  PREDICTED: WAT1-related protein At5g07050-like     238   4e-69    
gb|KHN47037.1|  Auxin-induced protein 5NG4-like protein                 237   4e-69    
ref|XP_009398157.1|  PREDICTED: WAT1-related protein At1g21890-like     236   5e-69    
ref|XP_011041376.1|  PREDICTED: WAT1-related protein At5g07050          237   6e-69    
ref|XP_010669710.1|  PREDICTED: WAT1-related protein At4g08300-like     237   6e-69    
ref|XP_011034692.1|  PREDICTED: WAT1-related protein At5g07050-like     237   7e-69    
ref|XP_009103277.1|  PREDICTED: WAT1-related protein At1g21890          236   8e-69    
ref|XP_009388785.1|  PREDICTED: WAT1-related protein At1g21890-like     236   9e-69    
ref|XP_006339335.1|  PREDICTED: WAT1-related protein At5g07050-like     235   1e-68    
gb|ACR34989.1|  unknown                                                 236   1e-68    
ref|XP_006307681.1|  hypothetical protein CARUB_v10009309mg             236   1e-68    
ref|XP_004249327.1|  PREDICTED: WAT1-related protein At5g07050-li...    236   2e-68    
ref|XP_010534673.1|  PREDICTED: WAT1-related protein At1g21890 is...    236   2e-68    
ref|XP_008346651.1|  PREDICTED: WAT1-related protein At5g07050-like     236   2e-68    
ref|XP_011040724.1|  PREDICTED: WAT1-related protein At5g07050          236   2e-68    
ref|XP_002283348.1|  PREDICTED: WAT1-related protein At5g07050          236   2e-68    
ref|XP_008655310.1|  PREDICTED: uncharacterized protein LOC100384...    236   2e-68    
gb|EAY98030.1|  hypothetical protein OsI_19945                          236   2e-68    
gb|KGN54680.1|  hypothetical protein Csa_4G420210                       236   2e-68    
ref|XP_004493327.1|  PREDICTED: WAT1-related protein At5g07050-li...    235   2e-68    
ref|XP_008219762.1|  PREDICTED: WAT1-related protein At4g08290          235   2e-68    
ref|NP_001078016.1|  nodulin MtN21 /EamA-like transporter family ...    234   2e-68    
gb|KHN47031.1|  Auxin-induced protein 5NG4-like protein                 235   2e-68    
emb|CDY01310.1|  BnaA07g10830D                                          235   2e-68    
dbj|BAB92246.1|  putative nodulin MtN21                                 236   2e-68    
ref|NP_001055529.2|  Os05g0409500                                       236   3e-68    
ref|XP_010055600.1|  PREDICTED: WAT1-related protein At5g07050-like     236   3e-68    
dbj|BAF00152.1|  nodulin-like protein                                   233   3e-68    
ref|XP_002893187.1|  T26F17.11                                          235   3e-68    
gb|ADN33888.1|  nodulin-like protein                                    234   3e-68    
ref|XP_008443232.1|  PREDICTED: WAT1-related protein At5g07050-like     235   3e-68    
ref|XP_009419851.1|  PREDICTED: WAT1-related protein At5g07050-like     234   4e-68    
ref|XP_004962102.1|  PREDICTED: WAT1-related protein At5g07050-like     235   4e-68    
gb|KHG09563.1|  Auxin-induced 5NG4                                      236   4e-68    
ref|NP_001150619.1|  nodulin-like protein                               235   4e-68    
ref|XP_006581581.1|  PREDICTED: WAT1-related protein At4g08300          234   5e-68    
gb|KHN09198.1|  Auxin-induced protein 5NG4                              234   5e-68    
ref|XP_011091919.1|  PREDICTED: WAT1-related protein At5g07050-like     234   5e-68    
ref|XP_009395155.1|  PREDICTED: WAT1-related protein At5g07050-like     234   5e-68    
ref|XP_007148806.1|  hypothetical protein PHAVU_005G015900g             234   6e-68    
ref|XP_003526623.1|  PREDICTED: WAT1-related protein At4g08290-like     233   6e-68    
gb|ACL54205.1|  unknown                                                 234   8e-68    
ref|XP_007141062.1|  hypothetical protein PHAVU_008G164100g             234   8e-68    
ref|XP_010461452.1|  PREDICTED: WAT1-related protein At1g44800          233   1e-67    
gb|EYU20823.1|  hypothetical protein MIMGU_mgv1a008005mg                233   1e-67    
ref|XP_003568462.2|  PREDICTED: WAT1-related protein At5g07050-like     234   1e-67    
emb|CDY04680.1|  BnaC05g17180D                                          233   1e-67    
ref|XP_002513792.1|  Auxin-induced protein 5NG4, putative               233   1e-67    
ref|XP_003526625.1|  PREDICTED: WAT1-related protein At4g08290-like     232   1e-67    
gb|EEC71658.1|  hypothetical protein OsI_04113                          233   1e-67    
ref|XP_003590514.1|  Auxin-induced protein 5NG4                         229   1e-67    
ref|XP_007133643.1|  hypothetical protein PHAVU_011G196800g             233   2e-67    
ref|NP_001240202.1|  uncharacterized protein LOC100811114               233   2e-67    
gb|AFW78503.1|  nodulin-like protein                                    233   2e-67    
ref|XP_007223097.1|  hypothetical protein PRUPE_ppa007061mg             233   2e-67    
gb|KDO40046.1|  hypothetical protein CISIN_1g019311mg                   230   2e-67    
gb|EMS45468.1|  Auxin-induced protein 5NG4                              233   2e-67    
gb|KHG10292.1|  Auxin-induced 5NG4                                      233   2e-67    
gb|EMS45454.1|  Auxin-induced protein 5NG4                              232   3e-67    
ref|XP_007019026.1|  Nodulin MtN21 /EamA-like transporter family ...    231   3e-67    
ref|XP_010682440.1|  PREDICTED: WAT1-related protein At4g08300-like     233   3e-67    
gb|EYU22954.1|  hypothetical protein MIMGU_mgv1a0088041mg               231   3e-67    
ref|XP_008388240.1|  PREDICTED: WAT1-related protein At1g21890          232   3e-67    
ref|XP_007141061.1|  hypothetical protein PHAVU_008G164000g             232   4e-67    
ref|XP_002458648.1|  hypothetical protein SORBIDRAFT_03g037390          233   4e-67    
ref|XP_006416254.1|  hypothetical protein EUTSA_v10007890mg             232   5e-67    
gb|AAM01041.1|AC091735_14  Putative nodulin-like protein                230   5e-67    
ref|XP_010477438.1|  PREDICTED: WAT1-related protein At1g21890-like     232   6e-67    
ref|XP_003523924.1|  PREDICTED: WAT1-related protein At5g07050-like     232   6e-67    
ref|XP_002525547.1|  Auxin-induced protein 5NG4, putative               232   6e-67    
ref|XP_010459911.1|  PREDICTED: WAT1-related protein At1g21890          231   7e-67    
gb|KHN33840.1|  Auxin-induced protein 5NG4                              230   7e-67    
gb|AFK47115.1|  unknown                                                 231   8e-67    
ref|XP_007218075.1|  hypothetical protein PRUPE_ppa006848mg             231   8e-67    
ref|XP_003543089.1|  PREDICTED: WAT1-related protein At4g08290-li...    230   9e-67    
ref|XP_007137403.1|  hypothetical protein PHAVU_009G124100g             231   9e-67    
ref|XP_010479058.1|  PREDICTED: WAT1-related protein At1g44800-like     231   9e-67    
ref|XP_004500582.1|  PREDICTED: WAT1-related protein At4g08290-like     230   1e-66    
ref|XP_003526345.1|  PREDICTED: WAT1-related protein At5g07050-like     231   1e-66    
ref|XP_006593592.1|  PREDICTED: WAT1-related protein At1g44800-like     230   2e-66    
ref|XP_003544681.1|  PREDICTED: WAT1-related protein At1g44800-like     230   2e-66    
gb|ACJ84735.1|  unknown                                                 229   2e-66    
ref|NP_173607.1|  WAT1-related protein                                  230   2e-66    
gb|AFK35679.1|  unknown                                                 230   2e-66    
ref|XP_003544696.1|  PREDICTED: WAT1-related protein At4g08290-like     229   2e-66    
gb|AAM62626.1|  nodulin protein, putative                               229   2e-66    
gb|KHN04117.1|  Auxin-induced protein 5NG4                              229   2e-66    
ref|XP_007223104.1|  hypothetical protein PRUPE_ppa007123mg             230   2e-66    
ref|XP_004499808.1|  PREDICTED: WAT1-related protein At5g07050-like     230   3e-66    
ref|NP_175101.1|  bidirectional amino acid transporter SIAR1            229   3e-66    
ref|XP_009346345.1|  PREDICTED: WAT1-related protein At1g21890-like     230   3e-66    
ref|NP_001242727.1|  uncharacterized protein LOC100811984               229   3e-66    
ref|XP_006305116.1|  hypothetical protein CARUB_v10009485mg             229   5e-66    
ref|XP_004307206.1|  PREDICTED: auxin-induced protein 5NG4-like         229   5e-66    
ref|NP_001151393.1|  nodulin-like protein                               228   1e-65    
ref|XP_010067678.1|  PREDICTED: WAT1-related protein At5g07050          228   1e-65    
ref|XP_004494996.1|  PREDICTED: WAT1-related protein At2g37460-li...    224   2e-65    
ref|XP_002893995.1|  nodulin MtN21 family protein                       227   2e-65    
gb|KGN59420.1|  hypothetical protein Csa_3G819280                       228   2e-65    
gb|AAO41946.1|  unknown protein                                         225   2e-65    
gb|AFK43964.1|  unknown                                                 224   2e-65    
ref|XP_004249326.1|  PREDICTED: WAT1-related protein At5g07050          227   2e-65    
ref|XP_011079091.1|  PREDICTED: WAT1-related protein At5g07050-like     227   2e-65    
ref|XP_004136770.1|  PREDICTED: auxin-induced protein 5NG4-like         226   3e-65    



>ref|XP_006343754.1| PREDICTED: WAT1-related protein At2g39510-like [Solanum tuberosum]
Length=366

 Score =   348 bits (894),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 199/348 (57%), Positives = 255/348 (73%), Gaps = 12/348 (3%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
              + KPYL V  LQ   AGSAI++K+ALN GM+ FTF+ YRN  A ++FAPFAL  ERK R
Sbjct  9     KEGKPYLAVTLLQFGYAGSAIIAKSALNHGMSHFTFAVYRNVFATIVFAPFALLFERKIR  68

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT SIF KI+LL L+E  ++ NLYY G+RYTTAT +  M NL+PA+TFLLAWI RLE+
Sbjct  69    PKMTISIFLKIMLLGLVEPVIDQNLYYTGLRYTTATSAAAMCNLLPALTFLLAWILRLER  128

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             V I+ L SQAKI+GT    GGAMIMTL+ GP I LPWT+H  +++  S   +      PI
Sbjct  129   VNIKRLSSQAKIIGTTVTFGGAMIMTLIGGPTIGLPWTRHHLNIIPSSPTDL-----QPI  183

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
             K  L +A  C   A F  LQA  +K+YPA LSLT LIC+ G+LQ ++LTL+VERGN S+W
Sbjct  184   KGALFIAAGCICWACFYNLQAITLKTYPATLSLTCLICSAGALQGTLLTLVVERGNTSIW  243

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
             ++QWD + L+YVY G+V SG  YY+ G+IMK KGPVFVTAFNPL+MV+VAI+GSF+LSE+
Sbjct  244   AIQWDTSFLSYVYSGMVTSGVGYYVSGLIMKEKGPVFVTAFNPLNMVIVAILGSFILSEE  303

Query  469   LYMgrvlgavvvlvglylviwGKSKDQ---TSPDNNDALP---IDHKQ  344
             L +GRVLG  ++++GLYLVIWGKSKDQ   TS  + +A+    +D K+
Sbjct  304   LNLGRVLGGAIIVIGLYLVIWGKSKDQQSSTSFSSEEAVQSEFVDQKE  351



>ref|XP_009601954.1| PREDICTED: WAT1-related protein At2g39510-like isoform X1 [Nicotiana 
tomentosiformis]
Length=372

 Score =   344 bits (882),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 202/368 (55%), Positives = 264/368 (72%), Gaps = 10/368 (3%)
 Frame = -3

Query  1402  MMRNERVVKWLNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIF  1223
             M   ER++K++  +A+PYL V+ LQ   AGSAI++K+ALN GM+ FTF+ YRNA A ++F
Sbjct  1     MSTRERLLKFVK-EAQPYLAVILLQFGYAGSAIIAKSALNHGMSHFTFAVYRNAFATLVF  59

Query  1222  APFALFLERKTRPTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAM  1046
             APFA+ LERK RP MT SIF KI+LL LLE  ++ NLYY G+RYTTAT +  M N++PA+
Sbjct  60    APFAIVLERKIRPNMTVSIFLKIMLLGLLEPVIDQNLYYTGLRYTTATFATAMCNVLPAL  119

Query  1045  TFLLAWIFRLEKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHS  866
             TF+LAWI RLEKV +R L SQAKIVGT    GGAMIMTL+ GP I LPWT+H     + +
Sbjct  120   TFMLAWILRLEKVNVRRLSSQAKIVGTTVTFGGAMIMTLIGGPTIGLPWTRHLLSTTTAT  179

Query  865   AQHVLNQHSNPIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSIL  686
             +  +      PIK  L +A  C   A F  LQA  +K+YPA LSLT LIC+ G++Q + L
Sbjct  180   SASLTELQ--PIKGALFIAAGCICWACFYNLQAITLKTYPAALSLTCLICSAGAVQGTAL  237

Query  685   TLIVERGNASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVL  506
             TL+ ERGN S+WS+  D  LL+YVY G+V SG  YY+ G+IMK KGPVFVTAFNPL+MV+
Sbjct  238   TLVAERGNTSIWSIHLDTKLLSYVYSGMVTSGVGYYVSGLIMKDKGPVFVTAFNPLNMVI  297

Query  505   VAIIGSFVLSEKLYMgrvlgavvvlvglylviwGKSKDQ-----TSPDNNDALPIDHKQP  341
             VAI+GSF+LSE+L +GRVLG  ++++GLYLVIWGKSKDQ     +S D+ +  P+  K+ 
Sbjct  298   VAILGSFILSEQLNLGRVLGGAIIVIGLYLVIWGKSKDQKLSKYSSTDDVEVEPVG-KET  356

Query  340   QVVQGFNK  317
                +  N+
Sbjct  357   STTKSLNQ  364



>ref|XP_004240770.1| PREDICTED: WAT1-related protein At2g39510 [Solanum lycopersicum]
Length=364

 Score =   343 bits (881),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 198/346 (57%), Positives = 251/346 (73%), Gaps = 10/346 (3%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
              + K YL V  LQ   AGSAI++K+ALN GM+ FTF+ YRN  A ++FAPFAL  ERK R
Sbjct  9     KEGKAYLAVTLLQFGYAGSAIIAKSALNHGMSHFTFAVYRNVFATIVFAPFALVFERKIR  68

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P M+ SIF KI+LL L+E  ++ NLYY G+RYTTAT +  M NL+PA+TFLLAWI RLEK
Sbjct  69    PKMSISIFLKIMLLGLVEPVIDQNLYYTGLRYTTATSAAAMCNLLPALTFLLAWILRLEK  128

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSN-DVVSHSAQHVLNQHSNP  833
             V I  L SQAKI+GT    GGAMIMTLV GP I LPWT+H + +++  S   +      P
Sbjct  129   VNIMRLSSQAKIIGTTVTFGGAMIMTLVGGPTIGLPWTRHDHINIIPSSTTDL-----QP  183

Query  832   IKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASV  653
             IK  L +A  C   A F  LQA  +K+YPA LSLT LIC+ G+LQ ++LTL+VERGN S+
Sbjct  184   IKGALFIAAGCICWACFYNLQAITLKTYPASLSLTCLICSAGALQGTLLTLVVERGNTSI  243

Query  652   WSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSE  473
             W++QWD T L+YVY G+V SG  YY+ G+IMK KGPVFVTAFNPL+MV+VAI+GSF+LSE
Sbjct  244   WAIQWDTTFLSYVYSGMVTSGVGYYVSGLIMKEKGPVFVTAFNPLNMVIVAILGSFILSE  303

Query  472   KLYMgrvlgavvvlvglylviwGKSKDQTS---PDNNDALPIDHKQ  344
             +L +GRVLG  ++++GLYLVIWGKSKDQ S    +   +  +D K+
Sbjct  304   ELNLGRVLGGAIIVIGLYLVIWGKSKDQQSLSIEETAQSEFVDQKE  349



>ref|XP_009798285.1| PREDICTED: WAT1-related protein At2g39510-like [Nicotiana sylvestris]
Length=372

 Score =   343 bits (880),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 202/368 (55%), Positives = 263/368 (71%), Gaps = 10/368 (3%)
 Frame = -3

Query  1402  MMRNERVVKWLNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIF  1223
             M   ER++K++  +A+PYL V+ LQ   AGSAI++K+ALN GM+ FTF+ YRN  A  +F
Sbjct  1     MSTRERILKFVK-EAQPYLAVILLQFGYAGSAIIAKSALNHGMSHFTFAVYRNVFATFVF  59

Query  1222  APFALFLERKTRPTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAM  1046
             APFA+ LERK RP MT SIF KI+LL LLE  ++ NLYY G+RYTTAT +  M N++PA+
Sbjct  60    APFAMVLERKIRPNMTVSIFLKIMLLGLLEPVIDQNLYYTGLRYTTATFATAMCNVLPAL  119

Query  1045  TFLLAWIFRLEKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHS  866
             TFLLAWI RLEKV IR L SQAKIVGT    GGAMIM L+ GP I LPWT+H     + +
Sbjct  120   TFLLAWILRLEKVNIRRLSSQAKIVGTTVTFGGAMIMALIGGPTIGLPWTRHLLSTTTAT  179

Query  865   AQHVLNQHSNPIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSIL  686
             +  +      PIK  L +A  C   A F  LQA  +K+YPA LSLT LIC+ G+++ + L
Sbjct  180   SASLTELQ--PIKGALFIAAGCICWACFYNLQAITLKTYPAALSLTCLICSAGAVEGTAL  237

Query  685   TLIVERGNASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVL  506
             TL+ ERGN S+W++  D  LL+YVY G+V SG  YY+ G+IMK KGPVFVTAFNPL+MVL
Sbjct  238   TLVAERGNTSIWAIHLDTKLLSYVYSGMVTSGLGYYVSGLIMKDKGPVFVTAFNPLNMVL  297

Query  505   VAIIGSFVLSEKLYMgrvlgavvvlvglylviwGKSKDQ-----TSPDNNDALPIDHKQP  341
             VAI+GSF+LSE+L +GRVLG  ++++GLYLVIWGKSKDQ     +S D+ +A P+  K+ 
Sbjct  298   VAILGSFILSEQLNLGRVLGGAIIVIGLYLVIWGKSKDQILSKSSSTDDAEAEPVG-KET  356

Query  340   QVVQGFNK  317
              + +  N+
Sbjct  357   SITKSLNQ  364



>ref|XP_009601955.1| PREDICTED: WAT1-related protein At2g39510-like isoform X2 [Nicotiana 
tomentosiformis]
Length=330

 Score =   337 bits (863),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 179/313 (57%), Positives = 229/313 (73%), Gaps = 4/313 (1%)
 Frame = -3

Query  1402  MMRNERVVKWLNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIF  1223
             M   ER++K++  +A+PYL V+ LQ   AGSAI++K+ALN GM+ FTF+ YRNA A ++F
Sbjct  1     MSTRERLLKFVK-EAQPYLAVILLQFGYAGSAIIAKSALNHGMSHFTFAVYRNAFATLVF  59

Query  1222  APFALFLERKTRPTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAM  1046
             APFA+ LERK RP MT SIF KI+LL LLE  ++ NLYY G+RYTTAT +  M N++PA+
Sbjct  60    APFAIVLERKIRPNMTVSIFLKIMLLGLLEPVIDQNLYYTGLRYTTATFATAMCNVLPAL  119

Query  1045  TFLLAWIFRLEKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHS  866
             TF+LAWI RLEKV +R L SQAKIVGT    GGAMIMTL+ GP I LPWT+H     + +
Sbjct  120   TFMLAWILRLEKVNVRRLSSQAKIVGTTVTFGGAMIMTLIGGPTIGLPWTRHLLSTTTAT  179

Query  865   AQHVLNQHSNPIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSIL  686
             +  +      PIK  L +A  C   A F  LQA  +K+YPA LSLT LIC+ G++Q + L
Sbjct  180   SASLTELQ--PIKGALFIAAGCICWACFYNLQAITLKTYPAALSLTCLICSAGAVQGTAL  237

Query  685   TLIVERGNASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVL  506
             TL+ ERGN S+WS+  D  LL+YVY G+V SG  YY+ G+IMK KGPVFVTAFNPL+MV+
Sbjct  238   TLVAERGNTSIWSIHLDTKLLSYVYSGMVTSGVGYYVSGLIMKDKGPVFVTAFNPLNMVI  297

Query  505   VAIIGSFVLSEKL  467
             VAI+GSF+LSE+L
Sbjct  298   VAILGSFILSEQL  310



>ref|XP_011072605.1| PREDICTED: WAT1-related protein At2g39510-like isoform X2 [Sesamum 
indicum]
Length=379

 Score =   324 bits (831),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 189/346 (55%), Positives = 251/346 (73%), Gaps = 7/346 (2%)
 Frame = -3

Query  1360  AKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPT  1181
             AKPYL V+ LQ  S GSAI++K+ALN GM+ +TFS YRN +A V+ APFAL LERK RP 
Sbjct  9     AKPYLAVIMLQFGSTGSAIIAKSALNHGMSHYTFSVYRNIVATVVMAPFALVLERKIRPR  68

Query  1180  MTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVK  1004
             MT SIF+KIVLLALLE  ++ NLYY GM+YTTAT +  M N++PA+TFLLAW   LE+V 
Sbjct  69    MTFSIFYKIVLLALLEPVIDQNLYYAGMKYTTATFASAMCNVLPAITFLLAWALGLERVN  128

Query  1003  IRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSN-DVVSHSAQHVLNQHSNPIK  827
             I+   SQAK+ GT   + GAMIMTLV+G II LPWT+HS+ +    +A    N H NP++
Sbjct  129   IKRWSSQAKVAGTLVTVSGAMIMTLVRGSIIGLPWTRHSHINSQLTAADADANSHQNPVR  188

Query  826   ATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWS  647
               L++   C   +IF ILQA  +KSYPAGLSLT LIC  G+LQ + LTL+ E+ N ++W+
Sbjct  189   GALMITAGCFCWSIFYILQAITLKSYPAGLSLTALICMGGALQGTALTLVAEKSNTAIWT  248

Query  646   LQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKL  467
             ++ D  LL YVY GLV SG  YY+ G++ K KGPVF T+FNPLSMV VA++ SF+L+E+L
Sbjct  249   IRGDTKLLAYVYSGLVGSGITYYVAGVVSKEKGPVFATSFNPLSMVFVAVMSSFILAEQL  308

Query  466   YMgrvlgavvvlvglylviwGKSKDQTSPDNNDALPIDHKQPQVVQ  329
              +G+V GA+V++VGLYL IWGK+KD+      ++L ++ +   VV+
Sbjct  309   DVGKVSGAIVIVVGLYLFIWGKAKDK-----KESLTLNAQSEMVVE  349



>ref|XP_010253282.1| PREDICTED: WAT1-related protein At2g39510-like [Nelumbo nucifera]
Length=382

 Score =   322 bits (824),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 184/353 (52%), Positives = 255/353 (72%), Gaps = 7/353 (2%)
 Frame = -3

Query  1372  LNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERK  1193
             L N AKP+L V+FLQ+  AG AI++K AL+QG++ +TF  YRNA+A  + APFA+ LERK
Sbjct  14    LFNKAKPFLAVIFLQLGLAGMAIIAKIALDQGLSHYTFVVYRNAVATCVIAPFAITLERK  73

Query  1192  TRPTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRL  1016
              RP MT S+F KI LL LLE  ++ NLYY GM YTTAT +  M N++PA+TFLLA++ RL
Sbjct  74    VRPKMTYSVFAKIALLGLLEPVIDQNLYYAGMSYTTATFTAAMCNILPALTFLLAFVLRL  133

Query  1015  EKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSN  836
             EKV I+N+ SQAK+VGT   +GGAM+MTL+KGP + LPWTK + +  S +   V     +
Sbjct  134   EKVNIKNVRSQAKVVGTLVTVGGAMLMTLIKGPTMDLPWTKGTVNNTSQTGHPV---QQD  190

Query  835   PIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNAS  656
             PIK  L++A  C   + FIILQA  +K+YPAGLSLT L+C +G+++ + + L ++ GN S
Sbjct  191   PIKGALMIATGCFCWSCFIILQAITLKAYPAGLSLTALLCFMGTIEGAAVALAMQWGNTS  250

Query  655   VWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLS  476
              W++ WD   L  VY G++ SG  YY+ G+IMK +GPVFVTAF+PL M++VAI+GSF+L+
Sbjct  251   SWAIHWDAKFLAAVYGGIMCSGVAYYVQGVIMKERGPVFVTAFSPLCMIIVAILGSFILA  310

Query  475   EKLYMgrvlgavvvlvglylviwGKSKDQ--TSPDNNDAL-PIDHKQPQVVQG  326
             E++Y+G V+GA V++VGLYLV+WGKSKD   +SP  N  + P++ K   +  G
Sbjct  311   EEMYLGSVIGATVIVVGLYLVVWGKSKDHIPSSPSTNQQIAPVELKASSIDTG  363



>emb|CDP05672.1| unnamed protein product [Coffea canephora]
Length=375

 Score =   321 bits (822),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 197/350 (56%), Positives = 255/350 (73%), Gaps = 9/350 (3%)
 Frame = -3

Query  1372  LNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERK  1193
             L   AKPYL V+F+Q   AGSAI+SK+ALN+GM+ + F+ YRN  AA +FAPFA+ LERK
Sbjct  3     LFKQAKPYLAVIFMQFGYAGSAIISKSALNKGMSHYAFAIYRNLFAAAVFAPFAVVLERK  62

Query  1192  TRPTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRL  1016
              RP MT S+ +KI+LL LLE  ++ NLYY  M+YTTAT +V+M N++PA+TFLLAWI RL
Sbjct  63    VRPRMTISVLWKIILLGLLEPVIDQNLYYAAMKYTTATFAVSMTNMLPALTFLLAWILRL  122

Query  1015  EKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSN  836
             E+V  R LHSQ KI GT   +GGAMIMTLV+GP I LPWT+   +V S +A +      +
Sbjct  123   EEVNTRRLHSQIKIAGTIITVGGAMIMTLVRGPAINLPWTRADANVQSPAAAN----PQD  178

Query  835   PIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNAS  656
             PIK  L+++  C   A F ILQA  +KSYPA LSLT++ICT G+LQ +I+TL+ ERGN S
Sbjct  179   PIKGALMISAGCFCWASFHILQAMTVKSYPACLSLTSMICTAGALQGTIVTLVAERGNPS  238

Query  655   VWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLS  476
             VWS+ +D  L++YVY G+V SG  Y I GIIM+ KGPVFVTAF+PLSMV+VA + +F+L+
Sbjct  239   VWSIHFDTILMSYVYSGVVTSGVGYCISGIIMRAKGPVFVTAFSPLSMVIVAFMSTFILA  298

Query  475   EKLYMgrvlgavvvlvglylviwGKSKDQTSPDN----NDALPIDHKQPQ  338
             E+L  GRV GA+ ++ GLYLVIWGK KDQ SP      ++  PID + P 
Sbjct  299   ERLTFGRVFGAISIVTGLYLVIWGKCKDQISPSKSTNVDETDPIDEQLPD  348



>ref|XP_010534481.1| PREDICTED: WAT1-related protein At2g39510-like [Tarenaya hassleriana]
Length=375

 Score =   320 bits (821),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 186/369 (50%), Positives = 263/369 (71%), Gaps = 12/369 (3%)
 Frame = -3

Query  1357  KPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPTM  1178
             KP+L V+FLQ  +AG +I++K ALN+GM+P   + YR+ +A +I APFA FL+RK RP M
Sbjct  13    KPFLTVIFLQFGNAGMSIIAKFALNKGMSPHVLAAYRHVVATLIIAPFAFFLDRKVRPKM  72

Query  1177  TTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVKI  1001
             T  I FKI+LL LLE  ++ NLYY GMRYT+AT +  M N++PA  FL+AW+FRLEKV I
Sbjct  73    TLPILFKILLLGLLEPTIDQNLYYTGMRYTSATFTAAMSNVLPAFAFLMAWLFRLEKVNI  132

Query  1000  RNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKAT  821
             + + SQAKI+GT   +GGAM+MTLVKGP++ LPWT + N+    S+   + Q  +P+K  
Sbjct  133   KKMPSQAKILGTIVTVGGAMLMTLVKGPLVPLPWTDNPNNAHQESSNPSIKQ--DPVKGA  190

Query  820   LLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSLQ  641
             LL+A  C   A FI LQA  +K+YP  LSLT  IC +G+++ +++ L++ERGN S WS+Q
Sbjct  191   LLIAVGCICWAGFINLQAITLKTYPVELSLTAYICLMGAIEGTVVALVIERGNPSAWSIQ  250

Query  640   WDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLYM  461
              D  LL  VY G++ SG  YY+ G++MK +GPVFVTAFNPLSMV+VAI+GSFVL+E +++
Sbjct  251   LDSKLLAIVYSGVICSGIAYYVQGVVMKTRGPVFVTAFNPLSMVIVAILGSFVLAEVMFL  310

Query  460   grvlgavvvlvglylviwGKSKDQTS--PDNNDALPIDHKQPQVVQGFNKDITVSLN*KV  287
             G +LGA+V+++GLY V+WGKSKD  +   D ++ LP+ H   QV     + ++   N  V
Sbjct  311   GTILGAIVIVLGLYSVLWGKSKDDNASFSDIDNELPLSHIH-QV-----ESVSSKANRGV  364

Query  286   ELPRSHPHD  260
             E P++ P++
Sbjct  365   E-PQARPNN  372



>ref|XP_011080962.1| PREDICTED: WAT1-related protein At2g39510-like [Sesamum indicum]
Length=379

 Score =   319 bits (818),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 183/354 (52%), Positives = 247/354 (70%), Gaps = 6/354 (2%)
 Frame = -3

Query  1372  LNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERK  1193
             L    + YL ++ +Q  + G AI++KAALNQG + +TFS YRNAIAA++FAPFA+ LERK
Sbjct  7     LKKKLQVYLSLVVVQFGNVGFAIVAKAALNQGTSHYTFSVYRNAIAALLFAPFAMVLERK  66

Query  1192  TRPTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRL  1016
              RP MT S+F KI+LL LL+     N++Y G+ YT+AT +  M NL+PA+TF++AWI R+
Sbjct  67    IRPKMTFSVFVKIMLLGLLDPVFGQNMFYSGLNYTSATFASAMCNLLPAITFVMAWILRI  126

Query  1015  EKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSN  836
             EKV +R + S AKIVGT   +GGAMIMTL+ GP+I LPWT   +      +    N H N
Sbjct  127   EKVNLREVRSHAKIVGTMVTVGGAMIMTLLSGPVIPLPWT---HKSHQSHSSSNSNDHEN  183

Query  835   PIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNAS  656
             P+K  L++   C   ++F ILQA  +K+YPAGLSLT LICT G+L+ ++LT IVERGN +
Sbjct  184   PVKGALMIGAGCFGYSLFYILQAVTLKTYPAGLSLTALICTFGALEGTVLTFIVERGNTA  243

Query  655   VWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLS  476
             +W+L W+  LL YVY G+V SG  YY+ G+IMK KGPVF+TAFNP +MV+VAI+ SF+  
Sbjct  244   IWALGWNAKLLAYVYGGIVASGVTYYLSGVIMKHKGPVFLTAFNPCTMVIVAILSSFIFH  303

Query  475   EKLYMgrvlgavvvlvglylviwGKSKDQTSPDNNDALPIDHKQPQVVQGFNKD  314
             E++ +G+V GA+V++ GLY VIWGKSKDQ        LP  HK P      ++D
Sbjct  304   EQMTVGKVTGALVIVTGLYFVIWGKSKDQKEEVKLTELP-QHK-PAAAAADHQD  355



>ref|XP_009625314.1| PREDICTED: WAT1-related protein At2g39510-like [Nicotiana tomentosiformis]
Length=375

 Score =   319 bits (817),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 184/311 (59%), Positives = 231/311 (74%), Gaps = 7/311 (2%)
 Frame = -3

Query  1393  NERVVKWLNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPF  1214
              E ++K+L  +AKPYL V+FLQ   AGSAI++K+ALN GM+ + F+ YRN+ AAV+FAPF
Sbjct  6     KECLIKFLK-EAKPYLAVIFLQFGYAGSAIIAKSALNHGMSHYAFAVYRNSFAAVVFAPF  64

Query  1213  ALFLERKTRPTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFL  1037
             A  LERK RP MT SIF+KI+LL LLE  ++ NLYY GM+YTTAT +  M N++PA+TFL
Sbjct  65    AAILERKIRPKMTLSIFWKIMLLGLLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFL  124

Query  1036  LAWIFRLEKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQH  857
             LAWI RLE V I  +HSQAKIVGT   +GGAM+MTLV GP I LPWTKHS    S ++  
Sbjct  125   LAWILRLENVNIWKIHSQAKIVGTIITLGGAMVMTLVGGPTIGLPWTKHSTTTTSVASPT  184

Query  856   VLNQHSNPIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLI  677
              L    NP+K  L +   C   A F  LQ   +K+YPAGLSLT+LIC  G+LQ + LTL+
Sbjct  185   EL----NPVKGALFILVGCFCWACFYNLQMITLKAYPAGLSLTSLICMAGALQGTALTLV  240

Query  676   VERGNASVWSLQWDMT-LLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVA  500
             VERGN++VWS+QW  + L  YVY G+V SG  YY+ G+IM VKGPVFVTAFNPL+MV+VA
Sbjct  241   VERGNSAVWSIQWGSSKLFAYVYCGIVNSGIGYYVSGLIMNVKGPVFVTAFNPLNMVIVA  300

Query  499   IIGSFVLSEKL  467
             I+GSF+LSE+L
Sbjct  301   ILGSFILSEQL  311



>ref|XP_011072598.1| PREDICTED: WAT1-related protein At2g39510-like isoform X1 [Sesamum 
indicum]
Length=386

 Score =   318 bits (816),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 169/309 (55%), Positives = 219/309 (71%), Gaps = 9/309 (3%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
               AKPYL V+ LQ  S GSAI++K+ALN GM+ +TFS YRN +A V+ APFAL LERK R
Sbjct  7     RKAKPYLAVIMLQFGSTGSAIIAKSALNHGMSHYTFSVYRNIVATVVMAPFALVLERKIR  66

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT SIF+KIVLLALLE  ++ NLYY GM+YTTAT +  M N++PA+TFLLAW   LE+
Sbjct  67    PRMTFSIFYKIVLLALLEPVIDQNLYYAGMKYTTATFASAMCNVLPAITFLLAWALGLER  126

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSN-DVVSHSAQHVLNQHSNP  833
             V I+   SQAK+ GT   + GAMIMTLV+G II LPWT+HS+ +    +A    N H NP
Sbjct  127   VNIKRWSSQAKVAGTLVTVSGAMIMTLVRGSIIGLPWTRHSHINSQLTAADADANSHQNP  186

Query  832   IKATLLLAGSCCSTAIFIILQANM-------IKSYPAGLSLTTLICTIGSLQCSILTLIV  674
             ++  L++   C   +IF ILQ  +       +KSYPAGLSLT LIC  G+LQ + LTL+ 
Sbjct  187   VRGALMITAGCFCWSIFYILQKKLTYLQAITLKSYPAGLSLTALICMGGALQGTALTLVA  246

Query  673   ERGNASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAII  494
             E+ N ++W+++ D  LL YVY GLV SG  YY+ G++ K KGPVF T+FNPLSMV VA++
Sbjct  247   EKSNTAIWTIRGDTKLLAYVYSGLVGSGITYYVAGVVSKEKGPVFATSFNPLSMVFVAVM  306

Query  493   GSFVLSEKL  467
              SF+L+E+L
Sbjct  307   SSFILAEQL  315



>ref|XP_009798400.1| PREDICTED: WAT1-related protein At2g39510 [Nicotiana sylvestris]
Length=373

 Score =   318 bits (814),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 202/359 (56%), Positives = 262/359 (73%), Gaps = 10/359 (3%)
 Frame = -3

Query  1393  NERVVKWLNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPF  1214
              E ++K+L  +AKPYL V+FLQ   AGSAI++K+ALN GM+ +TF+ YRNA AAV+FAPF
Sbjct  6     KECLIKFLK-EAKPYLAVIFLQFGYAGSAIIAKSALNHGMSHYTFAVYRNAFAAVVFAPF  64

Query  1213  ALFLERKTRPTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFL  1037
             A   ERK RP MT SIF+KI+LL LLE  ++ NLYY GM++TTAT +  M N++PA+TFL
Sbjct  65    AALFERKIRPKMTFSIFWKIMLLGLLEPVIDQNLYYAGMKFTTATFATAMCNVLPAITFL  124

Query  1036  LAWIFRLEKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQH  857
             LAWI RLE V I  +HSQAKIVGT   +GGAM+MTLV GP I LPWTKHS+   +  A  
Sbjct  125   LAWILRLENVNIWKIHSQAKIVGTIITLGGAMVMTLVGGPTIGLPWTKHSSTATTSVASP  184

Query  856   VLNQHSNPIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLI  677
                   NP+K  L +   C   A F  LQ   +K+YPAGLSLT+LIC  G+LQ + LTL+
Sbjct  185   T---ELNPVKGALFILVGCFCWACFYNLQMITLKAYPAGLSLTSLICMAGALQGTALTLV  241

Query  676   VERGNASVWSLQWDMT-LLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVA  500
             VERGN++VWS+QW  + L+  VY G+V SG  YY+ G+IM VKGPVFVTAFNPL+MV+VA
Sbjct  242   VERGNSAVWSIQWGSSKLIASVYCGIVNSGIGYYVSGLIMNVKGPVFVTAFNPLNMVIVA  301

Query  499   IIGSFVLSEKLYMgrvlgavvvlvglylviwGKSKDQTSPD----NNDALPIDHKQPQV  335
             I+GSF+LSE+L +GRV+GA V+++GLYLVIWG +K+Q S      N +   +D + P++
Sbjct  302   ILGSFILSEQLNLGRVVGAAVIVIGLYLVIWGTTKEQKSSKILSTNEEVEQVDKELPEI  360



>gb|EYU38348.1| hypothetical protein MIMGU_mgv1a009263mg [Erythranthe guttata]
Length=348

 Score =   315 bits (807),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 168/303 (55%), Positives = 216/303 (71%), Gaps = 3/303 (1%)
 Frame = -3

Query  1372  LNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERK  1193
             L    KPYL ++F+Q   AG AI++K AL+QGM+ +T S YRNAIA ++ APFAL LERK
Sbjct  5     LVKKVKPYLAIVFMQFGYAGFAIIAKTALDQGMSNYTLSIYRNAIATLVVAPFALLLERK  64

Query  1192  TRPTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRL  1016
              RP MT S+ +KI LLA LE  ++ NLYY+GM++TTAT S  M N++PA+TFLLAW  RL
Sbjct  65    IRPKMTVSVLWKIALLAFLEPVIDQNLYYMGMKHTTATFSTAMCNILPAITFLLAWALRL  124

Query  1015  EKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSN  836
             EKV +R  H  AKI+GT + +GGAMIMTLV+G II LPWTK   +  S SA  V+    +
Sbjct  125   EKVNVRRAHGYAKILGTFATLGGAMIMTLVQGSIIGLPWTKIEPN--SESADGVVITTQD  182

Query  835   PIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNAS  656
             P+K  L++   C   +IF ILQA  +KSY A LSLT LIC  G LQ  +LTL VERGN S
Sbjct  183   PVKGALMITVGCFCCSIFYILQAITMKSYAAPLSLTCLICMAGMLQGIVLTLAVERGNFS  242

Query  655   VWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLS  476
             +WS+ WD  LL Y Y G++ SG  YY+ GI+M  KGPVFVT+FNPL+MV+VA++ SF+ +
Sbjct  243   IWSIGWDTKLLAYTYSGVICSGVSYYVSGIVMNEKGPVFVTSFNPLNMVIVAVLSSFIFA  302

Query  475   EKL  467
             E+L
Sbjct  303   EQL  305



>ref|XP_010669871.1| PREDICTED: WAT1-related protein At2g39510 [Beta vulgaris subsp. 
vulgaris]
Length=366

 Score =   315 bits (808),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 187/371 (50%), Positives = 256/371 (69%), Gaps = 13/371 (4%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             N  KPYL V+F+Q   AG AI++K ALN+GM+ ++F  YR A+AA++ +PFAL LERK R
Sbjct  5     NGVKPYLAVIFMQFGIAGLAIIAKFALNKGMSHYSFVVYRQAVAAIVISPFALVLERKVR  64

Query  1186  PTMTTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P M+ SIF KI +L  L   ++ NLYY GM+YTTAT    + N +PA+TF++AWIFRLEK
Sbjct  65    PNMSVSIFIKIALLGLLEPVIDQNLYYAGMQYTTATFVSALSNTVPALTFIMAWIFRLEK  124

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             V +R + S AK+ GT   IGGA IMTLVKGP + LPW K   + V++++      H +PI
Sbjct  125   VNLREVRSLAKVGGTMVTIGGATIMTLVKGPGVKLPWIKRDYNHVTNTS-----YHQDPI  179

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
             K  +++   C   A F+ILQA  ++SYPA +SLT L+C  G+++  I+ LI+ER N S+W
Sbjct  180   KGAIMITSGCMGWAAFVILQAITLRSYPAEMSLTALMCFAGAVEGGIIALIMER-NTSIW  238

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
             SL WD  LL Y+Y G+V S   +++ G IM+ KGPVFVTAFNPLSMV+VAI+GSF+L+E+
Sbjct  239   SLHWDPKLLAYIYSGVVCSAIGFFLQGKIMQEKGPVFVTAFNPLSMVIVAILGSFILAEQ  298

Query  469   LYMgrvlgavvvlvglylviwGKSKDQTSPDNNDA---LPIDHKQPQVVQGFNKDITVSL  299
             L +GR+ GAVV++ GLY+VIWGKSKD+    +N     LPID   P+  QG  KD   S+
Sbjct  299   LTLGRITGAVVIVSGLYIVIWGKSKDKDQTSHNTTEQILPID--SPKTNQGSTKD-DASV  355

Query  298   N*KVELPRSHP  266
             +  V + +  P
Sbjct  356   DNDVNMHKEIP  366



>ref|XP_009143306.1| PREDICTED: WAT1-related protein At2g39510-like [Brassica rapa]
Length=375

 Score =   313 bits (802),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 183/345 (53%), Positives = 245/345 (71%), Gaps = 7/345 (2%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             N  KP+L V+ LQ   AG +I++K AL++GM+P   + YR+ +A V  APFA FL+RK R
Sbjct  4     NTWKPFLTVVSLQFGYAGLSIIAKFALDRGMSPHVLAAYRHIVATVFIAPFAFFLDRKIR  63

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT  IFFKI+LL LLE  ++ NLYY GM+YT+AT +  M N++PA  FL+AWIFRLEK
Sbjct  64    PKMTLPIFFKILLLGLLEPTIDQNLYYTGMKYTSATFTAAMTNVLPAFAFLMAWIFRLEK  123

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             V IR +HSQAKI+GT   +GGAM+MT+VKGP+I LPW   S++   H     L    +  
Sbjct  124   VNIRKIHSQAKILGTVVTVGGAMLMTVVKGPLIPLPWAHPSDN---HQDSSNLGVKQDLT  180

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
             K  LL+A  C   A F+ LQA  +KSYP  LSLT LIC +GS++ +I+ L +ERGN S W
Sbjct  181   KGALLIATGCICWAGFVNLQAITLKSYPVELSLTALICLMGSIESTIVALFIERGNPSAW  240

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
             ++Q D  LL  VY G++ SG  YY+ G+IMK +GPVFVTAFNPLSMV+VAI+GS +LSE 
Sbjct  241   AIQLDSKLLAAVYGGVICSGVGYYVQGVIMKTRGPVFVTAFNPLSMVIVAIMGSIILSEV  300

Query  469   LYMgrvlgavvvlvglylviwGKSKDQTS---PDNNDALPIDHKQ  344
             +Y+GR+LGA+V+++GLY V+WGKSKD+ +    D +  LP+ + Q
Sbjct  301   MYLGRILGAIVIVLGLYSVLWGKSKDEPANSFSDTDKELPVSNIQ  345



>ref|XP_007162672.1| hypothetical protein PHAVU_001G170400g [Phaseolus vulgaris]
 gb|ESW34666.1| hypothetical protein PHAVU_001G170400g [Phaseolus vulgaris]
Length=382

 Score =   312 bits (800),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 182/331 (55%), Positives = 250/331 (76%), Gaps = 4/331 (1%)
 Frame = -3

Query  1372  LNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERK  1193
             L N  KP++GV+FLQ   AG  +LSKAALN+GM+ + F  YR+  A V+ APFA+FLE+K
Sbjct  8     LFNRLKPFIGVVFLQFGYAGMDVLSKAALNKGMSNYVFVVYRHVFAFVVMAPFAVFLEKK  67

Query  1192  TRPTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRL  1016
              RP MT SIF K+V+L+LLE  ++ NLY++GM+YTTAT +V+M N++PA+TFL+AWI RL
Sbjct  68    VRPKMTFSIFMKLVILSLLEPVIDQNLYFLGMKYTTATFAVSMYNVLPAITFLMAWILRL  127

Query  1015  EKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSN  836
             EK+K++++ SQAK+VGT + + GAMIMTL+KGPI+ L  T H N+  +     V  QH+ 
Sbjct  128   EKIKLKSIRSQAKVVGTLATVAGAMIMTLLKGPILDLFGT-HGNNTNNLQNGGVNLQHA-  185

Query  835   PIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNAS  656
              IK ++++   C S A F+ILQA  I++YPA LSLT  IC +G+++  I+ L++ER N S
Sbjct  186   -IKGSVMITIGCFSCACFMILQAITIEAYPAELSLTAWICLLGTVEGGIVALVMERNNFS  244

Query  655   VWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLS  476
              WSLQWD  LL  VY G+V SG  YYI G++MK +GPVFVT FNPL MV+VAI+GSF L+
Sbjct  245   AWSLQWDTKLLAAVYSGIVCSGMAYYIQGVVMKDRGPVFVTTFNPLCMVIVAIMGSFFLA  304

Query  475   EKLYMgrvlgavvvlvglylviwGKSKDQTS  383
             E++Y+GR +GA+V+++GLYLV+WGKSKD  S
Sbjct  305   EQMYLGRAVGAIVIILGLYLVVWGKSKDYGS  335



>ref|XP_008447554.1| PREDICTED: WAT1-related protein At2g37460-like [Cucumis melo]
Length=373

 Score =   312 bits (799),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 184/351 (52%), Positives = 251/351 (72%), Gaps = 6/351 (2%)
 Frame = -3

Query  1393  NERVVKWLNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPF  1214
             N +V +W  + AKP+  V+FLQ   AG  ILSKAALNQGM+ +    YR+A+A ++ APF
Sbjct  2     NSQVSQWCVS-AKPFFAVVFLQFGLAGMDILSKAALNQGMSNYVLVVYRHAVATIVIAPF  60

Query  1213  ALFLERKTRPTMTTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFL  1037
             AL  ++K RP MT  +F K+ VL  L   ++ NLY++GM+YTTAT +  M N++PA+TF+
Sbjct  61    ALIFDKKVRPKMTIPVFAKLMVLSLLEPVIDQNLYFLGMKYTTATFAAAMCNILPAITFV  120

Query  1036  LAWIFRLEKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQH  857
             +AWI RLEKV+I+++ SQAKIVGT + +GGAMIMTL+KGPI+ L W K        S + 
Sbjct  121   MAWILRLEKVRIKSIRSQAKIVGTVATVGGAMIMTLMKGPILELFWVKERGTNPQQSGEI  180

Query  856   VLNQHSNPIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLI  677
              L QH+  IK ++++   C S A F+ILQA  +K+YPA LSLT  IC +G+ + +++ L+
Sbjct  181   SL-QHT--IKGSIMITIGCFSWACFMILQAITLKAYPAELSLTAWICLLGTAEGTVVALV  237

Query  676   VERGNASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAI  497
             +ERGN +VWS+ W   LL  VY G+  SG  YYI G++MK KGPVFVTAF+PLSMV+VAI
Sbjct  238   MERGNPAVWSITWGTKLLAAVYSGIFCSGLAYYIQGLVMKDKGPVFVTAFSPLSMVIVAI  297

Query  496   IGSFVLSEKLYMgrvlgavvvlvglylviwGKSKDQTSPDNNDALPIDHKQ  344
             + SF+L E+LY GRVLGAVV++VGLYLV+WGK+KD+    N D L +  KQ
Sbjct  298   MSSFILGERLYFGRVLGAVVIIVGLYLVVWGKNKDENCSSNED-LKLPTKQ  347



>ref|XP_009614496.1| PREDICTED: WAT1-related protein At2g37460-like isoform X1 [Nicotiana 
tomentosiformis]
Length=379

 Score =   311 bits (798),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 180/348 (52%), Positives = 258/348 (74%), Gaps = 5/348 (1%)
 Frame = -3

Query  1387  RVVKWLNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFAL  1208
             + V+ L   +KP++ V+FLQ   AG  IL+K ALN+GM+ + F  YR+A+A +  APFA+
Sbjct  2     KAVRELFIRSKPFIAVIFLQFGLAGMDILTKMALNEGMSNYVFVVYRHAVATLAIAPFAM  61

Query  1207  FLERKTRPTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLA  1031
              L++K RP MT SIF K+VLL++LE  ++ NLY +G++YTTAT +  M N++PA+TF++A
Sbjct  62    ILDKKIRPKMTLSIFTKLVLLSILEPVIDQNLYSIGLKYTTATFAAAMCNILPAITFIMA  121

Query  1030  WIFRLEKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVL  851
             WIFRLE+VK+ ++ SQAKI+GT + + GAMIMTLV+GP+I L WTK ++   SH +Q   
Sbjct  122   WIFRLERVKLTSIRSQAKIIGTIATVAGAMIMTLVRGPVIELFWTKGNS---SHESQSGG  178

Query  850   NQHSNPIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVE  671
                S+ IK +LL+   C S A F+ILQA  +++YPA LSLT  IC +G+ + +I+ +++E
Sbjct  179   LNLSHAIKGSLLITIGCFSWAAFMILQAITLRTYPAELSLTAWICLLGTAEGAIVAMVME  238

Query  670   RGNASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIG  491
             RG A+VW+++WD   L  VY G+  SG  YYI G+IMK +GPVFVTAFNPLSMV+VAI+ 
Sbjct  239   RGKAAVWAIKWDTKFLAAVYSGIFCSGLAYYIQGVIMKDRGPVFVTAFNPLSMVIVAILS  298

Query  490   SFVLSEKLYMgrvlgavvvlvglylviwGKSKDQTSPDNND-ALPIDH  350
             SF+L E++ +GRVLGAVV+++GLY+V+WGKSKDQ SP  ++ A+P   
Sbjct  299   SFILREQMNLGRVLGAVVIVLGLYIVLWGKSKDQKSPSTDEQAIPTQE  346



>emb|CDY20446.1| BnaC04g05980D [Brassica napus]
Length=375

 Score =   311 bits (797),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 181/345 (52%), Positives = 245/345 (71%), Gaps = 7/345 (2%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             N  KP+L V+ LQ   AG +I++K AL++GM+P   + YR+ +A +  APFA FL+RK R
Sbjct  4     NTWKPFLTVVSLQFGYAGLSIIAKFALDRGMSPHVLAAYRHIVATIFIAPFAFFLDRKIR  63

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT  IFF+I+LL LLE  ++ NLYY GM+YT+AT +  M N++PA  FL+AWIFRLEK
Sbjct  64    PKMTLPIFFEILLLGLLEPTIDQNLYYTGMKYTSATFTAAMTNVLPAFAFLMAWIFRLEK  123

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             V IR +HSQAKI+GT   +GGAM+MT+VKGP+I LPW   S++   H     L    +  
Sbjct  124   VNIRKIHSQAKILGTVVTVGGAMLMTVVKGPLIPLPWAHPSDN---HQDSSNLGVKQDLT  180

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
             K  LL+A  C   A F+ LQA  +KSYP  LSLT LIC +GS++ +I+ L +ERGN S W
Sbjct  181   KGALLIATGCICWAGFVNLQAITLKSYPVELSLTALICLMGSIESTIVALFIERGNPSAW  240

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
             ++Q D  LL  VY G++ SG  YY+ G+IMK +GPVFVTAFNPLSMV+VAI+GS +LSE 
Sbjct  241   AIQLDSKLLAAVYGGIICSGVGYYVQGVIMKTRGPVFVTAFNPLSMVIVAILGSIILSEV  300

Query  469   LYMgrvlgavvvlvglylviwGKSKDQTS---PDNNDALPIDHKQ  344
             +Y+GR+LGA+V+++GLY V+WGKSKD+ +    D +  LP+ + Q
Sbjct  301   MYLGRILGAIVIVLGLYSVLWGKSKDEPANSFSDTDKELPLSNIQ  345



>emb|CDY53594.1| BnaA05g34670D [Brassica napus]
Length=375

 Score =   311 bits (797),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 181/345 (52%), Positives = 245/345 (71%), Gaps = 7/345 (2%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             N  KP+L V+ LQ   AG +I++K AL++GM+P   + YR+ +A +  APFA FL+RK R
Sbjct  4     NTWKPFLTVVSLQFGYAGLSIIAKFALDRGMSPHVLAAYRHIVATIFIAPFAFFLDRKIR  63

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT  IFFKI+LL LLE  ++ NLYY GM+YT+AT +  M N++PA  FL+AWIFRLEK
Sbjct  64    PKMTLPIFFKILLLGLLEPTIDQNLYYTGMKYTSATFTAAMTNVLPAFAFLMAWIFRLEK  123

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             V IR +HSQAKI+GT   +GGAM+MT+VKGP+I LPW   S++   H     L    +  
Sbjct  124   VNIRKIHSQAKILGTVVTVGGAMLMTVVKGPLIPLPWAHPSDN---HQDSSNLGVKQDLT  180

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
             K  LL+A  C   A F+ LQA  +KSYP  LSLT LIC +GS++ +I+ L +ERGN S W
Sbjct  181   KGALLIATGCICWAGFVNLQAITLKSYPVELSLTALICLMGSIESTIVALFIERGNPSAW  240

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
             ++Q D  L+  VY G++ SG  YY+ G+IMK +GPVFVTAFNPLSMV+VAI+GS +LSE 
Sbjct  241   AIQLDSKLVAAVYGGVICSGVGYYVQGVIMKTRGPVFVTAFNPLSMVIVAIMGSIILSEV  300

Query  469   LYMgrvlgavvvlvglylviwGKSKDQTS---PDNNDALPIDHKQ  344
             +Y+GR+LGA+V+++GLY V+WGKSKD+ +    D +  LP+ + Q
Sbjct  301   MYLGRILGAIVIVLGLYSVLWGKSKDEPANSFSDTDKELPVSNIQ  345



>gb|KDO67719.1| hypothetical protein CISIN_1g042257mg [Citrus sinensis]
Length=383

 Score =   311 bits (796),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 174/347 (50%), Positives = 248/347 (71%), Gaps = 5/347 (1%)
 Frame = -3

Query  1378  KWLNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLE  1199
             ++L+++AKPYLGV+F+Q   +  ++++K ALNQGM+P+    YR  +A ++ APFA  LE
Sbjct  8     QFLSHNAKPYLGVIFMQFCYSIMSVIAKLALNQGMSPYVLVAYRMVVATILIAPFAFVLE  67

Query  1198  RKTRPTMTTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIF  1022
             RKTRP MT  IF KI ++      ++ NLYY GM+YTTAT +V M N++PA+TFL+AWIF
Sbjct  68    RKTRPKMTLPIFAKIALVSLFEPVISQNLYYTGMKYTTATFTVAMCNILPALTFLMAWIF  127

Query  1021  RLEKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQH  842
             RLEKVKI++ HSQAKI+GT    GGAM MTL+KGPI+  PW K    + +     + N  
Sbjct  128   RLEKVKIKSTHSQAKILGTIVTAGGAMCMTLLKGPILKFPW-KQVRLLHNQLETGIQNNE  186

Query  841   SNPIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGN  662
              +  K  LL+A  C + + FIILQA ++KSYPA LSLT LIC + S++ +ILTL +ERGN
Sbjct  187   EDLTKGALLIAAGCFAWSCFIILQAFLLKSYPAELSLTALICFMSSVEGTILTLAIERGN  246

Query  661   ASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFV  482
               +W L +D  LL  +Y G V S   Y+I G +MK +GPVFV++FNPL MV++A++GSF 
Sbjct  247   TGIWLLHFDAKLLAVIYGGFV-SCTAYFIMGWLMKRRGPVFVSSFNPLGMVIIAVLGSFF  305

Query  481   LSEKLYMgrvlgavvvlvglylviwGKSKDQ--TSPDNNDALPIDHK  347
             L+EKLY+GR++GAV++++GLY+V+WG++KD+  +  DNN+    D +
Sbjct  306   LAEKLYLGRIIGAVIIVIGLYMVLWGRNKDRSPSKSDNNEVTQPDQQ  352



>ref|XP_006436052.1| hypothetical protein CICLE_v10031808mg [Citrus clementina]
 ref|XP_006486061.1| PREDICTED: WAT1-related protein At2g39510-like [Citrus sinensis]
 gb|ESR49292.1| hypothetical protein CICLE_v10031808mg [Citrus clementina]
Length=383

 Score =   310 bits (795),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 174/347 (50%), Positives = 247/347 (71%), Gaps = 5/347 (1%)
 Frame = -3

Query  1378  KWLNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLE  1199
             ++L+++AKPYLGV+F+Q   +  ++++K ALNQGM+P+    YR  +A ++ APFA  LE
Sbjct  8     QFLSHNAKPYLGVIFMQFCYSIMSVIAKLALNQGMSPYVLVAYRMVVATILIAPFAFVLE  67

Query  1198  RKTRPTMTTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIF  1022
             RKTRP MT  IF KI ++      ++ NLYY GM+YTTAT +V M N++PA+TFL+AWIF
Sbjct  68    RKTRPKMTLPIFAKIALVSLFEPVISQNLYYTGMKYTTATFTVAMCNILPALTFLMAWIF  127

Query  1021  RLEKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQH  842
             RLEKVKI++ HSQAKI+GT    GGAM MTL KGPI+  PW K    + +     + N  
Sbjct  128   RLEKVKIKSTHSQAKILGTIVTAGGAMCMTLFKGPILKFPW-KQVRLLHNQLETSIQNNE  186

Query  841   SNPIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGN  662
              +  K  LL+A  C + + FIILQA ++KSYPA LSLT LIC + S++ +ILTL +ERGN
Sbjct  187   EDLTKGALLIAAGCFAWSCFIILQAFLLKSYPAELSLTALICFMSSVEGTILTLAIERGN  246

Query  661   ASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFV  482
               +W L +D  LL  +Y G V S   Y+I G +MK +GPVFV++FNPL MV++A++GSF 
Sbjct  247   TGIWLLHFDAKLLAVIYGGFV-SCTAYFIMGWLMKRRGPVFVSSFNPLGMVIIAVLGSFF  305

Query  481   LSEKLYMgrvlgavvvlvglylviwGKSKDQ--TSPDNNDALPIDHK  347
             L+EKLY+GR++GAV++++GLY+V+WG++KD+  +  DNN+    D +
Sbjct  306   LAEKLYLGRIIGAVIIVIGLYMVLWGRNKDRSPSKSDNNEVTQPDQQ  352



>ref|XP_009778852.1| PREDICTED: WAT1-related protein At2g37460-like isoform X1 [Nicotiana 
sylvestris]
Length=379

 Score =   310 bits (793),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 177/339 (52%), Positives = 254/339 (75%), Gaps = 5/339 (1%)
 Frame = -3

Query  1360  AKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPT  1181
             +KP++ V+FLQ   AG  IL+K ALN+GM+ + F  YR+A+A +  APFA+ L++K RP 
Sbjct  11    SKPFIAVIFLQFGLAGMDILTKMALNEGMSNYVFVVYRHAVATLAIAPFAIILDKKIRPK  70

Query  1180  MTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVK  1004
             MT SIF K+VLL++LE  ++ NLY +G++YTTAT +  M N++PA+TF++AWIFRLE+VK
Sbjct  71    MTLSIFTKLVLLSILEPVIDQNLYSIGLKYTTATFAAAMCNILPAITFIMAWIFRLERVK  130

Query  1003  IRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKA  824
             + ++ SQAKI+GT + + GAMIMTLV+GP+I L WTK ++   SH +Q      S+ IK 
Sbjct  131   LTSIRSQAKIIGTVATVAGAMIMTLVRGPVIELFWTKGNS---SHESQSGGLNLSHAIKG  187

Query  823   TLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSL  644
             +L++   C S A F+ILQA  +++YPA LSLT  IC +G+ + +I+ +++ERG A+VW++
Sbjct  188   SLMITIGCFSWAAFMILQAITLRTYPAELSLTAWICLLGTAEGAIVAMVMERGKAAVWAI  247

Query  643   QWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLY  464
             +WD   L  VY G+  SG  YYI G+IMK +GPVFVTAFNPLSMV+VAI+ SF+L E++ 
Sbjct  248   KWDTKFLAAVYSGIFCSGLAYYIQGVIMKDRGPVFVTAFNPLSMVIVAILSSFILREQMN  307

Query  463   MgrvlgavvvlvglylviwGKSKDQTSPDNND-ALPIDH  350
             +GRVLGAVV+++GLY+V+WGKSKDQ SP  ++ A+P   
Sbjct  308   LGRVLGAVVIVLGLYIVLWGKSKDQKSPSADEQAIPTQE  346



>ref|XP_002528467.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
 gb|EEF33950.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
Length=381

 Score =   310 bits (793),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 179/333 (54%), Positives = 240/333 (72%), Gaps = 5/333 (2%)
 Frame = -3

Query  1360  AKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPT  1181
             AKP+L V+ LQ   AG +I+SK ALNQGM+      YR+A+A ++  PFA+  +RK RP 
Sbjct  13    AKPFLAVILLQFGYAGLSIISKFALNQGMSQHVLVVYRHAVATIVITPFAILFDRKVRPK  72

Query  1180  MTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVK  1004
             MT SIF KI+++ LLE  ++ NLYY GM+YTTAT + TM N++PA  F++AWI RLEKV 
Sbjct  73    MTISIFLKILMMGLLEPTIDQNLYYTGMKYTTATFAATMCNILPAFAFIMAWILRLEKVN  132

Query  1003  IRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKA  824
             ++ +HSQAK++GT   +GGAMIMTLVKG  + LPWT+  ND+   S+   +    + IK 
Sbjct  133   LKRVHSQAKLLGTIVTVGGAMIMTLVKGAKLNLPWTEGYNDIQGSSSAPTMQ---DTIKG  189

Query  823   TLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSL  644
               L+   C   + FIILQA  +K+YPA LSLT  IC +G+++ +I  +I+ERGN S WS+
Sbjct  190   ASLIGVGCICWSAFIILQAITLKTYPAELSLTAFICLMGTIEGTIFAVIMERGNPSAWSI  249

Query  643   QWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLY  464
              +D  LL  VY G++ SG  YY+ G+IMK KGPVFVTAFNPL M++V I+GSFVLSE +Y
Sbjct  250   HFDTKLLACVYSGVICSGVAYYVQGVIMKSKGPVFVTAFNPLCMIIVTILGSFVLSEIVY  309

Query  463   MgrvlgavvvlvglylviwGKSKDQT-SPDNND  368
              GRVLGA+V+++GLYLV+WGKSKDQ+ S  NND
Sbjct  310   FGRVLGALVIVIGLYLVLWGKSKDQSPSTSNND  342



>gb|KHN02414.1| Auxin-induced protein 5NG4-like protein [Glycine soja]
Length=383

 Score =   309 bits (792),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 180/356 (51%), Positives = 253/356 (71%), Gaps = 6/356 (2%)
 Frame = -3

Query  1372  LNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERK  1193
             L N  KP++GV+FLQ   AG  ILSKAALN+GM+ + F  YR+  A V+ APFAL LE+K
Sbjct  8     LFNRLKPFIGVVFLQFGYAGMDILSKAALNKGMSNYVFVVYRHVFAFVVTAPFALILEKK  67

Query  1192  TRPTMTTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRL  1016
              RP MT SIF KI +L  L   ++ NLY++GM+YTTAT +V+M N++PA+TF++AWIFRL
Sbjct  68    VRPKMTFSIFMKIMILSLLEPVIDQNLYFLGMKYTTATFAVSMYNVLPAITFVMAWIFRL  127

Query  1015  EKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSN  836
             EKVK++++ SQAK+VGT + + GAM+MTL+KGP++ L  T  SN   +H+ Q+      +
Sbjct  128   EKVKLKSIRSQAKVVGTLATVAGAMVMTLIKGPVLDLFGTHTSN---THNQQNGGVNLQH  184

Query  835   PIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNAS  656
              IK ++++   C S A F+ILQA  I++YPA LSLT  IC +G+++  ++ L++ER N S
Sbjct  185   AIKGSVMITIGCFSCACFMILQAITIEAYPAELSLTAWICLLGTVEGGVVALVMERKNLS  244

Query  655   VWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLS  476
              WSLQWD  LL  VY G+V SG  YYI G +MK +GPVFVT FNPL MV+VAI+GSF L+
Sbjct  245   AWSLQWDTKLLAAVYSGIVCSGMAYYIQGAVMKDRGPVFVTTFNPLCMVIVAIMGSFFLA  304

Query  475   EKLYMgrvlgavvvlvglylviwGKSKD--QTSPDNNDALPIDHKQPQVVQGFNKD  314
             E +Y+GR +GA+V+++GLYLV+WGKS+D   +SP   + +    +  +   G  +D
Sbjct  305   EIMYLGRAVGAIVIILGLYLVVWGKSQDYESSSPITKEHILASKQTVEENNGKEED  360



>ref|XP_007009428.1| Nodulin MtN21 /EamA-like transporter family protein [Theobroma 
cacao]
 gb|EOY18238.1| Nodulin MtN21 /EamA-like transporter family protein [Theobroma 
cacao]
Length=376

 Score =   308 bits (790),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 196/375 (52%), Positives = 259/375 (69%), Gaps = 13/375 (3%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             N AKP+L V+FLQ   AG +I++K ALNQGM+   F  YR+AIA ++ APFA+ L+RK R
Sbjct  6     NQAKPFLAVIFLQFGYAGMSIIAKFALNQGMSQHVFVMYRHAIAFLVIAPFAIVLDRKVR  65

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT SIF K++LL LLE  ++ NLY+ GM+YT+AT +  M N++PA  F+LAWIF+LEK
Sbjct  66    PKMTLSIFVKLLLLGLLEPTIDQNLYFTGMKYTSATFTAAMCNVLPAFAFVLAWIFKLEK  125

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             V I+ LHSQAKI+GT   +GGAM+MTL+ GP++ LPW   +N  V  SA        + I
Sbjct  126   VHIKKLHSQAKILGTMVTVGGAMLMTLINGPMLNLPWANPNNQHVFSSAA----AKQDHI  181

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
             K  +++A  C   A FIILQA  +KSYPA LSLT LIC +G+++ SI+ L  E GNA+ W
Sbjct  182   KGAVMIAVGCFCWAGFIILQAITLKSYPAELSLTALICLVGTIEGSIVALAREAGNAAAW  241

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
             S+  D+  L  VY G+V SG  YY+  +IMK +GPVFVTAFNPL+MV+VAI+GSFVLSE 
Sbjct  242   SVHLDVKFLAAVYGGVVCSGVGYYLQAVIMKARGPVFVTAFNPLTMVIVAILGSFVLSEV  301

Query  469   LYMgrvlgavvvlvglylviwGKSKDQTSPD-NNDALP-IDHKQPQVVQ---GFNKDITV  305
             LY GRV+GA+V+++GLYLV+WGKSKDQ S + + D  P  D K   + +   G N+D  V
Sbjct  302   LYSGRVIGAIVIVIGLYLVLWGKSKDQPSSNLDVDVEPSSDQKMTAMDETKVGPNQDYVV  361

Query  304   SLN*KVELPRSHPHD  260
                  V   R +P D
Sbjct  362   L---DVTSNRVNPSD  373



>ref|XP_003553527.1| PREDICTED: WAT1-related protein At2g37460-like [Glycine max]
Length=383

 Score =   308 bits (790),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 179/356 (50%), Positives = 253/356 (71%), Gaps = 6/356 (2%)
 Frame = -3

Query  1372  LNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERK  1193
             L N  KP++GV+FLQ   AG  +LSKAALN+GM+ + F  YR+  A V+ APFAL LE+K
Sbjct  8     LFNRLKPFIGVVFLQFGYAGMDVLSKAALNKGMSNYVFVVYRHVFAFVVTAPFALILEKK  67

Query  1192  TRPTMTTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRL  1016
              RP MT SIF KI +L  L   ++ NLY++GM+YTTAT +V+M N++PA+TF++AWIFRL
Sbjct  68    VRPKMTFSIFMKIMILSLLEPVIDQNLYFLGMKYTTATFAVSMYNVLPAITFVMAWIFRL  127

Query  1015  EKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSN  836
             EKVK++++ SQAK+VGT + + GAM+MTL+KGP++ L  T  SN   +H+ Q+      +
Sbjct  128   EKVKLKSIRSQAKVVGTLATVAGAMVMTLIKGPVLDLFGTHTSN---THNQQNGGVNLQH  184

Query  835   PIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNAS  656
              IK ++++   C S A F+ILQA  I++YPA LSLT  IC +G+++  ++ L++ER N S
Sbjct  185   AIKGSVMITIGCFSCACFMILQAITIEAYPAELSLTAWICLLGTVEGGVVALVMERKNLS  244

Query  655   VWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLS  476
              WSLQWD  LL  VY G+V SG  YYI G +MK +GPVFVT FNPL MV+VAI+GSF L+
Sbjct  245   AWSLQWDTKLLAAVYSGIVCSGMAYYIQGAVMKDRGPVFVTTFNPLCMVIVAIMGSFFLA  304

Query  475   EKLYMgrvlgavvvlvglylviwGKSKD--QTSPDNNDALPIDHKQPQVVQGFNKD  314
             E +Y+GR +GA+V+++GLYLV+WGKS+D   +SP   + +    +  +   G  +D
Sbjct  305   EIMYLGRAVGAIVIILGLYLVVWGKSQDYESSSPITKEHILASKQTVEENNGKEED  360



>ref|XP_010067380.1| PREDICTED: WAT1-related protein At2g39510-like [Eucalyptus grandis]
Length=382

 Score =   308 bits (790),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 188/358 (53%), Positives = 256/358 (72%), Gaps = 10/358 (3%)
 Frame = -3

Query  1402  MMRN-ERVVKWLNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVI  1226
             M RN ERV++ L+   KPYL V+ LQ   AG AI++K +LN+GMN   F  YR+A A  +
Sbjct  1     MSRNGERVIRVLSR-LKPYLAVVLLQFGFAGMAIVAKFSLNRGMNQHVFVVYRHAFAIAV  59

Query  1225  FAPFALFLERKTRPTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPA  1049
              APFA+  ERKTRP MT S+F KI+LL LLE  ++ NL+Y GM+YTTA+ +  M N++PA
Sbjct  60    VAPFAILFERKTRPKMTRSVFLKILLLGLLEPVIDQNLFYTGMKYTTASFTAAMSNMLPA  119

Query  1048  MTFLLAWIFRLEKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSH  869
              TFL+AW FRLE++ IR+ HSQAKI+GT   IGGAMIMTL KGP++ LPWTK ++   +H
Sbjct  120   FTFLMAWFFRLERLSIRSKHSQAKILGTLVTIGGAMIMTLGKGPVLDLPWTKSTS---AH  176

Query  868   SAQHVLNQHSNPIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSI  689
                  + Q   PI+  L++   C   A FIILQA  +KSYPA L+LTTLIC  G+ Q ++
Sbjct  177   VDLDGVAQ--KPIEGALMITAGCFCWASFIILQAITLKSYPAELTLTTLICMTGTFQGAV  234

Query  688   LTLIVERGNASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMV  509
                 +ER N + WS+Q+D+ LL  VY G++ SG  YYI G++M++KGPVF+TAFNPL MV
Sbjct  235   FAFAMERSNFAAWSIQFDVRLLAVVYSGIICSGVGYYIQGVVMQIKGPVFLTAFNPLHMV  294

Query  508   LVAIIGSFVLSEKLYMgrvlgavvvlvglylviwGKSKDQTSPDNNDALPIDHKQPQV  335
             LVAI+GSF+L E L +GRV+GA+V+++GLYLV+WGKSKDQ +  +++    +  +PQ+
Sbjct  295   LVAILGSFILHEILCLGRVIGALVIVLGLYLVLWGKSKDQVAAGSSEKQ--ETSKPQI  350



>ref|XP_010509005.1| PREDICTED: WAT1-related protein At2g39510-like [Camelina sativa]
Length=375

 Score =   308 bits (789),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 183/346 (53%), Positives = 248/346 (72%), Gaps = 9/346 (3%)
 Frame = -3

Query  1357  KPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPTM  1178
             KP+L V+ LQ   AG +I++K ALNQGM+P   + YR+ +A +  APFA FL+RK RP M
Sbjct  7     KPFLTVVSLQFGYAGLSIIAKFALNQGMSPHVLAAYRHIVATIFIAPFAFFLDRKIRPKM  66

Query  1177  TTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVKI  1001
             T  IFFKI+LL LLE  ++ NLYY GM+YT+AT +  M N++PA  F++AWIFRLEKV +
Sbjct  67    TLPIFFKILLLGLLEPTIDQNLYYTGMKYTSATFTAAMTNVLPAFAFIMAWIFRLEKVNV  126

Query  1000  RNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKAT  821
             R +HSQAKI+GT   +GGAM+MT+VKGP+I LPW  + ND+   ++   + Q     K  
Sbjct  127   RKIHSQAKILGTIVTVGGAMLMTVVKGPMIPLPWA-NPNDIHQDASNPGVKQDLT--KGA  183

Query  820   LLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSLQ  641
             LL+A  C   A FI LQA  +KSYP  LS+T  IC +GSL+ +I+ L +ERGN S W++Q
Sbjct  184   LLIAVGCICWAGFINLQAITLKSYPVELSMTAYICFMGSLESTIVALYIERGNPSAWAIQ  243

Query  640   WDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLYM  461
              D  LL  VY G++ SG  YY+ G+IMK +GPVFVTAFNPLSMV+VAI+GS +L+E +++
Sbjct  244   LDSKLLAAVYGGIICSGIGYYVQGVIMKTRGPVFVTAFNPLSMVIVAILGSIILAEVMFL  303

Query  460   grvlgavvvlvglylviwGKSKDQTS---PDNNDALPIDHKQPQVV  332
             GR+LGA+V+++GLY V+WGKSKD+ S   PD +  LP+    PQ+V
Sbjct  304   GRILGAIVIVLGLYSVLWGKSKDEPSSPFPDMDRELPLS--SPQIV  347



>ref|XP_010505629.1| PREDICTED: WAT1-related protein At2g39510-like [Camelina sativa]
Length=375

 Score =   308 bits (789),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 185/352 (53%), Positives = 250/352 (71%), Gaps = 9/352 (3%)
 Frame = -3

Query  1357  KPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPTM  1178
             KP+L V+ LQ   AG +I++K ALNQGM+P   + YR+  A +  APFA FL+RK RP M
Sbjct  7     KPFLTVVSLQFGYAGLSIIAKFALNQGMSPHVLAAYRHIFATIFIAPFAYFLDRKIRPKM  66

Query  1177  TTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVKI  1001
             T  IFFKI+LL LLE  ++ NLYY GM+YT+AT +  M N++PA  F++AWIFRLEKV +
Sbjct  67    TLPIFFKILLLGLLEPTIDQNLYYTGMKYTSATFTAAMTNVLPAFAFIMAWIFRLEKVNV  126

Query  1000  RNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKAT  821
             R +HSQAKI+GT   +GGAM+MT+VKGP+I LPW  + ND+   ++   + Q     K  
Sbjct  127   RKIHSQAKILGTIVTVGGAMLMTVVKGPLIPLPWA-NPNDIHQDASNPGVKQDLT--KGA  183

Query  820   LLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSLQ  641
             LL+A  C   A FI LQA  +KSYP  LSLT  IC +GSL+ +I+ L +ERGN S W++Q
Sbjct  184   LLIAVGCICWAGFINLQAITLKSYPVELSLTACICFMGSLESTIVALYIERGNPSAWAIQ  243

Query  640   WDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLYM  461
              D  LL  VY G++ SG  YY+ G+IMK +GPVFVTAFNPLSMV+VAI+GS +L+E +++
Sbjct  244   LDSKLLAAVYGGIICSGIGYYVQGVIMKTRGPVFVTAFNPLSMVIVAILGSIILAEVMFL  303

Query  460   grvlgavvvlvglylviwGKSKDQTS---PDNNDALPIDHKQPQVVQGFNKD  314
             GR+LGA+V+++GLY V+WGKSKD+ S   PD +  LP+    PQ+V   +K+
Sbjct  304   GRILGAIVIVLGLYSVLWGKSKDEPSSPFPDMDKELPLS--TPQIVTFSSKE  353



>ref|XP_002315243.2| hypothetical protein POPTR_0010s21630g [Populus trichocarpa]
 gb|EEF01414.2| hypothetical protein POPTR_0010s21630g [Populus trichocarpa]
Length=381

 Score =   308 bits (790),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 188/377 (50%), Positives = 253/377 (67%), Gaps = 17/377 (5%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             + AKP+L V+ +Q   AG +I+SK ALN+GM+      YR+A+A ++ APFA   +RK R
Sbjct  11    DKAKPFLAVVLMQFGYAGMSIISKHALNEGMSQHVLVVYRHAVATIVIAPFAFIFDRKVR  70

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT SIFFKI+L+ LLE  ++ NLYY GM+YTTAT +  M N++PA  FL+AW  RLEK
Sbjct  71    PKMTLSIFFKIMLMGLLEPTIDQNLYYTGMKYTTATFASAMCNILPAFAFLMAWALRLEK  130

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             V IR +HSQAKI+GT   +GGAM+MTLVKG  + LPWTK  +    H++   L +  +PI
Sbjct  131   VNIRKMHSQAKIIGTIVTVGGAMLMTLVKGTQLDLPWTKGYDQ---HASTGGLTKQ-DPI  186

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
             K  L++   C   A FIILQA  +KSYP  LSLT  IC +G+++ ++L +++ERGN S W
Sbjct  187   KGALMITTGCACWASFIILQAITLKSYPVELSLTAWICFMGTIEGTVLAVVMERGNPSAW  246

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
             S+  D  LL  VY G+  SG  YY+ G+IMK +GPVFVTAFNPLSMV+VAI+GSF L E 
Sbjct  247   SIALDYKLLAAVYSGVFCSGLAYYVQGLIMKRRGPVFVTAFNPLSMVIVAILGSFFLKEI  306

Query  469   LYMgrvlgavvvlvglylviwGKSKDQ-TSPDNND------ALPIDHKQPQVVQGFNKDI  311
             LY+GRV GAVV++ GLYLV+WGKSKD+  S  +ND      A  +  K  +  +  N+D 
Sbjct  307   LYLGRVFGAVVIVTGLYLVLWGKSKDEPPSNSSNDHKVAASATQMATKTQERTETLNQDF  366

Query  310   TVSLN*KVELPRSHPHD  260
                    ++L +  P+D
Sbjct  367   VA-----LDLTKVRPND  378



>ref|XP_004142085.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
 gb|KGN54225.1| hypothetical protein Csa_4G293840 [Cucumis sativus]
Length=375

 Score =   308 bits (789),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 182/351 (52%), Positives = 251/351 (72%), Gaps = 6/351 (2%)
 Frame = -3

Query  1393  NERVVKWLNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPF  1214
             N +V +W  + AKP+  V+FLQ   AG  ILSKAALNQGM+ +    YR+A+A ++ APF
Sbjct  2     NPQVSQWCVS-AKPFFAVVFLQFGLAGMDILSKAALNQGMSNYVLVVYRHAVATIVIAPF  60

Query  1213  ALFLERKTRPTMTTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFL  1037
             AL  ++K RP MT  +F K+ VL  L   ++ NLY++GM+YTTAT +  M N++PA+TF+
Sbjct  61    ALIFDKKVRPKMTIPVFAKLMVLSLLEPVIDQNLYFMGMKYTTATFAAAMCNILPAITFV  120

Query  1036  LAWIFRLEKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQH  857
             +AWI RLEKV+I+++ SQAKIVGT + +GGAMIMTL+KGPI+ L W K   +      + 
Sbjct  121   MAWILRLEKVRIKSIRSQAKIVGTVATVGGAMIMTLMKGPIVELFWVKERANNPQQRGEI  180

Query  856   VLNQHSNPIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLI  677
              L QH+  IK ++++   C S A F+ILQA  +K+YPA LSLT  IC +G+ + +++ L+
Sbjct  181   SL-QHT--IKGSIMITIGCFSWACFMILQAITLKAYPAELSLTAWICLLGTAEGTVVALV  237

Query  676   VERGNASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAI  497
             +ERGN +VWS+ W   LL  VY G+  SG  YYI G++MK KGPVFVTAF+PLSMV+VAI
Sbjct  238   MERGNPAVWSITWGTKLLAAVYSGIFCSGLAYYIQGLVMKDKGPVFVTAFSPLSMVIVAI  297

Query  496   IGSFVLSEKLYMgrvlgavvvlvglylviwGKSKDQTSPDNNDALPIDHKQ  344
             + SF+L E+LY GRVLGAVV++VGLYLV+WGK+KD+    + D L +  KQ
Sbjct  298   MSSFILGERLYFGRVLGAVVIIVGLYLVVWGKNKDENCSSSED-LKLPTKQ  347



>gb|KHG26265.1| Auxin-induced 5NG4 [Gossypium arboreum]
 gb|KHG27688.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=377

 Score =   307 bits (787),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 160/300 (53%), Positives = 220/300 (73%), Gaps = 2/300 (1%)
 Frame = -3

Query  1357  KPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPTM  1178
             KPY   +FLQV  AG  ILSKAALNQGM+ +    YR+AIA ++ APFA+ LE+K RP M
Sbjct  8     KPYFAAIFLQVGLAGMDILSKAALNQGMSNYVLVVYRHAIATLVMAPFAVILEKKVRPKM  67

Query  1177  TTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVKI  1001
             T SIF KI+LL+LLE  ++ NLYYVGM+YTTAT +  M N++PA+TFL+AWI RLEKV  
Sbjct  68    TISIFIKIMLLSLLEPVIDQNLYYVGMKYTTATFAAAMYNILPAITFLMAWILRLEKVNF  127

Query  1000  RNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKAT  821
             R++ S AK+ GT + + GAM+MTL+KGP++ L WT    +    +A++  + H + IK  
Sbjct  128   RSIRSHAKVFGTLATVAGAMVMTLMKGPVLELFWTTGRINNHEAAAKNRTDFH-DTIKGG  186

Query  820   LLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSLQ  641
             LL+A  C S A F+ILQA  +K+YPA LSLT  IC +G+L+ ++  L++E G AS+W+++
Sbjct  187   LLIAVGCFSYACFVILQAVTLKTYPAELSLTVWICLMGTLEATVAALVMETGKASIWAIK  246

Query  640   WDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLYM  461
             WD  LLT  Y G+V SG  YYI G+IMK +GPVFVTAF+PL MV+VAI+ SF+L+E++++
Sbjct  247   WDTKLLTAAYSGIVCSGLAYYIQGVIMKDRGPVFVTAFSPLCMVIVAIMASFILAEQMFL  306



>ref|XP_010517305.1| PREDICTED: WAT1-related protein At2g39510 [Camelina sativa]
Length=375

 Score =   307 bits (786),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 183/346 (53%), Positives = 248/346 (72%), Gaps = 9/346 (3%)
 Frame = -3

Query  1357  KPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPTM  1178
             KP+L V+ LQ   AG +I++K ALNQGM+P   + YR+ +A +  APFA FL+RK RP M
Sbjct  7     KPFLTVVSLQFGYAGLSIIAKFALNQGMSPHVLAAYRHIVATIFIAPFAYFLDRKIRPKM  66

Query  1177  TTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVKI  1001
             T  IFFKI+LL LLE  ++ NLYY GM+YT+AT +  M N++PA  F++AWIFRLEKV +
Sbjct  67    TLPIFFKILLLGLLEPTIDQNLYYTGMKYTSATFTAAMTNVLPAFAFIMAWIFRLEKVNV  126

Query  1000  RNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKAT  821
             R +HSQAKI+GT   +GGAM+MT+VKGP+I LPW  + ND+   ++   + Q     K  
Sbjct  127   RKIHSQAKILGTIVTVGGAMLMTVVKGPLIPLPWA-NPNDIHQDASNPGVKQDLT--KGA  183

Query  820   LLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSLQ  641
             LL+A  C   A FI LQA  +KSYP  LSLT  IC +GSL+ +I+ L +ERGN S W++Q
Sbjct  184   LLIAVGCICWAGFINLQAITLKSYPVELSLTAYICFMGSLESTIVALYIERGNPSAWAIQ  243

Query  640   WDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLYM  461
              D  LL  VY G++ SG  YY+ G+IMK +GPVFVTAFNPLSMV+VAI+GS +L+E +++
Sbjct  244   LDSKLLAAVYGGIICSGIGYYVQGVIMKTRGPVFVTAFNPLSMVIVAILGSIILAEVMFL  303

Query  460   grvlgavvvlvglylviwGKSKDQ---TSPDNNDALPIDHKQPQVV  332
             GR+LGA+V+++GLY V+WGKSKD+   + PD +  LP+    PQ+V
Sbjct  304   GRILGAIVIVLGLYSVLWGKSKDEPPSSFPDMDTELPLS--TPQIV  347



>ref|XP_002284091.1| PREDICTED: WAT1-related protein At2g39510 [Vitis vinifera]
 emb|CBI31716.3| unnamed protein product [Vitis vinifera]
Length=371

 Score =   307 bits (786),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 185/340 (54%), Positives = 240/340 (71%), Gaps = 8/340 (2%)
 Frame = -3

Query  1363  DAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRP  1184
              A P L V+ LQ   AG +I++K ALN GMN +TF  YR+ IAA + APFA+ LERK  P
Sbjct  14    QAMPILAVVLLQFGYAGLSIIAKYALNAGMNHYTFVVYRHVIAAAVIAPFAIVLERKRWP  73

Query  1183  TMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKV  1007
              MT SIF KI+L+ LLE  ++ NLYYVGM+ TTAT +  M N+IPA TFL+A + RLEKV
Sbjct  74    RMTVSIFAKIMLMGLLEPVIDQNLYYVGMKNTTATFTTAMSNIIPAFTFLVALVLRLEKV  133

Query  1006  KIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIK  827
              +R LHSQAK+VGT   +GGAM+MTLVKGP   LPWTK       H  Q   +Q  +PIK
Sbjct  134   NLRRLHSQAKVVGTLVTVGGAMLMTLVKGPAPDLPWTKGR-----HYHQSSTSQQQHPIK  188

Query  826   ATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWS  647
               L++   C   A F+ LQA  +KSYPA LSLTTLIC +G+L+ +++TLI+E GNAS+W 
Sbjct  189   GALMITAGCVCWACFLNLQARTVKSYPAQLSLTTLICLMGALEGAMVTLIIEHGNASIWV  248

Query  646   LQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKL  467
             +    TL   +Y G+V S   YYI G+IM  KGPVFV++FNPLSM++VAI+ SF+ +E L
Sbjct  249   IPKGPTLCAVLYGGIVCSAIAYYIQGVIMGEKGPVFVSSFNPLSMIIVAILSSFIFAEAL  308

Query  466   YMgrvlgavvvlvglylviwGKSKDQTSPDNNDALPIDHK  347
             Y+G VLGAVV+++GLYL++WGKSKDQ  P+    +PID +
Sbjct  309   YLGMVLGAVVIIIGLYLILWGKSKDQ--PEGVRLVPIDQQ  346



>ref|XP_006296517.1| hypothetical protein CARUB_v10025706mg [Capsella rubella]
 gb|EOA29415.1| hypothetical protein CARUB_v10025706mg [Capsella rubella]
Length=375

 Score =   307 bits (786),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 182/342 (53%), Positives = 242/342 (71%), Gaps = 6/342 (2%)
 Frame = -3

Query  1357  KPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPTM  1178
             KP+L V+ LQ   AG +I++K ALNQGM+P   + YR+ +A +  APFA FL+RK RP M
Sbjct  7     KPFLTVVSLQFGYAGLSIIAKFALNQGMSPHVLAAYRHIVATIFIAPFAYFLDRKIRPKM  66

Query  1177  TTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVKI  1001
             T  IFFKI+LL LLE  ++ NLYY GM+YT+AT +  M N++PA  F++AWIFRLEKV +
Sbjct  67    TLPIFFKILLLGLLEPTIDQNLYYTGMKYTSATFTAAMTNVLPAFAFIMAWIFRLEKVNV  126

Query  1000  RNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKAT  821
             + +HSQAKI+GT   +GGAM+MT+VKGP+I LPW   S+  + H          +  K  
Sbjct  127   KKIHSQAKILGTIVTVGGAMLMTVVKGPLIPLPWANPSD--MHHQDASNPGVKQDLTKGA  184

Query  820   LLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSLQ  641
             LL+A  C   A FI LQA  +KSYP  LS+T  IC +GSL+ +I+ L +ERGN S W++Q
Sbjct  185   LLIAIGCICWAGFINLQAITLKSYPVELSMTAYICFMGSLESTIVALYIERGNPSAWAIQ  244

Query  640   WDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLYM  461
              D  LL  VY G++ SG  YY+ G+IMK +GPVFVTAFNPLSMV+VAI+GS +L+E +Y+
Sbjct  245   LDSKLLAAVYGGVICSGIGYYVQGVIMKTRGPVFVTAFNPLSMVIVAILGSIILAEVMYL  304

Query  460   grvlgavvvlvglylviwGKSKDQTS---PDNNDALPIDHKQ  344
             GR+LGAVV+++GLY V+WGKSKDQ S   PD +  LP+   Q
Sbjct  305   GRILGAVVIVLGLYSVLWGKSKDQPSSSFPDMDKELPLSTPQ  346



>ref|XP_010260186.1| PREDICTED: WAT1-related protein At2g39510-like [Nelumbo nucifera]
Length=390

 Score =   306 bits (785),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 172/342 (50%), Positives = 249/342 (73%), Gaps = 6/342 (2%)
 Frame = -3

Query  1372  LNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERK  1193
             L + AKP+L V+FLQ+  AG AI++K AL++G+N +TF  YRN IA  + +PFA+ LERK
Sbjct  13    LFSKAKPFLAVIFLQLGLAGMAIIAKLALDEGLNHYTFVVYRNFIATCVISPFAITLERK  72

Query  1192  TRPTMTTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRL  1016
              RP MT +IF KI +L  L   ++ NLYY GMR T+AT +  M N++PA+TFL+A+I RL
Sbjct  73    VRPKMTFTIFAKIALLGLLEPVIDQNLYYSGMRITSATFTTAMCNILPALTFLMAFICRL  132

Query  1015  EKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSN  836
             EKVKI+ + SQAK+VGT   +GGAM+MTL+KGP+I LPWTK     V++        H +
Sbjct  133   EKVKIKKVRSQAKVVGTLVTVGGAMLMTLIKGPVINLPWTKGR---VNNHGNQTTPIHQD  189

Query  835   PIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNAS  656
             PIK +L++A  C   + FIILQA  ++ YPA L+LT LIC +G+ + +++ L ++ G +S
Sbjct  190   PIKGSLMIAAGCFCWSCFIILQAITLREYPAELTLTALICLMGAAEGAVVALALQWGKSS  249

Query  655   VWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLS  476
             +WS+ WD   L  +Y G+V SG  YYI  +I+K +GPVFVTAF+PL M++VAI+GSF+L+
Sbjct  250   IWSIHWDAKFLAALYGGIVCSGVSYYIQAVIIKKRGPVFVTAFSPLCMIIVAILGSFILA  309

Query  475   EKLYMgrvlgavvvlvglylviwGKSKDQ--TSPDNNDALPI  356
             E++++G V+GA+V++VGLYLV+WGK KD   +SP +N+ +P+
Sbjct  310   EQMFVGSVIGAIVIVVGLYLVVWGKIKDHVPSSPADNELIPV  351



>emb|CDP00045.1| unnamed protein product [Coffea canephora]
Length=379

 Score =   306 bits (784),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 203/359 (57%), Positives = 261/359 (73%), Gaps = 10/359 (3%)
 Frame = -3

Query  1399  MRNERVVKWLNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFA  1220
             M N R + +L + A PYL V+F+QV  AGSAI++K+ALNQGM+ +  S YRN IAAV FA
Sbjct  1     MINHRGMGFLKH-ANPYLAVIFVQVGFAGSAIIAKSALNQGMSHYALSIYRNLIAAVAFA  59

Query  1219  PFALFLERKTRPTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMT  1043
             PFA+ LERK RP MT S+ +KI+LL LLE  ++ NLYY  M+YTTAT +  M N++PA+T
Sbjct  60    PFAVVLERKVRPRMTFSVLWKILLLGLLEPVIDQNLYYAAMKYTTATFTAAMTNMVPALT  119

Query  1042  FLLAWIFRLEKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSA  863
             FLLAWI RLE+V +R +H   KI GTA  +GGAMIMTLVKGP I LPWTK    V  HS+
Sbjct  120   FLLAWILRLEQVNLRRIHGLVKIAGTAVTVGGAMIMTLVKGPTIGLPWTKADTGV--HSS  177

Query  862   QHVLNQHSNPIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILT  683
                +    +PIK  L+LA  C   A F  LQA  +KSYPAGLSLT++IC  G+LQ  ++T
Sbjct  178   --TVANPQDPIKGALMLAAGCFCWANFYNLQAITLKSYPAGLSLTSMICMAGALQAIVVT  235

Query  682   LIVERGNASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLV  503
             L+ ERGN+S+WS+ +D  LL YVY GL+ SG  YY+ G+I++ KGPVFV AFNPLSMV+V
Sbjct  236   LVAERGNSSIWSIHFDTILLCYVYCGLINSGVTYYVTGLILRSKGPVFVAAFNPLSMVIV  295

Query  502   AIIGSFVLSEKLYMgrvlgavvvlvglylviwGKSKDQ---TSPDNNDAL-PIDHKQPQ  338
             AI+ SF+LSE+L  GRV GAV++++GLYLVIWGKSKD+   +  +N D + PID + P 
Sbjct  296   AIMSSFILSERLNFGRVFGAVIIMLGLYLVIWGKSKDKCLLSKSNNIDRIAPIDQQLPD  354



>ref|XP_004246473.1| PREDICTED: WAT1-related protein At2g37460-like [Solanum lycopersicum]
Length=375

 Score =   306 bits (783),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 182/362 (50%), Positives = 260/362 (72%), Gaps = 6/362 (2%)
 Frame = -3

Query  1387  RVVKWLNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFAL  1208
               V+ L N AKP+L V+FLQ   AG  IL+K ALN+GM+ + F  YR+A+A ++ APFA+
Sbjct  2     EAVRELYNRAKPFLAVIFLQFGLAGMDILTKVALNEGMSNYVFVVYRHAVATLVIAPFAI  61

Query  1207  FLERKTRPTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLA  1031
              L++K RP MT SIF K+VLL+LLE  ++ NLY +G++YTTAT +  M N++PA+TF++A
Sbjct  62    ILDKKVRPKMTPSIFAKLVLLSLLEPVIDQNLYSIGLKYTTATFAAAMCNILPAITFIMA  121

Query  1030  WIFRLEKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVL  851
             WIFRLEKVK+ ++ SQAKIVGT + + GAMIMTLV+GPI+ L WT  +     H++Q   
Sbjct  122   WIFRLEKVKLTSIRSQAKIVGTVATVAGAMIMTLVRGPIVELFWTTGN---AGHNSQSGG  178

Query  850   NQHSNPIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVE  671
                S+ IK ++++   C S A F+ILQA  +++YPA LSLT  IC +G+ + +I+ +++E
Sbjct  179   LNLSHAIKGSIMITIGCFSWAAFMILQAITLRTYPAELSLTAWICLLGTTEGAIVAMVME  238

Query  670   RGNASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIG  491
             RG  +VW++ WD   L  VY G+  SG  YYI G+IMK +GPVFVTAFNPLSMV+VA++ 
Sbjct  239   RGKPAVWAINWDSKFLAAVYSGIFCSGLAYYIQGVIMKDRGPVFVTAFNPLSMVIVAVLS  298

Query  490   SFVLSEKLYMgrvlgavvvlvglylviwGKSKDQTSPD-NNDALPIDHKQPQVVQGFNKD  314
             + +L E+L +GRVLGAVV++VGLY+V+WGKSKD  SP  +  A+P  H+     + F++ 
Sbjct  299   TIILREQLNLGRVLGAVVIVVGLYIVLWGKSKDHKSPSIDEQAIP-THETKIDKEPFSQT  357

Query  313   IT  308
             +T
Sbjct  358   VT  359



>ref|XP_008369847.1| PREDICTED: WAT1-related protein At2g37460-like [Malus domestica]
 ref|XP_008369848.1| PREDICTED: WAT1-related protein At2g37460-like [Malus domestica]
Length=363

 Score =   305 bits (781),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 179/344 (52%), Positives = 252/344 (73%), Gaps = 8/344 (2%)
 Frame = -3

Query  1360  AKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPT  1181
             AKP+  V+FLQ   AG  ILSKAALNQGM+ +    YR+ +A  + APFA+ L++K RP 
Sbjct  10    AKPFFAVVFLQFGLAGMDILSKAALNQGMSNYVLVVYRHVVATAVVAPFAVILDKKVRPK  69

Query  1180  MTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVK  1004
             MT SIF KI+LLALLE  L+ NLY++GM+YTTAT +  M N++PA+TF++AW+ RLEKV 
Sbjct  70    MTLSIFIKIMLLALLEPVLDQNLYFMGMKYTTATFAAAMCNILPALTFVMAWVLRLEKVN  129

Query  1003  IRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKA  824
             ++++ SQ+K+VGT + + GAMIMTLVKGP++ L WT+ S++   H++     Q S  IK 
Sbjct  130   LKSIRSQSKLVGTVATVAGAMIMTLVKGPLLHLFWTRASHE--QHTSAATSLQDS--IKG  185

Query  823   TLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSL  644
             +L++   C   A F+ILQA  +K+YPA LSL+  IC +G+L+ + + L++ERGNA+VWS+
Sbjct  186   SLMITVGCFCWACFMILQAITLKTYPAELSLSAWICALGTLEGTAVALVMERGNAAVWSI  245

Query  643   QWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLY  464
             +WD  LL   Y G+  SG  YYI G++MK +GPVFVTAF+PLSMV+VA++ SF+L E+++
Sbjct  246   KWDTKLLAASYSGIFCSGLAYYIQGVVMKYRGPVFVTAFSPLSMVIVAVMSSFILREQMF  305

Query  463   MgrvlgavvvlvglylviwGKSKDQTSPDN--NDALPIDHKQPQ  338
             +GR+LGAVV++ GLYLV+WGK+KD  SP+    D L    KQ Q
Sbjct  306   LGRLLGAVVIIAGLYLVVWGKAKDYESPEKTIEDELTAT-KQAQ  348



>ref|XP_010037869.1| PREDICTED: WAT1-related protein At2g37460-like [Eucalyptus grandis]
Length=386

 Score =   306 bits (783),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 181/384 (47%), Positives = 268/384 (70%), Gaps = 13/384 (3%)
 Frame = -3

Query  1378  KWLNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLE  1199
             K L +  KP+L V+FLQ   AG  IL KAALN+GM+ +    YR+A+A ++  PFA+ ++
Sbjct  4     KRLFHKLKPFLAVVFLQFGFAGMDILCKAALNKGMSNYVLVVYRHAVATIVIVPFAVIMD  63

Query  1198  RKTRPTMTTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIF  1022
             RKTRP MT  IF ++ VL  L   ++ NLYY+GM+ TTAT +  M N++PA+TF++AWI 
Sbjct  64    RKTRPRMTLPIFIRLMVLSLLEPVIDQNLYYLGMKQTTATFAAAMCNILPAITFVIAWIM  123

Query  1021  RLEKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKH----SNDVVSHSAQHV  854
             RLEKVK++++ SQAK+ GT + + GAMIMTL+KGP++ L WT+     +N++ + SA   
Sbjct  124   RLEKVKLKSIRSQAKVFGTLATVAGAMIMTLIKGPVLELFWTRGGGTTANNIQNGSAAGG  183

Query  853   LNQHSNPIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIV  674
             ++   N IK +L++   C S A F+ILQA  +++YPA LSLT  IC +G+++ + + L +
Sbjct  184   ISLQ-NSIKGSLMITAGCFSWACFMILQAITLQTYPAELSLTAWICFLGTVEGAAVALFM  242

Query  673   ERGNASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAII  494
             ERGNA+VW +QWD  LL  VY G+V SG  YYI G++MK +GPVFVTAFNPLSMV+VAI+
Sbjct  243   ERGNATVWFIQWDTKLLAAVYSGIVCSGVAYYIQGVVMKDRGPVFVTAFNPLSMVIVAIL  302

Query  493   GSFVLSEKLYMgrvlgavvvlvglylviwGKSKD-QTSP---DNNDALPIDHKQP--QVV  332
              +F+ +E+L++GR++GAVV++ GLYLV+WGK KD ++SP   D + ALP     P     
Sbjct  303   STFIFAEQLFLGRLVGAVVIVAGLYLVVWGKGKDYKSSPAPTDEHKALPTKFVDPGGNGK  362

Query  331   QGFNKD-ITVSLN*KVELPRSHPH  263
             + ++++ IT+S     E P ++ +
Sbjct  363   ENYSQEMITISTCKAKETPEANEN  386



>ref|XP_006411179.1| hypothetical protein EUTSA_v10016823mg [Eutrema salsugineum]
 gb|ESQ52632.1| hypothetical protein EUTSA_v10016823mg [Eutrema salsugineum]
Length=371

 Score =   305 bits (781),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 176/341 (52%), Positives = 239/341 (70%), Gaps = 6/341 (2%)
 Frame = -3

Query  1357  KPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPTM  1178
             KP+L V+ LQ   AG +I++K AL++GM+P   + YR+ +A ++ APFA  L+RK RP M
Sbjct  7     KPFLTVVSLQFGYAGLSIIAKFALDRGMSPHVLAAYRHIVATILMAPFAFILDRKVRPKM  66

Query  1177  TTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVKI  1001
             T  IFFKI VL  L   L+ NLYY GM+YT+AT +  M N++PA  FL+AWIFRLEKV I
Sbjct  67    TLPIFFKILVLGLLEPTLDQNLYYTGMKYTSATFTAAMTNVLPAFAFLMAWIFRLEKVNI  126

Query  1000  RNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKAT  821
             R +HSQAKI+GT   +GGAM+MT+VKGP+I LPWT  + +   H          +  K  
Sbjct  127   RKIHSQAKIIGTIVTVGGAMLMTVVKGPLIPLPWTNPNEN---HQDSSNPGVKPDLTKGA  183

Query  820   LLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSLQ  641
             LL+A  C   A F+ LQA  +KSYP  LSLT  IC +GS++ +I+ L +ERGN + W++Q
Sbjct  184   LLIATGCICWAAFVNLQAITLKSYPVELSLTAYICLMGSIESTIVALFIERGNPAAWAIQ  243

Query  640   WDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLYM  461
              D  LL  +Y G++ SG  YY+ G+IMK +GPVFVTAFNPLSMV+VAI+GS +LSE +Y+
Sbjct  244   LDSKLLAAIYGGVICSGIGYYVQGVIMKTRGPVFVTAFNPLSMVIVAILGSIILSEVMYL  303

Query  460   grvlgavvvlvglylviwGKSKDQTSP--DNNDALPIDHKQ  344
             GR+LGA+V+++GLY V+WGKSKD+ S   D +  LP+ + Q
Sbjct  304   GRILGAIVIVIGLYSVLWGKSKDEPSNSFDLDKELPLSNPQ  344



>ref|XP_003521346.1| PREDICTED: WAT1-related protein At2g37460-like [Glycine max]
Length=377

 Score =   305 bits (780),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 183/358 (51%), Positives = 253/358 (71%), Gaps = 9/358 (3%)
 Frame = -3

Query  1372  LNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERK  1193
             L N  KP++GV+FLQ   AG  ILSKAALN+GM+ + F  YR+  A V+ APFAL LE+K
Sbjct  8     LFNRLKPFIGVVFLQFGYAGMDILSKAALNKGMSNYVFVVYRHVFAFVVMAPFALILEKK  67

Query  1192  TRPTMTTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRL  1016
              RP MT SIF KI +L  L   ++ NLY++GM+YTTAT +V+M N++PA+TF++AWI RL
Sbjct  68    VRPKMTFSIFMKIMILSLLEPVIDQNLYFLGMKYTTATFAVSMYNVLPAITFVMAWILRL  127

Query  1015  EKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSN  836
             EKVK++++ SQAK+VGT + + GAM+MTL+KGPI+ L  T  S+   +H+ Q+      +
Sbjct  128   EKVKLKSIRSQAKVVGTLATVVGAMVMTLIKGPILDLFGTHASS---THNQQNGGVNLQH  184

Query  835   PIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNAS  656
              IK ++++   C S A F+ILQA  I++YPA LSLT  IC +G+++  ++ L++ER N S
Sbjct  185   AIKGSVMITIGCFSCACFMILQAITIEAYPAELSLTAWICLLGTVEGGVVALVMERKNLS  244

Query  655   VWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLS  476
              WSLQWD  LL  VY G+V SG  YYI G +MK +GPVFVT FNPL MV+VAI+GSF L+
Sbjct  245   AWSLQWDTKLLAAVYSGIVCSGMAYYIQGAVMKDRGPVFVTTFNPLCMVIVAIMGSFFLA  304

Query  475   EKLYMgrvlgavvvlvglylviwGKSKDQTSPDN---NDALPIDHKQPQVVQGFNKDI  311
             E +Y+GRV+GA+V+++GLYLV+WGKS D  S ++      LP   KQ    +  N D+
Sbjct  305   EIMYLGRVVGAIVIILGLYLVVWGKSNDYESSNSITKKHTLP--SKQTVEEEHSNHDV  360



>gb|KCW49646.1| hypothetical protein EUGRSUZ_K03164 [Eucalyptus grandis]
Length=446

 Score =   307 bits (786),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 185/404 (46%), Positives = 277/404 (69%), Gaps = 17/404 (4%)
 Frame = -3

Query  1438  SRGE*KELIKNIMMRNERVVKWLNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTF  1259
             + GE  + I++  M  +R+   L    KP+L V+FLQ   AG  IL KAALN+GM+ +  
Sbjct  48    TEGEGTDKIESRAMDAKRLFHKL----KPFLAVVFLQFGFAGMDILCKAALNKGMSNYVL  103

Query  1258  SFYRNAIAAVIFAPFALFLERKTRPTMTTSIFFKI-VllalleqlnlnLYYVGMRYTTAT  1082
               YR+A+A ++  PFA+ ++RKTRP MT  IF ++ VL  L   ++ NLYY+GM+ TTAT
Sbjct  104   VVYRHAVATIVIVPFAVIMDRKTRPRMTLPIFIRLMVLSLLEPVIDQNLYYLGMKQTTAT  163

Query  1081  ISVTMLNLIPAMTFLLAWIFRLEKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLP  902
              +  M N++PA+TF++AWI RLEKVK++++ SQAK+ GT + + GAMIMTL+KGP++ L 
Sbjct  164   FAAAMCNILPAITFVIAWIMRLEKVKLKSIRSQAKVFGTLATVAGAMIMTLIKGPVLELF  223

Query  901   WTKH----SNDVVSHSAQHVLNQHSNPIKATLLLAGSCCSTAIFIILQANMIKSYPAGLS  734
             WT+     +N++ + SA   ++   N IK +L++   C S A F+ILQA  +++YPA LS
Sbjct  224   WTRGGGTTANNIQNGSAAGGISLQ-NSIKGSLMITAGCFSWACFMILQAITLQTYPAELS  282

Query  733   LTTLICTIGSLQCSILTLIVERGNASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKV  554
             LT  IC +G+++ + + L +ERGNA+VW +QWD  LL  VY G+V SG  YYI G++MK 
Sbjct  283   LTAWICFLGTVEGAAVALFMERGNATVWFIQWDTKLLAAVYSGIVCSGVAYYIQGVVMKD  342

Query  553   KGPVFVTAFNPLSMVLVAIIGSFVLSEKLYMgrvlgavvvlvglylviwGKSKD-QTSP-  380
             +GPVFVTAFNPLSMV+VAI+ +F+ +E+L++GR++GAVV++ GLYLV+WGK KD ++SP 
Sbjct  343   RGPVFVTAFNPLSMVIVAILSTFIFAEQLFLGRLVGAVVIVAGLYLVVWGKGKDYKSSPA  402

Query  379   --DNNDALPIDHKQP--QVVQGFNKD-ITVSLN*KVELPRSHPH  263
               D + ALP     P     + ++++ IT+S     E P ++ +
Sbjct  403   PTDEHKALPTKFVDPGGNGKENYSQEMITISTCKAKETPEANEN  446



>ref|XP_008461645.1| PREDICTED: WAT1-related protein At2g39510-like [Cucumis melo]
Length=374

 Score =   305 bits (780),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 162/297 (55%), Positives = 215/297 (72%), Gaps = 3/297 (1%)
 Frame = -3

Query  1360  AKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPT  1181
             AKPY GV+F+Q+ SAG AI++K ALN+GM+ + F FYR  IA +I APFA+  ERK R  
Sbjct  11    AKPYFGVLFMQLGSAGMAIIAKFALNKGMSQYVFVFYRMIIATLIMAPFAIIFERKVRTK  70

Query  1180  MTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVK  1004
             MT S+ FKIV+L LLE  ++LNLY+ GM+YTTAT +V M N++PA  FL+AW  RLEKV 
Sbjct  71    MTISLVFKIVMLGLLEPVIDLNLYFTGMKYTTATFAVAMCNVLPAFAFLMAWACRLEKVN  130

Query  1003  IRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKA  824
             IR   SQAKIVGT   +GGAMIMT ++GP++ LPWTK ++   S S+      H + IK 
Sbjct  131   IRKRGSQAKIVGTIVTVGGAMIMTFIRGPMLNLPWTKPNHPSSSSSS--SSKNHQDQIKG  188

Query  823   TLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSL  644
             +L++A  C   + FIILQA  +K YPA LSLT LIC + ++   ++ L++ERGN S W+L
Sbjct  189   SLMIAIGCICQSAFIILQAITLKLYPAELSLTALICLVATVGGCLVALVMERGNPSAWAL  248

Query  643   QWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSE  473
              +D  LL+ VY G++ SG  YYI G++M++KGPVFVTAFNPLSM+ VAI+ SF+LSE
Sbjct  249   HFDSQLLSVVYAGVICSGVTYYIQGMVMQIKGPVFVTAFNPLSMIFVAIMSSFILSE  305



>ref|XP_009141815.1| PREDICTED: WAT1-related protein At2g39510 [Brassica rapa]
Length=375

 Score =   304 bits (779),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 178/344 (52%), Positives = 241/344 (70%), Gaps = 5/344 (1%)
 Frame = -3

Query  1357  KPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPTM  1178
             KP+L V+ LQ   AG +I++K AL++GM+P   + YR+ +A +  APFA FL+RK RP M
Sbjct  7     KPFLTVISLQFGYAGLSIIAKFALDRGMSPHVLAAYRHIVATIFIAPFAFFLDRKVRPKM  66

Query  1177  TTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVKI  1001
             T  IFFKI +L  L   ++ NLYY GM+YT+AT +  M N++PA  FL+AWIFRLEKV I
Sbjct  67    TLPIFFKIALLGLLEPTIDQNLYYTGMKYTSATFTAAMTNVLPAFAFLMAWIFRLEKVNI  126

Query  1000  RNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKAT  821
             R +HSQAKI+GT   +GGAM+MT+VKGP++ LPW  + ND  SH          +  K  
Sbjct  127   RKIHSQAKILGTVVTVGGAMLMTVVKGPLVPLPWA-NPND--SHQDSSNPGVTPDLTKGA  183

Query  820   LLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSLQ  641
             LL+A  C   A F+ LQA  +KSYP  LSLT  IC +GS++ +I+ L +ERGN S W++Q
Sbjct  184   LLIAIGCICWAGFVNLQAITLKSYPVELSLTAYICLMGSIESTIVALFIERGNPSAWAIQ  243

Query  640   WDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLYM  461
              D  LL  VY G++ SG  YY+ G+IMK +GPVFVTAFNPLSMV+VAI+GS +L+E +Y+
Sbjct  244   LDSKLLAAVYGGVICSGVGYYVQGVIMKTRGPVFVTAFNPLSMVIVAILGSIILAEVMYL  303

Query  460   grvlgavvvlvglylviwGKSKDQTSPDNND-ALPIDHKQPQVV  332
             GR+LGA+V+++GLY V+WGKSKD+ S   +D  + +    PQVV
Sbjct  304   GRILGAIVIVLGLYSVLWGKSKDEPSNSFSDMDIELPRSTPQVV  347



>ref|XP_009377106.1| PREDICTED: WAT1-related protein At2g37460-like [Pyrus x bretschneideri]
 ref|XP_009377107.1| PREDICTED: WAT1-related protein At2g37460-like [Pyrus x bretschneideri]
Length=363

 Score =   304 bits (778),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 173/331 (52%), Positives = 245/331 (74%), Gaps = 5/331 (2%)
 Frame = -3

Query  1360  AKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPT  1181
             AKP+  V+FLQ   AG  ILSKAALNQGM+ +    YR+ +A  + APFA+ L++K RP 
Sbjct  10    AKPFFAVVFLQFGLAGMDILSKAALNQGMSNYVLVVYRHVVATAVVAPFAVILDKKVRPK  69

Query  1180  MTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVK  1004
             MT SIF KI+LL LLE  L+ NLY++GM+YTTAT +  M N++PA+TF++AW+ RLEKVK
Sbjct  70    MTLSIFIKIMLLGLLEPVLDQNLYFMGMKYTTATFAAAMCNILPALTFVMAWVLRLEKVK  129

Query  1003  IRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKA  824
             ++++ SQ+K+VGT + + GAMIMTLVKGP++ L WT+  ++   H++     Q S  IK 
Sbjct  130   LKSIRSQSKLVGTVATVAGAMIMTLVKGPLLHLFWTRPGHE--QHTSAATSLQDS--IKG  185

Query  823   TLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSL  644
             +L++   C   A F+ILQA  +K+YPA LSL+  IC +G+L+ +   L++ERGNA+VWS+
Sbjct  186   SLMITVGCFCWACFMILQAITLKTYPAELSLSAWICALGTLEGTAAALVMERGNAAVWSI  245

Query  643   QWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLY  464
             +WD  LL   Y G+  SG  YYI G++MK +GPVFVTAF+PLSMV+VA++ SF+L E+++
Sbjct  246   KWDTKLLAASYSGIFCSGLAYYIQGVVMKYRGPVFVTAFSPLSMVIVAVMSSFILREQMF  305

Query  463   MgrvlgavvvlvglylviwGKSKDQTSPDNN  371
             +GR+LGAVV++ GLYLV+WGK+KD  SP+  
Sbjct  306   LGRLLGAVVIIAGLYLVVWGKAKDHESPEKT  336



>ref|XP_004493898.1| PREDICTED: WAT1-related protein At2g37460-like isoform X1 [Cicer 
arietinum]
Length=382

 Score =   303 bits (777),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 178/330 (54%), Positives = 247/330 (75%), Gaps = 4/330 (1%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             +  KP++ V+FLQ   AG  +LSKAALN+GM+ +    YR+A+A ++ APFAL LE+K R
Sbjct  10    DKLKPFIAVVFLQFGYAGMDVLSKAALNKGMSNYVLVVYRHAVAFIVIAPFALILEKKVR  69

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT SIF K+V LA+LE  ++ NLY++GM+YTTAT +V M+N++PA+TF++A I +LEK
Sbjct  70    PKMTFSIFMKLVTLAVLEPVIDQNLYFLGMKYTTATFAVAMINVLPAITFVMACILKLEK  129

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             +K+++ HSQAK+VGT + + GAM+MTL+KGPI+ +     S+  + H+A   L QH  PI
Sbjct  130   IKMKSTHSQAKVVGTLATVLGAMVMTLLKGPILNVFGIHGSSTQIQHNAGANL-QH--PI  186

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
             K ++++   C S A F+ILQA  +++YPA LSLT  IC +G+++  I+ LI+ERG  SVW
Sbjct  187   KGSIMITIGCFSCACFMILQAITLETYPAELSLTAWICLLGTVEGGIVALIMERGEPSVW  246

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
             SL WD  LL  VY G+V SG  YYI G +M+ +GPVFVT FNPL MV+VAI+GSF L+EK
Sbjct  247   SLNWDTKLLAAVYSGIVCSGMAYYIQGALMRYRGPVFVTTFNPLCMVIVAIMGSFFLAEK  306

Query  469   LYMgrvlgavvvlvglylviwGKSKDQTSP  380
             +Y+GRV+GAVV++ GLYLV+WGKSKD  SP
Sbjct  307   IYLGRVIGAVVIIFGLYLVVWGKSKDYDSP  336



>ref|XP_004167778.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
 gb|KGN50536.1| hypothetical protein Csa_5G181430 [Cucumis sativus]
Length=374

 Score =   303 bits (776),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 163/297 (55%), Positives = 215/297 (72%), Gaps = 2/297 (1%)
 Frame = -3

Query  1360  AKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPT  1181
             AKPY GV+F+Q+ SAG AI++K ALN+GM+ + F FYR  IA VI APFA+  ERK R  
Sbjct  11    AKPYFGVLFMQLGSAGMAIIAKFALNKGMSQYVFVFYRMIIATVIMAPFAIIFERKVRTK  70

Query  1180  MTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVK  1004
             MT S+ FKIV+L LLE  ++LNLY+ GM+YTTAT +V M N++PA  FL+AW  RLE+V 
Sbjct  71    MTISLAFKIVMLGLLEPVIDLNLYFTGMKYTTATFAVAMCNVLPAFAFLMAWACRLERVN  130

Query  1003  IRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKA  824
             I    SQAKIVGT   IGGAMIMT ++GP++ LPWTK ++   S S+   +N H N IK 
Sbjct  131   IWKRGSQAKIVGTIVTIGGAMIMTFIRGPMLNLPWTKPNHPSSSSSSSSSINHH-NQIKG  189

Query  823   TLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSL  644
             +L++   C   + FIILQA  +K YPA LSLT LIC + ++   ++ L++ERGN S W+L
Sbjct  190   SLMITIGCICQSAFIILQAITLKLYPAELSLTALICLVATVGGCLVALVMERGNPSAWAL  249

Query  643   QWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSE  473
              +D  LL+ VY G++ SG  YYI G++M++KGPVFVTAFNPLSM+ VAI+ SF+LSE
Sbjct  250   HFDSQLLSVVYAGVICSGVTYYIQGMVMQIKGPVFVTAFNPLSMIFVAIMSSFILSE  306



>gb|KCW65509.1| hypothetical protein EUGRSUZ_G02914 [Eucalyptus grandis]
Length=373

 Score =   303 bits (775),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 179/339 (53%), Positives = 242/339 (71%), Gaps = 6/339 (2%)
 Frame = -3

Query  1357  KPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPTM  1178
             KPYL V+ LQ   AG AI++K +LN+GMN   F  YR+A A  + APFA+  ERKTRP M
Sbjct  7     KPYLAVVLLQFGFAGMAIITKFSLNRGMNQHVFVVYRHAFATAVVAPFAILFERKTRPKM  66

Query  1177  TTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVKI  1001
             T S+F KI+LL LLE  ++ NLYY GM+YTTA+ +  M N++PA  FL+AW FRLE++ I
Sbjct  67    TRSVFLKILLLGLLEPVIDQNLYYTGMKYTTASFTAAMSNMLPAFAFLMAWFFRLERLSI  126

Query  1000  RNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKAT  821
             R+ HSQAKI+GT   IGGAMIMTL KGP++ LPWTK ++   +H     + Q   PI+  
Sbjct  127   RSKHSQAKILGTLVTIGGAMIMTLGKGPVLDLPWTKSAS---AHVDLDGVAQ--KPIEGA  181

Query  820   LLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSLQ  641
             L++   C   A FIILQA  +KSYPA L+LT LIC  G+ Q ++    +ER N++ WS+Q
Sbjct  182   LMITAGCFCWASFIILQAITLKSYPAELTLTALICMTGTFQGAVFAFAMERSNSAAWSIQ  241

Query  640   WDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLYM  461
             +D+ LL  VY GL+ SG  YY+ G++M++KGPVF+TAFNPL MVLVAI+GSF+L E L +
Sbjct  242   FDVRLLAIVYSGLICSGVGYYVQGVVMQIKGPVFLTAFNPLHMVLVAILGSFILHEILCL  301

Query  460   grvlgavvvlvglylviwGKSKDQTSPDNNDALPIDHKQ  344
             GRV+GA+V+++GLYLV+WGKSKDQ +  +++     + Q
Sbjct  302   GRVIGALVIVLGLYLVLWGKSKDQVAAGSSEKQETSNPQ  340



>ref|XP_006436050.1| hypothetical protein CICLE_v10031857mg [Citrus clementina]
 ref|XP_006486498.1| PREDICTED: WAT1-related protein At2g39510-like [Citrus sinensis]
 gb|ESR49290.1| hypothetical protein CICLE_v10031857mg [Citrus clementina]
Length=375

 Score =   302 bits (774),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 183/333 (55%), Positives = 243/333 (73%), Gaps = 7/333 (2%)
 Frame = -3

Query  1360  AKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPT  1181
             AKP+L V+ LQ   AG +I SK ALN+GM+P  F+ YR+A+A ++ APFAL L+RK RP 
Sbjct  11    AKPFLAVILLQFGYAGMSIFSKFALNKGMSPHVFAVYRHAVATIVVAPFALILDRKVRPK  70

Query  1180  MTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVK  1004
             MT SIF KI+LL LLE  ++ NL+Y GM+YTTAT +  M N++PA  FL+AWI RLEKV 
Sbjct  71    MTLSIFVKILLLGLLEPTIDQNLFYTGMKYTTATFTTAMANVLPAFAFLMAWIIRLEKVN  130

Query  1003  IRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKA  824
              R  HS AK+ GT   +GGAM MTL+KGP++ LPWT H+    S S   V     +PIK 
Sbjct  131   FRKFHSWAKVFGTIVTVGGAMFMTLIKGPVLDLPWTNHNYHQESTSNSSV----QSPIKG  186

Query  823   TLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSL  644
              L++   C S A F++LQA  +KSYP  LSLT LIC +G+++ +I+ L +ERGNA+VWS+
Sbjct  187   ALMITIGCFSWAGFMVLQAITLKSYPTELSLTALICLMGTIEGTIVALFLERGNAAVWSI  246

Query  643   QWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLY  464
               D  LL  VY G++ SG  YY+ G++MK +GPVFVTAFNPL M++VAI+GSF+LSE +Y
Sbjct  247   HLDSKLLAAVYSGVICSGIGYYVSGVVMKDRGPVFVTAFNPLCMIIVAIMGSFLLSEIMY  306

Query  463   MgrvlgavvvlvglylviwGKSKDQT--SPDNN  371
             +GRV+GA++++VGLYLV+WGKSKDQ   SP +N
Sbjct  307   LGRVVGAIIIVVGLYLVLWGKSKDQNTQSPGSN  339



>ref|XP_006341065.1| PREDICTED: WAT1-related protein At2g37460-like [Solanum tuberosum]
Length=375

 Score =   302 bits (774),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 177/338 (52%), Positives = 248/338 (73%), Gaps = 5/338 (1%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             N AKP+L V+FLQ   AG  IL+K ALN+GM+ + F  YR+A+A ++ APFA+ L++K R
Sbjct  9     NRAKPFLAVIFLQFGLAGMDILTKVALNEGMSNYVFVVYRHAVATLVIAPFAIILDKKVR  68

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT SIF K+VLL+LLE  ++ NLY +G++YTTAT +  M N++PA+TF++AWIFRLEK
Sbjct  69    PKMTPSIFAKLVLLSLLEPVIDQNLYSIGLKYTTATFAAAMCNILPAITFIMAWIFRLEK  128

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             VK+ ++ SQAK+VGT + + GAMIMTLV+GPI+ L WT  +     H +Q      S+ I
Sbjct  129   VKLTSIRSQAKLVGTVATVAGAMIMTLVRGPIVELFWTAGN---AGHDSQSGGLNLSHAI  185

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
             K ++++   C S A F+ILQA  +++YPA LSLT  IC +G+ + +I+ +++ERG  +VW
Sbjct  186   KGSIMITIGCFSWAAFMILQAITLRTYPAELSLTAWICLLGTTEGAIVAMVMERGKPAVW  245

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
             ++ WD   L  VY G+  SG  YYI G+IMK +GPVFVTAFNPLSMV+VAI+ + +L E+
Sbjct  246   AINWDSKFLAAVYSGIFCSGLAYYIQGVIMKDRGPVFVTAFNPLSMVIVAILSTIILREQ  305

Query  469   LYMgrvlgavvvlvglylviwGKSKDQTSPD-NNDALP  359
             L +GRVLGAVV++VGLY+V+WGKSKD  SP  +  A+P
Sbjct  306   LNLGRVLGAVVIVVGLYIVLWGKSKDHKSPSIDEQAIP  343



>gb|KFK36842.1| hypothetical protein AALP_AA4G179000 [Arabis alpina]
Length=368

 Score =   302 bits (773),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 179/340 (53%), Positives = 244/340 (72%), Gaps = 6/340 (2%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             N  KP+L V+ LQ   AG +I++K AL++GM+P   + YR+ +A +  APFA FL+RK R
Sbjct  4     NKWKPFLTVISLQFGYAGLSIIAKFALDRGMSPHVLASYRHIVATLFIAPFAYFLDRKVR  63

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT  IFFKI+LL LLE  ++ NLYY+GM+YT+AT +  M N++PA  FL+AWIFRLE 
Sbjct  64    PKMTLPIFFKILLLGLLEPTIDQNLYYMGMKYTSATFTAAMTNVLPAFAFLMAWIFRLEN  123

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             V ++ +HSQAKI+GT   +GGAM+MTLVKGP+I LPW  + ND    S+   + Q  +  
Sbjct  124   VNVKKIHSQAKILGTVVTVGGAMLMTLVKGPLIPLPWA-NPNDHHQDSSNTGVKQ--DLT  180

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
             K  +L+A  C   A F+ LQA  +KSYP  LSLT  IC +GS++ +I+ L +ERGN S W
Sbjct  181   KGAMLIATGCICWAGFVNLQAITLKSYPVELSLTAYICLMGSIESTIVALFIERGNPSAW  240

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
             S+Q D  LL  VY G++ SG  YY+ G+IMK +GPVFVTAFNPLSMV+VAI+GS +L+E 
Sbjct  241   SIQLDSKLLAAVYAGVICSGIGYYVQGVIMKTRGPVFVTAFNPLSMVIVAILGSIILAEV  300

Query  469   LYMgrvlgavvvlvglylviwGKSKDQTSP--DNNDALPI  356
             +Y+GR+LGA+V+++GLY V+WGKSKD+ S   D +  LP+
Sbjct  301   MYLGRILGAIVIVLGLYSVLWGKSKDEPSSFLDMDKELPL  340



>ref|XP_007009429.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
[Theobroma cacao]
 gb|EOY18239.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
[Theobroma cacao]
Length=436

 Score =   303 bits (777),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 172/334 (51%), Positives = 239/334 (72%), Gaps = 5/334 (1%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             N A PYL ++F++  SAG  I++K ALN+GM+      YR AIA ++FAPFA+  +RK R
Sbjct  9     NKAMPYLAMVFMRFGSAGMPIVAKFALNRGMSQHVLVVYRFAIATLVFAPFAIVFDRKVR  68

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT S+F +I+LL LLE  ++ NLYY G++YTTAT++  + N++PA  FLLAW  RLEK
Sbjct  69    PKMTFSVFVQILLLGLLEPTIDQNLYYTGIKYTTATVATALCNVLPAFVFLLAWACRLEK  128

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             V +R LH QAKI+GT   +GGAMIMTLV GPI+ LPWTK  N+   H +  V     +P+
Sbjct  129   VDMRKLHCQAKILGTLGTVGGAMIMTLVNGPILPLPWTKVKNE---HQST-VSATKDDPL  184

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
             K  L++   C   A F+ILQA  +KSYPA LSLTTL+C +G+++ +I+ L++E GNA+ W
Sbjct  185   KGALMILAGCVCWACFVILQAITLKSYPAELSLTTLVCFMGAIEGTIVALVMEGGNAAAW  244

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
             S+ WD  L    Y G++ SG  YY+  ++++ KGPVF  AFNPL+MV+VAI+ SF+ SE 
Sbjct  245   SIHWDSKLFAAAYSGVICSGVAYYVGAMVIQAKGPVFFAAFNPLTMVIVAIMSSFIFSEI  304

Query  469   LYMgrvlgavvvlvglylviwGKSKDQTSPDNND  368
             +Y+GRV+G +V++VGLYLV+WGKSKDQ S D++ 
Sbjct  305   MYLGRVIGVIVIVVGLYLVLWGKSKDQHSSDSDS  338


 Score = 73.9 bits (180),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -3

Query  610  HGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLYM  461
             G+V SG  YY+  +IMK +GPVFVTAFNPL+MV+VAI+GSFVLSE LY+
Sbjct  371  DGVVCSGVAYYLQAVIMKARGPVFVTAFNPLTMVIVAILGSFVLSEVLYL  420



>gb|KHN09434.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=377

 Score =   301 bits (772),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 182/358 (51%), Positives = 252/358 (70%), Gaps = 9/358 (3%)
 Frame = -3

Query  1372  LNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERK  1193
             L N  KP++GV+FLQ   AG  ILSKAALN+GM+ + F  YR+  A V+ APFAL LE+K
Sbjct  8     LFNRLKPFIGVVFLQFGYAGMDILSKAALNKGMSNYVFVVYRHVFAFVVMAPFALILEKK  67

Query  1192  TRPTMTTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRL  1016
              RP MT SIF KI +L  L   ++ NLY++GM+YTTAT +V+M N++PA+TF++AWI RL
Sbjct  68    VRPKMTFSIFMKIMILSLLEPVIDQNLYFLGMKYTTATFAVSMYNVLPAITFVMAWILRL  127

Query  1015  EKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSN  836
             EKVK++++ SQAK+VGT + + GAM+MTL+KGPI+ L  T  S+   +H+ Q+      +
Sbjct  128   EKVKLKSIRSQAKVVGTLATVVGAMVMTLIKGPILDLFGTHASS---THNQQNGGVNLQH  184

Query  835   PIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNAS  656
              IK ++++   C S A F+ILQA  I++YPA LSLT  IC +G+++  ++ L++ER N S
Sbjct  185   AIKGSVMITIGCFSCACFMILQAITIEAYPAELSLTAWICLLGTVEGGVVALVMERKNLS  244

Query  655   VWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLS  476
              WSLQWD  LL  VY G+V SG  YYI G +MK +GPVFVT FNPL MV+VAI+GSF  +
Sbjct  245   AWSLQWDTKLLAAVYSGIVCSGMAYYIQGAVMKDRGPVFVTTFNPLCMVIVAIMGSFFPA  304

Query  475   EKLYMgrvlgavvvlvglylviwGKSKDQTSPDN---NDALPIDHKQPQVVQGFNKDI  311
             E +Y+GRV+GA+V+++GLYLV+WGKS D  S ++      LP   KQ    +  N D+
Sbjct  305   EIMYLGRVVGAIVIILGLYLVVWGKSNDYESSNSITKKHTLP--SKQTVEEEHSNHDV  360



>ref|XP_003625520.1| Auxin-induced protein 5NG4 [Medicago truncatula]
 gb|AES81738.1| nodulin MtN21/EamA-like transporter family protein [Medicago 
truncatula]
Length=379

 Score =   301 bits (772),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 176/352 (50%), Positives = 253/352 (72%), Gaps = 11/352 (3%)
 Frame = -3

Query  1357  KPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPTM  1178
             KP++ V+ LQ   AG  ILSK+ALN+GM+ +    YR+A+A V+  PFA+ LE+K RP M
Sbjct  13    KPFIAVVLLQFGYAGMDILSKSALNKGMSCYVLVVYRHAVAFVVIVPFAVILEKKVRPKM  72

Query  1177  TTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVKI  1001
             T SIF K+V L++LE  ++ NLY++GM+YTTAT +V M N++PA+TF++AWI ++EK+K+
Sbjct  73    TLSIFLKLVALSVLEPVIDQNLYFLGMKYTTATFAVAMFNVLPAITFVVAWILKMEKIKM  132

Query  1000  RNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKAT  821
             R++HSQAKIVGT + + GAM+MTL+KGPI+ L     S+  + H+    L QH+  +K +
Sbjct  133   RSVHSQAKIVGTIATVAGAMVMTLIKGPILNLFGIHESSAQIQHNGGVNL-QHA--VKGS  189

Query  820   LLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSLQ  641
             +++   C S A F ILQA  +++YPA LSLT  IC +G+++  I+ LI+ERG  SVWSL 
Sbjct  190   IMITIGCFSCACFTILQAVTLETYPAELSLTAWICLLGTVEGGIVALIMERGEPSVWSLS  249

Query  640   WDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLYM  461
             WD  LL  VY G+V SG  YYI G++M+ +GPVFVT FNPL MV+VAI+  F+L+EK+Y+
Sbjct  250   WDTKLLAAVYSGIVCSGMAYYIQGVVMRYRGPVFVTTFNPLCMVIVAIMSPFILAEKIYL  309

Query  460   grvlgavvvlvglylviwGKSKDQTSPD---NNDALPIDHKQPQVVQGFNKD  314
             GRV+GAVV+++GLYLV+WGKSKD   P     ++ LP      Q ++  +K+
Sbjct  310   GRVIGAVVIILGLYLVVWGKSKDYDRPSPIIKDEILP----AKQTIENNDKE  357



>gb|AFK37217.1| unknown [Medicago truncatula]
Length=379

 Score =   301 bits (772),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 176/352 (50%), Positives = 253/352 (72%), Gaps = 11/352 (3%)
 Frame = -3

Query  1357  KPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPTM  1178
             KP++ V+ LQ   AG  ILSK+ALN+GM+ +    YR+A+A V+  PFA+ LE+K RP M
Sbjct  13    KPFIAVVLLQFGYAGMDILSKSALNKGMSCYVLVVYRHAVAFVVIVPFAVILEKKVRPKM  72

Query  1177  TTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVKI  1001
             T SIF K+V L++LE  ++ NLY++GM+YTTAT +V M N++PA+TF++AWI ++EK+K+
Sbjct  73    TLSIFLKLVALSVLEPVIDQNLYFLGMKYTTATFAVAMFNVLPAITFVVAWILKMEKIKM  132

Query  1000  RNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKAT  821
             R++HSQAKIVGT + + GAM+MTL+KGPI+ L     S+  + H+    L QH+  +K +
Sbjct  133   RSVHSQAKIVGTIATVAGAMVMTLIKGPILNLFGIHESSAQIQHNGGVNL-QHA--VKGS  189

Query  820   LLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSLQ  641
             +++   C S A F ILQA  +++YPA LSLT  IC +G+++  I+ LI+ERG  SVWSL 
Sbjct  190   IMITIGCFSCACFTILQAVTLEAYPAELSLTAWICLLGTVEGGIVALIMERGEPSVWSLS  249

Query  640   WDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLYM  461
             WD  LL  VY G+V SG  YYI G++M+ +GPVFVT FNPL MV+VAI+  F+L+EK+Y+
Sbjct  250   WDTKLLAAVYSGIVCSGMAYYIQGVVMRYRGPVFVTTFNPLCMVIVAIMSPFILAEKIYL  309

Query  460   grvlgavvvlvglylviwGKSKDQTSPD---NNDALPIDHKQPQVVQGFNKD  314
             GRV+GAVV+++GLYLV+WGKSKD   P     ++ LP      Q ++  +K+
Sbjct  310   GRVIGAVVIILGLYLVVWGKSKDYDRPSPIIKDEILP----AKQTIENNDKE  357



>ref|XP_011027136.1| PREDICTED: WAT1-related protein At2g39510-like [Populus euphratica]
Length=380

 Score =   301 bits (771),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 186/376 (49%), Positives = 252/376 (67%), Gaps = 16/376 (4%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             + AKP+L V+ +Q   AG +++SK ALN+GM+      YR+A+A ++ APFA   +RK R
Sbjct  11    DRAKPFLAVVLMQFGYAGMSLISKHALNEGMSQHVLVVYRHAVATIVIAPFAFIFDRKVR  70

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT SIFFKI+L+ LLE  L+ NLYY GM+YTTAT +  M N++PA  FL+AW  RLEK
Sbjct  71    PKMTLSIFFKIMLMGLLEPTLDQNLYYTGMKYTTATFASAMCNVLPAFAFLMAWALRLEK  130

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             V IR +HSQAKI+GT   +GGAM+MTLVKG  + LPWTK  +    H +   L +  +PI
Sbjct  131   VNIRKMHSQAKIIGTIVTVGGAMLMTLVKGTQLDLPWTKGYD---QHPSTGGLIKQ-DPI  186

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
             K  L++   C   A FIILQA  +K+YP  LSLT  IC +G+++ ++L +++ERGN S W
Sbjct  187   KGALMITIGCVCWASFIILQAITLKTYPVELSLTAWICFMGTIEGTVLAVVMERGNPSAW  246

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
             S+  D  LL  VY G+  SG  YY+ G+IMK +GPVFVTAFNPLSMV+VAI+GSF L E 
Sbjct  247   SIALDYKLLAAVYSGVFCSGLAYYVQGLIMKRRGPVFVTAFNPLSMVIVAILGSFFLKEI  306

Query  469   LYMgrvlgavvvlvglylviwGKSKDQ-TSPDNNDALP-----IDHKQPQVVQGFNKDIT  308
             LY+GRV GAVV++ GLYLV+WGKSKD+  S  +ND +      +  K  +  +  N+D  
Sbjct  307   LYLGRVFGAVVIVTGLYLVLWGKSKDEPPSNSSNDKVAACSTQMATKTHERTETLNQDFV  366

Query  307   VSLN*KVELPRSHPHD  260
                   ++L +  P+D
Sbjct  367   A-----LDLTKVRPND  377



>ref|XP_004161682.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
Length=368

 Score =   300 bits (769),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 179/368 (49%), Positives = 254/368 (69%), Gaps = 5/368 (1%)
 Frame = -3

Query  1360  AKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPT  1181
             ++ +  V+FLQ   AG  ILSKAALNQGM+ +    YR+A+A ++ APFAL  ++K RP 
Sbjct  5     SQAFFAVVFLQFGLAGMDILSKAALNQGMSNYVLVVYRHAVATIVIAPFALIFDKKVRPK  64

Query  1180  MTTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVK  1004
             MT  +F K+ VL  L   ++ NLY++GM+YTTAT +  M N++PA+TF++AWI RLEKV+
Sbjct  65    MTIPVFAKLMVLSLLEPVIDQNLYFMGMKYTTATFAAAMCNILPAITFVMAWILRLEKVR  124

Query  1003  IRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKA  824
             I+++ SQAKIVGT + +GGAMIMTL+KGPI+ L W K   +      +  L QH+  IK 
Sbjct  125   IKSIRSQAKIVGTVATVGGAMIMTLMKGPIVELFWVKERANNPQQRGEISL-QHT--IKG  181

Query  823   TLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSL  644
             ++++   C S A F+ILQA  +K+YPA LSLT  IC +G+ + +++ L++ERGN +VWS+
Sbjct  182   SIMITIGCFSWACFMILQAITLKAYPAELSLTAWICLLGTAEGTVVALVMERGNPAVWSI  241

Query  643   QWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLY  464
              W   LL  VY G+  SG  YYI G++MK KGPVFVTAF+PLSMV+VAI+ SF+L E+LY
Sbjct  242   TWGTKLLAAVYSGIFCSGLAYYIQGLVMKDKGPVFVTAFSPLSMVIVAIMSSFILGERLY  301

Query  463   MgrvlgavvvlvglylviwGKSKDQTSPDNNDALPIDHKQPQVVQGFNKDITVSLN*KVE  284
              GRVLGAVV++VGLYLV+WGK+KD+    + D L +  KQ        + +T+  N  ++
Sbjct  302   FGRVLGAVVIIVGLYLVVWGKNKDENCSSSED-LKLPTKQILEDNKTMETLTIEPNSCID  360

Query  283   LPRSHPHD  260
             L  ++   
Sbjct  361   LKNNNEQK  368



>ref|XP_004147717.1| PREDICTED: LOW QUALITY PROTEIN: auxin-induced protein 5NG4-like 
[Cucumis sativus]
Length=373

 Score =   300 bits (769),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 162/297 (55%), Positives = 214/297 (72%), Gaps = 3/297 (1%)
 Frame = -3

Query  1360  AKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPT  1181
             AKPY GV+F+Q+ SAG AI++K ALN+GM+ + F FYR  IA VI APFA+  ERK R  
Sbjct  11    AKPYFGVLFMQLGSAGMAIIAKFALNKGMSQYVFVFYRMIIATVIMAPFAIIFERKVRTK  70

Query  1180  MTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVK  1004
             MT S+ FKIV+L LLE  ++LNLY+ GM+YTTAT +V M N++PA  FL+AW  RLE+V 
Sbjct  71    MTISLAFKIVMLGLLEPVIDLNLYFTGMKYTTATFAVAMCNVLPAFAFLMAWACRLERVN  130

Query  1003  IRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKA  824
             I    SQAKIVGT   IGGAMIMT ++GP++ LPWTK ++   S S+  +   H N IK 
Sbjct  131   IWKRGSQAKIVGTIVTIGGAMIMTFIRGPMLNLPWTKPNHPSSSSSSSSI--NHHNQIKG  188

Query  823   TLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSL  644
             +L++   C   + FIILQA  +K YPA LSLT LIC + ++   ++ L++ERGN S W+L
Sbjct  189   SLMITIGCICQSAFIILQAITLKLYPAELSLTALICLVATVGGCLVALVMERGNPSAWAL  248

Query  643   QWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSE  473
              +D  LL+ VY G++ SG  YYI G++M++KGPVFVTAFNPLSM+ VAI+ SF+LSE
Sbjct  249   HFDSQLLSVVYAGVICSGVTYYIQGMVMQIKGPVFVTAFNPLSMIFVAIMSSFILSE  305



>ref|XP_010039216.1| PREDICTED: WAT1-related protein At2g37460-like [Eucalyptus grandis]
Length=386

 Score =   301 bits (770),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 181/384 (47%), Positives = 264/384 (69%), Gaps = 13/384 (3%)
 Frame = -3

Query  1378  KWLNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLE  1199
             K L +  KP+L V+FLQ   AG  IL KAALN+GM+ +    YRNA+A ++ APFA+ +E
Sbjct  4     KTLFHKLKPFLAVVFLQFGLAGMDILCKAALNKGMSNYVLVVYRNAVATIVIAPFAVIME  63

Query  1198  RKTRPTMTTSIFFK-IVllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIF  1022
             RKTRP MT  IF + IVL  L   ++ NLYY+GM+ TTAT +  M N++PA+  ++AWI 
Sbjct  64    RKTRPRMTLPIFIRLIVLSLLEPVIDQNLYYLGMKQTTATFAAAMCNILPAIALVMAWIM  123

Query  1021  RLEKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKH----SNDVVSHSAQHV  854
              LE VK++++ SQAK+ GT + + GAMIMTLVKGP++ L WT+     +N++ + SA   
Sbjct  124   GLETVKMKSIRSQAKVFGTLAMVAGAMIMTLVKGPVLELFWTRGGGTTANNIQNGSAAGG  183

Query  853   LNQHSNPIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIV  674
             ++   N I+ +L++   C S A F+ILQA  +++YPA LSLT  IC +G+++ +++ LI+
Sbjct  184   ISLQ-NSIEGSLMITAGCFSWACFMILQAITLRTYPAELSLTAWICFLGTVEGAVVALIM  242

Query  673   ERGNASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAII  494
             ERGNA+ W +QWD  LL  VY G+V SG  YYI G++MK +GPVFV AFNPLSMV+VAI+
Sbjct  243   ERGNATAWFIQWDTKLLAAVYSGIVCSGVAYYIQGVVMKDRGPVFVAAFNPLSMVIVAIL  302

Query  493   GSFVLSEKLYMgrvlgavvvlvglylviwGKSKD-QTSPDNND---ALP---IDHKQPQV  335
              +F+L+E+L++GR++GAVV++ GLYLV+WGK KD ++SP + D   ALP   +D      
Sbjct  303   STFILAEQLFLGRLVGAVVIVAGLYLVVWGKGKDYKSSPSSTDEPKALPTKFVDLGDNGK  362

Query  334   VQGFNKDITVSLN*KVELPRSHPH  263
                 ++ IT+S     E P ++ +
Sbjct  363   ENYSHQMITISACKDKETPETNEN  386



>ref|XP_010684183.1| PREDICTED: WAT1-related protein At2g37460-like [Beta vulgaris 
subsp. vulgaris]
Length=377

 Score =   300 bits (768),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 177/339 (52%), Positives = 249/339 (73%), Gaps = 7/339 (2%)
 Frame = -3

Query  1372  LNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERK  1193
             L N +KP+L V+FLQV  AG  ILSK ALN GM+ +    YR+A+A ++  PFALF ++K
Sbjct  7     LYNQSKPFLAVIFLQVGLAGMDILSKVALNHGMSNYVLVVYRHAVATIVITPFALFFDKK  66

Query  1192  TRPTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRL  1016
              RP MT SIF K++LL+LLE  ++ NLYY+GM+YT+AT + TM+N++PA+TF++AWI RL
Sbjct  67    VRPKMTLSIFIKLLLLSLLEPVIDQNLYYMGMKYTSATFAATMVNVLPAITFVMAWILRL  126

Query  1015  EKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLN-QHS  839
             E+VK R++ SQAKIVGT + +GGAM+MTL+KGP  L  W+K  N    H+    L+    
Sbjct  127   ERVKCRSIRSQAKIVGTVATVGGAMMMTLIKGPA-LTSWSK--NTATDHNGVKPLDISVH  183

Query  838   NPIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNA  659
             + IK ++++   C S A F+ILQA  +K+YP  LSLT  IC +G+L+ + L L++E+G +
Sbjct  184   DAIKGSIMIIIGCFSWAAFVILQAITLKTYPVELSLTAWICLLGTLEGTALALVMEKGRS  243

Query  658   SVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVL  479
             SVW++ WD  LL  VY G+  SG +Y+I G++MK +GPVFVTAF+PL MV+VAI+ +F +
Sbjct  244   SVWAINWDANLLAAVYSGIFCSGLLYFIQGVVMKERGPVFVTAFSPLCMVIVAILSTFFM  303

Query  478   SEKLYMgrvlgavvvlvglylviwGKSKDQTSP--DNND  368
             +EK+Y+GRVLGAVV++VGLY+VIWGK KD  +P  D  D
Sbjct  304   AEKMYLGRVLGAVVIVVGLYMVIWGKGKDYDAPPLDEED  342



>ref|XP_007027104.1| Nodulin MtN21 /EamA-like transporter family protein [Theobroma 
cacao]
 gb|EOY07606.1| Nodulin MtN21 /EamA-like transporter family protein [Theobroma 
cacao]
Length=391

 Score =   300 bits (769),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 154/300 (51%), Positives = 217/300 (72%), Gaps = 3/300 (1%)
 Frame = -3

Query  1357  KPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPTM  1178
             KPY   +FLQV  +G  +LSKAALNQGM+ +    YR+AIA V+  PFA  L++K RP M
Sbjct  14    KPYFAAIFLQVGLSGMDVLSKAALNQGMSNYALVVYRHAIATVVMVPFAAVLDKKVRPRM  73

Query  1177  TTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVKI  1001
             T  IF KI VL  L   ++ NLYYVGM+YTTAT +  M N++PA+TF++AW+ RLEKV +
Sbjct  74    TLPIFIKIMVLGLLEPVIDQNLYYVGMKYTTATFASAMYNILPAITFVMAWVLRLEKVNL  133

Query  1000  RNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKAT  821
             R++    K+VGT + + GAM+MTL+KGP++ L WTK S +  + +AQ+  + H + IK  
Sbjct  134   RSIRGHGKVVGTLATVAGAMVMTLMKGPVLELFWTKGSTNHQA-AAQNGTDIH-HTIKGG  191

Query  820   LLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSLQ  641
             L++   C S A F+ILQA  +++YPA LSLT  IC +G+L+ +I  LI+ERGNA++W+++
Sbjct  192   LMITVGCFSYACFVILQAVTLETYPAELSLTVWICLMGTLEGTIAALIMERGNAAIWAIK  251

Query  640   WDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLYM  461
             WD  LLT  Y G+V SG  YYI G+IMK +GPVFVTAF+PL MV+VAI+ +F+L+E++Y+
Sbjct  252   WDTKLLTAAYSGIVCSGLAYYIQGVIMKDRGPVFVTAFSPLCMVIVAIMSTFILAEQMYL  311



>emb|CDY07016.1| BnaA04g22990D [Brassica napus]
Length=376

 Score =   300 bits (767),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 183/361 (51%), Positives = 246/361 (68%), Gaps = 13/361 (4%)
 Frame = -3

Query  1357  KPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLE-RKTRPT  1181
             KP+L V+ LQ   AG +I++K AL++GM+P   + YR+ +A +  APFA FL+ RK RP 
Sbjct  7     KPFLTVISLQFGYAGLSIIAKFALDRGMSPHVLAAYRHIVATIFIAPFAFFLDSRKVRPK  66

Query  1180  MTTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVK  1004
             MT  IFFKI +L  L   ++ NLYY GM+YT+AT +  M N++PA  FL+AWIFRLEKV 
Sbjct  67    MTLPIFFKIALLGLLEPTIDQNLYYTGMKYTSATFTAAMTNVLPAFAFLMAWIFRLEKVN  126

Query  1003  IRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKA  824
             IR +HSQAKI+GT   +GGAM+MT+VKGP++ LPW  + ND  SH          +  K 
Sbjct  127   IRKIHSQAKILGTVVTVGGAMLMTVVKGPLVPLPWV-NPND--SHQDSSNPGVTPDLTKG  183

Query  823   TLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSL  644
              LL+A  C   A F+ LQA  +KSYP  LSLT  IC +GS++ +I+ L +ERGN S W++
Sbjct  184   ALLIAIGCICWAGFVNLQAITLKSYPVELSLTAYICLMGSIESTIVALFIERGNPSAWAI  243

Query  643   QWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLY  464
             Q D  LL  VY G++ SG  YY+ G+IMK +GPVFVTAFNPLSMV+VAI+GS +L+E +Y
Sbjct  244   QLDSKLLAAVYGGVICSGVGYYVQGVIMKTRGPVFVTAFNPLSMVIVAILGSIILAEVMY  303

Query  463   MgrvlgavvvlvglylviwGKSKDQTSPDNND-ALPIDHKQPQVVQGFNKDITVSLN*KV  287
             +GR+LGA+V+++GLY V+WGKSKD+ S   +D  + +    PQVV       T SLN   
Sbjct  304   LGRILGAIVIVLGLYSVLWGKSKDEPSNSFSDMDIELPRSTPQVV-------TFSLNANT  356

Query  286   E  284
             E
Sbjct  357   E  357



>ref|XP_002274909.2| PREDICTED: WAT1-related protein At2g37460-like [Vitis vinifera]
Length=396

 Score =   300 bits (767),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 178/356 (50%), Positives = 247/356 (69%), Gaps = 12/356 (3%)
 Frame = -3

Query  1357  KPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPTM  1178
             KP+L V FLQ   AG  + SK ALNQG++ +    YR+AIA    APFA+ L++K RP M
Sbjct  18    KPFLAVTFLQFGFAGMDVFSKVALNQGVSNYVLVVYRHAIATAFIAPFAVILDKKVRPKM  77

Query  1177  TTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVKI  1001
             T SIF K++LL+LLE  ++ NLYY G++YTTAT +  M N++PA+TFL+A IF LEKV +
Sbjct  78    TFSIFTKLMLLSLLEPVIDQNLYYFGLKYTTATFAAAMYNILPAITFLMACIFGLEKVTL  137

Query  1000  RNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSN---PI  830
             +++HSQAK+VGT + + GAM+MTLVKGP+I L WTK  N+      Q V    +N    I
Sbjct  138   KSIHSQAKVVGTVATVAGAMLMTLVKGPVIELIWTKGRNN------QGVKGGGTNIHDSI  191

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
             K +L++   C S A FIILQA  +K+YPA LSLT  IC +G+ Q +I+ L++ERG  SVW
Sbjct  192   KGSLMITAGCFSWACFIILQAITLKTYPAELSLTAWICLLGTAQGTIVALVMERGKTSVW  251

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
             S+ WD   L  +Y G+V SG  YYI G++MK +GPVFVTAFNPLSM++VA++ SF+L+E+
Sbjct  252   SIHWDTKFLAALYSGIVCSGLAYYIQGVVMKDRGPVFVTAFNPLSMIIVAVMSSFILAEQ  311

Query  469   LYMgrvlgavvvlvglylviwGKSKD--QTSPDNNDALPIDHKQPQVVQGFNKDIT  308
             +Y+GRV+GA+V++ GLY V+WGKSK+    SP  +  +  D +        N++ T
Sbjct  312   MYLGRVIGAIVIVAGLYFVVWGKSKEYKSGSPSTDGQMVQDKQMTDASSDSNENST  367



>ref|NP_181483.1| nodulin MtN21-like transporter family protein [Arabidopsis thaliana]
 sp|O80638.1|WTR14_ARATH RecName: Full=WAT1-related protein At2g39510 [Arabidopsis thaliana]
 gb|AAC27842.1| nodulin-like protein [Arabidopsis thaliana]
 gb|AAP12854.1| At2g39510 [Arabidopsis thaliana]
 dbj|BAE99731.1| nodulin-like protein [Arabidopsis thaliana]
 gb|AEC09688.1| nodulin MtN21-like transporter family protein [Arabidopsis thaliana]
Length=374

 Score =   298 bits (764),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 179/346 (52%), Positives = 247/346 (71%), Gaps = 9/346 (3%)
 Frame = -3

Query  1357  KPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPTM  1178
             KP++ V+ LQ   AG +I++K ALNQGM+P   + YR+ +A +  APFA FL+RK RP M
Sbjct  7     KPFITVVSLQFGYAGLSIIAKFALNQGMSPHVLASYRHIVATIFIAPFAYFLDRKIRPKM  66

Query  1177  TTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVKI  1001
             T SIFFKI+LL LLE  ++ NLYY GM+YT+AT +  M N++PA  F++AWIFRLEKV +
Sbjct  67    TLSIFFKILLLGLLEPTIDQNLYYTGMKYTSATFTAAMTNVLPAFAFIMAWIFRLEKVNV  126

Query  1000  RNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKAT  821
             + +HSQAKI+GT   +GGAM+MT+VKGP+I LPW  + +D+   S+   + Q  +  K  
Sbjct  127   KKIHSQAKILGTIVTVGGAMLMTVVKGPLIPLPWA-NPHDIHQDSSNTGVKQ--DLTKGA  183

Query  820   LLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSLQ  641
              L+A  C   A FI LQA  +KSYP  LSLT  IC +GS++ +I+ L +ERGN S W++ 
Sbjct  184   SLIAIGCICWAGFINLQAITLKSYPVELSLTAYICFLGSIESTIVALFIERGNPSAWAIH  243

Query  640   WDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLYM  461
              D  LL  VY G++ SG  YY+ G+IMK +GPVFVTAFNPLSMV+VAI+GS +L+E +++
Sbjct  244   LDSKLLAAVYGGVICSGIGYYVQGVIMKTRGPVFVTAFNPLSMVIVAILGSIILAEVMFL  303

Query  460   grvlgavvvlvglylviwGKSKDQTS---PDNNDALPIDHKQPQVV  332
             GR+LGA+V+++GLY V+WGKSKD+ S    D +  LP+    PQ+V
Sbjct  304   GRILGAIVIVLGLYSVLWGKSKDEPSSSFSDMDKELPLS--TPQIV  347



>gb|KHG24903.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=373

 Score =   298 bits (764),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 152/305 (50%), Positives = 216/305 (71%), Gaps = 3/305 (1%)
 Frame = -3

Query  1372  LNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERK  1193
             L    KP+   +FLQV  AG  ILSK ALN GM+ +    YR+AIA ++ APFA FL++K
Sbjct  9     LGGTYKPFFAAVFLQVGYAGMDILSKTALNLGMSNYVLVVYRHAIATLVMAPFAAFLDKK  68

Query  1192  TRPTMTTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRL  1016
              RP MT  IF +I VL  L   ++ NLY++GM+YTTAT +  M N++PA+TF++AWIFRL
Sbjct  69    VRPKMTMRIFIQIMVLGLLEPVIDQNLYFLGMKYTTATFATAMYNILPAITFVMAWIFRL  128

Query  1015  EKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSN  836
             EKVK+R++ S  KI+GT + + GAM+MTL+KGP++ L WTK  N+    +A        +
Sbjct  129   EKVKLRSIRSHGKIIGTLATVAGAMVMTLMKGPVLELFWTKGRNN--HEAASKNGTDLHD  186

Query  835   PIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNAS  656
              IK  +L+   C S A F+ILQA  +++YPA LSLT  IC +G+L+ +I  LI+E+GNA+
Sbjct  187   CIKGGVLITIGCFSYACFVILQAITLETYPADLSLTVWICLLGTLEGTIAALIMEKGNAA  246

Query  655   VWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLS  476
             +W+++WD  LLT  Y G+V SG  YYI G+IM+ +GPVFVTAF+PL MV+VAI+ SF+L+
Sbjct  247   IWAIKWDTKLLTAAYTGIVCSGLAYYIQGMIMRHRGPVFVTAFSPLCMVIVAIMSSFILA  306

Query  475   EKLYM  461
             E++++
Sbjct  307   EQMFL  311



>gb|KCW49650.1| hypothetical protein EUGRSUZ_K03168 [Eucalyptus grandis]
Length=446

 Score =   301 bits (770),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 179/369 (49%), Positives = 259/369 (70%), Gaps = 14/369 (4%)
 Frame = -3

Query  1438  SRGE*KELIKNIMMRNERVVKWLNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTF  1259
             + GE  + I++  M      K L +  KP+L V+FLQ   AG  IL KAALN+GM+ +  
Sbjct  48    TEGEGTDKIESKAMD----AKTLFHKLKPFLAVVFLQFGLAGMDILCKAALNKGMSNYVL  103

Query  1258  SFYRNAIAAVIFAPFALFLERKTRPTMTTSIFFK-IVllalleqlnlnLYYVGMRYTTAT  1082
               YRNA+A ++ APFA+ +ERKTRP MT  IF + IVL  L   ++ NLYY+GM+ TTAT
Sbjct  104   VVYRNAVATIVIAPFAVIMERKTRPRMTLPIFIRLIVLSLLEPVIDQNLYYLGMKQTTAT  163

Query  1081  ISVTMLNLIPAMTFLLAWIFRLEKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLP  902
              +  M N++PA+  ++AWI  LE VK++++ SQAK+ GT + + GAMIMTLVKGP++ L 
Sbjct  164   FAAAMCNILPAIALVMAWIMGLETVKMKSIRSQAKVFGTLAMVAGAMIMTLVKGPVLELF  223

Query  901   WTKH----SNDVVSHSAQHVLNQHSNPIKATLLLAGSCCSTAIFIILQANMIKSYPAGLS  734
             WT+     +N++ + SA   ++   N I+ +L++   C S A F+ILQA  +++YPA LS
Sbjct  224   WTRGGGTTANNIQNGSAAGGISLQ-NSIEGSLMITAGCFSWACFMILQAITLRTYPAELS  282

Query  733   LTTLICTIGSLQCSILTLIVERGNASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKV  554
             LT  IC +G+++ +++ LI+ERGNA+ W +QWD  LL  VY G+V SG  YYI G++MK 
Sbjct  283   LTAWICFLGTVEGAVVALIMERGNATAWFIQWDTKLLAAVYSGIVCSGVAYYIQGVVMKD  342

Query  553   KGPVFVTAFNPLSMVLVAIIGSFVLSEKLYMgrvlgavvvlvglylviwGKSKD-QTSPD  377
             +GPVFV AFNPLSMV+VAI+ +F+L+E+L++GR++GAVV++ GLYLV+WGK KD ++SP 
Sbjct  343   RGPVFVAAFNPLSMVIVAILSTFILAEQLFLGRLVGAVVIVAGLYLVVWGKGKDYKSSPS  402

Query  376   NND---ALP  359
             + D   ALP
Sbjct  403   STDEPKALP  411



>ref|XP_002881660.1| nodulin MtN21 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57919.1| nodulin MtN21 family protein [Arabidopsis lyrata subsp. lyrata]
Length=375

 Score =   298 bits (763),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 178/346 (51%), Positives = 244/346 (71%), Gaps = 9/346 (3%)
 Frame = -3

Query  1357  KPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPTM  1178
             KP++ V+ LQ   AG +I++K ALNQGM+P   + YR+ +A +  APFA FL+RK RP M
Sbjct  7     KPFITVVSLQFGYAGLSIIAKFALNQGMSPHVLAAYRHIVATIFIAPFAYFLDRKIRPKM  66

Query  1177  TTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVKI  1001
             T  IFFKI+LL LLE  ++ NLYY GM+YT+AT +  M N++PA  F++AWIFRLEKV +
Sbjct  67    TLPIFFKILLLGLLEPTIDQNLYYTGMKYTSATFTAAMTNVLPAFAFIMAWIFRLEKVNV  126

Query  1000  RNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKAT  821
             + +HSQAKI+GT   +GGAM+MT+VKGP+I LPW  + +D+  H          +  K  
Sbjct  127   KKIHSQAKILGTVVTVGGAMLMTVVKGPLIPLPWA-NPHDI--HQDPSNTGVQQDLTKGA  183

Query  820   LLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSLQ  641
              L+A  C   A FI LQA  +KSYP  LSLT  IC +GS++ +I+ L +ERGN S W++Q
Sbjct  184   SLIAIGCICWAGFINLQAITLKSYPVELSLTAYICFMGSIESTIVALFIERGNPSAWAIQ  243

Query  640   WDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLYM  461
              D  LL  VY G++ SG  YY+ G+IMK +GPVFVTAFNPLSMV+VAI+GS +L+E +++
Sbjct  244   LDSKLLAAVYGGVICSGIGYYVQGVIMKTRGPVFVTAFNPLSMVIVAILGSIILAEVMFL  303

Query  460   grvlgavvvlvglylviwGKSKDQTS---PDNNDALPIDHKQPQVV  332
             GR+LGA+V+++GLY V+WGKSKD+ S    D +  LP+    PQ+V
Sbjct  304   GRILGAIVIVLGLYSVLWGKSKDEPSSSFSDTDKELPLS--TPQIV  347



>emb|CDX93255.1| BnaC04g46410D [Brassica napus]
Length=376

 Score =   298 bits (762),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 178/345 (52%), Positives = 240/345 (70%), Gaps = 6/345 (2%)
 Frame = -3

Query  1357  KPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLE-RKTRPT  1181
             KP+L V+ LQ   AG +I++K AL++GM+P   + YR+ +A +  APFA FL+ RK RP 
Sbjct  7     KPFLIVISLQFGYAGLSIIAKFALDRGMSPHVLAAYRHIVATIFIAPFAFFLDSRKVRPK  66

Query  1180  MTTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVK  1004
             MT  IFFKI +L  L   ++ NLYY GM+YT+AT +  M N++PA  FL+AWIFRLEKV 
Sbjct  67    MTLPIFFKIALLGLLEPTIDQNLYYTGMKYTSATFTAAMTNVLPAFAFLMAWIFRLEKVN  126

Query  1003  IRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKA  824
             IR +HSQAKI+GT   +GGAM+MT+VKGP++ LPW  + ND  +H          +  K 
Sbjct  127   IRKVHSQAKILGTVVTVGGAMLMTVVKGPLVPLPWA-NPND--NHQDSSNPGVTPDLTKG  183

Query  823   TLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSL  644
              LL+A  C   A F+ LQA  IKSYP  LSLT  IC +GS++ +I+ L +ERGN S W++
Sbjct  184   ALLIAIGCICWAGFVNLQAITIKSYPVELSLTAYICLMGSIESTIVALFIERGNPSAWAI  243

Query  643   QWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLY  464
             Q D  LL  VY G++ SG  YY+ G+IMK +GPVFVTAFNPLSMV+VAI+GS +L+E +Y
Sbjct  244   QLDSKLLAAVYGGVICSGVGYYVQGVIMKTRGPVFVTAFNPLSMVIVAILGSIILAEVMY  303

Query  463   MgrvlgavvvlvglylviwGKSKDQTSPDNND-ALPIDHKQPQVV  332
             +GR+LGA+V+++GLY V+WGKSKD+ S   +D  +      PQVV
Sbjct  304   LGRILGAIVIVLGLYSVLWGKSKDEPSNSFSDMDIEFPRSTPQVV  348



>gb|EYU28266.1| hypothetical protein MIMGU_mgv1a008729mg [Erythranthe guttata]
Length=364

 Score =   297 bits (760),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 177/350 (51%), Positives = 249/350 (71%), Gaps = 3/350 (1%)
 Frame = -3

Query  1414  IKNIMMRNERVVKWLNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIA  1235
             +K I +  E + + L   AKP+L V+FLQ+  AG  I+ KAALN+GM+ + F  YR+ IA
Sbjct  1     MKKIQVSRENI-QLLFVKAKPFLAVIFLQLGVAGLDIICKAALNEGMSSYVFVVYRHVIA  59

Query  1234  AVIFAPFALFLERKTRPTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNL  1058
              V  APFAL LE+K RP MTTS+F KIVLL+LLE  ++ NLY++GM+YTTAT +  M N+
Sbjct  60    TVFIAPFALVLEKKIRPKMTTSVFAKIVLLSLLEPIIDQNLYFLGMKYTTATFAAAMGNV  119

Query  1057  IPAMTFLLAWIFRLEKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDV  878
             +PA+TF++A +FRLEKVK  + HS AK+VGT + + GAMIMTLVKGP I LPW K     
Sbjct  120   LPAITFIMACLFRLEKVKFTSKHSLAKMVGTLTTVTGAMIMTLVKGPHIHLPWNKEGLSN  179

Query  877   VSHSAQHVLNQHSNPIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQ  698
              +HS Q       + +   +++A  C   A F+ILQ   +++YPA LSLT  IC +G+++
Sbjct  180   NNHSTQKGEISFHHSVTGAIMIAIGCLCWACFMILQVITLRAYPAELSLTAWICVLGAVE  239

Query  697   CSILTLIVERGNASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPL  518
               ++ LI+E    + WSL+WD+ LL   Y G++ SG  YY+ G+++K +GPVFVTAF+PL
Sbjct  240   GGVVALIMENDKLA-WSLKWDIKLLAVAYSGIICSGIAYYVQGVVLKERGPVFVTAFSPL  298

Query  517   SMVLVAIIGSFVLSEKLYMgrvlgavvvlvglylviwGKSKDQTSPDNND  368
             SMVLVA++ SF+LSE++Y+GRV+GA+++++GLYLVIWGK KD  SP N +
Sbjct  299   SMVLVAVLSSFILSEQMYLGRVIGAIIIIMGLYLVIWGKKKDYNSPCNKE  348



>ref|XP_004236759.1| PREDICTED: WAT1-related protein At2g39510 [Solanum lycopersicum]
Length=376

 Score =   297 bits (760),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 198/359 (55%), Positives = 255/359 (71%), Gaps = 16/359 (4%)
 Frame = -3

Query  1360  AKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPT  1181
             +KPYL V+FLQ    GSAI++K ALN GM+ +TFS YRN  AAV+FAPFA  LERK RP 
Sbjct  16    SKPYLAVIFLQFGFGGSAIIAKTALNNGMSHYTFSVYRNLFAAVVFAPFAALLERKIRPK  75

Query  1180  MTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVK  1004
             MT SIF+KI+LL LLE  ++ NLYY GM+YTTAT +  M N++PA+TFLLAWI RLE V 
Sbjct  76    MTLSIFWKIMLLGLLEPVIDQNLYYAGMKYTTATFATAMCNVLPAITFLLAWILRLENVN  135

Query  1003  IRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHS-NPIK  827
             +  + SQAKI+GT   +GGA IM+LV GPII LPWTKH ++V   + ++V++ +  NP+K
Sbjct  136   VWKVSSQAKIIGTIITLGGATIMSLVGGPIIGLPWTKHHSNV--PTTKNVVSPNELNPVK  193

Query  826   ATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWS  647
               + +A  C   A F  LQA  +K Y AG+SLT+LIC  G+LQ + LTL+V+RGN  +WS
Sbjct  194   GAIFIAAGCFCWACFYNLQAITLKKYQAGMSLTSLICMSGALQGTALTLLVQRGNFGIWS  253

Query  646   LQWDMTLL-TYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
             ++W  +L    +Y G+V SG  YY+ G+IM  KGPVFVTAFNPL+MV+VAI+GSF+LSE+
Sbjct  254   IKWGSSLFYASLYCGIVNSGIGYYVSGLIMNEKGPVFVTAFNPLNMVIVAILGSFILSEQ  313

Query  469   LYMgrvlgavvvlvglylviwGKSKDQTS----------PDNNDALPIDHKQP-QVVQG  326
             L MGRV+GA V++VGLYLVIWG SKD+ S            NND    D K   Q+V G
Sbjct  314   LNMGRVVGAAVIVVGLYLVIWGTSKDKNSTKIVSTKENVESNNDKELADIKSSNQLVIG  372



>ref|XP_006365719.1| PREDICTED: WAT1-related protein At2g39510-like [Solanum tuberosum]
Length=377

 Score =   296 bits (759),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 175/319 (55%), Positives = 223/319 (70%), Gaps = 10/319 (3%)
 Frame = -3

Query  1411  KNIMMRNERVVKWLNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAA  1232
             K  +M+N +        +KPYL V+FLQ    GSAI++K ALN GM+ +TFS YRN  AA
Sbjct  6     KECLMKNLK-------RSKPYLAVIFLQFGFGGSAIIAKTALNNGMSHYTFSVYRNLFAA  58

Query  1231  VIFAPFALFLERKTRPTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLI  1055
             V+FAPFA  LERK RP MT SIF+KI+LL LLE  ++ NLYY GM+YTTAT +  M N++
Sbjct  59    VVFAPFAALLERKIRPKMTLSIFWKIMLLGLLEPVIDQNLYYAGMKYTTATFATAMCNVL  118

Query  1054  PAMTFLLAWIFRLEKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVV  875
             PA+TFLLAWI RLE V +  + SQAKI+GT   +GGA IMTLV GP I LPWTKH N+V 
Sbjct  119   PAITFLLAWILRLENVNVWKVGSQAKIIGTIITLGGATIMTLVGGPTIGLPWTKHHNNVP  178

Query  874   SHSAQHVLNQHSNPIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQC  695
             + +   V     NP+K  + +A  C   A F  LQA  +K Y AG+SLT+LIC  G+LQ 
Sbjct  179   T-TTNVVSPNELNPLKGAIFIAAGCFCWACFYNLQAITLKKYQAGMSLTSLICMSGALQG  237

Query  694   SILTLIVERGNASVWSLQWDMTLL-TYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPL  518
             + LTL+V+RGN  +WS+ W  +L    +Y G+V SG  YY+ G+IM  KGPVFVTAFNPL
Sbjct  238   TALTLLVQRGNFGIWSIHWGSSLFYASLYCGIVNSGIGYYVSGLIMNEKGPVFVTAFNPL  297

Query  517   SMVLVAIIGSFVLSEKLYM  461
             +MV+VAI+GSF+LSE+L M
Sbjct  298   NMVIVAILGSFILSEQLNM  316



>ref|XP_011019904.1| PREDICTED: WAT1-related protein At2g37460-like isoform X1 [Populus 
euphratica]
Length=348

 Score =   296 bits (757),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 170/343 (50%), Positives = 245/343 (71%), Gaps = 7/343 (2%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             + AKP++ VMFLQ   AG  ILSKAALNQGM+ +    YR+A+A V+ APFA  L++K R
Sbjct  5     DRAKPFVAVMFLQAGLAGMDILSKAALNQGMSNYVLVVYRHAVATVVIAPFAAILDKKLR  64

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT SIF K+V L+LLE  ++ NLY++GM+YTTAT +  ++N++PA+TF++AWI RLEK
Sbjct  65    PKMTLSIFIKLVALSLLEPVIDQNLYFLGMKYTTATFAAAIVNVLPAITFIIAWIVRLEK  124

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             VKI +LHSQAK+ GT + + GAM+MTL+KGP  L+ + +        +    ++ HS+ I
Sbjct  125   VKIGSLHSQAKVAGTIATVAGAMLMTLMKGP--LIEFFRIKGRAYHENGTSGIDLHSS-I  181

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
             K  L++   C S A F+ILQA  +KSYP  LSLT  IC +G+++ +++ L+ E+G  SVW
Sbjct  182   KGALMITVGCFSWACFMILQAITLKSYPVELSLTAWICLLGTIEGTVVALVAEKGKPSVW  241

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
             ++ WDM LL  VY G+  SG  YYI GI+MK +GPVFVTAF+PL MV+VA++ S + +E+
Sbjct  242   AINWDMKLLAAVYSGVFCSGLAYYIQGIVMKDRGPVFVTAFSPLCMVIVAVMSSIIWAEQ  301

Query  469   LYMgrvlgavvvlvglylviwGKSKD---QTSPDNNDALPIDH  350
             +Y+GR+LGA++++ GLYLV+WGKSKD    + P +   +P+  
Sbjct  302   MYLGRILGALIIVAGLYLVVWGKSKDYKTASPPADEQTIPVKQ  344



>ref|XP_010039215.1| PREDICTED: WAT1-related protein At2g37460-like [Eucalyptus grandis]
Length=386

 Score =   297 bits (760),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 178/384 (46%), Positives = 262/384 (68%), Gaps = 13/384 (3%)
 Frame = -3

Query  1378  KWLNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLE  1199
             K L +  KP+L V+FLQ   AG  IL KAALN+GM+ +    YRNA+A ++ APFA+ ++
Sbjct  4     KRLFHKLKPFLAVVFLQFGLAGMDILCKAALNKGMSNYVLVVYRNAVATIVIAPFAVIMD  63

Query  1198  RKTRPTMTTSIFFK-IVllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIF  1022
             RK RP MT  IF + IVL  L   ++ NLYY+GM+ TTAT +  M N++PA+  ++AWI 
Sbjct  64    RKKRPRMTLPIFIRLIVLSLLEPVIDQNLYYLGMKQTTATFAAAMCNILPAIALVMAWIM  123

Query  1021  RLEKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKH----SNDVVSHSAQHV  854
              LE VK++++ SQAK+ GT + + GAMIMTL+KGP++ L WT+     +N++ + SA   
Sbjct  124   GLETVKMKSIRSQAKVFGTLAMVAGAMIMTLIKGPVLELFWTRGGGTTANNIQNGSAAGG  183

Query  853   LNQHSNPIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIV  674
             ++   N I+ +L++   C S A F+ILQA  +++YPA LSLT  IC +G+++ +++ LI+
Sbjct  184   ISLQ-NSIEGSLMITAGCFSWACFMILQAITLQTYPAELSLTDWICFLGTVEGAVVALIM  242

Query  673   ERGNASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAII  494
             ERGNA+ W +QWD  LL  VY G+V SG  YYI G++MK +GPVFV AFNPLSMV+VAI+
Sbjct  243   ERGNATAWFIQWDTKLLAAVYSGIVCSGVAYYIQGVVMKDRGPVFVAAFNPLSMVIVAIL  302

Query  493   GSFVLSEKLYMgrvlgavvvlvglylviwGKSKD-QTSPDNND---ALP---IDHKQPQV  335
              +F+L+E+L++GR++GAVV++ GLYLV+WGK KD  +SP + D   ALP   +D      
Sbjct  303   STFILAEQLFLGRLVGAVVIVAGLYLVVWGKGKDYNSSPSSTDEPKALPTKFVDLGDNGK  362

Query  334   VQGFNKDITVSLN*KVELPRSHPH  263
                 ++ IT+S     E P ++ +
Sbjct  363   ENNSHEMITISACKDKETPETNEN  386



>ref|XP_008241503.1| PREDICTED: WAT1-related protein At2g37460-like [Prunus mume]
Length=372

 Score =   296 bits (758),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 181/367 (49%), Positives = 252/367 (69%), Gaps = 12/367 (3%)
 Frame = -3

Query  1390  ERVVKWLNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFA  1211
             ERV       AKP+  V+FLQ   AG  ILSKAALNQGM+ +    YR+ +A  + APFA
Sbjct  10    ERV-----KAAKPFFAVIFLQFGLAGMDILSKAALNQGMSNYVLVVYRHVVATAVVAPFA  64

Query  1210  LFLERKTRPTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLL  1034
             L L++K RP MT  IF KI+LL LLE  ++ NLY++GMRYTTAT +  M N++PA+TF +
Sbjct  65    LILDKKIRPKMTLPIFIKIMLLGLLEPVIDQNLYFMGMRYTTATFAAAMCNILPALTFAM  124

Query  1033  AWIFRLEKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHV  854
             AWI RLEKVK++ + SQ+K+ GTA+ + GAMIMTLVKGP++ L WT+ +      +   V
Sbjct  125   AWILRLEKVKLKCIRSQSKVFGTAATVAGAMIMTLVKGPLLDLFWTRGTTSHEQQTGGAV  184

Query  853   LNQHSNPIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIV  674
               Q S  IK  +++   C   A F+ILQ+  +K+YPA LSL+  IC +G+L+ + L L++
Sbjct  185   SLQSS--IKGAIMITIGCFCWACFMILQSITLKTYPAELSLSAWICLMGTLEGTALALVM  242

Query  673   ERGNASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAII  494
             ERGN++VW+++WD  LL   Y  +  SG  YYI GI+MK +GPVFVTAF+PLSMV+VA++
Sbjct  243   ERGNSAVWAIKWDAKLLAACYSAVFCSGLAYYIQGIVMKYRGPVFVTAFSPLSMVIVAVM  302

Query  493   GSFVLSEKLYMgrvlgavvvlvglylviwGKSKDQTS--PDNNDALPIDHKQPQVVQGFN  320
              SF+L E+LY+GR+LGA V++ GLY+V+WGKSKD  S  P   + +    KQ Q  +  N
Sbjct  303   SSFILREQLYLGRLLGAAVIITGLYMVVWGKSKDYKSETPTIEEEVA-STKQAQAKENPN  361

Query  319   -KDITVS  302
              + IT++
Sbjct  362   LQAITIA  368



>ref|XP_007009430.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
[Theobroma cacao]
 gb|EOY18240.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
[Theobroma cacao]
Length=394

 Score =   296 bits (759),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 172/333 (52%), Positives = 240/333 (72%), Gaps = 5/333 (2%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             N A PYL ++F++  SAG  I++K ALN+GM+      YR AIA ++ APFA+  +RK R
Sbjct  9     NKAMPYLAMVFMRFGSAGMPIVAKFALNRGMSQHVLVVYRFAIATLVLAPFAIVFDRKVR  68

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT SIF +I+LL LLE  ++ NLYY G++YTTAT++  + N++PA  FLLA   RLEK
Sbjct  69    PKMTFSIFVQILLLGLLEPTIDQNLYYTGIKYTTATVATALCNVLPAFVFLLALACRLEK  128

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             V +R LH QAKI+GT   +GGAMIMTLV GPI+ LPWTK +N+   H +  V     +P+
Sbjct  129   VDMRKLHCQAKILGTLGTVGGAMIMTLVNGPILPLPWTKVTNE---HQST-VSATKDDPL  184

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
             K  L++   C   A F+ILQA  +KSYPA LSLTTL+C +G+++ +I+ L++E GNA+ W
Sbjct  185   KGALMILAGCVCWACFVILQAITLKSYPAELSLTTLVCFMGAIEGTIVALVMEGGNAAAW  244

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
             S+ WD  L   VY G++ SG  YY+  ++++ KGPVF  AFNPL+MV+VAI+ SF+ SE 
Sbjct  245   SIHWDSKLFAAVYSGVICSGVAYYVGAMVIQAKGPVFYAAFNPLTMVIVAIMSSFIFSEI  304

Query  469   LYMgrvlgavvvlvglylviwGKSKDQTSPDNN  371
             +Y+GRV+GA+V++VGLYLV+WGK+KDQ S D++
Sbjct  305   MYLGRVIGAIVIVVGLYLVLWGKNKDQHSSDSD  337



>ref|XP_002312071.1| nodulin MtN21 family protein [Populus trichocarpa]
 gb|EEE89438.1| nodulin MtN21 family protein [Populus trichocarpa]
Length=380

 Score =   296 bits (757),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 177/334 (53%), Positives = 236/334 (71%), Gaps = 5/334 (1%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             + AKP+L V+ LQ   AG   ++K AL++GM+      YR+A+A ++ APFAL  +RK R
Sbjct  9     DRAKPFLAVILLQFGYAGMFTMTKHALDEGMSQHVLVVYRHAVATIVIAPFALVFDRKVR  68

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT SIFFKI+LL LLE  ++ NLYY GM+YTTAT +  M N++PA  FL+AW  R+E+
Sbjct  69    PKMTLSIFFKIMLLGLLEPTIDQNLYYTGMKYTTATFTSAMCNVLPAFAFLMAWALRIEQ  128

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             V IR +HSQAKI GT   +GGAM+MTLVKG  + LPWT+  +   S SA        +PI
Sbjct  129   VNIRKMHSQAKIFGTIVTVGGAMLMTLVKGTQLDLPWTRGYDQQASTSAL----TKQDPI  184

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
             K  L++A  C   A FIILQ+  +KSYP  LSLT  IC +G+++ S++ +++ERGN S W
Sbjct  185   KGALMIATGCVCWASFIILQSITLKSYPVELSLTAWICFMGTIEGSMVAVVMERGNPSAW  244

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
             S+  +  LL  VY G++ SG  YY+ G+IMK KGPVFVTAF+PLSMV+VAI+GSF L E 
Sbjct  245   SVGLNYKLLAAVYSGVICSGIGYYVQGLIMKRKGPVFVTAFSPLSMVIVAILGSFFLKEI  304

Query  469   LYMgrvlgavvvlvglylviwGKSKDQTSPDNND  368
             L +GRV+GAVV++ GLYLV+WGKSKDQ   D++D
Sbjct  305   LCVGRVIGAVVIVTGLYLVLWGKSKDQPPSDSSD  338



>ref|XP_010554592.1| PREDICTED: WAT1-related protein At2g39510-like [Tarenaya hassleriana]
Length=378

 Score =   295 bits (756),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 173/342 (51%), Positives = 242/342 (71%), Gaps = 7/342 (2%)
 Frame = -3

Query  1357  KPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPTM  1178
             KP+L V+FLQ  SAG +I++K+ALN GM+P     YR  +A ++ +PFA FL+RK RP M
Sbjct  13    KPFLLVIFLQFGSAGLSIIAKSALNNGMSPHVLVSYRYIVATLVISPFAFFLDRKVRPKM  72

Query  1177  TTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVKI  1001
             T  + FKI++L LLE  ++ NLYY GMRYT+AT +  M N++PA  FL+AW+FRLE V I
Sbjct  73    TLPVLFKILMLGLLEPTIDQNLYYTGMRYTSATFTAAMSNVLPAFAFLMAWLFRLENVNI  132

Query  1000  RNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIK-A  824
             R    QAKI GT   +GGAM+MTLV+GP++ LPW  +  D++   A +     + P+K A
Sbjct  133   RKTQGQAKIFGTIVTVGGAMLMTLVRGPLVPLPWNTNP-DIIDREAPNP-EIENQPLKGA  190

Query  823   TLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSL  644
              L++ GS C  A FI LQA  +KSYP  LSLT  IC +G+++ ++   ++ERGN + WS+
Sbjct  191   ILIVVGSIC-WAGFINLQAITLKSYPFELSLTAYICLMGAIEGTLAAFLIERGNPAAWSV  249

Query  643   QWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLY  464
             Q+D  LL  VY G++ SG  YY+ G+IMK +GPVFVTAF+PL MV+VAI+GSFVL+E  +
Sbjct  250   QFDSKLLAAVYSGVICSGIAYYVQGLIMKTRGPVFVTAFSPLKMVIVAILGSFVLAEVFF  309

Query  463   MgrvlgavvvlvglylviwGKSKDQTSP--DNNDALPIDHKQ  344
             +G VLGA+V+++GLY V+WGKSKD+ +P  D ++ LP+   Q
Sbjct  310   LGTVLGAIVIVLGLYSVLWGKSKDEPAPFSDMDNELPLGRIQ  351



>ref|XP_011094815.1| PREDICTED: WAT1-related protein At2g37460-like [Sesamum indicum]
 ref|XP_011094816.1| PREDICTED: WAT1-related protein At2g37460-like [Sesamum indicum]
Length=383

 Score =   295 bits (756),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 175/343 (51%), Positives = 256/343 (75%), Gaps = 5/343 (1%)
 Frame = -3

Query  1372  LNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERK  1193
             L + +KP+LGV+FLQ   AG  I+SKAALN+GM+ + F  YR+A+A ++ APFA+ L++K
Sbjct  11    LFHKSKPFLGVVFLQAGLAGMDIISKAALNEGMSNYVFVVYRHAVATLVIAPFAIALDKK  70

Query  1192  TRPTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRL  1016
              RP MTT+IF KI+LL+LLE  ++ NLY++GM+YTTAT +  M N++PA+TF++A IFRL
Sbjct  71    IRPKMTTAIFAKIMLLSLLEPVIDQNLYFLGMKYTTATFAAAMANVLPAITFVMACIFRL  130

Query  1015  EKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSN  836
             EKV++ ++ SQAKI+GT + + GAMIMTLV+GP + LPWTK   D     ++  L QHS 
Sbjct  131   EKVRLMSIRSQAKIIGTLATVAGAMIMTLVRGPNLDLPWTKVMTDPARQQSEVNL-QHS-  188

Query  835   PIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNAS  656
              IK  L++   C S A F+ILQA  +++YPA LSLT  IC +G+ Q + + L++E+GN++
Sbjct  189   -IKGALMITVGCFSWACFMILQAVTLRTYPAELSLTAWICLLGTAQGAAVALVMEKGNSA  247

Query  655   VWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLS  476
              W+++WD   L   Y G+  SG  YY+ G+IMK +GPVFVTAF+PLSMV+VAI+ SF+L+
Sbjct  248   AWAIKWDTKFLAAAYSGIFCSGIAYYVQGVIMKERGPVFVTAFSPLSMVIVAIMSSFILA  307

Query  475   EKLYMgrvlgavvvlvglylviwGKSKDQTSP-DNNDALPIDH  350
             E++++GRV+GA+V+++GLYLV+WGK KD  SP +  + +P+  
Sbjct  308   EQMFLGRVVGAIVIVMGLYLVVWGKKKDYGSPSEGEEEIPVKQ  350



>ref|XP_007205382.1| hypothetical protein PRUPE_ppa007333mg [Prunus persica]
 gb|EMJ06581.1| hypothetical protein PRUPE_ppa007333mg [Prunus persica]
Length=372

 Score =   295 bits (754),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 179/367 (49%), Positives = 252/367 (69%), Gaps = 12/367 (3%)
 Frame = -3

Query  1390  ERVVKWLNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFA  1211
             ERV       AKP+  V+FLQ   AG  ILSKAALNQGM+ +    YR+ +A  + APFA
Sbjct  10    ERV-----KAAKPFFAVIFLQFGLAGMDILSKAALNQGMSNYVLVVYRHVVATAVVAPFA  64

Query  1210  LFLERKTRPTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLL  1034
             L L++K RP MT  IF KI+LL LLE  ++ NLY++GMRYTTAT +  M N++PA+TF +
Sbjct  65    LILDKKIRPKMTLPIFIKIMLLGLLEPVIDQNLYFMGMRYTTATFAAAMCNILPALTFAM  124

Query  1033  AWIFRLEKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHV  854
             AWI RLEKVK++ + SQ+K+ GTA+ + GAMIMTLVKGP++ L WT+ +      +   +
Sbjct  125   AWILRLEKVKLKCIRSQSKVFGTAATVAGAMIMTLVKGPLLDLFWTRGTTSHEQQTGGAI  184

Query  853   LNQHSNPIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIV  674
               Q S  IK  +++   C   A F+ILQ+  +K+YPA LSL+  IC +G+L+ + L L++
Sbjct  185   SLQSS--IKGAVMITIGCFCWACFMILQSITLKTYPAELSLSAWICLMGTLEGTALALVM  242

Query  673   ERGNASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAII  494
             ERGN++VW+++WD  LL   Y  +  SG  YYI G++MK +GPVFVTAF+PLSMV+VA++
Sbjct  243   ERGNSAVWAIKWDAKLLAACYSAVFCSGLAYYIQGVVMKYRGPVFVTAFSPLSMVIVAVM  302

Query  493   GSFVLSEKLYMgrvlgavvvlvglylviwGKSKDQTS--PDNNDALPIDHKQPQVVQGFN  320
              SF+L E+LY+GR+LGA V++ GLY+V+WGKSKD  S  P   + +    KQ Q  +  N
Sbjct  303   SSFILREQLYLGRLLGAAVIVAGLYMVVWGKSKDYKSETPTIEEEVA-STKQAQAKENPN  361

Query  319   -KDITVS  302
              + IT++
Sbjct  362   LQAITIA  368



>ref|XP_004307548.1| PREDICTED: auxin-induced protein 5NG4-like [Fragaria vesca subsp. 
vesca]
Length=350

 Score =   294 bits (752),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 178/346 (51%), Positives = 238/346 (69%), Gaps = 6/346 (2%)
 Frame = -3

Query  1399  MRNERVVKWLNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFA  1220
             M  E V + L   AKP++ V+FLQ   AG +I++K ALNQGM+      YRNA+A V  A
Sbjct  1     MPKESVSQMLTQ-AKPFVAVIFLQFGFAGMSIITKFALNQGMSQHVLVVYRNAVAFVFIA  59

Query  1219  PFALFLERKTRPTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMT  1043
             PFAL  +RK RP MT S+F KI+LL LLE  ++ NL+Y GM+ TTAT +  M N++PA  
Sbjct  60    PFALVFDRKLRPKMTLSVFVKILLLGLLEPVIDGNLFYTGMKLTTATFTTAMCNVLPAFA  119

Query  1042  FLLAWIFRLEKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSA  863
             F++AWIFRLE V IR LHSQAKI+GT   +GGAM+MTLV GP++ LPWT+ +    SH  
Sbjct  120   FIMAWIFRLEMVNIRKLHSQAKILGTIVTVGGAMLMTLVNGPMLTLPWTRST----SHHQ  175

Query  862   QHVLNQHSNPIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILT  683
                     +PIK  L++   C   A F+ILQA  +K YPA LSLT  IC +G+L+ ++  
Sbjct  176   YTGSTASQDPIKGALMITAGCFCWASFMILQAVTLKVYPAELSLTAWICLMGTLEGTVAA  235

Query  682   LIVERGNASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLV  503
             + +E  N + W++  D  LL  VY G++ SG  YYI GI+MK +GPVFVTAFNPLSMV+V
Sbjct  236   VAIEWHNTAAWAIHLDYKLLPAVYGGVICSGVAYYIQGIVMKERGPVFVTAFNPLSMVIV  295

Query  502   AIIGSFVLSEKLYMgrvlgavvvlvglylviwGKSKDQTSPDNNDA  365
             AI+ S  LSE LY+GRV+GA+V+++GLY+V+WGKSKD  S  +++A
Sbjct  296   AILSSIALSEILYLGRVMGAMVIIIGLYMVLWGKSKDHHSQTDSEA  341



>ref|XP_010554433.1| PREDICTED: WAT1-related protein At2g39510-like [Tarenaya hassleriana]
Length=355

 Score =   294 bits (752),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 179/348 (51%), Positives = 246/348 (71%), Gaps = 10/348 (3%)
 Frame = -3

Query  1339  MFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPTMTTSIFF  1160
             MFLQ   AG AI++K+ALN+GM+P   + YR+ +A ++ APFA F +RK RP MT  I F
Sbjct  1     MFLQFGIAGLAIIAKSALNKGMSPHVLAAYRHIVATLVIAPFAFFFDRKVRPKMTLPILF  60

Query  1159  KIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVKIRNLHSQ  983
             KIVLL LLE  ++ NLYY GM  T+AT +  M N++PA +FL+AW+FRLEKV +R + SQ
Sbjct  61    KIVLLGLLEPTIDQNLYYTGMGCTSATFTAAMSNVLPAFSFLMAWLFRLEKVNVRKIPSQ  120

Query  982   AKIVGTASAIGGAMIMTLVKGPIILLPWTK-HSNDVVSHSAQHVLNQHSNPIKATLLLAG  806
             AKI+GT   +GGAM+MTLVKGP++ LPWT  HSN   S  A +   +  + +K  +L+  
Sbjct  121   AKILGTIVTVGGAMLMTLVKGPLVPLPWTNNHSN---SQGASNPETKQ-DLVKGAILIGV  176

Query  805   SCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSLQWDMTL  626
              C   A FI LQA  +KSYPA LSLT  +C  G++  +I+ L++ER N + WS+Q+D  L
Sbjct  177   GCICWAGFINLQAITLKSYPAELSLTAYMCLSGAIGGTIVALVIERANPAAWSIQFDSKL  236

Query  625   LTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLYMgrvlg  446
             L  VY G++ SG  YYI G +MK +GPVFVTAFNPLSMV+VAI+GSF+L+E +++GR+LG
Sbjct  237   LAVVYSGVICSGISYYIQGAVMKTRGPVFVTAFNPLSMVIVAILGSFLLAEVMFLGRILG  296

Query  445   avvvlvglylviwGKSKDQTS--PDNNDALPIDHKQPQVVQGFNKDIT  308
             AVV+++GLY V+WGKSKD+ +   D ++ LP+ H Q   V+G +   T
Sbjct  297   AVVIVLGLYSVLWGKSKDEPASFSDMDNELPLSHVQQ--VEGVSSKAT  342



>ref|XP_011019905.1| PREDICTED: WAT1-related protein At2g37460-like isoform X2 [Populus 
euphratica]
Length=313

 Score =   292 bits (747),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 152/303 (50%), Positives = 218/303 (72%), Gaps = 4/303 (1%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             + AKP++ VMFLQ   AG  ILSKAALNQGM+ +    YR+A+A V+ APFA  L++K R
Sbjct  5     DRAKPFVAVMFLQAGLAGMDILSKAALNQGMSNYVLVVYRHAVATVVIAPFAAILDKKLR  64

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT SIF K+V L+LLE  ++ NLY++GM+YTTAT +  ++N++PA+TF++AWI RLEK
Sbjct  65    PKMTLSIFIKLVALSLLEPVIDQNLYFLGMKYTTATFAAAIVNVLPAITFIIAWIVRLEK  124

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             VKI +LHSQAK+ GT + + GAM+MTL+KGP+I   + +        +    ++ HS+ I
Sbjct  125   VKIGSLHSQAKVAGTIATVAGAMLMTLMKGPLI--EFFRIKGRAYHENGTSGIDLHSS-I  181

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
             K  L++   C S A F+ILQA  +KSYP  LSLT  IC +G+++ +++ L+ E+G  SVW
Sbjct  182   KGALMITVGCFSWACFMILQAITLKSYPVELSLTAWICLLGTIEGTVVALVAEKGKPSVW  241

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
             ++ WDM LL  VY G+  SG  YYI GI+MK +GPVFVTAF+PL MV+VA++ S +L+++
Sbjct  242   AINWDMKLLAAVYSGVFCSGLAYYIQGIVMKDRGPVFVTAFSPLCMVIVAVMSSIILAQQ  301

Query  469   LYM  461
             +Y+
Sbjct  302   MYL  304



>ref|XP_004302750.1| PREDICTED: auxin-induced protein 5NG4-like [Fragaria vesca subsp. 
vesca]
Length=365

 Score =   293 bits (751),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 168/333 (50%), Positives = 244/333 (73%), Gaps = 5/333 (2%)
 Frame = -3

Query  1360  AKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPT  1181
             AKP+L V+FLQ   AG  IL KAALN+G++ +    YR+A+A ++  PFA+ L++K RP 
Sbjct  13    AKPFLAVVFLQFGLAGMDILCKAALNEGVSNYVLVVYRHAVATLVVGPFAVVLDKKVRPK  72

Query  1180  MTTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVK  1004
             MT +IF KI VL  L   L+ NLYY+GM+YTTAT +  M N++PA+TF++AWI RLEKVK
Sbjct  73    MTLAIFTKIMVLGLLEPVLDQNLYYLGMKYTTATFAAAMSNILPALTFVMAWILRLEKVK  132

Query  1003  IRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKA  824
             +  + SQ K++GTA+ + GAMIMTLVKGP++ L WT+ +    +    + ++ HS+ IK 
Sbjct  133   LTCIRSQCKLLGTAATVAGAMIMTLVKGPLLKLFWTRATTS--NQQQTNGVDIHSS-IKG  189

Query  823   TLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSL  644
              L++   C   A F+ILQ+  +++YPA LSL+  IC +G+L+ + + L++ERGNA+VW++
Sbjct  190   ALMITAGCFCWACFMILQSMTLRTYPAELSLSAWICLMGTLEGTAVALVMERGNAAVWAI  249

Query  643   QWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLY  464
              WD  LL  VY G+  SG  YYI G++MK +GPVFVTAF+PLSMV+VA++ SF+L E+L+
Sbjct  250   HWDGKLLAAVYSGIFCSGLAYYIQGVVMKHRGPVFVTAFSPLSMVIVAVMSSFILREQLF  309

Query  463   MgrvlgavvvlvglylviwGKSKDQTSPDNNDA  365
             +GR+LGA V+++GLYLV+WGKSK++ SP+   A
Sbjct  310   LGRLLGAFVIIIGLYLVVWGKSKEK-SPEEELA  341



>emb|CBI32681.3| unnamed protein product [Vitis vinifera]
Length=383

 Score =   293 bits (751),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 179/362 (49%), Positives = 245/362 (68%), Gaps = 18/362 (5%)
 Frame = -3

Query  1357  KPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFAL------FLER  1196
             KP+L V FLQ   AG  + SK ALNQG++ +    YR+AIA    APFA       F  R
Sbjct  18    KPFLAVTFLQFGFAGMDVFSKVALNQGVSNYVLVVYRHAIATAFIAPFAKTEYKIHFFNR  77

Query  1195  KTRPTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFR  1019
             K RP MT SIF K++LL+LLE  ++ NLYY G++YTTAT +  M N++PA+TFL+A IF 
Sbjct  78    KVRPKMTFSIFTKLMLLSLLEPVIDQNLYYFGLKYTTATFAAAMYNILPAITFLMACIFG  137

Query  1018  LEKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHS  839
             LEKV ++++HSQAK+VGT + + GAM+MTLVKGP+I L WTK  N+      Q V    +
Sbjct  138   LEKVTLKSIHSQAKVVGTVATVAGAMLMTLVKGPVIELIWTKGRNN------QGVKGGGT  191

Query  838   N---PIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVER  668
             N    IK +L++   C S A FIILQA  +K+YPA LSLT  IC +G+ Q +I+ L++ER
Sbjct  192   NIHDSIKGSLMITAGCFSWACFIILQAITLKTYPAELSLTAWICLLGTAQGTIVALVMER  251

Query  667   GNASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGS  488
             G  SVWS+ WD   L  +Y G+V SG  YYI G++MK +GPVFVTAFNPLSM++VA++ S
Sbjct  252   GKTSVWSIHWDTKFLAALYSGIVCSGLAYYIQGVVMKDRGPVFVTAFNPLSMIIVAVMSS  311

Query  487   FVLSEKLYMgrvlgavvvlvglylviwGKSKD--QTSPDNNDALPIDHKQPQVVQGFNKD  314
             F+L+E++Y+GRV+GA+V++ GLY V+WGKSK+    SP  +  +  D +        N++
Sbjct  312   FILAEQMYLGRVIGAIVIVAGLYFVVWGKSKEYKSGSPSTDGQMVQDKQMTDASSDSNEN  371

Query  313   IT  308
              T
Sbjct  372   ST  373



>ref|XP_011077436.1| PREDICTED: WAT1-related protein At2g37460-like [Sesamum indicum]
Length=383

 Score =   293 bits (750),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 180/354 (51%), Positives = 251/354 (71%), Gaps = 10/354 (3%)
 Frame = -3

Query  1372  LNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERK  1193
             L   AKP+L V+FLQ   AG  I+SKAA+NQGM+ +    YR+AIA +  +PFA   ++K
Sbjct  13    LFGKAKPFLCVVFLQAGVAGMDIISKAAMNQGMSTYVLVVYRHAIATIFISPFAFAFDKK  72

Query  1192  TRPTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRL  1016
              RP M  SIF+KI+LL+LLE  ++ N Y++GM++TTAT +  M N++PA+TFL+A  FRL
Sbjct  73    IRPRMNFSIFWKILLLSLLEPIIDQNFYFLGMKHTTATFTAAMANVLPAITFLMACFFRL  132

Query  1015  EKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSN  836
             EKVK+++ HSQAKIVGT + + GAMIMTLV+GP I LPWTK  +   +H  +  L QHS 
Sbjct  133   EKVKLKSTHSQAKIVGTLATVAGAMIMTLVRGPDIPLPWTKEGSKHGNHQGEIDL-QHS-  190

Query  835   PIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNAS  656
              IK  +++   C S A F+ILQ   +++YPA LSLT  IC +G+++ +I+ LI+E+GNA+
Sbjct  191   -IKGAVMIIIGCFSWACFMILQVITLQTYPAELSLTAWICLMGTVEGAIVALIMEKGNAT  249

Query  655   VWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLS  476
              WSL+WD+      Y G+  SG  YY+ G++MK +GPVFVTAF+PLSM+LVAI+ SF+L+
Sbjct  250   AWSLKWDIRFFAAAYSGIFCSGIAYYVQGVVMKERGPVFVTAFSPLSMILVAILSSFILA  309

Query  475   EKLYMgrvlgavvvlvglylviwGKSKDQTSPDNNDALPIDHKQPQVVQGFNKD  314
             EKLY+GRV+GA+V++VGLY V+WGK KD   P   +      ++P V Q  N D
Sbjct  310   EKLYLGRVIGAMVIIVGLYFVVWGKRKDYKPPSAGE------QEPPVNQSGNID  357



>ref|XP_011023754.1| PREDICTED: LOW QUALITY PROTEIN: WAT1-related protein At2g39510-like 
[Populus euphratica]
Length=351

 Score =   292 bits (747),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 175/334 (52%), Positives = 234/334 (70%), Gaps = 5/334 (1%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             + AKP+L V+ LQ   AG   ++K AL++GM+       R+A+A ++  PFAL  +RK R
Sbjct  9     DRAKPFLAVILLQFGYAGMFTITKHALDEGMSQHVLVVXRHAVATIVITPFALVFDRKVR  68

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT SIFFKI+LL LLE  ++ NLYY GM+YTTAT +  M N++PA  FL+AW+ R+E+
Sbjct  69    PKMTLSIFFKIMLLGLLEPTIDQNLYYTGMKYTTATFTSAMCNVLPAFAFLMAWVLRIEQ  128

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             V IR  HSQAKI GT   +GGAM+MTLVKG  + LPWT+  +   S SA        +PI
Sbjct  129   VNIRKKHSQAKIFGTIVTVGGAMLMTLVKGTQLDLPWTRGYDQQASTSAL----TKQDPI  184

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
             K  L++A  C   A FIILQ+  +KSYP  LSLT  IC +G+++ S++ +++ERGN S W
Sbjct  185   KGALMIATGCVCWASFIILQSITLKSYPVELSLTAWICFMGTIEGSMVAVVMERGNPSAW  244

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
             S+  +  LL  VY G++ SG  YY+ G+IMK KGPVFVTAF+PLSMV+V I+GSF L E 
Sbjct  245   SVGLNYKLLAAVYSGVICSGIGYYVQGLIMKRKGPVFVTAFSPLSMVIVTILGSFFLKEI  304

Query  469   LYMgrvlgavvvlvglylviwGKSKDQTSPDNND  368
             LY+GRV+GAVV++ GLYLV+WGKSKDQ   D++D
Sbjct  305   LYVGRVIGAVVIVTGLYLVLWGKSKDQPPSDSSD  338



>gb|KCW49647.1| hypothetical protein EUGRSUZ_K03165 [Eucalyptus grandis]
Length=472

 Score =   296 bits (757),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 182/404 (45%), Positives = 271/404 (67%), Gaps = 17/404 (4%)
 Frame = -3

Query  1438  SRGE*KELIKNIMMRNERVVKWLNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTF  1259
             + GE  + I++  M  +R+   L    KP+L V+FLQ   AG  IL KAALN+GM+ +  
Sbjct  74    TEGEGTDKIESKAMDAKRLFHKL----KPFLAVVFLQFGLAGMDILCKAALNKGMSNYVL  129

Query  1258  SFYRNAIAAVIFAPFALFLERKTRPTMTTSIFFK-IVllalleqlnlnLYYVGMRYTTAT  1082
               YRNA+A ++ APFA+ ++RK RP MT  IF + IVL  L   ++ NLYY+GM+ TTAT
Sbjct  130   VVYRNAVATIVIAPFAVIMDRKKRPRMTLPIFIRLIVLSLLEPVIDQNLYYLGMKQTTAT  189

Query  1081  ISVTMLNLIPAMTFLLAWIFRLEKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLP  902
              +  M N++PA+  ++AWI  LE VK++++ SQAK+ GT + + GAMIMTL+KGP++ L 
Sbjct  190   FAAAMCNILPAIALVMAWIMGLETVKMKSIRSQAKVFGTLAMVAGAMIMTLIKGPVLELF  249

Query  901   WTKH----SNDVVSHSAQHVLNQHSNPIKATLLLAGSCCSTAIFIILQANMIKSYPAGLS  734
             WT+     +N++ + SA   ++   N I+ +L++   C S A F+ILQA  +++YPA LS
Sbjct  250   WTRGGGTTANNIQNGSAAGGISLQ-NSIEGSLMITAGCFSWACFMILQAITLQTYPAELS  308

Query  733   LTTLICTIGSLQCSILTLIVERGNASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKV  554
             LT  IC +G+++ +++ LI+ERGNA+ W +QWD  LL  VY G+V SG  YYI G++MK 
Sbjct  309   LTDWICFLGTVEGAVVALIMERGNATAWFIQWDTKLLAAVYSGIVCSGVAYYIQGVVMKD  368

Query  553   KGPVFVTAFNPLSMVLVAIIGSFVLSEKLYMgrvlgavvvlvglylviwGKSKD-QTSPD  377
             +GPVFV AFNPLSMV+VAI+ +F+L+E+L++GR++GAVV++ GLYLV+WGK KD  +SP 
Sbjct  369   RGPVFVAAFNPLSMVIVAILSTFILAEQLFLGRLVGAVVIVAGLYLVVWGKGKDYNSSPS  428

Query  376   NND---ALP---IDHKQPQVVQGFNKDITVSLN*KVELPRSHPH  263
             + D   ALP   +D          ++ IT+S     E P ++ +
Sbjct  429   STDEPKALPTKFVDLGDNGKENNSHEMITISACKDKETPETNEN  472



>gb|AFK37263.1| unknown [Lotus japonicus]
Length=386

 Score =   293 bits (749),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 182/361 (50%), Positives = 256/361 (71%), Gaps = 13/361 (4%)
 Frame = -3

Query  1378  KWLNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLE  1199
             KW +  AKP++GV+F+Q   AG  +L KAALN GM+ +    YR+A+A V+  PFAL L+
Sbjct  7     KWFHK-AKPFIGVVFIQSGYAGMDVLCKAALNNGMSNYVLVVYRHAVAFVVMVPFALILD  65

Query  1198  RKTRPTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIF  1022
             +K RP MT SIF KIVLL+LLE  ++ NLYY+GM+YTTAT +V+M N++PA+TFL+A+I 
Sbjct  66    KKIRPKMTFSIFVKIVLLSLLEPVIDQNLYYLGMKYTTATFAVSMYNILPAITFLMAYIL  125

Query  1021  RLEKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQH  842
             +LEK+KI+++ SQAK+ GT + + GAM+MTL+KGP + L  T   +         V  QH
Sbjct  126   KLEKIKIKSIRSQAKVFGTLATVAGAMVMTLIKGPELELFGTHGGSSTHIQHNGGVNLQH  185

Query  841   SNPIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGN  662
             +  IK ++++   C S A F+ILQA  +++YPA LSLT  IC +G+++  I+ L++ERGN
Sbjct  186   A--IKGSVMITIGCFSFAGFMILQAITLEAYPADLSLTAWICLLGTVEGGIVALVMERGN  243

Query  661   -ASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSF  485
              A VWSL W+ +LL  VY G+V SG  YYI G +MK KGPVFVT F+PL M++VAI+GSF
Sbjct  244   PAPVWSLNWNTSLLAAVYGGIVCSGMTYYIQGAVMKYKGPVFVTTFSPLCMIIVAILGSF  303

Query  484   VLSEKLYMgrvlgavvvlvglylviwGKSKDQTSPD----NNDALPIDHKQPQVVQGFNK  317
             +L+E++Y+GRV+GA+V+L+GLYLV+WGK+KD  SP     N   LP      Q ++   K
Sbjct  304   ILAEQMYLGRVIGAIVILLGLYLVVWGKNKDYDSPPSPIINEHVLP----DKQTIESNAK  359

Query  316   D  314
             D
Sbjct  360   D  360



>ref|XP_002308146.2| hypothetical protein POPTR_0006s08270g [Populus trichocarpa]
 gb|EEE91669.2| hypothetical protein POPTR_0006s08270g [Populus trichocarpa]
Length=414

 Score =   293 bits (750),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 175/346 (51%), Positives = 248/346 (72%), Gaps = 5/346 (1%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             + AKP++ V+FLQV  AG  ILSKAALNQGM+ +    YR+A+A V+ APFA  L++K R
Sbjct  71    DRAKPFVAVIFLQVGFAGMDILSKAALNQGMSNYVLVVYRHAVATVVIAPFAAILDKKLR  130

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT SIF K+V L+LLE  ++ NLY++GM+YTTAT +  ++N++PA+TF++AWI RLEK
Sbjct  131   PKMTLSIFIKLVALSLLEPVIDQNLYFLGMKYTTATFAAAIVNVLPAITFIIAWIVRLEK  190

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             VKI +LHSQAK+ GT + + GAM+MTL+KGP  L+ + +   +    +    ++ HS+ I
Sbjct  191   VKIGSLHSQAKLAGTIATVAGAMLMTLMKGP--LIEFFRIKGNAYHENGTGGIDLHSS-I  247

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
             K  L++   C S A F+ILQA  +KSYPA LSLT  IC +G+++ +++ L+ E G  SVW
Sbjct  248   KGALMITVGCFSWACFMILQAITLKSYPAELSLTAWICLLGTIEGAVVALVAENGKPSVW  307

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
             ++ WDM LL  VY G+  SG  YYI GI+MK +GPVFVTAF+PL MV+VA++   + +E+
Sbjct  308   AINWDMKLLAAVYSGIFCSGLAYYIQGIVMKDRGPVFVTAFSPLCMVIVAVMSCIIWAEQ  367

Query  469   LYMgrvlgavvvlvglylviwGKSKD-QTSPDNNDALPIDHKQPQV  335
             +Y+GR+LGA++++ GLYLV+WGKSKD +TS    D   I  KQ  V
Sbjct  368   MYLGRILGAIIIVAGLYLVVWGKSKDYKTSSPPADEQTIPVKQTTV  413



>ref|XP_006294412.1| hypothetical protein CARUB_v10023430mg [Capsella rubella]
 gb|EOA27310.1| hypothetical protein CARUB_v10023430mg [Capsella rubella]
Length=380

 Score =   292 bits (747),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 177/374 (47%), Positives = 256/374 (68%), Gaps = 18/374 (5%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
               A+P++ ++ LQV  AG  ILSKA LN+GM+ +    YR+A+A V+ APFA + ++K R
Sbjct  11    EKARPFISMVVLQVGLAGMDILSKAVLNKGMSNYVLVVYRHAVATVVMAPFAFYFDKKVR  70

Query  1186  PTMTTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT  IFFKI +L  L   ++ NLYY+GM+YTTAT +  M N++PA+TF+LA+IF LE+
Sbjct  71    PKMTLMIFFKISLLGLLEPVIDQNLYYLGMKYTTATFATAMYNVLPAITFVLAYIFGLER  130

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             VK+R + S  K++GT + +GGAMIMTLVKGP++ L WTK     +S       + HS  I
Sbjct  131   VKLRCIRSAGKVIGTLATVGGAMIMTLVKGPVLDLFWTKG----ISSKNTAGTDIHS-AI  185

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
             K  +L+   C S A F+ILQA  +++YPA LSLT  IC +G+L+ +++ L++E+GN S W
Sbjct  186   KGAVLVTIGCFSYACFMILQAVTLRTYPAELSLTAWICLMGTLEGTVVALVMEKGNPSAW  245

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
             ++ WD  LLT  Y G+V S   YY+ G++MK +GPVFVTAF+PL M++VAI+ + + +E+
Sbjct  246   AIGWDTKLLTSTYSGIVCSALAYYVGGVVMKTRGPVFVTAFSPLCMIIVAIMSTIIFAEQ  305

Query  469   LYMgrvlgavvvlvglylviwGKSKD---QTSPDNNDALPIDHKQPQV-VQGFNKDIT--  308
             +Y+GRVLGAVV+  GLYLVIWGK KD   QT+P  ND    +  QP++ + G  KD T  
Sbjct  306   MYLGRVLGAVVICGGLYLVIWGKGKDYKYQTTPLTND----ESTQPKLQLSGIEKDNTDH  361

Query  307   --VSLN*KVELPRS  272
               +++N + E  R+
Sbjct  362   EVITINKEGEQRRT  375



>ref|XP_003590513.1| Auxin-induced protein 5NG4 [Medicago truncatula]
 gb|AES60764.1| nodulin MtN21/EamA-like transporter family protein [Medicago 
truncatula]
Length=364

 Score =   291 bits (745),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 172/348 (49%), Positives = 249/348 (72%), Gaps = 13/348 (4%)
 Frame = -3

Query  1375  WLNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLER  1196
             W+   AKP++ V+FLQ   A   +LSKAALN+GM+ + F  YR+A+A ++  PFAL+ +R
Sbjct  10    WIEK-AKPFIAVLFLQFGYAIMDVLSKAALNRGMSNYVFVVYRHAVAFIVITPFALYFDR  68

Query  1195  KTRPTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFR  1019
             K RP MT SIF KIVLL+LLE  ++ NLY++GM+YTTAT +  M N++PA+TF+LA I R
Sbjct  69    KIRPKMTISIFIKIVLLSLLEPVIDQNLYFLGMKYTTATFAAAMSNMLPAITFILASIVR  128

Query  1018  LEKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSH--SAQHVLNQ  845
             LEK+KI+++ SQAK++GT + + GAM+MTL+KGPI+   +  HS    S   SA H    
Sbjct  129   LEKIKIKSMRSQAKVLGTIATVSGAMVMTLMKGPILFETFGDHSQSYHSSGTSAHHT---  185

Query  844   HSNPIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERG  665
                 I  ++L+   C S A F+ILQA  +++YPA LSL++ IC  G+++ + L L++ER 
Sbjct  186   ----ILGSVLITIGCFSWACFVILQAITLETYPAALSLSSWICLFGAIEGAALALVMERN  241

Query  664   NASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSF  485
             N SVWS++WDM LL+ +Y G+  SG  YY+ G++MK +GPVFVT FNP  MV+VAI+G F
Sbjct  242   NPSVWSIKWDMRLLSAIYTGIFCSGLGYYLQGVVMKTRGPVFVTTFNPFCMVIVAIMGYF  301

Query  484   VLSEKLYMgrvlgavvvlvglylviwGKSKDQTSPDNNDALPIDHKQP  341
             +L+E++++GRV+GA ++ +GLYLV+WGKSKD  +P N  A+  +H  P
Sbjct  302   LLAEQMFLGRVIGAFIICLGLYLVVWGKSKDYNNPSN--AISEEHVLP  347



>gb|EYU28757.1| hypothetical protein MIMGU_mgv1a023410mg, partial [Erythranthe 
guttata]
Length=302

 Score =   289 bits (739),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 152/303 (50%), Positives = 217/303 (72%), Gaps = 7/303 (2%)
 Frame = -3

Query  1363  DAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERK-TR  1187
              AKP+L V+FLQ   AG  I++KAALNQGM+ + F  YR+A+A ++ APFA  LE+K  R
Sbjct  4     KAKPFLAVVFLQAALAGMDIIAKAALNQGMSNYVFIVYRHAVATIVIAPFAFLLEKKIQR  63

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT  IFFKI+L +L    ++ NLY++GM+YT+AT   +M N++PA+TF++A + R EK
Sbjct  64    PKMTLVIFFKIMLTSLFGPVISQNLYFLGMKYTSATFIASMTNVLPAVTFVIACLLRHEK  123

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             VK+ + HSQAKI+GT  +IGGAMIMTLV+GP + LPWT+ +     H         +N I
Sbjct  124   VKMTSTHSQAKIIGTLVSIGGAMIMTLVRGPNLDLPWTRGN-----HQDHKNGEDFNNSI  178

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
             K  L++A +  + A F+I  A  +++YPA LSLT  IC +G+++ + L LI+ERGN++VW
Sbjct  179   KGALMIAIASFAWAGFMISHAITLQTYPAALSLTAWICMLGTVEGAALALIMERGNSAVW  238

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
             S++WD  LL  VY G+  SG  YY+ GI++K +GPVFVTAF+PLSMVLVA++ SF+L E+
Sbjct  239   SIKWDTKLLGAVYSGIFCSGITYYVQGIVLKERGPVFVTAFSPLSMVLVAVMSSFILREQ  298

Query  469   LYM  461
             +Y+
Sbjct  299   MYL  301



>gb|KDP35589.1| hypothetical protein JCGZ_09027 [Jatropha curcas]
Length=375

 Score =   291 bits (745),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 171/365 (47%), Positives = 257/365 (70%), Gaps = 9/365 (2%)
 Frame = -3

Query  1357  KPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPTM  1178
             KP++ V+F+Q+  AG  ++SKAALN GM+ +    YR+A+A ++ APFA FL++K RP M
Sbjct  13    KPFIAVIFMQIGLAGMDVMSKAALNGGMSNYVLVVYRHAVATIVIAPFAFFLDKKVRPKM  72

Query  1177  TTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVKI  1001
             T SIF KI VL  L   ++ NLY++GM+YTTAT +  ++N++PA+TF++A I RLEKVK+
Sbjct  73    TRSIFIKILVLSLLEPVIDQNLYFLGMKYTTATFAAAIINILPAITFVMACIVRLEKVKM  132

Query  1000  RNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQ--HVLNQHSNPIK  827
              +LHSQAK+VGT + + GAM+MT+VKGP + L  +     +  H+ Q    +N H N IK
Sbjct  133   TSLHSQAKVVGTIATVAGAMVMTVVKGPPVDLFNSTKGMRIYHHNQQTSDDVNLH-NSIK  191

Query  826   ATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWS  647
               L++   C   A F+ILQA  +K+YPA LSLT  IC  G+++ SI+ L++ERGN SVWS
Sbjct  192   GALMITIGCFGWACFVILQAITLKTYPAELSLTAWICLFGTIEGSIVALVMERGNPSVWS  251

Query  646   LQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKL  467
             L  D+ L T VY G+V SG  YYI G++MK +GPVFVTAF+PL MV+VA++ S +L+E++
Sbjct  252   LNLDIKLATAVYSGVVCSGFAYYIQGVVMKDRGPVFVTAFSPLCMVIVAVMSSIILAEQM  311

Query  466   YMgrvlgavvvlvglylviwGKSKDQTSPDNNDALPID---HKQPQVVQGFNKDITVSLN  296
             ++GRV+GA++++ GLYLV+WGK KD    +++  +P      K+    + F++ +T S++
Sbjct  312   FLGRVIGAIIIVGGLYLVVWGKGKDYKD-ESSSPIPTKQEMEKETHEKENFDQQVTQSVH  370

Query  295   *KVEL  281
              ++E+
Sbjct  371   -RIEI  374



>ref|XP_008371417.1| PREDICTED: WAT1-related protein At2g39510-like [Malus domestica]
Length=350

 Score =   290 bits (742),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 170/340 (50%), Positives = 235/340 (69%), Gaps = 9/340 (3%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             N A P++ V F+Q   AG +I+SK ALN GM+P     YR+A+A V  APFA+  +RK R
Sbjct  11    NRAMPFMAVTFMQFGYAGMSIISKFALNHGMSPHVLVVYRHAVATVFIAPFAVVFDRKVR  70

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT SIF KIVLL LLE  ++ NL+Y GM+ TTAT +  M N++PA  F++AWIFRLEK
Sbjct  71    PKMTLSIFIKIVLLGLLEPVIDQNLFYTGMKLTTATFASAMCNVLPAFAFIMAWIFRLEK  130

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             + +R+LHS AKI+GT   +GGAM+MTL+ GP++  PWT+ +     H    V   H +PI
Sbjct  131   INLRSLHSLAKILGTIVTVGGAMLMTLINGPMLNFPWTRRN----IHQESTVSTVHQDPI  186

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
             K  +++A  C   A F+ILQA  + SYPA L+L T IC  G++Q + + L  E  N  VW
Sbjct  187   KGAIMIAAGCFCWAGFMILQAITLNSYPAELTLATWICLAGTVQGTAVALAFEWNNPIVW  246

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
             S+ +D  LL  VY G++ SG  YYI G++MK +GPVFVTAF+PLSM++VAI+ S +L+E 
Sbjct  247   SIHFDFKLLAAVYSGIICSGIAYYIQGVVMKERGPVFVTAFSPLSMIIVAIMSSLILAEI  306

Query  469   LYMgrvlgavvvlvglylviwGKSKDQ----TSPDNNDAL  362
             +Y+GRV+GA+V+++GLY+V+WGKSKDQ    +  D+N  L
Sbjct  307   MYLGRVIGAMVIVIGLYMVLWGKSKDQLPSESEKDDNMEL  346



>ref|XP_009614497.1| PREDICTED: WAT1-related protein At2g37460-like isoform X2 [Nicotiana 
tomentosiformis]
Length=358

 Score =   289 bits (740),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 165/347 (48%), Positives = 241/347 (69%), Gaps = 24/347 (7%)
 Frame = -3

Query  1387  RVVKWLNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFAL  1208
             + V+ L   +KP++ V+FLQ   AG  IL+K ALN+GM+ + F  YR+A+A +  APFA+
Sbjct  2     KAVRELFIRSKPFIAVIFLQFGLAGMDILTKMALNEGMSNYVFVVYRHAVATLAIAPFAM  61

Query  1207  FLERKTRPTMTTSIFFKIVllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAW  1028
              L++   P +  ++                 Y +G++YTTAT +  M N++PA+TF++AW
Sbjct  62    ILDK---PVIDQNL-----------------YSIGLKYTTATFAAAMCNILPAITFIMAW  101

Query  1027  IFRLEKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLN  848
             IFRLE+VK+ ++ SQAKI+GT + + GAMIMTLV+GP+I L WTK ++   SH +Q    
Sbjct  102   IFRLERVKLTSIRSQAKIIGTIATVAGAMIMTLVRGPVIELFWTKGNS---SHESQSGGL  158

Query  847   QHSNPIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVER  668
               S+ IK +LL+   C S A F+ILQA  +++YPA LSLT  IC +G+ + +I+ +++ER
Sbjct  159   NLSHAIKGSLLITIGCFSWAAFMILQAITLRTYPAELSLTAWICLLGTAEGAIVAMVMER  218

Query  667   GNASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGS  488
             G A+VW+++WD   L  VY G+  SG  YYI G+IMK +GPVFVTAFNPLSMV+VAI+ S
Sbjct  219   GKAAVWAIKWDTKFLAAVYSGIFCSGLAYYIQGVIMKDRGPVFVTAFNPLSMVIVAILSS  278

Query  487   FVLSEKLYMgrvlgavvvlvglylviwGKSKDQTSPDNND-ALPIDH  350
             F+L E++ +GRVLGAVV+++GLY+V+WGKSKDQ SP  ++ A+P   
Sbjct  279   FILREQMNLGRVLGAVVIVLGLYIVLWGKSKDQKSPSTDEQAIPTQE  325



>ref|XP_006429015.1| hypothetical protein CICLE_v10012001mg [Citrus clementina]
 ref|XP_006480748.1| PREDICTED: WAT1-related protein At2g37460-like [Citrus sinensis]
 gb|ESR42255.1| hypothetical protein CICLE_v10012001mg [Citrus clementina]
Length=370

 Score =   289 bits (739),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 168/350 (48%), Positives = 248/350 (71%), Gaps = 8/350 (2%)
 Frame = -3

Query  1399  MRNERVVKWLNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFA  1220
             M+N+ +   L N  +P++GV+F+QV  AG  +L KAALN+GM+P+    YR+A A +  A
Sbjct  1     MKNQMLS--LFNRTRPFIGVIFMQVGFAGMDVLCKAALNKGMSPYVLVVYRHAAATIAMA  58

Query  1219  PFALFLERKTRPTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMT  1043
             PFA+ L++K RP MT +I  K++LL LLE  ++ NLY++GM+YTTAT +  M N++PA+T
Sbjct  59    PFAVILDKKIRPKMTLAILTKLLLLGLLEPVIDQNLYFIGMKYTTATFAAAMYNILPAIT  118

Query  1042  FLLAWIFRLEKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSA  863
             FL+AWI RLE V ++++ S AK++GT + + GAM+MTL+KGPI+ L WTK + +   H  
Sbjct  119   FLMAWIIRLENVNLKSIRSLAKVIGTLATVAGAMVMTLIKGPILELFWTKGAEN---HGH  175

Query  862   QHVLNQHSNPIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILT  683
                     N IK  L++   C S + FIILQA  +K+YPA LSLT  IC  G+++ ++  
Sbjct  176   GSSGTTTHNSIKGALMITAGCFSWSFFIILQAITLKAYPAELSLTAWICFFGTVEGTLAA  235

Query  682   LIVERGNASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLV  503
             LI+ERG AS+W++ WD  L+  VY G++ SG  YYI GI+MK +GPVFV AF+PL MV+V
Sbjct  236   LIMERGKASIWAIHWDTKLVASVYSGIICSGLTYYIQGIVMKDRGPVFVAAFSPLCMVIV  295

Query  502   AIIGSFVLSEKLYMgrvlgavvvlvglylviwGKSKDQT--SPDNNDALP  359
             AI+ + +L+E++Y+GR++GA++++ GLYLV+WGKSKD    SP  ++ LP
Sbjct  296   AIMSTIILAEQMYLGRIIGAIIIIGGLYLVVWGKSKDHKSPSPSTDEHLP  345



>gb|KDO67718.1| hypothetical protein CISIN_1g043160mg, partial [Citrus sinensis]
Length=333

 Score =   287 bits (735),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 168/328 (51%), Positives = 237/328 (72%), Gaps = 3/328 (1%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             + AKPYLGV+F+Q  S+  +I++K AL QGM+      YR  +A  + APFA+ LERKTR
Sbjct  6     HHAKPYLGVIFMQFCSSIMSIITKIALTQGMSQHVLVAYRMVVATSLIAPFAIVLERKTR  65

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT  IF KI LL L E  +  NLY+ G++ +TAT +V M N++PA+TFL+AWIFRLEK
Sbjct  66    PKMTFRIFAKIALLGLFEPVIGQNLYFTGLKCSTATFTVAMCNILPALTFLMAWIFRLEK  125

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             VKI+++ SQAKI+GT    GGAM MTL+KGPI+  PW K    + + S     N+  +  
Sbjct  126   VKIKSMRSQAKILGTIVTAGGAMCMTLLKGPILEFPW-KQVRILHNQSETGTHNKEEHIT  184

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
             K  L++A  C S + FIIL+A ++KSYPA LSLT L+C + S++ +IL L +ERGN  +W
Sbjct  185   KGALMIAAGCFSWSCFIILEAFLLKSYPAELSLTALMCFVSSVEGTILALAIERGNTGIW  244

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
              L +D  LL+ +Y G V   A Y+I G +MK KGPVFV++FNPLSMV++AI+GSF ++E+
Sbjct  245   LLHFDAKLLSVLYGGFVSCTA-YFIMGWLMKRKGPVFVSSFNPLSMVIIAILGSFFIAEE  303

Query  469   LYMgrvlgavvvlvglylviwGKSKDQT  386
             L++GR++GA+V+++GLY+V+WG+SKDQ+
Sbjct  304   LFLGRIVGAIVIVIGLYMVLWGRSKDQS  331



>gb|KHG03072.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=391

 Score =   289 bits (739),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 177/335 (53%), Positives = 242/335 (72%), Gaps = 5/335 (1%)
 Frame = -3

Query  1372  LNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERK  1193
             L N  KP+L ++ +Q + A  +I++K ALNQGM+P     YR A+AAVI  PFA+ LERK
Sbjct  7     LFNHGKPFLAMILMQSSYAVMSIIAKYALNQGMSPHVLVAYRLAVAAVIITPFAIVLERK  66

Query  1192  TRPTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRL  1016
             TRP MT +IF KI+L++LLE  L+ N +Y GM+YTTAT +  M N++PA+TF LA I +L
Sbjct  67    TRPKMTFNIFIKIMLISLLEPVLDHNFFYTGMKYTTATFTTAMCNILPALTFALACIVKL  126

Query  1015  EKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSN  836
             E+V+   + SQAK+ GTA A+GGAMIMTL+KGP++ LPWTK  N  +        ++   
Sbjct  127   ERVETGKVRSQAKVAGTAVAVGGAMIMTLIKGPVLELPWTKGRNHYLGQHGASGAHKQDM  186

Query  835   PIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNAS  656
              + A LLLAG CC  A F+I QA ++KSYPA LSLT LIC +G+ + +IL   VE  N S
Sbjct  187   VMGALLLLAG-CCCWACFVISQARILKSYPAKLSLTALICIMGTFEGTILAFAVEWRNPS  245

Query  655   VWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLS  476
             VW + +D  L+  +Y GLV + A+Y + G +MK +GPVFV+AFNPLSMV+VAI+GSF L+
Sbjct  246   VWLIGFDSKLIASLYGGLVTAFALYAM-GSVMKRRGPVFVSAFNPLSMVIVAILGSFFLA  304

Query  475   EKLYMgrvlgavvvlvglylviwGKSKD--QTSPD  377
             E +Y+GRVLG++V+++GLYLV+WGKSKD  Q++PD
Sbjct  305   EDMYLGRVLGSIVIVIGLYLVLWGKSKDQPQSTPD  339



>ref|XP_008370940.1| PREDICTED: WAT1-related protein At2g39510-like [Malus domestica]
Length=350

 Score =   287 bits (735),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 168/337 (50%), Positives = 236/337 (70%), Gaps = 7/337 (2%)
 Frame = -3

Query  1354  PYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPTMT  1175
             P++ V  LQ   AG  I+SK ALN+GM+P  F  YR+A+A V  APFA+  +R+ RP MT
Sbjct  15    PFMAVTLLQFGFAGLFIISKFALNRGMSPQVFVAYRHAVATVFIAPFAIIFDRRVRPKMT  74

Query  1174  TSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVKIR  998
              SIFFKIVLL LLE  ++ NL Y GM+ TTAT++  + N++PA  F++AW+FRLEKV +R
Sbjct  75    LSIFFKIVLLGLLEPVMDQNLAYTGMKLTTATVTSALYNVLPAFAFIMAWVFRLEKVNLR  134

Query  997   NLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKATL  818
             +LHSQAKI+GT   +GGAM+MTL+ GP++  PWT+ +     H    V   H + IK  +
Sbjct  135   SLHSQAKILGTIVMVGGAMLMTLINGPMLNFPWTRRN----PHHESTVSTDHQDHIKGAI  190

Query  817   LLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSLQW  638
             ++A  C   A F+ LQA  +KSYPA LSLT  IC  G++Q   + L  E  N + WS+ +
Sbjct  191   MVAAGCFCWAGFVTLQAITLKSYPAELSLTVWICLAGTVQGFAVALAFEWNNLTAWSIHF  250

Query  637   DMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLYMg  458
             D  LL  VY G++ SG  +YI GI+MK +GPVFVTAFNPLS+++VA++ SF+L+E +Y+G
Sbjct  251   DSKLLAVVYCGIMCSGIAFYIQGIVMKERGPVFVTAFNPLSLIIVAVMSSFILAEIMYLG  310

Query  457   rvlgavvvlvglylviwGKSKDQ--TSPDNNDALPID  353
             RV+GA+V+++GLY+V+WGKSKDQ  +  + ND + +D
Sbjct  311   RVIGAIVIVIGLYMVLWGKSKDQLPSELEKNDXVELD  347



>ref|XP_009778858.1| PREDICTED: WAT1-related protein At2g37460-like isoform X2 [Nicotiana 
sylvestris]
Length=358

 Score =   288 bits (736),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 162/338 (48%), Positives = 237/338 (70%), Gaps = 24/338 (7%)
 Frame = -3

Query  1360  AKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPT  1181
             +KP++ V+FLQ   AG  IL+K ALN+GM+ + F  YR+A+A +  APFA+ L++   P 
Sbjct  11    SKPFIAVIFLQFGLAGMDILTKMALNEGMSNYVFVVYRHAVATLAIAPFAIILDK---PV  67

Query  1180  MTTSIFFKIVllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVKI  1001
             +  ++                 Y +G++YTTAT +  M N++PA+TF++AWIFRLE+VK+
Sbjct  68    IDQNL-----------------YSIGLKYTTATFAAAMCNILPAITFIMAWIFRLERVKL  110

Query  1000  RNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKAT  821
              ++ SQAKI+GT + + GAMIMTLV+GP+I L WTK ++   SH +Q      S+ IK +
Sbjct  111   TSIRSQAKIIGTVATVAGAMIMTLVRGPVIELFWTKGNS---SHESQSGGLNLSHAIKGS  167

Query  820   LLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSLQ  641
             L++   C S A F+ILQA  +++YPA LSLT  IC +G+ + +I+ +++ERG A+VW+++
Sbjct  168   LMITIGCFSWAAFMILQAITLRTYPAELSLTAWICLLGTAEGAIVAMVMERGKAAVWAIK  227

Query  640   WDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLYM  461
             WD   L  VY G+  SG  YYI G+IMK +GPVFVTAFNPLSMV+VAI+ SF+L E++ +
Sbjct  228   WDTKFLAAVYSGIFCSGLAYYIQGVIMKDRGPVFVTAFNPLSMVIVAILSSFILREQMNL  287

Query  460   grvlgavvvlvglylviwGKSKDQTSPDNND-ALPIDH  350
             GRVLGAVV+++GLY+V+WGKSKDQ SP  ++ A+P   
Sbjct  288   GRVLGAVVIVLGLYIVLWGKSKDQKSPSADEQAIPTQE  325



>ref|XP_008233581.1| PREDICTED: WAT1-related protein At2g39510-like isoform X1 [Prunus 
mume]
Length=347

 Score =   287 bits (735),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 167/339 (49%), Positives = 238/339 (70%), Gaps = 7/339 (2%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             N AKP++ V  +Q   AG +I+SK ALN+GM+      YR+A+A V  APFA+  +RK R
Sbjct  11    NLAKPFVAVTLMQFGYAGMSIISKFALNRGMSQHVLVVYRHAVATVFIAPFAIVFDRKVR  70

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT S+F KI+LL LLE  ++ NL+Y GM+ TTAT +  M N++PA  F++AWIFRLE 
Sbjct  71    PKMTFSVFTKILLLGLLEPVIDQNLFYTGMKLTTATFTSAMCNVLPAFAFIMAWIFRLEN  130

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             +  R+L S AKI+GT   +GGAM+MTL+ GP++ LPWT+ +    S SA      H +PI
Sbjct  131   INFRSLRSLAKILGTIVTVGGAMLMTLINGPMLNLPWTRRNIHQESTSA----TDHQDPI  186

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
             K TLL+   C   A F+ LQA  +KSYPA LSL   IC +G++Q +++ L  E  N + W
Sbjct  187   KGTLLIGAGCFCWAGFVNLQAITLKSYPAELSLAAWICLMGTVQGTVVALGFEWDNPAAW  246

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
             S+ WD  LL  VY G++ SG VYY+ G++MK +GPVFVTAF+PLSM++VA++ SF+L+E 
Sbjct  247   SIHWDSKLLAAVYSGIICSGVVYYVQGLVMKERGPVFVTAFSPLSMIIVAVMSSFMLAEI  306

Query  469   LYMgrvlgavvvlvglylviwGKSKDQ--TSPDNNDALP  359
             +Y+GRV+GA+V+++GLY+V+WGKSKD+  +  + +D +P
Sbjct  307   MYLGRVIGAMVIVIGLYMVLWGKSKDRIPSESEKDDVVP  345



>ref|XP_004141853.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
 gb|KGN50537.1| hypothetical protein Csa_5G181440 [Cucumis sativus]
Length=377

 Score =   288 bits (737),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 171/352 (49%), Positives = 239/352 (68%), Gaps = 6/352 (2%)
 Frame = -3

Query  1390  ERVVKWLNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFA  1211
             E  +++L + AKPY GV+F+Q   AG AIL+K+AL++GM+   F  YR   A ++ APFA
Sbjct  2     ESFIRFLRS-AKPYFGVIFVQFGYAGMAILTKSALDKGMSQHVFVAYRQVAATLVIAPFA  60

Query  1210  LFLERKTRPTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLL  1034
             +  ERK R  MT S+ FKI+LL  LE  ++ NLYY GM+YTTAT +  M N++PA  FL+
Sbjct  61    IIFERKARTKMTFSLLFKILLLGFLEPVIDQNLYYTGMKYTTATFAAAMCNVLPAFVFLM  120

Query  1033  AWIFRLEKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHV  854
             AW  RLEKVKI    SQAKI+GT   +GGAMIMT ++GP++ LPWTK  N V + S+   
Sbjct  121   AWACRLEKVKIMKRGSQAKILGTIVTVGGAMIMTFIRGPMLNLPWTKLPNQVSASSSLSA  180

Query  853   LN-QHSNPIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLI  677
              +  H N I   L++   C   A FI LQA  +K YPA LSLTTLIC +G++    + L+
Sbjct  181   ASPDHQNQIVGFLMITTGCVCWAAFITLQAITLKEYPADLSLTTLICLVGTIGGFGVALV  240

Query  676   VERGNASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAI  497
             +ERGN S W+L +D  LL  VY G++ SG  YYI G++M+ KGPVF  +FNPL+M+LVAI
Sbjct  241   IERGNVSAWALHFDSQLLAVVYSGVICSGVTYYIQGVVMQTKGPVFFASFNPLAMILVAI  300

Query  496   IGSFVLSEKLYMgrvlgavvvlvglylviwGKSKDQTSPDNNDALPIDHKQP  341
             +  F+LSE +++GR++G V+++ GLY+V+WGKS+D+    N++    D+  P
Sbjct  301   MSFFILSEIMFLGRMIGVVIIICGLYMVLWGKSQDEPPVLNSEC---DNMTP  349



>ref|XP_010529854.1| PREDICTED: WAT1-related protein At2g37460-like [Tarenaya hassleriana]
Length=383

 Score =   288 bits (737),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 172/349 (49%), Positives = 238/349 (68%), Gaps = 12/349 (3%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
               A+P++ V+FLQV  AG  ILSKA LN+GM+ +    YR+A+A  I APFA + ++K R
Sbjct  13    ERARPFMAVVFLQVGLAGMDILSKAVLNKGMSNYVLVVYRHAVATFIIAPFAFYFDKKVR  72

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
               MT  IF +I LL LLE  ++ NLYY+GM+YTTAT +  M N++PA+TF+LA+IFRLE+
Sbjct  73    TKMTMRIFIQITLLGLLEPVIDQNLYYLGMKYTTATFAAAMYNVLPAITFVLAYIFRLER  132

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             V +R + S AKI+GTA+ + GAM+MTLVKGP++ L WTK  +    H      + HS  I
Sbjct  133   VNLRCIRSAAKIIGTAATVAGAMMMTLVKGPVLDLFWTKGPSP--QHDGTEGTDIHS-AI  189

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
             K  +L+   C S A F++LQA  +++YPA LSLT  IC +G+++ + L L++E+G+   W
Sbjct  190   KGAVLITIGCFSYACFMVLQAITLRTYPAELSLTAWICLMGTIEGTALALVMEKGHPGAW  249

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
             ++ WD  LLT  Y G+V SG  YYI G++MK +GPVFVTAFNPL MV+VA I S + +E+
Sbjct  250   AIGWDTKLLTATYSGIVCSGLAYYIGGVVMKDRGPVFVTAFNPLCMVIVAFISSIIFAEQ  309

Query  469   LYMgrvlgavvvlvglylviwGKSKDQTSPDNNDALP--------IDHK  347
             +Y+GRVLGAVV+  GLY VIWGK KD   P+   A P        +DH+
Sbjct  310   MYLGRVLGAVVICAGLYFVIWGKGKDYEYPNEESAQPKLEMNGNSLDHE  358



>ref|XP_009347454.1| PREDICTED: WAT1-related protein At2g39510-like [Pyrus x bretschneideri]
Length=345

 Score =   287 bits (734),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 165/340 (49%), Positives = 236/340 (69%), Gaps = 7/340 (2%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             N A P++ V F+Q   AG +++SK ALN GM+P     YR+A+A V  APFA+  +R  R
Sbjct  6     NQAMPFMAVTFMQFGFAGMSLISKFALNHGMSPHVLVVYRHAVATVFIAPFAIIFDRNVR  65

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT SIF KIVLL LLE  ++ NL+Y GM+ TTAT +  M N++PA  F++AWIFRLEK
Sbjct  66    PKMTLSIFTKIVLLGLLEPVIDQNLFYTGMKLTTATFTSAMCNVLPAFAFIMAWIFRLEK  125

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             + +R+LHS AKI+GT   +GGAM+MTL+ GP++  PWT+ +     H    V   H +PI
Sbjct  126   INLRSLHSLAKILGTIVTVGGAMLMTLINGPMLNFPWTRRN----IHQESTVSTVHQDPI  181

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
             K  +++A  C   + F+ILQA  +KSYPA LSLTT IC +G++Q +   L  E  N   W
Sbjct  182   KGAIMIAAGCFCWSCFMILQAITLKSYPAELSLTTWICLVGTVQGTAAALAFEWNNPIAW  241

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
             S+ +D  LL  VY G++ SG  YYI G++MK +GPVFVTAF+PL+M++ A++ SF+L+E 
Sbjct  242   SIHFDYKLLAAVYSGIMCSGIAYYIQGMVMKERGPVFVTAFSPLNMIITAVMSSFILAEI  301

Query  469   LYMgrvlgavvvlvglylviwGKSKDQ--TSPDNNDALPI  356
             +Y+GRV+GA+V+++GLY+V+WGKSKDQ  +  + +D + +
Sbjct  302   MYLGRVIGAMVIVIGLYMVLWGKSKDQLPSELEKDDKMEL  341



>ref|XP_009347451.1| PREDICTED: WAT1-related protein At2g39510-like [Pyrus x bretschneideri]
Length=350

 Score =   286 bits (733),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 168/340 (49%), Positives = 235/340 (69%), Gaps = 9/340 (3%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             N A P++ V F+Q   AG +I+SK ALN GM+P     YR+A+A+V  APFA+  +RK R
Sbjct  11    NWATPFMAVTFMQFGFAGMSIISKFALNHGMSPHVLVVYRHAVASVFIAPFAIVFDRKVR  70

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT SIF KIVLL LLE  L+ NL+Y GM+ TTAT +  M N++P   F++AWIFR+EK
Sbjct  71    PKMTLSIFTKIVLLGLLEPVLDQNLFYTGMKLTTATFTSAMCNVLPTFAFIMAWIFRIEK  130

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             + +R+LHS AKI+GT   +GGAM+MTL+ GP++  PWT+ +     H    V   H +PI
Sbjct  131   INLRSLHSLAKILGTIVTVGGAMLMTLINGPLLNFPWTRRN----IHQESTVSTVHQDPI  186

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
             K  +++A  C   A F+ILQA  + SYPA LSL T IC  G++Q + + L  E  N   W
Sbjct  187   KGAIMIAAGCFCWAGFMILQAITLNSYPAELSLATWICLAGTVQGTAVALAFEWNNPIAW  246

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
             S+ +D  LL  VY G++ SG  YY+ G++MK +GPVFVTAF+PLSM++VA++ SF+L+E 
Sbjct  247   SIHFDFKLLAAVYSGIICSGIAYYVQGVVMKERGPVFVTAFSPLSMIIVAVMSSFILAEI  306

Query  469   LYMgrvlgavvvlvglylviwGKSKDQ----TSPDNNDAL  362
             +Y+GRV+GA+V+++GLY+V+WGKSKDQ    +  D+N  L
Sbjct  307   MYLGRVIGAMVIVIGLYMVLWGKSKDQLPSKSEKDDNMEL  346



>ref|XP_004142736.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
 gb|KGN51278.1| hypothetical protein Csa_5G512850 [Cucumis sativus]
Length=374

 Score =   287 bits (735),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 175/328 (53%), Positives = 235/328 (72%), Gaps = 5/328 (2%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
               AKPYLG + L+  SAG +I+SKAALNQGMN      YR +I A++ APFA  L+RK R
Sbjct  9     EKAKPYLGAIALRFASAGMSIISKAALNQGMNQLVTIVYRYSIGAIVVAPFAFVLDRKIR  68

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT  IF KI+LL LLE  +  +L Y G +YTTAT +  M N++PA  FL+AWI R+EK
Sbjct  69    PKMTLPIFAKILLLGLLEPVIAQSLIYSGTKYTTATFATAMCNILPAFAFLMAWICRMEK  128

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             V IR+L SQAKI+GT   +GGAM+MTL+KGP++ LPWT + N++  HS   + N+   P+
Sbjct  129   VNIRSLRSQAKILGTLVTVGGAMMMTLLKGPLLSLPWT-NQNNLNPHSYSTLPNKQ-QPV  186

Query  829   KATLLLA-GSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASV  653
             KA +++   S CS+A F IL A+ I++YPA L+LTT IC  G+++ +IL L  E  N S 
Sbjct  187   KAAIVITISSICSSA-FTILLAHTIRTYPAELTLTTFICLAGAVESTILALAFEWDNPSA  245

Query  652   WSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSE  473
             W L  D  LL  +Y G++ SG  YY+ G+++K+KGPVFVTAFNPLSMV+VAII SF+ +E
Sbjct  246   WVLHADSILLAALYGGIISSGIAYYLQGVVVKLKGPVFVTAFNPLSMVIVAIISSFIFAE  305

Query  472   KLYMgrvlgavvvlvglylviwGKSKDQ  389
              L +GRV+GA V+++GLYLV+WGKSKD+
Sbjct  306   TLRLGRVVGAAVIIIGLYLVLWGKSKDK  333



>ref|XP_006436051.1| hypothetical protein CICLE_v10033577mg, partial [Citrus clementina]
 gb|ESR49291.1| hypothetical protein CICLE_v10033577mg, partial [Citrus clementina]
Length=339

 Score =   286 bits (732),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 168/338 (50%), Positives = 240/338 (71%), Gaps = 3/338 (1%)
 Frame = -3

Query  1399  MRNERVVKWLNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFA  1220
             M N    ++L++ AKPYLGV+F+Q  S+  +I++K AL QGM+      YR  +A  + A
Sbjct  1     MSNCSSTQFLSHHAKPYLGVIFMQFCSSIMSIITKIALTQGMSQHVLVAYRMVVATSLIA  60

Query  1219  PFALFLERKTRPTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMT  1043
             PFA+ LERKTRP MT  IF KI LL L E  +  NLY+ G++ +TAT +V M N++PA+T
Sbjct  61    PFAIVLERKTRPKMTFRIFAKIALLGLFEPVIGQNLYFTGLKCSTATFTVAMCNILPALT  120

Query  1042  FLLAWIFRLEKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSA  863
             FL+AWIFRLEKVK +++ SQAKI+GT    GGAM MTL+KGPI+  PW K    + +   
Sbjct  121   FLMAWIFRLEKVKTKSMRSQAKILGTIVTAGGAMCMTLLKGPILEFPW-KQVRILHNQLE  179

Query  862   QHVLNQHSNPIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILT  683
                 N+  +  K  L++A +C S + FIILQA ++KSYPA LSLT L+C + S++ +IL 
Sbjct  180   TGTHNKEEHMTKGALMIAAACFSWSCFIILQAFLLKSYPAELSLTALMCFVSSVEGTILA  239

Query  682   LIVERGNASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLV  503
             L +E+GN  +W L +D  LL+ +Y G V S   Y+I G +MK KGPVFV++FNPLSMV++
Sbjct  240   LAIEQGNTGIWLLHFDAKLLSVLYGGFV-SCTAYFIMGWLMKRKGPVFVSSFNPLSMVII  298

Query  502   AIIGSFVLSEKLYMgrvlgavvvlvglylviwGKSKDQ  389
             AI+GSF ++E+L++GR++G +V+++GLY+V+WG+SKDQ
Sbjct  299   AILGSFFIAEELFLGRIVGGIVIVIGLYMVLWGRSKDQ  336



>gb|KHG11891.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=392

 Score =   287 bits (734),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 167/350 (48%), Positives = 241/350 (69%), Gaps = 8/350 (2%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             N A PY+ ++ ++  SAG  I++K ALN+GM+      YR  IA ++ APFA+  +RK R
Sbjct  11    NQALPYVAMVLMRFGSAGMPIVAKYALNRGMSQHVLVVYRFIIATLVLAPFAIVFDRKVR  70

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT S+F +I LL LLE  ++ NLYY G++YTTAT++  + N++PA  FLLAW+ RLEK
Sbjct  71    PKMTLSVFVQIALLGLLEPAIDQNLYYTGIKYTTATVATALSNVLPAFVFLLAWVCRLEK  130

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             V +R +  QAKI+GT   + GAMIMT+V GP++ LPWTK +N     S       + + +
Sbjct  131   VDVRKVKCQAKILGTIGTVAGAMIMTIVYGPMLPLPWTKVNNH--HQSTNTDAKNNEDAL  188

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
             K  +++   C   A F+ILQA  +KSYPA LSLTTL+C +G+++  I+ L++ERGNA+ W
Sbjct  189   KGAVMILVGCVCWACFVILQAITLKSYPAELSLTTLVCFMGAIEGGIVALVMERGNAAAW  248

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
             ++ WD  L   VY G++ SG  YYI  ++++ KGPVF  +FNPL+MV+VAI+ SF+ SE 
Sbjct  249   AIHWDSKLFAVVYSGIICSGVAYYIGAMVIQAKGPVFFASFNPLTMVIVAIMSSFIFSEI  308

Query  469   LYMgrvlgavvvlvglylviwGKSKDQTSPD--NN---DALPIDHKQPQV  335
             +Y+GRV+GA+V++VGLY+V+WGKSKDQ S D  NN   D +PI   + Q+
Sbjct  309   MYLGRVIGAMVIVVGLYMVLWGKSKDQISSDSSNNNTKDEIPISGDELQM  358



>ref|XP_008463583.1| PREDICTED: WAT1-related protein At2g39510-like [Cucumis melo]
Length=432

 Score =   288 bits (737),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 177/348 (51%), Positives = 240/348 (69%), Gaps = 5/348 (1%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
               AKPYLG + L+  SAG +I+SKAALNQGMN      YR +I A++ APFA  L+RK R
Sbjct  70    EKAKPYLGAIALRFASAGMSIISKAALNQGMNQLVTIVYRYSIGAIVVAPFAFVLDRKIR  129

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT  IF KI+LL LLE  +  +L Y G +YTTAT +  M N++PA  FL+AWI R+EK
Sbjct  130   PKMTLPIFAKILLLGLLEPVIAQSLIYSGTKYTTATFATAMCNILPAFAFLMAWICRMEK  189

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             V IR+L SQAKI+GT   +GGAM+MTL+KGP++ LPWT   N+   HS   + N+   P+
Sbjct  190   VNIRSLRSQAKILGTLVTVGGAMMMTLLKGPLLSLPWTNQ-NNFNPHSYSTLPNKQ-QPV  247

Query  829   KATLLLA-GSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASV  653
             KA +++   S CS+A F IL A+ I++YPA L+LTT IC  G+++ +IL L  E  N S 
Sbjct  248   KAAIVITISSICSSA-FTILLAHTIRTYPAELTLTTFICLAGAVESTILALAFEWDNPSA  306

Query  652   WSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSE  473
             W+L  D  LL  +Y G++ SG  YY+ G+++K+KGPVFVTAFNPLSMV+VA+I SF+ +E
Sbjct  307   WALHADSILLAALYGGIISSGIAYYLQGVVVKLKGPVFVTAFNPLSMVIVAVISSFIFAE  366

Query  472   KLYMgrvlgavvvlvglylviwGKSKDQTSPDNNDALPIDHKQPQVVQ  329
              L +GRV+GA V+++GLYLV+WGKSKD+    N      + + P  +Q
Sbjct  367   TLRLGRVVGAAVIIIGLYLVLWGKSKDKFQLKNGKNNENNEELPTSIQ  414



>ref|XP_007009431.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
[Theobroma cacao]
 gb|EOY18241.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
[Theobroma cacao]
Length=361

 Score =   285 bits (730),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 169/343 (49%), Positives = 242/343 (71%), Gaps = 6/343 (2%)
 Frame = -3

Query  1390  ERVVKWLNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFA  1211
             E  +  L N+AKP+L V+ +Q   A  +I++K ALNQGM+P     YR A+A+ + APFA
Sbjct  2     ESSLPQLFNNAKPFLAVILVQFGYAVMSIIAKFALNQGMSPHVLVAYRMAVASALIAPFA  61

Query  1210  LFLERKTRPTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLL  1034
             + LERK+RP MT +IF KI+L++L E  L+ NLYY G++YTTAT +  M N++P  TF +
Sbjct  62    IVLERKSRPKMTLTIFAKIMLISLFEPVLDHNLYYTGLKYTTATFTTAMCNMLPTFTFAM  121

Query  1033  AWIFRLEKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHV  854
             A IF+LE+V+IR +HSQAK+VGT   +GGAM+MTL+KGP++ LPWTK  N +    A   
Sbjct  122   ACIFKLERVEIRRVHSQAKVVGTMVTVGGAMVMTLIKGPVLELPWTKGRNHLDQSGASG-  180

Query  853   LNQHSNPIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIV  674
                  + +K TL+L   CC  + FII QA ++KSYPA LSL  LICT+G+++ +IL   V
Sbjct  181   -GHEHDLMKGTLMLMAGCCCWSCFIISQAVILKSYPAKLSLAALICTMGTVEGTILAFAV  239

Query  673   ERGNASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAII  494
             E  N SVW    D   +  +Y G++ + AV  + G +MK +GPVFV+AFNPLS+V+VAI+
Sbjct  240   EWRNTSVWLFHLDSKFIAAIYGGMISAFAVTTL-GSVMKKRGPVFVSAFNPLSLVIVAIL  298

Query  493   GSFVLSEKLYMgrvlgavvvlvglylviwGKSKD--QTSPDNN  371
             GSF+L+E++ +GRV+G++++++GLYLV+WGKSKD  Q+ PD  
Sbjct  299   GSFLLAEEICLGRVIGSIIIVIGLYLVLWGKSKDEPQSKPDGT  341



>ref|XP_004166081.1| PREDICTED: LOW QUALITY PROTEIN: auxin-induced protein 5NG4-like 
[Cucumis sativus]
Length=377

 Score =   286 bits (731),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 170/352 (48%), Positives = 238/352 (68%), Gaps = 6/352 (2%)
 Frame = -3

Query  1390  ERVVKWLNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFA  1211
             E  +++L + AKPY GV+F+Q   AG AIL+K+AL++GM+      YR   A ++ APFA
Sbjct  2     ESFIRFLRS-AKPYFGVIFVQFGYAGMAILTKSALDKGMSQHVLXAYRQVAATLVIAPFA  60

Query  1210  LFLERKTRPTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLL  1034
             +  ERK R  MT S+ FKI+LL  LE  ++ NLYY GM+YTTAT +  M N++PA  FL+
Sbjct  61    IIFERKARTKMTFSLLFKILLLGFLEPVIDQNLYYTGMKYTTATFAAAMCNVLPAFVFLM  120

Query  1033  AWIFRLEKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHV  854
             AW  RLEKVKI    SQAKI+GT   +GGAMIMT ++GP++ LPWTK  N V + S+   
Sbjct  121   AWACRLEKVKIMKRGSQAKILGTIVTVGGAMIMTFIRGPMLNLPWTKLPNQVSASSSLSA  180

Query  853   LN-QHSNPIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLI  677
              +  H N I   L++   C   A FI LQA  +K YPA LSLTTLIC +G++    + L+
Sbjct  181   ASPDHQNQIVGFLMITTGCVCWAAFITLQAITLKEYPADLSLTTLICLVGTIGGFGVALV  240

Query  676   VERGNASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAI  497
             +ERGN S W+L +D  LL  VY G++ SG  YYI G++M+ KGPVF  +FNPL+M+LVAI
Sbjct  241   IERGNVSAWALHFDSQLLAVVYSGVICSGVTYYIQGVVMQTKGPVFFASFNPLAMILVAI  300

Query  496   IGSFVLSEKLYMgrvlgavvvlvglylviwGKSKDQTSPDNNDALPIDHKQP  341
             +  F+LSE +++GR++G V+++ GLY+V+WGKS+D+    N++    D+  P
Sbjct  301   MSFFILSEIMFLGRMIGVVIIICGLYMVLWGKSQDEPPVLNSEC---DNMTP  349



>ref|XP_004494995.1| PREDICTED: WAT1-related protein At2g37460-like isoform X2 [Cicer 
arietinum]
Length=314

 Score =   283 bits (725),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 144/299 (48%), Positives = 220/299 (74%), Gaps = 6/299 (2%)
 Frame = -3

Query  1354  PYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPTMT  1175
             P++ V+FLQ   A   +LSKAALN+GM+ + F  YR+A+A ++  PFAL+ ++K RP MT
Sbjct  19    PFIAVLFLQFGYAVMDVLSKAALNKGMSNYVFVVYRHAVAFIVVTPFALYFDKKVRPKMT  78

Query  1174  TSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVKIR  998
              SIF KIV L+LLE  ++ NLY++GM++TTAT + +M N++PA+TF+LA I R+EK+KIR
Sbjct  79    ISIFIKIVALSLLEPVIDQNLYFLGMKFTTATFAASMSNILPAITFILASILRIEKIKIR  138

Query  997   NLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKATL  818
             ++ +QAK+VGT + + GAM+MTL+KGP++   +    +D  +H    +  QH+  I   +
Sbjct  139   SIRTQAKVVGTIATVSGAMVMTLIKGPVL---FGTFGSDSQNHHNSGISTQHT--IIGAV  193

Query  817   LLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSLQW  638
             ++   C S A FIILQA  +++YPA LSL++ IC +G+L+ + + L+VERGN SVWS++W
Sbjct  194   MITLGCFSWACFIILQAITLETYPAALSLSSWICLLGTLEGAAVALVVERGNYSVWSIKW  253

Query  637   DMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLYM  461
             D+ LL+ +Y G+  SG  YY+ G++MK +GPVFVT FNPL MV+VAI+G F+L+E++++
Sbjct  254   DVRLLSAIYTGIFCSGLGYYLQGVVMKTRGPVFVTTFNPLCMVIVAIMGYFILAEQMFL  312



>ref|XP_008371332.1| PREDICTED: WAT1-related protein At2g39510-like [Malus domestica]
 ref|XP_008348046.1| PREDICTED: WAT1-related protein At2g39510-like [Malus domestica]
Length=345

 Score =   284 bits (727),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 164/327 (50%), Positives = 229/327 (70%), Gaps = 5/327 (2%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             N A P++ V F+Q+  AG +++SK ALN GM+P     YR+A+A V  APFA+  +R  R
Sbjct  6     NRAVPFMAVTFMQIGFAGMSLISKFALNHGMSPHVLVVYRHAVATVFIAPFAIIFDRNVR  65

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT SIF KIVLL LLE  ++ NL+Y GM+ TTAT +  M N++PA  F++AWIFR EK
Sbjct  66    PKMTLSIFTKIVLLGLLEPVIDQNLFYTGMKLTTATFTSAMCNVLPAFAFIMAWIFRFEK  125

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             + +R+LHS A I+GT   +GGAM+MTL+ GP++  PWT+ +     H    V   H +PI
Sbjct  126   INLRSLHSLAMILGTIVTVGGAMLMTLINGPMLNFPWTRRN----IHQESTVSTVHQDPI  181

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
             K  ++LA  C   + F+ILQA  +KSYPA LSLTT IC +G++Q +   L  E  N   W
Sbjct  182   KGGIMLAAGCFCWSCFMILQAITLKSYPAELSLTTWICLVGTVQGTAAALAFEWNNPIAW  241

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
             S+ +D  LL  VY G++ SG  YYI G++MK +GPVFVTAF+PLSM++ A++ SF+L+E 
Sbjct  242   SIHFDYKLLAAVYSGIMCSGIAYYIQGMVMKERGPVFVTAFSPLSMIITAVMSSFILAEI  301

Query  469   LYMgrvlgavvvlvglylviwGKSKDQ  389
             +Y+GRV+GA+V+++GLY+V+WGKSKDQ
Sbjct  302   MYLGRVIGAMVIVIGLYMVLWGKSKDQ  328



>ref|XP_006486497.1| PREDICTED: WAT1-related protein At2g39510-like [Citrus sinensis]
Length=341

 Score =   284 bits (726),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 166/331 (50%), Positives = 238/331 (72%), Gaps = 3/331 (1%)
 Frame = -3

Query  1378  KWLNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLE  1199
             ++L++ AKPYLGV+F+Q  S+  +I++K AL QGM+      YR  +A  + APFA+ LE
Sbjct  9     QFLSHHAKPYLGVIFMQFCSSIMSIITKIALTQGMSQHVLVAYRMVVATSLIAPFAIVLE  68

Query  1198  RKTRPTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIF  1022
             RKTRP MT  IF KI LL L E  +  NLY+ G++ +TAT +V M N++PA+TFL+AWIF
Sbjct  69    RKTRPKMTFRIFAKIALLGLFEPVIGQNLYFTGLKCSTATFTVAMCNILPALTFLMAWIF  128

Query  1021  RLEKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQH  842
             RLEKVK +++ SQAKI+GT    GGAM MTL+KGPI+  PW K    + +       N+ 
Sbjct  129   RLEKVKTKSMRSQAKILGTIVTAGGAMCMTLLKGPILEFPW-KQVRILHNQLETGTHNKE  187

Query  841   SNPIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGN  662
              +  K  L++A +C S + FIILQA ++KSYPA LSLT L+C + S++ +IL L +E+GN
Sbjct  188   EHMTKGALMIAAACFSWSCFIILQAFLLKSYPAELSLTALMCFVSSVEGTILALAIEQGN  247

Query  661   ASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFV  482
               +W L +D  LL+ +Y G V S   Y+I G +MK KGPVFV++FNPLSMV++AI+GSF 
Sbjct  248   TGIWLLHFDAKLLSVLYGGFV-SCTAYFIMGWLMKRKGPVFVSSFNPLSMVIIAILGSFF  306

Query  481   LSEKLYMgrvlgavvvlvglylviwGKSKDQ  389
             ++E+L++GR++G +V+++GLY+V+WG+SKDQ
Sbjct  307   IAEELFLGRIVGGIVIVIGLYMVLWGRSKDQ  337



>gb|KCW65508.1| hypothetical protein EUGRSUZ_G02912 [Eucalyptus grandis]
Length=369

 Score =   285 bits (729),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 158/300 (53%), Positives = 210/300 (70%), Gaps = 8/300 (3%)
 Frame = -3

Query  1402  MMRN-ERVVKWLNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVI  1226
             M RN ERV++ L+   KPYL V+ LQ   AG AI++K +LN+GMN   F  YR+A A  +
Sbjct  1     MSRNGERVIRVLSR-LKPYLAVVLLQFGFAGMAIVAKFSLNRGMNQHVFVVYRHAFAIAV  59

Query  1225  FAPFALFLERKTRPTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPA  1049
              APFA+  ERKTRP MT S+F KI+LL LLE  ++ NL+Y GM+YTTA+ +  M N++PA
Sbjct  60    VAPFAILFERKTRPKMTRSVFLKILLLGLLEPVIDQNLFYTGMKYTTASFTAAMSNMLPA  119

Query  1048  MTFLLAWIFRLEKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSH  869
              TFL+AW FRLE++ IR+ HSQAKI+GT   IGGAMIMTL KGP++ LPWTK ++   +H
Sbjct  120   FTFLMAWFFRLERLSIRSKHSQAKILGTLVTIGGAMIMTLGKGPVLDLPWTKSTS---AH  176

Query  868   SAQHVLNQHSNPIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSI  689
                  + Q   PI+  L++   C   A FIILQA  +KSYPA L+LTTLIC  G+ Q ++
Sbjct  177   VDLDGVAQ--KPIEGALMITAGCFCWASFIILQAITLKSYPAELTLTTLICMTGTFQGAV  234

Query  688   LTLIVERGNASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMV  509
                 +ER N + WS+Q+D+ LL  VY G++ SG  YYI G++M++KGPVF+TAFNPL MV
Sbjct  235   FAFAMERSNFAAWSIQFDVRLLAVVYSGIICSGVGYYIQGVVMQIKGPVFLTAFNPLHMV  294



>emb|CDY18444.1| BnaA04g21430D [Brassica napus]
Length=373

 Score =   285 bits (728),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 176/372 (47%), Positives = 252/372 (68%), Gaps = 18/372 (5%)
 Frame = -3

Query  1357  KPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPTM  1178
             +P++ ++ LQV  AG  ILSKA LN+GM+ +    YR+A+A V+ APFAL+ ++K RP M
Sbjct  10    RPFISMVLLQVGLAGMDILSKAVLNKGMSNYVLVVYRHAVATVVMAPFALYFDKKVRPKM  69

Query  1177  TTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVKI  1001
             T  IFFKI LL LLE  ++ NLYY+GM+YTTAT +  M N++PA+TF+LA+IF LE+VK+
Sbjct  70    TLMIFFKITLLGLLEPVIDQNLYYLGMKYTTATFATAMYNVLPAITFVLAYIFGLERVKL  129

Query  1000  RNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKAT  821
             R + S  K++GT + +GGAMIMTLVKGP++ L WTK    V S       + HS  IK  
Sbjct  130   RCIRSAGKVIGTLATVGGAMIMTLVKGPVLDLFWTK----VASAQNTDGTDIHS-AIKGA  184

Query  820   LLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSLQ  641
             +L+   C S A F+ILQA  +++YPA LSLT  IC +G+++ + + L++E+GN   W++ 
Sbjct  185   VLVTIGCFSYACFMILQAVTLRTYPAELSLTAWICLMGTIEGTAVALVMEKGNPGAWAIG  244

Query  640   WDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLYM  461
             WD  LLT  Y G+V S   YY+ G++MK +GPVFVTAF+PL M++VAI+ + + +E++Y+
Sbjct  245   WDTKLLTSTYSGIVCSAIAYYVGGLVMKTRGPVFVTAFSPLCMIIVAIMSTVIFAEQMYL  304

Query  460   grvlgavvvlvglylviwGKSKD---QTSPDNNDALPIDHKQPQVVQGFNKDITVSL---  299
             GRVLGA V+  GLYLVIWGK KD    + P  ND    +  QP++    N + +V+L   
Sbjct  305   GRVLGAAVICAGLYLVIWGKGKDYEFSSMPQLND----ESTQPKLELSRNGEDSVNLEVI  360

Query  298   --N*KVELPRSH  269
               N + E  R+H
Sbjct  361   TINNQGEQRRTH  372



>ref|XP_010517017.1| PREDICTED: WAT1-related protein At2g37460 [Camelina sativa]
Length=380

 Score =   285 bits (729),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 170/356 (48%), Positives = 245/356 (69%), Gaps = 14/356 (4%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
               A+P++ ++ LQV  AG  ILSKA LN+GM+ +    YR+A+A ++ APFA + ++K R
Sbjct  11    EKARPFISMVVLQVGLAGMDILSKAVLNKGMSNYVLVVYRHAVATIVMAPFAFYFDKKVR  70

Query  1186  PTMTTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT  IFFKI +L  L   ++ NLYY+GM+YTTAT +  M N++PA+TF+LA+IF LE+
Sbjct  71    PKMTLVIFFKISLLGLLEPVIDQNLYYLGMKYTTATFATAMYNVLPAITFVLAYIFGLER  130

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             VK+R + S  K++GT + +GGAMIMTLVKGP++ L WTK     +S       + HS  I
Sbjct  131   VKLRCIRSAGKVIGTLATVGGAMIMTLVKGPVLDLFWTKG----ISSKNTDGTDIHS-AI  185

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
             K  +L+   C S A F+ILQA  +++YPA LSLT  IC +G+++ +++ L++E+GN S W
Sbjct  186   KGAVLVTIGCFSYACFMILQAVTLRTYPAELSLTAWICLMGTIEGTVVALVMEKGNPSAW  245

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
             ++ WD  LLT  Y G+V S   YY+ G++MK +GPVFVTAF+PL M++VAI+ + + +E+
Sbjct  246   AIGWDTKLLTSTYSGIVCSALAYYVGGVVMKTRGPVFVTAFSPLCMIIVAIMSTIIFAEQ  305

Query  469   LYMgrvlgavvvlvglylviwGKSKD---QTSPDNNDALPIDHKQPQV-VQGFNKD  314
             +Y+GRVLGAVV+  GLYLVIWGK KD   Q +   NDA      QP++ + G  KD
Sbjct  306   MYLGRVLGAVVICGGLYLVIWGKGKDYKYQVTLLTNDA----STQPKLELSGIGKD  357



>ref|XP_007218251.1| hypothetical protein PRUPE_ppa008064mg [Prunus persica]
 gb|EMJ19450.1| hypothetical protein PRUPE_ppa008064mg [Prunus persica]
Length=347

 Score =   283 bits (724),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 165/339 (49%), Positives = 235/339 (69%), Gaps = 7/339 (2%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             N AKP + V  +Q   AG +I+SK ALN+GM+      YR+A+A V  APFA+  +RK R
Sbjct  11    NRAKPSVAVTLMQFGFAGMSIISKFALNRGMSQHVLVVYRHAVATVFIAPFAVVFDRKVR  70

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT S+  KI+LL LLE  ++ NL+Y GM+ TTAT +  M N++PA  F++AWIFRLE 
Sbjct  71    PKMTFSVLTKILLLGLLEPVIDQNLFYTGMKLTTATFTSAMCNVLPAFAFIMAWIFRLEN  130

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             +  R+LHS AKI+GT   +GGAM+MTL+ GP++ LPWT+ +    S SA      H +PI
Sbjct  131   INFRSLHSLAKILGTIVTVGGAMLMTLINGPMLNLPWTRRNIHQESTSA----TDHQDPI  186

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
             K  L++   C   A F+ LQA  +KSYPA LSL   IC +G++Q +++ L  E  N + W
Sbjct  187   KGALMIGAGCFCWAGFVNLQAITLKSYPAELSLAAWICLMGTVQGTVVALGFEWDNPAAW  246

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
             S+ WD  LL  VY G++ SG  YY+ G++MK +GPVFVTAF+PLSM++VA++ SF+L+E 
Sbjct  247   SIHWDSKLLAAVYSGIICSGVAYYVQGLVMKERGPVFVTAFSPLSMIIVAVMSSFMLAEI  306

Query  469   LYMgrvlgavvvlvglylviwGKSKDQ--TSPDNNDALP  359
             +Y+GRV+GA+V+++GLY+V+WGKSKDQ  +  + +D +P
Sbjct  307   MYLGRVIGAMVIVIGLYMVLWGKSKDQIPSESEKDDLVP  345



>emb|CDY07788.1| BnaA03g17230D [Brassica napus]
Length=362

 Score =   283 bits (724),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 168/345 (49%), Positives = 242/345 (70%), Gaps = 7/345 (2%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
                +P++ V+ LQV  AG  ILSKA LN+GM+ +    YR+A+A ++ APFAL+ ++K R
Sbjct  11    EKVRPFILVVLLQVGLAGMDILSKAVLNKGMSNYVLVVYRHAVATLVMAPFALYFDKKVR  70

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT  IFF+I LL LLE  ++ NLYY+GM+YTTAT +  M N++PA+TF+LA+IF LE+
Sbjct  71    PKMTFMIFFRITLLGLLEPVIDQNLYYLGMKYTTATFATAMYNVLPAITFVLAYIFGLER  130

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             VK+R + S  K++GT + +GGAMIMTLVKGP++ L WTK ++     +   V     + I
Sbjct  131   VKLRCIRSAGKVIGTLATVGGAMIMTLVKGPVLDLFWTKGAS-----APNTVGTDIHSAI  185

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
             K  +L+   C S A F+ILQA  +++YPA LSLT  IC +G+++ +++ L++E+GN   W
Sbjct  186   KGAVLVTIGCFSYACFMILQAFTLRTYPAELSLTAWICLMGTIEGAVVALVIEKGNPGAW  245

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
             ++ WD  L+T  Y G+V SG  YY+ GI+MK KGPVFVTAF+PL M++VAI+ + + +E+
Sbjct  246   AIGWDTKLITATYSGIVCSGIGYYVGGIVMKTKGPVFVTAFSPLGMIIVAIMSTIIFAEQ  305

Query  469   LYMgrvlgavvvlvglylviwGKSKDQTSPDNNDALPIDHKQPQV  335
             +Y+GRVLGAVV+  GLYLVIWGKSKD   P +   +  +  QP V
Sbjct  306   MYLGRVLGAVVICAGLYLVIWGKSKDYKYP-STPQIDGESAQPSV  349



>ref|XP_006410933.1| hypothetical protein EUTSA_v10016799mg [Eutrema salsugineum]
 gb|ESQ52386.1| hypothetical protein EUTSA_v10016799mg [Eutrema salsugineum]
Length=380

 Score =   283 bits (725),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 172/350 (49%), Positives = 241/350 (69%), Gaps = 17/350 (5%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
               A+P++ V+ LQV  AG  ILSKA LN+GM+ +    YR+A+A V+ APFA + ++K R
Sbjct  11    EKARPFISVVLLQVGLAGMDILSKAVLNKGMSNYVLVVYRHAVATVVMAPFAFYFDKKVR  70

Query  1186  PTMTTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT  IFFKI +L  L   ++ NLYY+GM+YTTAT +  M N++PA+TF+LA+IF LE+
Sbjct  71    PKMTLMIFFKISLLGLLEPVIDQNLYYLGMKYTTATFATAMYNVLPAITFVLAYIFGLER  130

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHV--LNQHSN  836
             VK+R + S  K+VGT + +GGAMIMTLVKGP++ L WTK S      SAQ+    + HS 
Sbjct  131   VKLRCIRSAGKVVGTLATVGGAMIMTLVKGPVLDLFWTKGS------SAQNTNGTDIHS-  183

Query  835   PIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNAS  656
              IK  +L+   C S A F+ILQA  +++YPA LSLT  IC +G+++ + + L++E+GN  
Sbjct  184   AIKGAVLVTIGCFSYACFMILQAVTLRTYPAELSLTAWICLMGTIEGTAVALVMEKGNPG  243

Query  655   VWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLS  476
              W++ WD  LLT  Y G+V S   YYI G++MK +GPVFVTAF+PL M++VAI+ + + +
Sbjct  244   AWAIGWDTKLLTATYSGIVCSALAYYIGGVVMKTRGPVFVTAFSPLCMIIVAIMSTVIFA  303

Query  475   EKLYMgrvlgavvvlvglylviwGKSKDQTSP---DNNDALPIDHKQPQV  335
             E++Y+GRVLGAVV+  GLYLVIWGK KD   P     +D L     QP++
Sbjct  304   EQMYLGRVLGAVVICAGLYLVIWGKGKDYEYPSTLQTDDVL----TQPKL  349



>ref|XP_010505334.1| PREDICTED: WAT1-related protein At2g37460-like [Camelina sativa]
Length=380

 Score =   283 bits (724),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 169/356 (47%), Positives = 244/356 (69%), Gaps = 14/356 (4%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
               A+P++ ++ LQV  AG  ILSKA LN+GM+ +    YR+A+A ++ APFA + ++K R
Sbjct  11    EKARPFISMVVLQVGLAGMDILSKAVLNKGMSNYVLVVYRHAVATIVMAPFAFYFDKKVR  70

Query  1186  PTMTTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT  IFFKI +L  L   ++ NLYY+GM+YTTAT +  M N++PA+TF+LA+IF LE+
Sbjct  71    PKMTLMIFFKISLLGLLEPVIDQNLYYLGMKYTTATFATAMYNVLPAITFVLAYIFGLER  130

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             VK+R + S  K++GT + +GGAMIMTLVKGP++ L WTK     +S       + HS  I
Sbjct  131   VKLRCIRSAGKVIGTLATVGGAMIMTLVKGPVLDLFWTKG----ISSKNTDGTDIHS-AI  185

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
             K  +L+   C S A F+ILQA  +++YPA LSLT  IC +G+++ +++ L++E+GN   W
Sbjct  186   KGAVLVTIGCFSYACFMILQAVTLRTYPAELSLTAWICLMGTIEGTVVALVMEKGNPRAW  245

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
             ++ WD  LLT  Y G+V S   YY+ G++MK +GPVFVTAF+PL M++VAI+ + + +E+
Sbjct  246   AIGWDTKLLTSTYSGIVCSALAYYVGGVVMKTRGPVFVTAFSPLCMIIVAIMSTIIFAEQ  305

Query  469   LYMgrvlgavvvlvglylviwGKSKD---QTSPDNNDALPIDHKQPQV-VQGFNKD  314
             +Y+GRVLGAVV+  GLYLVIWGK KD   Q +   NDA      QP++ + G  KD
Sbjct  306   MYLGRVLGAVVICGGLYLVIWGKGKDYKYQVTLLTNDA----STQPKLELSGIGKD  357



>ref|XP_009133180.1| PREDICTED: WAT1-related protein At2g37460-like [Brassica rapa]
Length=362

 Score =   282 bits (722),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 164/345 (48%), Positives = 240/345 (70%), Gaps = 7/345 (2%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
                +P++ V+ LQV  AG  +LSKA LN+GM+ +    YR+A+A ++ APFAL+ ++K R
Sbjct  11    EKVRPFILVVLLQVGLAGMDVLSKAVLNKGMSNYVLVVYRHAVATLVMAPFALYFDKKVR  70

Query  1186  PTMTTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT  IFF+I +L  L   ++ NLYY+GM+YTTAT +  M N++PA+TF+LA+IF LE+
Sbjct  71    PKMTFMIFFRITLLGLLEPVIDQNLYYLGMKYTTATFATAMYNVLPAITFVLAYIFGLER  130

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             VK+R + S  K++GT + +GGAMIMTLVKGP++ L WTK ++     +   V     + I
Sbjct  131   VKLRCIRSAGKVIGTLATVGGAMIMTLVKGPVLDLFWTKGAS-----APNTVGTDIHSAI  185

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
             K  +L+   C S A F+ILQA  +++YPA LSLT  IC +G+++ +++ L++E+GN   W
Sbjct  186   KGAVLVTIGCFSYACFMILQAFTLRTYPAELSLTAWICLMGTIEGAVVALVIEKGNPGAW  245

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
             ++ WD  L+T  Y G+V SG  YY+ GI+MK KGPVFVTAF+PL M++VAI+ + + +E+
Sbjct  246   AIGWDTKLITATYSGIVCSGIGYYVGGIVMKTKGPVFVTAFSPLGMIIVAIMSTIIFAEQ  305

Query  469   LYMgrvlgavvvlvglylviwGKSKDQTSPDNNDALPIDHKQPQV  335
             +Y+GRVLGAVV+  GLYLVIWGKSKD   P +   +  +  QP V
Sbjct  306   MYLGRVLGAVVICAGLYLVIWGKSKDYKYP-STPQIDGESAQPSV  349



>gb|KDP29854.1| hypothetical protein JCGZ_18429 [Jatropha curcas]
Length=348

 Score =   282 bits (721),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 168/317 (53%), Positives = 231/317 (73%), Gaps = 8/317 (3%)
 Frame = -3

Query  1309  AILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPTMTTSIFFKIVllalle-  1133
             +I+SK ALNQGM+      YR+A+A ++ APFA+  +RK RP MT S+F KI+LL LLE 
Sbjct  2     SIISKFALNQGMSQHVLVVYRHAVATIVMAPFAILFDRKVRPKMTFSVFVKILLLGLLEP  61

Query  1132  qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVKIRNLHSQAKIVGTASAI  953
              ++ NLYY GM+YTTAT +  M N++PA  FL+AW  RLE+VK + +HS AK++GT   +
Sbjct  62    TIDQNLYYTGMKYTTATFASAMCNILPAFAFLMAWALRLEEVKWKKVHSWAKVLGTIVTV  121

Query  952   GGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKATLLLAGSCCSTAIFIIL  773
             GGAM+MTL+KG I+ LPW+K  ++  S +A   +  H + IK   ++   C   + FIIL
Sbjct  122   GGAMLMTLIKGAILELPWSKGYDNQASTAA---VTPH-DTIKGAFMIGIGCLCWSCFIIL  177

Query  772   QANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSLQWDMTLLTYVYHGLVRS  593
             QA  +K+YPA LSLT LIC +G+++ SI  +I+E+GN S WS+ +D  LL  VY G++ S
Sbjct  178   QAITLKTYPAELSLTALICFMGTIEGSIFAVIMEKGNPSAWSIHFDSKLLAAVYSGVMCS  237

Query  592   GAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLYMgrvlgavvvlvglylv  413
             G  YY+ G+IMK KGPVFVTAFNPLSMV+V I+GSFVLSE +Y+GR++GA+V++ GLYLV
Sbjct  238   GIAYYVQGVIMKAKGPVFVTAFNPLSMVIVTILGSFVLSEIMYLGRIIGALVIVTGLYLV  297

Query  412   iwGKSKDQTSP--DNND  368
             +WGKSKD+ SP   +ND
Sbjct  298   LWGKSKDK-SPLASSND  313



>ref|XP_008461650.1| PREDICTED: WAT1-related protein At2g39510-like isoform X2 [Cucumis 
melo]
Length=378

 Score =   283 bits (723),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 168/337 (50%), Positives = 230/337 (68%), Gaps = 4/337 (1%)
 Frame = -3

Query  1390  ERVVKWLNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFA  1211
             E  V+++ + AKPY GV+F+Q   AG  IL+K+AL++GM+   F  YR   A ++ APFA
Sbjct  2     ESFVRFMRS-AKPYFGVIFVQFGYAGMTILTKSALDKGMSQHVFVAYRQVAATLVIAPFA  60

Query  1210  LFLERKTRPTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLL  1034
             +  ERK R  MT S+ FKI+LL  LE  ++ NL+Y GM+YTTAT +  M N++PA  FL+
Sbjct  61    IIFERKARTKMTFSLLFKILLLGFLEPVIDQNLFYTGMKYTTATFAAAMCNVLPAFVFLM  120

Query  1033  AWIFRLEKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSND--VVSHSAQ  860
             AW  RLEKV I    SQAKI+GT   +GGAMIMT +KGP++ LPW+K  N     S S+ 
Sbjct  121   AWACRLEKVNIMKRGSQAKILGTIVTVGGAMIMTFIKGPMLHLPWSKLPNHPSASSSSSS  180

Query  859   HVLNQHSNPIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTL  680
                  H N I   L+L   C   A FI LQA  +K YPA LSLT LIC +G++  S + L
Sbjct  181   AASTDHQNQIIGFLMLTTGCICWAAFITLQAITLKEYPAELSLTALICLVGTIGGSGVAL  240

Query  679   IVERGNASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVA  500
             ++ERGN S W+L +D  LL  VY G++ SG  YYI G++M+ KGPVF +AFNPL+MVLVA
Sbjct  241   VIERGNPSAWALHFDRQLLAVVYSGVICSGVTYYIQGVVMQTKGPVFFSAFNPLAMVLVA  300

Query  499   IIGSFVLSEKLYMgrvlgavvvlvglylviwGKSKDQ  389
             I+  F+LSE +++GR++G V+++ GLY+V+WGK++DQ
Sbjct  301   IMSFFILSEIMFLGRMIGVVIIICGLYMVLWGKTRDQ  337



>ref|NP_181282.1| nodulin MtN21-like transporter family protein [Arabidopsis thaliana]
 sp|Q9ZUS1.1|WTR13_ARATH RecName: Full=WAT1-related protein At2g37460 [Arabidopsis thaliana]
 gb|AAC98072.1| nodulin-like protein [Arabidopsis thaliana]
 gb|AAK59607.1| putative nodulin protein [Arabidopsis thaliana]
 gb|AAK73261.1| nodulin-like protein [Arabidopsis thaliana]
 gb|AAL34209.1| putative nodulin protein [Arabidopsis thaliana]
 gb|AEC09403.1| nodulin MtN21-like transporter family protein [Arabidopsis thaliana]
Length=380

 Score =   283 bits (723),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 171/355 (48%), Positives = 246/355 (69%), Gaps = 12/355 (3%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
               A+P++ ++ LQV  AG  ILSKA LN+GM+ +    YR+A+A ++ APFA + ++K R
Sbjct  11    EKARPFISMVVLQVGLAGMDILSKAVLNKGMSNYVLVVYRHAVATIVMAPFAFYFDKKVR  70

Query  1186  PTMTTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT  IFFKI +L  L   ++ NLYY+GM+YTTAT +  M N++PA+TF+LA+IF LE+
Sbjct  71    PKMTLMIFFKISLLGLLEPVIDQNLYYLGMKYTTATFATAMYNVLPAITFVLAYIFGLER  130

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             VK+R + S  K+VGT + +GGAMIMTLVKGP++ L WTK    V +H+     + HS  I
Sbjct  131   VKLRCIRSTGKVVGTLATVGGAMIMTLVKGPVLDLFWTK---GVSAHNTAGT-DIHS-AI  185

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
             K  +L+   C S A F+ILQA  +++YPA LSLT  IC +G+++ + + L++E+GN S W
Sbjct  186   KGAVLVTIGCFSYACFMILQAITLRTYPAELSLTAWICLMGTIEGTAVALVMEKGNPSAW  245

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
             ++ WD  LLT  Y G+V S   YY+ G++MK +GPVFVTAF+PL M++VAI+ + + +E+
Sbjct  246   AIGWDTKLLTATYSGIVCSALAYYVGGVVMKTRGPVFVTAFSPLCMIIVAIMSTIIFAEQ  305

Query  469   LYMgrvlgavvvlvglylviwGKSKDQTSPDNNDALPIDHK--QPQV-VQGFNKD  314
             +Y+GRVLGAVV+  GLYLVIWGK KD      N  L +D +  QP++ + G  KD
Sbjct  306   MYLGRVLGAVVICAGLYLVIWGKGKDY---KYNSTLQLDDESAQPKLELSGNGKD  357



>emb|CDX79734.1| BnaC03g20700D [Brassica napus]
Length=362

 Score =   281 bits (720),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 168/345 (49%), Positives = 240/345 (70%), Gaps = 7/345 (2%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
               A+P + V+ LQV  AG  ILSKA LN+GM+ +    YR+A+A ++ APFAL+ ++K R
Sbjct  11    EKARPVILVVLLQVGLAGMDILSKAVLNKGMSNYVLVVYRHAVATLVMAPFALYFDKKVR  70

Query  1186  PTMTTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT  IFF+I +L  L   ++ NLYY+GM+YTTAT +  M N++PA+TF+LA+IF LE+
Sbjct  71    PKMTFMIFFRITLLGLLEPVIDQNLYYLGMKYTTATFATAMYNVLPAITFILAYIFGLER  130

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             VK+R + S  K++GT + +GGAMIMTLVKGP++ L WTK +    S       + HS  I
Sbjct  131   VKLRCIRSAGKVIGTLATVGGAMIMTLVKGPVLDLFWTKGA----SAPNTAGTDIHS-AI  185

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
             K  +L+   C S A F+ILQA  +++YPA LSLT  IC +G+++ +++ L++E+GN   W
Sbjct  186   KGAVLVTIGCFSYACFMILQAFTLRTYPAELSLTAWICLMGTIEGAVVALVIEKGNPGAW  245

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
             ++ WD  L+T  Y G+V SG  YY+ GI+MK KGPVFVTAF+PL M++VAI+ + + +E+
Sbjct  246   AIGWDTKLITATYTGIVCSGIGYYVGGIVMKTKGPVFVTAFSPLGMIIVAIMSTIIFAEQ  305

Query  469   LYMgrvlgavvvlvglylviwGKSKDQTSPDNNDALPIDHKQPQV  335
             +Y+GRVLGAVV+  GLYLVIWGKSKD   P +   +  +  QP V
Sbjct  306   MYLGRVLGAVVICAGLYLVIWGKSKDYKYP-STPQIDGESAQPSV  349



>ref|XP_006289509.1| hypothetical protein CARUB_v10003044mg [Capsella rubella]
 gb|EOA22407.1| hypothetical protein CARUB_v10003044mg [Capsella rubella]
Length=379

 Score =   282 bits (721),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 165/327 (50%), Positives = 228/327 (70%), Gaps = 2/327 (1%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
               A+P+L ++F+Q   A  +I++K ALN GM+P     YR A+A+ +  PFAL LER TR
Sbjct  4     ERARPFLAIVFIQCLYALMSIVAKLALNAGMSPHVLVAYRMAVASALITPFALVLERNTR  63

Query  1186  PTMTTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT  I F+I +L      +  NLYY GM+ TTAT +  + N +PAMTF++A IF+LEK
Sbjct  64    PRMTFKILFQIAILSLFEPVVEQNLYYSGMKLTTATFTSALCNALPAMTFIMACIFKLEK  123

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             V +R  HSQAK+VGT  AIGGAM MT +KG  + LPWTK+S  + +HS    + +  +  
Sbjct  124   VTMRRRHSQAKVVGTMVAIGGAMFMTFLKGHALELPWTKNSRGLDAHSHSLRIPKQEDIA  183

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
             + +L+L  SC S + +IILQA ++  Y A LSLT+L+C +G L+ ++L LI ER N SVW
Sbjct  184   RGSLMLVASCFSWSCYIILQAKILVQYQAELSLTSLMCIMGMLEATVLGLIWERKNMSVW  243

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
              +Q D+TL+  +Y GLV SG  YY+ G   K +GPVFV+AFNPLSMVLVAI+ +F+  EK
Sbjct  244   KIQPDVTLIASIYGGLV-SGLAYYVIGWASKERGPVFVSAFNPLSMVLVAILSTFIFFEK  302

Query  469   LYMgrvlgavvvlvglylviwGKSKDQ  389
             LY+GRV G+VV++VG+Y+V+WGKSKD+
Sbjct  303   LYLGRVFGSVVIVVGIYMVLWGKSKDE  329



>ref|XP_009357771.1| PREDICTED: WAT1-related protein At2g39510-like [Pyrus x bretschneideri]
Length=337

 Score =   280 bits (717),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 162/336 (48%), Positives = 233/336 (69%), Gaps = 7/336 (2%)
 Frame = -3

Query  1354  PYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPTMT  1175
             P++ V F+Q   AG +++SK ALN GM+P     YR+A+A V  APFA+  +R  RP MT
Sbjct  2     PFMAVTFMQFGFAGMSLISKFALNHGMSPHVLVVYRHAVATVFIAPFAIIFDRNVRPKMT  61

Query  1174  TSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVKIR  998
              SIF KIVLL LLE  ++ NL+Y GM+ TTAT +  M N++PA  F++AWIFRLEK+ +R
Sbjct  62    LSIFTKIVLLGLLEPVIDQNLFYTGMKLTTATFTSAMCNVLPAFAFIMAWIFRLEKINLR  121

Query  997   NLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKATL  818
             +LHS AKI+GT   +GGAM+MTL+ GP++  PWT+ +     H    V   H +PIK  +
Sbjct  122   SLHSLAKILGTIVTVGGAMLMTLINGPMLNFPWTRRN----IHQESTVSTVHQDPIKGAI  177

Query  817   LLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSLQW  638
             ++A  C   + F+ILQA  +KSYPA LSLTT IC +G++Q +   L  E  N   WS+ +
Sbjct  178   MIAAGCFCWSCFMILQAITLKSYPAELSLTTWICLVGTVQGTAAALAFEWNNPIAWSIHF  237

Query  637   DMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLYMg  458
             D  LL   Y G++ SG  YYI G++MK +GPVFVTAF+PL+M++ A++ SF+L+E +Y+G
Sbjct  238   DYKLLAAFYSGIMCSGIAYYIQGMVMKERGPVFVTAFSPLNMIITAVMSSFILAEIMYLG  297

Query  457   rvlgavvvlvglylviwGKSKDQ--TSPDNNDALPI  356
             RV+GA+V+++GLY+V+WGKSKDQ  +  + +D + +
Sbjct  298   RVIGAMVIVIGLYMVLWGKSKDQLPSELEKDDKMEL  333



>emb|CDY65991.1| BnaA10g29860D [Brassica napus]
Length=378

 Score =   282 bits (721),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 171/373 (46%), Positives = 243/373 (65%), Gaps = 5/373 (1%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
               A+P++ ++F+Q   A  +I++K ALNQGM+P     YR A+AA +  PFAL LER +R
Sbjct  4     EKARPFMAIVFIQFLYALMSIVAKIALNQGMSPHVLVAYRMAVAAALITPFALVLERNSR  63

Query  1186  PTMTTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P +T  IF +I +L      +  NLYY GM+ TTAT +  + N +PAMTF++A IF+LEK
Sbjct  64    PRLTFKIFLQISILSLFEPVVEQNLYYSGMKLTTATFTSALCNALPAMTFIMACIFKLEK  123

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             V IR  HSQAK+VGT  AIGGAM+MT  KG +I LPWT     ++  +      +  +  
Sbjct  124   VNIRRRHSQAKLVGTMVAIGGAMLMTFFKGNVIELPWTSKPMGIIGQAHSMNTPKQEDIG  183

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
             K +++L  SC S + +IILQAN++ +Y A LSLT L+C +G L+ S++ LI ER N SVW
Sbjct  184   KGSVMLVASCFSWSCYIILQANILNTYNAELSLTALMCIMGMLEASVIALIWERKNMSVW  243

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
              +  DM LL  +Y GLV SG  YY  G   K +GPVFV+AFNPLSMV+VAI+ SFV  EK
Sbjct  244   KIHPDMKLLASIYGGLV-SGLAYYAIGWASKKRGPVFVSAFNPLSMVIVAILSSFVFLEK  302

Query  469   LYMgrvlgavvvlvglylviwGKSKD---QTSPDNNDALPIDHKQPQVVQGFNKDITVSL  299
             LY+GRV+G+VV++ G+YLV+WGKSKD   Q S +   A  +     Q+V+  + +  + +
Sbjct  303   LYLGRVVGSVVIVFGVYLVLWGKSKDKIEQPSTNAGCAETVVKTDEQMVRTLDNNQVLPI  362

Query  298   N*KVELPRSHPHD  260
             + ++ +P++  H 
Sbjct  363   HDQLMIPKAVTHS  375



>ref|XP_010509331.1| PREDICTED: WAT1-related protein At2g37460-like [Camelina sativa]
Length=380

 Score =   281 bits (720),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 170/357 (48%), Positives = 247/357 (69%), Gaps = 16/357 (4%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
               A+P++ ++ LQV  AG  ILSKA LN+GM+ +    YR+A+A ++ APFA + ++K R
Sbjct  11    EKARPFISMVVLQVGLAGMDILSKAVLNKGMSNYVLVVYRHAVATIVMAPFAFYFDKKVR  70

Query  1186  PTMTTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT  IFFKI +L  L   ++ NLYY+GM+YTTAT +  M N++PA+TF+LA+IF LE+
Sbjct  71    PKMTLMIFFKISLLGLLEPVIDQNLYYLGMKYTTATFATAMYNVLPAITFVLAYIFGLER  130

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             VK+R + S  K++GT + +GGAMIMTLVKGP++ L WTK     +S       + HS  I
Sbjct  131   VKLRCIRSAGKVIGTLATVGGAMIMTLVKGPVLDLFWTKG----ISSKNTDGTDIHS-AI  185

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
             K  +L+   C S A F+ILQA  +++YPA LSLT  IC +G+++ +++ L++E+GN S W
Sbjct  186   KGAVLVTIGCFSYACFMILQAVTLRTYPAELSLTAWICLMGTIEGTVVALVMEKGNPSAW  245

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
             ++ WD  LLT  Y G+V S   YY+ G++MK +GPVFVTAF+PL M++VAI+ + + +E+
Sbjct  246   AIGWDTKLLTSTYSGIVCSALAYYVGGVVMKTRGPVFVTAFSPLCMIIVAIMSTIIFAEQ  305

Query  469   LYMgrvlgavvvlvglylviwGKSKD---QTSPDNNDALPID-HKQPQV-VQGFNKD  314
             +Y+GRVLGAVV+  GLYLVIWGK KD   Q++P     L ID   QP++ + G  K+
Sbjct  306   MYLGRVLGAVVICGGLYLVIWGKGKDYKYQSTP-----LTIDPSTQPKLELSGIGKN  357



>gb|KFK36632.1| hypothetical protein AALP_AA4G149800 [Arabis alpina]
Length=370

 Score =   281 bits (718),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 170/361 (47%), Positives = 245/361 (68%), Gaps = 10/361 (3%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
               A+P++ ++ LQV  AG  ILSKA LN+GM+ +    YR+A+A V+ APFA++ ++K R
Sbjct  2     EKARPFICMVLLQVGLAGMDILSKAVLNKGMSNYVLVVYRHAVATVVMAPFAIYFDKKVR  61

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT  IFFKI LL LLE  ++ NLYY+GM+YTTAT +  M N++PA+TF+LA+IF LE+
Sbjct  62    PKMTMMIFFKITLLGLLEPVIDQNLYYLGMKYTTATFATAMYNVLPAITFVLAYIFGLER  121

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             V +R + S  KI+GT + +GGAMIMTLVKGP++ L WTK     VS       + HS  I
Sbjct  122   VNLRCIRSAGKIIGTLATVGGAMIMTLVKGPVLELFWTKG----VSAPNTAGTDIHS-AI  176

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
             K  +L+   C S A F+ILQA  +++YPA LSLT  IC +G+++ + + L++E+GN   W
Sbjct  177   KGAVLVTIGCFSYACFMILQAVTLRTYPAELSLTAWICLMGTIEGTAVALVMEKGNPGAW  236

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
             ++ WD  LLT  Y G+V S   YY+ G++MK +GPVFVTAF+PL M++VAI+ + + +E+
Sbjct  237   AIGWDTKLLTATYSGIVCSALAYYVGGVVMKTRGPVFVTAFSPLCMIIVAIMSTVIFAEQ  296

Query  469   LYMgrvlgavvvlvglylviwGKSKDQTSPDNNDALPIDHKQPQVVQGFNKDITVSLN*K  290
             +Y+GRVLGA V+  GLYLVIWGK KD   P       ID +  Q     ++++  S++ +
Sbjct  297   MYLGRVLGAGVICAGLYLVIWGKGKDYEYPSTQ----IDGESAQTKLELSRNVEGSVDHE  352

Query  289   V  287
             V
Sbjct  353   V  353



>ref|XP_004493899.1| PREDICTED: WAT1-related protein At2g37460-like isoform X2 [Cicer 
arietinum]
Length=361

 Score =   280 bits (717),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 163/329 (50%), Positives = 231/329 (70%), Gaps = 23/329 (7%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             +  KP++ V+FLQ   AG  +LSKAALN+GM+ +    YR+A+A ++ APFAL LE+   
Sbjct  10    DKLKPFIAVVFLQFGYAGMDVLSKAALNKGMSNYVLVVYRHAVAFIVIAPFALILEK---  66

Query  1186  PTMTTSIFFKIVllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKV  1007
             P +  ++                 Y++GM+YTTAT +V M+N++PA+TF++A I +LEK+
Sbjct  67    PVIDQNL-----------------YFLGMKYTTATFAVAMINVLPAITFVMACILKLEKI  109

Query  1006  KIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIK  827
             K+++ HSQAK+VGT + + GAM+MTL+KGPI+ +     S+  + H+A   L QH  PIK
Sbjct  110   KMKSTHSQAKVVGTLATVLGAMVMTLLKGPILNVFGIHGSSTQIQHNAGANL-QH--PIK  166

Query  826   ATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWS  647
              ++++   C S A F+ILQA  +++YPA LSLT  IC +G+++  I+ LI+ERG  SVWS
Sbjct  167   GSIMITIGCFSCACFMILQAITLETYPAELSLTAWICLLGTVEGGIVALIMERGEPSVWS  226

Query  646   LQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKL  467
             L WD  LL  VY G+V SG  YYI G +M+ +GPVFVT FNPL MV+VAI+GSF L+EK+
Sbjct  227   LNWDTKLLAAVYSGIVCSGMAYYIQGALMRYRGPVFVTTFNPLCMVIVAIMGSFFLAEKI  286

Query  466   YMgrvlgavvvlvglylviwGKSKDQTSP  380
             Y+GRV+GAVV++ GLYLV+WGKSKD  SP
Sbjct  287   YLGRVIGAVVIIFGLYLVVWGKSKDYDSP  315



>ref|XP_010419959.1| PREDICTED: WAT1-related protein At5g13670-like [Camelina sativa]
Length=388

 Score =   280 bits (717),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 168/361 (47%), Positives = 236/361 (65%), Gaps = 24/361 (7%)
 Frame = -3

Query  1360  AKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPT  1181
             AKP++ ++F+Q   A  +I++K ALN GM+P     YR A+A+V+  PFAL LER TRP 
Sbjct  14    AKPFIAIVFIQCLYALMSIVAKLALNAGMSPHVLVAYRMAVASVLITPFALVLERNTRPR  73

Query  1180  MTTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVK  1004
             MT  I  +I +L      +  NLYY GM+ TTAT +  + N +PAMTF++A +F+LEKV 
Sbjct  74    MTFKILLQIAILSLFEPVVEQNLYYSGMKLTTATFTSALCNALPAMTFIMACLFKLEKVT  133

Query  1003  IRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKA  824
             I+  HSQAK+VGT  A+GGAM+MT VKG +I LPWTK+S  +  HS    + +  +  + 
Sbjct  134   IKKRHSQAKLVGTMVAVGGAMLMTFVKGNVIELPWTKNSKGLNVHSHAMRIPKQDDIARG  193

Query  823   TLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSL  644
             +++L  SC S + +IILQA ++  Y A LSLT L+C +G L+ ++L LI ER N SVW +
Sbjct  194   SIMLVASCFSWSCYIILQAKILAQYQAELSLTALMCIMGMLEATVLGLIWERKNMSVWKI  253

Query  643   QWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLY  464
             Q D+TLL  +Y GLV SG  YY+ G   K +GPVFV+AFNPLSMVLVAI+ +F+  E +Y
Sbjct  254   QPDVTLLASIYGGLV-SGLAYYVIGWASKERGPVFVSAFNPLSMVLVAILSTFIFLENMY  312

Query  463   MgrvlgavvvlvglylviwGKSKDQ----------------------TSPDNNDALPIDH  350
             +GRV+G+VV+++G+YLV+WGKSKD+                       +PDNN  +P   
Sbjct  313   LGRVVGSVVIVIGIYLVLWGKSKDKGGKLQPNAGCAETVVKIDEQKIPTPDNNRVVPTSD  372

Query  349   K  347
             +
Sbjct  373   Q  373



>ref|XP_010274315.1| PREDICTED: WAT1-related protein At1g21890 [Nelumbo nucifera]
Length=385

 Score =   280 bits (717),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 175/378 (46%), Positives = 240/378 (63%), Gaps = 30/378 (8%)
 Frame = -3

Query  1363  DAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRP  1184
              AKP++ ++ LQ   AG  I++   L +G+N +    YRN  A +  APFAL+ ERK RP
Sbjct  16    KAKPFVAMVSLQFGFAGMYIITMLCLKRGLNHYVLVVYRNGTATLAIAPFALYFERKIRP  75

Query  1183  TMTTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKV  1007
              MT S+F KI VL  L   L+ NLYYVGMRYT+AT S  M N++PA+TF++A IFRLEKV
Sbjct  76    KMTLSVFLKIMVLGFLEPVLDQNLYYVGMRYTSATFSSAMFNVLPAITFIMAIIFRLEKV  135

Query  1006  KIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTK---HSNDVVSHSAQHVLNQHSN  836
             KI+NLHSQAKI+GT   + GAM MTL KGPI+ L  ++   H  D  S S QH       
Sbjct  136   KIKNLHSQAKIIGTVVTLAGAMAMTLYKGPILNLGLSRGGSHHEDSSSSSGQHW------  189

Query  835   PIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNAS  656
              +  TL+L GSC   A F ILQ+  +K YPA LSLT+LIC +G++Q + + L++ER N +
Sbjct  190   -VVGTLMLLGSCTGWASFFILQSFTLKQYPAELSLTSLICFMGTMQGAAVALVMER-NPA  247

Query  655   VWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLS  476
              W++ WD  LL  VY G++ SG  YY+ G+++K +GPVFVTAFNPL M++VA +GS +L 
Sbjct  248   AWAVGWDSRLLAAVYTGVICSGVAYYVQGVVIKERGPVFVTAFNPLCMIIVAALGSLILG  307

Query  475   EKLYMgrvlgavvvlvglylviwGKSKDQ------------------TSPDNNDALPIDH  350
             E+L++G V+GA+V+++GLY V+WGKSKD                    S D   ++  +H
Sbjct  308   EQLHLGSVIGALVIVIGLYSVVWGKSKDHLVSSELTNEKGQALELPVASTDGAKSINGEH  367

Query  349   KQPQVVQGFNKDITVSLN  296
                  V G +  I V+ N
Sbjct  368   NGGFAVMGMSTKIPVAQN  385



>ref|XP_010492134.1| PREDICTED: WAT1-related protein At5g13670 isoform X1 [Camelina 
sativa]
Length=388

 Score =   280 bits (716),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 167/363 (46%), Positives = 236/363 (65%), Gaps = 24/363 (7%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
               A+P++ ++F+Q   A  +I++K ALN GM+P     YR A+A+V+  PFAL LER TR
Sbjct  12    KRARPFIAIIFIQCLYALMSIVAKLALNVGMSPHVLVAYRMAVASVLITPFALVLERNTR  71

Query  1186  PTMTTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT  IF +I +L      +  NLYY GM+ TTAT +  + N +PAMTF++A +F+LEK
Sbjct  72    PRMTFKIFLQIAILSLFEPVVEQNLYYSGMKLTTATFTSALCNALPAMTFIMACLFKLEK  131

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             V I+  HSQAK+VGT  A+GGAM+MT VKG +I LPWTK+S  +  HS    + +  +  
Sbjct  132   VTIKKRHSQAKLVGTMVAVGGAMLMTFVKGNVIELPWTKNSKGLNGHSHAMRIPKQDDIA  191

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
             K +++L  SC S + +II QA ++  Y A LSLT L+C +G L+ ++L LI ER N SVW
Sbjct  192   KGSIMLVASCFSWSCYIIFQAKILAQYQAELSLTALMCIMGMLEATVLGLIWERKNMSVW  251

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
              ++ D+TLL  +Y GLV SG  YY+ G   K +GPVFV+AFNPLSMVLVAI+ +F+  E 
Sbjct  252   KIKPDVTLLASIYGGLV-SGLAYYVIGWTSKERGPVFVSAFNPLSMVLVAILSTFIFLEN  310

Query  469   LYMgrvlgavvvlvglylviwGKSKDQ----------------------TSPDNNDALPI  356
             +Y+GRV+G+VV+++G+YLV+WGKSKD+                       +PDNN  +P 
Sbjct  311   MYLGRVIGSVVIVIGIYLVLWGKSKDKGGKLQPNAGCAETVVKIDEQKVPTPDNNRVVPT  370

Query  355   DHK  347
               +
Sbjct  371   SDQ  373



>ref|XP_010492135.1| PREDICTED: WAT1-related protein At5g13670 isoform X2 [Camelina 
sativa]
Length=380

 Score =   280 bits (715),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 167/361 (46%), Positives = 236/361 (65%), Gaps = 24/361 (7%)
 Frame = -3

Query  1360  AKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPT  1181
             A+P++ ++F+Q   A  +I++K ALN GM+P     YR A+A+V+  PFAL LER TRP 
Sbjct  6     ARPFIAIIFIQCLYALMSIVAKLALNVGMSPHVLVAYRMAVASVLITPFALVLERNTRPR  65

Query  1180  MTTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVK  1004
             MT  IF +I +L      +  NLYY GM+ TTAT +  + N +PAMTF++A +F+LEKV 
Sbjct  66    MTFKIFLQIAILSLFEPVVEQNLYYSGMKLTTATFTSALCNALPAMTFIMACLFKLEKVT  125

Query  1003  IRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKA  824
             I+  HSQAK+VGT  A+GGAM+MT VKG +I LPWTK+S  +  HS    + +  +  K 
Sbjct  126   IKKRHSQAKLVGTMVAVGGAMLMTFVKGNVIELPWTKNSKGLNGHSHAMRIPKQDDIAKG  185

Query  823   TLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSL  644
             +++L  SC S + +II QA ++  Y A LSLT L+C +G L+ ++L LI ER N SVW +
Sbjct  186   SIMLVASCFSWSCYIIFQAKILAQYQAELSLTALMCIMGMLEATVLGLIWERKNMSVWKI  245

Query  643   QWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLY  464
             + D+TLL  +Y GLV SG  YY+ G   K +GPVFV+AFNPLSMVLVAI+ +F+  E +Y
Sbjct  246   KPDVTLLASIYGGLV-SGLAYYVIGWTSKERGPVFVSAFNPLSMVLVAILSTFIFLENMY  304

Query  463   MgrvlgavvvlvglylviwGKSKDQ----------------------TSPDNNDALPIDH  350
             +GRV+G+VV+++G+YLV+WGKSKD+                       +PDNN  +P   
Sbjct  305   LGRVIGSVVIVIGIYLVLWGKSKDKGGKLQPNAGCAETVVKIDEQKVPTPDNNRVVPTSD  364

Query  349   K  347
             +
Sbjct  365   Q  365



>emb|CDX93378.1| BnaC04g45180D [Brassica napus]
Length=373

 Score =   279 bits (714),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 170/347 (49%), Positives = 241/347 (69%), Gaps = 15/347 (4%)
 Frame = -3

Query  1360  AKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPT  1181
             A+P++ ++ LQV  AG  ILSKA LN+GM+ +    YR+A+A V+ APFAL+ ++K RP 
Sbjct  13    ARPFISMVLLQVGLAGMDILSKAVLNKGMSNYVLVVYRHAVATVVMAPFALYFDKKVRPK  72

Query  1180  MTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVK  1004
             MT  IFFKI LL LLE  ++ NLYY+GM+YTTAT +  M N++PA+TF+LA+IF LE+VK
Sbjct  73    MTLMIFFKITLLGLLEPVIDQNLYYLGMKYTTATFATAMYNVLPAITFVLAYIFGLERVK  132

Query  1003  IRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSN-PIK  827
             +R + S  K++GT + +GGAMIMTLVKGP++ L WTK        S Q+      N  IK
Sbjct  133   LRCIRSAGKVIGTLATVGGAMIMTLVKGPVLDLFWTK------GVSTQNTDGTDINSAIK  186

Query  826   ATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWS  647
               +L+   C S A F+ILQA  +++YPA LSLT  IC +G+++ + + L++E+GN   W+
Sbjct  187   GAVLVTIGCFSYACFMILQAVTLRTYPAELSLTAWICLMGTIEGTAVALVMEKGNPGAWA  246

Query  646   LQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKL  467
             + WD  LLT  Y G+V S   YY+ G++MK +GPVFVTAF+PL M++VAI+ + + +E++
Sbjct  247   IGWDTKLLTSTYSGIVCSAIAYYVGGMVMKTRGPVFVTAFSPLCMIIVAIMSTVIFAEQM  306

Query  466   YMgrvlgavvvlvglylviwGKSKD---QTSPDNNDALPIDHKQPQV  335
             Y+GRVLGAVV+  GLYLVIWGK KD    + P  ND    +  QP++
Sbjct  307   YLGRVLGAVVICAGLYLVIWGKGKDYEFSSMPQPND----ESTQPKL  349



>ref|XP_006397315.1| hypothetical protein EUTSA_v10028726mg [Eutrema salsugineum]
 gb|ESQ38768.1| hypothetical protein EUTSA_v10028726mg [Eutrema salsugineum]
Length=382

 Score =   279 bits (714),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 147/306 (48%), Positives = 212/306 (69%), Gaps = 17/306 (6%)
 Frame = -3

Query  1357  KPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPTM  1178
             +PYL ++FLQ  +AG+ I+  A LNQG N +    YRNA+AA++ APFALF ERK RP M
Sbjct  12    RPYLLMIFLQFGAAGTYIVIMATLNQGQNRYVLIVYRNAVAALVLAPFALFFERKVRPKM  71

Query  1177  TTSIFFKIVllalleqlnlnLY-YVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVKI  1001
             T S+F+KIVLL  LE +    + Y+GM  T+AT +  ++N++P++TF++AWI R+EKVKI
Sbjct  72    TLSVFWKIVLLGFLEPILDQGFGYLGMNMTSATYTSAIMNVLPSVTFIIAWILRMEKVKI  131

Query  1000  RNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNP----  833
                 SQAKI+GT  A+GGA++MTL KGP+I LPW+  + D      QH  N+HSN     
Sbjct  132   VEARSQAKIIGTLVALGGALVMTLYKGPLIPLPWSNPNMD------QH--NEHSNSSQDN  183

Query  832   ---IKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGN  662
                +  TLL+  +C + + F +LQ+  IK+YPA LSL  LIC  G++Q + + L+VER +
Sbjct  184   NHWVAGTLLILLACVAWSCFYVLQSITIKTYPADLSLAALICLSGAIQSTAVALVVER-H  242

Query  661   ASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFV  482
             +S W++ WD  L   +Y G+V SG  YY+ G++M+ +GPVFVTAFNPL M+LVA++ SF+
Sbjct  243   SSGWAVGWDARLFAPLYTGIVSSGLTYYVQGMVMRTRGPVFVTAFNPLCMILVALLASFI  302

Query  481   LSEKLY  464
             L E+++
Sbjct  303   LHEQIH  308



>emb|CDX85633.1| BnaA02g01800D [Brassica napus]
Length=379

 Score =   279 bits (714),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 170/371 (46%), Positives = 244/371 (66%), Gaps = 9/371 (2%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
               A+P++ ++F+Q   A  +I++K ALNQGM+P     YR A+A  +  PFAL LER TR
Sbjct  4     QKARPFIAIVFIQFLYALMSIVAKLALNQGMSPHVLVAYRMAVATALITPFALILERNTR  63

Query  1186  PTMTTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P +T  I F+I ++      +  NLYY GM+ TTAT +  + N +PA+TF++A IF+LEK
Sbjct  64    PRLTFKILFQISIMSLFEPVVEQNLYYSGMKLTTATFTSALCNALPAITFIMACIFKLEK  123

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLN--QHSN  836
             V I+  HSQAK+VGT  AIGGAM+MT VKG +I LPWT  S      S  HV+N  +  +
Sbjct  124   VNIKRRHSQAKLVGTMVAIGGAMLMTFVKGNVIELPWTSKSRSYNGQS--HVMNTPKQED  181

Query  835   PIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNAS  656
               K +++L  SC + + +IILQAN++ SY A LSLT L+C +G L+ +++ LI+ER N S
Sbjct  182   TGKGSIMLVASCFTWSCYIILQANILNSYQAELSLTALMCCMGMLEATVMALILERNNMS  241

Query  655   VWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLS  476
              W +  DM LL  +Y GLV SG  YYI G   K +GPVFV+AFNPLSMV+VAI+ SF+  
Sbjct  242   AWKIHPDMRLLASIYGGLV-SGLSYYITGWASKERGPVFVSAFNPLSMVIVAILSSFIFL  300

Query  475   EKLYMgrvlgavvvlvglylviwGKSKDQTS---PDNNDALPIDHKQPQVVQGFNKDITV  305
             EK+Y+GRV+G+VV+++G+YLV+WGKSK++     P    A  +   + Q V   + +  V
Sbjct  301   EKMYIGRVVGSVVIVIGIYLVLWGKSKEKVGNLLPKAGCAGTVVKLEEQKVLTHDNNQVV  360

Query  304   SLN*KVELPRS  272
               + K+ +P++
Sbjct  361   HKSDKIMIPKA  371



>ref|XP_009121742.1| PREDICTED: WAT1-related protein At5g13670 [Brassica rapa]
Length=407

 Score =   279 bits (713),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 170/373 (46%), Positives = 242/373 (65%), Gaps = 5/373 (1%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
               A+P++ ++F+Q   A  +I++K ALNQGM+P     YR A+AA +  PFAL LER +R
Sbjct  33    EKARPFMAIVFIQFLYALMSIVAKIALNQGMSPHVLVAYRMAVAAALITPFALVLERNSR  92

Query  1186  PTMTTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P +T  IF +I +L      +  NLYY GM+ TTAT +  + N +PAMTF++A IF+LEK
Sbjct  93    PRLTFKIFLQISILSLFEPVVEQNLYYSGMKLTTATFTSALCNALPAMTFIMACIFKLEK  152

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             V IR  HSQAK+VGT  AIGGAM+MT  KG +I LPWT     ++  +      +  +  
Sbjct  153   VNIRRRHSQAKLVGTMVAIGGAMLMTFFKGNVIELPWTSKPMGIIGQAHSMNTPKQEDIG  212

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
             K +++L  SC S + +IILQAN++ +Y A LSLT L+C +G L+ S++ LI ER N SVW
Sbjct  213   KGSVMLVASCFSWSCYIILQANILNTYNAELSLTALMCIMGMLEASVIALIWERKNMSVW  272

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
              +  DM LL  +Y GLV SG  YY  G   K +GPVFV+AFNPLSMV+VA + SFV  EK
Sbjct  273   KIHPDMKLLASIYGGLV-SGLAYYAIGWASKKRGPVFVSAFNPLSMVIVARLSSFVFLEK  331

Query  469   LYMgrvlgavvvlvglylviwGKSKD---QTSPDNNDALPIDHKQPQVVQGFNKDITVSL  299
             LY+GRV+G+VV++ G+YLV+WGKSKD   Q S +   A  +     Q+V+  + +  + +
Sbjct  332   LYLGRVVGSVVIVFGVYLVLWGKSKDKIEQPSTNAGCAETVVKTDEQMVRTLDNNQVLPI  391

Query  298   N*KVELPRSHPHD  260
             + ++ +P++  H 
Sbjct  392   HDQLMIPKAVTHS  404



>gb|AAM62850.1| nodulin-like protein [Arabidopsis thaliana]
Length=362

 Score =   277 bits (709),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 170/344 (49%), Positives = 239/344 (69%), Gaps = 12/344 (3%)
 Frame = -3

Query  1333  LQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPTMTTSIFFKI  1154
             LQV  AG  ILSKA LN+GM+ +    YR+A+A ++ APFA + ++K RP MT  IFFKI
Sbjct  4     LQVGLAGMDILSKAVLNKGMSNYVLVVYRHAVATIVMAPFAFYFDKKVRPKMTLMIFFKI  63

Query  1153  -VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVKIRNLHSQAK  977
              +L  L   ++ NLYY+GM+YTTAT +  M N++PA+TF+LA+IF LE+VK+R + S  K
Sbjct  64    SLLGLLEPVIDQNLYYLGMKYTTATFATAMYNVLPAITFVLAYIFGLERVKLRCIRSTGK  123

Query  976   IVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKATLLLAGSCC  797
             +VGT + +GGAMIMTLVKGP++ L WTK    V +H+     + HS  IK  +L+   C 
Sbjct  124   VVGTLATVGGAMIMTLVKGPVLDLFWTK---GVSAHNTAGT-DIHS-AIKGAVLVTIGCF  178

Query  796   STAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSLQWDMTLLTY  617
             S A F+ILQA  +++YPA LSLT  IC +G+++ + + L++E+GN S W++ WD  LLT 
Sbjct  179   SYACFMILQAITLRTYPAELSLTAWICLMGTIEGTAVALVMEKGNPSAWAIGWDTKLLTA  238

Query  616   VYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLYMgrvlgavv  437
              Y G+V S   YY+ G++MK +GPVFVTAF+PL M++VAI+ + + +E++Y+GRVLGAVV
Sbjct  239   TYSGIVCSALAYYVGGVVMKTRGPVFVTAFSPLCMIIVAIMSTIIFAEQMYLGRVLGAVV  298

Query  436   vlvglylviwGKSKDQTSPDNNDALPIDHK--QPQV-VQGFNKD  314
             +  GLYLVIWGK KD      N  L +D K  QP++ + G  KD
Sbjct  299   ICAGLYLVIWGKGKDY---KYNSTLQLDDKSAQPKLELSGNGKD  339



>ref|XP_003537193.1| PREDICTED: WAT1-related protein At2g37460-like isoform 1 [Glycine 
max]
Length=379

 Score =   278 bits (711),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 164/335 (49%), Positives = 236/335 (70%), Gaps = 7/335 (2%)
 Frame = -3

Query  1357  KPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPTM  1178
             KP+  V+ +Q   A   +LSKAA+N+GM+ + F  YR+A+A  + AP A F ++K RP M
Sbjct  11    KPFAAVVSIQFGYAAMDVLSKAAMNKGMSNYVFVVYRHAVAFFVMAPLAWFFDKKVRPKM  70

Query  1177  TTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVKI  1001
             T SIF KI VL  +   ++ NLY++GM+YTTAT +VT+ N++PA+TF+ A I RLEK+KI
Sbjct  71    TFSIFMKIAVLSWIEPVIDQNLYFLGMKYTTATFAVTITNMLPAITFIFACILRLEKIKI  130

Query  1000  RNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKAT  821
             R++ SQAK+VGT + + GAM+MTL+KGP++    +  SND   HS QH      + I   
Sbjct  131   RSIRSQAKVVGTLTTVSGAMVMTLLKGPVLF--GSHGSND---HS-QHNGTSMRHTITGF  184

Query  820   LLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSLQ  641
             +L+   C   A F+ILQA  +K+YPA LSL+  IC +G+L+ + + +I+ERGN SVWSL+
Sbjct  185   ILITIGCFCWACFVILQATTLKTYPAELSLSAWICLMGTLEGAAVAMIMERGNPSVWSLK  244

Query  640   WDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLYM  461
              DM LL  VY G+V SG  YY+ G++MK +GPVFVTAF+PL MV+VA++  F+L+E++++
Sbjct  245   LDMKLLCAVYSGIVCSGMSYYLQGVVMKTRGPVFVTAFSPLCMVIVAVMSYFILAEQVFL  304

Query  460   grvlgavvvlvglylviwGKSKDQTSPDNNDALPI  356
             GRV+GAV++ +GLY V+WGKSKD +    N   PI
Sbjct  305   GRVIGAVIICLGLYAVVWGKSKDCSPRSPNTQEPI  339



>ref|XP_010419331.1| PREDICTED: LOW QUALITY PROTEIN: WAT1-related protein At2g37450-like 
[Camelina sativa]
Length=382

 Score =   278 bits (711),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 170/354 (48%), Positives = 234/354 (66%), Gaps = 10/354 (3%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
               A P+L ++FLQV  AG  IL+K  LN+GM+ +  + YR+ +A V+ APFAL+ +R  R
Sbjct  12    KKAIPFLLMVFLQVGLAGMDILTKDVLNKGMSIYVLAVYRHGVATVVMAPFALYFDRTVR  71

Query  1186  PTMTTSIFFKIVllalleqlnlnLYYV-GMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT  IFFKI LL LLE +     ++ GM+YTTAT +  + N +PA+TF+LA IFRLEK
Sbjct  72    PKMTLMIFFKITLLGLLEPVIDQNLFILGMKYTTATFATALYNTLPAITFILALIFRLEK  131

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQ--HSN  836
             VKIRN+ S AK+VGT + +GG M+MTLVKGP + L WTK        SAQ+      HS+
Sbjct  132   VKIRNIRSAAKVVGTLTTVGGTMMMTLVKGPALDLFWTK------GPSAQNTTGTDIHSS  185

Query  835   PIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNAS  656
              IK  +L+   C S A F+ILQA  +K+YPA LSL T IC +G+++ +++ L++E+GN +
Sbjct  186   -IKGAILVTIGCFSYACFMILQAITLKTYPAELSLATWICLMGTVEGAVVALVIEKGNPA  244

Query  655   VWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLS  476
              W++ WD  LLT  Y G++ S   YYI G++MK +GPVFVTAF PL M +VAI  S + +
Sbjct  245   AWAIGWDNKLLTVTYSGIMCSALGYYIGGVVMKTRGPVFVTAFKPLCMXVVAIKSSIIFA  304

Query  475   EKLYMgrvlgavvvlvglylviwGKSKDQTSPDNNDALPIDHKQPQVVQGFNKD  314
             E++Y+GR LGA ++  GLYLVIWGK+KD   P          K+  +V G  KD
Sbjct  305   EQMYLGRALGAAIICAGLYLVIWGKAKDYKHPFTPQVDDDVAKENTIVSGNTKD  358



>ref|XP_009141663.1| PREDICTED: WAT1-related protein At2g37460 [Brassica rapa]
Length=370

 Score =   277 bits (709),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 171/359 (48%), Positives = 244/359 (68%), Gaps = 13/359 (4%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
               A+P++ ++ LQV  AG  ILSKA LN+GM+ +    YR+A+A V+ APFAL+ ++K R
Sbjct  11    EKARPFISMVLLQVGLAGMDILSKAVLNKGMSNYVLVVYRHAVATVVMAPFALYFDKKVR  70

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT  IFFKI LL LLE  ++ NLYY+GM+YTTAT +  M N++PA+TF+LA+IF LE+
Sbjct  71    PEMTLMIFFKITLLGLLEPVIDQNLYYLGMKYTTATFATAMYNVLPAITFVLAYIFGLER  130

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             VK+R + S  K++GT + +GGAMIMTLVKGP++ L WTK    V S       + HS  I
Sbjct  131   VKLRCIRSAGKVIGTLATVGGAMIMTLVKGPVLDLFWTK----VASAQNTDGTDIHS-AI  185

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
             K  +L+   C S A F+ILQA  +++YPA LSLT  IC +G+++ + + L++E+GN   W
Sbjct  186   KGAVLVTIGCFSYACFMILQAVTLRTYPAELSLTAWICLMGTIEGTAVALVMEKGNPGAW  245

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
             ++ WD  LLT  Y G+V S   YY+ G +MK + PVFVTAF+PL M++VAI+ + + +E+
Sbjct  246   AIGWDTKLLTSTYSGIVCSAIAYYVGGPVMKTRCPVFVTAFSPLCMIIVAIMSTVIFAEQ  305

Query  469   LYMgrvlgavvvlvglylviwGKSKD---QTSPDNNDALPIDHKQPQVVQGFNKDITVS  302
             +Y+GRVLGA V+  GLYLVIWGK KD    + P  ND    +  QP++    N + +V+
Sbjct  306   MYLGRVLGAAVICAGLYLVIWGKGKDYEFSSMPQLND----ESTQPKLELSRNGEDSVN  360



>gb|KHN05928.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=379

 Score =   278 bits (710),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 163/335 (49%), Positives = 236/335 (70%), Gaps = 7/335 (2%)
 Frame = -3

Query  1357  KPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPTM  1178
             KP+  V+ +Q   A   +LSKAA+N+GM+ + F  YR+A+A  + AP A F ++K RP M
Sbjct  11    KPFAAVVSIQFGYAAMDVLSKAAMNKGMSNYVFVVYRHAVAFFVMAPLAWFFDKKVRPKM  70

Query  1177  TTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVKI  1001
             T SIF KI VL  +   ++ NLY++GM+YTTAT +VT+ N++PA+TF+ A I RLEK+KI
Sbjct  71    TLSIFMKIAVLSWIEPVIDQNLYFLGMKYTTATFAVTITNMLPAITFIFACILRLEKIKI  130

Query  1000  RNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKAT  821
             R++ SQAK+VGT + + GAM+MTL+KGP++    +  SND   HS QH      + I   
Sbjct  131   RSIRSQAKVVGTLTTVSGAMVMTLLKGPVLF--GSHGSND---HS-QHNGTSMRHTITGF  184

Query  820   LLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSLQ  641
             +L+   C   A F+ILQA  +K+YPA LSL+  IC +G+++ + + +I+ERGN SVWSL+
Sbjct  185   ILITIGCFCWACFVILQATTLKTYPAELSLSAWICLMGTIEGAAVAMIMERGNPSVWSLK  244

Query  640   WDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLYM  461
              DM LL  VY G+V SG  YY+ G++MK +GPVFVTAF+PL MV+VA++  F+L+E++++
Sbjct  245   LDMKLLCAVYSGIVCSGMSYYLQGVVMKTRGPVFVTAFSPLCMVIVAVMSYFILAEQVFL  304

Query  460   grvlgavvvlvglylviwGKSKDQTSPDNNDALPI  356
             GRV+GAV++ +GLY V+WGKSKD +    N   PI
Sbjct  305   GRVIGAVIICLGLYAVVWGKSKDCSPRSPNTQEPI  339



>emb|CDY09817.1| BnaC09g43440D [Brassica napus]
Length=345

 Score =   276 bits (706),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 166/337 (49%), Positives = 228/337 (68%), Gaps = 6/337 (2%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
               A+P++ ++F+Q   A  +I++K ALNQGM+P     YR A+AA +  PFAL LER +R
Sbjct  4     EKARPFMAIVFIQFLYALMSIVAKIALNQGMSPHVLVAYRMAVAAALITPFALVLERNSR  63

Query  1186  PTMTTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P +T  I  +I +L      +  NLYY GM+ TTAT +  + N +PAMTF++A IF+LEK
Sbjct  64    PRLTFKILLQISILSLFEPVVEQNLYYSGMKLTTATFTSALCNALPAMTFIMACIFKLEK  123

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLN--QHSN  836
             V I+  HSQAK+VGT  AIGGAM+MT  KG +I LPWT     ++  S  H +N  +  +
Sbjct  124   VNIKRRHSQAKLVGTMVAIGGAMLMTFFKGNVIELPWTSKPWGIIGQS--HAMNTPKQED  181

Query  835   PIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNAS  656
               K +++L  SC S + +IILQAN++ +Y A LSLT L+C +G L+ S++ LI ER N S
Sbjct  182   VGKGSVMLVASCFSWSCYIILQANILNTYNAELSLTALMCIMGMLEASVIALIWERKNMS  241

Query  655   VWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLS  476
             VW +  DM LL  +Y GLV SG  YY  G   K +GPVFV+AFNPLSMV+VAI+ SFV  
Sbjct  242   VWKIHPDMKLLASIYGGLV-SGLAYYAIGWASKKRGPVFVSAFNPLSMVIVAILSSFVFL  300

Query  475   EKLYMgrvlgavvvlvglylviwGKSKDQTSPDNNDA  365
             EKLY+GRV+G+VV++ G+YLV+WGKSKD+    + +A
Sbjct  301   EKLYLGRVVGSVVIVFGVYLVLWGKSKDKIEQPSTNA  337



>ref|XP_006399861.1| hypothetical protein EUTSA_v10013837mg [Eutrema salsugineum]
 gb|ESQ41314.1| hypothetical protein EUTSA_v10013837mg [Eutrema salsugineum]
Length=377

 Score =   277 bits (709),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 166/347 (48%), Positives = 232/347 (67%), Gaps = 10/347 (3%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
               A+P++ ++F+Q   A  +I++K ALN+GM+P     YR A+A+ +  PFAL LER +R
Sbjct  4     GKARPFMAIVFIQCLYALMSIVAKLALNEGMSPHVLVAYRMAVASALITPFALVLERNSR  63

Query  1186  PTMTTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT  I F+I +L      +  NLYY GM+ TTAT +  + N +PAMTF++A IF+LEK
Sbjct  64    PKMTFKILFRISILSLFEPVVEQNLYYSGMKLTTATFTSALCNALPAMTFIMACIFKLEK  123

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLN--QHSN  836
             V I+  HSQAK+VGT  A+GGAM+MT VKG  I LPWT  S      S  H +N  +  +
Sbjct  124   VNIKRRHSQAKLVGTMVAVGGAMLMTFVKGNAIDLPWTSKSRGFTGQS--HAMNTPKQDD  181

Query  835   PIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNAS  656
               + +++L  SC S + FIILQAN++  Y A LSLT L+C +G L+ +++ LI+ER + S
Sbjct  182   IGRGSVMLVASCLSWSCFIILQANILSLYQAELSLTALMCFMGMLEATVMALILEREDMS  241

Query  655   VWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLS  476
             VW +  DM LL  +Y GLV SG  YY+ G   K +GPVFV+AFNPLSMVLVAI+ SF+  
Sbjct  242   VWKIHPDMRLLASIYGGLV-SGLAYYVIGWASKERGPVFVSAFNPLSMVLVAILSSFIFL  300

Query  475   EKLYMgrvlgavvvlvglylviwGKSKDQTSPDN----NDALPIDHK  347
             EK+Y+GRVLG+VV+++G+Y+V+WGKSKD+    N       + ID +
Sbjct  301   EKMYLGRVLGSVVIVIGIYMVLWGKSKDKGGQPNAGCAESVIKIDEQ  347



>ref|XP_002873622.1| nodulin MtN21 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49881.1| nodulin MtN21 family protein [Arabidopsis lyrata subsp. lyrata]
Length=379

 Score =   277 bits (709),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 165/368 (45%), Positives = 244/368 (66%), Gaps = 5/368 (1%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
               A+P++ ++F+Q   A  +I++K ALN GM+P     YR A+A+ +  PFAL LER +R
Sbjct  4     ERARPFIAIVFIQCLYALMSIVAKLALNAGMSPHVLVAYRMAVASALITPFALVLERNSR  63

Query  1186  PTMTTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT  I  +I +L      +  NLYY GM+ TTAT +  + N +PAMTF++A +F+LEK
Sbjct  64    PRMTFKILLQIAILSLFEPVVEQNLYYSGMKLTTATFTSALCNALPAMTFIMACVFKLEK  123

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             V I   HSQAK+VGT  AIGGAM+MT VKG +I+LPWT +S  + +HS   ++ +  +  
Sbjct  124   VTIERRHSQAKLVGTVVAIGGAMLMTFVKGNVIVLPWTSNSRGLDAHSHAMMIPKQEDIA  183

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
             + +++L  SC S + +IILQA ++  Y A LSLT L+C +G L+ +++ L+ ER N SVW
Sbjct  184   RGSIMLVASCFSWSCYIILQAKILAQYQAELSLTALMCIMGMLEATVMGLLWERKNMSVW  243

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
              +  D+TLL  +Y GLV SG  YY+ G   K +GPVFV+AFNPLSMVLVAI+ +F+  EK
Sbjct  244   KINPDVTLLASIYGGLV-SGLAYYVIGWASKERGPVFVSAFNPLSMVLVAILSTFIFMEK  302

Query  469   LYMgrvlgavvvlvglylviwGKSKD---QTSPDNNDALPIDHKQPQVVQGFNKDITVSL  299
             +Y+GRV+G+VV+++G+YLV+WGKSKD   +  P+   A  +     Q V   + +  VS 
Sbjct  303   MYLGRVVGSVVIVIGIYLVLWGKSKDKGGKLQPNTGCAETVVKIDQQKVPTPDNNKVVST  362

Query  298   N*KVELPR  275
             + ++ +P+
Sbjct  363   SYQLMIPK  370



>ref|XP_009125930.1| PREDICTED: WAT1-related protein At5g13670-like [Brassica rapa]
Length=379

 Score =   277 bits (708),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 148/305 (49%), Positives = 204/305 (67%), Gaps = 6/305 (2%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
               A+P++ ++F+Q   A  +I++K ALNQGM+P     YR A+AA +  PFAL LER +R
Sbjct  4     QKARPFIAIVFIQFLYALMSIVAKLALNQGMSPHVLVAYRMAVAAALITPFALILERNSR  63

Query  1186  PTMTTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P +T  I F+I +L      +  NLYY GM+ TTAT +  + N +PA+TF++A IF+LEK
Sbjct  64    PRLTFKILFQISILSLFEPVVEQNLYYSGMKLTTATFTSALCNALPAITFIMACIFKLEK  123

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLN--QHSN  836
             V I+  HSQAK+ GT  AIGGAM+MT VKG +I LPWT  S      S  HV+N  +  +
Sbjct  124   VNIKRRHSQAKLAGTMVAIGGAMLMTFVKGNVIELPWTSKSRSYNGQS--HVMNTPKQED  181

Query  835   PIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNAS  656
               K +++L  SC + + +IILQAN++ SY A LSLT L+C +G L+ +++ LI+ER N S
Sbjct  182   TGKGSIMLVASCFTWSCYIILQANILNSYQAELSLTALMCCMGMLEATVMALILERNNMS  241

Query  655   VWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLS  476
              W +  DM LL  +Y GLV SG  YYI G   K +GPVFV+AFNPLSMV+VAI+ SF+  
Sbjct  242   AWKIHPDMRLLASIYGGLV-SGLSYYITGWASKERGPVFVSAFNPLSMVIVAILSSFIFL  300

Query  475   EKLYM  461
             EK+Y+
Sbjct  301   EKMYI  305



>emb|CDX91104.1| BnaC02g04930D [Brassica napus]
Length=379

 Score =   276 bits (707),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 169/371 (46%), Positives = 244/371 (66%), Gaps = 9/371 (2%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
               A+P++ ++F+Q   A  +I++K ALN+GM+P     YR A+A+ +  PFAL LER +R
Sbjct  4     QKARPFIAIVFIQFLYALMSIVAKLALNEGMSPHVLVAYRMAVASALITPFALVLERNSR  63

Query  1186  PTMTTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P +T  I F+I +L      +  NLYY GM+ TTAT +  + N +PA+TF++A IF+LEK
Sbjct  64    PRLTFKILFQISILSLFEPVVEQNLYYSGMKLTTATFTSALCNALPAITFIMACIFKLEK  123

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLN--QHSN  836
             V I+  HSQAK+VGT  AIGGAM+MT VKG +I LPWT  S      S  HV+N  +  +
Sbjct  124   VNIKRRHSQAKLVGTMVAIGGAMLMTFVKGNVIELPWTSKSRSYNGQS--HVMNTPKQED  181

Query  835   PIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNAS  656
               K +++L  SC + + +IILQAN++ SY A LSLT L+C +G L+ +++ LI+ER N S
Sbjct  182   TGKGSIMLVASCFTWSCYIILQANILNSYQAELSLTALMCCMGMLEATVMALILERNNMS  241

Query  655   VWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLS  476
              W +  DM LL  +Y GLV SG  YYI G   K +GPVFV+AFNPLSMV+VAI+ SF+  
Sbjct  242   AWKIHPDMRLLASIYGGLV-SGLSYYITGWASKERGPVFVSAFNPLSMVIVAILSSFIFL  300

Query  475   EKLYMgrvlgavvvlvglylviwGKSKDQTS---PDNNDALPIDHKQPQVVQGFNKDITV  305
             EK+Y+GRV G+VV+++G+YLV+WGKSK++     P    A  +   + Q V   + +  V
Sbjct  301   EKMYIGRVDGSVVIVIGIYLVLWGKSKEKVGNLLPKAGCAGTVVKLEEQKVLTHDNNQVV  360

Query  304   SLN*KVELPRS  272
               + K+ +P++
Sbjct  361   HKSDKIMIPKA  371



>gb|KGN51272.1| hypothetical protein Csa_5G505820 [Cucumis sativus]
Length=376

 Score =   275 bits (704),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 177/345 (51%), Positives = 226/345 (66%), Gaps = 7/345 (2%)
 Frame = -3

Query  1372  LNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERK  1193
             L + AKPY+ V+  Q  +AG  I+SK ALNQG+N      YR  IA ++ APFA   ERK
Sbjct  7     LLSQAKPYIAVILQQFITAGMVIISKFALNQGLNQHVLVVYRYTIATIVVAPFAFVFERK  66

Query  1192  TRPTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRL  1016
              RP MT SIF K+VLL LLE  L+ NLYY GM+YTTAT +  M N+ P + FL+AW+ RL
Sbjct  67    VRPKMTWSIFGKVVLLGLLEPALDQNLYYTGMKYTTATFASAMTNMAPGLVFLMAWVARL  126

Query  1015  EKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSN  836
             EKV +R L SQAKI+GT  A+GGAMIMT V+GPI+ LPWT H  ++  HS     NQ  +
Sbjct  127   EKVDVRQLSSQAKILGTVVAVGGAMIMTAVRGPILNLPWTNH--NLHDHSTTAA-NQQ-D  182

Query  835   PIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNAS  656
              +K +L++   C   ++F +LQA  IK YPA LSLT  IC  G++Q S++   +E    +
Sbjct  183   LLKGSLMILIGCIFWSVFNVLQAITIKVYPAQLSLTAWICFTGAVQASVIAFAMEGHKPA  242

Query  655   VWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLS  476
              WSL  D TLL  +Y G++ SG  Y I   +MK KGPVF + F+PLSMV+VAII SF LS
Sbjct  243   AWSLHLDSTLLAPLYSGIMSSGVSYTIQAAVMKTKGPVFSSTFSPLSMVIVAIISSFALS  302

Query  475   EKLYMgrvlgavvvlvglylviwGKSKDQT--SPDNNDALPIDHK  347
             E LY GRV+GA V++ GLYLV+WGK KDQ     D+    P D K
Sbjct  303   EILYFGRVIGAAVIITGLYLVLWGKIKDQALYKLDSEKMAPSDQK  347



>ref|XP_010999362.1| PREDICTED: WAT1-related protein At4g08290 isoform X1 [Populus 
euphratica]
Length=363

 Score =   274 bits (701),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 158/346 (46%), Positives = 234/346 (68%), Gaps = 14/346 (4%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             N   PY+ ++ +Q  SAG+ ILS  +LN+GMN +    YRN +AA++ APFAL LERKTR
Sbjct  15    NKMTPYILMVCVQFGSAGNYILSMISLNRGMNRYVLIVYRNGVAALVLAPFALLLERKTR  74

Query  1186  PTMTTSIFFKIVllalleqlnlnLY-YVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P +T  IF +I+ L  LE +    + Y+GM+YT+A+ +  ++N +P++TF++A IFRLE+
Sbjct  75    PKITLPIFLRIMALGFLEPILDQGFSYLGMQYTSASFTSAIMNAVPSVTFVIALIFRLER  134

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             V+I+ + SQAK+VGT   +GGA++MT+ KGP+I LPW++ ++   S +A    ++H   +
Sbjct  135   VRIKEIRSQAKVVGTLVTLGGALLMTVYKGPVIGLPWSQKTSQHGSTAASS--DKHW--V  190

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
               TLLL   C S + F +LQ   +K YPA LSL +LIC  GS+Q   + L+V   + S W
Sbjct  191   TGTLLLLVGCVSWSAFYVLQMETLKKYPAELSLASLICLAGSMQSLAIALVVAH-HPSSW  249

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
             ++ WD  L T +Y G+V SG  YY+ G++MK +GPVFVTAFNPL M++VA +GS +L+EK
Sbjct  250   AVGWDTRLFTPLYTGIVASGVTYYVQGLVMKTRGPVFVTAFNPLCMIIVAALGSLILAEK  309

Query  469   LYMgrvlgavvvlvglylviwGKSKDQTSPDN--------NDALPI  356
             L++G VLG +++ +GLY V+WGK KD  SP++        N  LPI
Sbjct  310   LHLGSVLGGIIIAIGLYSVVWGKRKDYASPEDLSTTAAKGNQELPI  355



>ref|XP_004149823.1| PREDICTED: auxin-induced protein 5NG4-like, partial [Cucumis 
sativus]
 ref|XP_004166635.1| PREDICTED: auxin-induced protein 5NG4-like, partial [Cucumis 
sativus]
Length=384

 Score =   275 bits (703),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 177/345 (51%), Positives = 226/345 (66%), Gaps = 7/345 (2%)
 Frame = -3

Query  1372  LNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERK  1193
             L + AKPY+ V+  Q  +AG  I+SK ALNQG+N      YR  IA ++ APFA   ERK
Sbjct  15    LLSQAKPYIAVILQQFITAGMVIISKFALNQGLNQHVLVVYRYTIATIVVAPFAFVFERK  74

Query  1192  TRPTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRL  1016
              RP MT SIF K+VLL LLE  L+ NLYY GM+YTTAT +  M N+ P + FL+AW+ RL
Sbjct  75    VRPKMTWSIFGKVVLLGLLEPALDQNLYYTGMKYTTATFASAMTNMAPGLVFLMAWVARL  134

Query  1015  EKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSN  836
             EKV +R L SQAKI+GT  A+GGAMIMT V+GPI+ LPWT H  ++  HS     NQ  +
Sbjct  135   EKVDVRQLSSQAKILGTVVAVGGAMIMTAVRGPILNLPWTNH--NLHDHSTTAA-NQQ-D  190

Query  835   PIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNAS  656
              +K +L++   C   ++F +LQA  IK YPA LSLT  IC  G++Q S++   +E    +
Sbjct  191   LLKGSLMILIGCIFWSVFNVLQAITIKVYPAQLSLTAWICFTGAVQASVIAFAMEGHKPA  250

Query  655   VWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLS  476
              WSL  D TLL  +Y G++ SG  Y I   +MK KGPVF + F+PLSMV+VAII SF LS
Sbjct  251   AWSLHLDSTLLAPLYSGIMSSGVSYTIQAAVMKTKGPVFSSTFSPLSMVIVAIISSFALS  310

Query  475   EKLYMgrvlgavvvlvglylviwGKSKDQT--SPDNNDALPIDHK  347
             E LY GRV+GA V++ GLYLV+WGK KDQ     D+    P D K
Sbjct  311   EILYFGRVIGAAVIITGLYLVLWGKIKDQALYKLDSEKMAPSDQK  355



>ref|XP_002284452.2| PREDICTED: WAT1-related protein At4g08290 [Vitis vinifera]
 emb|CBI19039.3| unnamed protein product [Vitis vinifera]
Length=382

 Score =   275 bits (703),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 168/347 (48%), Positives = 237/347 (68%), Gaps = 15/347 (4%)
 Frame = -3

Query  1357  KPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPTM  1178
             KPY+ ++ LQ  SAG  I+S A LN GM+ F    YRNA+AA+  APFAL LERK RP +
Sbjct  18    KPYVLMVALQFGSAGMYIISMATLNHGMSRFVLIVYRNAVAALAMAPFALLLERKIRPKI  77

Query  1177  TTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVKI  1001
             T +IF KI+ L  LE  L+ NL Y+GM+YT+A+ +  ++N +PA+TF++A +FRLE +KI
Sbjct  78    TIAIFLKIMALGFLEPILDQNLSYLGMQYTSASFTSAVMNAVPAVTFVMAVVFRLEHIKI  137

Query  1000  RNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKAT  821
             +   SQAKIVGT     GA++MTL KGPII L W+  +    SH+A H  +  ++ I  T
Sbjct  138   KERRSQAKIVGTVLTFSGALLMTLYKGPIIDLIWSHKT----SHNANHS-STDTHWITGT  192

Query  820   LLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSLQ  641
             LL+   CC+ + F ILQ+  IK+YPA LSL+TLIC +G++Q   + L+ ER + S W++ 
Sbjct  193   LLILVGCCAWSAFYILQSITIKTYPAELSLSTLICLMGAIQSGAVGLVAER-HPSAWAIG  251

Query  640   WDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLYM  461
             WD  LL  VY G+V SG  YY+ G++MK +GPVFVTAFNPL M++VA +G+ +L+E+L++
Sbjct  252   WDSRLLAPVYTGIVSSGLTYYVQGLVMKTRGPVFVTAFNPLCMIIVAALGTLILAEQLHL  311

Query  460   grvlgavvvlvglylviwGKSKDQTSP------DNNDA--LPIDHKQ  344
             G ++GA+++ +GLY V WGKSKDQ  P      +  DA  LPI   +
Sbjct  312   GSIIGAIIIAIGLYSVAWGKSKDQFGPTPTTTEEKGDAYELPISATE  358



>ref|XP_010939363.1| PREDICTED: WAT1-related protein At1g21890 isoform X1 [Elaeis 
guineensis]
Length=371

 Score =   275 bits (702),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 163/338 (48%), Positives = 224/338 (66%), Gaps = 10/338 (3%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             + AKPYL ++FLQV  AG  ++S A+L +GMN +    YRNA+A    APFAL+ ERK R
Sbjct  8     SKAKPYLAMVFLQVGYAGMYVISVASLKRGMNHYVLVVYRNAVAVAAIAPFALWFERKVR  67

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT SIF K + LALLE  L+ N YYVG   T+A  +  + N++PA+TFL+A + R+EK
Sbjct  68    PKMTLSIFLKTMALALLEPVLDQNFYYVGANLTSAGFASALFNILPAITFLMAIVLRMEK  127

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTK---HSNDVVSHSAQHVLNQHS  839
             V +R   SQAK+VGT   + GA++M L KGP++   W+K   H N  V H         S
Sbjct  128   VNLRQRRSQAKLVGTIVTVAGAVLMILYKGPVLDFVWSKGRSHQNTAVGH------QNSS  181

Query  838   NPIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNA  659
             N +K TL+L   C   + F ILQ+N I SYPA L+LTTLIC +G+L  S++ L+ ERG+A
Sbjct  182   NWLKGTLMLLSGCFCWSCFFILQSNTIDSYPAELTLTTLICLMGALMGSLVALVAERGSA  241

Query  658   SVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVL  479
               W + WD  LL  VY G++ SG  YY+ G +MK +GPVFVTAFNPL M++ A++GS VL
Sbjct  242   KPWIIGWDTRLLAAVYSGVICSGVAYYMQGKVMKERGPVFVTAFNPLCMIITAVLGSIVL  301

Query  478   SEKLYMgrvlgavvvlvglylviwGKSKDQTSPDNNDA  365
             +E + +G V+GAV +++GLY +IWGKSKD  +  +  +
Sbjct  302   AEDITLGSVIGAVFIVIGLYSLIWGKSKDHLNQRSQSS  339



>ref|XP_010553301.1| PREDICTED: WAT1-related protein At2g37460-like [Tarenaya hassleriana]
Length=388

 Score =   275 bits (703),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 172/360 (48%), Positives = 242/360 (67%), Gaps = 10/360 (3%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
               A+PY+ V+ LQV  AG  ILSKA LN GM+ +    YR+ +A +   PFA + ++K R
Sbjct  11    EKARPYISVVLLQVGLAGMDILSKAVLNIGMSNYVLVVYRHVVATLAILPFAFYFDKKVR  70

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
               MT  +F  ++LL LLE  ++ NLYY+GM+YTTAT +  M N++PA+TF+LA+IFRLE+
Sbjct  71    TKMTMRVFINVMLLGLLEPVIDQNLYYLGMKYTTATFASAMYNVLPAITFVLAYIFRLER  130

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             VK+R + S AKI+GTA+ + GAM+MTLVKGP++ L WTK ++     +A    + HS  I
Sbjct  131   VKLRCVRSAAKILGTAATVSGAMMMTLVKGPVLHLFWTKGASTNDGGTAGT--DIHS-AI  187

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
             K  +L+   C S A F+ILQA  +K+YPA LSLT  IC +G+++ + + L++E+GN  VW
Sbjct  188   KGAVLITIGCFSYACFMILQAITLKTYPAELSLTAWICLMGTIEGTAVALVMEKGNPGVW  247

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
              + WD  LLT  Y G+V S   YYI G++MK +GPVFVTAFNPL MV+VA + S + +E+
Sbjct  248   VIGWDTKLLTATYSGIVCSALAYYIGGVVMKSRGPVFVTAFNPLCMVIVAFMSSVIFAEQ  307

Query  469   LYMgrvlgavvvlvglylviwGKSKDQTSPDNNDALPIDHK--QPQVVQGFNKDITVSLN  296
             +Y+GRVLGA+V+ VGLY V+WGK KD   P      PID +  Q +   G N+D  + L 
Sbjct  308   MYLGRVLGALVICVGLYFVLWGKGKDYGYPST----PIDGEPSQGKPEMGGNRDGRLDLE  363



>ref|XP_008461649.1| PREDICTED: WAT1-related protein At2g39510-like isoform X1 [Cucumis 
melo]
Length=388

 Score =   275 bits (703),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 168/347 (48%), Positives = 230/347 (66%), Gaps = 14/347 (4%)
 Frame = -3

Query  1390  ERVVKWLNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFA  1211
             E  V+++ + AKPY GV+F+Q   AG  IL+K+AL++GM+   F  YR   A ++ APFA
Sbjct  2     ESFVRFMRS-AKPYFGVIFVQFGYAGMTILTKSALDKGMSQHVFVAYRQVAATLVIAPFA  60

Query  1210  LFLER----------KTRPTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTML  1064
             +  ER          K R  MT S+ FKI+LL  LE  ++ NL+Y GM+YTTAT +  M 
Sbjct  61    IIFERLSVFGVFACRKARTKMTFSLLFKILLLGFLEPVIDQNLFYTGMKYTTATFAAAMC  120

Query  1063  NLIPAMTFLLAWIFRLEKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSN  884
             N++PA  FL+AW  RLEKV I    SQAKI+GT   +GGAMIMT +KGP++ LPW+K  N
Sbjct  121   NVLPAFVFLMAWACRLEKVNIMKRGSQAKILGTIVTVGGAMIMTFIKGPMLHLPWSKLPN  180

Query  883   D--VVSHSAQHVLNQHSNPIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTI  710
                  S S+      H N I   L+L   C   A FI LQA  +K YPA LSLT LIC +
Sbjct  181   HPSASSSSSSAASTDHQNQIIGFLMLTTGCICWAAFITLQAITLKEYPAELSLTALICLV  240

Query  709   GSLQCSILTLIVERGNASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTA  530
             G++  S + L++ERGN S W+L +D  LL  VY G++ SG  YYI G++M+ KGPVF +A
Sbjct  241   GTIGGSGVALVIERGNPSAWALHFDRQLLAVVYSGVICSGVTYYIQGVVMQTKGPVFFSA  300

Query  529   FNPLSMVLVAIIGSFVLSEKLYMgrvlgavvvlvglylviwGKSKDQ  389
             FNPL+MVLVAI+  F+LSE +++GR++G V+++ GLY+V+WGK++DQ
Sbjct  301   FNPLAMVLVAIMSFFILSEIMFLGRMIGVVIIICGLYMVLWGKTRDQ  347



>ref|XP_007144467.1| hypothetical protein PHAVU_007G158600g [Phaseolus vulgaris]
 gb|ESW16461.1| hypothetical protein PHAVU_007G158600g [Phaseolus vulgaris]
Length=377

 Score =   274 bits (701),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 164/350 (47%), Positives = 243/350 (69%), Gaps = 10/350 (3%)
 Frame = -3

Query  1399  MRNERVVKWLNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFA  1220
             M N++   W    AKP   V+ +Q   A   I+SKAA+N+GM+ + F  YR+A+A  + A
Sbjct  1     MENQQKQSWFEK-AKPLAAVVSIQFGYALMDIISKAAMNKGMSNYVFVVYRHAVAFFVMA  59

Query  1219  PFALFLERKTRPTMTTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMT  1043
             P A F ERK +  MT SIF KI VL  L   ++ NLY++GM+YTTAT +VTM N++PA+T
Sbjct  60    PLAWFFERKVKQKMTLSIFMKILVLSLLEPVIDQNLYFLGMKYTTATFAVTMTNMLPAIT  119

Query  1042  FLLAWIFRLEKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSA  863
             F+ A I RLEK+ IR++ SQAK+VGT + + GAMIMTL+KGP++   +  H ++  +HS 
Sbjct  120   FVFACILRLEKINIRSIRSQAKVVGTVATVSGAMIMTLIKGPVL---FGSHVSN--AHSQ  174

Query  862   QH-VLNQHSNPIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSIL  686
              +    QHS  +   +++   C   A F+ILQA  +K+YPA LSL+  IC +G+++ + +
Sbjct  175   NNGTSTQHS--MTGFVMITIGCFCWASFMILQAITLKTYPAALSLSAWICLMGTIEGAAV  232

Query  685   TLIVERGNASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVL  506
              L++ERG+ SVWSL++DM LL  VY G+  SG  YY+ G++MK +GPVFVTAF+PL M++
Sbjct  233   ALVMERGHPSVWSLKFDMRLLCAVYAGITCSGVGYYLQGVVMKSRGPVFVTAFSPLCMII  292

Query  505   VAIIGSFVLSEKLYMgrvlgavvvlvglylviwGKSKDQTSPDNNDALPI  356
             VAI+G F+L+E++++GR++GA+++ +GLY V+WGKSKD +  D N   PI
Sbjct  293   VAIMGFFILAEQVFLGRMIGAIIICLGLYSVVWGKSKDYSPSDPNTEEPI  342



>ref|XP_002306625.2| hypothetical protein POPTR_0005s15820g [Populus trichocarpa]
 gb|EEE93621.2| hypothetical protein POPTR_0005s15820g [Populus trichocarpa]
Length=363

 Score =   274 bits (700),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 159/346 (46%), Positives = 233/346 (67%), Gaps = 14/346 (4%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             N   PY+ ++ +Q  SAG+ ILS  +LN+GMN +    YRN +AA++ APFAL LERKTR
Sbjct  15    NKMTPYILMVCVQFGSAGNYILSMISLNRGMNRYVLIVYRNGVAALVLAPFALLLERKTR  74

Query  1186  PTMTTSIFFKIVllalleqlnlnLY-YVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P +T  IF +I+ L  LE +    + Y+GM+YT+AT +  ++N +P++TF++A IFRLE+
Sbjct  75    PKITWPIFLRIMALGFLEPILDQGFSYLGMQYTSATFTSAIMNAVPSVTFVIALIFRLER  134

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             V+I+ + SQAK+VGT   + GA++MT+ KGP+I LPW++ ++   S +A    ++H   +
Sbjct  135   VRIKEIRSQAKVVGTLVTLAGALLMTVYKGPVIGLPWSQKTSQHGSTAASS--DKHW--V  190

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
               TLLL   C S + F +LQ   +K YPA LSL +LIC  GS+Q   + L+V   + S W
Sbjct  191   TGTLLLLVGCVSWSAFYVLQMETLKKYPAELSLASLICLAGSMQSLAIALVVAH-HPSSW  249

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
             ++ WD  L T +Y G+V SG  YY+ G++MK +GPVFVTAFNPL M++VA +GS +L+EK
Sbjct  250   AVGWDARLFTPLYTGIVASGITYYVQGLVMKTRGPVFVTAFNPLCMIIVAALGSLILAEK  309

Query  469   LYMgrvlgavvvlvglylviwGKSKDQTSPDN--------NDALPI  356
             L++G VLG +++ +GLY V+WGK KD TSP+         N  LPI
Sbjct  310   LHLGSVLGGIIIAIGLYSVVWGKRKDYTSPEELSTTAAKGNQELPI  355



>ref|XP_010453454.1| PREDICTED: WAT1-related protein At5g13670-like [Camelina sativa]
Length=388

 Score =   275 bits (702),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 163/361 (45%), Positives = 233/361 (65%), Gaps = 24/361 (7%)
 Frame = -3

Query  1360  AKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPT  1181
             AKP++ ++F+Q   A  +I++K ALN GM+P     YR A+A+V+  PFA  LER TRP 
Sbjct  14    AKPFIAIVFIQCLYALMSIVAKLALNAGMSPHVLVAYRMAVASVLITPFAFVLERNTRPR  73

Query  1180  MTTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVK  1004
             MT  I  +I +L      +  NLYY GM+ TTAT +  + N +PAMTF++A +F+LE+V 
Sbjct  74    MTFKILLQIAILSLFEPVVEQNLYYSGMKLTTATFTSALCNALPAMTFIMACLFKLEEVT  133

Query  1003  IRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKA  824
             I+  HSQAK+VGT  A+GGAM+MT VKG +I LPWT +S  +  HS    + +  +  + 
Sbjct  134   IKKRHSQAKLVGTMVAVGGAMLMTFVKGNVIELPWTNNSKGLNGHSDAMRIPKQDDIARG  193

Query  823   TLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSL  644
             +++L  SC S + +IILQA ++  Y A LSLT L+C +G L+ ++L LI ER N SVW +
Sbjct  194   SIMLVASCFSWSCYIILQAKILAQYQAELSLTALMCIMGMLEATVLGLIWERKNMSVWKI  253

Query  643   QWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLY  464
             + D+TLL  +Y GLV SG  YY+ G   K +GPVFV+AFNPLSMVLVAI+ +F+  E +Y
Sbjct  254   KPDVTLLASIYGGLV-SGLAYYVIGWASKERGPVFVSAFNPLSMVLVAILSTFIFLENMY  312

Query  463   MgrvlgavvvlvglylviwGKSKDQ----------------------TSPDNNDALPIDH  350
             +GRV+G+ V+++G+YLV+WGKSKD+                       +PDNN  +P   
Sbjct  313   LGRVVGSFVIVIGIYLVLWGKSKDKGGKLQPNAGCAETVVKIDEQKVPTPDNNRVVPTSD  372

Query  349   K  347
             +
Sbjct  373   Q  373



>ref|NP_196871.1| nodulin MtN21-like transporter UMAMIT 15 [Arabidopsis thaliana]
 sp|Q9FNA5.1|WTR39_ARATH RecName: Full=WAT1-related protein At5g13670 [Arabidopsis thaliana]
 dbj|BAB08694.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM60998.1| nodulin-like protein [Arabidopsis thaliana]
 gb|AED91926.1| nodulin MtN21-like transporter UMAMIT 15 [Arabidopsis thaliana]
Length=377

 Score =   274 bits (701),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 166/369 (45%), Positives = 244/369 (66%), Gaps = 5/369 (1%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
               A+P++ ++F+Q   A  +I++K ALN+GM+P     YR A+A+ +  PFAL LER TR
Sbjct  4     ERARPFIAIVFIQCLYALMSIVAKLALNKGMSPHVLVAYRMAVASALITPFALILERNTR  63

Query  1186  PTMTTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P +T  I  +I +L      +  NLYY GM+ TTAT +  + N +PAMTF++A +F+LEK
Sbjct  64    PKLTFKILLQIAILSLFEPVVEQNLYYSGMKLTTATFTSALCNALPAMTFIMACVFKLEK  123

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             V I   HSQAK+VGT  AIGGAM+MT VKG +I LPWT +S  +  H+    + + ++  
Sbjct  124   VTIERRHSQAKLVGTMVAIGGAMLMTFVKGNVIELPWTSNSRGLNGHTHAMRIPKQADIA  183

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
             + +++L  SC S + +IILQA ++  Y A LSLT L+C +G L+ +++ LI ER N SVW
Sbjct  184   RGSIMLVASCFSWSCYIILQAKILAQYKAELSLTALMCIMGMLEATVMGLIWERKNMSVW  243

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
              +  D+TLL  +Y GLV SG  YY+ G   K +GPVFV+AFNPLSMVLVAI+ +FV  EK
Sbjct  244   KINPDVTLLASIYGGLV-SGLAYYVIGWASKERGPVFVSAFNPLSMVLVAILSTFVFLEK  302

Query  469   LYMgrvlgavvvlvglylviwGKSKDQT---SPDNNDALPIDHKQPQVVQGFNKDITVSL  299
             +Y+GRV+G+VV+++G+YLV+WGKSKD+     P+   A  +     Q V   + +  VS+
Sbjct  303   VYVGRVIGSVVIVIGIYLVLWGKSKDKGGMLQPNAGCAETVVKIDQQKVPTPDNNQVVSI  362

Query  298   N*KVELPRS  272
             +  + +P++
Sbjct  363   SYHLMIPKA  371



>ref|XP_009337582.1| PREDICTED: WAT1-related protein At2g39510 [Pyrus x bretschneideri]
Length=350

 Score =   273 bits (698),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 160/323 (50%), Positives = 227/323 (70%), Gaps = 5/323 (2%)
 Frame = -3

Query  1354  PYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPTMT  1175
             P++ V FLQ   AG  I+SK ALN+GM+P  F  YR+A+A V  APFA+  +R+ RP MT
Sbjct  15    PFMAVTFLQFGYAGLFIISKFALNRGMSPQVFVAYRHAVATVFIAPFAIIFDRRVRPKMT  74

Query  1174  TSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVKIR  998
              SIF KIVLL LLE  L+ NL Y GM+ TTAT +  + N++PA  F++AW+FRLEK+ +R
Sbjct  75    LSIFCKIVLLGLLEPVLDQNLTYTGMKLTTATFTSALYNVLPAFAFIMAWVFRLEKINLR  134

Query  997   NLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKATL  818
             +LHSQAKI+GT   +GGAM++TL+ GP++  PWT+ +     H    V   H + IK  +
Sbjct  135   SLHSQAKILGTLVTVGGAMLLTLINGPMLNFPWTRRN----PHHESTVSTDHQDHIKGAI  190

Query  817   LLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSLQW  638
             ++A  C   A F+ L A  +KSYPA LSLT  IC +G++Q S + +  E  N + WS+ +
Sbjct  191   MVAAGCFCWAGFVNLLAITLKSYPAELSLTAWICLVGTVQGSAVAVAFEWNNPTSWSIHF  250

Query  637   DMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLYMg  458
             D  LL  VY G++ SG  YYI G++MK +GPVFVT+F+PL M++VA++ SF+L+E +Y+G
Sbjct  251   DSKLLAAVYSGIMCSGIAYYIQGMVMKERGPVFVTSFSPLIMIIVAVMSSFILAEIMYLG  310

Query  457   rvlgavvvlvglylviwGKSKDQ  389
             R +GA+V+++GLY+V+WGKSKDQ
Sbjct  311   RAIGAIVIVIGLYMVLWGKSKDQ  333



>ref|XP_010096638.1| Auxin-induced protein 5NG4 [Morus notabilis]
 gb|EXB65306.1| Auxin-induced protein 5NG4 [Morus notabilis]
Length=361

 Score =   273 bits (699),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 164/353 (46%), Positives = 226/353 (64%), Gaps = 25/353 (7%)
 Frame = -3

Query  1360  AKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPT  1181
             A+P+L V+ LQ   AG  I+ K ALNQGM+      YR+A+A  + APFAL LER   P 
Sbjct  13    ARPFLAVIVLQFGFAGLNIILKFALNQGMSQHVLVVYRHAVATAVIAPFALVLER---PV  69

Query  1180  MTTSIFFKIVllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVKI  1001
             +  ++F                 Y GM+ TTAT +  M N++PA  F++AWI RLEKV I
Sbjct  70    IDQNLF-----------------YTGMKSTTATFAAAMSNVLPAFVFIMAWIVRLEKVNI  112

Query  1000  RNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKAT  821
               +HSQAKI+GT   +GGAM MTL  GP++ LPW K  N + S    H  NQ S  IK  
Sbjct  113   GRIHSQAKILGTIVTVGGAMFMTLFNGPVLNLPWAKQDNHIDSTKGAH--NQVS--IKGA  168

Query  820   LLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSLQ  641
             L++   C S + FIILQA  +K+YPA LSLT LIC +G +Q S + L +E GN + WS+ 
Sbjct  169   LMIGAGCVSWSSFIILQAITLKAYPAELSLTALICLMGMVQGSAVALALEWGNPAAWSIH  228

Query  640   WDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLYM  461
             +D  LL  +Y G++ SG  YYI GI+M+ KGPVFVTAFNPL+MV+VAI+ SF+LSE +Y+
Sbjct  229   FDSKLLAALYSGVICSGLTYYIQGIVMQDKGPVFVTAFNPLNMVIVAIMSSFILSETMYL  288

Query  460   grvlgavvvlvglylviwGKSKDQTSPDNNDALPIDHKQPQVVQGFNKDITVS  302
             GRV+GA V++ GLY+V+WGKSKD+ + ++     +  +   + +  N++I+ S
Sbjct  289   GRVIGAAVIVAGLYMVLWGKSKDEPTSESIGKRVLASENEHMTE-MNENISTS  340



>emb|CDX75163.1| BnaC09g25190D [Brassica napus]
Length=384

 Score =   274 bits (701),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 140/300 (47%), Positives = 210/300 (70%), Gaps = 5/300 (2%)
 Frame = -3

Query  1357  KPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPTM  1178
             +P+L ++FLQ  +AG+ I+  A LNQG N +    YRNA+AA++  PFA+F ERK RP M
Sbjct  12    RPFLLMIFLQFGAAGTYIVIMATLNQGQNRYVLIVYRNAVAALVLGPFAIFCERKVRPKM  71

Query  1177  TTSIFFKIVllalleqlnlnLY-YVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVKI  1001
             T S+F KIVLL  LE +    + Y+GM  T+AT +  ++N++P++TF++AWI R+EKV I
Sbjct  72    TLSVFLKIVLLGFLEPILDQGFGYLGMNMTSATYTSAIMNVLPSVTFIIAWILRMEKVNI  131

Query  1000  RNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTK-HSNDVVSHSAQHVLNQHSNPIKA  824
               + SQAKI+GT  A+GGA++MTL KGP+I LPW+  ++N    HS       H++ +  
Sbjct  132   AEVRSQAKIIGTLVALGGALVMTLYKGPLIPLPWSNPNTNQHNGHSNSS--QDHNHWVGG  189

Query  823   TLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSL  644
             TLL+   C + + F +LQ+  IK+YPA LSL+ LIC  G++Q +++ L+VER ++  W++
Sbjct  190   TLLILLGCVAWSCFYVLQSITIKTYPADLSLSALICLSGAVQSTVVALVVER-HSRGWAV  248

Query  643   QWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLY  464
              WD  LL  +Y G+V SG  YY+ G++M+ +GPVFVTAFNPL M+LVA++ SF+L E+++
Sbjct  249   GWDARLLAPLYTGIVSSGLTYYVQGMVMRTRGPVFVTAFNPLCMILVALLASFILHEQIH  308



>ref|XP_008463490.1| PREDICTED: WAT1-related protein At2g39510-like isoform X1 [Cucumis 
melo]
Length=376

 Score =   273 bits (697),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 155/303 (51%), Positives = 200/303 (66%), Gaps = 5/303 (2%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             + A+PY+ V+  Q  +AG  I+SK ALNQG+N      YR  IA ++ APFA   ERK R
Sbjct  9     SQARPYIAVILQQFITAGMVIISKFALNQGLNQHVLVVYRYTIATIVVAPFAFVFERKVR  68

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT SIF K+VLL LLE  L+ NLYY GM+YTTAT +  M N+ P + FL+AW  RLE 
Sbjct  69    PRMTWSIFGKVVLLGLLEPALDQNLYYTGMKYTTATFASAMTNMTPGLVFLMAWAVRLEI  128

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             V +R L SQAKI+GT  A+GGAMIMT V+GPI+ LPWT H  ++  HS   V NQ  + +
Sbjct  129   VDVRQLSSQAKILGTVVAVGGAMIMTTVRGPILNLPWTNH--NIHDHSTTAV-NQQ-DLL  184

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
             K +L++   C   ++F +LQA  IK YPA LSLTTLIC  G++Q S++   +E    + W
Sbjct  185   KGSLMILVGCILWSVFNVLQAITIKVYPAQLSLTTLICFTGAVQASVIAFAMEGHKPAAW  244

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
             SL  D TLL  +Y G++ SG  Y I   +MK KGPVF + F PLS+V+VAII SF LSE 
Sbjct  245   SLHLDSTLLAPLYSGIMSSGVSYTIQSAVMKTKGPVFSSTFGPLSLVIVAIISSFALSEI  304

Query  469   LYM  461
             LY+
Sbjct  305   LYI  307



>emb|CDY29141.1| BnaA09g53940D [Brassica napus]
Length=383

 Score =   273 bits (698),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 140/300 (47%), Positives = 210/300 (70%), Gaps = 5/300 (2%)
 Frame = -3

Query  1357  KPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPTM  1178
             +P+L ++FLQ   AG+ I+  A LNQG N +    YRNA+AA++ APFA+F ERK RP M
Sbjct  12    RPFLLMIFLQFGGAGTYIVIMATLNQGQNRYVLIVYRNAVAALVLAPFAIFFERKVRPKM  71

Query  1177  TTSIFFKIVllalleqlnlnLY-YVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVKI  1001
             T S+F+KIVLL  LE +    + Y+GM  T+AT +  ++N++P++TF++AWI R+EKV I
Sbjct  72    TLSVFWKIVLLGFLEPILDQGFGYLGMNMTSATYTSAIMNVLPSVTFIIAWILRMEKVNI  131

Query  1000  RNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTK-HSNDVVSHSAQHVLNQHSNPIKA  824
               + SQAKI+GT  A+GGA++MTL KGP+I L W+  ++N    HS       H++ +  
Sbjct  132   AEVRSQAKIIGTLVALGGALVMTLYKGPLIPLQWSNPNTNQHNEHSNSS--QDHNHWVGG  189

Query  823   TLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSL  644
             TLL+   C + + F +LQ+  IK+YPA LSL+ LIC  G++Q +++ L+VER ++  W++
Sbjct  190   TLLILLGCVAWSCFYVLQSITIKTYPADLSLSALICLSGAVQSTVVALVVER-HSRGWAV  248

Query  643   QWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLY  464
              WD  LL  +Y G+V SG  YY+ G++M+ +GPVFVTAFNPL M+LVA++ SF+L E+++
Sbjct  249   GWDARLLAPLYTGIVSSGLTYYVQGMVMRTRGPVFVTAFNPLCMILVALLASFILHEQIH  308



>ref|XP_002312070.1| hypothetical protein POPTR_0008s05130g [Populus trichocarpa]
 gb|EEE89437.1| hypothetical protein POPTR_0008s05130g [Populus trichocarpa]
Length=368

 Score =   272 bits (696),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 168/329 (51%), Positives = 233/329 (71%), Gaps = 5/329 (2%)
 Frame = -3

Query  1372  LNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERK  1193
             L N A+ YL V+F+Q   +  +IL+K ALN GM P     YR A+A+++F PFAL LER 
Sbjct  7     LYNQARAYLLVIFVQFGYSVMSILAKLALNLGMKPHVLVAYRMAVASILFTPFALVLERN  66

Query  1192  TRPTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRL  1016
             +RP MT  +F KI LL+  E  L+ NL+Y GM+ TT T  + M N++PAMTF++A IF+L
Sbjct  67    SRPKMTWWMFAKIALLSFFEPVLDQNLFYAGMKITTPTFVLAMCNILPAMTFVMACIFKL  126

Query  1015  EKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSN  836
             EKV +R LH QAK+VGT   IGGAM++ L  GP+I LPWTK  N     SA  V  Q  +
Sbjct  127   EKVDMRRLHFQAKVVGTLVTIGGAMLLPLAHGPLINLPWTKR-NFCRGQSAHSVHIQ--D  183

Query  835   PIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNAS  656
              IK  +++   C S + FIILQA +++SYPA LSL  L+C +G+++ +IL   VER N +
Sbjct  184   LIKGAVMVIFGCLSWSSFIILQAMILESYPAKLSLAALMCIMGTVESTILAFAVERANTA  243

Query  655   VWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLS  476
             VWS+ +D+ LL  VY G++ SG  YYI+G+++K +GPVF++A NPLS+V+VAI+GSF+  
Sbjct  244   VWSVYFDIRLLAAVYGGIL-SGLAYYIFGLLVKERGPVFMSASNPLSLVMVAILGSFIFK  302

Query  475   EKLYMgrvlgavvvlvglylviwGKSKDQ  389
             EK Y+GR +GA+V+++GLYLV+WGKSKDQ
Sbjct  303   EKFYLGRAIGAIVIVLGLYLVLWGKSKDQ  331



>ref|XP_009151422.1| PREDICTED: WAT1-related protein At4g08290 [Brassica rapa]
Length=383

 Score =   272 bits (695),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 139/300 (46%), Positives = 210/300 (70%), Gaps = 5/300 (2%)
 Frame = -3

Query  1357  KPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPTM  1178
             +P+L ++FLQ   AG+ I+  A LNQG N +    YRNA+AA++ APFA+F ERK RP M
Sbjct  12    RPFLLMIFLQFGGAGTYIVIMATLNQGQNRYVLIVYRNAVAALVLAPFAIFFERKVRPKM  71

Query  1177  TTSIFFKIVllalleqlnlnLY-YVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVKI  1001
             T S+F+KIVLL  LE +    + Y+GM  T+AT +  ++N++P++TF++AWI R+EKV I
Sbjct  72    TLSVFWKIVLLGFLEPILDQGFGYLGMNMTSATYTSAIMNVLPSVTFIIAWILRMEKVNI  131

Query  1000  RNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTK-HSNDVVSHSAQHVLNQHSNPIKA  824
               + SQAKI+GT  A+GGA++MTL KGP+I L W+  ++N    HS       H++ +  
Sbjct  132   AEVRSQAKIIGTLVALGGALVMTLYKGPLIPLQWSNPNTNQHNEHSNSS--QDHNHWVGG  189

Query  823   TLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSL  644
             TLL+   C + + F +LQ+  I++YPA LSL+ LIC  G++Q +++ L+VER ++  W++
Sbjct  190   TLLILLGCVAWSCFYVLQSITIRTYPADLSLSALICLSGAVQSTVVALVVER-HSRGWAV  248

Query  643   QWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLY  464
              WD  LL  +Y G+V SG  YY+ G++M+ +GPVFVTAFNPL M+LVA++ SF+L E+++
Sbjct  249   GWDARLLAPLYTGIVSSGLTYYVQGMVMRTRGPVFVTAFNPLCMILVALLASFILHEQIH  308



>ref|XP_006294396.1| hypothetical protein CARUB_v10023413mg [Capsella rubella]
 gb|EOA27294.1| hypothetical protein CARUB_v10023413mg [Capsella rubella]
Length=385

 Score =   272 bits (695),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 170/363 (47%), Positives = 242/363 (67%), Gaps = 17/363 (5%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
               A P++ ++FLQV  AG  IL+K  LN+GM+ +  + YR+ +A V  APFA++ +R  R
Sbjct  5     KKAMPFMLMVFLQVGLAGMDILTKDVLNKGMSIYVLAVYRHGVATVAMAPFAIYFDRTIR  64

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT  IFFKI LL LLE  ++ NL+ +GM+YTTAT +  + N +PA+TF+LA +FRLEK
Sbjct  65    PKMTLMIFFKIALLGLLEPVIDQNLFNLGMKYTTATFATALYNTLPAITFILALMFRLEK  124

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQ--HSN  836
             VK RN+ S AK+ GT + +GG M+MTLVKGP + L WTK        S Q+      HS+
Sbjct  125   VKFRNIRSAAKVFGTITTVGGTMMMTLVKGPALDLFWTK------GPSGQNTTGTDIHSS  178

Query  835   PIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNAS  656
              IK  +L+   C S A F+ILQA  +K+YPA LSL TLIC +G+++ +++ L++E+GN +
Sbjct  179   -IKGAILVTIGCFSYACFMILQAITLKTYPAELSLATLICLMGTIEGAVVALVIEKGNPT  237

Query  655   VWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLS  476
              W++ WD  LLT  Y G++ S   YYI G++MK +GPVFVTAF PL M++VAI+ S + S
Sbjct  238   AWAIGWDNKLLTVTYSGIMCSALGYYIGGMVMKTRGPVFVTAFKPLCMIVVAIMSSIIFS  297

Query  475   EKLYMgrvlgavvvlvglylviwGKSKDQ---TSPDNNDALPIDHKQPQVVQGFNKDITV  305
             E++Y+GR LGA V+  GLYLVIWGK+KD    ++P  +D L     +   +   NK  ++
Sbjct  298   EQMYLGRALGAAVICAGLYLVIWGKAKDYKHLSTPQIDDEL----TKANTINSGNKKDSI  353

Query  304   SLN  296
             SL 
Sbjct  354   SLE  356



>ref|XP_011023643.1| PREDICTED: WAT1-related protein At5g13670-like [Populus euphratica]
Length=375

 Score =   270 bits (690),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 172/373 (46%), Positives = 240/373 (64%), Gaps = 11/373 (3%)
 Frame = -3

Query  1372  LNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERK  1193
             L N A+ Y+ V+F+Q   +  +IL+K ALN GM P     YR A+A+V+  PFA  LER 
Sbjct  9     LYNQARAYVLVIFVQFGYSVMSILAKLALNLGMKPHVLVAYRMAVASVLLTPFAFVLERN  68

Query  1192  TRPTMTTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRL  1016
             +RP MT  +F KI +L      L+ NL+Y GM+ TT    + M N++PAMTF++A IF+L
Sbjct  69    SRPKMTFWMFAKITLLSFFEPVLDQNLFYAGMKITTPAFVLAMCNILPAMTFVMACIFKL  128

Query  1015  EKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSN  836
             EKV +R LH QAK+ GT   IGGAM++    GP++ LPWTK  N     SAQ    Q  +
Sbjct  129   EKVDMRRLHFQAKVAGTLVTIGGAMLLPFAHGPLLHLPWTKR-NFCRGQSAQSAHIQ--D  185

Query  835   PIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNAS  656
              IK  +++   C S + FIILQA ++KSYPA LSL   +C +G+++ +ILT  VER N +
Sbjct  186   LIKGAVMVVFGCLSWSSFIILQAMILKSYPAKLSLAAFMCIMGTVESTILTFAVERANTA  245

Query  655   VWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLS  476
             VWS+ +D+ LL  VY G++ SG  YYI+G+++K +GPVF++A NPLS+V+VAI+GSF+  
Sbjct  246   VWSVYFDVRLLAAVYGGIL-SGLAYYIFGLLVKERGPVFMSASNPLSLVMVAILGSFIFK  304

Query  475   EKLYMgrvlgavvvlvglylviwGKSKDQTSPDN-NDALPIDHKQPQV--VQGFNKDITV  305
             EK Y+GR +GA+V+++GLYLV+WGKSKDQT+  N       D     V  +Q  N D+  
Sbjct  305   EKFYLGRAIGAIVIILGLYLVLWGKSKDQTTTSNGGSGTTYDQIASAVGNLQASNHDLVA  364

Query  304   SLN*KVELPRSHP  266
             S    V  P   P
Sbjct  365   S---NVNAPMDEP  374



>gb|KDO40045.1| hypothetical protein CISIN_1g019311mg [Citrus sinensis]
Length=343

 Score =   268 bits (686),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 156/319 (49%), Positives = 228/319 (71%), Gaps = 6/319 (2%)
 Frame = -3

Query  1306  ILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPTMTTSIFFKIVllalle-q  1130
             +L KAALN+GM+P+    YR+A A +  APFA+ L++K RP MT +I  K++LL LLE  
Sbjct  3     VLCKAALNKGMSPYVLVVYRHAAATIAMAPFAVILDKKIRPKMTLAILTKLLLLGLLEPV  62

Query  1129  lnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVKIRNLHSQAKIVGTASAIG  950
             ++ NLY++GM+YTTAT +  M N++PA+TFL+AWI RLE V ++++ S AK++GT + + 
Sbjct  63    IDQNLYFIGMKYTTATFAAAMYNILPAITFLMAWIIRLENVNLKSIRSLAKVIGTLATVA  122

Query  949   GAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKATLLLAGSCCSTAIFIILQ  770
             GAM+MTL+KGPI+ L WTK + +   H          N IK  L++   C S + FIILQ
Sbjct  123   GAMVMTLIKGPILELFWTKGAEN---HGHGSSGTTTHNSIKGALMITAGCFSWSFFIILQ  179

Query  769   ANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSLQWDMTLLTYVYHGLVRSG  590
             A  +K+YPA LSLT  IC  G+++ ++  LI+ERG AS+W++ WD  L+  VY G++ SG
Sbjct  180   AITLKAYPAELSLTAWICFFGTVEGTLAALIMERGKASIWAIHWDTKLVASVYSGIICSG  239

Query  589   AVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLYMgrvlgavvvlvglylvi  410
               YYI GI+MK +GPVFV AF+PL MV+VAI+ + +L+E++Y+GR++GA++++ GLYLV+
Sbjct  240   LTYYIQGIVMKDRGPVFVAAFSPLCMVIVAIMSTIILAEQMYLGRIIGAIIIIGGLYLVV  299

Query  409   wGKSKDQT--SPDNNDALP  359
             WGKSKD    SP  ++ LP
Sbjct  300   WGKSKDHKSPSPSTDEHLP  318



>ref|XP_010999363.1| PREDICTED: WAT1-related protein At4g08290 isoform X2 [Populus 
euphratica]
Length=318

 Score =   268 bits (684),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 139/303 (46%), Positives = 208/303 (69%), Gaps = 6/303 (2%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             N   PY+ ++ +Q  SAG+ ILS  +LN+GMN +    YRN +AA++ APFAL LERKTR
Sbjct  15    NKMTPYILMVCVQFGSAGNYILSMISLNRGMNRYVLIVYRNGVAALVLAPFALLLERKTR  74

Query  1186  PTMTTSIFFKIVllalleqlnlnLY-YVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P +T  IF +I+ L  LE +    + Y+GM+YT+A+ +  ++N +P++TF++A IFRLE+
Sbjct  75    PKITLPIFLRIMALGFLEPILDQGFSYLGMQYTSASFTSAIMNAVPSVTFVIALIFRLER  134

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             V+I+ + SQAK+VGT   +GGA++MT+ KGP+I LPW++ ++   S +A    ++H   +
Sbjct  135   VRIKEIRSQAKVVGTLVTLGGALLMTVYKGPVIGLPWSQKTSQHGSTAASS--DKHW--V  190

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
               TLLL   C S + F +LQ   +K YPA LSL +LIC  GS+Q   + L+V   + S W
Sbjct  191   TGTLLLLVGCVSWSAFYVLQMETLKKYPAELSLASLICLAGSMQSLAIALVVAH-HPSSW  249

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
             ++ WD  L T +Y G+V SG  YY+ G++MK +GPVFVTAFNPL M++VA +GS +L+EK
Sbjct  250   AVGWDTRLFTPLYTGIVASGVTYYVQGLVMKTRGPVFVTAFNPLCMIIVAALGSLILAEK  309

Query  469   LYM  461
             L++
Sbjct  310   LHL  312



>ref|XP_010097389.1| Auxin-induced protein 5NG4 [Morus notabilis]
 gb|EXB67895.1| Auxin-induced protein 5NG4 [Morus notabilis]
Length=357

 Score =   269 bits (687),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 167/368 (45%), Positives = 244/368 (66%), Gaps = 24/368 (7%)
 Frame = -3

Query  1399  MRNERVVKWLNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFA  1220
             M+  + V+ L   +KP+LGV+FLQ   AG  +LSKAALN GM+ +    YR+A+A  + A
Sbjct  1     MKKLQFVR-LFERSKPFLGVVFLQFGFAGMDVLSKAALNHGMSNYVLVVYRHAVATAVIA  59

Query  1219  PFALFLERKTRPTMTTSIFFKIVllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTF  1040
             PFA+ L++   P +  ++                 Y++GM+YTTAT +  M N++PA+TF
Sbjct  60    PFAVVLDK---PVIDQNL-----------------YFMGMKYTTATFAAAMTNILPAITF  99

Query  1039  LLAWIFRLEKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQ  860
             ++A I  LEKVKI+++ SQAK+VGT + + GAM+MT++KGPI+ L WT+ +    + S  
Sbjct  100   VMACILGLEKVKIKSIRSQAKVVGTTATVAGAMVMTVMKGPILDLFWTRGTRVDEARSGG  159

Query  859   HVLNQHSNPIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTL  680
               L   S+ IK +L++   C S A F+ILQA  +K+YPA LSLT  IC +G+L+ + + L
Sbjct  160   ISL---SHSIKGSLMITVGCFSWACFMILQAITLKTYPAELSLTAWICLLGTLEGTAVAL  216

Query  679   IVERGNASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVA  500
             ++ERGNASVWSL+WD  L+  +Y G+V SG  YYI G+IM+ +GPVFVTAF PL MV+VA
Sbjct  217   VMERGNASVWSLKWDTKLMAALYSGVVCSGLAYYIQGVIMRDRGPVFVTAFCPLCMVIVA  276

Query  499   IIGSFVLSEKLYMgrvlgavvvlvglylviwGKSKDQTSPDNNDALPIDHKQPQVVQGFN  320
             I+GS  L+E+LY+GRV+GA +++VGLYLV+WGKSKD  S   +   PI  +   +    +
Sbjct  277   IMGSLFLAEQLYLGRVIGATIIIVGLYLVVWGKSKDYKSSTTSLDEPISQESKHISDPDS  336

Query  319   KDITVSLN  296
                 V++N
Sbjct  337   NHQVVTIN  344



>ref|XP_010534299.1| PREDICTED: WAT1-related protein At2g39510-like [Tarenaya hassleriana]
Length=386

 Score =   270 bits (689),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 171/346 (49%), Positives = 223/346 (64%), Gaps = 16/346 (5%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
              + K  + V+ LQ   AG +I +  AL QGM+P     YR+AIA +   PFALF +RK R
Sbjct  3     REWKAPMAVILLQFGYAGLSITANFALRQGMSPHVLIVYRHAIATLFITPFALFFDRKVR  62

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT  IF KIV L LLE  +  NL+Y GM+YT+ T +  M N++PA  FL+AWIFRLEK
Sbjct  63    PKMTWPIFIKIVFLGLLEPTIGQNLFYTGMKYTSPTFTSAMSNVLPAFAFLMAWIFRLEK  122

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHS---  839
             V IR +HSQA I+GT   +GGAM M LVKGP + +PW  H++  +     ++L Q S   
Sbjct  123   VDIRRVHSQAMIMGTIVTVGGAMAMALVKGPSMDIPWV-HNHHKIHDMYLNLLQQQSHQT  181

Query  838   ------NPIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLI  677
                   +P K  L +A  C   A F  LQA  +K+YPA LSL   IC IG+ + SI  L+
Sbjct  182   KSTTSHDPTKGALFVASGCLCWAAFTTLQALTLKAYPAVLSLAAWICFIGATEGSIAALV  241

Query  676   VERGNASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAI  497
             +ER N S WSL  D+ L   VY G++ SG  YY+ G+IM+ KGPVFVTAFNPLSMV+V I
Sbjct  242   MERHNISAWSLHIDIKLFAAVYSGVICSGVGYYVQGMIMRKKGPVFVTAFNPLSMVIVTI  301

Query  496   IGSFVLSEKLYMgrvlgavvvlvglylviwGKSKDQTSPDNNDALP  359
             I S V  E +++GRV G+++++VGLYLV+WGKSKDQT     +ALP
Sbjct  302   ISSLVFHEGIHLGRVTGSILIVVGLYLVLWGKSKDQT-----EALP  342



>emb|CDP06652.1| unnamed protein product [Coffea canephora]
Length=339

 Score =   268 bits (685),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 158/309 (51%), Positives = 219/309 (71%), Gaps = 5/309 (2%)
 Frame = -3

Query  1276  MNPFTFSFYRNAIAAVIFAPFALFLERKTRPTMTTSIFFKI-VllalleqlnlnLYYVGM  1100
             MN + F  YR+AIA  + APFA+ L++K RP M  SIF KI VL  L   ++ NLY++GM
Sbjct  1     MNNYVFVVYRHAIATALIAPFAIILDKKIRPKMRLSIFAKILVLSLLEPVIDQNLYFLGM  60

Query  1099  RYTTATISVTMLNLIPAMTFLLAWIFRLEKVKIRNLHSQAKIVGTASAIGGAMIMTLVKG  920
             +YTTAT +  M N++PA+TFL+AWIFRLEKVK+++++SQAKIVGT + +GGAM+MTL++G
Sbjct  61    KYTTATFAAAMSNILPAITFLMAWIFRLEKVKLKSINSQAKIVGTVATVGGAMLMTLLRG  120

Query  919   PIILLPWTKHSNDVVSHSAQHVLNQHSNPIKATLLLAGSCCSTAIFIILQANMIKSYPAG  740
             P+I LPWTK +      S    L    N IK  L +       + F++LQA  +++YPA 
Sbjct  121   PVIKLPWTKGTTSPEHQSGGINLQ---NSIKGALFITIGYFGWSCFMVLQAITLRAYPAE  177

Query  739   LSLTTLICTIGSLQCSILTLIVERGNASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIM  560
             LSLT  IC +G+ + +IL LI+ERG A+VWS+ WD   L  +Y G+  SG  YYI G++M
Sbjct  178   LSLTAWICLLGTAEGAILALIMERGKAAVWSINWDTKFLAALYSGVFCSGLAYYIQGVVM  237

Query  559   KVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLYMgrvlgavvvlvglylviwGKSKDQTSP  380
             K +GPVFVTAF+PL+MV+VA++ SF+L E + +GRVLGA+ ++VGLYLV+WGK KD   P
Sbjct  238   KQRGPVFVTAFSPLNMVIVAVLSSFILHELMDLGRVLGAITIVVGLYLVVWGKRKDYDCP  297

Query  379   DNNDALPID  353
              + + LP D
Sbjct  298   -SIEGLPTD  305



>ref|XP_008233582.1| PREDICTED: WAT1-related protein At2g39510-like isoform X2 [Prunus 
mume]
Length=321

 Score =   267 bits (683),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 153/338 (45%), Positives = 222/338 (66%), Gaps = 26/338 (8%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             N AKP++ V  +Q   AG +I+SK ALN+GM+      YR+A+A V  APFA+  +R   
Sbjct  6     NLAKPFVAVTLMQFGYAGMSIISKFALNRGMSQHVLVVYRHAVATVFIAPFAIVFDR---  62

Query  1186  PTMTTSIFFKIVllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKV  1007
             P +  ++F                 Y GM+ TTAT +  M N++PA  F++AWIFRLE +
Sbjct  63    PVIDQNLF-----------------YTGMKLTTATFTSAMCNVLPAFAFIMAWIFRLENI  105

Query  1006  KIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIK  827
               R+L S AKI+GT   +GGAM+MTL+ GP++ LPWT+ +    S SA      H +PIK
Sbjct  106   NFRSLRSLAKILGTIVTVGGAMLMTLINGPMLNLPWTRRNIHQESTSA----TDHQDPIK  161

Query  826   ATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWS  647
              TLL+   C   A F+ LQA  +KSYPA LSL   IC +G++Q +++ L  E  N + WS
Sbjct  162   GTLLIGAGCFCWAGFVNLQAITLKSYPAELSLAAWICLMGTVQGTVVALGFEWDNPAAWS  221

Query  646   LQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKL  467
             + WD  LL  VY G++ SG VYY+ G++MK +GPVFVTAF+PLSM++VA++ SF+L+E +
Sbjct  222   IHWDSKLLAAVYSGIICSGVVYYVQGLVMKERGPVFVTAFSPLSMIIVAVMSSFMLAEIM  281

Query  466   YMgrvlgavvvlvglylviwGKSKDQ--TSPDNNDALP  359
             Y+GRV+GA+V+++GLY+V+WGKSKD+  +  + +D +P
Sbjct  282   YLGRVIGAMVIVIGLYMVLWGKSKDRIPSESEKDDVVP  319



>ref|XP_002284458.1| PREDICTED: WAT1-related protein At4g08290 isoform X1 [Vitis vinifera]
Length=381

 Score =   269 bits (687),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 171/362 (47%), Positives = 237/362 (65%), Gaps = 18/362 (5%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             N  KPYL ++ LQ  SAG  I+  A L  GM+ +    YRNA+A +  APFAL LERK R
Sbjct  14    NKMKPYLLMVALQFGSAGMYIICMATLTHGMSRYVLVVYRNAVATLAIAPFALLLERKGR  73

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P +T SIF KI+ L  LE  ++ NL Y+GM+YT+A+ +  ++N +PA+TF++A IFRLE 
Sbjct  74    PKLTFSIFLKIMALGFLEPIVDQNLSYLGMQYTSASYASAIMNAVPAVTFVMAIIFRLEH  133

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             +KI+   +QAKI+GT     GA++MTL KGPII +    HS+   SH A H  ++H   +
Sbjct  134   IKIKETRTQAKIIGTLVTFSGALLMTLYKGPIIDI---MHSHKA-SHQANHSSSKHW--L  187

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
               T+L+   CC+ + F ILQ+  IK+YPA LSL+TLIC +G++Q + + LI ER     W
Sbjct  188   IGTILILMGCCAWSAFFILQSITIKAYPAELSLSTLICLMGTVQSAAVGLIAER-KPRTW  246

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
             S+ WD  LL  VY G++ SG  YY+ G++MK KGPVFVTAFNPL MV+VA +GS +L+E+
Sbjct  247   SIGWDSRLLAPVYTGIISSGITYYVQGLVMKTKGPVFVTAFNPLCMVIVAALGSLILAEE  306

Query  469   LYMgrvlgavvvlvglylviwGKSKDQTSP------DNND--ALPI--DHKQPQVVQGFN  320
             L++G ++GA+++ VGLY V WGKSKD  SP      +  D   LPI        V++G N
Sbjct  307   LHLGSIIGAIIIAVGLYSVAWGKSKDHFSPAPSTTGEKTDPYQLPILATENTKLVIEGSN  366

Query  319   KD  314
              D
Sbjct  367   YD  368



>ref|XP_009143490.1| PREDICTED: WAT1-related protein At2g37460-like [Brassica rapa]
 emb|CDX91365.1| BnaC04g07850D [Brassica napus]
 emb|CDX74958.1| BnaA05g07040D [Brassica napus]
Length=380

 Score =   269 bits (687),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 167/348 (48%), Positives = 238/348 (68%), Gaps = 13/348 (4%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
               A+P++ V+ LQV  AG  ILSKA LN+GM+ +    YR+A+A V+ APFA + ++K R
Sbjct  11    EKARPFISVVLLQVGLAGMDILSKAVLNKGMSNYVLVVYRHAVATVVMAPFAFYFDKKVR  70

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT  IF KI LL LLE  ++ NLYY+GM+YTTAT +  M N++PA+TF+LA++F LE+
Sbjct  71    PKMTWMIFGKITLLGLLEPVIDQNLYYLGMKYTTATFATAMYNVLPAITFVLAYLFGLER  130

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             V +R + S  KI+GT + +GGAMIMTLVKGP++ L WTK     VS       + HS  I
Sbjct  131   VNLRCIRSAGKIIGTLATVGGAMIMTLVKGPVLDLFWTKG----VSAPNTTGTDIHS-AI  185

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
             K  +L+   C S A F+ILQA  +++Y A LSLT  IC +G+++ + + L++E+GN   W
Sbjct  186   KGAVLVTIGCFSYACFMILQAVTLRTYQAELSLTAWICLMGTIEGTAVALVMEKGNPGAW  245

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
             ++ WD  LLT  Y G+V S   YY+ G++MK +GPVFVTAF+PL M++VAI+ + + +E+
Sbjct  246   AIGWDTELLTAAYSGIVCSAIAYYVGGMVMKTRGPVFVTAFSPLCMIIVAIMSTVIFAEQ  305

Query  469   LYMgrvlgavvvlvglylviwGKSKD---QTSPDNNDALPIDHKQPQV  335
             +Y+GRVLGAVV+  GLYLVIWGK KD    ++P   D    +  QP++
Sbjct  306   MYLGRVLGAVVICAGLYLVIWGKGKDIEYPSTPQVGD----ESTQPKL  349



>ref|XP_010438422.1| PREDICTED: WAT1-related protein At4g08290-like [Camelina sativa]
Length=386

 Score =   269 bits (687),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 160/352 (45%), Positives = 232/352 (66%), Gaps = 4/352 (1%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
                +PY  ++FLQ  SAG+ I+  A LNQG N +    YRN +AA++ APFAL  ERK R
Sbjct  9     QKCRPYFLMIFLQFGSAGNYIVILATLNQGQNRYVLIVYRNLVAALVLAPFALIFERKVR  68

Query  1186  PTMTTSIFFKIVllalleqlnlnLY-YVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT S+F+KI+ L  LE +    + Y+GM  T+AT +  ++N++P++TF++AWI R+EK
Sbjct  69    PKMTFSVFWKIMALGFLEPVLDQGFGYLGMNMTSATYASAIMNILPSVTFIIAWILRMEK  128

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             V I  + S+AKI+GT   +GGA++MTL KGP+I LPW+  S D   +   +    HSN +
Sbjct  129   VSIAEVRSKAKIIGTLIGVGGALVMTLYKGPLIPLPWSNPSMD-QQNGHTNSSQDHSNWV  187

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
               TLL+   C + + F +LQ+  IK+YPA LSL++LIC  G +Q   + L+VER + S W
Sbjct  188   VGTLLILIGCVAWSGFYVLQSITIKTYPADLSLSSLICLAGVVQSFAVALVVER-HPSGW  246

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
             ++ WD  L   +Y G+V SG  YY+ G++MK +GPVFVTAFNPL MVLVA++ SF+L EK
Sbjct  247   AVGWDARLYGPLYTGIVSSGITYYVQGMVMKTRGPVFVTAFNPLCMVLVALLASFILHEK  306

Query  469   LYMgrvlgavvvlvglylviwGKSKD-QTSPDNNDALPIDHKQPQVVQGFNK  317
             +++G V+G V++  GLYLV+WGK KD + S  +N      H+ P   +G + 
Sbjct  307   IHVGCVIGGVIIAAGLYLVVWGKGKDYEVSGLDNLEKSSLHELPITTKGDDD  358



>ref|XP_004167845.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
Length=347

 Score =   268 bits (684),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 165/309 (53%), Positives = 222/309 (72%), Gaps = 5/309 (2%)
 Frame = -3

Query  1309  AILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPTMTTSIFFKIVllalle-  1133
             +I+SKAALNQGMN      YR +I A++ APFA  L+RK RP MT  IF KI+LL LLE 
Sbjct  2     SIISKAALNQGMNQLVTIVYRYSIGAIVVAPFAFVLDRKIRPKMTLPIFAKILLLGLLEP  61

Query  1132  qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVKIRNLHSQAKIVGTASAI  953
              +  +L Y G +YTTAT +  M N++PA  FL+AWI R+EKV IR+L SQAKI+GT   +
Sbjct  62    VIAQSLIYSGTKYTTATFATAMCNILPAFAFLMAWICRMEKVNIRSLRSQAKILGTLVTV  121

Query  952   GGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKATLLLA-GSCCSTAIFII  776
             GGAM+MTL+KGP++ LPWT   N++  HS   + N+   P+KA +++   S CS+A F I
Sbjct  122   GGAMMMTLLKGPLLSLPWTNQ-NNLNPHSYSTLPNKQ-QPVKAAIVITISSICSSA-FTI  178

Query  775   LQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSLQWDMTLLTYVYHGLVR  596
             L A+ I++YPA L+LTT IC  G+++ +IL L  E  N S W L  D  LL  +Y G++ 
Sbjct  179   LLAHTIRTYPAELTLTTFICLAGAVESTILALAFEWDNPSAWVLHADSILLAALYGGIIS  238

Query  595   SGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLYMgrvlgavvvlvglyl  416
             SG  YY+ G+++K+KGPVFVTAFNPLSMV+VAII SF+ +E L +GRV+GA V+++GLYL
Sbjct  239   SGIAYYLQGVVVKLKGPVFVTAFNPLSMVIVAIISSFIFAETLRLGRVIGAAVIIIGLYL  298

Query  415   viwGKSKDQ  389
             V+WGKSKD+
Sbjct  299   VLWGKSKDK  307



>ref|XP_006289117.1| hypothetical protein CARUB_v10002538mg [Capsella rubella]
 gb|EOA22015.1| hypothetical protein CARUB_v10002538mg [Capsella rubella]
Length=388

 Score =   268 bits (686),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 140/303 (46%), Positives = 207/303 (68%), Gaps = 5/303 (2%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             +  +PYL ++FLQ  +AG+ I+  A LNQG N +    YRN +AA++ APFAL  ERK R
Sbjct  9     HKCRPYLLMIFLQFGAAGTYIVVMATLNQGQNRYVVIVYRNLVAALVLAPFALIFERKVR  68

Query  1186  PTMTTSIFFKIVllalleqlnlnLY-YVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT S+F+KI+ L  LE +    + Y+GM  T+AT +  ++N++P++TF++AWI R+EK
Sbjct  69    PKMTFSVFWKIMALGFLEPVLDQGFGYLGMNMTSATYTSAIMNILPSVTFIIAWILRMEK  128

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHS-NDVVSHSAQHVLNQHSNP  833
             V +  + S+AKI+GT   +GGA++MTL KGP+I LPW+  S N    H+       H+N 
Sbjct  129   VNLAEIRSKAKIIGTLIGLGGALVMTLYKGPLIPLPWSNPSMNQQNGHTNSS--QDHNNW  186

Query  832   IKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASV  653
             +  TLL+   C + + F +LQ+  IK+YPA LSL++LIC  G++Q   + L+VER +AS 
Sbjct  187   VVGTLLILVGCVAWSGFYVLQSITIKTYPADLSLSSLICLAGAVQSFGVALVVER-HASG  245

Query  652   WSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSE  473
             W++ WD  L   +Y G+V SG  YY+ G++MK +GPVFVTAFNPL MVLVA++ SF+L E
Sbjct  246   WAVGWDARLYAPLYTGIVSSGITYYVQGMVMKTRGPVFVTAFNPLCMVLVALLASFILHE  305

Query  472   KLY  464
             +++
Sbjct  306   QIH  308



>ref|XP_002872388.1| hypothetical protein ARALYDRAFT_489740 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48647.1| hypothetical protein ARALYDRAFT_489740 [Arabidopsis lyrata subsp. 
lyrata]
Length=383

 Score =   268 bits (685),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 137/299 (46%), Positives = 205/299 (69%), Gaps = 3/299 (1%)
 Frame = -3

Query  1357  KPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPTM  1178
             +PYL ++FLQ  +AG+ I+  A LNQG N +    YRN +AA++ APFAL  ERK RP M
Sbjct  12    RPYLLMIFLQFGAAGTYIVIMATLNQGQNRYVVIVYRNLVAALVLAPFALIFERKVRPKM  71

Query  1177  TTSIFFKIVllalleqlnlnLY-YVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVKI  1001
             T S+F+KI+ L  LE +    + Y+GM  T+AT +  ++N++P++TF++AWI R+EKV I
Sbjct  72    TLSVFWKIMALGFLEPVLDQGFGYLGMNMTSATYTSAIMNILPSVTFIIAWILRMEKVNI  131

Query  1000  RNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKAT  821
               + S+AKI+GT   +GGA++MTL KGP+I LPW+  + D   +   +    H+N +  T
Sbjct  132   AEIRSKAKIIGTLVGLGGALVMTLYKGPLIPLPWSNPTMD-QQNGHTNSSEDHNNWVVGT  190

Query  820   LLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSLQ  641
             LL+   C + + F +LQ+  IK+YPA LSL+ LIC  G++Q   + L+VER ++S W++ 
Sbjct  191   LLILLGCVAWSGFYVLQSITIKTYPADLSLSALICLAGAVQSFAVALVVER-HSSGWAVG  249

Query  640   WDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLY  464
             WD  L   +Y G+V SG  YY+ G++MK +GPVFVTAFNPL M+LVA++ SF+L E+++
Sbjct  250   WDARLFAPLYTGIVSSGITYYVQGMVMKTRGPVFVTAFNPLCMILVALLASFILHEQIH  308



>ref|XP_006655900.1| PREDICTED: WAT1-related protein At1g21890-like [Oryza brachyantha]
Length=379

 Score =   268 bits (685),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 142/301 (47%), Positives = 203/301 (67%), Gaps = 5/301 (2%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             +DAKPY  ++ LQV  AG  I+S A+L +GMN F    YRN +A V+ APFAL  ER  R
Sbjct  8     SDAKPYAAMVLLQVGFAGMYIVSVASLKRGMNHFVLVVYRNLVATVLMAPFALLFERGVR  67

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT  IF KI+ LA+LE  L+ NLYY+G + T+A  +  ++N++PA+TFLLA + R+E+
Sbjct  68    PKMTVRIFIKIMGLAILEPVLDQNLYYMGAKLTSAGFASALVNILPAVTFLLAVLLRMER  127

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             V++R+LHSQAKIVGT   + GA++M L  GP++ LPW++ S+    H A       S+ +
Sbjct  128   VRLRSLHSQAKIVGTVFTVAGAVLMILYHGPVVPLPWSRGSH----HDAAAAAGTASSWL  183

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
               T++L GSC   + F ILQ+N ++SYPA LSLT LIC +GS     + L+ ER + SVW
Sbjct  184   NGTVMLVGSCVCWSGFFILQSNTLQSYPAELSLTALICVLGSAMSGAVALVAERRDMSVW  243

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
              + +D  L T VY G+V SG  YY+ G++ + +GPVFVTAF PL M++ A++GS +L E+
Sbjct  244   VIGFDTRLFTAVYSGIVCSGVAYYVQGLVTRARGPVFVTAFQPLCMMITAVLGSTILKEE  303

Query  469   L  467
             +
Sbjct  304   I  304



>ref|XP_003542469.1| PREDICTED: WAT1-related protein At2g37460-like [Glycine max]
Length=379

 Score =   267 bits (683),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 162/334 (49%), Positives = 238/334 (71%), Gaps = 7/334 (2%)
 Frame = -3

Query  1357  KPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPTM  1178
             KP   V+ +Q   A   +LSKAA+N+GM+ + F  YR+A+A  + AP A F ++K RP M
Sbjct  11    KPLAAVVSMQFGYAAMDVLSKAAMNKGMSNYVFVVYRHAVAFFVMAPLAWFFDKKVRPKM  70

Query  1177  TTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVKI  1001
             T SIF KI VL  L   ++ NLY++GM+YTTAT +V   N++PA+TF+ A I RLEK+KI
Sbjct  71    TLSIFMKIAVLSLLEPVIDQNLYFLGMKYTTATFAVATTNMLPAITFIFACILRLEKIKI  130

Query  1000  RNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKAT  821
             +++ SQAK+VGT + + GAM+MTL+KGP++L   +  SND   H+   +  QH+  I   
Sbjct  131   KSIRSQAKVVGTLATVSGAMVMTLLKGPVLL--GSHRSNDHGQHNGTSM--QHT--ITGF  184

Query  820   LLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSLQ  641
             +++   C S A F+ILQA  +K+YPA LSL+  IC +G+++ + + LI+ERGN SVWSL+
Sbjct  185   IMITIGCFSWACFVILQAITLKTYPAELSLSAWICLMGTIEGAAVALIMERGNPSVWSLK  244

Query  640   WDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLYM  461
              DM LL  VY G+V SG  YY+ G++MK +GPVFVTAF+PL MV+VA++  F+L+E++++
Sbjct  245   LDMKLLCAVYTGIVCSGMGYYLQGVVMKTRGPVFVTAFSPLCMVIVAVMSYFILAEQVFL  304

Query  460   grvlgavvvlvglylviwGKSKDQTSPDNNDALP  359
             GR++GAV++ +GLY+V+WGKSKD + P+ N   P
Sbjct  305   GRMIGAVIICLGLYVVVWGKSKDYSPPNPNTQEP  338



>ref|XP_010421738.1| PREDICTED: WAT1-related protein At4g08290 [Camelina sativa]
Length=386

 Score =   268 bits (684),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 158/352 (45%), Positives = 232/352 (66%), Gaps = 4/352 (1%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
                +PY  ++FLQ  +AG+ I+  A LNQG N + F  YRN +AA++ APFAL  ERK R
Sbjct  9     QKCRPYFLMIFLQFGAAGAYIVIMATLNQGQNRYVFIVYRNLVAALVLAPFALIFERKVR  68

Query  1186  PTMTTSIFFKIVllalleqlnlnLY-YVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT S+F+KI+ L  LE +    + Y+GM  T+AT +  ++N++P++TF++AWI R+EK
Sbjct  69    PKMTFSVFWKIMALGFLEPVLDQGFGYLGMNMTSATYASAIMNILPSVTFIIAWILRMEK  128

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             V I  + S+AKI+GT   +GGA++MTL KGP+I LPW+  S D   +   +    HS+ +
Sbjct  129   VNIAEVRSKAKIIGTLIGVGGALVMTLYKGPLIPLPWSNPSMD-QQNGHTNSSQDHSHWV  187

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
               TLLL   C + + F +LQ+  IK+YPA LSL++LIC  G++Q   + L+VER + S W
Sbjct  188   VGTLLLLIGCVAWSGFYVLQSITIKTYPANLSLSSLICLAGAVQSFAVALVVER-HPSGW  246

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
             ++ WD  L   +Y G+V SG  YY+ G++M  +GPVFVTAFNPL MVLVA++ SF+L E+
Sbjct  247   AVGWDARLYGPLYTGIVSSGITYYVQGMVMNTRGPVFVTAFNPLCMVLVALLASFILHEQ  306

Query  469   LYMgrvlgavvvlvglylviwGKSKD-QTSPDNNDALPIDHKQPQVVQGFNK  317
             ++ G V+G VV+  GLY+V+WGK KD + S  +N      H+ P   +G + 
Sbjct  307   IHFGCVIGGVVIAAGLYMVVWGKGKDYEVSGLDNLEKSSLHELPITTKGDDD  358



>ref|XP_010455250.1| PREDICTED: WAT1-related protein At4g08290-like [Camelina sativa]
Length=387

 Score =   267 bits (682),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 156/352 (44%), Positives = 232/352 (66%), Gaps = 4/352 (1%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
                +PY+ ++FLQ  +AG+ I+  A LNQG N +    YRN +AA++ APFAL  ERK R
Sbjct  9     QKCRPYILMIFLQFGAAGTYIVIMATLNQGQNRYVLIVYRNLVAALVLAPFALIFERKVR  68

Query  1186  PTMTTSIFFKIVllalleqlnlnLY-YVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT S+F+KI+ L  LE +    + Y+GM  T+AT +  ++N++P++TF++AWI R+EK
Sbjct  69    PKMTISVFWKIMALGFLEPVLDQGFGYLGMNMTSATYASAIMNILPSVTFIIAWILRIEK  128

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             V I  + S+AKI+GT   +GGA++MTL KGP+I LPW+  S D   +   +    HSN +
Sbjct  129   VNIVEVRSKAKIIGTLIGVGGALVMTLYKGPLIPLPWSNPSTD-QQNGHTNSSQDHSNWV  187

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
               TLL+   C + + F +LQ+  IK+YPA LSL++LIC  G++Q   + L++ER + S W
Sbjct  188   VGTLLILICCVAWSCFYVLQSITIKTYPADLSLSSLICLAGAVQSFAVALVMER-HPSGW  246

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
             ++ WD  L   +Y G+V SG  YY+ G +MK +GPVFVTAFNPL MVLVA++ SF+L E+
Sbjct  247   AVGWDARLYGPLYTGIVSSGITYYVQGKVMKTRGPVFVTAFNPLCMVLVALLASFILHEQ  306

Query  469   LYMgrvlgavvvlvglylviwGKSKD-QTSPDNNDALPIDHKQPQVVQGFNK  317
             ++ G V+G +V+  GLY+V+WGK KD + S  +N      H+ P   +G + 
Sbjct  307   IHFGCVIGGIVIAAGLYMVVWGKGKDYEVSGLDNLEKSSLHELPITTKGDDD  358



>ref|XP_008461651.1| PREDICTED: WAT1-related protein At2g39510-like isoform X3 [Cucumis 
melo]
Length=357

 Score =   266 bits (679),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 156/336 (46%), Positives = 216/336 (64%), Gaps = 23/336 (7%)
 Frame = -3

Query  1390  ERVVKWLNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFA  1211
             E  V+++ + AKPY GV+F+Q   AG  IL+K+AL++GM+   F  YR   A ++ APFA
Sbjct  2     ESFVRFMRS-AKPYFGVIFVQFGYAGMTILTKSALDKGMSQHVFVAYRQVAATLVIAPFA  60

Query  1210  LFLERKTRPTMTTSIFFKIVllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLA  1031
             +  ER   P +  ++F                 Y GM+YTTAT +  M N++PA  FL+A
Sbjct  61    IIFER---PVIDQNLF-----------------YTGMKYTTATFAAAMCNVLPAFVFLMA  100

Query  1030  WIFRLEKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSND--VVSHSAQH  857
             W  RLEKV I    SQAKI+GT   +GGAMIMT +KGP++ LPW+K  N     S S+  
Sbjct  101   WACRLEKVNIMKRGSQAKILGTIVTVGGAMIMTFIKGPMLHLPWSKLPNHPSASSSSSSA  160

Query  856   VLNQHSNPIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLI  677
                 H N I   L+L   C   A FI LQA  +K YPA LSLT LIC +G++  S + L+
Sbjct  161   ASTDHQNQIIGFLMLTTGCICWAAFITLQAITLKEYPAELSLTALICLVGTIGGSGVALV  220

Query  676   VERGNASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAI  497
             +ERGN S W+L +D  LL  VY G++ SG  YYI G++M+ KGPVF +AFNPL+MVLVAI
Sbjct  221   IERGNPSAWALHFDRQLLAVVYSGVICSGVTYYIQGVVMQTKGPVFFSAFNPLAMVLVAI  280

Query  496   IGSFVLSEKLYMgrvlgavvvlvglylviwGKSKDQ  389
             +  F+LSE +++GR++G V+++ GLY+V+WGK++DQ
Sbjct  281   MSFFILSEIMFLGRMIGVVIIICGLYMVLWGKTRDQ  316



>ref|NP_192569.1| nodulin MtN21 /EamA-like transporter family protein [Arabidopsis 
thaliana]
 sp|Q9SUF1.1|WTR31_ARATH RecName: Full=WAT1-related protein At4g08290 [Arabidopsis thaliana]
 emb|CAB45799.1| nodulin-like protein [Arabidopsis thaliana]
 emb|CAB77954.1| nodulin-like protein [Arabidopsis thaliana]
 gb|AEE82622.1| nodulin MtN21 /EamA-like transporter family protein [Arabidopsis 
thaliana]
Length=384

 Score =   266 bits (681),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 140/301 (47%), Positives = 203/301 (67%), Gaps = 7/301 (2%)
 Frame = -3

Query  1357  KPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPTM  1178
             +PYL ++FLQ  +AG+ I+  A LNQG N +    YRN +AA++ APFAL  ERK RP M
Sbjct  12    RPYLLMIFLQFGAAGTYIVIMATLNQGQNRYVVIVYRNLVAALVLAPFALIFERKVRPKM  71

Query  1177  TTSIFFKIVllalleqlnlnLY-YVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVKI  1001
             T S+ +KI+ L  LE +    + Y+GM  T+AT +  ++N++P++TF++AWI R+EKV I
Sbjct  72    TLSVLWKIMALGFLEPVLDQGFGYLGMNMTSATYTSAIMNILPSVTFIIAWILRMEKVNI  131

Query  1000  RNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLN--QHSNPIK  827
               + S+AKI+GT   +GGA++MTL KGP+I LPW   SN  +     H  N   H+N + 
Sbjct  132   AEVRSKAKIIGTLVGLGGALVMTLYKGPLIPLPW---SNPNMDQQNGHTNNSQDHNNWVV  188

Query  826   ATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWS  647
              TLL+   C + + F +LQ+  IK+YPA LSL+ LIC  G++Q   + L+VER + S W+
Sbjct  189   GTLLILLGCVAWSGFYVLQSITIKTYPADLSLSALICLAGAVQSFAVALVVER-HPSGWA  247

Query  646   LQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKL  467
             + WD  L   +Y G+V SG  YY+ G++MK +GPVFVTAFNPL M+LVA+I SF+L E++
Sbjct  248   VGWDARLFAPLYTGIVSSGITYYVQGMVMKTRGPVFVTAFNPLCMILVALIASFILHEQI  307

Query  466   Y  464
             +
Sbjct  308   H  308



>gb|KFK32145.1| hypothetical protein AALP_AA6G204100 [Arabis alpina]
Length=383

 Score =   266 bits (681),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 140/300 (47%), Positives = 208/300 (69%), Gaps = 7/300 (2%)
 Frame = -3

Query  1357  KPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPTM  1178
             +PYL ++FLQ  +AG+ I+  A LNQG N +    YRNAIAA++ APFALF ERK RP M
Sbjct  12    RPYLLMIFLQFGAAGTYIVIMATLNQGQNRYVIIVYRNAIAALVLAPFALFFERKVRPKM  71

Query  1177  TTSIFFKIVllalleqlnlnLY-YVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVKI  1001
             T S+F+KI+LL  LE +    + Y+GM  T+AT +  ++N++P++TF++AWI R+E+V I
Sbjct  72    TLSVFWKIMLLGFLEPILDQGFGYLGMNMTSATYTSAIMNVLPSVTFVIAWILRMERVTI  131

Query  1000  RNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSN-DVVSHSAQHVLNQHSNPIKA  824
               + SQAKI GT  A+ GA++MTL KGP+I LPW+     +  + S+Q     H++ +  
Sbjct  132   VEVRSQAKIAGTLVALAGALVMTLYKGPLIPLPWSNPDQLNGNTKSSQ----DHNHWVAG  187

Query  823   TLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSL  644
             TLL+  +C + + F +LQ+  IK YPA LSL  LIC  G++Q + + L++ER ++S W++
Sbjct  188   TLLILLACVAWSCFYVLQSITIKKYPADLSLAALICLSGAVQSTAVALVMER-HSSGWAV  246

Query  643   QWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLY  464
              WD  L   +Y G+V SG  YY+ G++MK +GPVFVTAFNPL M+LVA++ SF+L E+++
Sbjct  247   GWDARLFAPLYTGVVSSGLTYYVQGMVMKTRGPVFVTAFNPLCMILVALLASFILHEQIH  306



>ref|XP_004494994.1| PREDICTED: WAT1-related protein At2g37460-like isoform X1 [Cicer 
arietinum]
Length=330

 Score =   264 bits (675),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 146/329 (44%), Positives = 229/329 (70%), Gaps = 25/329 (8%)
 Frame = -3

Query  1354  PYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPTMT  1175
             P++ V+FLQ   A   +LSKAALN+GM+ + F  YR+A+A ++  PFAL+ ++   P + 
Sbjct  19    PFIAVLFLQFGYAVMDVLSKAALNKGMSNYVFVVYRHAVAFIVVTPFALYFDK---PVID  75

Query  1174  TSIFFKIVllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVKIRN  995
              ++                 Y++GM++TTAT + +M N++PA+TF+LA I R+EK+KIR+
Sbjct  76    QNL-----------------YFLGMKFTTATFAASMSNILPAITFILASILRIEKIKIRS  118

Query  994   LHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKATLL  815
             + +QAK+VGT + + GAM+MTL+KGP++   +    +D  +H    +  QH+  I   ++
Sbjct  119   IRTQAKVVGTIATVSGAMVMTLIKGPVL---FGTFGSDSQNHHNSGISTQHT--IIGAVM  173

Query  814   LAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSLQWD  635
             +   C S A FIILQA  +++YPA LSL++ IC +G+L+ + + L+VERGN SVWS++WD
Sbjct  174   ITLGCFSWACFIILQAITLETYPAALSLSSWICLLGTLEGAAVALVVERGNYSVWSIKWD  233

Query  634   MTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLYMgr  455
             + LL+ +Y G+  SG  YY+ G++MK +GPVFVT FNPL MV+VAI+G F+L+E++++GR
Sbjct  234   VRLLSAIYTGIFCSGLGYYLQGVVMKTRGPVFVTTFNPLCMVIVAIMGYFILAEQMFLGR  293

Query  454   vlgavvvlvglylviwGKSKDQTSPDNND  368
             V+GA ++ +GLYLV+WGKSKD  SP  ++
Sbjct  294   VVGAFIICLGLYLVVWGKSKDYNSPSKSN  322



>ref|XP_003570554.1| PREDICTED: WAT1-related protein At1g44800-like [Brachypodium 
distachyon]
Length=398

 Score =   266 bits (681),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 154/348 (44%), Positives = 226/348 (65%), Gaps = 4/348 (1%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             ND KPYL ++ LQV  AG  +++ A+L  GM+ F    YRN +A  + APFAL+ ER  R
Sbjct  8     NDVKPYLAMVLLQVGFAGMYVVAVASLKGGMSHFVLVVYRNLVATAVMAPFALYFERGQR  67

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT  +F KI+ LA LE  L+ NLY++G + T+A+ +  ++N++PA+TF+LA I R+EK
Sbjct  68    PPMTIKVFLKIMGLAFLEPVLDQNLYFMGAKLTSASFASALINILPAVTFVLALILRMEK  127

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             V++R+LHSQAKI GT   + GA++M L  GP +  PWTK      +H A     Q +  +
Sbjct  128   VRLRSLHSQAKIAGTVLTVAGAVLMILYHGPAVQFPWTKGRAGAANHGAGQGQGQGAGWL  187

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
               T++   +C + A F +LQ++ ++SYPA LSLT LIC +GSL    + L+ ERGN   W
Sbjct  188   SGTIMTIAACVAWACFFVLQSSTLQSYPAELSLTVLICAVGSLMSGSVALVAERGNTQAW  247

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
              + +D  L T VY G+V SG  YY+ GI+ + +GPVFVTAFNPL M++ +++GS +L E+
Sbjct  248   VIGFDTRLFTAVYAGIVCSGVAYYVQGIVSRQRGPVFVTAFNPLCMIITSVMGSIILKEE  307

Query  469   LYMgrvlgavvvlvglylviwGKSKDQTSP---DNNDALPIDHKQPQV  335
             + +G V+GA +++ GLY +IWGKSKD+ S         LP+  +  QV
Sbjct  308   ITLGSVIGAAIIVAGLYFLIWGKSKDEVSQVPVKGAGELPLTSEISQV  355



>ref|XP_004983289.1| PREDICTED: WAT1-related protein At4g08290-like [Setaria italica]
Length=364

 Score =   265 bits (677),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 155/332 (47%), Positives = 227/332 (68%), Gaps = 7/332 (2%)
 Frame = -3

Query  1357  KPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPTM  1178
             KPY+ ++FLQ   AG  ++S A+L QGM+ +    YRNA+AAV+ APFAL+ ERKTRP M
Sbjct  11    KPYMAMVFLQFGFAGMFLISVASLRQGMSHYVLVVYRNAVAAVVMAPFALWFERKTRPKM  70

Query  1177  TTSIFFKIVllalleqlnlnLY-YVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVKI  1001
             T SIFFKI+ L LLE +    + Y+G+  T+A+ S  + N++PA+TF+ A I R+E++ I
Sbjct  71    TLSIFFKILALGLLEPVLDQNFIYMGVNNTSASFSSALTNILPAVTFVNAIILRMERINI  130

Query  1000  RNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKAT  821
             +   SQAKI GTA  +GGA++M L KGPI+  PWTK  +  VS S  H      + +  T
Sbjct  131   KERRSQAKIAGTAITVGGALLMILFKGPIVNFPWTKDVSHAVSDSGAH---NGGHWLMGT  187

Query  820   LLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSLQ  641
              ++  SC   + F ILQ+  ++SYP+ LSLTTLIC +G+ +   + L++ER +   WS+ 
Sbjct  188   FMILLSCFCWSAFFILQSYTLRSYPSELSLTTLICALGATESGAVALVMER-DTKTWSIG  246

Query  640   WDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLYM  461
             +DM L T +Y G++ SG  YY+ GI++K +GPVFVTAF+PL M++V ++GS +LSE + +
Sbjct  247   FDMRLFTAIYSGIMCSGVAYYVQGIVIKERGPVFVTAFSPLCMIIVTLLGSIILSEVVTL  306

Query  460   grvlgavvvlvglylviwGKSKDQTSPDNNDA  365
             GR++GA V++ GLY +IWGK+KD    + NDA
Sbjct  307   GRLIGATVIVFGLYALIWGKNKDHV--NGNDA  336



>gb|KHN48995.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=379

 Score =   265 bits (678),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 161/334 (48%), Positives = 238/334 (71%), Gaps = 7/334 (2%)
 Frame = -3

Query  1357  KPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPTM  1178
             KP   V+ +Q   A   +LSKAA+N+GM+ + F  YR+A+A  + AP A F ++K RP M
Sbjct  11    KPLAAVVSMQFGYAAMDVLSKAAMNKGMSNYVFVVYRHAVAFFVMAPLAWFFDKKVRPKM  70

Query  1177  TTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVKI  1001
             T SIF KI VL  L   ++ NLY++GM+YTTAT +V   N++PA+TF+ A I RLEK+KI
Sbjct  71    TLSIFMKIAVLSLLEPVIDQNLYFLGMKYTTATFAVATTNMLPAITFIFACILRLEKIKI  130

Query  1000  RNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKAT  821
             +++ SQAK+VGT + + GAM+MTL+KGP++L   +  SND   H+   +  QH+  I   
Sbjct  131   KSIRSQAKVVGTLATVSGAMVMTLLKGPVLL--GSHRSNDHGQHNGTSM--QHT--ITGF  184

Query  820   LLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSLQ  641
             +++   C S A F+ILQA  +K+YPA LSL+  IC +G+++ + + LI+ERGN SVWSL+
Sbjct  185   IMITIGCFSWACFVILQAITLKTYPAELSLSAWICLMGTIEGAAVALIMERGNPSVWSLK  244

Query  640   WDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLYM  461
              DM LL  VY G+V SG  YY+ G+++K +GPVFVTAF+PL MV+VA++  F+L+E++++
Sbjct  245   LDMKLLCAVYTGIVCSGMGYYLQGVVIKTRGPVFVTAFSPLCMVIVAVMSYFILAEQVFL  304

Query  460   grvlgavvvlvglylviwGKSKDQTSPDNNDALP  359
             GR++GAV++ +GLY+V+WGKSKD + P+ N   P
Sbjct  305   GRMIGAVIICLGLYVVVWGKSKDYSPPNPNTQEP  338



>gb|EEC66707.1| hypothetical protein OsI_33030 [Oryza sativa Indica Group]
Length=364

 Score =   265 bits (677),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 160/340 (47%), Positives = 232/340 (68%), Gaps = 10/340 (3%)
 Frame = -3

Query  1378  KWLNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLE  1199
             KW    A PY+ ++FLQ   AG  ++S A+L QGM+ +    YRNA+AAV+ APFAL+ E
Sbjct  6     KW--RKAMPYMAMVFLQFGFAGLFLISVASLRQGMSHYVLVVYRNAVAAVVMAPFALWFE  63

Query  1198  RKTRPTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIF  1022
             RKTRP MT S+FFKI+ L LLE  L+ N +Y+G + T+A+ S  + N++PA+TF+ A I 
Sbjct  64    RKTRPKMTLSVFFKIMALGLLEPVLDQNFFYMGAKNTSASFSSALTNILPAVTFVNAIIL  123

Query  1021  RLEKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQH  842
             R+E++ I+   SQAKI GT   +GGAM+M L KGP+I  PWTK++N  +S S+ H    +
Sbjct  124   RMERISIKERRSQAKIAGTLITVGGAMLMILFKGPVINFPWTKNANQNISDSSDH---NN  180

Query  841   SNPIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGN  662
                +    ++  SC   + F ILQ+  ++SYPA LSLTTLIC +G  Q   + L++ER +
Sbjct  181   GRWLMGIFMILLSCFCWSAFFILQSYTLRSYPAELSLTTLICAMGVAQSGAVALVMER-D  239

Query  661   ASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFV  482
                W + +DM L T VY G++ SG  YY+ G+++K +GPVFVTAF+PL M++V I+GSF+
Sbjct  240   IKAWLIGFDMRLFTAVYSGIMCSGVAYYVQGMVIKERGPVFVTAFSPLCMIIVTILGSFI  299

Query  481   LSEKLYMgrvlgavvvlvglylviwGKSKD---QTSPDNN  371
             L E + +GRV+GA++++VGLY +IWGK+KD   Q   D+N
Sbjct  300   LCEVVTLGRVIGAIIIVVGLYALIWGKNKDHGNQVDQDDN  339



>gb|EMS60728.1| Auxin-induced protein 5NG4 [Triticum urartu]
Length=389

 Score =   266 bits (679),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 157/332 (47%), Positives = 221/332 (67%), Gaps = 4/332 (1%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             ND KPYL ++ LQV  AG  I++ ++L  GM+ F    YRN +A    APFAL+ ER+ R
Sbjct  9     NDVKPYLAMVLLQVGFAGMNIVAVSSLKAGMSHFVLVVYRNIVATAFMAPFALYFERERR  68

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MTT+IF KI+ LA LE  L+ NLY++G + T+A  +  +LN +PA+TF+LA I R+EK
Sbjct  69    PKMTTTIFIKIMWLAFLEPVLDQNLYFMGAKLTSAGFATALLNTLPAVTFVLALILRMEK  128

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             V++R+LHSQAKI GT  A+ GA++M L  GP++  PWT   +D         +    + +
Sbjct  129   VRLRSLHSQAKIAGTVLAVAGAVLMVLYHGPVVRFPWTSGHHDATIGGQ---VAAARDWL  185

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
               T++L  SC     F ILQAN + SYPA LSLT LIC +GSL    + L+ ER +  VW
Sbjct  186   IGTVMLIASCMIWPGFFILQANTLGSYPAELSLTALICGMGSLMSGAIALVAERADTQVW  245

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
              + +D  LLT VY G+V SG  YY+ G++ + +GPVFVTAF+PLSM++ A++GS +L E+
Sbjct  246   VVGFDSRLLTVVYAGIVCSGVAYYLQGVVSRQRGPVFVTAFSPLSMIITAVMGSIILKEE  305

Query  469   LYMgrvlgavvvlvglylviwGKSKDQTSPDN  374
             + +G V+GAV+++ GLY +IWGKSKD  SP  
Sbjct  306   ITLGSVIGAVIIVTGLYFIIWGKSKDDISPSQ  337



>emb|CBI19038.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   268 bits (684),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 171/362 (47%), Positives = 237/362 (65%), Gaps = 18/362 (5%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             N  KPYL ++ LQ  SAG  I+  A L  GM+ +    YRNA+A +  APFAL LERK R
Sbjct  16    NKMKPYLLMVALQFGSAGMYIICMATLTHGMSRYVLVVYRNAVATLAIAPFALLLERKGR  75

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P +T SIF KI+ L  LE  ++ NL Y+GM+YT+A+ +  ++N +PA+TF++A IFRLE 
Sbjct  76    PKLTFSIFLKIMALGFLEPIVDQNLSYLGMQYTSASYASAIMNAVPAVTFVMAIIFRLEH  135

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             +KI+   +QAKI+GT     GA++MTL KGPII +    HS+   SH A H  ++H   +
Sbjct  136   IKIKETRTQAKIIGTLVTFSGALLMTLYKGPIIDI---MHSHKA-SHQANHSSSKHW--L  189

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
               T+L+   CC+ + F ILQ+  IK+YPA LSL+TLIC +G++Q + + LI ER     W
Sbjct  190   IGTILILMGCCAWSAFFILQSITIKAYPAELSLSTLICLMGTVQSAAVGLIAER-KPRTW  248

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
             S+ WD  LL  VY G++ SG  YY+ G++MK KGPVFVTAFNPL MV+VA +GS +L+E+
Sbjct  249   SIGWDSRLLAPVYTGIISSGITYYVQGLVMKTKGPVFVTAFNPLCMVIVAALGSLILAEE  308

Query  469   LYMgrvlgavvvlvglylviwGKSKDQTSP------DNND--ALPI--DHKQPQVVQGFN  320
             L++G ++GA+++ VGLY V WGKSKD  SP      +  D   LPI        V++G N
Sbjct  309   LHLGSIIGAIIIAVGLYSVAWGKSKDHFSPAPSTTGEKTDPYQLPILATENTKLVIEGSN  368

Query  319   KD  314
              D
Sbjct  369   YD  370



>gb|AAM65570.1| nodulin-like protein [Arabidopsis thaliana]
Length=377

 Score =   265 bits (676),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 136/299 (45%), Positives = 203/299 (68%), Gaps = 3/299 (1%)
 Frame = -3

Query  1357  KPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPTM  1178
             +PYL ++FLQ  +AG+ I+  A LNQG N +    YRN +AA++ APFAL  ERK RP M
Sbjct  5     RPYLLMIFLQFGAAGTYIVIMATLNQGQNRYVVIVYRNLVAALVLAPFALIFERKVRPKM  64

Query  1177  TTSIFFKIVllalleqlnlnLY-YVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVKI  1001
             T S+ +KI+ L  LE +    + Y+GM  T+AT +  ++N++P++TF++AWI R+EKV I
Sbjct  65    TLSVLWKIMALGFLEPVLDQGFGYLGMNMTSATYTSAIMNILPSVTFIIAWILRMEKVNI  124

Query  1000  RNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKAT  821
               + S+AKI+GT   +GGA++MTL KGP+I LPW+  + D   +   +    H+N +  T
Sbjct  125   AEVRSKAKIIGTLVGLGGALVMTLYKGPLIPLPWSNPNMD-QQNGHTNSSQDHNNWVVGT  183

Query  820   LLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSLQ  641
             LL+   C + + F +LQ+  IK+YPA LSL+ LIC  G++Q   + L+VER + S W++ 
Sbjct  184   LLILLGCVAWSGFYVLQSITIKTYPADLSLSALICLAGAVQSFAVALVVER-HPSGWAVG  242

Query  640   WDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLY  464
             WD  L   +Y G+V SG  YY+ G++MK +GPVFVTAFNPL M+LVA++ SF+L E+++
Sbjct  243   WDARLFAPLYTGIVSSGITYYVQGMVMKTRGPVFVTAFNPLCMILVALLASFILHEQIH  301



>ref|XP_007220060.1| hypothetical protein PRUPE_ppa025780mg [Prunus persica]
 gb|EMJ21259.1| hypothetical protein PRUPE_ppa025780mg [Prunus persica]
Length=378

 Score =   264 bits (675),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 169/359 (47%), Positives = 230/359 (64%), Gaps = 13/359 (4%)
 Frame = -3

Query  1360  AKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPT  1181
             AK  L V  LQ   AG AI+ + A+N+GM+ + F  YR A A V+ APFAL L+RK+RP 
Sbjct  11    AKLILAVALLQGAYAGQAIIVRMAMNKGMSHYIFLVYRMAFATVLIAPFALILDRKSRPK  70

Query  1180  MTTSIFFK-IVllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVK  1004
             MT+SI  K ++L      L+ NLYY+ M Y+TAT +  M N++PA+ F +AWIFRLE V 
Sbjct  71    MTSSILVKTMLLSLFDPLLDQNLYYMAMSYSTATFTSAMFNILPAIAFFMAWIFRLETVN  130

Query  1003  IRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKA  824
             IR LHSQAK++GT   +GGA+I+TL KGP + LPWTK  N    H      + H +  K+
Sbjct  131   IRKLHSQAKVLGTIITVGGAIILTLAKGPALNLPWTKGKNQ--HHHQMQSDSNHKDITKS  188

Query  823   TLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVE-RGNASVWS  647
              LL A +C   + FIILQA  ++SYP  LSL  L C  G ++ +IL L+VE R + + WS
Sbjct  189   ALLSAAACFCWSSFIILQAFTLRSYPCKLSLAALTCFWGLVEGAILALVVEWRNSNADWS  248

Query  646   LQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKL  467
             +  D+ LL   Y G++ SG  YYI G++ K KGPVF +AFNPL  V++AI+GS VL E +
Sbjct  249   IHLDIRLLAAFYGGIL-SGVAYYIMGMVNKEKGPVFFSAFNPLGTVIIAILGSLVLDEHM  307

Query  466   YMgrvlgavvvlvglylviwGKSKDQ-------TSPDNNDALPIDHKQPQVVQGFNKDI  311
             Y+G ++GA+V++VGLYLV+WGK+KD+       T    ND  PI   Q Q++     DI
Sbjct  308   YLGSLIGAIVIVVGLYLVLWGKTKDEPPSQLSKTQSQPNDE-PITTSQQQMMPEGGLDI  365



>ref|XP_006661686.1| PREDICTED: WAT1-related protein At4g08290-like [Oryza brachyantha]
Length=364

 Score =   264 bits (674),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 162/350 (46%), Positives = 237/350 (68%), Gaps = 9/350 (3%)
 Frame = -3

Query  1390  ERVVKWLNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFA  1211
             E   KW    A PY+ ++FLQ   AG  ++S A+L QGM+ +    YRNA+AAV+ APFA
Sbjct  2     ELTGKW--RKAMPYMAMVFLQFGFAGLFLISVASLRQGMSHYVLVVYRNAVAAVVMAPFA  59

Query  1210  LFLERKTRPTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLL  1034
             L+ ERKTRP MT S+FFKI+ L LLE  L+ N +Y+G + T+A+ S  + N++PA+TF+ 
Sbjct  60    LWFERKTRPKMTLSVFFKIMALGLLEPVLDQNFFYMGAKNTSASFSSALTNILPAVTFVN  119

Query  1033  AWIFRLEKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSN-DVVSHSAQH  857
             A I R+E++ I+   SQAKIVGT   +GGAM+M L KGP+I  PWTK++N +V  +S Q+
Sbjct  120   AIILRMERISIKERRSQAKIVGTLVTVGGAMLMILFKGPVINFPWTKNANYNVADNSGQN  179

Query  856   VLNQHSNPIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLI  677
                   + +    ++  SC   + F ILQ+  +++YPA LSLTTLIC +G  Q   + L+
Sbjct  180   ----SGHWLMGIFMILLSCFCWSAFFILQSYTLRNYPAELSLTTLICAMGVAQSGAIALV  235

Query  676   VERGNASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAI  497
             +ER +   W + +DM L T VY G++ SG  YY+ G+++K +GPVFVTAF+PL M++V I
Sbjct  236   MER-DMKAWLIGFDMRLFTAVYSGIMCSGVAYYVQGMVIKERGPVFVTAFSPLCMIIVTI  294

Query  496   IGSFVLSEKLYMgrvlgavvvlvglylviwGKSKDQTSPDNNDALPIDHK  347
             +GSF+LSE + +GRV+GA++++VGLY +IWGK+KD  +  + D     HK
Sbjct  295   LGSFILSEVVTLGRVIGAIIIVVGLYALIWGKNKDHANQVDQDDNFEKHK  344



>gb|ABB47055.1| nodulin MtN21 family protein, putative, expressed [Oryza sativa 
Japonica Group]
Length=310

 Score =   261 bits (668),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 141/303 (47%), Positives = 204/303 (67%), Gaps = 7/303 (2%)
 Frame = -3

Query  1378  KWLNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLE  1199
             KW    A PY+ ++FLQ   AG  ++S A+L QGM+ +    YRNA+AAV+ APFAL+ E
Sbjct  6     KW--RKAMPYMAMVFLQFGFAGLFLISVASLRQGMSHYVLVVYRNAVAAVVMAPFALWFE  63

Query  1198  RKTRPTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIF  1022
             RKTRP MT S+FFKI+ L LLE  L+ N +Y+G + T+A+ S  + N++PA+TF+ A I 
Sbjct  64    RKTRPKMTLSVFFKIMALGLLEPVLDQNFFYMGAKNTSASFSSALTNILPAVTFVNAIIL  123

Query  1021  RLEKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQH  842
             R+E++ I+   SQAKI GT   +GGAM+M L KGP+I  PWTK++N  +S S+ H    +
Sbjct  124   RMERISIKERRSQAKIAGTLITVGGAMLMILFKGPVINFPWTKNANHNISDSSDH---NN  180

Query  841   SNPIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGN  662
              + +    ++  SC   + F ILQ+  ++ YPA LSLTTLIC +G  Q   + L++ER +
Sbjct  181   GHWLMGIFMILLSCFCWSAFFILQSYTLRGYPAELSLTTLICAMGVAQSGAVALVMER-D  239

Query  661   ASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFV  482
                W + +DM L T VY G++ SG  YY+ G+++K +GPVFVTAF+PL M++V I+GSF+
Sbjct  240   IKAWLIGFDMRLFTAVYSGIMCSGVAYYVQGMVIKERGPVFVTAFSPLCMIIVTILGSFI  299

Query  481   LSE  473
             L E
Sbjct  300   LCE  302



>gb|ABR16695.1| unknown [Picea sitchensis]
Length=406

 Score =   265 bits (676),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 157/340 (46%), Positives = 231/340 (68%), Gaps = 10/340 (3%)
 Frame = -3

Query  1360  AKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPT  1181
             +KPY+ ++ LQ   AG  I++K +LN+GMN +    YR+AIA +  APFA F ERK RP 
Sbjct  16    SKPYIAMISLQFGYAGMNIMTKVSLNRGMNHYVLVVYRHAIATIAMAPFAFFFERKVRPK  75

Query  1180  MTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVK  1004
             +T   F  I  L LL   ++ N+YY G++ TT T S  + N +PAMTF++A +FR+E++ 
Sbjct  76    LTFLTFCLIFALGLLGPVIDQNVYYAGLKLTTPTFSCALSNTLPAMTFVMAIVFRMERLS  135

Query  1003  IRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNP---  833
             ++ + SQAKIVGT  ++GGAM+MTL KGP + + W+ H +    H  ++V +  + P   
Sbjct  136   MKQVRSQAKIVGTLLSVGGAMLMTLYKGPAVHMFWSPHHH----HHDKYVKSASAVPDKD  191

Query  832   -IKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNAS  656
              IK +LL+  SC + A F +LQA + K Y A LSLTTLIC +G+LQ + LTL++E    S
Sbjct  192   WIKGSLLVIASCLAWAGFFVLQAFVAKKYSAQLSLTTLICFLGTLQSAALTLVIEH-KPS  250

Query  655   VWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLS  476
             VW++ WDM LLT VY G++ SG  YY+  + M++KGPVF TAF+PL M++VA++GS +L+
Sbjct  251   VWAIGWDMNLLTAVYSGVIASGIAYYVQSLCMELKGPVFATAFSPLMMIIVAVMGSIILA  310

Query  475   EKLYMgrvlgavvvlvglylviwGKSKDQTSPDNNDALPI  356
             E +Y+G VLGA++++VGLY V+WGK KD   P   ++L +
Sbjct  311   ETIYLGSVLGAILIVVGLYAVLWGKVKDHKIPSGKNSLQV  350



>ref|NP_001064323.1| Os10g0210500 [Oryza sativa Japonica Group]
 gb|ABB47053.1| nodulin MtN21 family protein, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABB47054.2| nodulin MtN21 family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF26237.1| Os10g0210500 [Oryza sativa Japonica Group]
 dbj|BAG90481.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE50726.1| hypothetical protein OsJ_31032 [Oryza sativa Japonica Group]
Length=364

 Score =   263 bits (672),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 159/340 (47%), Positives = 232/340 (68%), Gaps = 10/340 (3%)
 Frame = -3

Query  1378  KWLNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLE  1199
             KW    A PY+ ++FLQ   AG  ++S A+L QGM+ +    YRNA+AAV+ APFAL+ E
Sbjct  6     KW--RKAMPYMAMVFLQFGFAGLFLISVASLRQGMSHYVLVVYRNAVAAVVMAPFALWFE  63

Query  1198  RKTRPTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIF  1022
             RKTRP MT S+FFKI+ L LLE  L+ N +Y+G + T+A+ S  + N++PA+TF+ A I 
Sbjct  64    RKTRPKMTLSVFFKIMALGLLEPVLDQNFFYMGAKNTSASFSSALTNILPAVTFVNAIIL  123

Query  1021  RLEKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQH  842
             R+E++ I+   SQAKI GT   +GGAM+M L KGP+I  PWTK++N  +S S+ H    +
Sbjct  124   RMERISIKERRSQAKIAGTLITVGGAMLMILFKGPVINFPWTKNANHNISDSSDH---NN  180

Query  841   SNPIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGN  662
              + +    ++  SC   + F ILQ+  ++ YPA LSLTTLIC +G  Q   + L++ER +
Sbjct  181   GHWLMGIFMILLSCFCWSAFFILQSYTLRGYPAELSLTTLICAMGVAQSGAVALVMER-D  239

Query  661   ASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFV  482
                W + +DM L T VY G++ SG  YY+ G+++K +GPVFVTAF+PL M++V I+GSF+
Sbjct  240   IKAWLIGFDMRLFTAVYSGIMCSGVAYYVQGMVIKERGPVFVTAFSPLCMIIVTILGSFI  299

Query  481   LSEKLYMgrvlgavvvlvglylviwGKSKD---QTSPDNN  371
             L E + +GRV+GA++++VGLY +IWGK+KD   Q   D+N
Sbjct  300   LCEVVTLGRVIGAIIIVVGLYALIWGKNKDHGNQVDQDDN  339



>ref|XP_010664225.1| PREDICTED: WAT1-related protein At4g08290 isoform X2 [Vitis vinifera]
Length=345

 Score =   262 bits (670),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 147/303 (49%), Positives = 205/303 (68%), Gaps = 8/303 (3%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             N  KPYL ++ LQ  SAG  I+  A L  GM+ +    YRNA+A +  APFAL LERK R
Sbjct  14    NKMKPYLLMVALQFGSAGMYIICMATLTHGMSRYVLVVYRNAVATLAIAPFALLLERKGR  73

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P +T SIF KI+ L  LE  ++ NL Y+GM+YT+A+ +  ++N +PA+TF++A IFRLE 
Sbjct  74    PKLTFSIFLKIMALGFLEPIVDQNLSYLGMQYTSASYASAIMNAVPAVTFVMAIIFRLEH  133

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             +KI+   +QAKI+GT     GA++MTL KGPII +    HS+   SH A H  ++H   +
Sbjct  134   IKIKETRTQAKIIGTLVTFSGALLMTLYKGPIIDI---MHSHKA-SHQANHSSSKHW--L  187

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
               T+L+   CC+ + F ILQ+  IK+YPA LSL+TLIC +G++Q + + LI ER     W
Sbjct  188   IGTILILMGCCAWSAFFILQSITIKAYPAELSLSTLICLMGTVQSAAVGLIAER-KPRTW  246

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
             S+ WD  LL  VY G++ SG  YY+ G++MK KGPVFVTAFNPL MV+VA +GS +L+E+
Sbjct  247   SIGWDSRLLAPVYTGIISSGITYYVQGLVMKTKGPVFVTAFNPLCMVIVAALGSLILAEE  306

Query  469   LYM  461
             L++
Sbjct  307   LHL  309



>ref|XP_010272782.1| PREDICTED: WAT1-related protein At1g21890-like [Nelumbo nucifera]
Length=386

 Score =   263 bits (672),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 165/360 (46%), Positives = 229/360 (64%), Gaps = 17/360 (5%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             N  KP++ ++ LQ   AG  I++   L +GM+ +  + YR+A A +  APFALF ERK R
Sbjct  16    NKVKPFMAMVSLQFGYAGMYIVTMLCLRRGMSHYVLAVYRHAAATLAIAPFALFFERKIR  75

Query  1186  PTMTTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT S+F KI VL  L   L+ NLYYVGM+ T+AT S  + N++P +TF++A IFRLE 
Sbjct  76    PKMTVSVFLKIMVLAFLEPVLDQNLYYVGMKSTSATFSSAIFNVLPGITFIMAIIFRLEH  135

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTK---HSNDVVSHSAQHVLNQHS  839
             VKI+ +HSQAKI+GT     GAM MTL KGPI+ L  ++   H     S + QH      
Sbjct  136   VKIKKIHSQAKIIGTIVTFAGAMAMTLYKGPILNLGLSRGGAHHEASSSAAGQHW-----  190

Query  838   NPIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNA  659
               +  TL+L  SC   + F ILQ+  +K YPA LSLT+LIC +G +Q + + L++ER   
Sbjct  191   --VAGTLMLLASCTGWSCFFILQSFTLKQYPAELSLTSLICFMGMVQGAAVALVMER-KP  247

Query  658   SVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVL  479
               WSL WD  LL  VY G+V SG  YY+ GI++K +GPVFVTAFNPL MV+VA +GS +L
Sbjct  248   GAWSLGWDSRLLAAVYSGVVCSGITYYVQGIVIKERGPVFVTAFNPLCMVIVAALGSLIL  307

Query  478   SEKLYMgrvlgavvvlvglylviwGKSKD-----QTSPDNNDALPIDHKQPQVVQGFNKD  314
             +E++++G V+GA+V+++GLY V+WGKSKD     Q + +   AL +        +  N D
Sbjct  308   AEQIHLGSVIGAIVIVIGLYSVVWGKSKDIVASSQLTNEKGQALELPVAATDGAKSINGD  367



>dbj|BAC43205.1| putative nodulin [Arabidopsis thaliana]
 gb|AAO63397.1| At4g08290 [Arabidopsis thaliana]
Length=384

 Score =   263 bits (672),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 139/301 (46%), Positives = 202/301 (67%), Gaps = 7/301 (2%)
 Frame = -3

Query  1357  KPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPTM  1178
             +PYL ++FLQ  +AG+ I+  A LNQG N +    YRN +AA++ A FAL  ERK RP M
Sbjct  12    RPYLLMIFLQFGAAGTYIVIMATLNQGQNRYVVIVYRNLVAALVLAHFALIFERKVRPKM  71

Query  1177  TTSIFFKIVllalleqlnlnLY-YVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVKI  1001
             T S+ +KI+ L  LE +    + Y+GM  T+AT +  ++N++P++TF++AWI R+EKV I
Sbjct  72    TLSVLWKIMALGFLEPVLDQGFGYLGMNMTSATYTSAIMNILPSVTFIIAWILRMEKVNI  131

Query  1000  RNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLN--QHSNPIK  827
               + S+AKI+GT   +GGA++MTL KGP+I LPW   SN  +     H  N   H+N + 
Sbjct  132   AEVRSKAKIIGTLVGLGGALVMTLYKGPLIPLPW---SNPNMDQQNGHTNNSQDHNNWVV  188

Query  826   ATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWS  647
              TLL+   C + + F +LQ+  IK+YPA LSL+ LIC  G++Q   + L+VER + S W+
Sbjct  189   GTLLILLGCVAWSGFYVLQSITIKTYPADLSLSALICLAGAVQSFAVALVVER-HPSGWA  247

Query  646   LQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKL  467
             + WD  L   +Y G+V SG  YY+ G++MK +GPVFVTAFNPL M+LVA+I SF+L E++
Sbjct  248   VGWDARLFAPLYTGIVSSGITYYVQGMVMKTRGPVFVTAFNPLCMILVALIASFILHEQI  307

Query  466   Y  464
             +
Sbjct  308   H  308



>gb|ABK25095.1| unknown [Picea sitchensis]
Length=392

 Score =   263 bits (671),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 165/372 (44%), Positives = 246/372 (66%), Gaps = 8/372 (2%)
 Frame = -3

Query  1360  AKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPT  1181
             +KPY+ ++ LQ   AG  I++K +LN+GMN F    YR+A A V+ APFA F+ERK RP 
Sbjct  8     SKPYVAMISLQFGYAGMNIITKVSLNRGMNHFVLVVYRHAAATVVLAPFAFFIERKVRPK  67

Query  1180  MTTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVK  1004
             +T SIF +I VL  L   ++ N YY+G++ T+ T +  + N++PAMTF++A +FR+E V 
Sbjct  68    LTFSIFCQIFVLGLLGPVIDQNFYYLGLKLTSPTYACALSNVLPAMTFVIALLFRMENVN  127

Query  1003  IRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKA  824
             I+ L SQAKIVGT   +GGAM+MTL KGPI+ + W+ H     + +A  + N++   I +
Sbjct  128   IKKLRSQAKIVGTIVCVGGAMLMTLYKGPIVKMVWSAHHQSPQTSAAAAIDNKNW-IIGS  186

Query  823   TLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSL  644
              L++A +   + +F ILQA ++K Y A LSL TLIC +G+LQ ++L+L V R + S W+L
Sbjct  187   VLIIAATLAWSGLF-ILQAAVLKKYSAQLSLATLICFLGTLQATVLSLAVVR-DPSQWAL  244

Query  643   QWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLY  464
              WD+ LLT VY G+V S   YY+ G+ M+VKGPVF TAF+PL M++VAI+ S +L+E ++
Sbjct  245   GWDLNLLTAVYSGVVASAIAYYVQGLCMRVKGPVFATAFSPLMMIIVAIMASIILAENIF  304

Query  463   MgrvlgavvvlvglylviwGKSKD-QTSPDNNDALPIDHKQPQVVQGFNK--DI-TVSLN  296
             +G VLG V++++GLY V+WGK KD +   D N    + + Q  + +  NK  DI   S N
Sbjct  305   LGSVLGGVLIVIGLYAVLWGKVKDSKILTDKNSTEVLSNSQVMLPENQNKADDIEAASKN  364

Query  295   *KVELPRSHPHD  260
                + P++H  +
Sbjct  365   LMCKGPQAHQFN  376



>ref|XP_002454615.1| hypothetical protein SORBIDRAFT_04g034330 [Sorghum bicolor]
 gb|EES07591.1| hypothetical protein SORBIDRAFT_04g034330 [Sorghum bicolor]
Length=385

 Score =   261 bits (667),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 160/356 (45%), Positives = 228/356 (64%), Gaps = 17/356 (5%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             ND KPYL ++ LQV  AG  I++ A+L +GM+ F    YRN  A  + APFAL+ ERK+R
Sbjct  8     NDVKPYLAMILLQVGFAGMYIVAVASLKRGMSHFVLVVYRNLFATAVMAPFALWFERKSR  67

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT  IF KI+ L LLE  L+ NLY++G   T+A  +  ++N++PA+TF++A + R+EK
Sbjct  68    PRMTIKIFLKIMGLTLLEPVLDQNLYFMGANLTSAGFASALINILPAVTFVMALVLRMEK  127

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTK-HSNDVVSHSAQHVLNQHSNP  833
             V++R++HSQAKIVGT   + GA++M L  GP++  PW+K H +D  +  A    +  +  
Sbjct  128   VRLRSVHSQAKIVGTVLTVAGAVLMILYHGPVVQFPWSKGHHHDAGAQGAASSGSFLTGI  187

Query  832   IKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASV  653
             I  T+++A  C S   F +LQAN +KSYPA LSLTTLIC +GSL    + L+ ER N   
Sbjct  188   I--TIIVACVCWSA--FFVLQANTLKSYPAELSLTTLICLMGSLMSGSVALVAERNNTQA  243

Query  652   WSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSE  473
             W + +D  L T  Y G+V SG  YY+ GI+ + +GPVFVTAFNPL M++ AI+GS +L E
Sbjct  244   WVIGFDTRLFTCAYAGIVCSGVAYYVQGIVSRQRGPVFVTAFNPLCMIITAIMGSIILKE  303

Query  472   KLYMgrvlgavvvlvglylviwGKSKDQTSP-----------DNNDALPIDHKQPQ  338
             ++  G V+GA ++++GLY +IWGKSKD+ +                 LPI   QP 
Sbjct  304   EITRGSVIGAAIIVLGLYALIWGKSKDEVNQVADVSASGGCGSKGGELPITLAQPN  359



>ref|XP_010558786.1| PREDICTED: WAT1-related protein At5g13670 [Tarenaya hassleriana]
 ref|XP_010558787.1| PREDICTED: WAT1-related protein At5g13670 [Tarenaya hassleriana]
 ref|XP_010558788.1| PREDICTED: WAT1-related protein At5g13670 [Tarenaya hassleriana]
Length=369

 Score =   261 bits (666),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 141/304 (46%), Positives = 199/304 (65%), Gaps = 16/304 (5%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
               +KP+L V+F+Q   A  +I++K ALN GM+P     YR A+A+ + +PFA+FLER  R
Sbjct  5     ERSKPFLAVIFIQFCYALMSIVAKFALNDGMSPHVLVAYRMALASALISPFAIFLERNKR  64

Query  1186  PTMTTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT  +  ++ +L      +  NL+Y GM+ TTAT +  M N++PA+TF++A IFRLEK
Sbjct  65    PKMTFKLLIQVSMLSLFEPVVEQNLFYTGMKLTTATFTSAMCNVLPALTFIMACIFRLEK  124

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             V I    SQAK+VGT  A+GGAM+MT VKG ++ LPWT  S                +P+
Sbjct  125   VDISKHRSQAKLVGTIIAVGGAMLMTFVKGNVVELPWTNKSRGF-------------DPL  171

Query  829   -KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASV  653
              +   +L  SC S + +IILQA ++KSYPA LSLT L+C  G ++ +I+ L+ ER N SV
Sbjct  172   GRGATMLVVSCFSWSCYIILQAKILKSYPAELSLTALMCFTGMVEATIMALVWERNNTSV  231

Query  652   WSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSE  473
             W +  D+ LL +VY G+V SG  YY+ G + K +GPVFV+AFNPL+MV+VAI+ SFV SE
Sbjct  232   WEIHPDVRLLAFVYGGVV-SGLAYYVIGWVAKERGPVFVSAFNPLNMVIVAILSSFVFSE  290

Query  472   KLYM  461
              +Y+
Sbjct  291   VMYL  294



>ref|XP_009409675.1| PREDICTED: WAT1-related protein At1g21890-like [Musa acuminata 
subsp. malaccensis]
Length=373

 Score =   260 bits (665),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 160/342 (47%), Positives = 229/342 (67%), Gaps = 12/342 (4%)
 Frame = -3

Query  1357  KPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPTM  1178
             K Y+ ++ LQ   AG  ++S A++ +GMN F    YRNAIAA+  APFAL+ ERKTRP M
Sbjct  11    KAYVLMVLLQFGYAGMFVISVASIKRGMNHFVLVVYRNAIAALFIAPFALWFERKTRPEM  70

Query  1177  TTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVKI  1001
             T  IF KI  LALLE  L+ NLYY+G   T+A  +  + N+IPA+TF++A + R+EK++I
Sbjct  71    TVIIFLKIAALALLEPVLDQNLYYMGANLTSAGFASALYNMIPAITFIMAIVLRIEKLRI  130

Query  1000  RNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKAT  821
             ++ HSQAKIVG+   + GA++M L KGP++   W+K      SH          N +   
Sbjct  131   KSRHSQAKIVGSLVTVVGALLMILYKGPVVEFVWSKGR----SHRDTATSQSSGNWLTGI  186

Query  820   LLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSLQ  641
              LL GSC   + F ILQ+N +++Y A LSLTTLIC +G+   +++TL VE  +A  W++ 
Sbjct  187   FLLLGSCLCWSSFFILQSNTLETYSAELSLTTLICLMGAAMSAVVTLAVEGFSAKPWTIG  246

Query  640   WDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLYM  461
             WDM L+T +Y G+V SG  YY+ GI+MK +GPV+VTAFNPL M++ A++GS +L+E++ +
Sbjct  247   WDMRLVTAIYSGVVCSGVAYYVQGIVMKERGPVYVTAFNPLCMIITAVLGSIILAEEITL  306

Query  460   grvlgavvvlvglylviwGKSKDQ-------TSPDNNDALPI  356
             G V+GAV+++VGLY +IWGKSKDQ       T+ +    LPI
Sbjct  307   GSVIGAVIIVVGLYSLIWGKSKDQAKQSSERTAAERTLQLPI  348



>gb|EYU41683.1| hypothetical protein MIMGU_mgv1a009185mg [Erythranthe guttata]
Length=350

 Score =   259 bits (663),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 152/312 (49%), Positives = 228/312 (73%), Gaps = 6/312 (2%)
 Frame = -3

Query  1276  MNPFTFSFYRNAIAAVIFAPFALFLERKTRPTMTTSIFFKIVllalle-qlnlnLYYVGM  1100
             M+ + F  YR+A+A ++ APFA  L+ K RP MTTSIF KI+L++LLE  ++ NLY++GM
Sbjct  1     MSNYVFVVYRHAVATIVIAPFAFALDTKIRPKMTTSIFVKIMLMSLLEPVIDQNLYFLGM  60

Query  1099  RYTTATISVTMLNLIPAMTFLLAWIFRLEKVKIRNLHSQAKIVGTASAIGGAMIMTLVKG  920
             +YTTAT +  M N++PA+TF++A  FRLEKVK+ ++ SQAKI+GT + + GAMIMTLV+G
Sbjct  61    KYTTATFAAAMANILPALTFVIACFFRLEKVKVMSIRSQAKIIGTLATVAGAMIMTLVQG  120

Query  919   PIILLPWTKHSNDVVSHSAQHVLNQHSNPIKATLLLAGSCCSTAIFIILQANMIKSYPAG  740
             P I LPWT+   D   H  +  L+   + IK  +++   C + A F+ILQA  +K+YPA 
Sbjct  121   PHINLPWTRSGIDHAHHHGEVSLH---HTIKGAIMITIGCLAWACFMILQAITLKTYPAE  177

Query  739   LSLTTLICTIGSLQCSILTLIVERGNASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIM  560
             LSLT  IC +G+ + + L L++E+GN+S W+++WD   L   Y G+  SG  YY+ G++M
Sbjct  178   LSLTAWICLLGTAEGAALALVMEKGNSSAWAIKWDTKFLAAAYSGIFCSGIAYYVQGVVM  237

Query  559   KVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLYMgrvlgavvvlvglylviwGKSKDQTSP  380
             K +GPVFVTAF+PLSMV+VAI+ SF+L+E++++GR++GA+V+++GLY V+WGK+KD  SP
Sbjct  238   KERGPVFVTAFSPLSMVMVAIMSSFILAEQMFLGRIVGAIVIVLGLYFVVWGKAKDYKSP  297

Query  379   --DNNDALPIDH  350
               ++ + +PI  
Sbjct  298   LGEDQEIMPIKQ  309



>emb|CDY18443.1| BnaA04g21440D [Brassica napus]
Length=374

 Score =   260 bits (665),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 143/305 (47%), Positives = 205/305 (67%), Gaps = 10/305 (3%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
               A P++ V+ LQV  AG  IL+KA LN+GM+ +    YR+ +AA++ APFA + ++  R
Sbjct  11    KKAMPFILVILLQVGLAGMDILTKAVLNEGMSNYVLVVYRHGVAAIVMAPFAFYFDKAAR  70

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT  IFFKI LL L E  ++ NL+ +GM+YTTAT +  + N +PA+TF+LA I RLEK
Sbjct  71    PKMTPMIFFKITLLGLFEPVIDQNLFCLGMKYTTATFATALYNTLPAVTFILALIVRLEK  130

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQ--HSN  836
             VK+R++ S +K++GT +++GG MIMTLVKGP + L WTK        SAQ+      HS+
Sbjct  131   VKLRSIRSASKVIGTMTSVGGTMIMTLVKGPALDLFWTK------GPSAQNTTGTDIHSS  184

Query  835   PIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNAS  656
              IK  +L+   C S A F IL A  +K+YP  LSLT  IC +G+L+ + + L++ERGN  
Sbjct  185   -IKGAVLVTIGCFSYACFFILYAITLKTYPTELSLTAWICLMGTLEGAAVALVMERGNPG  243

Query  655   VWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLS  476
              W++ WD  LLT  Y G+V S   YYI G++MK +GPVFVTAF+PL M++VA + S + +
Sbjct  244   AWAIGWDNKLLTVTYSGIVCSALGYYIGGLVMKTRGPVFVTAFSPLCMIVVAFMSSIIFA  303

Query  475   EKLYM  461
             E++Y+
Sbjct  304   EQMYL  308



>ref|XP_009141664.1| PREDICTED: WAT1-related protein At2g37460-like isoform X1 [Brassica 
rapa]
Length=374

 Score =   260 bits (665),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 143/305 (47%), Positives = 205/305 (67%), Gaps = 10/305 (3%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
               A P++ V+ LQV  AG  IL+KA LN+GM+ +    YR+ +AA++ APFA + ++  R
Sbjct  11    KKAMPFILVILLQVGLAGMDILTKAVLNEGMSNYVLVVYRHGVAAIVMAPFAFYFDKAAR  70

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT  IFFKI LL L E  ++ NL+ +GM+YTTAT +  + N +PA+TF+LA I RLEK
Sbjct  71    PKMTPMIFFKITLLGLFEPVIDQNLFCLGMKYTTATFATALYNTLPAVTFVLALIVRLEK  130

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQ--HSN  836
             VK+R++ S +K++GT +++GG MIMTLVKGP + L WTK        SAQ+      HS+
Sbjct  131   VKLRSIRSASKVIGTMTSVGGTMIMTLVKGPALDLFWTK------GPSAQNTTGTDIHSS  184

Query  835   PIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNAS  656
              IK  +L+   C S A F IL A  +K+YP  LSLT  IC +G+L+ + + L++ERGN  
Sbjct  185   -IKGAILVTIGCFSYACFFILYAITLKTYPTELSLTAWICLMGTLEGAAVALVMERGNPG  243

Query  655   VWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLS  476
              W++ WD  LLT  Y G+V S   YYI G++MK +GPVFVTAF+PL M++VA + S + +
Sbjct  244   AWAIGWDNKLLTVTYSGIVCSALGYYIGGLVMKTRGPVFVTAFSPLCMIVVAFMSSIIFA  303

Query  475   EKLYM  461
             E++Y+
Sbjct  304   EQMYL  308



>ref|XP_008233580.1| PREDICTED: WAT1-related protein At2g39510-like [Prunus mume]
Length=378

 Score =   260 bits (664),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 167/359 (47%), Positives = 227/359 (63%), Gaps = 13/359 (4%)
 Frame = -3

Query  1360  AKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPT  1181
             AK  L V  LQ   AG AI+ + A+NQGM+ + F  YR A A V+ APFAL L+RK RP 
Sbjct  11    AKLILAVALLQGAYAGQAIIVRMAMNQGMSHYIFLVYRMAFATVLIAPFALILDRKLRPK  70

Query  1180  MTTSIFFK-IVllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVK  1004
             MT+SI  K ++L      L+ NLYY+   Y+TAT +  M N++PA+ F +AWIFRLE V 
Sbjct  71    MTSSILVKTMLLSLFDPVLDQNLYYMATSYSTATFTSAMFNILPAIAFFMAWIFRLETVN  130

Query  1003  IRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKA  824
             IR LHSQAK++GT   +GGA+I+TL KG  + LPWTK  N    H      + H +  K+
Sbjct  131   IRKLHSQAKVLGTIITVGGAIILTLAKGAALNLPWTKGKNQ--HHHQMQSDSNHKDITKS  188

Query  823   TLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVE-RGNASVWS  647
              LL A +C   + FIILQA  ++SYP  LSL TL C  G ++ +IL L+VE R + + WS
Sbjct  189   ALLSAAACFCWSSFIILQAFTLRSYPCKLSLATLTCFWGLVEGAILALVVEWRNSNADWS  248

Query  646   LQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKL  467
             +  D+ LL   Y G++ SG  YYI G++ K KGPVF +AFNPL  V++AI+GS VL E  
Sbjct  249   IHLDIRLLAAFYGGIL-SGVAYYIIGMVNKEKGPVFFSAFNPLGTVIIAILGSLVLDEHT  307

Query  466   YMgrvlgavvvlvglylviwGKSKDQ-------TSPDNNDALPIDHKQPQVVQGFNKDI  311
             Y+G ++G++V++VG+YLV+WGK+KD+       T    ND  PI   Q Q++     DI
Sbjct  308   YLGSLIGSIVIVVGVYLVLWGKTKDEAPSQLSKTQSQPNDE-PITTSQQQMMPEGGLDI  365



>emb|CDX93377.1| BnaC04g45190D [Brassica napus]
Length=374

 Score =   259 bits (662),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 144/305 (47%), Positives = 204/305 (67%), Gaps = 10/305 (3%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
               A P++ V+ LQV  AG  IL+KA LN+GM+ +    YR+ +AA+I APFA + ++  R
Sbjct  11    KKAMPFILVILLQVGLAGMDILTKAVLNEGMSNYVLVVYRHGVAAIIMAPFAFYFDKAAR  70

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT  IFFKI LL L E  ++ NL+ +GM+YTTAT +  + N +PA+TF+LA I RLEK
Sbjct  71    PKMTPMIFFKITLLGLFEPVIDQNLFCLGMKYTTATFATALYNTLPAVTFILALIVRLEK  130

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQ--HSN  836
             VK+R++ S +K++GT +++GG MIMTLVKGP + L WTK        SAQ+      HS+
Sbjct  131   VKLRSMRSASKVIGTMASVGGTMIMTLVKGPALDLFWTK------GPSAQNTTGTDIHSS  184

Query  835   PIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNAS  656
              IK  +L+   C S A F IL A  +K YP  LSLT  IC +G+L+ + + L++ERGN  
Sbjct  185   -IKGAVLVTIGCFSYACFFILYAITLKIYPTELSLTAWICLMGTLEGAAVALVMERGNPG  243

Query  655   VWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLS  476
              W++ WD  LLT  Y G+V S   YYI G++MK +GPVFVTAF+PL M++VA + S + +
Sbjct  244   AWAIGWDNKLLTVTYSGIVCSALGYYIGGLVMKTRGPVFVTAFSPLCMIVVAFMSSIIFA  303

Query  475   EKLYM  461
             E++Y+
Sbjct  304   EQMYL  308



>ref|XP_008785769.1| PREDICTED: WAT1-related protein At1g21890-like [Phoenix dactylifera]
Length=651

 Score =   267 bits (682),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 157/327 (48%), Positives = 219/327 (67%), Gaps = 5/327 (2%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             +  KPYL ++FLQ   AG  ++S  +L + MN +    YRNAIA    +PFAL+ ERK R
Sbjct  283   SKVKPYLAMVFLQFGYAGMFVISVESLKRRMNHYVLVVYRNAIAVAAVSPFALWFERKVR  342

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT SIF KI+ LA LE  L+ N YYVG   T+A+ +  M N++PA+TFLLA + R+E 
Sbjct  343   PKMTLSIFLKIMALAFLEPVLDQNFYYVGSNLTSASFASAMFNILPAITFLLAIVLRIET  402

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             + +R   SQAK+VGT   + GA++M L KGP++   W+K      SH    V    SN +
Sbjct  403   MNLRRRRSQAKLVGTIVTVAGALLMILYKGPVLDFVWSKGR----SHHNTAVGQNGSNSL  458

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
             K TL+L G C   + F ILQ+N ++SYPA L+LT+LIC +G+L  S++ L+ ERG+A  W
Sbjct  459   KGTLMLLGGCFCCSSFYILQSNTLESYPAELTLTSLICLMGALMSSLVALVAERGSAKPW  518

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
              + WD  LL  VY G++ SG  YY+ G +MK +GPVFVTAFNPL M++ A++GS VL+E+
Sbjct  519   IIGWDTRLLAVVYSGVLCSGVAYYVQGKVMKERGPVFVTAFNPLCMIVTAVLGSIVLAEE  578

Query  469   LYMgrvlgavvvlvglylviwGKSKDQ  389
             + +G V+GA V+++GLY +IWGKSKD 
Sbjct  579   ITLGSVIGAAVIVIGLYSLIWGKSKDH  605


 Score =   205 bits (522),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 119/256 (46%), Positives = 163/256 (64%), Gaps = 11/256 (4%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             +  KPYL ++FLQ   AG  ++S A+L  GMN +    YRNA+A  + APFAL+ ERK R
Sbjct  8     SKVKPYLAMVFLQFGYAGMFVISVASLKHGMNHYVLVVYRNAVAVAVVAPFALWFERKVR  67

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT SIF K + LALLE  L+ N YYVG   T+A+ +  + N++PA+TFLLA + R+E 
Sbjct  68    PKMTLSIFLKTMALALLEPVLDQNFYYVGANLTSASFASALFNILPAITFLLAIVLRIEN  127

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTK---HSNDVVSHSAQHVLNQHS  839
             + +R   SQAK+VGT   + GA++M L KGP +   W+K   H N  VS +        S
Sbjct  128   MNLRRRRSQAKLVGTIVTVAGALLMILYKGPSLDFVWSKGRSHHNTAVSQNG-------S  180

Query  838   NPIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNA  659
             N +K TL+L G C   + F ILQ+N ++SYPA L+LTTLIC +G+L  S++ L+ ERG+A
Sbjct  181   NSLKGTLMLLGGCFCWSSFFILQSNTLESYPAALTLTTLICLMGTLMSSLVALVAERGSA  240

Query  658   SVWSLQWDMTLLTYVY  611
               W + WD  LL  VY
Sbjct  241   KPWIIGWDTRLLAVVY  256



>gb|EMS48876.1| Auxin-induced protein 5NG4 [Triticum urartu]
Length=389

 Score =   259 bits (662),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 162/356 (46%), Positives = 231/356 (65%), Gaps = 10/356 (3%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             + AKPY+ ++ LQ   AG  +L+K +LN GM+ +    YR+A A +  APFALFLERK R
Sbjct  9     DKAKPYISMISLQFGYAGMNVLTKVSLNGGMSHYVLVVYRHAFATLAIAPFALFLERKVR  68

Query  1186  PTMTTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT SIFF+I VL  L   ++ N YYVG++YT  T +  M N++PAMTF++A IFR+EK
Sbjct  69    PKMTWSIFFQIFVLALLGPVIDQNFYYVGLKYTGPTFACAMSNILPAMTFVMAVIFRMEK  128

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTK---HSNDVVSHSAQHVLNQHS  839
             ++++ +  QAKI GT   + GAM+MTL KGP++ LPWT      +   +  A  V     
Sbjct  129   IELKKVRCQAKIFGTVVTVAGAMLMTLYKGPLMHLPWTNGHAQPSGGEASGAAGVDPTAR  188

Query  838   NPIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNA  659
                  +L +  +  + A   ILQ + I+ Y A LSLTTLIC IG++Q   +T ++ER   
Sbjct  189   EWFLGSLFIIIATLAWASLFILQTHTIRKYTAQLSLTTLICFIGTIQAIAVTFVMER-RV  247

Query  658   SVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVL  479
             SVW++ +DM LL   Y G+V S   YY+ G++++  GPVF +AF+PL M++VA++GSF+L
Sbjct  248   SVWTIGFDMNLLAAAYAGIVTSSIAYYVQGLVIQKTGPVFASAFSPLMMIIVAVMGSFIL  307

Query  478   SEKLYMgrvlgavvvlvglylviwGKSKD--QTSPDNNDALPIDHKQPQ---VVQG  326
             SEK+Y+G VLGAVV++VGLY V+WGK K+  +   D   ALP+  K P    V+QG
Sbjct  308   SEKIYLGAVLGAVVIVVGLYAVLWGKHKEKQEQEADAKAALPVASKGPDGASVLQG  363



>gb|EMT04611.1| Auxin-induced protein 5NG4 [Aegilops tauschii]
Length=385

 Score =   259 bits (661),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 151/329 (46%), Positives = 220/329 (67%), Gaps = 4/329 (1%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             NDAKPYL ++ LQV  AG  I++ A+L +GM+ F    YRN +A  + APFAL+ ER  R
Sbjct  9     NDAKPYLAMVLLQVGFAGMYIIAVASLKRGMSHFVLVVYRNLVATAVMAPFALYFERGVR  68

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT +IF KI+ LALLE  L+ NLYY+G   T+A  +  ++N++PA+TF+LA I R+EK
Sbjct  69    PKMTITIFIKIMGLALLEPVLDQNLYYMGANLTSAGFATALVNILPAVTFVLALILRMEK  128

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             V++R+LHSQAKI GT   + GA++M L  GP++  PWTK  +     +           +
Sbjct  129   VRLRSLHSQAKIAGTVLTVAGAVLMVLYHGPVVQFPWTKGQHHAGGAATAADGAAW---L  185

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
             K T++   +C + + F ILQ++ ++ YPA LSLT LIC +GS+  + + ++ ER N   W
Sbjct  186   KGTIMTVAACVAWSCFFILQSSTLRDYPAELSLTVLICGVGSVMSTAVAVVAERANTHAW  245

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
              + +D  L T VY G+V SG  YY+ G++ + +GPVFVTAFNPL M++ A++GS +L E 
Sbjct  246   VIGFDTRLFTVVYGGIVCSGVAYYVQGVVSRQRGPVFVTAFNPLCMIVTAVMGSIILKEA  305

Query  469   LYMgrvlgavvvlvglylviwGKSKDQTS  383
             + +G V+GAV+++VGLY +IWGKSKD  S
Sbjct  306   ITLGSVIGAVIIVVGLYFLIWGKSKDGIS  334



>ref|XP_006399183.1| hypothetical protein EUTSA_v10015938mg [Eutrema salsugineum]
 gb|ESQ40636.1| hypothetical protein EUTSA_v10015938mg [Eutrema salsugineum]
Length=406

 Score =   259 bits (662),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 143/320 (45%), Positives = 205/320 (64%), Gaps = 11/320 (3%)
 Frame = -3

Query  1399  MRNERVVKWLNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFA  1220
             M N    +     +KPY  ++ LQ   AG  I++K +LN GM+ +    YR+AIA  + A
Sbjct  3     MENLSCCESFLKSSKPYFAMVSLQFGYAGMNIITKISLNTGMSHYVLVVYRHAIATAVIA  62

Query  1219  PFALFLERKTRPTMTTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMT  1043
             PFA F ERK +P +T +IF ++ +L  L   ++ N YYVG++YT+ T S  M N++PAMT
Sbjct  63    PFAFFFERKAQPKITFTIFVQLFILGLLGPVIDQNFYYVGLKYTSPTFSCAMSNMLPAMT  122

Query  1042  FLLAWIFRLEKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTK-----HSNDV  878
             F+LA +FR+E + ++ L  QAKI GT   + GAM+MT+ KGPI+ L WTK     H+ND 
Sbjct  123   FILAVLFRMEMLDVKKLWCQAKIAGTVVTVAGAMLMTIYKGPIVELFWTKYMHLQHANDT  182

Query  877   VSHSAQHVLNQHSNPIKATLLLAGSCCSTAIFIILQANMIKSYPA-GLSLTTLICTIGSL  701
              S +     N   + +K ++LL  +  + A   +LQAN++K+Y    +SLTTLIC IG+L
Sbjct  183   TSSNNP---NDSKDFLKGSILLILATLAWASLFVLQANILKTYAKHQISLTTLICFIGTL  239

Query  700   QCSILTLIVERGNASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNP  521
             Q  ++T  +E  N S W + WDM LL   Y G+V S   YY+ G++MK KGPVF TAF+P
Sbjct  240   QAVVVTFAMEH-NPSAWRIGWDMNLLAAAYSGIVASSISYYVQGVVMKKKGPVFATAFSP  298

Query  520   LSMVLVAIIGSFVLSEKLYM  461
             L MV+VAI+GSFVL+EK+Y+
Sbjct  299   LMMVIVAIMGSFVLAEKIYL  318



>gb|AFK35983.1| unknown [Lotus japonicus]
Length=368

 Score =   258 bits (659),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 136/306 (44%), Positives = 200/306 (65%), Gaps = 10/306 (3%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             N AKPYL  + LQ   AG+ + S A+LN GM+   F  YRN IAAV  APFALF ERKTR
Sbjct  15    NRAKPYLFTVGLQFGMAGTYVFSMASLNHGMSRLVFVVYRNVIAAVALAPFALFFERKTR  74

Query  1186  PTMTTSIFFKIVllalleqlnlnLY-YVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT S+F +I+ L  LE +    + ++GM+YT+A+ + +++N +P++TF+LA I RLE+
Sbjct  75    PKMTLSVFVQILALGFLEPVIDQGFTFLGMQYTSASFASSVMNAVPSVTFVLAVILRLER  134

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILL---PWTKHSNDVVSHSAQHVLNQHS  839
             VKI+ L SQAK++GT  +  GA++MTL KGP + L   P T H       S  H    H 
Sbjct  135   VKIKELRSQAKVIGTLVSFAGALLMTLYKGPQVHLFHNPNTTHQE-----SGNHSTQSHQ  189

Query  838   NPIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNA  659
             + I  TL +   C + + F ILQ+  I+ YPA LSL++LIC +G+++ +++ L+ E   +
Sbjct  190   HWIAGTLFIGLGCLAWSSFYILQSITIRRYPAELSLSSLICLVGAMESAVVALVAEH-RS  248

Query  658   SVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVL  479
               W++ +D  L   +Y G++ SG  YY+ G++MK +GPVFVT+FNPL  ++VA +GSF+L
Sbjct  249   QAWTIGFDYRLYGPLYTGIISSGIAYYVQGLVMKSRGPVFVTSFNPLCTIIVAALGSFIL  308

Query  478   SEKLYM  461
              E LY+
Sbjct  309   GEHLYL  314



>ref|XP_010063373.1| PREDICTED: WAT1-related protein At4g08300-like [Eucalyptus grandis]
 gb|KCW70588.1| hypothetical protein EUGRSUZ_F03778 [Eucalyptus grandis]
Length=372

 Score =   258 bits (659),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 151/345 (44%), Positives = 230/345 (67%), Gaps = 7/345 (2%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
                KPYL ++ LQ   AG  I++  +LN GMN +  + YR+ +A ++ APFA  LERK R
Sbjct  12    KKVKPYLAMVSLQFGYAGMYIITLVSLNHGMNHYVLAVYRHVVATLLIAPFAFVLERKIR  71

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P +T  IF +I+ L  LE  L+ NLYYVGM+ T+AT +   +N++PA+TF++A  FRLEK
Sbjct  72    PKLTLPIFLRIMALGFLEPVLDQNLYYVGMKSTSATFASATVNILPAITFIMALAFRLEK  131

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNP-  833
             V ++ + S +K++GTA  +GGAM+MTL KGPI+   + +       H+     +Q +N  
Sbjct  132   VNVKKIQSLSKVIGTAVTVGGAMVMTLYKGPIV--DFMRSGGTGHPHAGGDGPHQSTNQH  189

Query  832   -IKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNAS  656
              +  TL+L  SCC  + F ILQ+  +K YPA LSLT LIC +GS++ + +TL++ER N +
Sbjct  190   WVTGTLMLLASCCGWSGFFILQSFTLKKYPAELSLTALICLMGSVEGAAVTLVMER-NMN  248

Query  655   VWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLS  476
             VW + WD  LL  VY G+V SG  YY+ G+++K +GPVF+T+F+PL M++ A +G+ VL+
Sbjct  249   VWRIGWDSRLLAAVYSGVVCSGIAYYVQGVVIKERGPVFITSFSPLCMIITAALGAIVLA  308

Query  475   EKLYMgrvlgavvvlvglylviwGKSKDQTSPDNNDALPIDHKQP  341
             E +++G ++GA+ ++ GLY+V+WGKSKD+ +      +P D K P
Sbjct  309   ETIHLGSIIGAIFIVCGLYIVVWGKSKDRQAESTTALMP-DEKVP  352



>ref|NP_001137108.1| hypothetical protein [Zea mays]
 gb|ACF83274.1| unknown [Zea mays]
 tpg|DAA46823.1| TPA: hypothetical protein ZEAMMB73_893748 [Zea mays]
Length=364

 Score =   258 bits (658),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 152/338 (45%), Positives = 228/338 (67%), Gaps = 9/338 (3%)
 Frame = -3

Query  1354  PYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPTMT  1175
             PY+ ++FLQ   AG  ++S A+L QGM+ +    YRN +AA++ APFAL+ ERKTRP M+
Sbjct  12    PYMAMVFLQFGFAGMFLISVASLRQGMSHYVLVVYRNVVAAIVMAPFALWFERKTRPKMS  71

Query  1174  TSIFFKIVllalleqlnlnLY-YVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVKIR  998
               +F KI+ L LLE +    + Y+G+  T+A+ S  + N++PA+TF+ A I R+E++ I+
Sbjct  72    LPVFIKILALGLLEPVLDQNFIYMGVNSTSASFSSALTNILPALTFVNAIILRMERIVIK  131

Query  997   NLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKATL  818
                SQAKI GTA  + GA++M L KGPII  PW+KH++  VS S  H      + +  T 
Sbjct  132   ERRSQAKIAGTAITVCGALLMILFKGPIINFPWSKHASHAVSDSGVH---NSGHWLMGTF  188

Query  817   LLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSLQW  638
             ++  SC   + F ILQ+  ++SYP+ LSLTTLIC +G+ +   + L++ER +   WS+ +
Sbjct  189   MILLSCFCWSAFFILQSYTLRSYPSELSLTTLICAMGATESGAVALVMER-DTKAWSIGF  247

Query  637   DMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLYMg  458
             DM L T +Y G++ SG  YY+ GI++K +GPVFVTAF+PL M+LV ++GSF+LSE + +G
Sbjct  248   DMRLFTAIYSGIMCSGVAYYVQGIVIKDRGPVFVTAFSPLCMILVTVLGSFILSEVVTLG  307

Query  457   rvlgavvvlvglylviwGKSKD----QTSPDNNDALPI  356
             R++GA V++VGLY +IWGK+KD    Q S D +D   +
Sbjct  308   RLIGATVIVVGLYALIWGKNKDHVKSQNSFDKHDTFEL  345



>dbj|BAK04730.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=365

 Score =   258 bits (658),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 156/347 (45%), Positives = 232/347 (67%), Gaps = 9/347 (3%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
               A PY+ ++FLQ   AG  ++S A+L QGM+ +    YRNAIAAV  APFAL+ +RKTR
Sbjct  8     RKAMPYVAMVFLQFGYAGLFLVSVASLRQGMSHYVLVVYRNAIAAVAMAPFALWFDRKTR  67

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT S+F+KIV LALLE  L+ N +Y+G   T+A+ S  + N++PA+TF+ A + R+E+
Sbjct  68    PKMTLSVFYKIVALALLEPVLDQNFFYIGAHNTSASFSSALTNILPAVTFVNAILIRMER  127

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNP-  833
             + I+   SQAKI GT   +GGA++M L  GP+I  PWTKH+    SH+  +  +  S   
Sbjct  128   INIKERRSQAKIAGTLITVGGALLMVLFSGPVINFPWTKHAG---SHAVTNTASHSSGCW  184

Query  832   IKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASV  653
             +    ++  SC   + F ILQ++ ++SYP+ LSLTTLICT G +Q  ++ L++ER +   
Sbjct  185   LLGIFMILLSCFCWSAFFILQSHTLRSYPSELSLTTLICTTGVVQSGVVALVMER-DTKA  243

Query  652   WSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSE  473
             W++ +DM L T VY G++ SG  YY+ GI+++ +GPVF+TAF PL M++V ++GSF+LSE
Sbjct  244   WAIGFDMRLFTAVYSGIMCSGVAYYVQGIVIQERGPVFITAFCPLCMIIVTVLGSFILSE  303

Query  472   KLYMgrvlgavvvlvglylviwGKSKD---QTSPDNNDALPIDHKQP  341
              + +GR+ GA++++VGLY +IWGKS D   Q   D+N   P   + P
Sbjct  304   VITLGRITGAMIIVVGLYALIWGKSNDHVNQVERDDNFEKPNSFELP  350



>ref|XP_010664224.1| PREDICTED: WAT1-related protein At1g21890 [Vitis vinifera]
 emb|CBI19037.3| unnamed protein product [Vitis vinifera]
Length=391

 Score =   258 bits (658),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 159/341 (47%), Positives = 226/341 (66%), Gaps = 7/341 (2%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             +  K YLG++ LQ   AG  I++  +L  GMN +    YR+A+A ++ APFAL LERK R
Sbjct  15    SKVKAYLGIVSLQFGYAGMYIITMVSLKHGMNHYVLVVYRHAVATLVIAPFALVLERKVR  74

Query  1186  PTMTTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT S F KI VL  L   L+ NLYYVGM+YT+AT +   +N++PA+TF+LA IFRLEK
Sbjct  75    PKMTLSTFLKIMVLGFLEPVLDQNLYYVGMKYTSATFASATVNVLPAITFILAIIFRLEK  134

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             + I+ + SQAK++GT   + GAM+MTL KGPII      H+  +  H +    +   N  
Sbjct  135   INIKKIPSQAKVIGTLITVTGAMVMTLYKGPIIDFI---HTRGISHHESSSDPSAGQNWA  191

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
               TL+L GSC   + F ILQ+  +K YPA LSLT LIC +G++Q + + L++ER  A+ W
Sbjct  192   TGTLMLLGSCFGWSGFFILQSFTLKQYPAELSLTALICFMGTVQGAAVALVMERDKAA-W  250

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
             ++ +D  +L   Y G+V SG  YY+  +++K +GPVFVTAF+PL M++ A +GSF+L+EK
Sbjct  251   AVGFDSRILAAAYSGVVCSGIAYYVQSLVIKERGPVFVTAFSPLCMIITAALGSFILAEK  310

Query  469   LYMgrvlgavvvlvglylviwGKSKDQTSPDNNDALPIDHK  347
             L++G +LGA V++VGLY V+WGKSK+  S  +    P D K
Sbjct  311   LHLGSILGAAVIVVGLYSVVWGKSKEARSSASQA--PTDEK  349



>ref|XP_006349970.1| PREDICTED: WAT1-related protein At2g37460-like [Solanum tuberosum]
Length=440

 Score =   258 bits (660),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 155/338 (46%), Positives = 236/338 (70%), Gaps = 9/338 (3%)
 Frame = -3

Query  1360  AKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPT  1181
             AKP+  V+FLQ+  +G  ILSK ALN+G + + +  YR A+A +  APFA+FL++  RP 
Sbjct  8     AKPFFAVVFLQLGLSGMYILSKMALNEGSSNYVYVVYRQAVATLFMAPFAIFLDKGKRPK  67

Query  1180  MTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVK  1004
             MT SIF K+VLL++LE  ++ NLY +G++YTTAT +  M N +PA+TF+++WIFR EKV 
Sbjct  68    MTFSIFAKLVLLSILEPVIDQNLYSLGLKYTTATFAAAMYNTLPAITFIMSWIFRQEKVN  127

Query  1003  IRNLHSQAKIVGTASAIGGAMIMTLVKGPII-LLPWTKHSNDVVSHSAQHVLNQHSNPI-  830
               ++ SQ KI+GT + +GGAMIM LV+GP + L P   +   V ++ A   ++   NPI 
Sbjct  128   FTSIGSQLKIIGTIATLGGAMIMMLVRGPEVQLFPTDDYY--VNNNDASDQISGGINPID  185

Query  829   --KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNAS  656
               K +L++   C S A FIILQ  ++++YPA LSL T IC +G+++  I+ +I+ERGN++
Sbjct  186   AIKGSLMIMLGCTSGAGFIILQTKILQTYPAELSLHTWICLLGTIEGGIMAMIMERGNSA  245

Query  655   VWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLS  476
             VW + WD   L  VY G+  SG  YYI G+I++ +  +F++AFNPL++++VAII S +L 
Sbjct  246   VWIINWDSKFLAVVYSGIFGSGLAYYIQGVILEDRSSLFISAFNPLNILIVAIISSIILQ  305

Query  475   EKLYMgrvlgavvvlvglylviwGKSKDQT--SPDNND  368
             E++ +GR+LG VV+++GLY+++WGKSKD    SP  ++
Sbjct  306   EQMNLGRILGVVVIIIGLYIILWGKSKDHKILSPSKDE  343



>dbj|BAJ98418.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=395

 Score =   256 bits (655),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 146/328 (45%), Positives = 217/328 (66%), Gaps = 2/328 (1%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             +D KPYL ++ LQV  AG  I++ A+L  GM+ F    YRN +A  +  PFA++ ER  R
Sbjct  9     DDVKPYLAMVLLQVGFAGMYIIAVASLKAGMSHFVLVVYRNLVATAVMTPFAIYFERGLR  68

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT +IF K++ LA LE  ++ NLY++G + T+A  +  ++N++PA+TF+LA I R+EK
Sbjct  69    PKMTITIFIKVMGLAFLEPVMDQNLYFMGAKLTSAGFATALVNILPAVTFVLALILRMEK  128

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNP-  833
             V++R+LHSQAKI GT   + GA++M L  GPI+  PWTK  +   +          +   
Sbjct  129   VRLRSLHSQAKIAGTVLTVAGAVLMVLYHGPIVQFPWTKGQHHATASGQGAGGAAAARDW  188

Query  832   IKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASV  653
             +  T+++  +C + A F ILQ+N ++SYPA LSLT LIC +GSL    + L+ ER N   
Sbjct  189   LNGTIMVIIACVAWACFFILQSNTLRSYPAELSLTVLICGMGSLMSGAIALVAERANTQA  248

Query  652   WSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSE  473
             W + +D  L T VY G+V SG  YY+ GI+ + +GPVFVTAFNPL M++ A++GS +L E
Sbjct  249   WVIGFDTRLFTAVYAGIVCSGVAYYVQGIVSRQRGPVFVTAFNPLCMIITAVMGSIILKE  308

Query  472   KLYMgrvlgavvvlvglylviwGKSKDQ  389
             ++ +G V+GA +++ GLY +IWGKSKD+
Sbjct  309   EINLGSVIGAAIIVGGLYFLIWGKSKDE  336



>ref|XP_010063981.1| PREDICTED: WAT1-related protein At4g08290-like [Eucalyptus grandis]
 gb|KCW71272.1| hypothetical protein EUGRSUZ_F04361 [Eucalyptus grandis]
Length=369

 Score =   255 bits (651),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 151/342 (44%), Positives = 222/342 (65%), Gaps = 6/342 (2%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             N  KPYL ++ LQ  SAG  ++S   L  GM+ +    YRNAIAA++ APFAL LERKTR
Sbjct  14    NKVKPYLLMVGLQFGSAGMYVISAQTLKNGMSRYVLIVYRNAIAALVLAPFALVLERKTR  73

Query  1186  PTMTTSIFFKIVllalleqlnlnLY-YVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT SIFF+I++L  LE +    + Y+G+ YT+A+ +  ++N +P++TF++A + RLE+
Sbjct  74    PKMTFSIFFQIIVLGFLEPILDQNFAYLGITYTSASFASAIMNAVPSVTFVIAVMLRLER  133

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             VKI+ +   AKI+GT     GA++MTL KGP   L     +N   S +      +H   +
Sbjct  134   VKIKEVRGIAKIIGTIVTFLGALVMTLYKGPSFHL--IGSANTAASGTGTDPSEKHW--V  189

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
               TL +   CC+ + F  LQ+  +K YPA LSL++LIC +G++Q + + L+ ER  A+ W
Sbjct  190   SGTLFILIGCCAWSAFFNLQSITVKKYPAELSLSSLICLMGAMQSAAVALVAERHPAA-W  248

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
              + WD  LL  VY G+V SG  YY+ GI+MK +GPVFVTAFNPL M++VA++ S +LSE+
Sbjct  249   RVGWDSRLLAPVYTGIVSSGITYYVQGIVMKTRGPVFVTAFNPLCMIIVAVLSSLILSER  308

Query  469   LYMgrvlgavvvlvglylviwGKSKDQTSPDNNDALPIDHKQ  344
             LY+G ++G +V+ +GLY V+WGK+KD ++P      P    Q
Sbjct  309   LYLGSIIGGIVIAIGLYSVVWGKAKDYSTPSQECVDPKAETQ  350



>gb|EMS46274.1| Auxin-induced protein 5NG4 [Triticum urartu]
Length=385

 Score =   256 bits (653),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 160/386 (41%), Positives = 242/386 (63%), Gaps = 25/386 (6%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             +D KPYL ++ LQV  AG  I++ A+L +GM+ F    YRN +A  + APFAL+ ER  R
Sbjct  7     SDVKPYLAMVLLQVGFAGMYIVAVASLKRGMSHFVLVVYRNLVATAVMAPFALYFERGLR  66

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT +IF KI+ LA LE  L+ NLYY+G + T+A     ++N++PA+TF+LA I R+EK
Sbjct  67    PKMTITIFIKIMGLAFLEPVLDQNLYYMGAKLTSAGFGAALINILPAVTFVLALIMRMEK  126

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             V++R+LHSQAKI GT   + GA++M L  GP +  PWTK  +     +A          +
Sbjct  127   VRLRSLHSQAKIAGTVLTVAGAVLMILYHGPTVQFPWTKGQHHAGGAAAGADAAAW---L  183

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
             K T+++  +C + + F +LQ++ ++ YP+ LSLT LIC +GS+  + + L+ ER N   W
Sbjct  184   KGTIMVIAACVAWSCFFVLQSSTLRDYPSELSLTVLICGVGSVMSTGVALVAERANTQAW  243

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
              + +D    T VY G+V SG  YY+ GI+ K +GPVFVTAFNPL M++ A++GS +L E+
Sbjct  244   VIGFDARFFTAVYAGIVCSGVAYYVQGIVSKQRGPVFVTAFNPLCMIITAVMGSIILKEE  303

Query  469   LYMgrvlgavvvlvglylviwGKSKDQTSPDNND----------ALPI------DHKQPQ  338
             + +G V+GAV+++VGLY +IWGKSKD+ +  ++D           LP+      + KQ +
Sbjct  304   ITLGSVIGAVIIVVGLYFLIWGKSKDKVNQVSDDFVAGSSKGAGELPLTSVTNDNGKQHE  363

Query  337   VVQG-FNKDITVSLN*KVELPRSHPH  263
             +  G FN    ++    VE P ++ H
Sbjct  364   LGNGQFNGGYVLN----VETPATNGH  385



>ref|XP_010096633.1| Auxin-induced protein 5NG4 [Morus notabilis]
 gb|EXB65301.1| Auxin-induced protein 5NG4 [Morus notabilis]
Length=378

 Score =   255 bits (651),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 154/344 (45%), Positives = 215/344 (63%), Gaps = 35/344 (10%)
 Frame = -3

Query  1363  DAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRP  1184
              AKP+L ++  QV  AG +I+SK ALNQGM+      YR+AIAA + APFA+ LER   P
Sbjct  12    QAKPFLFLILQQVGYAGMSIISKFALNQGMSQHVLVVYRHAIAAAVTAPFAIVLER---P  68

Query  1183  TMTTSIFFKIVllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVK  1004
              M  ++                 YY GM++TTAT +  M N++PA   ++AWIFRLEKV 
Sbjct  69    VMDQNL-----------------YYTGMKFTTATFATAMCNVLPAFALIMAWIFRLEKVN  111

Query  1003  IRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKA  824
             IR L SQAK++GT   +GGAM MTL  GPI+ LPWT  S     H    +   +    K 
Sbjct  112   IRKLPSQAKLIGTVVTVGGAMSMTLYNGPILNLPWTNQSTH---HPESMIAKNNQVSAKG  168

Query  823   TLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSL  644
              L++   C   + FIILQA  +KSYPA LSLT  +C +G++Q S++ L +E GN + WS+
Sbjct  169   ALMITAGCLCWSSFIILQAITLKSYPAELSLTAWMCLMGAVQGSVVALALEWGNPAAWSI  228

Query  643   QWDMTLLTYVY------------HGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVA  500
                  +L  +Y             G+ RSG  YYI G++MK KGPVFV AFNP+ +V+V 
Sbjct  229   CSGSMILAALYSFLSFNVVDGIWQGIFRSGFAYYIQGLVMKEKGPVFVAAFNPVGLVIVV  288

Query  499   IIGSFVLSEKLYMgrvlgavvvlvglylviwGKSKDQTSPDNND  368
             I+GSF+LSE +Y+GR++GA++++VGLYLV+WGKSKD+   ++++
Sbjct  289   ILGSFLLSEIMYLGRIIGAIIIIVGLYLVLWGKSKDERQSESSE  332



>ref|XP_010544709.1| PREDICTED: WAT1-related protein At4g08290 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010544717.1| PREDICTED: WAT1-related protein At4g08290 isoform X2 [Tarenaya 
hassleriana]
Length=389

 Score =   255 bits (652),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 155/359 (43%), Positives = 231/359 (64%), Gaps = 18/359 (5%)
 Frame = -3

Query  1393  NERVVKWLNNDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPF  1214
             +E   KW     KPY+ ++ LQ   AG  I+  A L++G N +   FYRNA+AA++ +PF
Sbjct  5     SEIFEKW-----KPYVLMICLQFGGAGMYIILMATLSRGQNRYVLIFYRNAVAALVLSPF  59

Query  1213  ALFLERKTRPTMTTSIFFKIVllalleqlnlnLY-YVGMRYTTATISVTMLNLIPAMTFL  1037
             ALF ERK RP MT ++F +I+ L  LE +    + Y+GM+ T+A+ +  ++N +P++TF+
Sbjct  60    ALFFERKVRPKMTFTVFLQIMALGFLEPILDQGFGYLGMKLTSASYTSAIMNALPSITFV  119

Query  1036  LAWIFRLEKVKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQH  857
             +A + R EKV I+ + SQAK++GT   +GGA+ MTL KGP++ LPW+  + D   H+   
Sbjct  120   IALVLRQEKVNIKEVRSQAKVIGTLVTLGGALAMTLYKGPVVPLPWSDQNLD--GHNGNT  177

Query  856   VLNQ-HSNPIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTL  680
                Q H++ I  T+L+   C + + F +LQ+  IK YPA LSL+ LIC  G+ Q   + L
Sbjct  178   NDTQDHAHWIAGTMLILLGCVAWSGFYVLQSITIKKYPAELSLSALICFAGAAQSLAVAL  237

Query  679   IVERGNASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVA  500
             ++ER  +S W++ WD  L   +Y G++ SG  YY+ G++MK +GPVFVTAFNPL MVLVA
Sbjct  238   VMER-RSSGWAVGWDARLFAPLYTGIISSGLTYYVQGMVMKTRGPVFVTAFNPLCMVLVA  296

Query  499   IIGSFVLSEKLYMgrvlgavvvlvglylviwGKSKDQTS-----PDNN---DALPIDHK  347
             ++ SF+L E++++G V+G VV+ VGLY V+WGK KD T      P+ N     LPI  K
Sbjct  297   VLASFILHEQIHLGSVIGGVVIAVGLYSVVWGKGKDYTEAGLVIPEKNKNLQELPITAK  355



>ref|XP_010063982.1| PREDICTED: WAT1-related protein At4g08290-like [Eucalyptus grandis]
 gb|KCW71271.1| hypothetical protein EUGRSUZ_F04360 [Eucalyptus grandis]
Length=369

 Score =   254 bits (650),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 150/342 (44%), Positives = 222/342 (65%), Gaps = 6/342 (2%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             N  KPYL ++ LQ  SAG  ++S   L  GM+ +    YRNAIAA++ APFAL LERK R
Sbjct  14    NKVKPYLLMVGLQFGSAGMYVISAQTLKNGMSRYVLIVYRNAIAALVLAPFALVLERKIR  73

Query  1186  PTMTTSIFFKIVllalleqlnlnLY-YVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT +IFF+I++L  LE +    + Y+G+ YT+A  +  ++N +P++TF++A + RLE+
Sbjct  74    PKMTFTIFFQIIVLGFLEPILDQNFSYLGITYTSAAFASAIMNAVPSVTFVMAVMLRLER  133

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             +KI+     AK+VGT     GA++MTL KGP   L   + +N   S +     ++H   +
Sbjct  134   LKIKEARGIAKVVGTIVTFLGALVMTLYKGPSFHL--IRATNTAPSGTGTEPSDKHW--V  189

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
               TL +   CC+ + F I+Q+  +K YPA LSL++LIC +G++Q + + L+ ER  A+ W
Sbjct  190   SGTLFILIGCCAWSAFFIVQSITVKKYPAELSLSSLICLMGAMQSAAVALVAERHPAA-W  248

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
              + WD  LL  VY G+V SG  YY+ GI+MK +GPVFVTAFNPL MV+VA +GS +LSE+
Sbjct  249   RVGWDSRLLASVYTGVVSSGVTYYVQGIVMKTRGPVFVTAFNPLCMVIVAALGSLILSEQ  308

Query  469   LYMgrvlgavvvlvglylviwGKSKDQTSPDNNDALPIDHKQ  344
             LY+G ++G +V+ +GLY V+WGK+KD ++P      P    Q
Sbjct  309   LYLGSIIGGIVIAIGLYSVVWGKAKDYSAPSQECVEPKAETQ  350



>ref|XP_009340891.1| PREDICTED: WAT1-related protein At4g08290-like [Pyrus x bretschneideri]
Length=394

 Score =   255 bits (652),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 156/347 (45%), Positives = 226/347 (65%), Gaps = 13/347 (4%)
 Frame = -3

Query  1357  KPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPTM  1178
             KPYL V+ LQ  SAG  I+S A LN GMN +    YRNA AA++ APFAL LERKTRP M
Sbjct  21    KPYLLVVSLQFGSAGMYIISMATLNHGMNRYVLIVYRNATAALVLAPFALVLERKTRPKM  80

Query  1177  TTSIFFKIVllalleqlnlnLY-YVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVKI  1001
             T S F  I++L  LE +    + Y+GM+YT+A+ +  ++N +P++TF++A IFR+E VKI
Sbjct  81    TISTFLHIMVLGFLEPVIDQGFTYLGMKYTSASFASAIMNAVPSVTFVIAVIFRVETVKI  140

Query  1000  RNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKAT  821
             + + SQAK++GT     GA++MTL KGP+I L W+  ++     S+  + N + + I  T
Sbjct  141   KEVRSQAKVIGTLVTFAGALLMTLYKGPVIDLLWSHKTSSHHESSSTTI-NSNQHWIAGT  199

Query  820   LLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSLQ  641
             L +     + + F +LQ+  +K YPA +SL+  IC  G+LQ S +   VER   S W++ 
Sbjct  200   LFILLGSVAWSCFYVLQSITVKKYPANISLSCFICLAGALQGSAVAFTVER-RPSAWAVG  258

Query  640   WDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLYM  461
             WD  LL  +Y G++ SG  YY+ G++MK +GPVFVTAFNPL M++V+I+GS +L+EKL++
Sbjct  259   WDSRLLAPLYTGIISSGITYYVQGLVMKTRGPVFVTAFNPLCMIIVSILGSIILAEKLHL  318

Query  460   grvlgavvvlvglylviwGKSKD-QTSP---------DNNDALPIDH  350
             G ++G +V+  GLY V+WGKSKD  T+P         D    LPI +
Sbjct  319   GSIIGGMVIAFGLYSVVWGKSKDYGTNPAVQSNTTVKDEAQELPITN  365



>ref|XP_008646318.1| PREDICTED: WAT1-related protein At1g44800-like [Zea mays]
 gb|AFW73640.1| hypothetical protein ZEAMMB73_930197 [Zea mays]
Length=394

 Score =   255 bits (651),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 148/331 (45%), Positives = 217/331 (66%), Gaps = 3/331 (1%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             ND KPYL ++ LQV  AG  I++ A+L +GM+ F    YRN  A  + APFAL+ ER  R
Sbjct  8     NDVKPYLAMVLLQVGFAGMYIVAVASLKRGMSHFVLVVYRNLCATAVMAPFALWFERNAR  67

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT +IF KI+ LA+LE  L+ NLYY+G   T+A  +  ++N++PA+TF++A + R+EK
Sbjct  68    PRMTITIFLKIMGLAMLEPVLDQNLYYMGANLTSAGFASALINILPAVTFVMALVLRMEK  127

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTK--HSNDVVSHSAQHVLNQHSN  836
             V++R++HSQAKI GT   + GA++M L  GP++  PW+K  H +D       +       
Sbjct  128   VRLRSVHSQAKIAGTVLTVAGAVLMVLYHGPVVQFPWSKGQHHHDSAGGQGANSAAAAGG  187

Query  835   PIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNAS  656
              +   + +  +C   + F +LQAN +KSYPA LSLT LIC +GSL    + L+ ER N  
Sbjct  188   FLTGIITIVIACVCWSAFFVLQANTLKSYPAELSLTALICLMGSLMSGSVALVAERRNTQ  247

Query  655   VWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLS  476
              W + +D  L T VY G+V SG  YY+ GI+ + +GPVFVTAFNPL M++ A++GS +L 
Sbjct  248   AWVIGFDTRLFTAVYAGIVCSGVAYYVQGIVSRQRGPVFVTAFNPLCMIITAVMGSIILK  307

Query  475   EKLYMgrvlgavvvlvglylviwGKSKDQTS  383
             E++ +G V+GA ++++GLY +IWGKSKD  +
Sbjct  308   EEITLGSVIGAAIIVLGLYALIWGKSKDSVA  338



>dbj|BAK04850.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=389

 Score =   255 bits (651),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 162/358 (45%), Positives = 229/358 (64%), Gaps = 14/358 (4%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
               AKPY+ ++ LQ   AG  +L+K +LN GM+ +    YR+A A +  APFAL LERK R
Sbjct  9     EKAKPYIAMISLQFGYAGMNVLTKVSLNGGMSHYVLVVYRHAFATLAIAPFALILERKVR  68

Query  1186  PTMTTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT SIFF+I VL  L   ++ N YYVG++YT  T +  M N++PAMTF++A IFR+EK
Sbjct  69    PQMTWSIFFQIFVLALLGPVIDQNFYYVGLKYTGPTFACAMSNILPAMTFVMAVIFRMEK  128

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             +++  L  QAKI GT   + GAM+MTL KGP++ LPWT  ++       +       +P 
Sbjct  129   IELTKLRCQAKIFGTVVTVAGAMLMTLYKGPLMHLPWT--NSHAQPGGGEAAGAAGVDPT  186

Query  829   K-----ATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERG  665
                    +L +  +  + A   ILQ + IK Y A LSLTTLIC +G++Q   +T ++ER 
Sbjct  187   AREWFLGSLFIIIATLAWASLFILQTHTIKKYTAQLSLTTLICFVGTIQAVAVTFVMER-  245

Query  664   NASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSF  485
               SVW++ +DM LL   Y G+V S   YY+ G++++  GPVF +AF+PL M++VA++GSF
Sbjct  246   RVSVWTIGFDMNLLAAAYAGIVTSSIAYYVQGLVIQKTGPVFASAFSPLMMIIVAVMGSF  305

Query  484   VLSEKLYMgrvlgavvvlvglylviwGKSKD--QTSPDNNDALPIDHKQPQ---VVQG  326
             +LSEK+Y+G VLGAVV++VGLY V+WGK K+  +   D   ALP+  K P    VVQG
Sbjct  306   ILSEKIYLGAVLGAVVIVVGLYAVLWGKHKETQEQEADAKVALPVASKGPDGTSVVQG  363



>ref|XP_002873292.1| hypothetical protein ARALYDRAFT_487525 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49551.1| hypothetical protein ARALYDRAFT_487525 [Arabidopsis lyrata subsp. 
lyrata]
Length=404

 Score =   255 bits (651),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 139/308 (45%), Positives = 202/308 (66%), Gaps = 8/308 (3%)
 Frame = -3

Query  1363  DAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRP  1184
              +KPY  ++ LQ   AG  I++K +LN GM+ +    YR+AIA  + APFA F ERK +P
Sbjct  15    SSKPYFAMISLQFGYAGMNIITKISLNTGMSHYVLVVYRHAIATAVIAPFAFFFERKAQP  74

Query  1183  TMTTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKV  1007
              +T SIF ++ +L  L   ++ N YY+G++YT+ T S  M N++PAMTF+LA +FR+E +
Sbjct  75    KITFSIFMQLFILGLLGPVIDQNFYYMGLKYTSPTFSCAMSNMLPAMTFILAVLFRMEML  134

Query  1006  KIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNP--  833
              ++ L  QAKI GT   +GGAM+MT+ KGPI+ L WTK+ +   S  A H  +  ++   
Sbjct  135   DVKKLWCQAKIGGTVVTVGGAMVMTIYKGPIVELFWTKYMHLQDSSHANHTTSSKNSSSD  194

Query  832   ---IKATLLLAGSCCSTAIFIILQANMIKSYPA-GLSLTTLICTIGSLQCSILTLIVERG  665
                +K ++LL  +  + A   +LQA ++K+Y    LSLTTLIC IG+LQ   +T ++E  
Sbjct  195   KEFLKGSILLIFATLAWASLFVLQAKILKTYAKHQLSLTTLICFIGTLQAVAVTFVMEH-  253

Query  664   NASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSF  485
             N SVW + WDM LL   Y G+V S   YY+ GI+MK +GPVF TAF+PL MV+VA+ GSF
Sbjct  254   NPSVWRIGWDMNLLAAAYSGIVASSISYYVQGIVMKKRGPVFATAFSPLMMVIVAVTGSF  313

Query  484   VLSEKLYM  461
             VL+EK+++
Sbjct  314   VLAEKIFL  321



>gb|ABR18253.1| unknown [Picea sitchensis]
Length=429

 Score =   256 bits (653),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 139/303 (46%), Positives = 203/303 (67%), Gaps = 5/303 (2%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
               +KPY+ ++ LQ   AG  I++K +L  GM+ +    YR+A+A  + APFA F+ERK R
Sbjct  17    ERSKPYIAMISLQFGYAGMNIITKVSLTNGMSHYVLVVYRHAVATAVIAPFAFFVERKVR  76

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P +T S+F +I  L LL   ++ N YY G++YT+ T +  M N++PAMTF++A +FR+EK
Sbjct  77    PKLTFSVFCQIFALGLLGPVIDQNFYYAGLKYTSPTFACAMSNVLPAMTFVMAALFRMEK  136

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             V I+ + SQ KI GT   + GAM+MTL KGPI+  P    ++     S   V +   +  
Sbjct  137   VDIKKVRSQTKIAGTVVCVAGAMLMTLYKGPIV--PIFGQAHHSHFSSPSSVHSDK-DWT  193

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
             K ++LL  +C + A F ILQA ++K Y A LSLTTLIC +G+LQ   +TL++ER + S+W
Sbjct  194   KGSVLLVAACLAWAAFFILQAAVLKQYSAQLSLTTLICFMGTLQSITITLVIER-DPSLW  252

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
             +L W+M LLT VY G+V SG  YY+ G+ MK+KGPVF TAF+PL M++VAI+GS +L+E 
Sbjct  253   ALGWNMNLLTAVYSGIVASGIAYYVQGLCMKLKGPVFATAFSPLMMIIVAIMGSIILAES  312

Query  469   LYM  461
             +Y+
Sbjct  313   IYL  315



>gb|EAZ36228.1| hypothetical protein OsJ_20548 [Oryza sativa Japonica Group]
Length=393

 Score =   254 bits (649),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 158/357 (44%), Positives = 226/357 (63%), Gaps = 20/357 (6%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             +DAKPY+ ++ LQV  AG  I+S A+L +GMN F    YRN +A V+ APFAL LER  R
Sbjct  8     SDAKPYVAMVLLQVGFAGMYIVSVASLKRGMNHFVLVVYRNLVATVLMAPFALLLERGVR  67

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT  IF KI+ LA+LE  L+ NLYY+G + T+A  +  ++N++PA+TFLLA + R+EK
Sbjct  68    PKMTLRIFLKIMGLAILEPVLDQNLYYMGAKLTSAGFASALVNILPAVTFLLAVLLRMEK  127

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNP-  833
             V++R+LHSQAKI GT   + GA++M +  GP++  PW+  ++    H         +   
Sbjct  128   VRLRSLHSQAKIAGTVFTVAGAVLMIMYHGPVVQFPWSSSASGSAGHHVDGAAAAAATAS  187

Query  832   -----IKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVER  668
                  +  T++L GSC   + F ILQ N ++SYPA LSLT LIC +GS     + L+ ER
Sbjct  188   SASSWLNGTVMLVGSCVCWSGFFILQNNTLQSYPAELSLTALICVLGSAMSGAVALVAER  247

Query  667   GNASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGS  488
              + SVW + +D  L T VY G+V SG  YY+ G++ + +GPVFVTAF PL M++ A++GS
Sbjct  248   RDMSVWVIGFDTRLFTAVYSGIVCSGVAYYVQGLVTRARGPVFVTAFQPLCMIITAVLGS  307

Query  487   FVLSEKLYMgrvlgavvvlvglylviwGKSKDQTSPDN-----------NDALPIDH  350
              +L E++ +G V+GAV+++VGLY +IWGK  D    DN            + L IDH
Sbjct  308   TILKEEITLGSVIGAVIIVVGLYALIWGKGGDHA--DNGKPPAAAAAAPGEGLAIDH  362



>gb|EAZ00107.1| hypothetical protein OsI_22111 [Oryza sativa Indica Group]
Length=389

 Score =   254 bits (649),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 138/307 (45%), Positives = 199/307 (65%), Gaps = 7/307 (2%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             +DAKPY+ ++ LQV  AG  I+S A+L +GMN F    YRN +A V+ APFAL LER  R
Sbjct  8     SDAKPYVAMVLLQVGFAGMYIVSVASLKRGMNHFVLVVYRNLVATVLMAPFALLLERGVR  67

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT  IF KI+ LA+LE  L+ NLYY+G + T+A  +  ++N++PA+TFLLA + R+EK
Sbjct  68    PKMTVRIFLKIMGLAILEPVLDQNLYYMGAKLTSAGFASALVNILPAVTFLLAVLLRMEK  127

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNP-  833
             V++R+LHSQAKI GT   + GA++M +  GP++  PW+  ++    H         +   
Sbjct  128   VRLRSLHSQAKIAGTVFTVAGAVLMIMYHGPVVQFPWSSSASGSAGHHVDGAAAAAATAS  187

Query  832   -----IKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVER  668
                  +  T++L GSC   + F ILQ N ++SYPA LSLT LIC +GS     + L+ ER
Sbjct  188   SASSWLNGTVMLVGSCVCWSGFFILQNNTLQSYPAELSLTALICVLGSAMSGAVALVAER  247

Query  667   GNASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGS  488
              + SVW + +D  L T VY G+V SG  YY+ G++ + +GPVFVTAF PL M++ A++GS
Sbjct  248   RDMSVWVIGFDTRLFTAVYSGIVCSGVAYYVQGLVTRARGPVFVTAFQPLCMIITAVLGS  307

Query  487   FVLSEKL  467
              +L E++
Sbjct  308   TILKEEI  314



>dbj|BAD35697.1| putative MtN21 [Oryza sativa Japonica Group]
Length=389

 Score =   254 bits (648),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 138/307 (45%), Positives = 199/307 (65%), Gaps = 7/307 (2%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             +DAKPY+ ++ LQV  AG  I+S A+L +GMN F    YRN +A V+ APFAL LER  R
Sbjct  8     SDAKPYVAMVLLQVGFAGMYIVSVASLKRGMNHFVLVVYRNLVATVLMAPFALLLERGVR  67

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT  IF KI+ LA+LE  L+ NLYY+G + T+A  +  ++N++PA+TFLLA + R+EK
Sbjct  68    PKMTLRIFLKIMGLAILEPVLDQNLYYMGAKLTSAGFASALVNILPAVTFLLAVLLRMEK  127

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNP-  833
             V++R+LHSQAKI GT   + GA++M +  GP++  PW+  ++    H         +   
Sbjct  128   VRLRSLHSQAKIAGTVFTVAGAVLMIMYHGPVVQFPWSSSASGSAGHHVDGAAAAAATAS  187

Query  832   -----IKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVER  668
                  +  T++L GSC   + F ILQ N ++SYPA LSLT LIC +GS     + L+ ER
Sbjct  188   SASSWLNGTVMLVGSCVCWSGFFILQNNTLQSYPAELSLTALICVLGSAMSGAVALVAER  247

Query  667   GNASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGS  488
              + SVW + +D  L T VY G+V SG  YY+ G++ + +GPVFVTAF PL M++ A++GS
Sbjct  248   RDMSVWVIGFDTRLFTAVYSGIVCSGVAYYVQGLVTRARGPVFVTAFQPLCMIITAVLGS  307

Query  487   FVLSEKL  467
              +L E++
Sbjct  308   TILKEEI  314



>gb|KHG18008.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=387

 Score =   254 bits (648),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 159/354 (45%), Positives = 232/354 (66%), Gaps = 8/354 (2%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             N  KPYL ++ LQ   AG  I+S   L  GM+ F  + YR+ +A ++ APFA+ LERK R
Sbjct  15    NTMKPYLAMVSLQFGYAGMYIVSMVCLKHGMSNFILATYRHVVATIVIAPFAIVLERKIR  74

Query  1186  PTMTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P MT  +F +IV L  LE  L+ N YY+GM+ TTAT S   +N++PA+TF+LA IFRLEK
Sbjct  75    PKMTLPVFLRIVALGFLEPVLDQNFYYLGMKLTTATYSSAFVNMLPAVTFILAMIFRLEK  134

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             V ++ + S AKI+GTA  + GAM+MTL KGPII   + K    V   +A    ++H   +
Sbjct  135   VNVKKIRSFAKIIGTAITVIGAMVMTLYKGPII--DFIKSGGAVHQGTATESADKHW--V  190

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
               T+LL GS CS A F ILQ+  +K YPA LSLT  IC +G ++ +I++LI+ R + S W
Sbjct  191   TGTILLLGSICSWAGFFILQSFTLKKYPAELSLTAWICFMGMIEDAIVSLIMVR-DLSAW  249

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
              + WD  LL   Y G+V SG  YY+ G++++ +GPVFVT+F+PL M++ AI+G+ +L+EK
Sbjct  250   KIGWDSRLLAASYSGIVNSGIAYYVQGVVIRQRGPVFVTSFSPLCMIITAILGAIILAEK  309

Query  469   LYMgrvlgavvvlvglylviwGKSKDQTSPDNNDALPIDHKQPQVVQGFNKDIT  308
             +++G +LGA++++ GLY V+WGKSKD  + + +  +  +  Q   + G  K IT
Sbjct  310   IHLGSILGAIIIVTGLYTVVWGKSKDGENSETD--VKCNGLQELPITGNAKSIT  361



>gb|KFK25097.1| hypothetical protein AALP_AA8G066000 [Arabis alpina]
Length=406

 Score =   254 bits (649),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 138/306 (45%), Positives = 201/306 (66%), Gaps = 5/306 (2%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
               +KPY  ++ LQ   AG  I++K +LN GM+ +    YR+AIA  + APFA F ERK +
Sbjct  14    KSSKPYFAMISLQFGYAGMNIITKISLNTGMSHYVLVVYRHAIATAVIAPFAFFFERKAQ  73

Query  1186  PTMTTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P +T +IF ++ +L  L   ++ N YYVG++YT+ T S  M N++PAMTF+LA IFR+E 
Sbjct  74    PKITFTIFVQLFILGLLGPVIDQNFYYVGLKYTSPTFSCAMSNMLPAMTFILAVIFRMEM  133

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNP-  833
             + ++ L  QAKI+GT   + GAM+MT+ KGPI+ L WTK+ +   S  A    N  S+  
Sbjct  134   LDVKKLWCQAKIIGTVVTVAGAMLMTIYKGPIVELFWTKYLHLQDSSHANESSNNTSDKD  193

Query  832   -IKATLLLAGSCCSTAIFIILQANMIKSYPA-GLSLTTLICTIGSLQCSILTLIVERGNA  659
              +K ++LL  +  + A   +LQA ++K+Y    LSLTTL+C IG+LQ   +T ++E  N 
Sbjct  194   FLKGSILLILATLAWASLFVLQARILKTYAKHQLSLTTLVCFIGTLQAIAVTFVMEH-NP  252

Query  658   SVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVL  479
             S W + WDM LL   Y G+V S   YY+ GI+MK +GPVF TAF+PL MV+VA++GSFVL
Sbjct  253   SAWRIGWDMNLLAAAYSGIVASSIAYYVQGIVMKKRGPVFATAFSPLMMVIVAVMGSFVL  312

Query  478   SEKLYM  461
             +EK+++
Sbjct  313   AEKIFL  318



>ref|XP_004253170.1| PREDICTED: WAT1-related protein At2g37460-like [Solanum lycopersicum]
Length=416

 Score =   254 bits (650),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 157/347 (45%), Positives = 238/347 (69%), Gaps = 11/347 (3%)
 Frame = -3

Query  1360  AKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPT  1181
             AKP+  V+FLQ+  +G  ILSK ALN+G + + +  YR A+A +  APFA+ L++  RP 
Sbjct  8     AKPFFAVVFLQLGLSGMYILSKMALNEGSSNYVYVVYRQAVATLFMAPFAIILDKGKRPK  67

Query  1180  MTTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVK  1004
             MT SIF K+VLL++LE  ++ NLY +G++YTTAT +  M N +PA+TF+++WIFR EKVK
Sbjct  68    MTFSIFAKLVLLSILEPVIDQNLYSLGLKYTTATFAAAMYNTLPAITFIMSWIFRQEKVK  127

Query  1003  IRNLHSQAKIVGTASAIGGAMIMTLVKGPII-LLPWTKH---SNDVVSH-SAQHVLNQHS  839
               ++ SQAKI+GT +  GGAMIM LV+GP + L P  ++   +ND     S   +LN   
Sbjct  128   FTSIGSQAKIIGTIATFGGAMIMMLVRGPEVQLFPTNEYYVNNNDASDQISGGIILN---  184

Query  838   NPIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNA  659
             + IK +L++   C S A FII Q  ++++YPA LSL T IC +G+++  I+ +I+ERGN+
Sbjct  185   DAIKGSLMIMLGCTSGAAFIIYQTKILQTYPAELSLHTWICLLGTVEGGIIAMIMERGNS  244

Query  658   SVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVL  479
             +VW +  D   L  VY G+  SG  YYI G+I++ +  +F++AFNPL++++VAII S +L
Sbjct  245   AVWIINLDSKFLAVVYSGIFGSGLAYYIQGVILEDRSSLFISAFNPLNILIVAIISSIIL  304

Query  478   SEKLYMgrvlgavvvlvglylviwGKSKDQT--SPDNNDALPIDHKQ  344
              E++ +GR+LG VV+++GLY+++WGKSKD    SP  ++   I  K+
Sbjct  305   QEQMNLGRILGVVVIIIGLYIILWGKSKDHKILSPSKDEQAIISPKK  351



>gb|KHG29314.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=296

 Score =   250 bits (639),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 147/282 (52%), Positives = 196/282 (70%), Gaps = 15/282 (5%)
 Frame = -3

Query  1111  YVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVKIRNLHSQAKIVGTASAIGGAMIMT  932
             Y GM+YTTAT +  M N++PA  FLLAWI +LEKV IR LHSQAKI+GT    GGAM+MT
Sbjct  7     YTGMKYTTATFTSAMTNVLPAFVFLLAWIVKLEKVNIRKLHSQAKILGTIVTFGGAMLMT  66

Query  931   LVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKATLLLAGSCCSTAIFIILQANMIKS  752
             L+ GP++ LPWTK +N+ V  SA  V     +PIK  L++   C   A FIILQA  +KS
Sbjct  67    LINGPMLPLPWTKSNNNHVFSSASAV---KQDPIKGALMIIFGCFCWAGFIILQAITLKS  123

Query  751   YPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSLQWDMTLLTYVYHGLVRSGAVYYIY  572
             YPA LSLT  IC  G++  SI+ L +E GNA+VWS+ +D+ LL  VY G++ SG  YY+ 
Sbjct  124   YPAELSLTAFICLAGTIGGSIVALAMEAGNAAVWSIHFDVKLLAAVYSGVICSGITYYVQ  183

Query  571   GIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLYMgrvlgavvvlvglylviwGKSKD  392
             G+IM+ +GPVFVTAFNPLSMV+VAI+ SF+LSE LY+GR++GA+V+++GLY+V+WGKSKD
Sbjct  184   GVIMRSRGPVFVTAFNPLSMVIVAILSSFILSEILYLGRIIGAIVIVIGLYMVLWGKSKD  243

Query  391   QTSPDNN----------DALPIDHKQPQVVQGFNKDITVSLN  296
             Q S + N            + ID  Q  ++   ++D  V L+
Sbjct  244   QCSSNQNIKVEEASNDQKMIVIDDHQTSIIS--DQDFVVVLD  283



>emb|CDX70003.1| BnaA10g23520D [Brassica napus]
Length=399

 Score =   254 bits (648),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 137/309 (44%), Positives = 201/309 (65%), Gaps = 11/309 (4%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
               +KPY  ++ LQ   AG  I++K +LN GM+ +    YR+AIA  + APFA F ERK +
Sbjct  14    KSSKPYFAMISLQFGYAGMNIITKISLNTGMSHYVLVVYRHAIATAVIAPFAFFFERKAQ  73

Query  1186  PTMTTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P +T +IF ++ +L  L   ++ N YY+G++YT+ T S  M N++PAMTF+LA +FR+E 
Sbjct  74    PKITFTIFMQLFILGLLGPVIDQNFYYMGLKYTSPTFSCAMSNMLPAMTFILAVLFRMEV  133

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTK-----HSNDVVSHSAQHVLNQ  845
             + ++ L  QAKI GT   + GAM+MT+ KGPI+ L WTK     H+ND    S     N 
Sbjct  134   LDVKKLWCQAKIAGTVVTVAGAMLMTIYKGPIVELFWTKYMHLQHANDTTPSSNS---ND  190

Query  844   HSNPIKATLLLAGSCCSTAIFIILQANMIKSYPA-GLSLTTLICTIGSLQCSILTLIVER  668
             + + +K ++LL  +  + A   +LQA ++K+Y    L+LTTL+C IG+LQ   +T ++E 
Sbjct  191   NKDFLKGSILLIFATLAWASLFVLQAKILKTYSKHQLTLTTLVCFIGTLQAVAVTFVMEH  250

Query  667   GNASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGS  488
              N S W + WDM LL   Y G+V S   YY+ GI+MK +GPVF TAF+PL MV+VAI+GS
Sbjct  251   -NPSAWRIGWDMNLLAAAYSGIVASSIAYYVQGIVMKKRGPVFATAFSPLMMVIVAIMGS  309

Query  487   FVLSEKLYM  461
             FVL+EK+++
Sbjct  310   FVLAEKIFL  318



>ref|XP_006482028.1| PREDICTED: WAT1-related protein At5g07050-like [Citrus sinensis]
Length=405

 Score =   253 bits (647),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 135/307 (44%), Positives = 206/307 (67%), Gaps = 9/307 (3%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
                KPY+ ++ LQ   AG  I++K +LN+GM+ +    YR+A A  + APFAL LERK R
Sbjct  12    QRCKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIAPFALLLERKVR  71

Query  1186  PTMTTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P +T  IF ++ VL  L   ++ N YY G+++T+ T S  M N++PAMTF++A + R+EK
Sbjct  72    PKITFPIFMQLFVLGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTFVMAVLCRMEK  131

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHV----LNQH  842
             V+I+ +  QAK+VGT   + GAM+MT+ KG +I L W++H   + SH++  V     +  
Sbjct  132   VEIKKIRCQAKMVGTIVTVAGAMLMTIYKGNVINLVWSQH---IHSHTSSPVPAATTSSD  188

Query  841   SNPIKATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGN  662
              + +K ++LL  +  + A F ILQA  ++ YPA LSLT ++C +G+LQ   +T ++E   
Sbjct  189   KDWLKGSILLILATLAWASFFILQAVTMRRYPAHLSLTAIVCFLGTLQSIAVTFVMEH-K  247

Query  661   ASVWSLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFV  482
             ASVW++ WDM LL   Y G+V SG  YY+ G++M+ +GPVFVTAF+PL M++VAI+GSF+
Sbjct  248   ASVWTIGWDMNLLAAAYAGIVSSGIAYYVQGLVMQKRGPVFVTAFSPLMMIIVAIMGSFI  307

Query  481   LSEKLYM  461
             L+EK+Y+
Sbjct  308   LAEKIYV  314



>ref|XP_008391905.1| PREDICTED: LOW QUALITY PROTEIN: WAT1-related protein At4g08300-like 
[Malus domestica]
 ref|XP_008351484.1| PREDICTED: WAT1-related protein At4g08300-like [Malus domestica]
Length=363

 Score =   252 bits (643),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 158/349 (45%), Positives = 225/349 (64%), Gaps = 16/349 (5%)
 Frame = -3

Query  1357  KPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPTM  1178
             KPYL ++ LQ   +G  I+S  +   GM+ F  S YR+ +A  + APFA  LERK RP M
Sbjct  14    KPYLAMVSLQFGYSGMYIISMVSFKHGMSHFVLSVYRHVVAFCVIAPFAFVLERKVRPRM  73

Query  1177  TTSIFFKIVllalle-qlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVKI  1001
             T  IF +IVLL  LE  L+ NLY++GM+YT+AT +  ++N++PA+TF++A  FRLE V +
Sbjct  74    TLPIFLRIVLLGFLEPVLDQNLYFLGMKYTSATFASAVVNVLPAITFIMALCFRLETVNV  133

Query  1000  RNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPIKAT  821
             + LHS AK++GT   +GGAMIMTL KGPI+ +    HS+   SH++    +   + I   
Sbjct  134   KKLHSLAKVIGTVITVGGAMIMTLYKGPIVDII-RGHSH---SHNSSTTESSEQHWIAGP  189

Query  820   LLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSLQ  641
             L+L GSC   A F ILQ+  +K YPA LSLT  IC +G L+  ++T  VER   SVW + 
Sbjct  190   LMLLGSCGGWASFFILQSFTLKKYPAELSLTAWICLMGMLEGGVITFAVER-KLSVWVIG  248

Query  640   WDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEKLYM  461
             WD  LL  VY G+V SG  YY+ G++++ +GPVFVTAF+PL M++ A +G+ VL+E++++
Sbjct  249   WDSRLLASVYSGVVCSGMAYYVQGVVIRERGPVFVTAFSPLCMIITAALGAIVLAEQVHL  308

Query  460   grvlgavvvlvglylviwGKSKD--------QTSPDNNDALPI--DHKQ  344
             G V+GA+ ++ GLY V+WGKSKD        +     N  LP+  DH  
Sbjct  309   GSVIGAICIVFGLYTVVWGKSKDPLASSAPLKDEKTRNLELPVSADHHN  357



>ref|XP_002489200.1| hypothetical protein SORBIDRAFT_0012s002110 [Sorghum bicolor]
 gb|EES20205.1| hypothetical protein SORBIDRAFT_0012s002110 [Sorghum bicolor]
Length=368

 Score =   252 bits (643),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 131/296 (44%), Positives = 199/296 (67%), Gaps = 6/296 (2%)
 Frame = -3

Query  1354  PYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTRPTMT  1175
             PY+ ++FLQ+  AG  ++S A+L QGM+ +    YRN  AA++ APFAL+ ERKTRP ++
Sbjct  12    PYMAMVFLQLGFAGMFLISVASLRQGMSHYVLVVYRNVAAAIVMAPFALWFERKTRPKLS  71

Query  1174  TSIFFKIVllalleqlnlnLY-YVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEKVKIR  998
              S+F KI+ L LLE +    + Y+G+  T+A+ +  + N++PA+TF+ A I R+E+++ +
Sbjct  72    LSVFIKILALGLLEPVLDQNFIYMGVNSTSASFASALTNILPALTFVNAIILRMERIETK  131

Query  997   NLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHS-NDVVSHSAQHVLNQHSNPIKAT  821
                S AKI GTA  +GGA++M L KGP +  PW+KH  ND VS S  H      + +  T
Sbjct  132   ERRSLAKIAGTAITVGGALLMILFKGPNVNCPWSKHVINDSVSDSGAH---NSGHWLMGT  188

Query  820   LLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVWSLQ  641
              ++  SC   + F ILQ+  ++SYP GLSLTTLIC  G+++   + L++ER +   WS+ 
Sbjct  189   FMILLSCFCWSAFFILQSYTLRSYPCGLSLTTLICATGAMESGAVALVMER-DTKAWSIG  247

Query  640   WDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSE  473
             +D+ L T VY G++ SG  YY+ GI++K +GPVFVTAF+PL M++V ++GSF+LSE
Sbjct  248   FDIRLFTAVYSGIMCSGVAYYVQGIVIKERGPVFVTAFSPLCMIIVTVLGSFILSE  303



>gb|KHG29659.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=377

 Score =   252 bits (643),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 150/335 (45%), Positives = 224/335 (67%), Gaps = 6/335 (2%)
 Frame = -3

Query  1366  NDAKPYLGVMFLQVTSAGSAILSKAALNQGMNPFTFSFYRNAIAAVIFAPFALFLERKTR  1187
             N AKPYL +  LQ   AG  +++  +L  GMN +  + YR+ +A ++ APFAL LERK R
Sbjct  10    NKAKPYLTMTSLQFGFAGMYVITMVSLQHGMNHYVLAVYRHLVATIVIAPFALVLERKIR  69

Query  1186  PTMTTSIFFKI-VllalleqlnlnLYYVGMRYTTATISVTMLNLIPAMTFLLAWIFRLEK  1010
             P +T  IF +I VL  L   ++ NLYY+GM+YTTAT++   +N+IPA+TF+LA IFRLEK
Sbjct  70    PKLTVPIFLRILVLGFLEPVIDQNLYYLGMKYTTATLASATVNVIPAITFVLALIFRLEK  129

Query  1009  VKIRNLHSQAKIVGTASAIGGAMIMTLVKGPIILLPWTKHSNDVVSHSAQHVLNQHSNPI  830
             V ++ +HS AKI+GT   + GA+IMTL KGP I   +TK      +H     + +  + +
Sbjct  130   VNLKKVHSIAKIIGTTIMVPGAVIMTLYKGPSI--SFTKFGGG--AHQTATNVAEAKHWV  185

Query  829   KATLLLAGSCCSTAIFIILQANMIKSYPAGLSLTTLICTIGSLQCSILTLIVERGNASVW  650
               TL+L G C   + F ILQ+  +K YPA LSLT LIC IG++  + ++  +ER + + W
Sbjct  186   VGTLMLLGRCWGWSGFYILQSFTLKMYPAELSLTALICFIGTIGGAAVSFAMER-DLNAW  244

Query  649   SLQWDMTLLTYVYHGLVRSGAVYYIYGIIMKVKGPVFVTAFNPLSMVLVAIIGSFVLSEK  470
              + WD +LL  VY G+V SG  YY  G++++ +GPVFVTAF+PL M++ A++GS +L+EK
Sbjct  245   KIGWDSSLLAAVYSGVVCSGIAYYAQGVVIREQGPVFVTAFSPLCMIITAVLGSMILAEK  304

Query  469   LYMgrvlgavvvlvglylviwGKSKDQTSPDNNDA  365
             +++G ++G V+++ GLY V+WGKSKD+ S +  + 
Sbjct  305   IHLGSIIGTVLIIFGLYTVLWGKSKDRKSSNTEEG  339



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4018413329892