BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7435_g1_i1 len=1933 path=[1:0-1617 3759:1618-1717 1619:1718-1932]

Length=1933
                                                                      Score     E

ref|XP_006341924.1|  PREDICTED: uncharacterized protein LOC102585551    142   2e-35   
ref|XP_004238248.1|  PREDICTED: uncharacterized protein LOC101256584    142   4e-35   
ref|XP_009613542.1|  PREDICTED: uncharacterized protein LOC104106659    139   3e-34   
ref|XP_009759556.1|  PREDICTED: uncharacterized protein LOC104212073    138   8e-34   
ref|XP_010254892.1|  PREDICTED: uncharacterized protein LOC104595729    125   2e-29   
gb|KHG24772.1|  Aldehyde dehydrogenase                                  121   5e-28   
ref|XP_007156925.1|  hypothetical protein PHAVU_002G028800g             117   8e-27   
gb|KHN41992.1|  hypothetical protein glysoja_003732                     117   2e-26   
ref|XP_006590683.1|  PREDICTED: uncharacterized protein LOC100787922    114   1e-25   
ref|XP_006466772.1|  PREDICTED: uncharacterized protein LOC102620...    114   2e-25   
gb|ACU23828.1|  unknown                                                 113   4e-25   Glycine max [soybeans]
gb|KDO79509.1|  hypothetical protein CISIN_1g0391382mg                  112   5e-25   
ref|XP_006573579.1|  PREDICTED: uncharacterized protein LOC100800366    111   1e-24   
ref|XP_004512021.1|  PREDICTED: uncharacterized protein LOC101494863    112   1e-24   
ref|XP_011074529.1|  PREDICTED: uncharacterized protein LOC105159234    110   4e-24   
ref|XP_004300622.1|  PREDICTED: uncharacterized protein LOC101302363    109   1e-23   
gb|KFK30286.1|  hypothetical protein AALP_AA7G241900                    109   1e-23   
ref|XP_003611971.1|  hypothetical protein MTR_5g019900                  108   1e-23   
gb|AFK42567.1|  unknown                                                 108   2e-23   
ref|XP_006282502.1|  hypothetical protein CARUB_v10006860mg             108   2e-23   
ref|XP_007046980.1|  Sugar transporter, putative                        108   2e-23   
ref|XP_002320589.2|  hypothetical protein POPTR_0014s17990g             108   2e-23   Populus trichocarpa [western balsam poplar]
ref|XP_010060934.1|  PREDICTED: uncharacterized protein LOC104448744    108   3e-23   
ref|XP_002510368.1|  conserved hypothetical protein                     108   3e-23   Ricinus communis
ref|XP_010095271.1|  hypothetical protein L484_014612                   108   3e-23   
gb|KCW67828.1|  hypothetical protein EUGRSUZ_F01557                     108   3e-23   
gb|KCW67829.1|  hypothetical protein EUGRSUZ_F01557                     107   4e-23   
ref|XP_002867000.1|  At4g36660                                          107   5e-23   
ref|XP_010939259.1|  PREDICTED: uncharacterized protein LOC105058...    106   5e-23   
gb|EYU45139.1|  hypothetical protein MIMGU_mgv1a014622mg                107   5e-23   
gb|KHN47872.1|  hypothetical protein glysoja_036616                     107   5e-23   
gb|KDP38489.1|  hypothetical protein JCGZ_04414                         107   5e-23   
ref|XP_011012938.1|  PREDICTED: uncharacterized protein LOC105117091    107   6e-23   
ref|XP_010939258.1|  PREDICTED: uncharacterized protein LOC105058...    106   6e-23   
ref|XP_010939257.1|  PREDICTED: uncharacterized protein LOC105058...    107   6e-23   
ref|XP_010432152.1|  PREDICTED: uncharacterized protein LOC104716471    107   7e-23   
ref|XP_010939255.1|  PREDICTED: uncharacterized protein LOC105058...    107   7e-23   
ref|XP_006856090.1|  hypothetical protein AMTR_s00059p00127380          106   9e-23   
emb|CAB16809.1|  hypothetical protein                                   105   1e-22   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195384.5|  uncharacterized protein                               106   1e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010106008.1|  hypothetical protein L484_021185                   105   1e-22   
dbj|BAH30560.1|  hypothetical protein                                   105   1e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010446762.1|  PREDICTED: uncharacterized protein LOC104729514    106   2e-22   
gb|KHF97827.1|  Serine--tRNA ligase                                     105   2e-22   
emb|CDX75587.1|  BnaA01g01150D                                          105   2e-22   
ref|XP_007017505.1|  Sugar transporter, putative isoform 2              105   2e-22   
ref|XP_009142898.1|  PREDICTED: uncharacterized protein LOC103866654    105   3e-22   
ref|XP_008362114.1|  PREDICTED: uncharacterized protein LOC103425793    105   3e-22   
ref|XP_009356685.1|  PREDICTED: uncharacterized protein LOC103947497    105   4e-22   
ref|XP_010244287.1|  PREDICTED: uncharacterized protein LOC104588164    104   4e-22   
ref|XP_008241652.1|  PREDICTED: uncharacterized protein LOC103340064    104   6e-22   
ref|XP_008357183.1|  PREDICTED: uncharacterized protein LOC103420925    104   6e-22   
ref|XP_006411975.1|  hypothetical protein EUTSA_v10026362mg             103   7e-22   
ref|XP_004291885.1|  PREDICTED: uncharacterized protein LOC101301938    104   7e-22   
ref|XP_007202654.1|  hypothetical protein PRUPE_ppa012270mg             103   8e-22   
ref|XP_008338119.1|  PREDICTED: uncharacterized protein LOC103401176    103   2e-21   
ref|XP_006593126.1|  PREDICTED: uncharacterized protein LOC100783879    107   3e-21   
ref|NP_173371.1|  uncharacterized protein                               101   4e-21   Arabidopsis thaliana [mouse-ear cress]
gb|KHN20989.1|  hypothetical protein glysoja_009297                     101   4e-21   
ref|XP_008352460.1|  PREDICTED: uncharacterized protein LOC103415959    102   4e-21   
ref|XP_007206057.1|  hypothetical protein PRUPE_ppa012645mg             101   4e-21   
ref|XP_006595581.1|  PREDICTED: uncharacterized protein LOC100803...    101   4e-21   
ref|XP_002521583.1|  sugar transporter, putative                        105   5e-21   Ricinus communis
ref|XP_008790343.1|  PREDICTED: uncharacterized protein LOC103707...    101   5e-21   
ref|XP_010936292.1|  PREDICTED: uncharacterized protein LOC105055...    101   6e-21   
ref|XP_009625643.1|  PREDICTED: uncharacterized protein LOC104116484    101   6e-21   
ref|XP_010936400.1|  PREDICTED: uncharacterized protein LOC105056...    101   7e-21   
ref|XP_008790342.1|  PREDICTED: uncharacterized protein LOC103707...    101   8e-21   
ref|XP_010936293.1|  PREDICTED: uncharacterized protein LOC105055...    101   9e-21   
ref|XP_010936399.1|  PREDICTED: uncharacterized protein LOC105056...    100   1e-20   
gb|KDP27567.1|  hypothetical protein JCGZ_20030                         101   1e-20   
ref|XP_007017504.1|  Sugar transporter, putative isoform 1              100   1e-20   
ref|XP_006466773.1|  PREDICTED: uncharacterized protein LOC102620...  99.8    1e-20   
ref|XP_010444944.1|  PREDICTED: probable polyol transporter 6           106   1e-20   
ref|XP_007227275.1|  hypothetical protein PRUPE_ppa017694mg           98.6    1e-20   
ref|XP_009791325.1|  PREDICTED: uncharacterized protein LOC104238615    100   2e-20   
ref|XP_008220784.1|  PREDICTED: uncharacterized protein LOC103320...    100   2e-20   
ref|XP_008220785.1|  PREDICTED: uncharacterized protein LOC103320...    100   2e-20   
ref|XP_009364539.1|  PREDICTED: uncharacterized protein LOC103954431    100   2e-20   
ref|XP_009402023.1|  PREDICTED: uncharacterized protein LOC103985884  99.8    3e-20   
ref|XP_007156031.1|  hypothetical protein PHAVU_003G252600g           99.0    3e-20   
gb|KHG00293.1|  Gamma-aminobutyric acid receptor alpha-like protein   98.6    8e-20   
emb|CBI17540.3|  unnamed protein product                              97.8    1e-19   
ref|XP_006383226.1|  hypothetical protein POPTR_0005s12660g           97.4    1e-19   
ref|XP_008785651.1|  PREDICTED: uncharacterized protein LOC103704228  97.8    1e-19   
gb|ABU45182.1|  unknown                                               97.4    2e-19   Capsicum frutescens [bird pepper]
ref|XP_010680806.1|  PREDICTED: uncharacterized protein LOC104895866  97.1    3e-19   
ref|XP_004160032.1|  PREDICTED: uncharacterized protein LOC101224396  96.7    3e-19   
ref|XP_010558208.1|  PREDICTED: uncharacterized protein LOC104826929  96.7    4e-19   
gb|KFK44072.1|  hypothetical protein AALP_AA1G212500                  95.5    4e-19   
gb|KHG25088.1|  Protein FAM75A4                                       96.3    4e-19   
ref|XP_004232390.1|  PREDICTED: uncharacterized protein LOC101253740  95.9    6e-19   
ref|XP_010999974.1|  PREDICTED: uncharacterized protein LOC105107660  95.5    7e-19   
emb|CDP07532.1|  unnamed protein product                              95.5    8e-19   
ref|XP_010550395.1|  PREDICTED: uncharacterized protein LOC104821281  95.5    9e-19   
gb|AAG01119.1|AF273333_4  BAC19.4                                     95.5    9e-19   Solanum lycopersicum
ref|XP_006340593.1|  PREDICTED: uncharacterized protein LOC102599104  95.1    1e-18   
gb|KHN45844.1|  hypothetical protein glysoja_023067                   94.4    1e-18   
ref|NP_001237413.1|  uncharacterized protein LOC100500653             94.4    1e-18   
ref|XP_007136586.1|  hypothetical protein PHAVU_009G057300g           94.4    1e-18   
gb|ABU45202.1|  unknown                                               94.7    1e-18   Solanum bulbocastanum [ornamental nightshade]
ref|XP_007156030.1|  hypothetical protein PHAVU_003G252600g           94.0    1e-18   
ref|XP_010649162.1|  PREDICTED: probable polyol transporter 6 iso...  97.8    1e-18   
ref|XP_002310215.2|  hypothetical protein POPTR_0007s12630g           94.4    2e-18   Populus trichocarpa [western balsam poplar]
gb|KGN48820.1|  hypothetical protein Csa_6G502580                     93.6    3e-18   
ref|XP_004234561.1|  PREDICTED: uncharacterized protein LOC101254...  93.6    3e-18   
ref|XP_008440698.1|  PREDICTED: uncharacterized protein LOC103485038  93.2    5e-18   
ref|XP_004152705.1|  PREDICTED: uncharacterized protein LOC101218892  93.2    5e-18   
gb|KEH36150.1|  transmembrane protein, putative                       92.0    6e-18   
gb|AEI98625.1|  hypothetical protein 111O18.12                        93.2    7e-18   
emb|CDP02042.1|  unnamed protein product                              92.4    1e-17   
gb|KHN00553.1|  hypothetical protein glysoja_000221                   92.0    1e-17   
gb|KEH36149.1|  transmembrane protein, putative                       91.7    1e-17   
ref|XP_004143580.1|  PREDICTED: probable polyol transporter 3-like    94.0    3e-17   
ref|XP_010070047.1|  PREDICTED: uncharacterized protein LOC104456867  90.5    4e-17   
emb|CDY30757.1|  BnaC07g16570D                                        90.1    5e-17   
ref|XP_011025752.1|  PREDICTED: uncharacterized protein LOC105126554  89.7    6e-17   
dbj|BAA98184.1|  unnamed protein product                              89.4    6e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009787249.1|  PREDICTED: uncharacterized protein LOC104235226  89.7    7e-17   
ref|XP_009138437.1|  PREDICTED: uncharacterized protein LOC103862481  89.0    1e-16   
ref|XP_010531023.1|  PREDICTED: uncharacterized protein LOC104807...  89.0    1e-16   
ref|XP_009622062.1|  PREDICTED: uncharacterized protein LOC104113...  88.2    1e-16   
ref|XP_010531025.1|  PREDICTED: uncharacterized protein LOC104807...  88.2    1e-16   
ref|XP_002282877.1|  PREDICTED: uncharacterized protein LOC100264357  88.6    2e-16   Vitis vinifera
gb|ABC69762.1|  unknown                                               88.6    2e-16   Vitis pseudoreticulata
ref|XP_010444743.1|  PREDICTED: uncharacterized protein LOC104727358  88.6    2e-16   
ref|XP_010464966.1|  PREDICTED: uncharacterized protein LOC104745426  88.6    2e-16   
ref|XP_009103491.1|  PREDICTED: uncharacterized protein LOC103829572  88.6    2e-16   
ref|XP_009622061.1|  PREDICTED: uncharacterized protein LOC104113...  88.2    2e-16   
ref|XP_009371570.1|  PREDICTED: uncharacterized protein LOC103960807  87.4    2e-16   
ref|XP_006393868.1|  hypothetical protein EUTSA_v10004972mg           88.6    2e-16   
gb|KFK28355.1|  hypothetical protein AALP_AA8G505100                  88.2    3e-16   
ref|XP_002864968.1|  hypothetical protein ARALYDRAFT_919901           87.8    4e-16   
ref|XP_009365595.1|  PREDICTED: uncharacterized protein LOC103955427  87.8    4e-16   
ref|NP_569015.1|  uncharacterized protein                             87.8    4e-16   Arabidopsis thaliana [mouse-ear cress]
emb|CDY67099.1|  BnaCnng53540D                                        85.5    6e-16   
ref|XP_009396443.1|  PREDICTED: uncharacterized protein LOC103981440  85.1    2e-15   
emb|CDX72594.1|  BnaC07g46160D                                        89.7    3e-15   
gb|ABK27045.1|  unknown                                               84.7    3e-15   Picea sitchensis
ref|XP_008444700.1|  PREDICTED: uncharacterized protein LOC103487960  84.7    3e-15   
ref|XP_010484594.1|  PREDICTED: uncharacterized protein LOC104762894  85.1    4e-15   
emb|CDX83766.1|  BnaC08g18790D                                        83.6    5e-15   
ref|XP_010459607.1|  PREDICTED: uncharacterized protein LOC104740635  83.6    7e-15   
ref|XP_002890331.1|  hypothetical protein ARALYDRAFT_472165           83.2    7e-15   
ref|XP_010498354.1|  PREDICTED: uncharacterized protein LOC104776052  83.2    1e-14   
ref|XP_011083699.1|  PREDICTED: uncharacterized protein LOC105166154  83.6    1e-14   
emb|CDX96663.1|  BnaA08g22060D                                        82.4    1e-14   
ref|XP_009110276.1|  PREDICTED: uncharacterized protein LOC103835844  82.4    2e-14   
ref|XP_004501128.1|  PREDICTED: uncharacterized protein LOC101512645  82.0    2e-14   
ref|XP_006416510.1|  hypothetical protein EUTSA_v10008999mg           80.5    7e-14   
ref|XP_010477152.1|  PREDICTED: uncharacterized protein LOC104756282  79.7    1e-13   
ref|XP_002463166.1|  hypothetical protein SORBIDRAFT_02g038920        79.7    1e-13   Sorghum bicolor [broomcorn]
ref|XP_006425705.1|  hypothetical protein CICLE_v10027139mg           77.8    4e-13   
gb|EPS71215.1|  hypothetical protein M569_03548                       76.6    5e-13   
ref|XP_008667655.1|  PREDICTED: uncharacterized protein LOC100276...  78.2    5e-13   
ref|XP_006305739.1|  hypothetical protein CARUB_v10010542mg           77.8    5e-13   
gb|ACG40814.1|  hypothetical protein                                  75.9    3e-12   Zea mays [maize]
gb|KCW45824.1|  hypothetical protein EUGRSUZ_L00342                   73.2    4e-12   
ref|XP_010484713.1|  PREDICTED: uncharacterized protein LOC104762987  75.5    4e-12   
ref|XP_010039660.1|  PREDICTED: uncharacterized protein LOC104428358  74.3    4e-12   
ref|XP_009627606.1|  PREDICTED: uncharacterized protein LOC104118...  75.5    8e-12   
ref|XP_011097125.1|  PREDICTED: uncharacterized protein LOC105176117  75.1    8e-12   
ref|XP_009627612.1|  PREDICTED: uncharacterized protein LOC104118...  75.1    8e-12   
ref|XP_009627627.1|  PREDICTED: uncharacterized protein LOC104118...  74.7    9e-12   
ref|XP_009627619.1|  PREDICTED: uncharacterized protein LOC104118...  75.1    9e-12   
ref|XP_010317714.1|  PREDICTED: uncharacterized protein LOC101254...  73.9    1e-11   
ref|NP_001241923.1|  uncharacterized protein LOC100803339             73.2    1e-11   
ref|XP_003570023.1|  PREDICTED: uncharacterized protein LOC100822234  73.6    2e-11   
ref|XP_010529511.1|  PREDICTED: uncharacterized protein LOC104806349  72.8    3e-11   
dbj|BAK05463.1|  predicted protein                                    73.2    3e-11   
ref|XP_004984041.1|  PREDICTED: uncharacterized protein LOC101766...  71.6    1e-10   
gb|EMT24196.1|  hypothetical protein F775_30518                       71.6    1e-10   
ref|NP_001144135.1|  uncharacterized protein LOC100276984             71.2    2e-10   Zea mays [maize]
ref|XP_004984040.1|  PREDICTED: uncharacterized protein LOC101766...  71.2    2e-10   
ref|NP_001281179.1|  uncharacterized protein LOC100276045             69.3    2e-10   
ref|NP_001143565.1|  uncharacterized protein LOC100276262             70.9    2e-10   Zea mays [maize]
emb|CAN75408.1|  hypothetical protein VITISV_042285                   64.7    2e-10   Vitis vinifera
ref|XP_002467700.1|  hypothetical protein SORBIDRAFT_01g032680        70.5    2e-10   Sorghum bicolor [broomcorn]
gb|ACG48314.1|  hypothetical protein                                  68.2    2e-10   Zea mays [maize]
ref|XP_009394309.1|  PREDICTED: uncharacterized protein LOC103979819  70.1    3e-10   
gb|EYU40147.1|  hypothetical protein MIMGU_mgv1a015364mg              69.3    5e-10   
ref|XP_006650190.1|  PREDICTED: uncharacterized protein LOC102720218  69.3    6e-10   
gb|EMT26061.1|  hypothetical protein F775_27408                       68.2    7e-10   
gb|EPS67837.1|  hypothetical protein M569_06941                       68.6    8e-10   
ref|NP_001050350.1|  Os03g0411600                                     68.9    9e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004958258.1|  PREDICTED: uncharacterized protein LOC101780353  68.2    1e-09   
gb|ABK24848.1|  unknown                                               65.5    3e-09   Picea sitchensis
emb|CAN60001.1|  hypothetical protein VITISV_043637                   64.3    1e-08   Vitis vinifera
ref|NP_001060236.1|  Os07g0607500                                     64.7    1e-08   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ04660.1|  hypothetical protein OsI_26812                        64.7    1e-08   Oryza sativa Indica Group [Indian rice]
gb|KHN22260.1|  hypothetical protein glysoja_022016                   63.5    2e-08   
ref|XP_006657943.1|  PREDICTED: uncharacterized protein LOC102708073  63.9    3e-08   
ref|XP_008353121.1|  PREDICTED: uncharacterized protein LOC103416670  61.2    5e-08   
ref|XP_008361468.1|  PREDICTED: uncharacterized protein LOC103425174  62.8    9e-08   
ref|XP_008361894.1|  PREDICTED: uncharacterized protein LOC103425582  60.8    4e-07   
ref|XP_010533258.1|  PREDICTED: uncharacterized protein LOC104809062  59.3    1e-06   



>ref|XP_006341924.1| PREDICTED: uncharacterized protein LOC102585551 [Solanum tuberosum]
Length=202

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 116/171 (68%), Gaps = 32/171 (19%)
 Frame = +1

Query  1186  LYEEMRDEEAQVK---------------------TNGVQKKEGF-------KYKLWVLAA  1281
             +Y+EM+DEEAQ +                     T+ V+K +GF       KYKLWVLAA
Sbjct  3     IYQEMKDEEAQSRISTNTVTTVSSVSVVATPAAATSTVKKDQGFSGVFGKGKYKLWVLAA  62

Query  1282  ILLLAGWTMFTGSITLSLNWK--HLSAKPHSP--AIHedldlleveerekvvrHMWDVYT  1449
             ILLLA W+MFTGS+TLSLNW   +LS   H+    IHEDLD+L +EEREK+V+HMWDVYT
Sbjct  63    ILLLAFWSMFTGSLTLSLNWSTSNLSRLSHASDFTIHEDLDILVLEEREKMVKHMWDVYT  122

Query  1450  ESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESP  1602
             ++   RLPKFWQ+AF+AAY D+ SDS A RD AV+EIAKMSL S +  ESP
Sbjct  123   QNSRIRLPKFWQDAFQAAYLDLTSDSPATRDTAVSEIAKMSLRSTSTYESP  173



>ref|XP_004238248.1| PREDICTED: uncharacterized protein LOC101256584 [Solanum lycopersicum]
Length=204

 Score =   142 bits (357),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 95/173 (55%), Positives = 116/173 (67%), Gaps = 34/173 (20%)
 Frame = +1

Query  1186  LYEEMRDEEAQ--VKTNGV---------------------QKKEGF-------KYKLWVL  1275
             +Y+EM+DEEAQ  + TN V                     +K +GF       KYKLWVL
Sbjct  3     IYQEMKDEEAQSRISTNTVTTVSSVSAVATPAAAAATSTVKKDQGFSGVFGKGKYKLWVL  62

Query  1276  AAILLLAGWTMFTGSITLSLNWK--HLSAKPHSP--AIHedldlleveerekvvrHMWDV  1443
             AAILLLA W+MFTGS+TLSLNW   +LS   H+    IHEDLD+L +EEREK+V+HMWDV
Sbjct  63    AAILLLAFWSMFTGSLTLSLNWSTSNLSRLSHASDFTIHEDLDILVLEEREKMVKHMWDV  122

Query  1444  YTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESP  1602
             YT++   RLPKFWQ+AF+AAY D+ SDS A RD AV+EIAKMSL S +  ESP
Sbjct  123   YTQNSRIRLPKFWQDAFQAAYLDLTSDSPATRDTAVSEIAKMSLRSTSTYESP  175



>ref|XP_009613542.1| PREDICTED: uncharacterized protein LOC104106659 [Nicotiana tomentosiformis]
Length=198

 Score =   139 bits (350),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 113/167 (68%), Gaps = 29/167 (17%)
 Frame = +1

Query  1186  LYEEMRDEEAQ---VKTNGVQ---------------KKEGF-------KYKLWVLAAILL  1290
             +Y+EM+DEEA+   + TN V                KKEG        KYKLWVLAAILL
Sbjct  3     IYQEMKDEEARTRSITTNTVTPAAVSVVVAPAAASGKKEGCNGLLGKGKYKLWVLAAILL  62

Query  1291  LAGWTMFTGSITLSLNWKHLSAKPHSPA----IHedldlleveerekvvrHMWDVYTESR  1458
             LA W+MFTGS+TLSLNW   +    S A    IH+DLD+LE+EE+E++V+HMWDVYT+S 
Sbjct  63    LAFWSMFTGSLTLSLNWSAANLSRLSDASDFSIHDDLDILELEEKERMVKHMWDVYTQSS  122

Query  1459  TARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPES  1599
               RLPKFWQEAF+AAY D+ SDS A+RD AV EIAKMSL S +  ES
Sbjct  123   RIRLPKFWQEAFQAAYLDLTSDSPAIRDTAVAEIAKMSLRSISTYES  169



>ref|XP_009759556.1| PREDICTED: uncharacterized protein LOC104212073 [Nicotiana sylvestris]
Length=199

 Score =   138 bits (347),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 114/174 (66%), Gaps = 30/174 (17%)
 Frame = +1

Query  1186  LYEEMRDEEAQVKT-------------------NGVQKKEGF-------KYKLWVLAAIL  1287
             +Y+EM++EEAQ ++                       KKEG        KYKLWVLAAIL
Sbjct  3     IYQEMKEEEAQTRSITTYTVTPTAASVAVAAAAAASGKKEGCNGLLGKGKYKLWVLAAIL  62

Query  1288  LLAGWTMFTGSITLSLNWKHLSAKPHSPA----IHedldlleveerekvvrHMWDVYTES  1455
             LLA W+MFTGS+TLSLNW   +    S A    IH+DLD+LE+EE+E++V+HMWDVYT+S
Sbjct  63    LLAFWSMFTGSLTLSLNWSAANLSRLSDASDFSIHDDLDILELEEKERMVKHMWDVYTQS  122

Query  1456  RTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPPIQSN  1617
                RLPKFWQEAF+AAY D+ SDS A+RD AV EIAKMS+ S +  ESP  Q +
Sbjct  123   SRIRLPKFWQEAFQAAYLDLTSDSPAIRDTAVAEIAKMSMRSISTYESPSNQQS  176



>ref|XP_010254892.1| PREDICTED: uncharacterized protein LOC104595729 [Nelumbo nucifera]
 ref|XP_010254893.1| PREDICTED: uncharacterized protein LOC104595729 [Nelumbo nucifera]
Length=174

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 96/125 (77%), Gaps = 5/125 (4%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldlleveerekvv  1425
             +YK W LAAI+LLA W+MFTG++TL   + N   LS    +P IH+DLD+LE+EEREKVV
Sbjct  27    RYKFWALAAIILLAFWSMFTGTVTLKWSAGNLNRLSDDLDTP-IHDDLDVLEIEEREKVV  85

Query  1426  rHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPP  1605
             RHMWDVYT SR  RLP+FWQEAFEAAYED+ SD   VRDAA++EIAKMS+ S    E PP
Sbjct  86    RHMWDVYTHSRRIRLPRFWQEAFEAAYEDLTSDVPGVRDAAISEIAKMSVRS-LDLEPPP  144

Query  1606  IQSNS  1620
             +QS S
Sbjct  145   VQSTS  149



>gb|KHG24772.1| Aldehyde dehydrogenase [Gossypium arboreum]
Length=171

 Score =   121 bits (303),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 94/125 (75%), Gaps = 5/125 (4%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldlleveerekvv  1425
             +YK W  AAILLLA W+MFTG++TL   + N   LS    SP +H+DLD+LE+EEREKVV
Sbjct  30    RYKFWAFAAILLLAFWSMFTGTVTLRWSAGNLNRLSDDIGSP-VHDDLDVLEMEEREKVV  88

Query  1426  rHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPP  1605
             +HMWDVYT SR  RLP+FWQEAFEAAYE++ SD   VR+AAVTEIAKMS+      + PP
Sbjct  89    KHMWDVYTNSRRIRLPRFWQEAFEAAYEELTSDVPGVREAAVTEIAKMSVQY-VHLDPPP  147

Query  1606  IQSNS  1620
             IQS S
Sbjct  148   IQSTS  152



>ref|XP_007156925.1| hypothetical protein PHAVU_002G028800g [Phaseolus vulgaris]
 gb|ESW28919.1| hypothetical protein PHAVU_002G028800g [Phaseolus vulgaris]
Length=172

 Score =   117 bits (294),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 106/151 (70%), Gaps = 12/151 (8%)
 Frame = +1

Query  1198  MRDEEAQVKTNGVQKKEGF--------KYKLWVLAAILLLAGWTMFTGSITL--SLNWKH  1347
             M+DEE    T    KKE          KYK W LAAILLLA W+MFTG+++L  S     
Sbjct  1     MKDEEGLPTTTAGAKKEPLDSGLFGKGKYKFWALAAILLLAFWSMFTGTVSLRWSGTLNS  60

Query  1348  LSAKPHSPAIHedldlleveerekvvrHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDS  1527
             LS    SP IH+DLD+LE+EEREKVVRHMWDVYT SR  RLPKFWQEAFEAAYED+ SD 
Sbjct  61    LSNDMDSP-IHDDLDVLEMEEREKVVRHMWDVYTNSRRIRLPKFWQEAFEAAYEDLTSDL  119

Query  1528  SAVRDAAVTEIAKMSLHSKAKPESPPIQSNS  1620
               VRDAA+TEIAKMS+HS  + + PP+QS S
Sbjct  120   GEVRDAAITEIAKMSVHS-IEFDPPPVQSTS  149



>gb|KHN41992.1| hypothetical protein glysoja_003732 [Glycine soja]
Length=172

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 107/151 (71%), Gaps = 12/151 (8%)
 Frame = +1

Query  1198  MRDEEAQVKTNGVQKKEGF--------KYKLWVLAAILLLAGWTMFTGSITL--SLNWKH  1347
             M+DE+    T  V KKE          +YK W LAAILLLA W+MFTG+++L  S     
Sbjct  1     MKDEDGLPTTTAVTKKENLDSSLFGKGRYKFWALAAILLLAFWSMFTGTVSLRWSGTLNS  60

Query  1348  LSAKPHSPAIHedldlleveerekvvrHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDS  1527
             LS    +P IH+DLD+LE+EEREKVVRHMWDVYT SR+ RLP+FWQEAFEAAYED+ SD 
Sbjct  61    LSNDIDTP-IHDDLDVLEMEEREKVVRHMWDVYTNSRSVRLPRFWQEAFEAAYEDLTSDV  119

Query  1528  SAVRDAAVTEIAKMSLHSKAKPESPPIQSNS  1620
             + VRDAAVTEIAKMS+ S    + PP+QS S
Sbjct  120   AEVRDAAVTEIAKMSVRS-IHFDPPPLQSTS  149



>ref|XP_006590683.1| PREDICTED: uncharacterized protein LOC100787922 [Glycine max]
Length=172

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 106/151 (70%), Gaps = 12/151 (8%)
 Frame = +1

Query  1198  MRDEEAQVKTNGVQKKEGF--------KYKLWVLAAILLLAGWTMFTGSITL--SLNWKH  1347
             M+DE+    T  V KKE          +YK W LAAILLLA W+MFTG+++L  S     
Sbjct  1     MKDEDGLPTTTAVTKKENLDSSLFGKGRYKFWALAAILLLAFWSMFTGTVSLRWSGTLNS  60

Query  1348  LSAKPHSPAIHedldlleveerekvvrHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDS  1527
             LS    +P IH+DLD+LE+EEREKVVRHMWDVYT SR+ RLP+FWQEAFEAAYED+ SD 
Sbjct  61    LSNDIDTP-IHDDLDVLEMEEREKVVRHMWDVYTNSRSVRLPRFWQEAFEAAYEDLTSDV  119

Query  1528  SAVRDAAVTEIAKMSLHSKAKPESPPIQSNS  1620
             + VRDAAV EIAKMS+ S    + PP+QS S
Sbjct  120   AEVRDAAVAEIAKMSVRS-IHFDPPPLQSTS  149



>ref|XP_006466772.1| PREDICTED: uncharacterized protein LOC102620496 isoform X1 [Citrus 
sinensis]
Length=177

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 107/154 (69%), Gaps = 14/154 (9%)
 Frame = +1

Query  1198  MRDEEA--QVKTNGVQKKEG--------FKYKLWVLAAILLLAGWTMFTGSITL---SLN  1338
             M+D+E+     T  V KKE          +YK W LAAILLLA W+MFTG++TL   + N
Sbjct  1     MKDDESVPTTTTLNVTKKESSDSSIFGKGRYKFWALAAILLLAFWSMFTGTVTLRWSAGN  60

Query  1339  WKHLSAKPHSPAIHedldlleveerekvvrHMWDVYTESRTARLPKFWQEAFEAAYEDMM  1518
                LS    SP IH+DLD+LE+EEREKVV+HMWDVYT SR  RLP+FWQEAFEAAYE++ 
Sbjct  61    LNRLSDDLGSP-IHDDLDVLEMEEREKVVKHMWDVYTNSRRIRLPRFWQEAFEAAYEELS  119

Query  1519  SDSSAVRDAAVTEIAKMSLHSKAKPESPPIQSNS  1620
             SD + VRDAA+TEIAKMS+ S    +SPP  S S
Sbjct  120   SDVAEVRDAAITEIAKMSVRSLVNIDSPPFHSTS  153



>gb|ACU23828.1| unknown [Glycine max]
Length=168

 Score =   113 bits (282),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 105/151 (70%), Gaps = 12/151 (8%)
 Frame = +1

Query  1198  MRDEEAQVKTNGVQKKEGF--------KYKLWVLAAILLLAGWTMFTGSITL--SLNWKH  1347
             M+DE+    T  V KKE          +YK W LAAILLLA W+MFTG+++L  S     
Sbjct  1     MKDEDGLPTTTAVTKKENLDSSLFGKGRYKFWALAAILLLAFWSMFTGTVSLRWSGTLNS  60

Query  1348  LSAKPHSPAIHedldlleveerekvvrHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDS  1527
             LS    +P IH+DLD+LE+EEREKVVRHMWDVYT SR+ RLP+FWQEAFEAAYED+  D 
Sbjct  61    LSNDIDTP-IHDDLDVLEMEEREKVVRHMWDVYTNSRSVRLPRFWQEAFEAAYEDLTGDV  119

Query  1528  SAVRDAAVTEIAKMSLHSKAKPESPPIQSNS  1620
             + VRDAAV EIAKMS+ S    + PP+QS S
Sbjct  120   AEVRDAAVAEIAKMSVRS-IHFDPPPLQSTS  149



>gb|KDO79509.1| hypothetical protein CISIN_1g0391382mg, partial [Citrus sinensis]
Length=152

 Score =   112 bits (280),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 106/152 (70%), Gaps = 14/152 (9%)
 Frame = +1

Query  1198  MRDEEA--QVKTNGVQKKEG--------FKYKLWVLAAILLLAGWTMFTGSITL---SLN  1338
             M+D+E+     T  V KKE          +YK W LAAILLLA W+MFTG++TL   + N
Sbjct  1     MKDDESLPTTTTLNVTKKESSDSSAFGKGRYKFWALAAILLLAFWSMFTGTVTLRWSAGN  60

Query  1339  WKHLSAKPHSPAIHedldlleveerekvvrHMWDVYTESRTARLPKFWQEAFEAAYEDMM  1518
                LS    SP IH+DLD+LE+EEREKVV+HMWDVYT SR  RLP+FWQEAFEAAYE++ 
Sbjct  61    LNRLSDDLGSP-IHDDLDVLEMEEREKVVKHMWDVYTNSRRIRLPRFWQEAFEAAYEELS  119

Query  1519  SDSSAVRDAAVTEIAKMSLHSKAKPESPPIQS  1614
             SD + VRDAA+TEIAKMS+ S    +SPP  S
Sbjct  120   SDVAEVRDAAITEIAKMSVRSLVNIDSPPFHS  151



>ref|XP_006573579.1| PREDICTED: uncharacterized protein LOC100800366 [Glycine max]
 gb|KHN36115.1| hypothetical protein glysoja_003238 [Glycine soja]
Length=167

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 107/151 (71%), Gaps = 13/151 (9%)
 Frame = +1

Query  1198  MRDEEAQVKTNGVQKKEGF--------KYKLWVLAAILLLAGWTMFTGSITL--SLNWKH  1347
             M+DE+  + T    KKE          +YK W LAAILLLA W+MFTG+++L  S     
Sbjct  1     MKDEDG-LPTTAATKKESMDSSLFGKGRYKFWALAAILLLAFWSMFTGTVSLRWSGTLNS  59

Query  1348  LSAKPHSPAIHedldlleveerekvvrHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDS  1527
             LS+   +P IH+DLD+LE+EEREKVVRHMWDVYT SR  RLP+FWQEAFEAAYED+ SD 
Sbjct  60    LSSDIDTP-IHDDLDVLEMEEREKVVRHMWDVYTNSRRVRLPRFWQEAFEAAYEDLTSDV  118

Query  1528  SAVRDAAVTEIAKMSLHSKAKPESPPIQSNS  1620
             + VRDAAVTEIAKMS+ S    + PP+QS S
Sbjct  119   TEVRDAAVTEIAKMSVRS-IHFDPPPLQSTS  148



>ref|XP_004512021.1| PREDICTED: uncharacterized protein LOC101494863 [Cicer arietinum]
Length=172

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 105/149 (70%), Gaps = 12/149 (8%)
 Frame = +1

Query  1198  MRDEEAQVKTNGVQKKEGF--------KYKLWVLAAILLLAGWTMFTGSITL--SLNWKH  1347
             M+D++A   T    KKE          +YK W LAAILLLA W+MFTG+++L  S N   
Sbjct  1     MKDDDALPTTATSNKKENMDSSLFGKGRYKFWALAAILLLAFWSMFTGTVSLRWSGNLNS  60

Query  1348  LSAKPHSPAIHedldlleveerekvvrHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDS  1527
             LS    +P IH+DLD+LE+EEREKVVRHMWDVYT SR  RLP+FWQEAFEAAYE++ SD 
Sbjct  61    LSNDLDTP-IHDDLDVLEMEEREKVVRHMWDVYTNSRRIRLPRFWQEAFEAAYEELTSDV  119

Query  1528  SAVRDAAVTEIAKMSLHSKAKPESPPIQS  1614
               VRDAA+TEIAKMS+ S    + PPIQS
Sbjct  120   PGVRDAAITEIAKMSVRS-IDFDPPPIQS  147



>ref|XP_011074529.1| PREDICTED: uncharacterized protein LOC105159234 [Sesamum indicum]
Length=170

 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 103/163 (63%), Gaps = 22/163 (13%)
 Frame = +1

Query  1198  MRDEEAQ---------VKTNGVQKKEG---------FKYKLWVLAAILLLAGWTMFTGSI  1323
             MRDEEAQ            +   KK+G          +YKLW L AI LLA W+MFTGS+
Sbjct  1     MRDEEAQKPWTSPTSSPAASFSTKKDGSVLEGVCGRGRYKLWALGAIFLLAIWSMFTGSV  60

Query  1324  TL---SLNWKHLSAKPHSPAIHedldlleveerekvvrHMWDVYTESRTARLPKFWQEAF  1494
             TL    +  KH S    S +IH DLD+L+V+EREK+VR MWD Y  S T  LP FW++AF
Sbjct  61    TLKSSDVIIKHPSQDLGS-SIHGDLDILDVDEREKMVRQMWDAYKHSSTISLPSFWRDAF  119

Query  1495  EAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPPIQSNSR  1623
              AAY+D+ S+ ++VRDAA++EIAKMS  S+   E PP+QS +R
Sbjct  120   GAAYQDLTSEVASVRDAALSEIAKMSFRSRDVYEPPPVQSTAR  162



>ref|XP_004300622.1| PREDICTED: uncharacterized protein LOC101302363 [Fragaria vesca 
subsp. vesca]
Length=174

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 104/151 (69%), Gaps = 12/151 (8%)
 Frame = +1

Query  1198  MRDEEAQVKTNGVQKKEG-------FKYKLWVLAAILLLAGWTMFTGSITL---SLNWKH  1347
             M+D++    T    KK+         +YK W LAAILLLA W+MFTG++TL   + N   
Sbjct  1     MKDDDGLPTTTAAAKKDSSDSSLGKGRYKFWALAAILLLAFWSMFTGTVTLRWSAGNLNR  60

Query  1348  LSAKPHSPAIHedldlleveerekvvrHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDS  1527
              S +  SP IH+DLD+LE+EEREKVV HMWDVYT SR  RLP+FWQEAFEAAYED+ SD 
Sbjct  61    FSDEFDSP-IHDDLDVLEMEEREKVVEHMWDVYTNSRRIRLPRFWQEAFEAAYEDLTSDL  119

Query  1528  SAVRDAAVTEIAKMSLHSKAKPESPPIQSNS  1620
               VRD+A++EIAKMS+ S    + PP+QS S
Sbjct  120   PGVRDSAISEIAKMSVRS-VDLDPPPVQSAS  149



>gb|KFK30286.1| hypothetical protein AALP_AA7G241900 [Arabis alpina]
Length=180

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 90/124 (73%), Gaps = 3/124 (2%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITLSLNWKHLSAKPHSPAI--Hedldlleveerekvvr  1428
             +YK W  AAILLLA W+MFTG++TL L+  +L+       I  +E+LD LE+EEREKVV+
Sbjct  39    RYKFWAFAAILLLAFWSMFTGTVTLRLSDGNLNRLAEDLGIPNYENLDALEMEEREKVVK  98

Query  1429  HMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPPI  1608
             HMWDVYT +R  +LPKFWQEAF AAYE++ SD   VRDAA+ EIAKMS+ S    + PP 
Sbjct  99    HMWDVYTNTRRIKLPKFWQEAFVAAYEELTSDVPGVRDAAIGEIAKMSVQS-ITLDPPPS  157

Query  1609  QSNS  1620
             +S S
Sbjct  158   RSMS  161



>ref|XP_003611971.1| hypothetical protein MTR_5g019900 [Medicago truncatula]
 ref|XP_003636273.1| hypothetical protein MTR_036s0057 [Medicago truncatula]
 gb|AES94929.1| polyol transporter-like protein, putative [Medicago truncatula]
 gb|AFK44303.1| unknown [Medicago truncatula]
Length=171

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 105/150 (70%), Gaps = 13/150 (9%)
 Frame = +1

Query  1198  MRDEEA-QVKTNGVQKKEGF--------KYKLWVLAAILLLAGWTMFTGSITL--SLNWK  1344
             M+D++     T  + KKE          +YK W LAAILLLA W+MFTG+++L  S N  
Sbjct  1     MKDDDGLPTTTAAINKKENMDSGLFGKGRYKFWALAAILLLAFWSMFTGTVSLRWSGNLN  60

Query  1345  HLSAKPHSPAIHedldlleveerekvvrHMWDVYTESRTARLPKFWQEAFEAAYEDMMSD  1524
              LS+   +P IH+DLD+LE+EEREKVVRHMWDVYT SR  RLP+FWQEAFEAAYE++ SD
Sbjct  61    TLSSDLDTP-IHDDLDVLEMEEREKVVRHMWDVYTNSRRIRLPRFWQEAFEAAYEELTSD  119

Query  1525  SSAVRDAAVTEIAKMSLHSKAKPESPPIQS  1614
                VRD A+TEIAKMS+ S    + PPIQS
Sbjct  120   VPGVRDDAITEIAKMSVRS-VNYDPPPIQS  148



>gb|AFK42567.1| unknown [Lotus japonicus]
Length=176

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 96/122 (79%), Gaps = 4/122 (3%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL--SLNWKHLSAKPHSPAIHedldlleveerekvvr  1428
             +YK W LAAILLLA W+MFTG+++L  S N   LS    +P IH+DLD+LE+EEREKVVR
Sbjct  29    RYKFWALAAILLLAFWSMFTGTVSLRWSGNLNSLSNDLDTP-IHDDLDVLEMEEREKVVR  87

Query  1429  HMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPPI  1608
             HMWDVYT SR  RLP+FWQEAFEAAYE++ SD+  VRDAA+TEIAKMS+ S    + PPI
Sbjct  88    HMWDVYTNSRRIRLPRFWQEAFEAAYEELTSDAPGVRDAAITEIAKMSVRS-IDFDPPPI  146

Query  1609  QS  1614
             QS
Sbjct  147   QS  148



>ref|XP_006282502.1| hypothetical protein CARUB_v10006860mg [Capsella rubella]
 gb|EOA15400.1| hypothetical protein CARUB_v10006860mg [Capsella rubella]
Length=177

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 93/124 (75%), Gaps = 3/124 (2%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITLSLNWKHLS--AKPHSPAIHedldlleveerekvvr  1428
             +YK W  AAILLLA W+MFTG++TL L+  +L+  ++     I+++LD+LE+EEREKVV+
Sbjct  37    RYKFWAFAAILLLAFWSMFTGTVTLRLSTGNLNRFSEDLGIPIYDNLDVLEMEEREKVVK  96

Query  1429  HMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPPI  1608
             HMWDVYT SR  +LP+FWQEAF AAYE++ SD   VR+AA+ EIAKMS+ S    + PP 
Sbjct  97    HMWDVYTNSRRIKLPRFWQEAFVAAYEELTSDVPGVREAAIGEIAKMSVQS-ITIDPPPS  155

Query  1609  QSNS  1620
             +S S
Sbjct  156   RSMS  159



>ref|XP_007046980.1| Sugar transporter, putative [Theobroma cacao]
 gb|EOX91137.1| Sugar transporter, putative [Theobroma cacao]
Length=180

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 96/125 (77%), Gaps = 5/125 (4%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldlleveerekvv  1425
             +YK W LAAILLLA W+MFTG++TL   + N   LS    SP IH+DLD+LE+EEREKVV
Sbjct  33    RYKFWALAAILLLAFWSMFTGTVTLRWSAGNLNRLSDDLDSP-IHDDLDVLEMEEREKVV  91

Query  1426  rHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPP  1605
             +HMWDVYT SR  RLP+FWQEAFEAAYE++ SD   VR+AA+TEIAKMS+ S    + PP
Sbjct  92    KHMWDVYTNSRRIRLPRFWQEAFEAAYEELTSDVPGVREAAITEIAKMSIRS-VDLDPPP  150

Query  1606  IQSNS  1620
             IQS +
Sbjct  151   IQSTN  155



>ref|XP_002320589.2| hypothetical protein POPTR_0014s17990g [Populus trichocarpa]
 gb|EEE98904.2| hypothetical protein POPTR_0014s17990g [Populus trichocarpa]
Length=183

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 82/126 (65%), Gaps = 4/126 (3%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITLSLNWKHLSAKPHSPAIHedldlleveerekvvr--  1428
             +YK WVL+AILLLA W+MFTGSITL  +   LS  P +       D+  +E  EK     
Sbjct  45    RYKFWVLSAILLLAFWSMFTGSITLKWSTGDLSQHPDNLGFQTQDDVDILEVEEKKKLVW  104

Query  1429  HMWDVYT-ESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESP-  1602
              MWDVYT  SR  RLP+FW+ AF+AAYE + SD +AVRDAAV EIAK+S+ S    + P 
Sbjct  105   RMWDVYTHSSRGTRLPRFWERAFQAAYEALASDVTAVRDAAVYEIAKLSISSTINLDDPF  164

Query  1603  PIQSNS  1620
             P+QS +
Sbjct  165   PVQSTT  170



>ref|XP_010060934.1| PREDICTED: uncharacterized protein LOC104448744 [Eucalyptus grandis]
 gb|KCW67827.1| hypothetical protein EUGRSUZ_F01557 [Eucalyptus grandis]
Length=190

 Score =   108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 93/126 (74%), Gaps = 5/126 (4%)
 Frame = +1

Query  1258  YKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldlleveerekvvr  1428
             YK WVLAAILLLA W+M TGS+TL   + N    S+       +EDLD+LEVEEREKVVR
Sbjct  41    YKFWVLAAILLLAFWSMLTGSVTLKWSAGNLARFSSDLLDLPSYEDLDILEVEEREKVVR  100

Query  1429  HMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPPI  1608
             HMWDVYT+S+++RLPKFWQ+AF+A YE + SD   VRD AV+EIAKMSL S A   S P+
Sbjct  101   HMWDVYTQSKSSRLPKFWQDAFQAGYEFLTSDVPGVRDVAVSEIAKMSLRSFAF--SDPL  158

Query  1609  QSNSRC  1626
              ++SR 
Sbjct  159   AAHSRS  164



>ref|XP_002510368.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52555.1| conserved hypothetical protein [Ricinus communis]
Length=184

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 90/123 (73%), Gaps = 4/123 (3%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldlleveerekvv  1425
             +YK WVLAAILLLA W+MFTGS+TL   +    H S       + +DLD+LE+EE+EK+V
Sbjct  41    RYKFWVLAAILLLAFWSMFTGSVTLEWSAGKLTHPSEDLGFATLDDDLDILEIEEKEKLV  100

Query  1426  rHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPP  1605
             +HMWD+YT S + +LP FWQEAFEAAYE + SD  +VRDAA++EIAKM L S   P+  P
Sbjct  101   KHMWDIYTHSTSTKLPHFWQEAFEAAYESLASDVPSVRDAAISEIAKMFLRS-FNPDPLP  159

Query  1606  IQS  1614
             +QS
Sbjct  160   VQS  162



>ref|XP_010095271.1| hypothetical protein L484_014612 [Morus notabilis]
 gb|EXB59117.1| hypothetical protein L484_014612 [Morus notabilis]
Length=176

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 102/153 (67%), Gaps = 14/153 (9%)
 Frame = +1

Query  1198  MRDEEAQVKTNGVQKKEG---------FKYKLWVLAAILLLAGWTMFTGSITL---SLNW  1341
             M+DE+    T    KKE           +YK W L AILLLA W+MFTG++TL   + N 
Sbjct  1     MKDEDGLPTTTATAKKESSDSGLAFGKGRYKFWALGAILLLALWSMFTGTVTLRWSAGNL  60

Query  1342  KHLSAKPHSPAIHedldlleveerekvvrHMWDVYTESRTARLPKFWQEAFEAAYEDMMS  1521
               +S    +P IH+DLD+LE+EEREKVV HMWDVYT SR  RL +FWQEAFEAAYED+ S
Sbjct  61    NRISDDFDAP-IHDDLDVLEMEEREKVVNHMWDVYTNSRRIRLTRFWQEAFEAAYEDLTS  119

Query  1522  DSSAVRDAAVTEIAKMSLHSKAKPESPPIQSNS  1620
             D   VR+AA++EIAKMS+ S    + PP+QS S
Sbjct  120   DVPGVREAAISEIAKMSVRS-IDLDPPPVQSTS  151



>gb|KCW67828.1| hypothetical protein EUGRSUZ_F01557 [Eucalyptus grandis]
Length=189

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 93/126 (74%), Gaps = 5/126 (4%)
 Frame = +1

Query  1258  YKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldlleveerekvvr  1428
             YK WVLAAILLLA W+M TGS+TL   + N    S+       +EDLD+LEVEEREKVVR
Sbjct  41    YKFWVLAAILLLAFWSMLTGSVTLKWSAGNLARFSSDLLDLPSYEDLDILEVEEREKVVR  100

Query  1429  HMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPPI  1608
             HMWDVYT+S+++RLPKFWQ+AF+A YE + SD   VRD AV+EIAKMSL S A   S P+
Sbjct  101   HMWDVYTQSKSSRLPKFWQDAFQAGYEFLTSDVPGVRDVAVSEIAKMSLRSFAF--SDPL  158

Query  1609  QSNSRC  1626
              ++SR 
Sbjct  159   AAHSRS  164



>gb|KCW67829.1| hypothetical protein EUGRSUZ_F01557 [Eucalyptus grandis]
Length=181

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 93/126 (74%), Gaps = 5/126 (4%)
 Frame = +1

Query  1258  YKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldlleveerekvvr  1428
             YK WVLAAILLLA W+M TGS+TL   + N    S+       +EDLD+LEVEEREKVVR
Sbjct  41    YKFWVLAAILLLAFWSMLTGSVTLKWSAGNLARFSSDLLDLPSYEDLDILEVEEREKVVR  100

Query  1429  HMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPPI  1608
             HMWDVYT+S+++RLPKFWQ+AF+A YE + SD   VRD AV+EIAKMSL S A   S P+
Sbjct  101   HMWDVYTQSKSSRLPKFWQDAFQAGYEFLTSDVPGVRDVAVSEIAKMSLRSFAF--SDPL  158

Query  1609  QSNSRC  1626
              ++SR 
Sbjct  159   AAHSRS  164



>ref|XP_002867000.1| At4g36660 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43259.1| At4g36660 [Arabidopsis lyrata subsp. lyrata]
Length=178

 Score =   107 bits (267),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 90/124 (73%), Gaps = 3/124 (2%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITLSLNWKHLSAKPHSPAI--Hedldlleveerekvvr  1428
             +YK W  AAILLLA W+MFTG++TL L+  +L+       I  + +LD+LE+EEREKVV+
Sbjct  37    RYKFWAFAAILLLAFWSMFTGTVTLRLSTGNLNRLSEDLGIPNYANLDVLEMEEREKVVK  96

Query  1429  HMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPPI  1608
             HMWDVYT SR  +LP+FWQEAF AAYE++ SD   VR+AA+ EIAKMS+ S    + PP 
Sbjct  97    HMWDVYTSSRRIKLPRFWQEAFVAAYEELTSDVPGVREAAIGEIAKMSVRS-ITLDPPPS  155

Query  1609  QSNS  1620
             +S S
Sbjct  156   RSMS  159



>ref|XP_010939259.1| PREDICTED: uncharacterized protein LOC105058138 isoform X4 [Elaeis 
guineensis]
Length=151

 Score =   106 bits (265),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 87/121 (72%), Gaps = 5/121 (4%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedld-lleveerekv  1422
             +YK W LAAI+LLA W+MFTG++TL   + N   LS     P + +    +LE+EEREKV
Sbjct  26    RYKFWALAAIILLAFWSMFTGTVTLKWSAGNLNRLSDDLLDPPLRDAALDVLEMEEREKV  85

Query  1423  vrHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESP  1602
             VRHMWD+Y  S   RLP+FWQEAFEAAYE++ SD +AVR+AAV+EIA+MSL      ESP
Sbjct  86    VRHMWDIYAHSLRIRLPRFWQEAFEAAYEELASDDAAVRNAAVSEIARMSLR-MVDLESP  144

Query  1603  P  1605
             P
Sbjct  145   P  145



>gb|EYU45139.1| hypothetical protein MIMGU_mgv1a014622mg [Erythranthe guttata]
Length=184

 Score =   107 bits (268),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 100/167 (60%), Gaps = 25/167 (15%)
 Frame = +1

Query  1198  MRDEEAQV-----------------KTNGVQKKEGF----KYKLWVLAAILLLAGWTMFT  1314
             MRDEE Q                  K  G    EG     KYKLW L  I+LLA W+MFT
Sbjct  1     MRDEETQTNPSSSSSTNLAGSFSIKKDGGGSGFEGLFGKGKYKLWALTVIILLAVWSMFT  60

Query  1315  GSITL---SLNWKHLSAKPHSPAIHedldlleveerekvvrHMWDVYTESRTARLPKFWQ  1485
             GS+TL   S+  KH S+     +IH DLD+L+V+EREK+VR MW+VY  +   RLP FW+
Sbjct  61    GSVTLKWSSVYLKH-SSLDLDQSIHGDLDVLDVDEREKMVRQMWNVYKHNSIVRLPSFWR  119

Query  1486  EAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPPIQSNSRC  1626
             +AF AAY+D++S+ S VR++A+ EIAKMS  S    + PP++S  R 
Sbjct  120   DAFGAAYQDLISEVSTVRNSALLEIAKMSFDSGVVYDPPPVESTPRV  166



>gb|KHN47872.1| hypothetical protein glysoja_036616 [Glycine soja]
Length=162

 Score =   107 bits (266),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 104/153 (68%), Gaps = 18/153 (12%)
 Frame = +1

Query  1198  MRDEEA--QVKTNGVQKKEGF--------KYKLWVLAAILLLAGWTMFTGSITLSLNW--  1341
             M+DE+    + T    KKE          +YK WVLAA+LL   W+M+ G  T+SL+W  
Sbjct  1     MKDEDGLQMMTTTAATKKESMDSSLFGKGRYKFWVLAAMLLQVFWSMYNG--TVSLHWFG  58

Query  1342  --KHLSAKPHSPAIHedldlleveerekvvrHMWDVYTESRTARLPKFWQEAFEAAYEDM  1515
                 LS+  ++P IH+DLD+LE+EEREKVVR+MWDV T +   RLP+FWQE F+AAY+D+
Sbjct  59    TLNSLSSDINTP-IHDDLDVLEMEEREKVVRNMWDVCTNNHRVRLPRFWQEVFKAAYKDL  117

Query  1516  MSDSSAVRDAAVTEIAKMSLHSKAKPESPPIQS  1614
             MSD++ VRDAAVTEIAKM + S    + PP+QS
Sbjct  118   MSDAAEVRDAAVTEIAKMFVRS-IHFDPPPLQS  149



>gb|KDP38489.1| hypothetical protein JCGZ_04414 [Jatropha curcas]
Length=181

 Score =   107 bits (267),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 96/134 (72%), Gaps = 10/134 (7%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldlleveerekvv  1425
             +YK WVLAAILLLA W+MFTGS+TL   + N+  L+     P   +DLD+LEVEE+EKVV
Sbjct  38    RYKFWVLAAILLLAFWSMFTGSVTLKWSTGNFSRLADDLDLPIHDDDLDILEVEEKEKVV  97

Query  1426  rHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPE---  1596
             R MW++YT   T +LP+FWQEAFEAAYE + SD  AVR AAV+EIAK+S+ S   P+   
Sbjct  98    RQMWNIYTHGSTTKLPRFWQEAFEAAYEALASDVPAVRSAAVSEIAKLSIRS-VNPDPLS  156

Query  1597  ---SPPIQSNSRCR  1629
                +P +QS+++ R
Sbjct  157   VQSTPQVQSSNKRR  170



>ref|XP_011012938.1| PREDICTED: uncharacterized protein LOC105117091 [Populus euphratica]
Length=187

 Score =   107 bits (267),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 81/126 (64%), Gaps = 4/126 (3%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITLSLNWKHLSAKPHSPAIHedldlleveerekvvr--  1428
             +YK WVL+AILLLA W+MFTGSITL  +   LS  P +       D+  +   EK     
Sbjct  46    RYKFWVLSAILLLAFWSMFTGSITLKWSTGDLSQHPDNLGFQTQDDVDILVVEEKKKLVW  105

Query  1429  HMWDVYTES-RTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESP-  1602
              MWDVY  S R  RLP+FW+ AF+AAYE + SD +AVRDAAV+EIAK+S+ S    + P 
Sbjct  106   RMWDVYKHSNRGTRLPRFWERAFQAAYEALASDVTAVRDAAVSEIAKLSISSTINLDDPF  165

Query  1603  PIQSNS  1620
             P+QS +
Sbjct  166   PVQSTT  171



>ref|XP_010939258.1| PREDICTED: uncharacterized protein LOC105058138 isoform X3 [Elaeis 
guineensis]
Length=164

 Score =   106 bits (265),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 87/121 (72%), Gaps = 5/121 (4%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedld-lleveerekv  1422
             +YK W LAAI+LLA W+MFTG++TL   + N   LS     P + +    +LE+EEREKV
Sbjct  26    RYKFWALAAIILLAFWSMFTGTVTLKWSAGNLNRLSDDLLDPPLRDAALDVLEMEEREKV  85

Query  1423  vrHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESP  1602
             VRHMWD+Y  S   RLP+FWQEAFEAAYE++ SD +AVR+AAV+EIA+MSL      ESP
Sbjct  86    VRHMWDIYAHSLRIRLPRFWQEAFEAAYEELASDDAAVRNAAVSEIARMSLR-MVDLESP  144

Query  1603  P  1605
             P
Sbjct  145   P  145



>ref|XP_010939257.1| PREDICTED: uncharacterized protein LOC105058138 isoform X2 [Elaeis 
guineensis]
Length=177

 Score =   107 bits (266),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 86/121 (71%), Gaps = 5/121 (4%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldll-eveerekv  1422
             +YK W LAAI+LLA W+MFTG++TL   + N   LS     P + +    + E+EEREKV
Sbjct  26    RYKFWALAAIILLAFWSMFTGTVTLKWSAGNLNRLSDDLLDPPLRDAALDVLEMEEREKV  85

Query  1423  vrHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESP  1602
             VRHMWD+Y  S   RLP+FWQEAFEAAYE++ SD +AVR+AAV+EIA+MSL      ESP
Sbjct  86    VRHMWDIYAHSLRIRLPRFWQEAFEAAYEELASDDAAVRNAAVSEIARMSLR-MVDLESP  144

Query  1603  P  1605
             P
Sbjct  145   P  145



>ref|XP_010432152.1| PREDICTED: uncharacterized protein LOC104716471 [Camelina sativa]
Length=179

 Score =   107 bits (266),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 87/125 (70%), Gaps = 2/125 (2%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITLSLNWKHLSAKPHSPAI--Hedldlleveerekvvr  1428
             +YK W   AILLLA W+MFTG++TL L   +L+       I  +++LD+LE+EEREKVV+
Sbjct  38    RYKFWAFGAILLLAFWSMFTGTVTLRLTTGNLNRFSEDLGIPNYDNLDVLEMEEREKVVK  97

Query  1429  HMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPPI  1608
             HMWDVYT SR  +LP+FWQEAF AAYE++ SD   VR+AA+ EIAKMS+ S      P  
Sbjct  98    HMWDVYTSSRRIKLPRFWQEAFVAAYEELTSDVPGVREAAIGEIAKMSVQSITIDPPPSR  157

Query  1609  QSNSR  1623
               N+R
Sbjct  158   SMNAR  162



>ref|XP_010939255.1| PREDICTED: uncharacterized protein LOC105058138 isoform X1 [Elaeis 
guineensis]
 ref|XP_010939256.1| PREDICTED: uncharacterized protein LOC105058138 isoform X1 [Elaeis 
guineensis]
Length=192

 Score =   107 bits (267),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 87/121 (72%), Gaps = 5/121 (4%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedld-lleveerekv  1422
             +YK W LAAI+LLA W+MFTG++TL   + N   LS     P + +    +LE+EEREKV
Sbjct  26    RYKFWALAAIILLAFWSMFTGTVTLKWSAGNLNRLSDDLLDPPLRDAALDVLEMEEREKV  85

Query  1423  vrHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESP  1602
             VRHMWD+Y  S   RLP+FWQEAFEAAYE++ SD +AVR+AAV+EIA+MSL      ESP
Sbjct  86    VRHMWDIYAHSLRIRLPRFWQEAFEAAYEELASDDAAVRNAAVSEIARMSLR-MVDLESP  144

Query  1603  P  1605
             P
Sbjct  145   P  145



>ref|XP_006856090.1| hypothetical protein AMTR_s00059p00127380 [Amborella trichopoda]
 gb|ERN17557.1| hypothetical protein AMTR_s00059p00127380 [Amborella trichopoda]
Length=159

 Score =   106 bits (264),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 85/111 (77%), Gaps = 4/111 (4%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldlleveerekvv  1425
             +YK W L AI+LLA W++FTGS+TL     N   LS    SP IHEDLD+LE+EEREKVV
Sbjct  21    RYKFWALGAIILLAFWSIFTGSVTLKWSDGNLMRLSDDMDSP-IHEDLDVLELEEREKVV  79

Query  1426  rHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLH  1578
             RHMWDVYT ++  +LP+FWQEAFEAAYE++ SDS  V++ A++EIAKMS  
Sbjct  80    RHMWDVYTHNKRVKLPRFWQEAFEAAYEELDSDSPGVKEVAISEIAKMSFR  130



>emb|CAB16809.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB80332.1| hypothetical protein [Arabidopsis thaliana]
Length=159

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 89/122 (73%), Gaps = 3/122 (2%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITLSLNWKHLSAKPHSPAI--Hedldlleveerekvvr  1428
             +YK W  AAILLLA W+MFTG++TL L+  +L+       I  +++LD+LE+EEREKVV+
Sbjct  38    RYKFWAFAAILLLAFWSMFTGTVTLRLSTGNLNRLSEDLGIPNYDNLDVLEMEEREKVVK  97

Query  1429  HMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPPI  1608
             HMWDVYT SR  +LP+FWQEAF AAYE++ SD   VR+AA+ EIAKMS  S    + PP 
Sbjct  98    HMWDVYTNSRRIKLPRFWQEAFVAAYEELTSDVPGVREAAIGEIAKMSARS-ITLDPPPS  156

Query  1609  QS  1614
             +S
Sbjct  157   RS  158



>ref|NP_195384.5| uncharacterized protein [Arabidopsis thaliana]
 gb|AAS76222.1| At4g36660 [Arabidopsis thaliana]
 gb|AAS76688.1| At4g36660 [Arabidopsis thaliana]
 gb|AEE86684.1| uncharacterized protein AT4G36660 [Arabidopsis thaliana]
Length=179

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 90/124 (73%), Gaps = 3/124 (2%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITLSLNWKHLSAKPHSPAI--Hedldlleveerekvvr  1428
             +YK W  AAILLLA W+MFTG++TL L+  +L+       I  +++LD+LE+EEREKVV+
Sbjct  38    RYKFWAFAAILLLAFWSMFTGTVTLRLSTGNLNRLSEDLGIPNYDNLDVLEMEEREKVVK  97

Query  1429  HMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPPI  1608
             HMWDVYT SR  +LP+FWQEAF AAYE++ SD   VR+AA+ EIAKMS  S    + PP 
Sbjct  98    HMWDVYTNSRRIKLPRFWQEAFVAAYEELTSDVPGVREAAIGEIAKMSARS-ITLDPPPS  156

Query  1609  QSNS  1620
             +S S
Sbjct  157   RSMS  160



>ref|XP_010106008.1| hypothetical protein L484_021185 [Morus notabilis]
 gb|EXC07278.1| hypothetical protein L484_021185 [Morus notabilis]
Length=155

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 88/115 (77%), Gaps = 3/115 (3%)
 Frame = +1

Query  1246  EGFKYKLWVLAAILLLAGWTMFTGSITLSLNWKHLS--AKPHSPAIHedldlleveerek  1419
             + F YK WVL A+LLLA W+MFTGS+TL  +  +LS  +   S   ++DLD+LEVEEREK
Sbjct  23    KSFSYKFWVLFAVLLLAFWSMFTGSVTLKWSAGNLSRFSDDFSSPNYDDLDILEVEEREK  82

Query  1420  vvrHMWDVYTESRTARL-PKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHS  1581
             VVR MWDVYT+SR  R+ P+FWQEAFEAAYED++SD   +RDAA  EIAK+SL S
Sbjct  83    VVRLMWDVYTQSRNGRVVPRFWQEAFEAAYEDLVSDVPGLRDAAFLEIAKISLFS  137



>dbj|BAH30560.1| hypothetical protein [Arabidopsis thaliana]
Length=167

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 89/122 (73%), Gaps = 3/122 (2%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITLSLNWKHLSAKPHSPAI--Hedldlleveerekvvr  1428
             +YK W  AAILLLA W+MFTG++TL L+  +L+       I  +++LD+LE+EEREKVV+
Sbjct  38    RYKFWAFAAILLLAFWSMFTGTVTLRLSTGNLNRLSEDLGIPNYDNLDVLEMEEREKVVK  97

Query  1429  HMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPPI  1608
             HMWDVYT SR  +LP+FWQEAF AAYE++ SD   VR+AA+ EIAKMS  S    + PP 
Sbjct  98    HMWDVYTNSRRIKLPRFWQEAFVAAYEELTSDVPGVREAAIGEIAKMSARS-ITLDPPPS  156

Query  1609  QS  1614
             +S
Sbjct  157   RS  158



>ref|XP_010446762.1| PREDICTED: uncharacterized protein LOC104729514 [Camelina sativa]
Length=180

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 87/122 (71%), Gaps = 3/122 (2%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITLSLNWKHLSAKPHSPAI--Hedldlleveerekvvr  1428
             +YK W   AILLLA W+MFTG++TL L   +L+       I  +++LD+LE+EEREKVV+
Sbjct  39    RYKFWAFGAILLLAFWSMFTGTVTLRLTTGNLNRFSEDLGIPNYDNLDVLEMEEREKVVK  98

Query  1429  HMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPPI  1608
             HMWD YT SR  +LP+FWQEAF AAYE++ SD   VRDAA+ EIAKMS+ S    + PP 
Sbjct  99    HMWDAYTSSRRIKLPRFWQEAFVAAYEELTSDVPGVRDAAIGEIAKMSVQS-ITIDPPPS  157

Query  1609  QS  1614
             +S
Sbjct  158   RS  159



>gb|KHF97827.1| Serine--tRNA ligase [Gossypium arboreum]
Length=182

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 96/134 (72%), Gaps = 5/134 (4%)
 Frame = +1

Query  1225  TNGVQKKEGFKYKLWVLAAILLLAGWTMFTGSITLSLNWKHLSAKPHSP--AIHedldll  1398
             T G   K G  YK WVLAAILLLA W+MFTGS++L  +  HL+A       ++++DLD+L
Sbjct  32    TAGFLGKSG--YKFWVLAAILLLAFWSMFTGSVSLKWSSGHLTAFSDDIDFSVYDDLDVL  89

Query  1399  eveerekvvrHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLH  1578
             E+EEREKVVR MWDVYT S + RLP+FW EAFEAAYE + SD   VRD A++EIAK+S+ 
Sbjct  90    ELEEREKVVRKMWDVYTHSASVRLPRFWLEAFEAAYEYLSSDVPGVRDTAMSEIAKLSMR  149

Query  1579  SKAKPESPPIQSNS  1620
             S    +SP ++S S
Sbjct  150   S-LNLDSPSLRSKS  162



>emb|CDX75587.1| BnaA01g01150D [Brassica napus]
Length=169

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 82/110 (75%), Gaps = 3/110 (3%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITLSL---NWKHLSAKPHSPAIHedldlleveerekvv  1425
             +YK +  AA++LLA W+MFTG++TL L   +   LS     P  HE LD+LE+EERE+VV
Sbjct  28    RYKFFAFAALMLLAFWSMFTGTVTLRLSTEDLNRLSEDIGIPTNHESLDVLEMEERERVV  87

Query  1426  rHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSL  1575
             +HMWDVYT SR  +LP+FWQ+AF AAYE++ SD   VRDAA+ EIAKMS+
Sbjct  88    KHMWDVYTNSRRIKLPQFWQQAFVAAYEELTSDVPGVRDAAIGEIAKMSV  137



>ref|XP_007017505.1| Sugar transporter, putative isoform 2, partial [Theobroma cacao]
 gb|EOY14730.1| Sugar transporter, putative isoform 2, partial [Theobroma cacao]
Length=170

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 100/149 (67%), Gaps = 11/149 (7%)
 Frame = +1

Query  1216  QVKTNGVQKKE----GF----KYKLWVLAAILLLAGWTMFTGSITLSLNWKHLS--AKPH  1365
             Q +T G  KK     GF     YK WVLAAILLLA W+MFTGS++L  +   L+  +   
Sbjct  17    QQQTTGSAKKHSSVAGFFGKSGYKFWVLAAILLLAFWSMFTGSVSLKWSSGDLTRFSDDS  76

Query  1366  SPAIHedldlleveerekvvrHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDA  1545
               ++H+DLD+LE+EEREKVVR MW+VYT S + RLPKFW EAFEAAYE + SD   VRD 
Sbjct  77    EFSVHDDLDVLELEEREKVVRKMWNVYTHSASLRLPKFWLEAFEAAYEYLSSDVPGVRDT  136

Query  1546  AVTEIAKMSLHS-KAKPESPPIQSNSRCR  1629
             A++EIAK+S+ S    P SP  +S S+ R
Sbjct  137   AMSEIAKLSMRSLNLDPLSPKSKSTSQGR  165



>ref|XP_009142898.1| PREDICTED: uncharacterized protein LOC103866654 [Brassica rapa]
Length=172

 Score =   105 bits (261),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 82/110 (75%), Gaps = 3/110 (3%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITLSL---NWKHLSAKPHSPAIHedldlleveerekvv  1425
             +YK +  AA++LLA W+MFTG++TL L   +   LS     P  HE LD+LE+EEREKVV
Sbjct  28    RYKFFAFAALMLLAFWSMFTGTVTLRLSTEDLNRLSEDIGIPTNHESLDVLEMEEREKVV  87

Query  1426  rHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSL  1575
             +HMWDVYT SR  +LP+FWQ+AF AAYE++ SD   VRDAA+ EIAKMS+
Sbjct  88    KHMWDVYTNSRRIKLPQFWQQAFVAAYEELTSDVPGVRDAAIGEIAKMSV  137



>ref|XP_008362114.1| PREDICTED: uncharacterized protein LOC103425793 [Malus domestica]
Length=178

 Score =   105 bits (261),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 93/125 (74%), Gaps = 5/125 (4%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldlleveerekvv  1425
             +YK W LAAILLLA W+MFTG++TL   + N   LS    SP IH+DLD+LE+EEREKVV
Sbjct  31    RYKFWALAAILLLAFWSMFTGTVTLRWSAGNLNRLSDDFDSP-IHDDLDVLEMEEREKVV  89

Query  1426  rHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPP  1605
              HMWDVYT SR  RLP+FWQEAFEAAYE++ SD   VR+ A+TEIAKMS+ S    + PP
Sbjct  90    EHMWDVYTNSRRIRLPRFWQEAFEAAYEELTSDVPGVREEAITEIAKMSIRS-VDLDPPP  148

Query  1606  IQSNS  1620
              QS S
Sbjct  149   FQSAS  153



>ref|XP_009356685.1| PREDICTED: uncharacterized protein LOC103947497 [Pyrus x bretschneideri]
Length=178

 Score =   105 bits (261),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 93/125 (74%), Gaps = 5/125 (4%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldlleveerekvv  1425
             +YK W LAAILLLA W+MFTG++TL   + N   LS    SP IH+DLD+LE+EEREKVV
Sbjct  31    RYKFWALAAILLLAFWSMFTGTVTLRWSAGNLNRLSDDFDSP-IHDDLDVLEMEEREKVV  89

Query  1426  rHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPP  1605
              HMWDVYT SR  RLP+FWQEAFEAAYE++ SD   VR+ A+TEIAKMS+ S    + PP
Sbjct  90    EHMWDVYTNSRRIRLPRFWQEAFEAAYEELTSDVPGVREEAITEIAKMSVRS-VDLDPPP  148

Query  1606  IQSNS  1620
              QS S
Sbjct  149   FQSAS  153



>ref|XP_010244287.1| PREDICTED: uncharacterized protein LOC104588164 [Nelumbo nucifera]
Length=176

 Score =   104 bits (260),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 105/151 (70%), Gaps = 12/151 (8%)
 Frame = +1

Query  1198  MRDEEAQVKTNGVQKKEG-------FKYKLWVLAAILLLAGWTMFTGSITL---SLNWKH  1347
             M+D++A   T       G        +YK W LAAILLLA W+MFTG++TL   + N   
Sbjct  1     MKDDDAPSPTTKKDNSSGDASLFGKGRYKFWALAAILLLAFWSMFTGTVTLKWSASNLNR  60

Query  1348  LSAKPHSPAIHedldlleveerekvvrHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDS  1527
             LS   ++P I +DLD+LEVEEREKVV+HMWDVYT SR  +LP+FWQEAFEAAYED++SD 
Sbjct  61    LSDHLNTP-ILDDLDVLEVEEREKVVKHMWDVYTHSRRIQLPRFWQEAFEAAYEDLVSDL  119

Query  1528  SAVRDAAVTEIAKMSLHSKAKPESPPIQSNS  1620
               VRDAA++EIAKMS+ S    E PP+QS S
Sbjct  120   PGVRDAAISEIAKMSMRS-IDFEPPPVQSAS  149



>ref|XP_008241652.1| PREDICTED: uncharacterized protein LOC103340064 [Prunus mume]
Length=177

 Score =   104 bits (259),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 94/125 (75%), Gaps = 5/125 (4%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldlleveerekvv  1425
             +YK W LAAILLLA W+MFTG++TL   + N   LS    SP IH+DLD+LE+EEREKVV
Sbjct  30    RYKFWALAAILLLAFWSMFTGTVTLRWSAGNLNRLSDDLDSP-IHDDLDVLEMEEREKVV  88

Query  1426  rHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPP  1605
             +HMWDVYT SR  RLP+FWQEAFEAAYE++ SD    R+ A+TEIAKMS+ S    + PP
Sbjct  89    KHMWDVYTNSRRIRLPRFWQEAFEAAYEELTSDVPGFREEAITEIAKMSVRS-VDLDPPP  147

Query  1606  IQSNS  1620
             +QS S
Sbjct  148   VQSAS  152



>ref|XP_008357183.1| PREDICTED: uncharacterized protein LOC103420925 [Malus domestica]
 ref|XP_008364977.1| PREDICTED: uncharacterized protein LOC103428637 [Malus domestica]
Length=188

 Score =   104 bits (260),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 81/129 (63%), Gaps = 7/129 (5%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldlleveerekvv  1425
             +YK  VLAAILLLA W++FTG +TL   + N  H+S     P   +   L   E    V 
Sbjct  38    RYKFSVLAAILLLAFWSIFTGCVTLKWSAGNLSHVSDDLDIPTFDDLDILEVEERETVVR  97

Query  1426  rHMWDVYTESR---TARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPE  1596
              HMWD+YT+S    T+RLP+FWQEAFEAA+E + SD +AVRDAAV+EIAKMS+ S     
Sbjct  98    -HMWDLYTQSSRTSTSRLPRFWQEAFEAAFEHLSSDVAAVRDAAVSEIAKMSIRSIVLDP  156

Query  1597  SPPIQSNSR  1623
              P   +N R
Sbjct  157   IPLQSTNIR  165



>ref|XP_006411975.1| hypothetical protein EUTSA_v10026362mg [Eutrema salsugineum]
 gb|ESQ53428.1| hypothetical protein EUTSA_v10026362mg [Eutrema salsugineum]
Length=179

 Score =   103 bits (258),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 85/119 (71%), Gaps = 4/119 (3%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITLSLNWKHLSAKPHSPAI--Hedldlleveerekvvr  1428
             +YK W  AAILLLA W+MFTG++TL L+  +L+          +E+LD+LE+EEREKVV+
Sbjct  38    RYKFWAFAAILLLAFWSMFTGTVTLRLSTGNLNRLSDDRGFTNYENLDVLEMEEREKVVK  97

Query  1429  HMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPP  1605
             HMWDVYT S   +LP+FWQEAF AAYE++ SD   VRDAA  EIAKMS+ S   P  PP
Sbjct  98    HMWDVYTNSHRIKLPRFWQEAFVAAYEELTSDVPGVRDAAFGEIAKMSVES--IPLDPP  154



>ref|XP_004291885.1| PREDICTED: uncharacterized protein LOC101301938 [Fragaria vesca 
subsp. vesca]
Length=196

 Score =   104 bits (260),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 95/130 (73%), Gaps = 11/130 (8%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldlleveerekvv  1425
             +YKLWVLAAILLLA W+MFTGS+TL   + N   LS   + P  ++DLD+LEVE+REKVV
Sbjct  44    RYKLWVLAAILLLAFWSMFTGSVTLRWSAGNLTGLSDDLNIPT-YDDLDILEVEDREKVV  102

Query  1426  rHMWDVYTESR-------TARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSK  1584
             RH+WD+YT+ +       T RLP+FWQEAFEAAY+ + SD  AVR+AAV+EIAKMS+   
Sbjct  103   RHLWDLYTQRQSGSGRKSTTRLPRFWQEAFEAAYDPLSSDVPAVRNAAVSEIAKMSIRFI  162

Query  1585  AKPESPPIQS  1614
                +  P+QS
Sbjct  163   NVVDPFPLQS  172



>ref|XP_007202654.1| hypothetical protein PRUPE_ppa012270mg [Prunus persica]
 gb|EMJ03853.1| hypothetical protein PRUPE_ppa012270mg [Prunus persica]
Length=177

 Score =   103 bits (258),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 94/125 (75%), Gaps = 5/125 (4%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldlleveerekvv  1425
             +YK W LAAILLLA W+MFTG++TL   + N   LS    SP I +DLD+LE+EEREKVV
Sbjct  30    RYKFWALAAILLLAFWSMFTGTVTLRWSAGNLNRLSDDLDSP-IRDDLDVLEMEEREKVV  88

Query  1426  rHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPP  1605
             +HMWDVYT SR  RLP+FWQEAFEAAYE++ SD   VR+ A+TEIAKMS+ S    + PP
Sbjct  89    KHMWDVYTNSRRIRLPRFWQEAFEAAYEELTSDVPGVREEAITEIAKMSVRS-VDLDPPP  147

Query  1606  IQSNS  1620
             +QS S
Sbjct  148   VQSAS  152



>ref|XP_008338119.1| PREDICTED: uncharacterized protein LOC103401176 [Malus domestica]
Length=178

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 94/125 (75%), Gaps = 5/125 (4%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldlleveerekvv  1425
             +YK W LAAILLLA W+MFTG++TL   + N   LS    S  IH+DLD+LE+EEREKVV
Sbjct  31    RYKFWALAAILLLAFWSMFTGTVTLRWSAGNLNRLSDDLDS-RIHDDLDVLEMEEREKVV  89

Query  1426  rHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPP  1605
             +HMWDVYT SR  RLP+FWQEAFEAAYE++ SD   VR+ A+TEIAKMS+ S    + PP
Sbjct  90    KHMWDVYTNSRRIRLPRFWQEAFEAAYEELTSDVPGVREEAITEIAKMSVRS-VDLDPPP  148

Query  1606  IQSNS  1620
             +QS S
Sbjct  149   VQSAS  153



>ref|XP_006593126.1| PREDICTED: uncharacterized protein LOC100783879 [Glycine max]
Length=488

 Score =   107 bits (267),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 104/153 (68%), Gaps = 18/153 (12%)
 Frame = +1

Query  1198  MRDEEA--QVKTNGVQKKEGF--------KYKLWVLAAILLLAGWTMFTGSITLSLNW--  1341
             M+DE+    + T    KKE          +YK WVLAA+LL   W+M+ G  T+SL+W  
Sbjct  1     MKDEDGLQMMTTTAATKKESMDSSLFGKGRYKFWVLAAMLLQVFWSMYNG--TVSLHWFG  58

Query  1342  --KHLSAKPHSPAIHedldlleveerekvvrHMWDVYTESRTARLPKFWQEAFEAAYEDM  1515
                 LS+  ++P IH+DLD+LE+EEREKVVR+MWDV T +   RLP+FWQE F+AAY+D+
Sbjct  59    TLNSLSSDINTP-IHDDLDVLEMEEREKVVRNMWDVCTNNHRVRLPRFWQEVFKAAYKDL  117

Query  1516  MSDSSAVRDAAVTEIAKMSLHSKAKPESPPIQS  1614
             MSD++ VRDAAVTEIAKM + S    + PP+QS
Sbjct  118   MSDAAEVRDAAVTEIAKMFVRS-IHFDPPPLQS  149


 Score = 66.6 bits (161),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 38/54 (70%), Gaps = 1/54 (2%)
 Frame = +1

Query  1453  SRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPPIQS  1614
              R  RL +FWQEAFE AYED+M D + VRDA +TEIAKM + S    + PP+QS
Sbjct  302   CRRVRLSRFWQEAFEVAYEDLMGDVAEVRDAVITEIAKMCVRS-IHFDPPPLQS  354



>ref|NP_173371.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF79423.1|AC025808_5 F18O14.10 [Arabidopsis thaliana]
 gb|AAS76218.1| At1g19380 [Arabidopsis thaliana]
 gb|AAS88771.1| At1g19380 [Arabidopsis thaliana]
 dbj|BAF00843.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29841.1| uncharacterized protein AT1G19380 [Arabidopsis thaliana]
Length=147

 Score =   101 bits (251),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 94/132 (71%), Gaps = 3/132 (2%)
 Frame = +1

Query  1225  TNGVQKKEGFKYKLWVLAAILLLAGWTMFTGSITL-SLNWKHLSAKPHSPAIHedldlle  1401
              NG +K  G  YKLWVL A+LLLA  +M TGS++L  +   H +   ++ +  +DLD+LE
Sbjct  16    VNGNRKTAG--YKLWVLIAVLLLAFGSMLTGSVSLKGIGLFHSADGVNAFSFGDDLDVLE  73

Query  1402  veerekvvrHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHS  1581
             +EEREKVVR MWDVY  S   ++P+FW+EAFEAAYE ++SDS+AVR+AAV++IAK+SL  
Sbjct  74    IEEREKVVRQMWDVYGRSGGVKVPRFWREAFEAAYEFLISDSAAVRNAAVSDIAKLSLVR  133

Query  1582  KAKPESPPIQSN  1617
               K ES   Q N
Sbjct  134   FVKSESTSAQPN  145



>gb|KHN20989.1| hypothetical protein glysoja_009297 [Glycine soja]
Length=161

 Score =   101 bits (252),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 88/131 (67%), Gaps = 9/131 (7%)
 Frame = +1

Query  1198  MRDEEAQVKTNGVQKKEGFKYKLWVLAAILLLAGWTMFTGSITLSLNWKHLSAKPHSPAI  1377
             M+DE+   ++ G    +G +YKLWVL AI+LLA W+MFT S+TL  +  +L+    S  +
Sbjct  1     MKDEDGTPQSAG----KG-QYKLWVLGAIILLALWSMFTASLTLKWSAGNLNRDFDSATL  55

Query  1378  HedldlleveerekvvrHMWDVYTESRTAR---LPKFWQEAFEAAYEDMMSDSSAVRDAA  1548
             ++   L   E  + V   MWDVYT+S++ R   LP+FW +AF AAY+ ++SD  +VRDAA
Sbjct  56    NDFDVLEVEEREKVVR-RMWDVYTQSKSGRGSGLPRFWSDAFHAAYDHLVSDVQSVRDAA  114

Query  1549  VTEIAKMSLHS  1581
             V+EIAK+SLHS
Sbjct  115   VSEIAKISLHS  125



>ref|XP_008352460.1| PREDICTED: uncharacterized protein LOC103415959 [Malus domestica]
Length=173

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 93/123 (76%), Gaps = 5/123 (4%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldlleveerekvv  1425
             +YK W LAAILLLA W+MFTG++TL   + N   LS    S  IH+DLD+LE+EEREKVV
Sbjct  31    RYKFWALAAILLLAFWSMFTGTVTLRWSAGNLNRLSDDLDS-RIHDDLDVLEMEEREKVV  89

Query  1426  rHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPP  1605
             +HMWDVYT SR  RLP+FWQEAFEAAYE++ SD   VR+ A+TEIAKMS+ S    + PP
Sbjct  90    KHMWDVYTNSRRIRLPRFWQEAFEAAYEELTSDVPGVREEAITEIAKMSVRS-VDLDPPP  148

Query  1606  IQS  1614
             +QS
Sbjct  149   VQS  151



>ref|XP_007206057.1| hypothetical protein PRUPE_ppa012645mg [Prunus persica]
 gb|EMJ07256.1| hypothetical protein PRUPE_ppa012645mg [Prunus persica]
Length=160

 Score =   101 bits (252),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 75/113 (66%), Gaps = 7/113 (6%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldlleveerekvv  1425
             +YK WVLAAILLLA W+MFTGS+TL   + N   LS     P+  +   L   E  + V 
Sbjct  46    RYKFWVLAAILLLAFWSMFTGSVTLKWSAGNLTRLSDDLDLPSFDDLDILEVEEREKVVR  105

Query  1426  rHMWDVYTESR---TARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSL  1575
              HMWD+YT+S    + RLP+FWQEAFEAAYE + SD + VRDAAV EIAKM L
Sbjct  106   -HMWDLYTQSSRSSSNRLPRFWQEAFEAAYEHLSSDVAPVRDAAVLEIAKMPL  157



>ref|XP_006595581.1| PREDICTED: uncharacterized protein LOC100803339 isoform X1 [Glycine 
max]
Length=158

 Score =   101 bits (251),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 88/131 (67%), Gaps = 9/131 (7%)
 Frame = +1

Query  1198  MRDEEAQVKTNGVQKKEGFKYKLWVLAAILLLAGWTMFTGSITLSLNWKHLSAKPHSPAI  1377
             M+DE+   ++ G    +G +YKLWVL AI+LLA W+MFT S+TL  +  +L+    S  +
Sbjct  1     MKDEDGTPQSAG----KG-QYKLWVLGAIILLALWSMFTASLTLKWSAGNLNRDFDSATL  55

Query  1378  HedldlleveerekvvrHMWDVYTESRTAR---LPKFWQEAFEAAYEDMMSDSSAVRDAA  1548
             ++   L   E  + V   MWDVYT+S++ R   LP+FW +AF AAY+ ++SD  +VRDAA
Sbjct  56    NDFDVLEVEEREKVVR-RMWDVYTQSKSGRGSGLPRFWSDAFHAAYDHLVSDVQSVRDAA  114

Query  1549  VTEIAKMSLHS  1581
             V+EIAK+SLHS
Sbjct  115   VSEIAKISLHS  125



>ref|XP_002521583.1| sugar transporter, putative [Ricinus communis]
 gb|EEF40854.1| sugar transporter, putative [Ricinus communis]
Length=382

 Score =   105 bits (262),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 95/125 (76%), Gaps = 5/125 (4%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldlleveerekvv  1425
             +YK W LAAILLLA W+MFTG++TL   + N   LS    +P IH+DLD+LE+EERE+VV
Sbjct  235   RYKFWALAAILLLAFWSMFTGTVTLRWSAGNLNRLSDDIDAP-IHDDLDVLEMEERERVV  293

Query  1426  rHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPP  1605
             +HMWDVYT S   RLP+FWQEAFEAAYED+ SD   ++DAA++EIAKMS+ S    + PP
Sbjct  294   KHMWDVYTNSHRIRLPRFWQEAFEAAYEDLTSDVPGIKDAAISEIAKMSVRSIIL-DPPP  352

Query  1606  IQSNS  1620
             +QS S
Sbjct  353   VQSTS  357



>ref|XP_008790343.1| PREDICTED: uncharacterized protein LOC103707584 isoform X2 [Phoenix 
dactylifera]
Length=172

 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 86/121 (71%), Gaps = 5/121 (4%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKP-HSPAIHedldlleveerekv  1422
             +YK W LAAI+LLA W+M TG++TL   + N   LS     +P    DLD+LE+EEREKV
Sbjct  26    RYKFWALAAIILLAFWSMLTGTVTLKWSAGNLNRLSDDLLGAPFRDADLDVLEMEEREKV  85

Query  1423  vrHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESP  1602
             VRHMWD+Y  S   RLP+FWQEAFEAAYE++ SD  AVRDAAV+EIA+MS+      E P
Sbjct  86    VRHMWDIYAHSLRIRLPRFWQEAFEAAYEELASDDLAVRDAAVSEIARMSMR-MVDLEPP  144

Query  1603  P  1605
             P
Sbjct  145   P  145



>ref|XP_010936292.1| PREDICTED: uncharacterized protein LOC105055949 isoform X1 [Elaeis 
guineensis]
Length=181

 Score =   101 bits (252),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 86/121 (71%), Gaps = 5/121 (4%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITLSLNWKHLSAKPH----SPAIHedldlleveerekv  1422
             +YK W LAAI+LLA W+M TG++TL  +  +L+        +P    DLD+LE+EEREKV
Sbjct  29    RYKFWALAAIILLAFWSMLTGTVTLKGSAGNLNRISDDLLDAPLRDADLDVLEMEEREKV  88

Query  1423  vrHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESP  1602
             VRHMWD+Y  S   RLP+FWQEAFEAAYE++ SD  AVRDAAV+EIA+MS+      E P
Sbjct  89    VRHMWDIYAHSLRIRLPRFWQEAFEAAYEELASDDLAVRDAAVSEIARMSMR-MVDLEPP  147

Query  1603  P  1605
             P
Sbjct  148   P  148



>ref|XP_009625643.1| PREDICTED: uncharacterized protein LOC104116484 [Nicotiana tomentosiformis]
Length=182

 Score =   101 bits (252),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 90/124 (73%), Gaps = 3/124 (2%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITLSLNWKHLSAKPHSPAIH--edldlleveerekvvr  1428
             +YK W  AAILLLA W+M TG++TL  +  +L+A   +  I   EDLD+LE+EEREK+V+
Sbjct  39    RYKFWAFAAILLLAFWSMLTGTVTLRWSAGNLNAISDNIDIPLPEDLDVLEMEEREKLVK  98

Query  1429  HMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPPI  1608
             HMWDVYT SR  ++PKFWQEAFEAAYE++ SD   V + A++EIAKMS+      ESPP+
Sbjct  99    HMWDVYTNSRGIKMPKFWQEAFEAAYEELTSDVPGVSEDAISEIAKMSVR-YIPIESPPL  157

Query  1609  QSNS  1620
              S+ 
Sbjct  158   HSSG  161



>ref|XP_010936400.1| PREDICTED: uncharacterized protein LOC105056036 isoform X2 [Elaeis 
guineensis]
Length=179

 Score =   101 bits (251),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 86/121 (71%), Gaps = 5/121 (4%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITLSLNWKHLSAKPH----SPAIHedldlleveerekv  1422
             +YK W LAAI+LLA W+M TG++TL  +  +L+        +P    DLD+LE+EEREKV
Sbjct  29    RYKFWALAAIILLAFWSMLTGTVTLKGSAGNLNRISDDFLDAPLRDADLDVLEMEEREKV  88

Query  1423  vrHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESP  1602
             VRHMWD+Y  S   RLP+FWQEAFEAAYE++ SD  AVRDAAV+EIA+MS+      E P
Sbjct  89    VRHMWDIYAHSLRIRLPRFWQEAFEAAYEELASDDLAVRDAAVSEIARMSMR-MVDLEPP  147

Query  1603  P  1605
             P
Sbjct  148   P  148



>ref|XP_008790342.1| PREDICTED: uncharacterized protein LOC103707584 isoform X1 [Phoenix 
dactylifera]
Length=177

 Score =   101 bits (251),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 86/121 (71%), Gaps = 5/121 (4%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKP-HSPAIHedldlleveerekv  1422
             +YK W LAAI+LLA W+M TG++TL   + N   LS     +P    DLD+LE+EEREKV
Sbjct  26    RYKFWALAAIILLAFWSMLTGTVTLKWSAGNLNRLSDDLLGAPFRDADLDVLEMEEREKV  85

Query  1423  vrHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESP  1602
             VRHMWD+Y  S   RLP+FWQEAFEAAYE++ SD  AVRDAAV+EIA+MS+      E P
Sbjct  86    VRHMWDIYAHSLRIRLPRFWQEAFEAAYEELASDDLAVRDAAVSEIARMSMR-MVDLEPP  144

Query  1603  P  1605
             P
Sbjct  145   P  145



>ref|XP_010936293.1| PREDICTED: uncharacterized protein LOC105055949 isoform X2 [Elaeis 
guineensis]
Length=180

 Score =   101 bits (251),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 86/121 (71%), Gaps = 5/121 (4%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITLSLNWKHLSAKPH----SPAIHedldlleveerekv  1422
             +YK W LAAI+LLA W+M TG++TL  +  +L+        +P    DLD+LE+EEREKV
Sbjct  29    RYKFWALAAIILLAFWSMLTGTVTLKGSAGNLNRISDDLLDAPLRDADLDVLEMEEREKV  88

Query  1423  vrHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESP  1602
             VRHMWD+Y  S   RLP+FWQEAFEAAYE++ SD  AVRDAAV+EIA+MS+      E P
Sbjct  89    VRHMWDIYAHSLRIRLPRFWQEAFEAAYEELASDDLAVRDAAVSEIARMSMR-MVDLEPP  147

Query  1603  P  1605
             P
Sbjct  148   P  148



>ref|XP_010936399.1| PREDICTED: uncharacterized protein LOC105056036 isoform X1 [Elaeis 
guineensis]
Length=180

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 83/112 (74%), Gaps = 4/112 (4%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITLSLNWKHLSAKPH----SPAIHedldlleveerekv  1422
             +YK W LAAI+LLA W+M TG++TL  +  +L+        +P    DLD+LE+EEREKV
Sbjct  29    RYKFWALAAIILLAFWSMLTGTVTLKGSAGNLNRISDDFLDAPLRDADLDVLEMEEREKV  88

Query  1423  vrHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLH  1578
             VRHMWD+Y  S   RLP+FWQEAFEAAYE++ SD  AVRDAAV+EIA+MS+ 
Sbjct  89    VRHMWDIYAHSLRIRLPRFWQEAFEAAYEELASDDLAVRDAAVSEIARMSMR  140



>gb|KDP27567.1| hypothetical protein JCGZ_20030 [Jatropha curcas]
Length=187

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 96/127 (76%), Gaps = 6/127 (5%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldlleveerekvv  1425
             +YK W LAAILLLA W+MFTG++TL   S N   L     +P IH+DLD+LE+EEREKVV
Sbjct  40    RYKFWALAAILLLAFWSMFTGTVTLRWSSGNLNSLYDDIDAP-IHDDLDVLEMEEREKVV  98

Query  1426  rHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPP  1605
             +HMWDVYT SR  RLP+FW EAFEAAYE++ SD   +RDAA++EIAKMS+ S    + PP
Sbjct  99    KHMWDVYTNSRRIRLPRFWLEAFEAAYEELTSDVPGIRDAAISEIAKMSVRSIIL-DPPP  157

Query  1606  IQS-NSR  1623
             IQS N+R
Sbjct  158   IQSTNAR  164



>ref|XP_007017504.1| Sugar transporter, putative isoform 1 [Theobroma cacao]
 gb|EOY14729.1| Sugar transporter, putative isoform 1 [Theobroma cacao]
Length=173

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 95/140 (68%), Gaps = 11/140 (8%)
 Frame = +1

Query  1216  QVKTNGVQKKE----GF----KYKLWVLAAILLLAGWTMFTGSITLSLNWKHLS--AKPH  1365
             Q +T G  KK     GF     YK WVLAAILLLA W+MFTGS++L  +   L+  +   
Sbjct  17    QQQTTGSAKKHSSVAGFFGKSGYKFWVLAAILLLAFWSMFTGSVSLKWSSGDLTRFSDDS  76

Query  1366  SPAIHedldlleveerekvvrHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDA  1545
               ++H+DLD+LE+EEREKVVR MW+VYT S + RLPKFW EAFEAAYE + SD   VRD 
Sbjct  77    EFSVHDDLDVLELEEREKVVRKMWNVYTHSASLRLPKFWLEAFEAAYEYLSSDVPGVRDT  136

Query  1546  AVTEIAKMSLHS-KAKPESP  1602
             A++EIAK+S+ S    P SP
Sbjct  137   AMSEIAKLSMRSLNLDPLSP  156



>ref|XP_006466773.1| PREDICTED: uncharacterized protein LOC102620496 isoform X2 [Citrus 
sinensis]
Length=144

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 98/137 (72%), Gaps = 14/137 (10%)
 Frame = +1

Query  1198  MRDEEA--QVKTNGVQKKEG--------FKYKLWVLAAILLLAGWTMFTGSITL---SLN  1338
             M+D+E+     T  V KKE          +YK W LAAILLLA W+MFTG++TL   + N
Sbjct  1     MKDDESVPTTTTLNVTKKESSDSSIFGKGRYKFWALAAILLLAFWSMFTGTVTLRWSAGN  60

Query  1339  WKHLSAKPHSPAIHedldlleveerekvvrHMWDVYTESRTARLPKFWQEAFEAAYEDMM  1518
                LS    SP IH+DLD+LE+EEREKVV+HMWDVYT SR  RLP+FWQEAFEAAYE++ 
Sbjct  61    LNRLSDDLGSP-IHDDLDVLEMEEREKVVKHMWDVYTNSRRIRLPRFWQEAFEAAYEELS  119

Query  1519  SDSSAVRDAAVTEIAKM  1569
             SD + VRDAA+TEIAK+
Sbjct  120   SDVAEVRDAAITEIAKI  136



>ref|XP_010444944.1| PREDICTED: probable polyol transporter 6 [Camelina sativa]
Length=677

 Score =   106 bits (265),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 88/122 (72%), Gaps = 3/122 (2%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITLSLNWKHLSAKPHSPAI--Hedldlleveerekvvr  1428
             +YK W   AILLLA W+MFTG++TL L   +L+       I  +++LD+LE+EEREKVV+
Sbjct  536   RYKFWAFGAILLLAFWSMFTGTVTLRLTTGNLNRFSEDLGIPNYDNLDVLEMEEREKVVK  595

Query  1429  HMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPPI  1608
             HMWDVYT SR  +LP+FWQEAF AAYE++ SD   VR+AA+ EIAKMS+ S    + PP 
Sbjct  596   HMWDVYTSSRRIKLPRFWQEAFVAAYEELTSDVPGVREAAIGEIAKMSVQS-ITIDPPPS  654

Query  1609  QS  1614
             +S
Sbjct  655   RS  656



>ref|XP_007227275.1| hypothetical protein PRUPE_ppa017694mg, partial [Prunus persica]
 gb|EMJ28474.1| hypothetical protein PRUPE_ppa017694mg, partial [Prunus persica]
Length=117

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 74/111 (67%), Gaps = 7/111 (6%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldlleveerekvv  1425
             +YK WVLAAILLLA W+MFTGS+TL   + N   LS     P+  +   L   E  + V 
Sbjct  8     RYKFWVLAAILLLAFWSMFTGSVTLKWSAGNLTRLSDDLDLPSFDDLDILEVEEREKVVR  67

Query  1426  rHMWDVYTESR---TARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKM  1569
              HMWD+YT+S    + RLP+FWQEAFEAAYE + SD + VRDAAV EIAK+
Sbjct  68    -HMWDLYTQSSRSSSNRLPRFWQEAFEAAYEHLSSDVAPVRDAAVLEIAKI  117



>ref|XP_009791325.1| PREDICTED: uncharacterized protein LOC104238615 [Nicotiana sylvestris]
Length=182

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 87/121 (72%), Gaps = 3/121 (2%)
 Frame = +1

Query  1258  YKLWVLAAILLLAGWTMFTGSITLSLNWKHLSAKPHSPAIH--edldlleveerekvvrH  1431
             YK W  AAILLLA W+M TG++TL  +  +L+A   +  I   EDLD+L +EEREK+V+H
Sbjct  40    YKFWAFAAILLLAFWSMLTGTVTLRWSAGNLNAISDNIDIPLPEDLDVLAMEEREKLVKH  99

Query  1432  MWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPPIQ  1611
             MWDVYT SR  ++PKFWQEAFEAAYE++ SD   V + A++EIAKMS+      ESPP+ 
Sbjct  100   MWDVYTNSRGIKMPKFWQEAFEAAYEELTSDVPGVSEDAISEIAKMSVR-YIPIESPPLH  158

Query  1612  S  1614
             S
Sbjct  159   S  159



>ref|XP_008220784.1| PREDICTED: uncharacterized protein LOC103320830 isoform X1 [Prunus 
mume]
Length=198

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 76/115 (66%), Gaps = 7/115 (6%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldlleveerekvv  1425
             +YK WVLAAILLLA W+MFTGS+TL   + N   LS     P+  +   L   E  + V 
Sbjct  47    RYKFWVLAAILLLAFWSMFTGSVTLRWSAGNLTRLSDDWDLPSFDDLDILEVEEREKVVR  106

Query  1426  rHMWDVYTESR---TARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHS  1581
              HMWD+YT+S    + RLP+FWQEAFEAAYE + SD +  RDAAV EIAKMS+ S
Sbjct  107   -HMWDLYTQSSRSSSNRLPRFWQEAFEAAYEHLSSDVAPDRDAAVLEIAKMSIRS  160



>ref|XP_008220785.1| PREDICTED: uncharacterized protein LOC103320830 isoform X2 [Prunus 
mume]
Length=182

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 76/115 (66%), Gaps = 7/115 (6%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldlleveerekvv  1425
             +YK WVLAAILLLA W+MFTGS+TL   + N   LS     P+  +   L   E  + V 
Sbjct  47    RYKFWVLAAILLLAFWSMFTGSVTLRWSAGNLTRLSDDWDLPSFDDLDILEVEEREKVVR  106

Query  1426  rHMWDVYTESR---TARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHS  1581
              HMWD+YT+S    + RLP+FWQEAFEAAYE + SD +  RDAAV EIAKMS+ S
Sbjct  107   -HMWDLYTQSSRSSSNRLPRFWQEAFEAAYEHLSSDVAPDRDAAVLEIAKMSIRS  160



>ref|XP_009364539.1| PREDICTED: uncharacterized protein LOC103954431 [Pyrus x bretschneideri]
Length=183

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 83/138 (60%), Gaps = 11/138 (8%)
 Frame = +1

Query  1240  KKEGF----KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldll  1398
             K  GF    +YK  VLAAILLLA W+MFTG +TL   + N  HLS     P   +   L 
Sbjct  29    KAGGFLDKNRYKFSVLAAILLLAFWSMFTGCVTLKWSAGNLSHLSDDLDIPTFDDLDILE  88

Query  1399  eveerekvvrHMWDVYTESRTA---RLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKM  1569
               E  + V   MWD+YT+S ++   RLP FWQEAFEAAYE + SD +AVRDAAV+EIAKM
Sbjct  89    VEEREKVVR-QMWDLYTQSSSSSTSRLPLFWQEAFEAAYEHLSSDVAAVRDAAVSEIAKM  147

Query  1570  SLHSKAKPESPPIQSNSR  1623
             S+ S      P   +N R
Sbjct  148   SIRSIVLDPIPLQSTNIR  165



>ref|XP_009402023.1| PREDICTED: uncharacterized protein LOC103985884 [Musa acuminata 
subsp. malaccensis]
Length=185

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 79/111 (71%), Gaps = 4/111 (4%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldlleveerekvv  1425
             +YK W L AILLLA W+M TG++TL   + +   L    ++P IH DLD LE+EEREKVV
Sbjct  36    RYKFWALTAILLLAFWSMVTGTVTLRWSAGDLNRLDRDLNAP-IHSDLDALEMEEREKVV  94

Query  1426  rHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLH  1578
             RHMWDVY  +   RLP+FWQEAFEAAYE++  D  A RD A+ EIA+MS+ 
Sbjct  95    RHMWDVYAHNHRIRLPRFWQEAFEAAYEELAGDDPAARDGAIAEIARMSVR  145



>ref|XP_007156031.1| hypothetical protein PHAVU_003G252600g [Phaseolus vulgaris]
 gb|ESW28025.1| hypothetical protein PHAVU_003G252600g [Phaseolus vulgaris]
Length=170

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 91/126 (72%), Gaps = 4/126 (3%)
 Frame = +1

Query  1258  YKLWVLAAILLLAGWTMFTGSITL--SLNWKHLSAKPHSPAIHedldlleveerekvvrH  1431
             YK W LAAILLLA W+MFTG+++L  S      S   H P +H+ LD+LE+EEREKVVRH
Sbjct  27    YKFWALAAILLLALWSMFTGTVSLRWSGTLNTFSHDLHVP-LHDHLDVLEMEEREKVVRH  85

Query  1432  MWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPPIQ  1611
             MWDVYT +R  RLP+FWQEAFEAAYED+ SD +  RDAA+ EIA MSL S    + PPI 
Sbjct  86    MWDVYTNNRRIRLPRFWQEAFEAAYEDLSSDVAEDRDAAIAEIANMSL-SSFDIQLPPIT  144

Query  1612  SNSRCR  1629
              ++R R
Sbjct  145   HSTRAR  150



>gb|KHG00293.1| Gamma-aminobutyric acid receptor alpha-like protein [Gossypium 
arboreum]
Length=194

 Score = 98.6 bits (244),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 91/129 (71%), Gaps = 4/129 (3%)
 Frame = +1

Query  1201  RDEEAQVKTNGVQKKEGFKYKLWVLAAILLLAGWTMFTGSITLSLNWKHLSAKPHSP--A  1374
             +D  +     G   K G  YK WVL AI+LLA W+MFTGS++L  +  +L++  +    +
Sbjct  28    KDSSSSSSVAGFFGKNG--YKFWVLTAIILLAFWSMFTGSVSLKWSSGNLTSFSYDSDFS  85

Query  1375  IHedldlleveerekvvrHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVT  1554
             I EDLD+LE+EEREKVVR MW VYT S + RLP+FW +AFEAAYE++ SD + VRD A++
Sbjct  86    IREDLDVLELEEREKVVRKMWHVYTHSTSIRLPRFWLDAFEAAYENLSSDVNGVRDKAIS  145

Query  1555  EIAKMSLHS  1581
             EIAK+S+ S
Sbjct  146   EIAKLSMQS  154



>emb|CBI17540.3| unnamed protein product [Vitis vinifera]
Length=178

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 93/123 (76%), Gaps = 5/123 (4%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldlleveerekvv  1425
             +YK W LAAILLLA W+MFTG++TL   + N  H+S    S  IH+DLD+LE+EEREKVV
Sbjct  30    RYKFWALAAILLLAFWSMFTGTVTLRWSAGNLNHISDDLDS-HIHDDLDVLEMEEREKVV  88

Query  1426  rHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPP  1605
             +HMWDVYT SR +RLP+FWQEAFEAAYED+ +D   VR+ A++EI +MS+ +    + P 
Sbjct  89    KHMWDVYTNSRRSRLPRFWQEAFEAAYEDLTNDDPGVREDAISEIVRMSVRN-IDLDPPL  147

Query  1606  IQS  1614
             IQS
Sbjct  148   IQS  150



>ref|XP_006383226.1| hypothetical protein POPTR_0005s12660g [Populus trichocarpa]
 gb|ERP61023.1| hypothetical protein POPTR_0005s12660g [Populus trichocarpa]
Length=164

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 95/136 (70%), Gaps = 13/136 (10%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldlleveerekvv  1425
             +YK W LAAILLLA W+MFTG++TL   + N   L+    +P I +D D+LE+EEREK V
Sbjct  29    RYKFWALAAILLLAFWSMFTGTVTLRWSAGNLNSLADDIDTP-IRDDRDVLEMEEREKAV  87

Query  1426  rHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPP  1605
             +HMWD+YT SR  RLPKFWQEAFEAAYE++ SD+  V++AA+TEIAKMS+ S    +  P
Sbjct  88    KHMWDIYTNSRRIRLPKFWQEAFEAAYEELTSDAPDVKEAAITEIAKMSIRS-IDLDPLP  146

Query  1606  IQSN--------SRCR  1629
             +QS         S CR
Sbjct  147   VQSTLEFALLYFSNCR  162



>ref|XP_008785651.1| PREDICTED: uncharacterized protein LOC103704228 [Phoenix dactylifera]
Length=177

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 82/123 (67%), Gaps = 9/123 (7%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL-----SLNWKHLSAKPHSPAIHedldll-eveere  1416
             +YK W LAAI+LLA W+M TG++TL     SLN    S     P + +    + E+EERE
Sbjct  26    RYKFWALAAIILLAFWSMLTGTVTLKWSAGSLN--RFSDDLLDPPLRDADLDVLEMEERE  83

Query  1417  kvvrHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPE  1596
             KVVRHMWD+Y  S   RLP+FWQ+AFEAAYE++ SD  AVRDAAV+EI +MS+      E
Sbjct  84    KVVRHMWDIYAHSLRIRLPRFWQQAFEAAYEELASDDPAVRDAAVSEIVRMSMR-MVDLE  142

Query  1597  SPP  1605
              PP
Sbjct  143   PPP  145



>gb|ABU45182.1| unknown [Capsicum frutescens]
Length=195

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 86/119 (72%), Gaps = 3/119 (3%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITLSLNWKHLSAKPHSPAIH--edldlleveerekvvr  1428
             +YK W  AAILLLA W+M TG++TL  +  +L+A      I   EDLD+LE+EEREK+V+
Sbjct  44    RYKFWAFAAILLLAFWSMLTGTVTLRWSAGNLNAISDDIDIPLPEDLDVLEMEEREKLVK  103

Query  1429  HMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPP  1605
             HMWDVYT SR  +LPKFWQ+AFEAAYE++ SD   V + +++EIAKMS+      ESPP
Sbjct  104   HMWDVYTNSRGIKLPKFWQDAFEAAYEELTSDVPGVTEDSISEIAKMSVR-YIPIESPP  161



>ref|XP_010680806.1| PREDICTED: uncharacterized protein LOC104895866 [Beta vulgaris 
subsp. vulgaris]
Length=183

 Score = 97.1 bits (240),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 91/122 (75%), Gaps = 5/122 (4%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldlleveerekvv  1425
             +YK W LAAILLLA W+MFTG++TL   + N   LS    +P + +DLD+LE+EEREKVV
Sbjct  40    RYKFWALAAILLLAFWSMFTGTVTLRWSAGNLNRLSDDLDTP-LRDDLDVLEMEEREKVV  98

Query  1426  rHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPP  1605
             ++MWDVYT S   RLP+FWQ+AFEAAYEDM SD   VR+AA+ EIAKMS+ S    + PP
Sbjct  99    KYMWDVYTNSHRMRLPRFWQQAFEAAYEDMTSDVPGVREAAINEIAKMSIRS-IDLDPPP  157

Query  1606  IQ  1611
             IQ
Sbjct  158   IQ  159



>ref|XP_004160032.1| PREDICTED: uncharacterized protein LOC101224396 [Cucumis sativus]
 gb|KGN62590.1| hypothetical protein Csa_2G361550 [Cucumis sativus]
Length=169

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 79/112 (71%), Gaps = 4/112 (4%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldlleveerekvv  1425
             +YK W LA ILLLA W+MFTGS++L   +  +      P  P I +DLD+LEVEERE+ V
Sbjct  31    RYKFWALAVILLLAFWSMFTGSVSLKWSAGTFARFYDGPLKP-IFDDLDILEVEERERDV  89

Query  1426  rHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHS  1581
             RHMW++YT     RLP+FW +AFEAAYED++ D    RDAA+ EIA+MSL S
Sbjct  90    RHMWNLYTHGGGGRLPRFWSDAFEAAYEDLIGDVPGARDAALLEIARMSLQS  141



>ref|XP_010558208.1| PREDICTED: uncharacterized protein LOC104826929 [Tarenaya hassleriana]
Length=185

 Score = 96.7 bits (239),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 90/126 (71%), Gaps = 4/126 (3%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldlleveerekvv  1425
             +YK W LAAILLLA W+MFTG++TL   + N    S    SP IHEDLD+LE+EEREKVV
Sbjct  33    RYKFWALAAILLLAFWSMFTGTVTLRWSAGNLNRFSDDFDSP-IHEDLDVLEMEEREKVV  91

Query  1426  rHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPP  1605
             +HMWDVYT  R  RLP+FWQEAFEAAYE++ SD   V++AA TEIA+MS+ S      P 
Sbjct  92    KHMWDVYTNGRRIRLPRFWQEAFEAAYEELSSDVPGVKEAATTEIARMSVRSVVIDPPPA  151

Query  1606  IQSNSR  1623
               +N R
Sbjct  152   HSTNVR  157



>gb|KFK44072.1| hypothetical protein AALP_AA1G212500 [Arabis alpina]
Length=153

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 87/122 (71%), Gaps = 3/122 (2%)
 Frame = +1

Query  1237  QKKEGFKYKLWVLAAILLLAGWTMFTGSITL-SLNWKHLSAKPHSPAIHedldlleveer  1413
             +K+ G  YKLWVL A+LLLA  +M TGS++L      H     +   + +DLD+LE+EER
Sbjct  25    RKRAG--YKLWVLIAVLLLAFGSMLTGSVSLKGTGLFHSVDGEYGFPVGDDLDILEIEER  82

Query  1414  ekvvrHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKP  1593
             EKVVRHMWDVY  S   ++P+FW+EAFEAAYE + SDS+ VR+ AV++IAK+SL    KP
Sbjct  83    EKVVRHMWDVYGRSGGIKVPRFWREAFEAAYEFLTSDSAVVRNVAVSDIAKLSLVRSLKP  142

Query  1594  ES  1599
             ES
Sbjct  143   ES  144



>gb|KHG25088.1| Protein FAM75A4 [Gossypium arboreum]
Length=176

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 87/111 (78%), Gaps = 2/111 (2%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITLSLNWKHLS--AKPHSPAIHedldlleveerekvvr  1428
             +YK W LAAILLLA W+MFTG++TL  +  +L+  +      IH+DLD+LE+EEREKVV+
Sbjct  35    RYKFWALAAILLLAFWSMFTGTVTLRWSAGNLNRFSDDFDSHIHDDLDVLEMEEREKVVK  94

Query  1429  HMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHS  1581
             HMWDVYT SR  RLP+FWQEAFEAAYE++ SD   VR+ AV+EIAKMS+ S
Sbjct  95    HMWDVYTNSRRIRLPRFWQEAFEAAYEELTSDVPGVREDAVSEIAKMSIRS  145



>ref|XP_004232390.1| PREDICTED: uncharacterized protein LOC101253740 [Solanum lycopersicum]
Length=178

 Score = 95.9 bits (237),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 88/124 (71%), Gaps = 3/124 (2%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITLSLNWKHLSAKPHSPAIH--edldlleveerekvvr  1428
             +YK W  AAI LLA W+MFTG++TL  +  +L+A      I   EDLD+LE+EEREK+V+
Sbjct  35    RYKFWAFAAISLLALWSMFTGTVTLRWSAGNLNAISDDIDIPLPEDLDVLEMEEREKLVK  94

Query  1429  HMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPPI  1608
             HMWDVYT SR  +L KFWQEAFEAAYE++ SD   V + A++EIAKMS+      ESPP+
Sbjct  95    HMWDVYTNSRGIKLLKFWQEAFEAAYEELASDVPGVPEDALSEIAKMSVR-YIPIESPPL  153

Query  1609  QSNS  1620
              S+ 
Sbjct  154   HSSG  157



>ref|XP_010999974.1| PREDICTED: uncharacterized protein LOC105107660 [Populus euphratica]
Length=171

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 93/128 (73%), Gaps = 6/128 (5%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldlleveerekvv  1425
             +YK W LAAILLLA W+MFTG++TL   + N   L+    +P I +D D+LE+EEREK V
Sbjct  29    RYKFWALAAILLLAFWSMFTGTVTLRWSAGNLNSLADDIDTP-IRDDRDVLEMEEREKAV  87

Query  1426  rHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPP  1605
             +HMWD+YT SR  RLPKFWQEAFEAAYE++ SD+  V++AA TEIAKMS+ S       P
Sbjct  88    KHMWDIYTNSRRIRLPKFWQEAFEAAYEELTSDAPDVKEAAFTEIAKMSIRS-IDLNPLP  146

Query  1606  IQSNSRCR  1629
             +QS +R R
Sbjct  147   VQS-TRAR  153



>emb|CDP07532.1| unnamed protein product [Coffea canephora]
Length=188

 Score = 95.5 bits (236),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 87/110 (79%), Gaps = 3/110 (3%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldlleveerekvv  1425
             KYK W LAAILLLA W+MFTGS+TL   S++  H+S       +H DLD+LEVEEREK+V
Sbjct  39    KYKFWALAAILLLAFWSMFTGSVTLKWSSVHLNHVSDDLFDSPLHHDLDILEVEEREKMV  98

Query  1426  rHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSL  1575
             R +WDVYT+S+T +LP FWQEAFEAAYED++S+   VR AA++EIAKMSL
Sbjct  99    RRLWDVYTQSKTVKLPIFWQEAFEAAYEDLISEVPRVRHAAISEIAKMSL  148



>ref|XP_010550395.1| PREDICTED: uncharacterized protein LOC104821281 [Tarenaya hassleriana]
Length=184

 Score = 95.5 bits (236),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 91/125 (73%), Gaps = 5/125 (4%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldlleveerekvv  1425
             +YK W LAAILLLA W+MFTG++TL   + N    +    SP IHEDLD+LE+EEREKVV
Sbjct  32    RYKFWALAAILLLAFWSMFTGTVTLRWSAGNLNRFTDDLDSP-IHEDLDVLEMEEREKVV  90

Query  1426  rHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPP  1605
             +HMWDVY   R  RLP+FWQEAFEAAYE++ SD   V++AA+ EIA+MS+ S    + PP
Sbjct  91    KHMWDVYNNGRRIRLPRFWQEAFEAAYEELTSDVPGVKEAAIAEIARMSIRS-VVIDPPP  149

Query  1606  IQSNS  1620
             + S +
Sbjct  150   VHSTN  154



>gb|AAG01119.1|AF273333_4 BAC19.4 [Solanum lycopersicum]
Length=182

 Score = 95.5 bits (236),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 88/123 (72%), Gaps = 3/123 (2%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITLSLNWKHLSAKPHSPAIH--edldlleveerekvvr  1428
             +YK W  AAI LLA W+MFTG++TL  +  +L+A      I   EDLD+LE+EEREK+V+
Sbjct  35    RYKFWAFAAISLLALWSMFTGTVTLRWSAGNLNAISDDIDIPLPEDLDVLEMEEREKLVK  94

Query  1429  HMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPPI  1608
             HMWDVYT SR  +L KFWQEAFEAAYE++ SD   V + A++EIAKMS+      ESPP+
Sbjct  95    HMWDVYTNSRGIKLLKFWQEAFEAAYEELASDVPGVPEDALSEIAKMSVR-YIPIESPPL  153

Query  1609  QSN  1617
              S+
Sbjct  154   HSS  156



>ref|XP_006340593.1| PREDICTED: uncharacterized protein LOC102599104 [Solanum tuberosum]
Length=178

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 87/124 (70%), Gaps = 3/124 (2%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITLSLNWKHLSAKPHSPAIH--edldlleveerekvvr  1428
             +YK W   AILLLA W+M TG++TL  +  +L+A      I   EDLD+LE+EEREK+V+
Sbjct  35    RYKFWAFTAILLLAFWSMLTGTVTLRWSAGNLNAISDDIDIPLPEDLDVLEMEEREKLVK  94

Query  1429  HMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPPI  1608
             HMWDVYT SR  +L KFWQEAFEAAYE++ SD   V + A++EIAKMS+      ESPP+
Sbjct  95    HMWDVYTNSRGIKLLKFWQEAFEAAYEELTSDVPGVPEDALSEIAKMSVR-YIPIESPPL  153

Query  1609  QSNS  1620
              S+ 
Sbjct  154   HSSG  157



>gb|KHN45844.1| hypothetical protein glysoja_023067 [Glycine soja]
Length=155

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 86/121 (71%), Gaps = 10/121 (8%)
 Frame = +1

Query  1264  LWVLAAILLLAGWTMFTGSITLSLNWKHLSAKPHSPAIHedldlleveerekvvrHMWDV  1443
             LW+LAA++L+A W+MF GS+TL   W   +       I EDLD+LEVEEREKVVRHMWD+
Sbjct  24    LWILAAVILIALWSMFAGSVTL--KWSLSNNDDLDSTILEDLDVLEVEEREKVVRHMWDL  81

Query  1444  Y--TESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPPIQSN  1617
             Y  T +++  LPKFW EAFEAAY+ ++SD  AVRDAAV+EIAKMSL       S PIQ  
Sbjct  82    YSHTNTKSVGLPKFWWEAFEAAYQQLVSDVPAVRDAAVSEIAKMSLR------SLPIQIQ  135

Query  1618  S  1620
             S
Sbjct  136   S  136



>ref|NP_001237413.1| uncharacterized protein LOC100500653 [Glycine max]
 gb|ACU15793.1| unknown [Glycine max]
Length=155

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 86/121 (71%), Gaps = 10/121 (8%)
 Frame = +1

Query  1264  LWVLAAILLLAGWTMFTGSITLSLNWKHLSAKPHSPAIHedldlleveerekvvrHMWDV  1443
             LW+LAA++L+A W+MF GS+TL   W   +       I EDLD+LEVEEREKVVRHMWD+
Sbjct  24    LWILAAVILIALWSMFAGSVTL--KWSLSNNDDLDSTILEDLDVLEVEEREKVVRHMWDL  81

Query  1444  Y--TESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPPIQSN  1617
             Y  T +++  LPKFW EAFEAAY+ ++SD  AVRDAAV+EIAKMSL       S PIQ  
Sbjct  82    YSHTNTKSVGLPKFWWEAFEAAYQQLVSDVPAVRDAAVSEIAKMSLR------SLPIQIQ  135

Query  1618  S  1620
             S
Sbjct  136   S  136



>ref|XP_007136586.1| hypothetical protein PHAVU_009G057300g [Phaseolus vulgaris]
 gb|ESW08580.1| hypothetical protein PHAVU_009G057300g [Phaseolus vulgaris]
Length=154

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 82/118 (69%), Gaps = 7/118 (6%)
 Frame = +1

Query  1228  NGVQKKEGFKYKLWVLAAILLLAGWTMFTGSITLSLNWKHLSAKPHSPAIHedldlleve  1407
             NG +K++   +  WVLA ++L+  W+MF GS+TL   W           I +DLD+LEVE
Sbjct  13    NGNRKRQ---FLFWVLAVVILVGLWSMFAGSVTL--KWSTTDNDDFGSTIIQDLDVLEVE  67

Query  1408  erekvvrHMWDVYTESRT--ARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSL  1575
             EREKVVR MWD+Y+ SRT    LPKFW EAFEAAYE+++SD   VRD AV+EIAKMSL
Sbjct  68    EREKVVRQMWDLYSHSRTKSVGLPKFWWEAFEAAYEELVSDVGGVRDGAVSEIAKMSL  125



>gb|ABU45202.1| unknown [Solanum bulbocastanum]
Length=186

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 86/123 (70%), Gaps = 3/123 (2%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITLSLNWKHLSAKPHSPAIHe--dldlleveerekvvr  1428
             +YK W   AILLLA W+M TG++TL  +  +L+A      I    DLD+LE+EEREK+V+
Sbjct  35    RYKFWAFTAILLLAFWSMLTGTVTLRWSAGNLNAISDDIDIPLPEDLDVLEMEEREKLVK  94

Query  1429  HMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPPI  1608
             HMWDVYT SR  +L KFWQEAFEAAYE++ SD   V + A++EIAKMS+      ESPP+
Sbjct  95    HMWDVYTNSRGIKLRKFWQEAFEAAYEELTSDVPGVPEDALSEIAKMSVR-YIPIESPPL  153

Query  1609  QSN  1617
              S+
Sbjct  154   HSS  156



>ref|XP_007156030.1| hypothetical protein PHAVU_003G252600g [Phaseolus vulgaris]
 gb|ESW28024.1| hypothetical protein PHAVU_003G252600g [Phaseolus vulgaris]
Length=155

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 97/149 (65%), Gaps = 18/149 (12%)
 Frame = +1

Query  1198  MRDEEAQVKTNGVQKKEGF----------KYKLWVLAAILLLAGWTMFTGSITL--SLNW  1341
             M+DEE    T  + KKE             YK W LAAILLLA W+MFTG+++L  S   
Sbjct  1     MKDEE----TLPIAKKETLASDSGLFGRGSYKFWALAAILLLALWSMFTGTVSLRWSGTL  56

Query  1342  KHLSAKPHSPAIHedldlleveerekvvrHMWDVYTESRTARLPKFWQEAFEAAYEDMMS  1521
                S   H P +H+ LD+LE+EEREKVVRHMWDVYT +R  RLP+FWQEAFEAAYED+ S
Sbjct  57    NTFSHDLHVP-LHDHLDVLEMEEREKVVRHMWDVYTNNRRIRLPRFWQEAFEAAYEDLSS  115

Query  1522  DSSAVRDAAVTEIAKMSLHSKAKPESPPI  1608
             D +  RDAA+ EIA MSL S    + PPI
Sbjct  116   DVAEDRDAAIAEIANMSL-SSFDIQLPPI  143



>ref|XP_010649162.1| PREDICTED: probable polyol transporter 6 isoform X2 [Vitis vinifera]
Length=378

 Score = 97.8 bits (242),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 93/123 (76%), Gaps = 5/123 (4%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldlleveerekvv  1425
             +YK W LAAILLLA W+MFTG++TL   + N  H+S    S  IH+DLD+LE+EEREKVV
Sbjct  230   RYKFWALAAILLLAFWSMFTGTVTLRWSAGNLNHISDDLDS-HIHDDLDVLEMEEREKVV  288

Query  1426  rHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPP  1605
             +HMWDVYT SR +RLP+FWQEAFEAAYED+ +D   VR+ A++EI +MS+ +    + P 
Sbjct  289   KHMWDVYTNSRRSRLPRFWQEAFEAAYEDLTNDDPGVREDAISEIVRMSVRN-IDLDPPL  347

Query  1606  IQS  1614
             IQS
Sbjct  348   IQS  350



>ref|XP_002310215.2| hypothetical protein POPTR_0007s12630g [Populus trichocarpa]
 gb|ABK93535.1| unknown [Populus trichocarpa]
 gb|EEE90665.2| hypothetical protein POPTR_0007s12630g [Populus trichocarpa]
Length=171

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 95/128 (74%), Gaps = 6/128 (5%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldlleveerekvv  1425
             +YK W LAAILLLA W+M TG++TL   + N   L     +P I +DLD+LE+E+REKVV
Sbjct  29    RYKFWALAAILLLAFWSMLTGTVTLRWSAGNLNSLVDDIDTP-IRDDLDVLEMEDREKVV  87

Query  1426  rHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPP  1605
             +HMWD+YT SR  RLPKFWQEAFEAAYE++ SD+S V++AA+ EIAKMS+ S    +  P
Sbjct  88    KHMWDIYTNSRRIRLPKFWQEAFEAAYEELTSDASDVKEAAIAEIAKMSIRS-IDLDPLP  146

Query  1606  IQSNSRCR  1629
             +QS +R R
Sbjct  147   VQS-TRAR  153



>gb|KGN48820.1| hypothetical protein Csa_6G502580 [Cucumis sativus]
Length=176

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 94/124 (76%), Gaps = 3/124 (2%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITLSLNWKHLSAKPHSP--AIHedldlleveerekvvr  1428
             +YK W LAAILLLA W+MFTG+++L  +  +L+        +IH+DLD+LE+EEREK+V+
Sbjct  29    RYKFWALAAILLLAFWSMFTGTVSLRWSAGNLNGLSDDIDFSIHDDLDVLEMEEREKIVK  88

Query  1429  HMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPPI  1608
             HMWDVYT +R  RLP+FWQEAFEAAYED+ S+    R+AA++EIA+MS+HS    ++P  
Sbjct  89    HMWDVYTNNRRIRLPRFWQEAFEAAYEDLTSEVPGDREAAISEIARMSVHS-VVLDTPSD  147

Query  1609  QSNS  1620
             QS +
Sbjct  148   QSTA  151



>ref|XP_004234561.1| PREDICTED: uncharacterized protein LOC101254457 isoform X1 [Solanum 
lycopersicum]
Length=182

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 87/123 (71%), Gaps = 5/123 (4%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldlleveerekvv  1425
             +YK W LAAIL LA W+M TG+++L   + N   LS     P   +DLD+LE+E+REK+V
Sbjct  39    RYKFWALAAILFLAFWSMCTGTVSLRWSAGNLNSLSDLFDIPK-SDDLDVLEMEDREKLV  97

Query  1426  rHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPP  1605
              HMWDVYT S   R+ KFWQEAFEAAYE++ SD + VR+AA++EI+KMS+      + PP
Sbjct  98    NHMWDVYTNSPRIRILKFWQEAFEAAYEELNSDVAEVREAAISEISKMSIQF-VNIDLPP  156

Query  1606  IQS  1614
             ++S
Sbjct  157   LRS  159



>ref|XP_008440698.1| PREDICTED: uncharacterized protein LOC103485038 [Cucumis melo]
Length=176

 Score = 93.2 bits (230),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 93/124 (75%), Gaps = 3/124 (2%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITLSLNWKHLSAKPHSP--AIHedldlleveerekvvr  1428
             +YK W LAAILLLA W+MFTG+++L  +  +L+         IH+DLD+LE+EEREK+V+
Sbjct  29    RYKFWALAAILLLAFWSMFTGTVSLRWSAGNLNGLSDDIDFNIHDDLDVLEMEEREKIVK  88

Query  1429  HMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPPI  1608
             HMWDVYT +R  RLP+FWQEAFEAAYED+ S+    R+AA++EIA+MS+HS    ++P  
Sbjct  89    HMWDVYTNNRRIRLPRFWQEAFEAAYEDLTSEVPGDREAAISEIARMSVHS-VVLDTPSD  147

Query  1609  QSNS  1620
             QS +
Sbjct  148   QSTA  151



>ref|XP_004152705.1| PREDICTED: uncharacterized protein LOC101218892 [Cucumis sativus]
Length=177

 Score = 93.2 bits (230),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 74/119 (62%), Gaps = 10/119 (8%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPA-------IHedldllev  1404
             +YK W LA ILLLA W+MFTGS++L   +  +      P  P        ++      EV
Sbjct  31    RYKFWALAVILLLAFWSMFTGSVSLKWSAGTFARFYDGPLKPIFDDLDILVNLFSHFHEV  90

Query  1405  eerekvvrHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHS  1581
             EERE+ VRHMW++YT     RLP+FW +AFEAAYED++ D    RDAA+ EIA+MSL S
Sbjct  91    EERERDVRHMWNLYTHGGGGRLPRFWSDAFEAAYEDLIGDVPGARDAALLEIARMSLQS  149



>gb|KEH36150.1| transmembrane protein, putative [Medicago truncatula]
Length=146

 Score = 92.0 bits (227),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 81/107 (76%), Gaps = 4/107 (4%)
 Frame = +1

Query  1258  YKLWVLAAILLLAGWTMFTGSITLSLNWKHLS--AKPHSPAIHedldlleveerekvvrH  1431
             YKL  LAAI+L+A W MFTGSITL L+  +L+  +      I +DLD+LEVEEREKVVRH
Sbjct  11    YKLCALAAIVLIALWFMFTGSITLKLSINNLNPFSDDLDSMILDDLDVLEVEEREKVVRH  70

Query  1432  MWDVYTES--RTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAK  1566
             MWDVYT S   +  LP+FW EAFEAAYE ++SD  AVRDAAV+EIAK
Sbjct  71    MWDVYTRSHSNSIGLPQFWLEAFEAAYEHLVSDVPAVRDAAVSEIAK  117



>gb|AEI98625.1| hypothetical protein 111O18.12 [Coffea canephora]
Length=203

 Score = 93.2 bits (230),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 83/121 (69%), Gaps = 5/121 (4%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldlleveerekvv  1425
             +YK W LAAI+LLA W++ TG++TL   + N   LS +        D   +E+EEREKVV
Sbjct  45    RYKFWALAAIILLAFWSILTGTVTLRWSAANLNQLSKRDSLDFPLPDDLDVEMEEREKVV  104

Query  1426  rHMWDVYTES-RTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESP  1602
             RHMWDVYT S R  RL KFW++AF++AYE M SD   VR+AAV+EIAKMSL S  + E P
Sbjct  105   RHMWDVYTSSNRRIRLAKFWEDAFKSAYEYMNSDVLGVREAAVSEIAKMSLRS-IRLEPP  163

Query  1603  P  1605
             P
Sbjct  164   P  164



>emb|CDP02042.1| unnamed protein product [Coffea canephora]
Length=191

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 89/122 (73%), Gaps = 6/122 (5%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITLSLNWKHLSAKPHSPAIH----edldlleveerekv  1422
             +YK W LAAI+LLA W++ TG++TL  +  +L+   +  ++     +DLD+LE+EEREKV
Sbjct  45    RYKFWALAAIILLAFWSILTGTVTLRWSAANLNQLSNRDSLDFPLPDDLDVLEMEEREKV  104

Query  1423  vrHMWDVYTES-RTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPES  1599
             VRHMWDVYT S R  RL KFW++AF++AYE M SD   VR+AAV+EIAKMSL S  + E 
Sbjct  105   VRHMWDVYTSSNRRIRLAKFWEDAFKSAYEYMNSDVLGVREAAVSEIAKMSLRS-IRLEP  163

Query  1600  PP  1605
             PP
Sbjct  164   PP  165



>gb|KHN00553.1| hypothetical protein glysoja_000221 [Glycine soja]
Length=173

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 85/117 (73%), Gaps = 3/117 (3%)
 Frame = +1

Query  1258  YKLWVLAAILLLAGWTMFTGSITLSLNWKHLSAKPHSPAIHedldlleveerekvvrHMW  1437
             YK W LAA+LLLA W+MFTG  T+SL W          ++H+ LD+LE+EEREK+VRHMW
Sbjct  25    YKFWALAAMLLLAFWSMFTG--TVSLRWSGTLNTFSHASLHDHLDVLEIEEREKLVRHMW  82

Query  1438  DVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPPI  1608
             DVYT +R  RLP+FW++AFEAAYED+ SD++ VRD AV EI  MSL S    + PP+
Sbjct  83    DVYTNNRRIRLPRFWEKAFEAAYEDLTSDAADVRDVAVAEIVNMSLRS-LDLQLPPV  138



>gb|KEH36149.1| transmembrane protein, putative [Medicago truncatula]
Length=166

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 81/107 (76%), Gaps = 4/107 (4%)
 Frame = +1

Query  1258  YKLWVLAAILLLAGWTMFTGSITLSLNWKHLS--AKPHSPAIHedldlleveerekvvrH  1431
             YKL  LAAI+L+A W MFTGSITL L+  +L+  +      I +DLD+LEVEEREKVVRH
Sbjct  11    YKLCALAAIVLIALWFMFTGSITLKLSINNLNPFSDDLDSMILDDLDVLEVEEREKVVRH  70

Query  1432  MWDVYTES--RTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAK  1566
             MWDVYT S   +  LP+FW EAFEAAYE ++SD  AVRDAAV+EIAK
Sbjct  71    MWDVYTRSHSNSIGLPQFWLEAFEAAYEHLVSDVPAVRDAAVSEIAK  117



>ref|XP_004143580.1| PREDICTED: probable polyol transporter 3-like [Cucumis sativus]
 ref|XP_004162330.1| PREDICTED: probable polyol transporter 3-like [Cucumis sativus]
Length=378

 Score = 94.0 bits (232),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 94/124 (76%), Gaps = 3/124 (2%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITLSLNWKHLSAKPHSP--AIHedldlleveerekvvr  1428
             +YK W LAAILLLA W+MFTG+++L  +  +L+        +IH+DLD+LE+EEREK+V+
Sbjct  231   RYKFWALAAILLLAFWSMFTGTVSLRWSAGNLNGLSDDIDFSIHDDLDVLEMEEREKIVK  290

Query  1429  HMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPPI  1608
             HMWDVYT +R  RLP+FWQEAFEAAYED+ S+    R+AA++EIA+MS+HS    ++P  
Sbjct  291   HMWDVYTNNRRIRLPRFWQEAFEAAYEDLTSEVPGDREAAISEIARMSVHSVVL-DTPSD  349

Query  1609  QSNS  1620
             QS +
Sbjct  350   QSTA  353



>ref|XP_010070047.1| PREDICTED: uncharacterized protein LOC104456867 [Eucalyptus grandis]
 gb|KCW58604.1| hypothetical protein EUGRSUZ_H01264 [Eucalyptus grandis]
Length=174

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 90/125 (72%), Gaps = 7/125 (6%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldlleveerekvv  1425
             +YK+W LAAILLLA W+MFTG++TL   + N    S    +P I +DLD+LE+EEREK+V
Sbjct  34    RYKIWALAAILLLAFWSMFTGTVTLRWSAGNLNRFSDDLDAP-IRDDLDVLEMEEREKLV  92

Query  1426  rHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPP  1605
             +HMWDVYT SR  R+ KFWQEAFEAA+ED+ SD   VR+ A+ EIAKMS+      + PP
Sbjct  93    KHMWDVYTNSRRMRMHKFWQEAFEAAFEDLSSDVPGVREDAIAEIAKMSIRF---IDPPP  149

Query  1606  IQSNS  1620
              QS +
Sbjct  150   AQSTN  154



>emb|CDY30757.1| BnaC07g16570D [Brassica napus]
Length=185

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 96/146 (66%), Gaps = 12/146 (8%)
 Frame = +1

Query  1213  AQVKTNGVQKKEGF-------KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKP  1362
             A   T   +K+ G+       +YK W LAAILLLA W+M TG++ L   + N  H +   
Sbjct  14    AAASTGNAKKENGYSALFAKGRYKFWALAAILLLAFWSMLTGTVNLRWSAGNISHFTDDL  73

Query  1363  HSPAIHedldlleveerekvvrHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRD  1542
               P IHEDLD+LE+EEREKVV+HMWDVY   R  RLP+FWQEAFEAAYE++ SD   V +
Sbjct  74    VFP-IHEDLDVLEMEEREKVVKHMWDVYNNGRRIRLPRFWQEAFEAAYEELTSDVPDVVE  132

Query  1543  AAVTEIAKMSLHSKAKPESPPIQSNS  1620
             AA++EIA+MS+ S    + PP+ S +
Sbjct  133   AAISEIARMSIRS-VVIDPPPVHSTN  157



>ref|XP_011025752.1| PREDICTED: uncharacterized protein LOC105126554 [Populus euphratica]
Length=171

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 93/128 (73%), Gaps = 6/128 (5%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldlleveerekvv  1425
             +YK W LAAILLLA W+M TG++TL   + N   L     +P I +DLD+LE+E+REKVV
Sbjct  29    RYKFWALAAILLLAFWSMLTGTVTLRWSAGNLNSLVDDIDTP-IRDDLDVLEMEDREKVV  87

Query  1426  rHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPP  1605
             +HMWD+YT S   RLPKFWQEAFEAAYE++ SD+S V++A + EIAKMS+ S    +  P
Sbjct  88    KHMWDIYTNSHRIRLPKFWQEAFEAAYEELTSDASDVKEAVIAEIAKMSIRS-IDLDPFP  146

Query  1606  IQSNSRCR  1629
             +QS +R R
Sbjct  147   VQS-TRAR  153



>dbj|BAA98184.1| unnamed protein product [Arabidopsis thaliana]
Length=159

 Score = 89.4 bits (220),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 89/127 (70%), Gaps = 5/127 (4%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldlleveerekvv  1425
             +YK W LAAILLLA W+M TG++ L   + N  H +     P IHEDLD+LE+EEREKVV
Sbjct  35    RYKFWALAAILLLAFWSMLTGTVNLRWSAGNINHFTDDLVFP-IHEDLDVLEMEEREKVV  93

Query  1426  rHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPP  1605
             +HMWDVY   R  RLP+FWQEAFEAAYE++ SD   V +AA++EIA+MS+ S    + PP
Sbjct  94    KHMWDVYNNGRRIRLPRFWQEAFEAAYEELTSDVPDVVEAAISEIARMSIRSIVI-DPPP  152

Query  1606  IQSNSRC  1626
             + S  R 
Sbjct  153   LHSTVRV  159



>ref|XP_009787249.1| PREDICTED: uncharacterized protein LOC104235226 [Nicotiana sylvestris]
Length=182

 Score = 89.7 bits (221),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 93/123 (76%), Gaps = 5/123 (4%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldlleveerekvv  1425
             +YK W LAAILLLA W+MFTG++TL   + N   LS   + P + ++LD++E+EEREK+V
Sbjct  39    RYKFWALAAILLLAFWSMFTGTVTLRWSAGNLNGLSDYFNVP-LSDNLDVIEMEEREKLV  97

Query  1426  rHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPP  1605
             +HMWDVYT +   RLPKFWQEAFEAAYE++ SD + +R+AA++EI+KMSL      E PP
Sbjct  98    KHMWDVYTNTPRIRLPKFWQEAFEAAYEELTSDLADIREAAISEISKMSLRF-VHMEPPP  156

Query  1606  IQS  1614
             ++S
Sbjct  157   LRS  159



>ref|XP_009138437.1| PREDICTED: uncharacterized protein LOC103862481 [Brassica rapa]
 emb|CDY42699.1| BnaA03g53520D [Brassica napus]
Length=169

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 89/124 (72%), Gaps = 3/124 (2%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITLSLNWKHLSAKPHSPAI--Hedldlleveerekvvr  1428
             +YK +  AA+LLLA W+MFTG++TL L+  +L+       +  ++ LD LE+EERE+VV+
Sbjct  29    RYKFYAFAALLLLAFWSMFTGTVTLRLSTGNLNRLSEDLRVRNYDHLDALEMEERERVVK  88

Query  1429  HMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPPI  1608
              MWDVYT SR  +LP+FWQEAF AAY+++ SD   VRDAA+ EIAKMS+ S  K +S P 
Sbjct  89    RMWDVYTNSRRIKLPQFWQEAFVAAYDELTSDVPGVRDAAIDEIAKMSVQS-VKLDSKPS  147

Query  1609  QSNS  1620
             +S S
Sbjct  148   RSMS  151



>ref|XP_010531023.1| PREDICTED: uncharacterized protein LOC104807445 isoform X1 [Tarenaya 
hassleriana]
Length=176

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 87/124 (70%), Gaps = 2/124 (2%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITLSLNWKHLSAKPHSPAI--Hedldlleveerekvvr  1428
             +YK W LAAILLLA W+MF G++TL L+  +L+          +++LD+LE+EEREKVV+
Sbjct  33    RYKFWALAAILLLAFWSMFAGTVTLRLSDGNLNRISDDLGFQSYDNLDVLEMEEREKVVK  92

Query  1429  HMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPPI  1608
             HMWDVYT     RLP+FWQEAFEAAYE++ SD   VR+AA+ EIAKMS+ S      P  
Sbjct  93    HMWDVYTNGHRIRLPRFWQEAFEAAYEELTSDVPGVREAAIGEIAKMSVRSVTLDPPPTA  152

Query  1609  QSNS  1620
             +S S
Sbjct  153   RSMS  156



>ref|XP_009622062.1| PREDICTED: uncharacterized protein LOC104113563 isoform X2 [Nicotiana 
tomentosiformis]
Length=152

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 92/123 (75%), Gaps = 5/123 (4%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldlleveerekvv  1425
             +YK W LAAILLLA W+MFTG++TL   + N   LS   + P + +DLD++E+EEREK+V
Sbjct  30    RYKFWALAAILLLAFWSMFTGTVTLRWSAGNLNGLSDYFNLP-LSDDLDVIEMEEREKLV  88

Query  1426  rHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPP  1605
             +HMWDVYT +   RLPKFWQEAFEAAYE++ SD + +R+AA++EI+KMSL      E PP
Sbjct  89    KHMWDVYTNTPRIRLPKFWQEAFEAAYEELTSDLADIREAAISEISKMSLRF-VHMEPPP  147

Query  1606  IQS  1614
             + S
Sbjct  148   LHS  150



>ref|XP_010531025.1| PREDICTED: uncharacterized protein LOC104807445 isoform X2 [Tarenaya 
hassleriana]
Length=156

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 86/122 (70%), Gaps = 2/122 (2%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITLSLNWKHLSAKPHSPAI--Hedldlleveerekvvr  1428
             +YK W LAAILLLA W+MF G++TL L+  +L+          +++LD+LE+EEREKVV+
Sbjct  33    RYKFWALAAILLLAFWSMFAGTVTLRLSDGNLNRISDDLGFQSYDNLDVLEMEEREKVVK  92

Query  1429  HMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPPI  1608
             HMWDVYT     RLP+FWQEAFEAAYE++ SD   VR+AA+ EIAKMS+ S      P  
Sbjct  93    HMWDVYTNGHRIRLPRFWQEAFEAAYEELTSDVPGVREAAIGEIAKMSVRSVTLDPPPTA  152

Query  1609  QS  1614
             +S
Sbjct  153   RS  154



>ref|XP_002282877.1| PREDICTED: uncharacterized protein LOC100264357 [Vitis vinifera]
 emb|CBI19682.3| unnamed protein product [Vitis vinifera]
Length=173

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 88/111 (79%), Gaps = 4/111 (4%)
 Frame = +1

Query  1258  YKLWVLAAILLLAGWTMFTGSITLSLNWKHLSAKPH---SPAIHedldlleveerekvvr  1428
             YK W LAAILLLA W+MFTGS+TL  +  +LS  P    SP  H+DLD+LEVEEREK+VR
Sbjct  28    YKFWALAAILLLAFWSMFTGSVTLKWSASNLSRFPDDIDSPT-HDDLDVLEVEEREKLVR  86

Query  1429  HMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHS  1581
             +MWD+YT + T+RLP+FW+EAFEAAY ++ SD  +VR+AAV EIAKMSL S
Sbjct  87    YMWDLYTHTTTSRLPRFWEEAFEAAYMELASDVPSVRNAAVLEIAKMSLRS  137



>gb|ABC69762.1| unknown [Vitis pseudoreticulata]
Length=173

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 88/111 (79%), Gaps = 4/111 (4%)
 Frame = +1

Query  1258  YKLWVLAAILLLAGWTMFTGSITLSLNWKHLSAKPH---SPAIHedldlleveerekvvr  1428
             YK W LAAILLLA W+MFTGS+TL  +  +LS  P    SP  H+DLD+LEVEEREK+VR
Sbjct  28    YKFWALAAILLLAFWSMFTGSVTLKWSASNLSRFPDDIDSPT-HDDLDVLEVEEREKLVR  86

Query  1429  HMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHS  1581
             +MWD+YT + T+RLP+FW+EAFEAAY ++ SD  +VR+AAV EIAKMSL S
Sbjct  87    YMWDLYTHTTTSRLPRFWEEAFEAAYMELASDVPSVRNAAVLEIAKMSLRS  137



>ref|XP_010444743.1| PREDICTED: uncharacterized protein LOC104727358 [Camelina sativa]
Length=186

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 89/125 (71%), Gaps = 5/125 (4%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldlleveerekvv  1425
             +YK W LAAILLLA W+M TG++ L   + N  H +     P IHEDLD+LE+EEREKVV
Sbjct  36    RYKFWALAAILLLAFWSMLTGTVNLRWSAGNINHFTDDLVFP-IHEDLDVLEMEEREKVV  94

Query  1426  rHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPP  1605
             +HMWDVY   R  RLP+FWQEAFEAAYE++ SD   V +AA++EIA+MS+ S    + PP
Sbjct  95    KHMWDVYNNGRRIRLPRFWQEAFEAAYEELTSDVPDVVEAAISEIARMSIRS-VVIDPPP  153

Query  1606  IQSNS  1620
             + S +
Sbjct  154   VHSTN  158



>ref|XP_010464966.1| PREDICTED: uncharacterized protein LOC104745426 [Camelina sativa]
Length=186

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 89/125 (71%), Gaps = 5/125 (4%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldlleveerekvv  1425
             +YK W LAAILLLA W+M TG++ L   + N  H +     P IHEDLD+LE+EEREKVV
Sbjct  36    RYKFWALAAILLLAFWSMLTGTVNLRWSAGNINHFTDDLIFP-IHEDLDVLEMEEREKVV  94

Query  1426  rHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPP  1605
             +HMWDVY   R  RLP+FWQEAFEAAYE++ SD   V +AA++EIA+MS+ S    + PP
Sbjct  95    KHMWDVYNNGRRIRLPRFWQEAFEAAYEELTSDVPDVVEAAISEIARMSIRS-VVIDPPP  153

Query  1606  IQSNS  1620
             + S +
Sbjct  154   VHSTN  158



>ref|XP_009103491.1| PREDICTED: uncharacterized protein LOC103829572 [Brassica rapa]
 emb|CDY53850.1| BnaA07g37450D [Brassica napus]
Length=182

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 89/125 (71%), Gaps = 5/125 (4%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldlleveerekvv  1425
             +YK W LAAILLLA W+M TG++ L   + N  H +     P IHEDLD+LE+EEREKVV
Sbjct  32    RYKFWALAAILLLAFWSMLTGTVNLRWSAGNISHFTDDLVFP-IHEDLDVLEMEEREKVV  90

Query  1426  rHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPP  1605
             +HMWDVY   R  RLP+FWQEAFEAAYE++ SD   V +AAV+EIA+MS+ S    + PP
Sbjct  91    KHMWDVYNNGRRIRLPRFWQEAFEAAYEELTSDVPDVVEAAVSEIARMSIRS-VVIDPPP  149

Query  1606  IQSNS  1620
             + S +
Sbjct  150   VHSTN  154



>ref|XP_009622061.1| PREDICTED: uncharacterized protein LOC104113563 isoform X1 [Nicotiana 
tomentosiformis]
Length=173

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 92/123 (75%), Gaps = 5/123 (4%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldlleveerekvv  1425
             +YK W LAAILLLA W+MFTG++TL   + N   LS   + P + +DLD++E+EEREK+V
Sbjct  30    RYKFWALAAILLLAFWSMFTGTVTLRWSAGNLNGLSDYFNLP-LSDDLDVIEMEEREKLV  88

Query  1426  rHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPP  1605
             +HMWDVYT +   RLPKFWQEAFEAAYE++ SD + +R+AA++EI+KMSL      E PP
Sbjct  89    KHMWDVYTNTPRIRLPKFWQEAFEAAYEELTSDLADIREAAISEISKMSLRF-VHMEPPP  147

Query  1606  IQS  1614
             + S
Sbjct  148   LHS  150



>ref|XP_009371570.1| PREDICTED: uncharacterized protein LOC103960807, partial [Pyrus 
x bretschneideri]
Length=134

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 81/105 (77%), Gaps = 4/105 (4%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldlleveerekvv  1425
             +YK W LAAILLLA W+MFTG++TL   + N   LS    SP IH+DLD+LE+EEREKVV
Sbjct  31    RYKFWALAAILLLAFWSMFTGTVTLRWSAGNLNRLSDDLDSP-IHDDLDVLEMEEREKVV  89

Query  1426  rHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEI  1560
             +HMWDVYT S   RLP+FWQEAFEAAYE++ SD   VR+ A+TEI
Sbjct  90    KHMWDVYTNSHRIRLPRFWQEAFEAAYEELTSDVPGVREEALTEI  134



>ref|XP_006393868.1| hypothetical protein EUTSA_v10004972mg [Eutrema salsugineum]
 gb|ESQ31154.1| hypothetical protein EUTSA_v10004972mg [Eutrema salsugineum]
Length=188

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 89/125 (71%), Gaps = 5/125 (4%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldlleveerekvv  1425
             +YK W LAAILLLA W+M TG++ L   + N  H +     P IHEDLD+LE+EEREKVV
Sbjct  38    RYKFWALAAILLLAFWSMLTGTVNLRWSAGNINHFTDDLVFP-IHEDLDVLEMEEREKVV  96

Query  1426  rHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPP  1605
             +HMWDVY   R  RLP+FWQEAFEAAYE++ SD   V +AA++EIA+MS+ S    + PP
Sbjct  97    KHMWDVYNNGRRIRLPRFWQEAFEAAYEELTSDVPDVVEAAISEIARMSIRS-VVIDPPP  155

Query  1606  IQSNS  1620
             + S +
Sbjct  156   VHSTN  160



>gb|KFK28355.1| hypothetical protein AALP_AA8G505100 [Arabis alpina]
Length=184

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 88/125 (70%), Gaps = 5/125 (4%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldlleveerekvv  1425
             +YK W LAAILLLA W+M TG++ L   + N  H +     P IHEDLD+LE+EEREKVV
Sbjct  36    RYKFWALAAILLLAFWSMLTGTVNLRWSAGNINHFTDDLVFP-IHEDLDVLEMEEREKVV  94

Query  1426  rHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPP  1605
             +HMWDVY   R  RLP+FWQEAFEAAYE++ SD   V +AA+ EIA+MS+ S    + PP
Sbjct  95    KHMWDVYNNGRRIRLPRFWQEAFEAAYEELTSDVPDVVEAAIAEIARMSIRS-VVIDPPP  153

Query  1606  IQSNS  1620
             + S +
Sbjct  154   VHSTN  158



>ref|XP_002864968.1| hypothetical protein ARALYDRAFT_919901 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41227.1| hypothetical protein ARALYDRAFT_919901 [Arabidopsis lyrata subsp. 
lyrata]
Length=185

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 89/125 (71%), Gaps = 5/125 (4%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldlleveerekvv  1425
             +YK W LAAILLLA W+M TG++ L   + N  H +     P IHEDLD+LE+EEREKVV
Sbjct  35    RYKFWALAAILLLAFWSMLTGTVNLRWSAGNINHFTDDLVFP-IHEDLDVLEMEEREKVV  93

Query  1426  rHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPP  1605
             +HMWDVY   R  RLP+FWQEAFEAAYE++ SD   V +AA++EIA+MS+ S    + PP
Sbjct  94    KHMWDVYNNGRRIRLPRFWQEAFEAAYEELTSDVPDVVEAAISEIARMSIRS-VVIDPPP  152

Query  1606  IQSNS  1620
             + S +
Sbjct  153   LHSTN  157



>ref|XP_009365595.1| PREDICTED: uncharacterized protein LOC103955427 [Pyrus x bretschneideri]
Length=188

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 85/140 (61%), Gaps = 9/140 (6%)
 Frame = +1

Query  1222  KTNGVQKKEGFKYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedld  1392
             KT     K G  YK W LAAILLLA W+MFTGS+TL   + N   LS     P   +   
Sbjct  30    KTRVFLDKNG--YKFWALAAILLLAFWSMFTGSVTLKWSTGNLSRLSDDLDIPTFDDLDI  87

Query  1393  lleveerekvvrHMWDVYTESRTA---RLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIA  1563
             L   E  + V  HMWD+YT++ +    RLP+FWQEAFEAAYE + SD +AVRDAAV+EIA
Sbjct  88    LEVEEREKVVR-HMWDLYTQTTSTSTSRLPRFWQEAFEAAYEHLTSDVAAVRDAAVSEIA  146

Query  1564  KMSLHSKAKPESPPIQSNSR  1623
             KMS+ S      P   +N+R
Sbjct  147   KMSIRSIVLDPFPLQSTNTR  166



>ref|NP_569015.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAM61360.1| unknown [Arabidopsis thaliana]
 gb|AAO22636.1| unknown protein [Arabidopsis thaliana]
 gb|AAO42441.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43048.1| putative protein [Arabidopsis thaliana]
 dbj|BAD44480.1| putative protein [Arabidopsis thaliana]
 gb|AED98082.1| uncharacterized protein AT5G65650 [Arabidopsis thaliana]
Length=185

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 89/125 (71%), Gaps = 5/125 (4%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldlleveerekvv  1425
             +YK W LAAILLLA W+M TG++ L   + N  H +     P IHEDLD+LE+EEREKVV
Sbjct  35    RYKFWALAAILLLAFWSMLTGTVNLRWSAGNINHFTDDLVFP-IHEDLDVLEMEEREKVV  93

Query  1426  rHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPP  1605
             +HMWDVY   R  RLP+FWQEAFEAAYE++ SD   V +AA++EIA+MS+ S    + PP
Sbjct  94    KHMWDVYNNGRRIRLPRFWQEAFEAAYEELTSDVPDVVEAAISEIARMSIRSIV-IDPPP  152

Query  1606  IQSNS  1620
             + S +
Sbjct  153   LHSTN  157



>emb|CDY67099.1| BnaCnng53540D, partial [Brassica napus]
Length=120

 Score = 85.5 bits (210),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 69/93 (74%), Gaps = 3/93 (3%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITLSL---NWKHLSAKPHSPAIHedldlleveerekvv  1425
             +YK +  AA++LLA W+MFTG++TL L   +   LS     P  HE LD+LE+EERE+VV
Sbjct  25    RYKFFAFAALMLLAFWSMFTGTVTLRLSTEDLNRLSEDIGIPTNHESLDVLEMEERERVV  84

Query  1426  rHMWDVYTESRTARLPKFWQEAFEAAYEDMMSD  1524
             +HMWDVYT SR  +LPKFWQ+AF AAYE++ SD
Sbjct  85    KHMWDVYTNSRRIKLPKFWQQAFVAAYEELTSD  117



>ref|XP_009396443.1| PREDICTED: uncharacterized protein LOC103981440 [Musa acuminata 
subsp. malaccensis]
Length=171

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 84/115 (73%), Gaps = 4/115 (3%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITLSLNWKHLSAK-PHSPAIHedldlleveerekvvrH  1431
             +YKLWV AAILLLA W++ TG++TL   W    A  P    +  DLD+LEVEEREKVVRH
Sbjct  28    RYKLWVCAAILLLALWSLLTGTVTLK--WSIGGANSPSDAPVFGDLDVLEVEEREKVVRH  85

Query  1432  MWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPE  1596
             MWDVY  SR ARLP+FWQEAFEAAYE++  D  + RDAA +EIA+MS+   A PE
Sbjct  86    MWDVYVHSRIARLPRFWQEAFEAAYEELAGDDPSSRDAATSEIARMSMR-MADPE  139



>emb|CDX72594.1| BnaC07g46160D [Brassica napus]
Length=681

 Score = 89.7 bits (221),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 87/125 (70%), Gaps = 2/125 (2%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITLSLNWKHLSAKPHSPAI--Hedldlleveerekvvr  1428
             +YK +  AA+LLLA W+MFTG++TL L+  +L+       +  ++ LD LE+E+RE+VV+
Sbjct  540   RYKFYAFAALLLLAFWSMFTGTVTLRLSTGNLNRLSEDLGVRNYDHLDALEMEKRERVVK  599

Query  1429  HMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPPI  1608
              MWDVYT SR  +LP+FWQEAF AAYE++ SD   VRDAA+ EIAKMS+ S     +P  
Sbjct  600   RMWDVYTNSRRIKLPQFWQEAFVAAYEELTSDVPGVRDAAIGEIAKMSVQSINLDSNPSR  659

Query  1609  QSNSR  1623
               ++R
Sbjct  660   SMSAR  664



>gb|ABK27045.1| unknown [Picea sitchensis]
Length=162

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 82/131 (63%), Gaps = 7/131 (5%)
 Frame = +1

Query  1234  VQKKEGF-----KYKLWVLAAILLLAGWTMFTGSITL--SLNWKHLSAKPHSPAIHedld  1392
              ++KE F     +YK W LA I+LLA W+M +GS +L  S     L +      + +D D
Sbjct  7     TKEKENFLLGKGRYKFWALAIIILLAFWSMLSGSASLKWSAGNLMLFSDELDKRLQDDFD  66

Query  1393  lleveerekvvrHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMS  1572
             +LE+E REKVVRHMWD+Y  +   +L  FWQEAF+AAYE++ S++  VRD A +EIAKMS
Sbjct  67    VLEIEAREKVVRHMWDIYIHNPRLKLSSFWQEAFQAAYEELESEAPGVRDHAFSEIAKMS  126

Query  1573  LHSKAKPESPP  1605
             L    K   PP
Sbjct  127   LRLVEKDPIPP  137



>ref|XP_008444700.1| PREDICTED: uncharacterized protein LOC103487960 [Cucumis melo]
Length=171

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 81/112 (72%), Gaps = 4/112 (4%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldlleveerekvv  1425
             +YK W LAAILLLA W+MFTGS++L   +  +      P  P I +DLD+LEVE+RE+ V
Sbjct  33    RYKFWALAAILLLAFWSMFTGSVSLKWSAGTFARFYDGPLKP-IFDDLDILEVEDRERDV  91

Query  1426  rHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHS  1581
             RHMW++YT     RLP+FW EAFEAAYED++ D   +RDAA+ EIA+MSL S
Sbjct  92    RHMWNLYTHGGGGRLPRFWSEAFEAAYEDLIGDDPGLRDAALLEIARMSLQS  143



>ref|XP_010484594.1| PREDICTED: uncharacterized protein LOC104762894 [Camelina sativa]
Length=186

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 88/125 (70%), Gaps = 5/125 (4%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldlleveerekvv  1425
             +YK W LAAILLLA W+M TG++ L   + N  H +     P I EDLD+LE+EEREKVV
Sbjct  36    RYKFWALAAILLLAFWSMLTGTVNLRWSAGNINHFTEDLVFP-IPEDLDVLEMEEREKVV  94

Query  1426  rHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPP  1605
             +HMWDVY   R  RLP+FWQEAFEAAYE++ SD   V +AA++EIA+MS+ S    + PP
Sbjct  95    KHMWDVYNNGRRIRLPRFWQEAFEAAYEELTSDVPDVVEAAISEIARMSIRS-VVIDPPP  153

Query  1606  IQSNS  1620
             + S +
Sbjct  154   VHSTN  158



>emb|CDX83766.1| BnaC08g18790D [Brassica napus]
Length=149

 Score = 83.6 bits (205),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 76/108 (70%), Gaps = 1/108 (1%)
 Frame = +1

Query  1303  TMFTGSITL-SLNWKHLSAKPHSPAIHedldlleveerekvvrHMWDVYTESRTARLPKF  1479
             +M TGS++L  L   H         + +DLD+LE+EEREKVVRHMWDVY  S   R+P+F
Sbjct  42    SMLTGSVSLKGLGLFHSVDGKFGFHVSDDLDVLEIEEREKVVRHMWDVYGRSGGVRVPQF  101

Query  1480  WQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPPIQSNSR  1623
             W+EAFEAAYE ++SDS+AVR+ A+++IAK+SL    KP+S   Q N R
Sbjct  102   WREAFEAAYEILVSDSAAVRNGAISDIAKLSLVRSLKPDSTTAQPNRR  149



>ref|XP_010459607.1| PREDICTED: uncharacterized protein LOC104740635 [Camelina sativa]
Length=154

 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 93/130 (72%), Gaps = 1/130 (1%)
 Frame = +1

Query  1237  QKKEGFKYKLWVLAAILLLAGWTMFTGSITL-SLNWKHLSAKPHSPAIHedldlleveer  1413
             +K+ G+ YKLWVLAA+LLLA  +M TGS++L  +   H     +  +  +DLD+LE+EER
Sbjct  25    RKRAGYNYKLWVLAAVLLLAFGSMLTGSVSLKGIGLFHSVDGVNGFSAGDDLDVLEIEER  84

Query  1414  ekvvrHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKP  1593
             EKVVR MWDVY  S   R+P+FW+EAFEAAYE ++SDS+AVR  AV++IAK+SL    K 
Sbjct  85    EKVVRQMWDVYGRSGGVRVPRFWREAFEAAYEFLISDSAAVRSGAVSDIAKLSLVRFVKS  144

Query  1594  ESPPIQSNSR  1623
             ES P + N R
Sbjct  145   ESTPARPNLR  154



>ref|XP_002890331.1| hypothetical protein ARALYDRAFT_472165 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66590.1| hypothetical protein ARALYDRAFT_472165 [Arabidopsis lyrata subsp. 
lyrata]
Length=146

 Score = 83.2 bits (204),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 92/131 (70%), Gaps = 1/131 (1%)
 Frame = +1

Query  1234  VQKKEGFKYKLWVLAAILLLAGWTMFTGSITL-SLNWKHLSAKPHSPAIHedldllevee  1410
             V  ++   YKLWVL A+LLLA  +M TGS++L  +   H     ++ ++ +DLD+LE+EE
Sbjct  16    VNDRKSAGYKLWVLIALLLLAFGSMLTGSVSLKGIGLFHSVDGTNAFSVGDDLDVLEIEE  75

Query  1411  rekvvrHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAK  1590
             RE+VVR MWDVY  S   +LP+FW+EAFEAAYE ++SDS AVR+ AV++IAK+SL    K
Sbjct  76    RERVVRQMWDVYGRSGGVKLPRFWREAFEAAYEFLISDSPAVRNGAVSDIAKLSLVRFVK  135

Query  1591  PESPPIQSNSR  1623
              ES P Q N R
Sbjct  136   SESTPAQPNPR  146



>ref|XP_010498354.1| PREDICTED: uncharacterized protein LOC104776052 [Camelina sativa]
 ref|XP_010498356.1| PREDICTED: uncharacterized protein LOC104776054 [Camelina sativa]
Length=155

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 78/108 (72%), Gaps = 1/108 (1%)
 Frame = +1

Query  1303  TMFTGSITL-SLNWKHLSAKPHSPAIHedldlleveerekvvrHMWDVYTESRTARLPKF  1479
             +M TGS++L  +   H     +  ++ +DLD+LE+EEREKVVR MWDVY+ S   R+P+F
Sbjct  48    SMLTGSVSLKGIGLFHSVDGVNGFSVGDDLDVLEIEEREKVVRQMWDVYSRSGGVRVPRF  107

Query  1480  WQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPPIQSNSR  1623
             W+EAFEAAYE ++SDS+AVR+ AV++IAK+SL    K ES P + N R
Sbjct  108   WREAFEAAYEFLISDSAAVRNGAVSDIAKLSLVRFVKSESTPARPNLR  155



>ref|XP_011083699.1| PREDICTED: uncharacterized protein LOC105166154 [Sesamum indicum]
Length=186

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 91/126 (72%), Gaps = 2/126 (2%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITLSLNWKHL--SAKPHSPAIHedldlleveerekvvr  1428
             KYKLW LAAI LLA W+M+TGS+TL  +  +L  S+     +IH DLD+L+V+ER K+V 
Sbjct  43    KYKLWALAAITLLALWSMYTGSVTLKWSADNLTNSSDDLDHSIHGDLDVLDVDERVKMVT  102

Query  1429  HMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPPI  1608
              MW+VY  S  ARLP+FW++AF AAY+++ SD ++VR+AA+ EIAKMS  S    + PP+
Sbjct  103   QMWNVYKHSSIARLPRFWRDAFGAAYQELTSDVASVRNAALLEIAKMSFRSTDVYDPPPV  162

Query  1609  QSNSRC  1626
             +S +R 
Sbjct  163   ESTART  168



>emb|CDX96663.1| BnaA08g22060D [Brassica napus]
Length=149

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 91/133 (68%), Gaps = 1/133 (1%)
 Frame = +1

Query  1228  NGVQKKEGFKYKLWVLAAILLLAGWTMFTGSITL-SLNWKHLSAKPHSPAIHedldllev  1404
             NG   ++   YKLWVL A+LLLA  +M TGS++L  L   H         + +DLD+LE+
Sbjct  17    NGGSDRKRAGYKLWVLVAVLLLALGSMLTGSVSLKGLGLFHSVDGKFGFHVSDDLDVLEI  76

Query  1405  eerekvvrHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSK  1584
             EEREKVVRHMWDVY  S   R+P+FW+EAFEAAYE ++SDS+ VR+ A+++IAK+SL   
Sbjct  77    EEREKVVRHMWDVYGRSGGVRVPQFWREAFEAAYEFLVSDSAGVRNGAISDIAKLSLVRS  136

Query  1585  AKPESPPIQSNSR  1623
              KP+S   Q N R
Sbjct  137   LKPDSSLAQPNRR  149



>ref|XP_009110276.1| PREDICTED: uncharacterized protein LOC103835844 [Brassica rapa]
Length=149

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 92/131 (70%), Gaps = 3/131 (2%)
 Frame = +1

Query  1234  VQKKEGFKYKLWVLAAILLLAGWTMFTGSITL-SLNWKHLSAKPHSPAIHedldllevee  1410
             ++K+ G  YKLWVL A+LLLA  +M TGS++L  L   H         + +DLD+LE+EE
Sbjct  21    IRKRAG--YKLWVLVAVLLLALGSMLTGSVSLKGLGLFHSVDGKFGFHVSDDLDVLEIEE  78

Query  1411  rekvvrHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAK  1590
             REKVVRHMWDVY  S   R+P+FW+EAFEAAYE ++SDS+AVR  A+++IAK+SL    K
Sbjct  79    REKVVRHMWDVYGRSGGVRVPQFWREAFEAAYEFLVSDSAAVRSGAISDIAKLSLVRSLK  138

Query  1591  PESPPIQSNSR  1623
             P+S   Q N R
Sbjct  139   PDSSLAQPNRR  149



>ref|XP_004501128.1| PREDICTED: uncharacterized protein LOC101512645 [Cicer arietinum]
Length=157

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 79/108 (73%), Gaps = 3/108 (3%)
 Frame = +1

Query  1258  YKLWVLAAILLLAGWTMFTGSITLSLNWKHLS--AKPHSPAIHedldlleveerekvvrH  1431
             Y L  LA I+++A W MFTGSITL  +  +L+  +      I EDLD+LEVEEREKVV+H
Sbjct  11    YMLCALATIVIVALWFMFTGSITLKWSAGNLNQFSDDLDSMILEDLDVLEVEEREKVVKH  70

Query  1432  MWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSL  1575
             MWDVYT S+   L +FW EAFEA YE ++SD  AV++AAV+EIAKMSL
Sbjct  71    MWDVYTRSQNG-LSQFWLEAFEAGYEHLISDVPAVKNAAVSEIAKMSL  117



>ref|XP_006416510.1| hypothetical protein EUTSA_v10008999mg [Eutrema salsugineum]
 gb|ESQ34863.1| hypothetical protein EUTSA_v10008999mg [Eutrema salsugineum]
Length=152

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 74/106 (70%), Gaps = 1/106 (1%)
 Frame = +1

Query  1303  TMFTGSITL-SLNWKHLSAKPHSPAIHedldlleveerekvvrHMWDVYTESRTARLPKF  1479
             +M TGS++L  L   H         + +DLD+LE+EEREKVVR MWDVY  S   R+P+F
Sbjct  45    SMLTGSVSLKGLGLFHSVDGEFGFPVGDDLDVLEIEEREKVVRQMWDVYGRSGGVRIPRF  104

Query  1480  WQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPPIQSN  1617
             W+EAFEAAYE ++SDS+AVR+ AV++IAK+SL    KP+S   Q N
Sbjct  105   WREAFEAAYEFLVSDSAAVRNGAVSDIAKLSLVRSLKPDSTSAQPN  150



>ref|XP_010477152.1| PREDICTED: uncharacterized protein LOC104756282 [Camelina sativa]
Length=155

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +1

Query  1429  HMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPPI  1608
              MWDVY  S   R+P+FW+EAFEAAYE ++SDS+AVR+   ++IAK+SL    K ES P+
Sbjct  91    QMWDVYGRSGGVRVPRFWREAFEAAYEFLISDSAAVRNGVFSDIAKLSLVRFVKSESTPV  150

Query  1609  QSNSR  1623
             Q  +R
Sbjct  151   QPKNR  155



>ref|XP_002463166.1| hypothetical protein SORBIDRAFT_02g038920 [Sorghum bicolor]
 gb|EER99687.1| hypothetical protein SORBIDRAFT_02g038920 [Sorghum bicolor]
Length=164

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 84/117 (72%), Gaps = 6/117 (5%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITLSLNWKHLSAK--PHSPAIHedldlleveerekvvr  1428
             +YK+W LAAI LLA W+MF  S+TL L+   L+A     S  + +DLD LE+E+REK+VR
Sbjct  43    RYKVWALAAIALLALWSMFAASVTLRLSSGELAATFGDVSDPLIDDLDPLEMEQREKLVR  102

Query  1429  HMWDVYTESRT-ARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPE  1596
              MWDVYT +    RLP+FWQEAFEAAYE++  D +   DAA++EIA+MS+H   +PE
Sbjct  103   RMWDVYTRTDNHVRLPRFWQEAFEAAYEELAGDDTLATDAAISEIARMSIH---RPE  156



>ref|XP_006425705.1| hypothetical protein CICLE_v10027139mg [Citrus clementina]
 gb|ESR38945.1| hypothetical protein CICLE_v10027139mg [Citrus clementina]
Length=140

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 86/152 (57%), Gaps = 33/152 (22%)
 Frame = +1

Query  1198  MRDEEA--QVKTNGVQKKEG--------FKYKLWVLAAILLLAGWTMFTGSITL---SLN  1338
             M+D+E+     T  V KKE          +YK W LAAILLLA W+MFTG++TL   + N
Sbjct  1     MKDDESVPTTTTLNVTKKESSDSSIFGKGRYKFWALAAILLLAFWSMFTGTVTLRWSAGN  60

Query  1339  WKHLSAKPHSPAIHedldlleveerekvvrHMWDVYTESRTARLPKFWQEAFEAAYEDMM  1518
                LS    SP IH+DL                DV     + ++ +FWQEAFEAAYE++ 
Sbjct  61    LNRLSDDLGSP-IHDDL----------------DVLP---SDQITEFWQEAFEAAYEELS  100

Query  1519  SDSSAVRDAAVTEIAKMSLHSKAKPESPPIQS  1614
             SD + VRDAA+TEIAKMS+ S    +SPP  S
Sbjct  101   SDVAEVRDAAITEIAKMSVRSLVNIDSPPFHS  132



>gb|EPS71215.1| hypothetical protein M569_03548, partial [Genlisea aurea]
Length=108

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 69/108 (64%), Gaps = 4/108 (4%)
 Frame = +1

Query  1258  YKLWVLAAILLLAGWTMFTGSITLSLNWKHLSAKPHSPAIHedldlleveerekvvrHMW  1437
             +KLW   AI+ LA  +M T SITL   W  L  K     +  DLDLL++EER K+V  MW
Sbjct  3     HKLWAFIAIISLASCSMLTASITL--KWSPLDLKQQKDFLDADLDLLDLEERVKMVMQMW  60

Query  1438  DVYTE--SRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSL  1575
             D Y +  + TARL  FW+EAF AAY+ + SD SAVRDAA  EIA+MS 
Sbjct  61    DTYQQHAATTARLSSFWREAFGAAYQQLASDVSAVRDAAFVEIAQMSF  108



>ref|XP_008667655.1| PREDICTED: uncharacterized protein LOC100276045 isoform X1 [Zea 
mays]
 gb|ACN31558.1| unknown [Zea mays]
 tpg|DAA41383.1| TPA: hypothetical protein ZEAMMB73_276453 [Zea mays]
Length=164

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 73/118 (62%), Gaps = 8/118 (7%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITLSLNWKHLS---AKPHSPAIHedldlleveerekvv  1425
             +YK+W LAAI LLA W+MF  S+TL L+   L+        P I E   L   +  + V 
Sbjct  43    RYKVWALAAIALLALWSMFAASVTLRLSSVDLATTFGDASDPLIDELDPLEMEQREKLVR  102

Query  1426  rHMWDVYTESRT-ARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPE  1596
               MWDVYT +    RLP+FWQEAFEAAYE++  D +   DAA++EIA+MS+H   +PE
Sbjct  103   -RMWDVYTRTDNHVRLPRFWQEAFEAAYEELAGDDTLTTDAAISEIARMSIH---RPE  156



>ref|XP_006305739.1| hypothetical protein CARUB_v10010542mg [Capsella rubella]
 gb|EOA38637.1| hypothetical protein CARUB_v10010542mg [Capsella rubella]
Length=154

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  1429  HMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPP  1605
              MWDVY  S   R+P+FW+EAFEAAYE ++SDS+AVR+ AV++IAK+SL    K ES P
Sbjct  90    QMWDVYGRSGGVRVPRFWREAFEAAYEFLISDSAAVRNGAVSDIAKLSLVRFVKSESTP  148



>gb|ACG40814.1| hypothetical protein [Zea mays]
Length=164

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 72/118 (61%), Gaps = 8/118 (7%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITLSLNWKHLS---AKPHSPAIHedldlleveerekvv  1425
             +YK+W LAAI LLA W+MF  S+TL L+   L+        P I E   L   +  + V 
Sbjct  43    RYKVWALAAIALLALWSMFAASVTLRLSSVDLATTFGDASDPLIDELDPLEMEQREKLVR  102

Query  1426  rHMWDVYTESRT-ARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPE  1596
               MWDVYT +    RLP+FWQEAFEAAYE++  D     DAA++EIA+MS+H   +PE
Sbjct  103   -RMWDVYTRTDNHVRLPRFWQEAFEAAYEELAGDDMLTTDAAISEIARMSIH---RPE  156



>gb|KCW45824.1| hypothetical protein EUGRSUZ_L00342, partial [Eucalyptus grandis]
Length=68

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 48/64 (75%), Gaps = 2/64 (3%)
 Frame = +1

Query  1432  MWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPPIQ  1611
             +WDVYT+S+ +RLPKFW++AF+A YE + SD   VRD AV+EIAKMSL S     S P+ 
Sbjct  5     LWDVYTQSKRSRLPKFWRDAFQAGYEFLTSDVPGVRDVAVSEIAKMSLRSFT--FSDPLA  62

Query  1612  SNSR  1623
             ++SR
Sbjct  63    AHSR  66



>ref|XP_010484713.1| PREDICTED: uncharacterized protein LOC104762987 [Camelina sativa]
Length=171

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 78/108 (72%), Gaps = 4/108 (4%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldlleveerekvv  1425
             +YK W LAAILLLA W+M TG++ L   + N  H +     P I EDLD+LE+EEREKVV
Sbjct  36    RYKFWALAAILLLAFWSMLTGTVNLRWSAGNINHFTEDLVFP-IPEDLDVLEMEEREKVV  94

Query  1426  rHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKM  1569
             +HMWDVY   R  RLP+FWQEAFEAAYE++ SD   V +AA++EI ++
Sbjct  95    KHMWDVYNNGRRIRLPRFWQEAFEAAYEELTSDVPDVVEAAISEIVQL  142



>ref|XP_010039660.1| PREDICTED: uncharacterized protein LOC104428358 [Eucalyptus grandis]
Length=109

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +1

Query  1432  MWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHS  1581
             +WDVYT+S+ +RLPKFW++AF+A YE + SD   VRD AV+EIAKMSL S
Sbjct  21    LWDVYTQSKRSRLPKFWRDAFQAGYEFLTSDVPGVRDVAVSEIAKMSLRS  70



>ref|XP_009627606.1| PREDICTED: uncharacterized protein LOC104118125 isoform X1 [Nicotiana 
tomentosiformis]
Length=233

 Score = 75.5 bits (184),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 85/122 (70%), Gaps = 3/122 (2%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITLSLNWKHLSAKPHSPAIH--edldlleveerekvvr  1428
             +YK W LAAILLLA W+M TG++TL  +  +L+        H  EDLD+LE+EEREK+V+
Sbjct  59    RYKFWALAAILLLAFWSMLTGTVTLRWSAGNLNGLSDDFDTHLPEDLDVLELEEREKLVK  118

Query  1429  HMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPPI  1608
              +WDVYT +    L  FWQEAFEAAYE++ SD   V +AA++EIAKMS+ S    ESP +
Sbjct  119   RLWDVYTNTHRIGLTTFWQEAFEAAYEELSSDVPEVLEAAISEIAKMSVRS-IDIESPSL  177

Query  1609  QS  1614
             QS
Sbjct  178   QS  179



>ref|XP_011097125.1| PREDICTED: uncharacterized protein LOC105176117, partial [Sesamum 
indicum]
Length=182

 Score = 75.1 bits (183),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 85/121 (70%), Gaps = 4/121 (3%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL---SLNWKHLSAKPHSPAIHedldlleveerekvv  1425
             +YK W LAAILLLA W+M TG++TL   + + K+  A  ++    EDLD+L++EEREK+V
Sbjct  43    RYKFWALAAILLLAFWSMLTGTVTLRWSAGDLKNRFADDYNSHAAEDLDVLDLEEREKLV  102

Query  1426  rHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPP  1605
             +HMWDVYT S   R   FWQEAF AAYED+ S+   VR+AA++EIA+MS     K + PP
Sbjct  103   KHMWDVYTNSPRFRFGGFWQEAFVAAYEDLTSEVPEVREAAISEIARMSARY-LKLDPPP  161

Query  1606  I  1608
             +
Sbjct  162   V  162



>ref|XP_009627612.1| PREDICTED: uncharacterized protein LOC104118125 isoform X2 [Nicotiana 
tomentosiformis]
Length=202

 Score = 75.1 bits (183),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 87/124 (70%), Gaps = 3/124 (2%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITLSLNWKHLSAKPHSPAIH--edldlleveerekvvr  1428
             +YK W LAAILLLA W+M TG++TL  +  +L+        H  EDLD+LE+EEREK+V+
Sbjct  59    RYKFWALAAILLLAFWSMLTGTVTLRWSAGNLNGLSDDFDTHLPEDLDVLELEEREKLVK  118

Query  1429  HMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPPI  1608
              +WDVYT +    L  FWQEAFEAAYE++ SD   V +AA++EIAKMS+ S    ESP +
Sbjct  119   RLWDVYTNTHRIGLTTFWQEAFEAAYEELSSDVPEVLEAAISEIAKMSVRS-IDIESPSL  177

Query  1609  QSNS  1620
             QS++
Sbjct  178   QSSA  181



>ref|XP_009627627.1| PREDICTED: uncharacterized protein LOC104118125 isoform X4 [Nicotiana 
tomentosiformis]
Length=182

 Score = 74.7 bits (182),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 86/123 (70%), Gaps = 3/123 (2%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITLSLNWKHLSAKPHSPAIH--edldlleveerekvvr  1428
             +YK W LAAILLLA W+M TG++TL  +  +L+        H  EDLD+LE+EEREK+V+
Sbjct  59    RYKFWALAAILLLAFWSMLTGTVTLRWSAGNLNGLSDDFDTHLPEDLDVLELEEREKLVK  118

Query  1429  HMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPPI  1608
              +WDVYT +    L  FWQEAFEAAYE++ SD   V +AA++EIAKMS+ S    ESP +
Sbjct  119   RLWDVYTNTHRIGLTTFWQEAFEAAYEELSSDVPEVLEAAISEIAKMSVRS-IDIESPSL  177

Query  1609  QSN  1617
             QS+
Sbjct  178   QSS  180



>ref|XP_009627619.1| PREDICTED: uncharacterized protein LOC104118125 isoform X3 [Nicotiana 
tomentosiformis]
Length=196

 Score = 75.1 bits (183),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 86/123 (70%), Gaps = 3/123 (2%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITLSLNWKHLSAKPHSPAIH--edldlleveerekvvr  1428
             +YK W LAAILLLA W+M TG++TL  +  +L+        H  EDLD+LE+EEREK+V+
Sbjct  59    RYKFWALAAILLLAFWSMLTGTVTLRWSAGNLNGLSDDFDTHLPEDLDVLELEEREKLVK  118

Query  1429  HMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPPI  1608
              +WDVYT +    L  FWQEAFEAAYE++ SD   V +AA++EIAKMS+ S    ESP +
Sbjct  119   RLWDVYTNTHRIGLTTFWQEAFEAAYEELSSDVPEVLEAAISEIAKMSVRS-IDIESPSL  177

Query  1609  QSN  1617
             QS+
Sbjct  178   QSS  180



>ref|XP_010317714.1| PREDICTED: uncharacterized protein LOC101254457 isoform X2 [Solanum 
lycopersicum]
Length=161

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = +1

Query  1429  HMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPPI  1608
             HMWDVYT S   R+ KFWQEAFEAAYE++ SD + VR+AA++EI+KMS+      + PP+
Sbjct  78    HMWDVYTNSPRIRILKFWQEAFEAAYEELNSDVAEVREAAISEISKMSIQF-VNIDLPPL  136

Query  1609  QS  1614
             +S
Sbjct  137   RS  138



>ref|NP_001241923.1| uncharacterized protein LOC100803339 [Glycine max]
 gb|ACU17571.1| unknown [Glycine max]
Length=130

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 64/95 (67%), Gaps = 4/95 (4%)
 Frame = +1

Query  1306  MFTGSITLSLNWKHLSAKPHSPAIHedldlleveerekvvrHMWDVYTESRTAR---LPK  1476
             MFT S+TL  +  +L+    S  +++   L   E  + V R MWDVYT+S++ R   LP+
Sbjct  1     MFTASLTLKWSAGNLNRDFDSATLNDFDVLEVEEREKVVRR-MWDVYTQSKSGRGSGLPR  59

Query  1477  FWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHS  1581
             FW +AF AAY+ ++SD  +VRDAAV+EIAK+SLHS
Sbjct  60    FWSDAFHAAYDHLVSDVQSVRDAAVSEIAKISLHS  94



>ref|XP_003570023.1| PREDICTED: uncharacterized protein LOC100822234 [Brachypodium 
distachyon]
Length=177

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 77/112 (69%), Gaps = 4/112 (4%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITLSLNWKHLSAKPHSP---AIHedldlleveerekvv  1425
             +YK+W LAAI LLA W+M   S++L  +   L+A           +DLD LE+EEREK+V
Sbjct  37    RYKVWALAAIALLALWSMSAASVSLRWSAGDLAASASGDLDAPFSQDLDSLEMEEREKLV  96

Query  1426  rHMWDVYTE-SRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLH  1578
               MWD+YT  S   RLP+FWQEAFEAAYE+++ D   VRDAA++EIA+MS H
Sbjct  97    GRMWDMYTRTSDEVRLPRFWQEAFEAAYEELVGDDLQVRDAAISEIARMSAH  148



>ref|XP_010529511.1| PREDICTED: uncharacterized protein LOC104806349 [Tarenaya hassleriana]
Length=161

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 48/61 (79%), Gaps = 3/61 (5%)
 Frame = +1

Query  1432  MWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSL--HS-KAKPESP  1602
             MWDVYT +  +RLP+FW+EAFEAAYE ++SDS  +R+AAV++IAK+SL  HS   KP S 
Sbjct  101   MWDVYTRAAGSRLPRFWREAFEAAYEFLVSDSPEIRNAAVSDIAKLSLTYHSVNPKPLSV  160

Query  1603  P  1605
             P
Sbjct  161   P  161



>dbj|BAK05463.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=180

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 76/112 (68%), Gaps = 4/112 (4%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITLSLNWKHLSA---KPHSPAIHedldlleveerekvv  1425
             +YK+W LAAI LLA W+M   S++L  +   L+A         +  DLD LE+EEREK+V
Sbjct  40    RYKVWALAAIALLALWSMSAASVSLRWSAGDLAAAVAGDLDAPLRGDLDSLEMEEREKLV  99

Query  1426  rHMWDVYTE-SRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLH  1578
               MWD+YT  S   RLP+FWQEAFEAAYE++  D   VRDAA++EIA+MS H
Sbjct  100   GRMWDMYTRTSDEIRLPRFWQEAFEAAYEELAGDDMQVRDAAISEIARMSAH  151



>ref|XP_004984041.1| PREDICTED: uncharacterized protein LOC101766086 isoform X2 [Setaria 
italica]
Length=171

 Score = 71.6 bits (174),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 40/51 (78%), Gaps = 1/51 (2%)
 Frame = +1

Query  1429  HMWDVYTE-SRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLH  1578
              MWD+YT  S   RLP+FWQEAFEAAYE++  D + VRDAA++EIA+MS H
Sbjct  94    RMWDMYTRTSDEVRLPRFWQEAFEAAYEELAGDDTQVRDAAISEIARMSAH  144



>gb|EMT24196.1| hypothetical protein F775_30518 [Aegilops tauschii]
Length=198

 Score = 71.6 bits (174),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 74/120 (62%), Gaps = 12/120 (10%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITLSLNWKHLSAKP---HSPAIHedldlleveerekvv  1425
             +YK W LAAI LLA W+MF  S+TL  +   L+A P    SP + +   L   E  + V 
Sbjct  42    RYKAWTLAAIALLALWSMFAASVTLRWSSGDLAAAPWDLSSPLLDDLDPLEMEEREKLVR  101

Query  1426  rHMWDVYTESRTAR---LPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPE  1596
               MWD+YT  RT     LP+FWQEAFEAAYE++  D +   DAAV+EIA+M++H   +PE
Sbjct  102   -RMWDLYT--RTGDHVWLPRFWQEAFEAAYEELAGDDTPASDAAVSEIARMAIH---RPE  155



>ref|NP_001144135.1| uncharacterized protein LOC100276984 [Zea mays]
 gb|ACF86246.1| unknown [Zea mays]
 gb|ACG38155.1| hypothetical protein [Zea mays]
 gb|ACG40221.1| hypothetical protein [Zea mays]
Length=182

 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 77/113 (68%), Gaps = 6/113 (5%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL----SLNWKHLSAKPHSPAIHedldlleveerekv  1422
             +YK+W LAAI LLA W+M   S++L    S +   +      P + +DLD LE+EEREK+
Sbjct  43    RYKVWALAAIALLALWSMSAASVSLRWSSSGDLASVYGDLDVP-LADDLDSLEMEEREKL  101

Query  1423  vrHMWDVYTE-SRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLH  1578
             V  MWD+YT  S   RLP+FWQEAFEAAYE++  D   VRDAA++EIA+MS H
Sbjct  102   VGRMWDMYTRTSDEVRLPRFWQEAFEAAYEELAGDDVQVRDAAISEIARMSAH  154



>ref|XP_004984040.1| PREDICTED: uncharacterized protein LOC101766086 isoform X1 [Setaria 
italica]
Length=195

 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 40/51 (78%), Gaps = 1/51 (2%)
 Frame = +1

Query  1429  HMWDVYTE-SRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLH  1578
              MWD+YT  S   RLP+FWQEAFEAAYE++  D + VRDAA++EIA+MS H
Sbjct  94    RMWDMYTRTSDEVRLPRFWQEAFEAAYEELAGDDTQVRDAAISEIARMSAH  144



>ref|NP_001281179.1| uncharacterized protein LOC100276045 [Zea mays]
 gb|ACR38676.1| unknown [Zea mays]
Length=105

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/101 (44%), Positives = 59/101 (58%), Gaps = 8/101 (8%)
 Frame = +1

Query  1306  MFTGSITLSLNWKHLS---AKPHSPAIHedldlleveerekvvrHMWDVYTESRT-ARLP  1473
             MF  S+TL L+   L+        P I E   L   +  + V   MWDVYT +    RLP
Sbjct  1     MFAASVTLRLSSVDLATTFGDASDPLIDELDPLEMEQREKLVR-RMWDVYTRTDNHVRLP  59

Query  1474  KFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPE  1596
             +FWQEAFEAAYE++  D +   DAA++EIA+MS+H   +PE
Sbjct  60    RFWQEAFEAAYEELAGDDTLTTDAAISEIARMSIH---RPE  97



>ref|NP_001143565.1| uncharacterized protein LOC100276262 [Zea mays]
 gb|ACG33090.1| hypothetical protein [Zea mays]
Length=178

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 77/113 (68%), Gaps = 6/113 (5%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL----SLNWKHLSAKPHSPAIHedldlleveerekv  1422
             +YK+W LAAI LLA W+M   S++L    S +   +      P + +DLD LE+EEREK+
Sbjct  39    RYKVWALAAIALLALWSMSAASVSLRWSSSGDLASVYGDLDVP-LADDLDSLEMEEREKL  97

Query  1423  vrHMWDVYTE-SRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLH  1578
             V  MWD+YT  S   RLP+FWQEAFEAAYE++  D   VRDAA++EIA+MS H
Sbjct  98    VGRMWDMYTRTSDEVRLPRFWQEAFEAAYEELAGDDVQVRDAAISEIARMSAH  150



>emb|CAN75408.1| hypothetical protein VITISV_042285 [Vitis vinifera]
Length=125

 Score = 64.7 bits (156),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  1429  HMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVR  1539
             HMWDVYT SR  RLP+FWQEAFEAAYED+ +D   VR
Sbjct  89    HMWDVYTNSRRGRLPRFWQEAFEAAYEDLANDDPDVR  125


 Score = 30.4 bits (67),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 30/57 (53%), Gaps = 4/57 (7%)
 Frame = +2

Query  1256  NTSYGYWLQFFC*LVGPCSLAPSLSA---*TGNIFLQNLTLLPSMRILISWKWRKER  1417
             +TS G W +F   L G CS AP LS     T  IF    T   +M I + WKWR+E+
Sbjct  30    STSSGCWQRFCSLLSGLCSPAPLLSGGPPVTSTIFPTTSTPTSTM-ISMFWKWRREK  85



>ref|XP_002467700.1| hypothetical protein SORBIDRAFT_01g032680 [Sorghum bicolor]
 gb|EER94698.1| hypothetical protein SORBIDRAFT_01g032680 [Sorghum bicolor]
Length=176

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 77/113 (68%), Gaps = 6/113 (5%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITL----SLNWKHLSAKPHSPAIHedldlleveerekv  1422
             +YK+W LAAI LLA W+M   S++L    S +   +      P + +DLD LE+EEREK+
Sbjct  38    RYKVWALAAIALLALWSMSAASVSLRWSSSGDLASVYGDLDVP-LADDLDSLEMEEREKL  96

Query  1423  vrHMWDVYTE-SRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLH  1578
             V  MWD+YT  S   RLP+FWQEAFEAAYE++  D   VRDAA++EIA+MS H
Sbjct  97    VGRMWDMYTRTSDEVRLPRFWQEAFEAAYEELAGDDVQVRDAAISEIARMSAH  149



>gb|ACG48314.1| hypothetical protein [Zea mays]
Length=71

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 42/56 (75%), Gaps = 4/56 (7%)
 Frame = +1

Query  1432  MWDVYTESRT-ARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPE  1596
             MWDVYT +    RLP+FWQEAFEAAYE++  D +   DAA++EIA+MS+H   +PE
Sbjct  11    MWDVYTRTDNHVRLPRFWQEAFEAAYEELAGDDTLTTDAAISEIARMSIH---RPE  63



>ref|XP_009394309.1| PREDICTED: uncharacterized protein LOC103979819 [Musa acuminata 
subsp. malaccensis]
Length=177

 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 39/51 (76%), Gaps = 1/51 (2%)
 Frame = +1

Query  1429  HMWDVYTESR-TARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLH  1578
             HMWDVY  S  T RLP+FWQ+AFEAAYE++  D  A RDAAV EIA++S+ 
Sbjct  87    HMWDVYAHSHSTGRLPRFWQQAFEAAYEELSGDDPASRDAAVAEIARLSMR  137



>gb|EYU40147.1| hypothetical protein MIMGU_mgv1a015364mg [Erythranthe guttata]
Length=160

 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 66/116 (57%), Gaps = 1/116 (1%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITLSLNWKHLSAKPHSPAIHedldlleveerekvvrHM  1434
             +YK W LAAILLLA  +M T +++L  +    S    SPA+     L   E  + V   M
Sbjct  29    RYKCWALAAILLLAFCSMLTATVSLRRSAGDFSRLNDSPAVEFLDVLDLEEREKLVK-QM  87

Query  1435  WDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESP  1602
             WDVYT S    L  FWQ+AF AAYED+ SD+  VRD A++EIA MS+       SP
Sbjct  88    WDVYTGSHRTGLVGFWQDAFVAAYEDLSSDAPLVRDIAISEIAMMSVRYLPSLNSP  143



>ref|XP_006650190.1| PREDICTED: uncharacterized protein LOC102720218 [Oryza brachyantha]
Length=184

 Score = 69.3 bits (168),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 76/116 (66%), Gaps = 10/116 (9%)
 Frame = +1

Query  1255  KYKLWVLAAILLLAGWTMFTGSITLSLNWKH-------LSAKPHSPAIHedldlleveer  1413
             +YK+W  AAI LLA W+M   S+  SL W          +++     + +DLD LE+EER
Sbjct  42    RYKVWAFAAIALLALWSMSAASV--SLRWSSGRFLLAAAASEDLDAPLRDDLDSLEMEER  99

Query  1414  ekvvrHMWDVYTES-RTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLH  1578
             EK+V  MWD+YT +    RLP+FWQEAFEAAYE++  D   VRDAA++EIA+MS H
Sbjct  100   EKLVGRMWDMYTRTGDEVRLPRFWQEAFEAAYEELSGDDMQVRDAAISEIARMSAH  155



>gb|EMT26061.1| hypothetical protein F775_27408 [Aegilops tauschii]
Length=130

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 38/51 (75%), Gaps = 1/51 (2%)
 Frame = +1

Query  1429  HMWDVYTE-SRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLH  1578
              MWD+YT  S   RLP+FWQEAFEAAYE++  D   VRD A++EIA+MS H
Sbjct  60    RMWDMYTRTSDEVRLPRFWQEAFEAAYEELAGDDMQVRDTAISEIARMSAH  110



>gb|EPS67837.1| hypothetical protein M569_06941, partial [Genlisea aurea]
Length=158

 Score = 68.6 bits (166),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 68/111 (61%), Gaps = 6/111 (5%)
 Frame = +1

Query  1258  YKLWVLAAILLLAGWTMFTGSITLSLNWKHLSAKP----HSPAIHedldlleveerekvv  1425
             YK W LA ILLLA W+M  G+ TL  +   L+ +P     SP++ +   L+  E    V 
Sbjct  44    YKFWALAVILLLALWSMIIGAATLRWSAGDLN-RPTDDYSSPSVEDLDVLILEERERLVK  102

Query  1426  rHMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLH  1578
              H+WDVYT SR  +   FWQ+AF AAYED+ S+   VRD+A +EIAKMS+ 
Sbjct  103   -HLWDVYTNSRRIKFSGFWQDAFVAAYEDLTSEIPEVRDSAFSEIAKMSVQ  152



>ref|NP_001050350.1| Os03g0411600 [Oryza sativa Japonica Group]
 gb|AAO37508.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABF96570.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF12264.1| Os03g0411600 [Oryza sativa Japonica Group]
 gb|EAY90431.1| hypothetical protein OsI_12018 [Oryza sativa Indica Group]
 gb|EAZ27304.1| hypothetical protein OsJ_11244 [Oryza sativa Japonica Group]
Length=178

 Score = 68.9 bits (167),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 39/51 (76%), Gaps = 1/51 (2%)
 Frame = +1

Query  1429  HMWDVYTES-RTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLH  1578
              MWD+YT +    RLP+FWQEAFEAAYE++  D   VRDAA++EIA+MS H
Sbjct  102   RMWDMYTRTGDEVRLPRFWQEAFEAAYEELAGDDMQVRDAAISEIARMSAH  152



>ref|XP_004958258.1| PREDICTED: uncharacterized protein LOC101780353 [Setaria italica]
Length=159

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 42/56 (75%), Gaps = 4/56 (7%)
 Frame = +1

Query  1432  MWDVYTESRT-ARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPE  1596
             MWDVYT +    RLP+FWQEAFEAAYE++  D +   DAA++EIA+MS+H   +PE
Sbjct  99    MWDVYTRTGDHVRLPRFWQEAFEAAYEELAGDDTQASDAAISEIARMSVH---RPE  151



>gb|ABK24848.1| unknown [Picea sitchensis]
Length=97

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +1

Query  1429  HMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPESPP  1605
             HMWD+Y  +   +L  FWQEAF+AAYE++ S++  VRD A +EIAKMSL    K   PP
Sbjct  14    HMWDIYIHNPRLKLSSFWQEAFQAAYEELESEAPGVRDHAFSEIAKMSLRLVEKDPIPP  72



>emb|CAN60001.1| hypothetical protein VITISV_043637 [Vitis vinifera]
Length=127

 Score = 64.3 bits (155),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  1429  HMWDVYTESRTARLPKFWQEAFEAAYEDMMSDSSAVR  1539
             HMWDVYT SR  RLP+FWQEAFEAAYED+ +D   VR
Sbjct  89    HMWDVYTNSRRGRLPRFWQEAFEAAYEDLANDDPDVR  125


 Score = 24.6 bits (52),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 27/57 (47%), Gaps = 4/57 (7%)
 Frame = +2

Query  1256  NTSYGYWLQFFC*LVGPCSLAPSLSA*---TGNIFLQNLTLLPSMRILISWKWRKER  1417
             +TS   W +F   L G CS  P LS     T  IF    T   S  I + WKWR+E+
Sbjct  30    STSSERWQRFCSLLCGLCSPGPLLSGGPPATSTIFPTTSTPT-STTISMFWKWRREK  85



>ref|NP_001060236.1| Os07g0607500 [Oryza sativa Japonica Group]
 dbj|BAD31152.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD32031.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF22150.1| Os07g0607500 [Oryza sativa Japonica Group]
 gb|EAZ40602.1| hypothetical protein OsJ_25063 [Oryza sativa Japonica Group]
Length=164

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 41/58 (71%), Gaps = 5/58 (9%)
 Frame = +1

Query  1429  HMWDVYTESRT--ARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPE  1596
              MWDVYT +     RLP+FWQEAFEAAYE++  D +   + AV+EIA+MS+H   +PE
Sbjct  102   RMWDVYTRTGVDRVRLPRFWQEAFEAAYEELAGDDTQASETAVSEIARMSVH---RPE  156



>gb|EAZ04660.1| hypothetical protein OsI_26812 [Oryza sativa Indica Group]
Length=164

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 41/58 (71%), Gaps = 5/58 (9%)
 Frame = +1

Query  1429  HMWDVYTESRT--ARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPE  1596
              MWDVYT +     RLP+FWQEAFEAAYE++  D +   + AV+EIA+MS+H   +PE
Sbjct  102   RMWDVYTRTGVDRVRLPRFWQEAFEAAYEELAGDDTQASETAVSEIARMSVH---RPE  156



>gb|KHN22260.1| hypothetical protein glysoja_022016 [Glycine soja]
Length=97

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 62/94 (66%), Gaps = 9/94 (10%)
 Frame = +1

Query  1306  MFTGSITLSLNWKHLSAKPHSPAIHedldlleveerekvvrHMWDVY--TESRTARLPKF  1479
             M  GS+TL   W   +       IHEDLD+L+V EREKVVRHMWD Y  T +++  LPKF
Sbjct  1     MLAGSVTL--KWSSSNNDDFDSTIHEDLDVLDVGEREKVVRHMWDAYSRTHTKSVGLPKF  58

Query  1480  WQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHS  1581
             W EAFEAAYE +MSD       AV+EIAKMSL S
Sbjct  59    WWEAFEAAYEQLMSDV-----PAVSEIAKMSLRS  87



>ref|XP_006657943.1| PREDICTED: uncharacterized protein LOC102708073 [Oryza brachyantha]
Length=160

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 40/57 (70%), Gaps = 4/57 (7%)
 Frame = +1

Query  1429  HMWDVYTESRT-ARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHSKAKPE  1596
              MWDVYT +    RLP+FWQEAFEAAYE++  D     + AV+EIA+MS+H   +PE
Sbjct  99    RMWDVYTRTGDRVRLPRFWQEAFEAAYEELAGDDMQASEMAVSEIARMSVH---RPE  152



>ref|XP_008353121.1| PREDICTED: uncharacterized protein LOC103416670 [Malus domestica]
Length=55

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 42/53 (79%), Gaps = 3/53 (6%)
 Frame = +1

Query  1432  MWDVYTESR---TARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHS  1581
             MWD+Y +S    T++L +FWQEAFEA ++ + SD +AVRDAAV++IAKMS+ S
Sbjct  1     MWDLYMQSSHTSTSQLLRFWQEAFEAEFKHLSSDIAAVRDAAVSKIAKMSIRS  53



>ref|XP_008361468.1| PREDICTED: uncharacterized protein LOC103425174 [Malus domestica]
Length=205

 Score = 62.8 bits (151),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 42/53 (79%), Gaps = 3/53 (6%)
 Frame = +1

Query  1432  MWDVYTESR---TARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHS  1581
             MWD+Y +S    T++L +FWQEAFEA ++ + SD +AVRDAAV++IAKMS+ S
Sbjct  1     MWDLYMQSSHTSTSQLLRFWQEAFEAEFKHLSSDVAAVRDAAVSKIAKMSIRS  53



>ref|XP_008361894.1| PREDICTED: uncharacterized protein LOC103425582 [Malus domestica]
Length=196

 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 42/53 (79%), Gaps = 3/53 (6%)
 Frame = +1

Query  1432  MWDVYTESR---TARLPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSLHS  1581
             MWD+Y +S    T++L +FWQEAFEA ++ + SD +AVRDAAV++IAKMS+ S
Sbjct  1     MWDLYMQSSHTSTSQLLRFWQEAFEAEFKHLSSDIAAVRDAAVSKIAKMSIRS  53



>ref|XP_010533258.1| PREDICTED: uncharacterized protein LOC104809062 [Tarenaya hassleriana]
Length=173

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 39/52 (75%), Gaps = 4/52 (8%)
 Frame = +1

Query  1432  MWDVYTES--RTAR--LPKFWQEAFEAAYEDMMSDSSAVRDAAVTEIAKMSL  1575
             MWDVY     R  R  LP+FW+EAF+AAYE +++DS   R+AAV++IAK+SL
Sbjct  94    MWDVYARGAGRGGRVMLPRFWREAFDAAYECLVNDSPEARNAAVSDIAKLSL  145



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5717038917792