BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c74476_g1_i1 len=132 path=[1:0-131]

Length=132
                                                                      Score     E

gb|KHG06856.1|  Purine permease 1 -like protein                       64.3    1e-10   
gb|KHG22236.1|  Purine permease 1 -like protein                       63.9    1e-10   
ref|XP_007018134.1|  Purine permease 3                                62.0    6e-10   
ref|XP_002307351.2|  PURINE PERMEASE 1 family protein                 62.0    6e-10   Populus trichocarpa [western balsam poplar]
gb|KDP41439.1|  hypothetical protein JCGZ_15846                       62.0    6e-10   
ref|XP_011006371.1|  PREDICTED: purine permease 3                     62.0    7e-10   
gb|KHG13700.1|  Purine permease 3 -like protein                       61.6    8e-10   
gb|KCW66597.1|  hypothetical protein EUGRSUZ_F00391                   59.3    3e-09   
ref|XP_002285719.1|  PREDICTED: purine permease 1-like                60.5    3e-09   Vitis vinifera
gb|AES73111.2|  purine permease-like protein                          60.5    3e-09   
ref|XP_010538168.1|  PREDICTED: purine permease 1-like                60.1    3e-09   
ref|XP_003602860.1|  Purine permease                                  60.5    3e-09   
ref|XP_002285718.1|  PREDICTED: purine permease 1                     59.7    4e-09   Vitis vinifera
ref|XP_002285717.1|  PREDICTED: purine permease 1                     59.7    4e-09   Vitis vinifera
ref|XP_004501676.1|  PREDICTED: purine permease 1-like isoform X1     59.3    6e-09   
ref|XP_010060066.1|  PREDICTED: purine permease 1-like                59.3    7e-09   
ref|XP_003602861.1|  Purine permease                                  58.2    8e-09   
ref|XP_004164781.1|  PREDICTED: purine permease 3-like                58.9    9e-09   
ref|XP_004152619.1|  PREDICTED: purine permease 3-like                58.9    1e-08   
emb|CDP01126.1|  unnamed protein product                              58.5    1e-08   
ref|XP_010098677.1|  Purine permease 3                                57.8    1e-08   
gb|AES73112.2|  purine permease-like protein                          58.5    1e-08   
ref|XP_002513994.1|  purine transporter, putative                     58.2    1e-08   Ricinus communis
ref|XP_008444876.1|  PREDICTED: purine permease 3-like                58.2    2e-08   
ref|XP_007018133.1|  Purine permease 3, putative                      57.8    2e-08   
gb|EPS67422.1|  hypothetical protein M569_07351                       57.4    2e-08   
ref|XP_004152618.1|  PREDICTED: purine permease 3-like                57.4    3e-08   
ref|XP_008444875.1|  PREDICTED: purine permease 3-like                57.4    3e-08   
gb|KCW66598.1|  hypothetical protein EUGRSUZ_F00392                   57.4    4e-08   
ref|XP_009143832.1|  PREDICTED: purine permease 2 isoform X1          57.0    4e-08   
gb|KCW51602.1|  hypothetical protein EUGRSUZ_J01094                   54.7    4e-08   
ref|XP_009143833.1|  PREDICTED: purine permease 2 isoform X2          57.0    4e-08   
emb|CDY27947.1|  BnaCnng05320D                                        57.0    5e-08   
ref|XP_010060067.1|  PREDICTED: purine permease 1-like                56.6    5e-08   
ref|XP_003522775.1|  PREDICTED: purine permease 1-like                56.2    9e-08   
ref|XP_010060063.1|  PREDICTED: purine permease 3-like isoform X1     55.8    1e-07   
ref|XP_007042880.1|  Purine permease 3                                55.5    2e-07   
ref|XP_009588639.1|  PREDICTED: purine permease 3-like                55.1    2e-07   
ref|XP_006410518.1|  hypothetical protein EUTSA_v10017788mg           55.1    2e-07   
gb|KDP40942.1|  hypothetical protein JCGZ_24941                       54.7    3e-07   
gb|KFK31021.1|  hypothetical protein AALP_AA6G057800                  54.3    3e-07   
gb|KDP40961.1|  hypothetical protein JCGZ_24960                       54.7    4e-07   
ref|XP_010460601.1|  PREDICTED: purine permease 1                     53.9    5e-07   
ref|XP_002531513.1|  purine transporter, putative                     53.9    6e-07   Ricinus communis
gb|EPS72255.1|  hypothetical protein M569_02503                       52.8    6e-07   
ref|XP_010499327.1|  PREDICTED: purine permease 1-like isoform X1     53.9    6e-07   
ref|XP_002893513.1|  hypothetical protein ARALYDRAFT_890360           53.5    7e-07   
ref|XP_010478191.1|  PREDICTED: purine permease 1-like                53.5    8e-07   
gb|AAF64547.1|AF078531_1  purine permease                             53.1    1e-06   Arabidopsis thaliana [mouse-ear cress]
ref|NP_174144.1|  purine permease 1                                   53.1    1e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006305203.1|  hypothetical protein CARUB_v10009570mg           52.8    1e-06   
ref|XP_007141230.1|  hypothetical protein PHAVU_008G178300g           52.8    1e-06   
ref|XP_010926345.1|  PREDICTED: purine permease 1-like isoform X2     52.0    1e-06   
ref|XP_008219366.1|  PREDICTED: purine permease 3-like                52.8    1e-06   
gb|EYU34537.1|  hypothetical protein MIMGU_mgv1a022801mg              52.8    2e-06   
ref|XP_007223326.1|  hypothetical protein PRUPE_ppa007339mg           52.8    2e-06   
ref|XP_006364706.1|  PREDICTED: purine permease 3-like                52.8    2e-06   
emb|CDP05635.1|  unnamed protein product                              50.4    2e-06   
gb|EYU21537.1|  hypothetical protein MIMGU_mgv1a018814mg              52.4    2e-06   
ref|XP_009109746.1|  PREDICTED: purine permease 1-like                52.4    2e-06   
ref|XP_010926344.1|  PREDICTED: purine permease 3-like isoform X1     52.4    2e-06   
ref|XP_007042882.1|  Purine permease 3 isoform 2                      52.4    2e-06   
ref|XP_007042881.1|  Purine permease 3 isoform 1                      52.4    2e-06   
gb|KFK44702.1|  hypothetical protein AALP_AA1G292000                  52.4    2e-06   
emb|CDP08377.1|  unnamed protein product                              52.4    2e-06   
ref|XP_007136297.1|  hypothetical protein PHAVU_009G034400g           52.0    2e-06   
ref|XP_004242795.1|  PREDICTED: purine permease 3-like                52.0    2e-06   
emb|CDP16579.1|  unnamed protein product                              51.6    2e-06   
ref|XP_004299691.1|  PREDICTED: purine permease 3-like                52.0    3e-06   
ref|XP_009373619.1|  PREDICTED: purine permease 3-like                51.6    4e-06   
ref|XP_006415682.1|  hypothetical protein EUTSA_v10008037mg           51.2    4e-06   
ref|XP_011072345.1|  PREDICTED: LOW QUALITY PROTEIN: purine perme...  51.2    5e-06   
emb|CDP19267.1|  unnamed protein product                              51.2    5e-06   
ref|XP_010098679.1|  Purine permease 3                                51.2    5e-06   
ref|XP_010509839.1|  PREDICTED: purine permease 2-like                51.2    5e-06   
ref|XP_010413817.1|  PREDICTED: purine permease 2-like                51.2    5e-06   
ref|XP_010509841.1|  PREDICTED: purine permease 2-like                51.2    5e-06   
ref|XP_010418647.1|  PREDICTED: purine permease 2-like                50.1    6e-06   
ref|XP_006433898.1|  hypothetical protein CICLE_v10001546mg           50.8    6e-06   
ref|XP_006472532.1|  PREDICTED: purine permease 1-like                50.8    6e-06   
ref|XP_002881298.1|  ATPUP2                                           50.8    7e-06   
ref|XP_008338896.1|  PREDICTED: purine permease 3-like                50.8    8e-06   
ref|XP_009373503.1|  PREDICTED: purine permease 3-like                50.8    8e-06   
ref|XP_010549316.1|  PREDICTED: purine permease 3                     50.4    8e-06   
gb|EPS65699.1|  hypothetical protein M569_09078                       50.4    9e-06   
ref|XP_010675382.1|  PREDICTED: purine permease 3-like                50.4    1e-05   
ref|XP_010413821.1|  PREDICTED: purine permease 2                     50.1    1e-05   
ref|XP_004299692.1|  PREDICTED: purine permease 3-like                50.1    1e-05   
ref|XP_006295883.1|  hypothetical protein CARUB_v10025013mg           50.1    1e-05   
ref|XP_010469434.1|  PREDICTED: purine permease 2-like                50.1    1e-05   
ref|XP_006305220.1|  hypothetical protein CARUB_v10009586mg           50.1    1e-05   
ref|XP_010478189.1|  PREDICTED: purine permease 3-like                49.7    1e-05   
ref|XP_002893512.1|  ATPUP3                                           49.7    1e-05   
ref|XP_010460596.1|  PREDICTED: purine permease 3                     49.7    1e-05   
ref|XP_008795222.1|  PREDICTED: purine permease 3-like                49.7    1e-05   
ref|NP_174143.1|  purine permease 3                                   49.7    2e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008446590.1|  PREDICTED: purine permease 3-like                49.7    2e-05   
ref|XP_008806390.1|  PREDICTED: purine permease 3-like                49.7    2e-05   
ref|XP_009766753.1|  PREDICTED: purine permease 3-like                49.3    2e-05   
ref|XP_009609429.1|  PREDICTED: purine permease 3-like                49.3    2e-05   
ref|XP_009615076.1|  PREDICTED: purine permease 3-like                49.3    2e-05   
ref|XP_009380885.1|  PREDICTED: purine permease 1-like                48.9    2e-05   
gb|EMS61796.1|  hypothetical protein TRIUR3_08587                     47.0    3e-05   
ref|XP_004158055.1|  PREDICTED: LOW QUALITY PROTEIN: purine perme...  48.9    3e-05   
gb|EMS63809.1|  Purine permease 3                                     48.9    3e-05   
gb|KGN64615.1|  hypothetical protein Csa_1G071290                     48.9    3e-05   
emb|CDX90135.1|  BnaA08g18490D                                        48.9    3e-05   
ref|XP_004146629.1|  PREDICTED: purine permease 3-like                48.9    3e-05   
dbj|BAG88745.1|  unnamed protein product                              48.5    3e-05   Oryza sativa Japonica Group [Japonica rice]
gb|EMT19524.1|  Purine permease 3                                     48.9    3e-05   
ref|XP_006661330.1|  PREDICTED: purine permease 3-like                48.9    4e-05   
dbj|BAK04933.1|  predicted protein                                    48.9    4e-05   
gb|EAZ09425.1|  hypothetical protein OsI_31698                        48.9    4e-05   Oryza sativa Indica Group [Indian rice]
ref|NP_001063424.1|  Os09g0467300                                     48.9    4e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010509840.1|  PREDICTED: purine permease 2-like                48.5    5e-05   
emb|CDP11456.1|  unnamed protein product                              48.1    6e-05   
ref|XP_010266586.1|  PREDICTED: purine permease 3-like                47.8    7e-05   
ref|XP_007227615.1|  hypothetical protein PRUPE_ppa022492mg           47.8    8e-05   
ref|NP_973592.1|  purine permease 2                                   47.8    8e-05   Arabidopsis thaliana [mouse-ear cress]
gb|AAC69140.1|  hypothetical protein                                  47.8    8e-05   Arabidopsis thaliana [mouse-ear cress]
ref|NP_180931.2|  purine permease 2                                   47.8    8e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009380886.1|  PREDICTED: purine permease 3-like                47.8    9e-05   
ref|XP_008219368.1|  PREDICTED: purine permease 3-like                47.8    9e-05   
ref|XP_010939717.1|  PREDICTED: purine permease 3-like isoform X2     47.4    1e-04   
dbj|BAJ88843.1|  predicted protein                                    47.4    1e-04   
emb|CDY35722.1|  BnaC03g58430D                                        47.0    1e-04   
ref|XP_009109745.1|  PREDICTED: purine permease 1                     47.0    1e-04   
dbj|BAJ87663.1|  predicted protein                                    47.0    1e-04   
ref|XP_006415683.1|  hypothetical protein EUTSA_v10009673mg           47.0    1e-04   
ref|XP_010939716.1|  PREDICTED: purine permease 1-like isoform X1     47.0    2e-04   
ref|XP_010322002.1|  PREDICTED: LOW QUALITY PROTEIN: purine perme...  47.0    2e-04   
emb|CDY15687.1|  BnaA07g08580D                                        46.6    2e-04   
ref|XP_010499329.1|  PREDICTED: purine permease 3-like                46.6    2e-04   
ref|XP_010064227.1|  PREDICTED: purine permease 3-like                46.6    2e-04   
ref|XP_003578263.2|  PREDICTED: purine permease 3-like                46.6    2e-04   
emb|CDY72169.1|  BnaCnng76300D                                        46.2    2e-04   
emb|CDX94595.1|  BnaC07g10630D                                        46.6    2e-04   
ref|XP_009102926.1|  PREDICTED: purine permease 3                     46.6    2e-04   
ref|XP_010549318.1|  PREDICTED: purine permease 3-like                46.6    2e-04   
ref|XP_010247465.1|  PREDICTED: purine permease 3-like                46.6    2e-04   
ref|XP_008667894.1|  PREDICTED: PUP1 isoform X1                       46.6    2e-04   
ref|XP_010538169.1|  PREDICTED: purine permease 3-like                46.2    2e-04   
ref|NP_001147096.1|  PUP1                                             46.2    2e-04   Zea mays [maize]
dbj|BAJ95836.1|  predicted protein                                    46.2    3e-04   
ref|XP_010098678.1|  Purine permease 1                                46.2    3e-04   
ref|XP_010439890.1|  PREDICTED: probable purine permease 8            45.8    4e-04   
emb|CDY17197.1|  BnaA05g09910D                                        45.8    4e-04   
gb|KFK44691.1|  hypothetical protein AALP_AA1G290900                  45.8    4e-04   
ref|XP_009113691.1|  PREDICTED: purine permease 1-like                45.8    4e-04   
ref|XP_010939715.1|  PREDICTED: purine permease 3-like                45.8    4e-04   
ref|XP_004959530.1|  PREDICTED: purine permease 1-like                45.4    6e-04   
ref|XP_010244044.1|  PREDICTED: purine permease 1-like                45.4    6e-04   
ref|XP_009789614.1|  PREDICTED: purine permease 1-like                44.7    6e-04   
ref|XP_009603730.1|  PREDICTED: purine permease 3-like                45.1    7e-04   
gb|EPS58788.1|  hypothetical protein M569_16026                       44.7    8e-04   
ref|XP_010248452.1|  PREDICTED: purine permease 3-like                44.7    8e-04   
ref|XP_009765499.1|  PREDICTED: purine permease 1-like                44.7    8e-04   
ref|XP_009769306.1|  PREDICTED: purine permease 1-like                44.7    8e-04   
ref|XP_009776518.1|  PREDICTED: purine permease 1-like                44.7    9e-04   
ref|XP_006357923.1|  PREDICTED: purine permease 3-like                44.7    9e-04   
ref|NP_001031662.1|  purine permease 8                                44.7    0.001   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006338102.1|  PREDICTED: purine permease 1-like                44.7    0.001   
ref|XP_009401279.1|  PREDICTED: purine permease 1-like                44.7    0.001   
ref|XP_004237962.1|  PREDICTED: purine permease 3-like                44.7    0.001   
ref|XP_006414136.1|  hypothetical protein EUTSA_v10025391mg           44.7    0.001   
ref|XP_010942638.1|  PREDICTED: purine permease 3-like isoform X2     44.7    0.001   



>gb|KHG06856.1| Purine permease 1 -like protein [Gossypium arboreum]
Length=374

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+ASQLAFTAG AFLLVKQ+FT +++NAV LLTI AGVLA+
Sbjct  136  LIIASQLAFTAGFAFLLVKQKFTAYSINAVFLLTIGAGVLAL  177



>gb|KHG22236.1| Purine permease 1 -like protein [Gossypium arboreum]
Length=357

 Score = 63.9 bits (154),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+ASQLAFTAG AFLLVKQ+FT +++NAV LLTI AGVLA+
Sbjct  119  LIIASQLAFTAGFAFLLVKQKFTAYSINAVFLLTIGAGVLAL  160



>ref|XP_007018134.1| Purine permease 3 [Theobroma cacao]
 gb|EOY15359.1| Purine permease 3 [Theobroma cacao]
Length=356

 Score = 62.0 bits (149),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAVG  3
            LI+A+QLAFTAG AFLLVKQ+FT +++NAV LLTI AGVLA+ 
Sbjct  121  LIIAAQLAFTAGFAFLLVKQKFTSYSINAVFLLTIGAGVLALN  163



>ref|XP_002307351.2| PURINE PERMEASE 1 family protein [Populus trichocarpa]
 gb|EEE94347.2| PURINE PERMEASE 1 family protein [Populus trichocarpa]
Length=356

 Score = 62.0 bits (149),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+A+QLAFTAG AFLLVKQ+FT +++NAV+LLT+ AGVLA+
Sbjct  120  LIIATQLAFTAGFAFLLVKQKFTSYSINAVVLLTVGAGVLAM  161



>gb|KDP41439.1| hypothetical protein JCGZ_15846 [Jatropha curcas]
Length=359

 Score = 62.0 bits (149),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+A+QLAFTAG AFLLVKQ+FT +++NAV+LLT+ AGVLA+
Sbjct  124  LIIATQLAFTAGFAFLLVKQKFTSYSINAVVLLTVGAGVLAL  165



>ref|XP_011006371.1| PREDICTED: purine permease 3 [Populus euphratica]
Length=356

 Score = 62.0 bits (149),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+A+QLAFTAG AFLLVKQ+FT +++NAV+LLT+ AGVLA+
Sbjct  120  LIIATQLAFTAGFAFLLVKQKFTSYSINAVVLLTVGAGVLAM  161



>gb|KHG13700.1| Purine permease 3 -like protein [Gossypium arboreum]
 gb|KHG19122.1| Purine permease 3 -like protein [Gossypium arboreum]
Length=358

 Score = 61.6 bits (148),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+ASQLAFTAG AF+LVKQ+FT +++NAV LLTI +GVLA+
Sbjct  123  LIIASQLAFTAGFAFVLVKQKFTSYSINAVFLLTIGSGVLAM  164



>gb|KCW66597.1| hypothetical protein EUGRSUZ_F00391 [Eucalyptus grandis]
Length=261

 Score = 59.3 bits (142),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            L++A+QLAFTAG AFLLV+Q+FT +++N+V LLT+AAGVLA+
Sbjct  139  LLIATQLAFTAGFAFLLVRQQFTSYSINSVYLLTVAAGVLAL  180



>ref|XP_002285719.1| PREDICTED: purine permease 1-like [Vitis vinifera]
Length=351

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LIVASQLAFTA  AFLLVKQ+FT ++VNA+ LL+I AGVLA+
Sbjct  119  LIVASQLAFTAAFAFLLVKQKFTSYSVNAIFLLSIGAGVLAL  160



>gb|AES73111.2| purine permease-like protein [Medicago truncatula]
Length=371

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+ASQL FTA  AFLLVKQ+FT FTVNAV LLT+ AGVLA+
Sbjct  134  LIIASQLGFTAFFAFLLVKQKFTAFTVNAVFLLTVGAGVLAM  175



>ref|XP_010538168.1| PREDICTED: purine permease 1-like [Tarenaya hassleriana]
Length=359

 Score = 60.1 bits (144),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+ASQLAFTA  AFLLVKQ+FT F+VNAV+LLT+ AGVLA+
Sbjct  121  LIIASQLAFTALFAFLLVKQKFTPFSVNAVVLLTVGAGVLAL  162



>ref|XP_003602860.1| Purine permease [Medicago truncatula]
Length=440

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+ASQL FTA  AFLLVKQ+FT FTVNAV LLT+ AGVLA+
Sbjct  134  LIIASQLGFTAFFAFLLVKQKFTAFTVNAVFLLTVGAGVLAM  175



>ref|XP_002285718.1| PREDICTED: purine permease 1 [Vitis vinifera]
Length=351

 Score = 59.7 bits (143),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+ASQLAFTA  AFLLVKQ+FT ++VNA+ LL+I AGVLA+
Sbjct  119  LIIASQLAFTAAFAFLLVKQKFTSYSVNAIFLLSIGAGVLAL  160



>ref|XP_002285717.1| PREDICTED: purine permease 1 [Vitis vinifera]
 emb|CAN64392.1| hypothetical protein VITISV_015235 [Vitis vinifera]
Length=349

 Score = 59.7 bits (143),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+ASQLAFTA  AFLLVKQ+FT ++VNA+ LL+I AGVLA+
Sbjct  117  LIIASQLAFTAAFAFLLVKQKFTSYSVNAIFLLSIGAGVLAL  158



>ref|XP_004501676.1| PREDICTED: purine permease 1-like isoform X1 [Cicer arietinum]
 ref|XP_004501677.1| PREDICTED: purine permease 1-like isoform X2 [Cicer arietinum]
Length=367

 Score = 59.3 bits (142),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+ASQL FTA  AFLLVKQ+FT F++NAV+LLTI AGVLA+
Sbjct  129  LIIASQLGFTAVFAFLLVKQKFTAFSINAVVLLTIGAGVLAM  170



>ref|XP_010060066.1| PREDICTED: purine permease 1-like [Eucalyptus grandis]
Length=367

 Score = 59.3 bits (142),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            L++A+QLAFTAG AFLLV+Q+FT +++N+V LLT+AAGVLA+
Sbjct  139  LLIATQLAFTAGFAFLLVRQQFTSYSINSVYLLTVAAGVLAL  180



>ref|XP_003602861.1| Purine permease [Medicago truncatula]
Length=274

 Score = 58.2 bits (139),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+ASQL FTA  AFL+VK++FT FTVNAV+LLT+ AGVLA+
Sbjct  133  LIIASQLGFTAFFAFLIVKEKFTAFTVNAVVLLTVGAGVLAM  174



>ref|XP_004164781.1| PREDICTED: purine permease 3-like [Cucumis sativus]
Length=371

 Score = 58.9 bits (141),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+ASQLAFTAG A+LLVKQ+FT +TVNAV+LLT+   +LA+
Sbjct  134  LIIASQLAFTAGFAYLLVKQKFTSYTVNAVVLLTMGGAILAL  175



>ref|XP_004152619.1| PREDICTED: purine permease 3-like [Cucumis sativus]
 gb|KGN62723.1| hypothetical protein Csa_2G369740 [Cucumis sativus]
Length=371

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+ASQLAFTAG A+LLVKQ+FT +TVNAV+LLT+   +LA+
Sbjct  134  LIIASQLAFTAGFAYLLVKQKFTSYTVNAVVLLTMGGAILAL  175



>emb|CDP01126.1| unnamed protein product [Coffea canephora]
Length=353

 Score = 58.5 bits (140),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            +I+ASQLAFTA  AFLLVKQ+FT ++VNAV+LLT+ AGVLA+
Sbjct  117  IIIASQLAFTAVFAFLLVKQKFTAYSVNAVVLLTVGAGVLAM  158



>ref|XP_010098677.1| Purine permease 3 [Morus notabilis]
 gb|EXB75580.1| Purine permease 3 [Morus notabilis]
Length=273

 Score = 57.8 bits (138),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+ASQLAFTA  A+LLVKQ+FT ++VNAV+LLTIA  VLA+
Sbjct  119  LIIASQLAFTAAFAYLLVKQKFTSYSVNAVVLLTIAGAVLAL  160



>gb|AES73112.2| purine permease-like protein [Medicago truncatula]
Length=370

 Score = 58.5 bits (140),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+ASQL FTA  AFL+VK++FT FTVNAV+LLT+ AGVLA+
Sbjct  133  LIIASQLGFTAFFAFLIVKEKFTAFTVNAVVLLTVGAGVLAM  174



>ref|XP_002513994.1| purine transporter, putative [Ricinus communis]
 gb|EEF48577.1| purine transporter, putative [Ricinus communis]
Length=356

 Score = 58.2 bits (139),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+A+QLAFTA  AFLLVKQ+FT F++NAV+LLT  AGVLA+
Sbjct  121  LIIATQLAFTAAFAFLLVKQKFTSFSINAVVLLTAGAGVLAL  162



>ref|XP_008444876.1| PREDICTED: purine permease 3-like [Cucumis melo]
Length=359

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+ASQLAFTAG A+LLVKQ+FT +TVN+V+LLT+   +LA+
Sbjct  121  LIIASQLAFTAGFAYLLVKQKFTSYTVNSVVLLTMGGAILAL  162



>ref|XP_007018133.1| Purine permease 3, putative [Theobroma cacao]
 gb|EOY15358.1| Purine permease 3, putative [Theobroma cacao]
Length=410

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            +++ASQLAFTA  AF+LVKQ+FT ++VNAV LLT+ AGVLA+
Sbjct  110  IVIASQLAFTAAFAFILVKQKFTSYSVNAVFLLTVGAGVLAL  151



>gb|EPS67422.1| hypothetical protein M569_07351, partial [Genlisea aurea]
Length=319

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+ASQL FTA  A+L+VKQ+FT F++NAV+LLT+AAG+LA+
Sbjct  107  LIIASQLGFTAVFAYLIVKQKFTAFSINAVVLLTVAAGILAL  148



>ref|XP_004152618.1| PREDICTED: purine permease 3-like [Cucumis sativus]
 ref|XP_004174047.1| PREDICTED: purine permease 3-like [Cucumis sativus]
 gb|KGN62722.1| hypothetical protein Csa_2G369730 [Cucumis sativus]
Length=363

 Score = 57.4 bits (137),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+A QLAFTAG AFLLVKQ+FT +++NAV+LLTI   VLA+
Sbjct  128  LIIACQLAFTAGFAFLLVKQKFTSYSINAVVLLTIGGAVLAL  169



>ref|XP_008444875.1| PREDICTED: purine permease 3-like [Cucumis melo]
Length=365

 Score = 57.4 bits (137),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+A QLAFTAG AFLLVKQ+FT +++NAV+LLTI   VLA+
Sbjct  130  LIIACQLAFTAGFAFLLVKQKFTSYSINAVVLLTIGGAVLAL  171



>gb|KCW66598.1| hypothetical protein EUGRSUZ_F00392 [Eucalyptus grandis]
Length=480

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            L++A+QLAFTAG AFLLV+QRFT  ++N++ LLTI AGVL++
Sbjct  241  LLIATQLAFTAGFAFLLVRQRFTSCSINSIFLLTIGAGVLSM  282



>ref|XP_009143832.1| PREDICTED: purine permease 2 isoform X1 [Brassica rapa]
Length=351

 Score = 57.0 bits (136),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI++SQLAFTA  AF +VKQRFT FT+NAV+LLT+ AG LA+
Sbjct  115  LIISSQLAFTALFAFFMVKQRFTPFTINAVVLLTLGAGSLAL  156



>gb|KCW51602.1| hypothetical protein EUGRSUZ_J01094 [Eucalyptus grandis]
Length=118

 Score = 54.7 bits (130),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            L++A+QLAFTAG AFLLV+Q+FT ++ N++ LLT+ AG+LA+
Sbjct  37   LLIATQLAFTAGFAFLLVRQQFTSYSNNSIFLLTMGAGILAM  78



>ref|XP_009143833.1| PREDICTED: purine permease 2 isoform X2 [Brassica rapa]
Length=362

 Score = 57.0 bits (136),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI++SQLAFTA  AF +VKQRFT FT+NAV+LLT+ AG LA+
Sbjct  115  LIISSQLAFTALFAFFMVKQRFTPFTINAVVLLTLGAGSLAL  156



>emb|CDY27947.1| BnaCnng05320D [Brassica napus]
Length=349

 Score = 57.0 bits (136),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI++SQLAFTA  AF +VKQRFT FT+NAV+LLT+ AG LA+
Sbjct  114  LIISSQLAFTALFAFFMVKQRFTPFTINAVVLLTLGAGSLAL  155



>ref|XP_010060067.1| PREDICTED: purine permease 1-like [Eucalyptus grandis]
Length=360

 Score = 56.6 bits (135),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            L++A+QLAFTAG AFLLV+QRFT  ++N++ LLTI AGVL++
Sbjct  121  LLIATQLAFTAGFAFLLVRQRFTSCSINSIFLLTIGAGVLSM  162



>ref|XP_003522775.1| PREDICTED: purine permease 1-like [Glycine max]
Length=357

 Score = 56.2 bits (134),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+A+QL FTA  AFLLV+Q+FT ++VNAV+LLT+ AGVLA+
Sbjct  124  LIIATQLGFTAFFAFLLVRQKFTAYSVNAVVLLTVGAGVLAL  165



>ref|XP_010060063.1| PREDICTED: purine permease 3-like isoform X1 [Eucalyptus grandis]
 ref|XP_010060064.1| PREDICTED: purine permease 3-like isoform X2 [Eucalyptus grandis]
 ref|XP_010060065.1| PREDICTED: purine permease 3-like isoform X1 [Eucalyptus grandis]
 gb|KCW66595.1| hypothetical protein EUGRSUZ_F00389 [Eucalyptus grandis]
Length=360

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            L++A+QLAFTAG AFLLV+Q FT ++VN+V LLT+ AGVLA+
Sbjct  121  LLIATQLAFTAGFAFLLVRQLFTSYSVNSVFLLTMGAGVLAM  162



>ref|XP_007042880.1| Purine permease 3 [Theobroma cacao]
 gb|EOX98711.1| Purine permease 3 [Theobroma cacao]
Length=419

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+++QLAFTA  AFLLVKQ+FT FT+N+V LLT+ A VLA+
Sbjct  194  LIISTQLAFTAAFAFLLVKQKFTSFTINSVFLLTVGAVVLAL  235



>ref|XP_009588639.1| PREDICTED: purine permease 3-like [Nicotiana tomentosiformis]
Length=356

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            L++ASQLAFTAG AFLLVKQ+F+ +++N++ LLT+ A VLA+
Sbjct  132  LLIASQLAFTAGFAFLLVKQKFSAYSINSIYLLTLGAVVLAL  173



>ref|XP_006410518.1| hypothetical protein EUTSA_v10017788mg [Eutrema salsugineum]
 gb|ESQ51971.1| hypothetical protein EUTSA_v10017788mg [Eutrema salsugineum]
Length=372

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI++SQLAFTA  AF +VKQ+FT F +NAV+LLT+ AG+LA+
Sbjct  134  LIISSQLAFTALFAFFMVKQKFTPFVINAVVLLTLGAGILAL  175



>gb|KDP40942.1| hypothetical protein JCGZ_24941 [Jatropha curcas]
Length=355

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+A+QL FTAG A++LVKQ+FT FT+NA+ LL+I A VL +
Sbjct  129  LIIATQLGFTAGFAYILVKQKFTPFTINAIFLLSIGAVVLVI  170



>gb|KFK31021.1| hypothetical protein AALP_AA6G057800 [Arabis alpina]
Length=317

 Score = 54.3 bits (129),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI++SQLAFTA  AF LVK +FT FT+NA++L+TI +G+LA+
Sbjct  111  LILSSQLAFTALFAFFLVKHKFTPFTINAIVLITIGSGILAL  152



>gb|KDP40961.1| hypothetical protein JCGZ_24960 [Jatropha curcas]
Length=472

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+A+QL FTAG A++LVKQ+FT FT+NA+ LL+I A VL +
Sbjct  246  LIIATQLGFTAGFAYILVKQKFTPFTINAIFLLSIGAVVLVI  287



>ref|XP_010460601.1| PREDICTED: purine permease 1 [Camelina sativa]
Length=354

 Score = 53.9 bits (128),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+ +QLAF A  AFLLVKQ+FT F+VNAV+LLT+  G+LA+
Sbjct  113  LIIGTQLAFNALFAFLLVKQKFTPFSVNAVVLLTVGTGILAL  154



>ref|XP_002531513.1| purine transporter, putative [Ricinus communis]
 gb|EEF30867.1| purine transporter, putative [Ricinus communis]
Length=380

 Score = 53.9 bits (128),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVL  12
            LI+A+QL FTAG A++LVKQ+FT FTVNA+ LL+I A VL
Sbjct  154  LIIATQLGFTAGFAYVLVKQKFTPFTVNAIFLLSIGAVVL  193



>gb|EPS72255.1| hypothetical protein M569_02503, partial [Genlisea aurea]
Length=232

 Score = 52.8 bits (125),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+ASQLAFTA   F LVKQ+FT +++NAV+LLT  A VLA+
Sbjct  22   LIIASQLAFTAVFCFFLVKQKFTPYSINAVVLLTCGAAVLAM  63



>ref|XP_010499327.1| PREDICTED: purine permease 1-like isoform X1 [Camelina sativa]
 ref|XP_010499328.1| PREDICTED: purine permease 1-like isoform X2 [Camelina sativa]
Length=354

 Score = 53.9 bits (128),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+ +QLAF A  AFLLVKQ+FT F+VNAV+LLT+  G+LA+
Sbjct  113  LIIGTQLAFNALFAFLLVKQKFTPFSVNAVVLLTVGTGILAL  154



>ref|XP_002893513.1| hypothetical protein ARALYDRAFT_890360 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69772.1| hypothetical protein ARALYDRAFT_890360 [Arabidopsis lyrata subsp. 
lyrata]
Length=356

 Score = 53.5 bits (127),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+ +QLAF A  AFLLVKQ+FT F++NAV+LLT+  G+LA+
Sbjct  117  LIIGTQLAFNALFAFLLVKQKFTPFSINAVVLLTVGTGILAL  158



>ref|XP_010478191.1| PREDICTED: purine permease 1-like [Camelina sativa]
Length=354

 Score = 53.5 bits (127),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+ +QLAF A  AFLLVKQ+FT F++NAV+LLT+  G+LA+
Sbjct  113  LIIGTQLAFNALFAFLLVKQKFTPFSINAVVLLTVGTGILAL  154



>gb|AAF64547.1|AF078531_1 purine permease [Arabidopsis thaliana]
Length=356

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+ +QLAF A  AFLLVKQ+FT F++NAV+LLT+  G+LA+
Sbjct  117  LIIGTQLAFNALFAFLLVKQKFTPFSINAVVLLTVGIGILAL  158



>ref|NP_174144.1| purine permease 1 [Arabidopsis thaliana]
 sp|Q9FZ96.1|PUP1_ARATH RecName: Full=Purine permease 1; Short=AtPUP1 [Arabidopsis thaliana]
 gb|AAF98432.1|AC021044_11 purine permease [Arabidopsis thaliana]
 dbj|BAC42317.1| putative purine permease [Arabidopsis thaliana]
 gb|AAO63924.1| putative purine permease [Arabidopsis thaliana]
 gb|AEE30934.1| purine permease 1 [Arabidopsis thaliana]
Length=356

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+ +QLAF A  AFLLVKQ+FT F++NAV+LLT+  G+LA+
Sbjct  117  LIIGTQLAFNALFAFLLVKQKFTPFSINAVVLLTVGIGILAL  158



>ref|XP_006305203.1| hypothetical protein CARUB_v10009570mg [Capsella rubella]
 gb|EOA38101.1| hypothetical protein CARUB_v10009570mg [Capsella rubella]
Length=355

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LIV +QLAF A  +FLLVKQ+FT F++NAV+LLT+  G+LA+
Sbjct  115  LIVGTQLAFNALFSFLLVKQKFTPFSINAVVLLTVGTGILAL  156



>ref|XP_007141230.1| hypothetical protein PHAVU_008G178300g [Phaseolus vulgaris]
 gb|ESW13224.1| hypothetical protein PHAVU_008G178300g [Phaseolus vulgaris]
Length=344

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI AS LAFTA  AFLLVK RFT ++VNA++LLT+AA VLA+
Sbjct  109  LIQASHLAFTAVFAFLLVKHRFTAYSVNAIVLLTVAAVVLAL  150



>ref|XP_010926345.1| PREDICTED: purine permease 1-like isoform X2 [Elaeis guineensis]
Length=256

 Score = 52.0 bits (123),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAVG  3
            L++ASQLAFTA  +FL+V+QRFT F++NAV+LLT+   VL++G
Sbjct  136  LLIASQLAFTAVFSFLIVRQRFTAFSLNAVVLLTLGPVVLSLG  178



>ref|XP_008219366.1| PREDICTED: purine permease 3-like [Prunus mume]
Length=368

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+A+QLAFTA  AFLLVKQ+FT ++ NAV+LLTI A VL +
Sbjct  121  LIIAAQLAFTALFAFLLVKQKFTSYSTNAVVLLTIGAAVLGL  162



>gb|EYU34537.1| hypothetical protein MIMGU_mgv1a022801mg, partial [Erythranthe 
guttata]
Length=349

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+ASQLAFTA  AFL+VKQ FT ++VN+V+LLT+ A VL +
Sbjct  110  LIIASQLAFTAAFAFLMVKQEFTAYSVNSVVLLTLGAVVLGL  151



>ref|XP_007223326.1| hypothetical protein PRUPE_ppa007339mg [Prunus persica]
 gb|EMJ24525.1| hypothetical protein PRUPE_ppa007339mg [Prunus persica]
Length=372

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+A+QLAFTA  AFLLVKQ+FT ++ NAV+LLTI A VL +
Sbjct  121  LIIAAQLAFTALFAFLLVKQKFTSYSTNAVVLLTIGAAVLGL  162



>ref|XP_006364706.1| PREDICTED: purine permease 3-like [Solanum tuberosum]
Length=362

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            L++ASQLAFTA  AFLLVKQ+FT +++N++ LLT  A VLA+
Sbjct  127  LLIASQLAFTAAFAFLLVKQKFTSYSINSIFLLTFGAVVLAL  168



>emb|CDP05635.1| unnamed protein product [Coffea canephora]
Length=173

 Score = 50.4 bits (119),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            +I+ASQLAFTA  AFLLVKQ+F  ++VNA++LL + A VLA+
Sbjct  86   IIIASQLAFTAVFAFLLVKQKFVAYSVNAIVLLAVGARVLAM  127



>gb|EYU21537.1| hypothetical protein MIMGU_mgv1a018814mg [Erythranthe guttata]
Length=354

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LIVASQLAFTA  AFL+VKQ FT ++VNAV+LLT+ A VL +
Sbjct  110  LIVASQLAFTAVFAFLMVKQEFTAYSVNAVVLLTLGAVVLGL  151



>ref|XP_009109746.1| PREDICTED: purine permease 1-like [Brassica rapa]
Length=356

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LIV +QLAF A  +FL+VKQ+FT F++NAV+LLT+  G+LA+
Sbjct  116  LIVGTQLAFNAIFSFLMVKQKFTPFSINAVVLLTVGTGILAL  157



>ref|XP_010926344.1| PREDICTED: purine permease 3-like isoform X1 [Elaeis guineensis]
Length=367

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAVG  3
            L++ASQLAFTA  +FL+V+QRFT F++NAV+LLT+   VL++G
Sbjct  136  LLIASQLAFTAVFSFLIVRQRFTAFSLNAVVLLTLGPVVLSLG  178



>ref|XP_007042882.1| Purine permease 3 isoform 2 [Theobroma cacao]
 gb|EOX98713.1| Purine permease 3 isoform 2 [Theobroma cacao]
Length=338

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+++QLAFT   AFLLVKQ+FT FT+N+V LL I A VLA+
Sbjct  113  LIISTQLAFTVAFAFLLVKQKFTSFTINSVFLLNIGAVVLAL  154



>ref|XP_007042881.1| Purine permease 3 isoform 1 [Theobroma cacao]
 gb|EOX98712.1| Purine permease 3 isoform 1 [Theobroma cacao]
Length=338

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+++QLAFT   AFLLVKQ+FT FT+N+V LL I A VLA+
Sbjct  113  LIISTQLAFTVAFAFLLVKQKFTSFTINSVFLLNIGAVVLAL  154



>gb|KFK44702.1| hypothetical protein AALP_AA1G292000 [Arabis alpina]
Length=354

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+ +QLAF A  AFL+VKQ+FT F++NAV+LLT+  G+LA+
Sbjct  114  LIIGTQLAFNALFAFLMVKQKFTPFSINAVVLLTVGIGILAL  155



>emb|CDP08377.1| unnamed protein product [Coffea canephora]
Length=356

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            +IVA+ L FTA  AFLLVKQ+FT ++VNA++LL++ +GVLA+
Sbjct  117  IIVATHLGFTAFFAFLLVKQKFTAYSVNAIVLLSVGSGVLAM  158



>ref|XP_007136297.1| hypothetical protein PHAVU_009G034400g [Phaseolus vulgaris]
 gb|ESW08291.1| hypothetical protein PHAVU_009G034400g [Phaseolus vulgaris]
Length=366

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+A+QL FTA  AFLLV+Q+FT ++VNAV+LLTI A VLA+
Sbjct  125  LIIATQLGFTAFFAFLLVRQKFTSYSVNAVVLLTIGAVVLAL  166



>ref|XP_004242795.1| PREDICTED: purine permease 3-like [Solanum lycopersicum]
Length=367

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            L++ASQLAFTAG AFLLVKQ+FT +++N++ LLT+ A VLA+
Sbjct  132  LLIASQLAFTAGFAFLLVKQKFTSYSINSIFLLTLGAVVLAL  173



>emb|CDP16579.1| unnamed protein product [Coffea canephora]
Length=271

 Score = 51.6 bits (122),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            +I+A+QLAFTA  AFLLVKQ+FT ++VNA++LLT+ + VL +
Sbjct  37   IIIATQLAFTALFAFLLVKQKFTAYSVNAIVLLTVGSAVLGL  78



>ref|XP_004299691.1| PREDICTED: purine permease 3-like [Fragaria vesca subsp. vesca]
Length=373

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAVG  3
            LI+A+QLAFTA  AF+LVKQ+FT +++NAV+LLT+ A VL + 
Sbjct  127  LIIAAQLAFTALFAFILVKQKFTSYSINAVVLLTVGAAVLGLN  169



>ref|XP_009373619.1| PREDICTED: purine permease 3-like [Pyrus x bretschneideri]
Length=380

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+AS LAFTA  AF+LVKQ+FT+F++NA++LLTI A VL +
Sbjct  123  LILASHLAFTALFAFILVKQKFTLFSINAIVLLTIGAVVLGL  164



>ref|XP_006415682.1| hypothetical protein EUTSA_v10008037mg [Eutrema salsugineum]
 gb|ESQ34035.1| hypothetical protein EUTSA_v10008037mg [Eutrema salsugineum]
Length=356

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+ +QLAF A  AF +VKQ+FT F++NAV+LLT+  G+LA+
Sbjct  117  LIIGTQLAFNALFAFFMVKQKFTPFSINAVVLLTVGTGILAL  158



>ref|XP_011072345.1| PREDICTED: LOW QUALITY PROTEIN: purine permease 3-like [Sesamum 
indicum]
Length=341

 Score = 51.2 bits (121),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGV  15
            LI+ASQLAFTA  A+ LVKQ+FT +++NAV+LLT+ A V
Sbjct  116  LIIASQLAFTAVFAYFLVKQKFTAYSINAVVLLTVGAAV  154



>emb|CDP19267.1| unnamed protein product [Coffea canephora]
Length=349

 Score = 51.2 bits (121),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVL  12
            +I+A+QL F A  AFLLVKQ+FT ++VNAV+LLT+ +GVL
Sbjct  111  IIIAAQLVFVAFFAFLLVKQKFTAYSVNAVILLTVGSGVL  150



>ref|XP_010098679.1| Purine permease 3 [Morus notabilis]
 gb|EXB75582.1| Purine permease 3 [Morus notabilis]
Length=377

 Score = 51.2 bits (121),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI ASQLAFTA  A+LLVKQ+FT +++NAV LLT    VLA+
Sbjct  134  LITASQLAFTAAFAYLLVKQKFTAYSLNAVALLTAGGAVLAL  175



>ref|XP_010509839.1| PREDICTED: purine permease 2-like [Camelina sativa]
Length=351

 Score = 51.2 bits (121),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAVG  3
            LI+++QL FTA  AF +VKQ+FT FT+NA++LLT+ A VLA+ 
Sbjct  114  LIISAQLGFTALFAFFMVKQKFTPFTINAIVLLTVGAVVLAIN  156



>ref|XP_010413817.1| PREDICTED: purine permease 2-like [Camelina sativa]
Length=349

 Score = 51.2 bits (121),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAVG  3
            LI+++QL FTA  AF +VKQ+FT FT+NA++LLT++A VLA+ 
Sbjct  112  LIISAQLGFTALFAFCMVKQKFTPFTINAIVLLTLSAVVLAIN  154



>ref|XP_010509841.1| PREDICTED: purine permease 2-like [Camelina sativa]
Length=347

 Score = 51.2 bits (121),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAVG  3
            LI+++QL FTA  AF +VKQ+FT FT+NA++LLT+ A VLA+ 
Sbjct  110  LIISAQLGFTALFAFFMVKQKFTPFTINAIVLLTVGAVVLAIN  152



>ref|XP_010418647.1| PREDICTED: purine permease 2-like [Camelina sativa]
Length=248

 Score = 50.1 bits (118),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLA  9
            LI+++QL FTA  AF +VKQ+FT FT+NA++LLT+ A VLA
Sbjct  114  LIISAQLGFTALFAFFMVKQKFTPFTINAIVLLTVGAVVLA  154



>ref|XP_006433898.1| hypothetical protein CICLE_v10001546mg [Citrus clementina]
 gb|ESR47138.1| hypothetical protein CICLE_v10001546mg [Citrus clementina]
Length=371

 Score = 50.8 bits (120),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+ASQLAFTA  AFLLVKQ+ T +++NAV LLT+ A VL +
Sbjct  138  LIIASQLAFTAAFAFLLVKQKLTSYSLNAVFLLTLGAVVLGL  179



>ref|XP_006472532.1| PREDICTED: purine permease 1-like [Citrus sinensis]
 gb|KDO81081.1| hypothetical protein CISIN_1g017456mg [Citrus sinensis]
Length=371

 Score = 50.8 bits (120),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+ASQLAFTA  AFLLVKQ+ T +++NAV LLT+ A VL +
Sbjct  138  LIIASQLAFTAAFAFLLVKQKLTSYSLNAVFLLTLGAVVLGL  179



>ref|XP_002881298.1| ATPUP2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57557.1| ATPUP2 [Arabidopsis lyrata subsp. lyrata]
Length=358

 Score = 50.8 bits (120),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAVG  3
            LI+++QL FTA  AF +VKQ+FT FT+NAV+LLT+ A VLA+ 
Sbjct  113  LIISAQLGFTALFAFFMVKQKFTPFTINAVVLLTVGAVVLALN  155



>ref|XP_008338896.1| PREDICTED: purine permease 3-like [Malus domestica]
Length=378

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+AS LAFTA  AF+LVKQ+FT F++NA++LLTI A VL +
Sbjct  123  LILASHLAFTALFAFILVKQKFTSFSINAIVLLTIGAVVLGL  164



>ref|XP_009373503.1| PREDICTED: purine permease 3-like [Pyrus x bretschneideri]
Length=378

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+A QLAFTA  AF+LVKQ+FT F++NAV+LLT+ + VL +
Sbjct  121  LIIAGQLAFTALFAFILVKQKFTSFSMNAVVLLTMGSAVLGL  162



>ref|XP_010549316.1| PREDICTED: purine permease 3 [Tarenaya hassleriana]
Length=340

 Score = 50.4 bits (119),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+ASQLAF A  +F +VK +FT FT+NAV+LLTI A VL +
Sbjct  108  LIIASQLAFIAVFSFFMVKHKFTHFTINAVVLLTIGAAVLGM  149



>gb|EPS65699.1| hypothetical protein M569_09078, partial [Genlisea aurea]
Length=327

 Score = 50.4 bits (119),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            L++A+QLAFTA   FL+VK RFT +++NAV+LLT+ A VLA+
Sbjct  103  LVIATQLAFTALFGFLIVKLRFTAYSINAVVLLTVGAAVLAI  144



>ref|XP_010675382.1| PREDICTED: purine permease 3-like [Beta vulgaris subsp. vulgaris]
Length=388

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+A+QLAFTA  AF+LV+Q+FT F+VNAV LLT  A VLA+
Sbjct  155  LILATQLAFTAVFAFILVRQKFTAFSVNAVALLTFGAIVLAL  196



>ref|XP_010413821.1| PREDICTED: purine permease 2 [Camelina sativa]
Length=351

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLA  9
            LI+++QL FTA  AF +VKQ+FT FT+NA++LLT+ A VLA
Sbjct  114  LIISAQLGFTALFAFFMVKQKFTPFTINAIVLLTVGAVVLA  154



>ref|XP_004299692.1| PREDICTED: purine permease 3-like [Fragaria vesca subsp. vesca]
Length=373

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAVG  3
            LI+AS L FTA  AF+LVKQ+FT +++NAV+LLT+ A VL + 
Sbjct  127  LIIASHLVFTALFAFILVKQKFTSYSINAVVLLTVGAAVLGLN  169



>ref|XP_006295883.1| hypothetical protein CARUB_v10025013mg [Capsella rubella]
 gb|EOA28781.1| hypothetical protein CARUB_v10025013mg [Capsella rubella]
Length=349

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+++QL FTA  AF +VKQ+FT FT+NA++LLT+ A VLA+
Sbjct  113  LIISAQLGFTALFAFFMVKQKFTPFTINAIVLLTVGAVVLAL  154



>ref|XP_010469434.1| PREDICTED: purine permease 2-like [Camelina sativa]
Length=350

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAVG  3
            LI+++QL FTA  AF +V+Q+FT FT+NA++LLT+ A VLA+ 
Sbjct  113  LIISAQLGFTALFAFFMVRQKFTPFTINAIVLLTVGAVVLAIN  155



>ref|XP_006305220.1| hypothetical protein CARUB_v10009586mg [Capsella rubella]
 gb|EOA38118.1| hypothetical protein CARUB_v10009586mg [Capsella rubella]
Length=351

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+ASQLAF A  +F +VK +FT FT+NAV+LLT+ A VL +
Sbjct  111  LIIASQLAFIAIFSFFMVKHKFTPFTINAVVLLTVGAAVLGM  152



>ref|XP_010478189.1| PREDICTED: purine permease 3-like [Camelina sativa]
Length=345

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+ASQLAF A  +F +VK +FT FT+NAV+LLT+ A VL +
Sbjct  112  LIIASQLAFIAIFSFFMVKHKFTPFTINAVVLLTVGAAVLGM  153



>ref|XP_002893512.1| ATPUP3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69771.1| ATPUP3 [Arabidopsis lyrata subsp. lyrata]
Length=348

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+ASQLAF A  +F +VK +FT FT+NAV+LLT+ A VL +
Sbjct  111  LIIASQLAFIAIFSFFMVKHKFTPFTINAVVLLTVGAAVLGM  152



>ref|XP_010460596.1| PREDICTED: purine permease 3 [Camelina sativa]
Length=353

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+ASQLAF A  +F +VK +FT FT+NAV+LLT+ A VL +
Sbjct  112  LIIASQLAFIAIFSFFMVKHKFTPFTINAVVLLTVGAAVLGM  153



>ref|XP_008795222.1| PREDICTED: purine permease 3-like [Phoenix dactylifera]
Length=351

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAVG  3
            L++ASQLAFTA  A L+V+QRFT F++NAV+LLT+   VL +G
Sbjct  121  LLMASQLAFTAVFALLIVRQRFTPFSLNAVVLLTLGPVVLGLG  163



>ref|NP_174143.1| purine permease 3 [Arabidopsis thaliana]
 sp|Q9FZ95.1|PUP3_ARATH RecName: Full=Purine permease 3; Short=AtPUP3 [Arabidopsis thaliana]
 gb|AAF98433.1|AC021044_12 Similar to purine permease [Arabidopsis thaliana]
 gb|AEE30933.1| purine permease 3 [Arabidopsis thaliana]
Length=351

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+ASQLAF A  +F +VK +FT FT+NAV+LLT+ A VL +
Sbjct  111  LIIASQLAFIAIFSFFMVKHKFTPFTINAVVLLTVGAAVLGM  152



>ref|XP_008446590.1| PREDICTED: purine permease 3-like [Cucumis melo]
Length=366

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI A QLAFTAG AF LVKQ+FT +++NAV+L+T    +LA+
Sbjct  130  LIRACQLAFTAGFAFWLVKQKFTPYSINAVVLVTAGGAILAL  171



>ref|XP_008806390.1| PREDICTED: purine permease 3-like [Phoenix dactylifera]
Length=367

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            L+++SQLAFTA  AFL+VKQ+FT +++N+V LLT+ A +L +
Sbjct  135  LLISSQLAFTASFAFLIVKQKFTPYSINSVALLTVGAVMLGL  176



>ref|XP_009766753.1| PREDICTED: purine permease 3-like [Nicotiana sylvestris]
Length=358

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            L+ A+QLAFTAG AFL+VK +FT ++VNAV LLT+ A +LA+
Sbjct  124  LLFATQLAFTAGFAFLIVKLKFTSYSVNAVFLLTVGAVLLAL  165



>ref|XP_009609429.1| PREDICTED: purine permease 3-like [Nicotiana tomentosiformis]
Length=359

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            L+ A+QLAFTAG AFL+VK +FT ++VNAV LLT+ A +LA+
Sbjct  125  LLFATQLAFTAGFAFLIVKLKFTSYSVNAVFLLTVGAVLLAL  166



>ref|XP_009615076.1| PREDICTED: purine permease 3-like [Nicotiana tomentosiformis]
Length=353

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+A+QLAFTA  AF LVKQ+FT  ++NA++LLT+ A VLA+
Sbjct  115  LILATQLAFTAVFAFFLVKQKFTAHSINAIVLLTVGAVVLAL  156



>ref|XP_009380885.1| PREDICTED: purine permease 1-like [Musa acuminata subsp. malaccensis]
Length=266

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            L++++QLAFTA  AFL+VKQ+FT +++N+V LLT+ A +L +
Sbjct  140  LLISTQLAFTAFFAFLIVKQKFTPYSINSVALLTVGAAILGL  181



>gb|EMS61796.1| hypothetical protein TRIUR3_08587 [Triticum urartu]
Length=148

 Score = 47.0 bits (110),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAVG  3
            +++++QLAFTA  A LLV+QRFT  TVNA++LL++ A +L +G
Sbjct  19   ILISTQLAFTAAFALLLVRQRFTGSTVNAIVLLSVGAAMLGMG  61



>ref|XP_004158055.1| PREDICTED: LOW QUALITY PROTEIN: purine permease 3-like [Cucumis 
sativus]
Length=304

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI A QLAFTAG AF LVKQ+FT +++N+V+L+T    +LA+
Sbjct  118  LIRACQLAFTAGFAFWLVKQKFTAYSINSVVLVTAGGAILAL  159



>gb|EMS63809.1| Purine permease 3 [Triticum urartu]
Length=284

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            +++++QLAFTA  A LLV+QRFT F+VNAV+LL++ A +L +
Sbjct  23   ILISTQLAFTAAFALLLVRQRFTAFSVNAVVLLSVGAAMLGM  64



>gb|KGN64615.1| hypothetical protein Csa_1G071290 [Cucumis sativus]
Length=366

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI A QLAFTAG AF LVKQ+FT +++N+V+L+T    +LA+
Sbjct  129  LIRACQLAFTAGFAFWLVKQKFTAYSINSVVLVTAGGAILAL  170



>emb|CDX90135.1| BnaA08g18490D [Brassica napus]
Length=323

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            L +AS LAF A  +FL+VKQ+FT F++NAV+LLT+  G+LA+
Sbjct  83   LFIASILAFNAIFSFLMVKQKFTPFSINAVVLLTVGTGILAL  124



>ref|XP_004146629.1| PREDICTED: purine permease 3-like [Cucumis sativus]
Length=355

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI A QLAFTAG AF LVKQ+FT +++N+V+L+T    +LA+
Sbjct  118  LIRACQLAFTAGFAFWLVKQKFTAYSINSVVLVTAGGAILAL  159



>dbj|BAG88745.1| unnamed protein product [Oryza sativa Japonica Group]
Length=289

 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            +++++QLAFTA  A LLV+QRFT F+VNAV+LL++ A +L +
Sbjct  153  ILISTQLAFTAAFALLLVRQRFTAFSVNAVVLLSVGAAMLGM  194



>gb|EMT19524.1| Purine permease 3 [Aegilops tauschii]
Length=333

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            +++++QLAFTA  A LLV+QRFT F+VNAV+LL++ A +L +
Sbjct  100  ILISTQLAFTAAFALLLVRQRFTAFSVNAVVLLSVGAAMLGM  141



>ref|XP_006661330.1| PREDICTED: purine permease 3-like [Oryza brachyantha]
Length=377

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            +++++QLAFTA  A LLV+QRFT F+VNAV+LL++ A +L +
Sbjct  143  ILISTQLAFTAAFALLLVRQRFTAFSVNAVVLLSVGAAMLGM  184



>dbj|BAK04933.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=377

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            +++++QLAFTA  A LLV+QRFT F+VNAV+LL++ A +L +
Sbjct  144  ILISTQLAFTAAFALLLVRQRFTAFSVNAVVLLSVGAAMLGM  185



>gb|EAZ09425.1| hypothetical protein OsI_31698 [Oryza sativa Indica Group]
Length=388

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            +++++QLAFTA  A LLV+QRFT F+VNAV+LL++ A +L +
Sbjct  151  ILISTQLAFTAAFALLLVRQRFTAFSVNAVVLLSVGAAMLGM  192



>ref|NP_001063424.1| Os09g0467300 [Oryza sativa Japonica Group]
 dbj|BAD17524.1| putative purine permease [Oryza sativa Japonica Group]
 dbj|BAD19735.1| putative purine permease [Oryza sativa Japonica Group]
 dbj|BAF25338.1| Os09g0467300 [Oryza sativa Japonica Group]
Length=390

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            +++++QLAFTA  A LLV+QRFT F+VNAV+LL++ A +L +
Sbjct  153  ILISTQLAFTAAFALLLVRQRFTAFSVNAVVLLSVGAAMLGM  194



>ref|XP_010509840.1| PREDICTED: purine permease 2-like [Camelina sativa]
Length=380

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAVG  3
            LI+++QL FTA  AF +VKQ+ T FT+NA++LLT+ A VLA+ 
Sbjct  143  LIISAQLGFTALFAFFMVKQKITPFTINAIVLLTVGAVVLAIN  185



>emb|CDP11456.1| unnamed protein product [Coffea canephora]
Length=345

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+A+QL FTA +AF+LV Q+F  +TVNA++LLT+ + VLA+
Sbjct  120  LILATQLVFTAFSAFILVGQKFNAYTVNAIVLLTLGSVVLAI  161



>ref|XP_010266586.1| PREDICTED: purine permease 3-like [Nelumbo nucifera]
Length=373

 Score = 47.8 bits (112),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 26/42 (62%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI +SQLAF A  +FLLV+QRFT F++N+V+LLTI A VL +
Sbjct  138  LINSSQLAFNALFSFLLVRQRFTPFSINSVVLLTIGAIVLGL  179



>ref|XP_007227615.1| hypothetical protein PRUPE_ppa022492mg [Prunus persica]
 gb|EMJ28814.1| hypothetical protein PRUPE_ppa022492mg [Prunus persica]
Length=368

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAVG  3
            LI A+ L FTA  AFLLVKQ+FT +++N V LLTI A VL + 
Sbjct  121  LITAAHLVFTALFAFLLVKQKFTSYSINCVFLLTIGAAVLGLN  163



>ref|NP_973592.1| purine permease 2 [Arabidopsis thaliana]
 gb|AEC08879.1| purine permease 2 [Arabidopsis thaliana]
Length=347

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+++QL FTA  AF +VKQ+FT FT+NA++LLT  A VLA+
Sbjct  113  LIISAQLGFTALFAFFMVKQKFTPFTINAIVLLTGGAVVLAL  154



>gb|AAC69140.1| hypothetical protein [Arabidopsis thaliana]
Length=356

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+++QL FTA  AF +VKQ+FT FT+NA++LLT  A VLA+
Sbjct  111  LIISAQLGFTALFAFFMVKQKFTPFTINAIVLLTGGAVVLAL  152



>ref|NP_180931.2| purine permease 2 [Arabidopsis thaliana]
 sp|Q94GB1.1|PUP2_ARATH RecName: Full=Purine permease 2; Short=AtPUP2 [Arabidopsis thaliana]
 gb|AAK61813.1|AF078532_1 putative purine permease [Arabidopsis thaliana]
 gb|AEC08880.1| purine permease 2 [Arabidopsis thaliana]
Length=358

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+++QL FTA  AF +VKQ+FT FT+NA++LLT  A VLA+
Sbjct  113  LIISAQLGFTALFAFFMVKQKFTPFTINAIVLLTGGAVVLAL  154



>ref|XP_009380886.1| PREDICTED: purine permease 3-like [Musa acuminata subsp. malaccensis]
Length=365

 Score = 47.8 bits (112),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            L++++QLAFTA  AFL+VKQ+FT +++N+V LLT+ A VL +
Sbjct  137  LLISTQLAFTAFFAFLIVKQKFTPYSINSVALLTVGAVVLGL  178



>ref|XP_008219368.1| PREDICTED: purine permease 3-like [Prunus mume]
Length=370

 Score = 47.8 bits (112),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI A+ L FTA  AFLLVKQ+FT +++N V LLTI A VL +
Sbjct  123  LITAAHLVFTALFAFLLVKQKFTSYSINGVFLLTIGAAVLGL  164



>ref|XP_010939717.1| PREDICTED: purine permease 3-like isoform X2 [Elaeis guineensis]
Length=362

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            ++++SQL FTA  AF +VKQ+FT F+VNAV+LL+I A +L +
Sbjct  131  ILISSQLGFTALFAFFMVKQKFTSFSVNAVVLLSIGAVILGL  172



>dbj|BAJ88843.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=417

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAVG  3
            +++++QLAFTA  A L+V+QRFT  TVNA++LL++ A +L +G
Sbjct  180  ILISTQLAFTAAFALLVVRQRFTASTVNAIVLLSVGAAMLGMG  222



>emb|CDY35722.1| BnaC03g58430D [Brassica napus]
Length=354

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+ +QLAF A  AF +VKQ+FT F++NAV+LLT+   VLA+
Sbjct  115  LIIGTQLAFNALFAFFMVKQKFTPFSINAVVLLTVGIVVLAL  156



>ref|XP_009109745.1| PREDICTED: purine permease 1 [Brassica rapa]
 emb|CDX90136.1| BnaA08g18480D [Brassica napus]
Length=352

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+ +QLAF A  AF +VKQ+FT F++NAV+LLT+   VLA+
Sbjct  113  LIIGTQLAFNALFAFFMVKQKFTPFSINAVVLLTVGIVVLAL  154



>dbj|BAJ87663.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=388

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAVG  3
            +++++QLAFTA  A L+V+QRFT  TVNA++LL++ A +L +G
Sbjct  151  ILISTQLAFTAAFALLVVRQRFTASTVNAIVLLSVGAAMLGMG  193



>ref|XP_006415683.1| hypothetical protein EUTSA_v10009673mg [Eutrema salsugineum]
 gb|ESQ34036.1| hypothetical protein EUTSA_v10009673mg [Eutrema salsugineum]
Length=338

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+ASQLAF A  ++ +V  +FT FT+NAV+LLT+ A VL +
Sbjct  111  LIIASQLAFIAIFSYFMVNHKFTPFTINAVVLLTVGAAVLGM  152



>ref|XP_010939716.1| PREDICTED: purine permease 1-like isoform X1 [Elaeis guineensis]
Length=408

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            ++++SQL FTA  AF +VKQ+FT F+VNAV+LL+I A +L +
Sbjct  131  ILISSQLGFTALFAFFMVKQKFTSFSVNAVVLLSIGAVILGL  172



>ref|XP_010322002.1| PREDICTED: LOW QUALITY PROTEIN: purine permease 3-like [Solanum 
lycopersicum]
Length=346

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            L+ A+QLAFTA  AFL+VK +FT ++VN+V LLTI A VLA+
Sbjct  110  LLFATQLAFTAFFAFLIVKLKFTPYSVNSVFLLTIGAVVLAL  151



>emb|CDY15687.1| BnaA07g08580D [Brassica napus]
Length=303

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+ASQLAF A  ++ +V  +FT FT+NAV+LLT+ A VL +
Sbjct  66   LIIASQLAFIAIFSYFMVSHKFTPFTINAVVLLTVGAAVLGM  107



>ref|XP_010499329.1| PREDICTED: purine permease 3-like [Camelina sativa]
 ref|XP_010499330.1| PREDICTED: purine permease 3-like [Camelina sativa]
Length=355

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+ASQLA  A  +F +VK +FT FT+NAV+LLT+ A VL +
Sbjct  112  LIIASQLACIAIFSFFMVKHKFTPFTINAVVLLTVGAAVLGM  153



>ref|XP_010064227.1| PREDICTED: purine permease 3-like [Eucalyptus grandis]
 gb|KCW66596.1| hypothetical protein EUGRSUZ_F00390 [Eucalyptus grandis]
Length=379

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 34/42 (81%), Gaps = 3/42 (7%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            L++A+QLAFTAG AFLLV+Q FT ++   + LLTI AGVLA+
Sbjct  120  LLIATQLAFTAGFAFLLVRQLFTSYS---IFLLTIGAGVLAM  158



>ref|XP_003578263.2| PREDICTED: purine permease 3-like [Brachypodium distachyon]
Length=397

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            +++++QL FTA  A LLV+QRFT F+VNAV+LL++ A +L +
Sbjct  159  ILISTQLVFTAAFALLLVRQRFTAFSVNAVVLLSVGAAMLGM  200



>emb|CDY72169.1| BnaCnng76300D, partial [Brassica napus]
Length=253

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LIV +QL F A  +F +VKQ FT F++NAV+LLT   G+LA+
Sbjct  113  LIVGTQLGFNAIFSFFMVKQTFTPFSINAVVLLTAGTGILAL  154



>emb|CDX94595.1| BnaC07g10630D [Brassica napus]
Length=349

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+ASQLAF A  ++ +V  +FT FT+NAV+LLT+ A VL +
Sbjct  112  LIIASQLAFIAIFSYFMVSHKFTPFTINAVVLLTVGAAVLGM  153



>ref|XP_009102926.1| PREDICTED: purine permease 3 [Brassica rapa]
 ref|XP_009102927.1| PREDICTED: purine permease 3 [Brassica rapa]
 emb|CDX94594.1| BnaC07g10640D [Brassica napus]
Length=349

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+ASQLAF A  ++ +V  +FT FT+NAV+LLT+ A VL +
Sbjct  112  LIIASQLAFIAIFSYFMVSHKFTPFTINAVVLLTVGAAVLGM  153



>ref|XP_010549318.1| PREDICTED: purine permease 3-like [Tarenaya hassleriana]
Length=347

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+ASQLAFTA  AF LVKQ+FT F++NA++LLT+ AGVLA+
Sbjct  113  LIIASQLAFTAFFAFFLVKQKFTPFSINAIVLLTLGAGVLAL  154



>ref|XP_010247465.1| PREDICTED: purine permease 3-like [Nelumbo nucifera]
Length=364

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            ++ ASQLAF AG A L+VKQRFT +++N+V+L+TI +  L +
Sbjct  135  ILFASQLAFIAGFARLIVKQRFTPYSINSVVLMTIGSITLGI  176



>ref|XP_008667894.1| PREDICTED: PUP1 isoform X1 [Zea mays]
 tpg|DAA40285.1| TPA: PUP1 [Zea mays]
Length=387

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            +++++QLAFTA  A LLV+QRFT F+VNAV LL+  A +L +
Sbjct  151  ILISTQLAFTAAFALLLVRQRFTAFSVNAVALLSAGAAMLGM  192



>ref|XP_010538169.1| PREDICTED: purine permease 3-like [Tarenaya hassleriana]
Length=346

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+ASQLAFTA  AF LVKQ+FT F++NA++LLT+ AGVLA+
Sbjct  111  LIIASQLAFTAFFAFFLVKQKFTPFSINAIVLLTLGAGVLAL  152



>ref|NP_001147096.1| PUP1 [Zea mays]
 gb|ACG25423.1| PUP1 [Zea mays]
Length=373

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            +++++QLAFTA  A LLV+QRFT F+VNAV LL+  A +L +
Sbjct  138  ILISTQLAFTAAFALLLVRQRFTAFSVNAVALLSAGAAMLGM  179



>dbj|BAJ95836.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95854.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97308.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=390

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  QLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAVG  3
            QLAFTA  AFL V  RFT F+ NAVMLLTI   VL VG
Sbjct  146  QLAFTAVFAFLFVGLRFTPFSANAVMLLTIGPAVLGVG  183



>ref|XP_010098678.1| Purine permease 1 [Morus notabilis]
 gb|EXB75581.1| Purine permease 1 [Morus notabilis]
Length=433

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLA  9
            LI+ASQL FTA  A+LLVKQ+ T  +V AV+LLTI   VLA
Sbjct  105  LIIASQLVFTAAFAYLLVKQKLTSHSVIAVILLTIGGAVLA  145


 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLA  9
            LI+ASQL FTA  A+LLVKQ+ T  +V AV+LLTI   VLA
Sbjct  279  LIIASQLVFTAAFAYLLVKQKLTSHSVIAVILLTIGGAVLA  319



>ref|XP_010439890.1| PREDICTED: probable purine permease 8 [Camelina sativa]
Length=393

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAVG  3
            LI+ASQLAFTA  ++LL  Q+FT F VN++ LLTI++ +L V 
Sbjct  151  LILASQLAFTAFFSYLLNSQKFTPFIVNSLFLLTISSALLVVN  193



>emb|CDY17197.1| BnaA05g09910D [Brassica napus]
Length=351

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI++SQLAFTA  AF +VKQRFT FT+NAV+LLT+ AG LA+
Sbjct  115  LIISSQLAFTAFFAFFMVKQRFTPFTINAVVLLTLGAGSLAL  156



>gb|KFK44691.1| hypothetical protein AALP_AA1G290900 [Arabis alpina]
Length=351

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI+ASQLAF A  ++ +V  +FT +T+NAV+LLT+ A VL +
Sbjct  115  LIIASQLAFIAIFSYFMVNHKFTPYTINAVVLLTVGAAVLGM  156



>ref|XP_009113691.1| PREDICTED: purine permease 1-like [Brassica rapa]
Length=355

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LIV +QL F A  +F +VKQ FT F++NAV+LLT   G+LA+
Sbjct  113  LIVGTQLGFNAIFSFFMVKQTFTPFSINAVVLLTAGTGILAL  154



>ref|XP_010939715.1| PREDICTED: purine permease 3-like [Elaeis guineensis]
Length=362

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            +++++QL FTA  AF +VKQ+FT F+VNAV+LL+I A +L +
Sbjct  131  ILISTQLGFTALFAFFIVKQKFTSFSVNAVVLLSIGAVILGL  172



>ref|XP_004959530.1| PREDICTED: purine permease 1-like [Setaria italica]
Length=378

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            +++++QLAFTA  A LLV+QRFT  +VNAV+LL++ A +L +
Sbjct  140  ILISTQLAFTAAFALLLVRQRFTASSVNAVVLLSVGAAMLGM  181



>ref|XP_010244044.1| PREDICTED: purine permease 1-like [Nelumbo nucifera]
Length=357

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI ++QLAF A  +F++V+QRFT +++NAV+LLTI A VL +
Sbjct  127  LIGSTQLAFNAVFSFIIVRQRFTSYSINAVVLLTIGAIVLGL  168



>ref|XP_009789614.1| PREDICTED: purine permease 1-like [Nicotiana sylvestris]
Length=271

 Score = 44.7 bits (104),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            L++A+QLAFTA  AF +VK +FT +++NAV+LLT+ A +L +
Sbjct  118  LLLAAQLAFTAVGAFFIVKLKFTPYSINAVILLTVGAVLLGI  159



>ref|XP_009603730.1| PREDICTED: purine permease 3-like [Nicotiana tomentosiformis]
Length=352

 Score = 45.1 bits (105),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            L++A+QLAFTA  AF +VK +FT +++NAV+LLT+ A +L V
Sbjct  118  LLLAAQLAFTAVGAFFIVKLKFTPYSINAVVLLTVGAVLLGV  159



>gb|EPS58788.1| hypothetical protein M569_16026, partial [Genlisea aurea]
Length=330

 Score = 44.7 bits (104),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            LI A+QLAFT   +F +VKQ+ T F+VNAV+LLT+ A V AV
Sbjct  111  LIDATQLAFTVVFSFFIVKQKLTAFSVNAVVLLTVGAVVFAV  152



>ref|XP_010248452.1| PREDICTED: purine permease 3-like [Nelumbo nucifera]
Length=326

 Score = 44.7 bits (104),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            L+ A+QLAFTAG A L+VKQRFT +++N+V+L+ + +  L +
Sbjct  97   LLFATQLAFTAGFARLIVKQRFTPYSINSVVLMILGSITLGI  138



>ref|XP_009765499.1| PREDICTED: purine permease 1-like [Nicotiana sylvestris]
Length=352

 Score = 44.7 bits (104),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            L++A+QLAFTA  AF +VK +FT +++NAV+LLT+ A +L V
Sbjct  118  LLLAAQLAFTAIGAFFIVKLKFTPYSINAVVLLTVGAVLLGV  159



>ref|XP_009769306.1| PREDICTED: purine permease 1-like [Nicotiana sylvestris]
Length=352

 Score = 44.7 bits (104),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            L++A+QLAFTA  AF +VK +FT +++NAV+LLT+ A +L V
Sbjct  118  LLLAAQLAFTAIGAFFIVKLKFTPYSINAVVLLTVGAVLLGV  159



>ref|XP_009776518.1| PREDICTED: purine permease 1-like [Nicotiana sylvestris]
Length=352

 Score = 44.7 bits (104),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            L++A+QLAFTA  AF +VK +FT +++NAV+LLT+ A +L V
Sbjct  118  LLLAAQLAFTAIGAFFIVKLKFTPYSINAVVLLTVGAVLLGV  159



>ref|XP_006357923.1| PREDICTED: purine permease 3-like [Solanum tuberosum]
Length=341

 Score = 44.7 bits (104),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            L+ A+QLAFTA  AFL+VK +FT ++VN+V LLT  A VLA+
Sbjct  108  LLFATQLAFTAFFAFLIVKLKFTPYSVNSVFLLTTGAVVLAL  149



>ref|NP_001031662.1| purine permease 8 [Arabidopsis thaliana]
 sp|Q0WRB9.1|PUP8_ARATH RecName: Full=Probable purine permease 8; Short=AtPUP8 [Arabidopsis 
thaliana]
 dbj|BAF00330.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE84009.1| purine permease 8 [Arabidopsis thaliana]
Length=394

 Score = 44.7 bits (104),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAVG  3
            LI+ASQLAFTA  ++ L  Q+FT F VN++ LLTI++ +L V 
Sbjct  151  LILASQLAFTAFFSYFLNSQKFTPFIVNSLFLLTISSALLVVN  193



>ref|XP_006338102.1| PREDICTED: purine permease 1-like [Solanum tuberosum]
Length=352

 Score = 44.7 bits (104),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -2

Query  128  IVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            I A+QL FT   AFL+VKQ+ T ++VNAV+LL + AG LA+
Sbjct  117  IYAAQLGFTVIFAFLIVKQKLTAYSVNAVVLLIVGAGTLAL  157



>ref|XP_009401279.1| PREDICTED: purine permease 1-like [Musa acuminata subsp. malaccensis]
Length=368

 Score = 44.7 bits (104),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAA  21
            L++++QL FTA  AF+LVKQ+FT +++N+V+LLT+ A
Sbjct  139  LLISAQLVFTAFFAFVLVKQKFTPYSINSVVLLTVGA  175



>ref|XP_004237962.1| PREDICTED: purine permease 3-like [Solanum lycopersicum]
Length=355

 Score = 44.7 bits (104),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -2

Query  128  IVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            I A+QL FT   AFL+VKQ+ T ++VNAV+LL + AG LA+
Sbjct  117  IYAAQLGFTVVFAFLIVKQKLTSYSVNAVVLLIVGAGTLAL  157



>ref|XP_006414136.1| hypothetical protein EUTSA_v10025391mg [Eutrema salsugineum]
 gb|ESQ55589.1| hypothetical protein EUTSA_v10025391mg [Eutrema salsugineum]
Length=396

 Score = 44.7 bits (104),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAVG  3
            LI+ASQLAFTA  ++ L  Q+FT F VN++ LLTI++ +L V 
Sbjct  154  LILASQLAFTAFFSYFLNSQKFTPFIVNSLFLLTISSALLVVN  196



>ref|XP_010942638.1| PREDICTED: purine permease 3-like isoform X2 [Elaeis guineensis]
 ref|XP_010942639.1| PREDICTED: purine permease 3-like isoform X2 [Elaeis guineensis]
Length=365

 Score = 44.7 bits (104),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  131  LIVASQLAFTAGAAFLLVKQRFTVFTVNAVMLLTIAAGVLAV  6
            +++++QLAFTA  AFL+VKQ+FT +++N++ LL++ A +L +
Sbjct  132  ILISTQLAFTAFFAFLIVKQKFTPYSINSIALLSVGAVILGL  173



Lambda      K        H        a         alpha
   0.315    0.116    0.343    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 512165903184