BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7421_g1_i1 len=1448 path=[1:0-987 989:988-1447]

Length=1448
                                                                      Score     E

dbj|BAF46315.1|  nodulin-like protein                                   528   0.0      Ipomoea nil [qian niu]
ref|XP_004230332.1|  PREDICTED: WAT1-related protein At1g09380-like     511   5e-176   
ref|XP_006344799.1|  PREDICTED: WAT1-related protein At1g09380-li...    510   1e-175   
ref|XP_009794409.1|  PREDICTED: WAT1-related protein At1g09380-like     506   7e-174   
ref|XP_009629514.1|  PREDICTED: WAT1-related protein At1g09380-like     503   6e-173   
ref|XP_011087522.1|  PREDICTED: WAT1-related protein At1g09380          498   8e-171   
gb|EYU19418.1|  hypothetical protein MIMGU_mgv1a009113mg                493   4e-169   
emb|CDP15218.1|  unnamed protein product                                474   2e-161   
ref|XP_006417578.1|  hypothetical protein EUTSA_v10007900mg             444   2e-149   
emb|CDX94976.1|  BnaC05g06950D                                          442   6e-149   
emb|CDX94974.1|  BnaC05g06970D                                          441   3e-148   
ref|XP_009148234.1|  PREDICTED: WAT1-related protein At1g09380          438   4e-147   
ref|XP_002277072.1|  PREDICTED: WAT1-related protein At1g09380          436   6e-147   Vitis vinifera
emb|CDY69907.1|  BnaA06g37940D                                          437   7e-147   
gb|KDP23359.1|  hypothetical protein JCGZ_23192                         435   3e-146   
ref|XP_010026174.1|  PREDICTED: WAT1-related protein At1g09380-like     433   2e-145   
ref|XP_011038989.1|  PREDICTED: WAT1-related protein At1g09380          433   3e-145   
ref|XP_007031215.1|  Nodulin MtN21 /EamA-like transporter family ...    432   3e-145   
gb|KFK43234.1|  hypothetical protein AALP_AA1G097400                    433   4e-145   
emb|CBI39638.3|  unnamed protein product                                439   2e-144   
ref|XP_002892502.1|  hypothetical protein ARALYDRAFT_888180             431   2e-144   
ref|XP_006305109.1|  hypothetical protein CARUB_v10009476mg             429   1e-143   
ref|XP_010544146.1|  PREDICTED: WAT1-related protein At1g09380          427   9e-143   
ref|XP_010458220.1|  PREDICTED: WAT1-related protein At1g09380-like     426   2e-142   
ref|XP_009118319.1|  PREDICTED: WAT1-related protein At1g09380-like     425   3e-142   
ref|NP_172409.1|  nodulin MtN21-like transporter family protein         425   5e-142   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010475772.1|  PREDICTED: WAT1-related protein At1g09380          424   5e-142   
ref|XP_009625723.1|  PREDICTED: WAT1-related protein At1g09380-li...    422   5e-141   
ref|XP_010489953.1|  PREDICTED: WAT1-related protein At1g09380-like     420   4e-140   
ref|XP_009777189.1|  PREDICTED: WAT1-related protein At1g09380-li...    419   1e-139   
gb|AFK39803.1|  unknown                                                 419   1e-139   
gb|AAM65466.1|  putative nodulin protein, N21                           417   2e-139   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010674547.1|  PREDICTED: WAT1-related protein At1g09380          418   2e-139   
ref|XP_006344854.1|  PREDICTED: WAT1-related protein At1g09380-like     417   6e-139   
gb|KHG28119.1|  Auxin-induced protein 5NG4                              415   3e-138   
gb|AAO60108.1|  nodulin-like protein                                    415   4e-138   Gossypium hirsutum [American cotton]
ref|XP_010026177.1|  PREDICTED: WAT1-related protein At1g09380-like     414   5e-138   
ref|XP_009616803.1|  PREDICTED: WAT1-related protein At1g09380-li...    413   5e-138   
gb|AAO60157.1|  putative nodulin protein                                414   9e-138   Gossypium hirsutum [American cotton]
ref|XP_006382304.1|  hypothetical protein POPTR_0005s00820g             410   2e-136   
gb|KHG28117.1|  ADP-ribosylation factor 2                               416   3e-136   
ref|XP_010270886.1|  PREDICTED: WAT1-related protein At1g09380 is...    409   3e-136   
ref|XP_003536035.1|  PREDICTED: WAT1-related protein At1g09380-like     410   4e-136   
ref|XP_004230335.1|  PREDICTED: WAT1-related protein At1g09380          409   5e-136   
ref|XP_003554607.1|  PREDICTED: WAT1-related protein At1g09380-li...    409   5e-136   
ref|XP_006341313.1|  PREDICTED: WAT1-related protein At1g09380-like     408   7e-136   
ref|XP_004231303.1|  PREDICTED: WAT1-related protein At1g09380-like     409   9e-136   
ref|XP_003555788.1|  PREDICTED: WAT1-related protein At1g09380-like     408   1e-135   
ref|XP_007208228.1|  hypothetical protein PRUPE_ppa018179mg             408   1e-135   
ref|XP_004252215.1|  PREDICTED: WAT1-related protein At1g09380          407   2e-135   
ref|XP_007163305.1|  hypothetical protein PHAVU_001G223600g             405   1e-134   
ref|XP_003520787.1|  PREDICTED: WAT1-related protein At1g09380-li...    405   3e-134   
ref|XP_002512549.1|  Auxin-induced protein 5NG4, putative               404   5e-134   Ricinus communis
ref|XP_009768038.1|  PREDICTED: WAT1-related protein At1g09380-like     404   7e-134   
gb|EPS65422.1|  hypothetical protein M569_09355                         401   2e-133   
ref|XP_008246269.1|  PREDICTED: WAT1-related protein At1g09380          401   8e-133   
ref|XP_004166072.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-induce...    399   4e-132   
ref|XP_004139525.1|  PREDICTED: auxin-induced protein 5NG4-like         398   9e-132   
ref|XP_009616806.1|  PREDICTED: WAT1-related protein At1g09380-li...    394   7e-131   
ref|XP_009616805.1|  PREDICTED: WAT1-related protein At1g09380-li...    395   8e-131   
gb|KEH24463.1|  nodulin MtN21/EamA-like transporter family protein      393   2e-129   
ref|XP_004302299.1|  PREDICTED: auxin-induced protein 5NG4-like         392   3e-129   
ref|XP_006344801.1|  PREDICTED: WAT1-related protein At1g09380-li...    392   4e-129   
ref|XP_009366070.1|  PREDICTED: WAT1-related protein At1g09380          391   6e-129   
ref|XP_008364022.1|  PREDICTED: LOW QUALITY PROTEIN: WAT1-related...    389   4e-128   
ref|XP_004230334.1|  PREDICTED: WAT1-related protein At1g09380-like     388   8e-128   
ref|XP_010026180.1|  PREDICTED: WAT1-related protein At1g09380-like     388   8e-128   
ref|XP_008370594.1|  PREDICTED: LOW QUALITY PROTEIN: WAT1-related...    387   1e-127   
ref|XP_008463595.1|  PREDICTED: WAT1-related protein At1g09380-like     387   2e-127   
ref|XP_006344855.1|  PREDICTED: WAT1-related protein At1g09380-like     387   4e-127   
ref|XP_006428234.1|  hypothetical protein CICLE_v10012006mg             386   4e-127   
ref|XP_004230333.1|  PREDICTED: WAT1-related protein At1g09380-like     384   2e-126   
ref|XP_009625724.1|  PREDICTED: WAT1-related protein At1g09380-li...    382   8e-126   
ref|XP_006344800.1|  PREDICTED: WAT1-related protein At1g09380-li...    379   1e-125   
ref|XP_004494524.1|  PREDICTED: WAT1-related protein At1g09380-like     383   1e-125   
ref|XP_008350587.1|  PREDICTED: WAT1-related protein At1g09380-like     382   3e-125   
ref|XP_010092938.1|  Auxin-induced protein 5NG4                         382   4e-125   
ref|XP_006344802.1|  PREDICTED: WAT1-related protein At1g09380-li...    379   2e-124   
ref|XP_009335510.1|  PREDICTED: WAT1-related protein At1g09380-like     379   3e-124   
ref|XP_009777190.1|  PREDICTED: WAT1-related protein At1g09380-li...    379   3e-124   
ref|XP_008453225.1|  PREDICTED: WAT1-related protein At1g09380          378   6e-124   
ref|XP_010921389.1|  PREDICTED: WAT1-related protein At1g09380          379   7e-124   
ref|XP_009623882.1|  PREDICTED: WAT1-related protein At1g09380-like     375   7e-122   
ref|XP_008781052.1|  PREDICTED: WAT1-related protein At1g09380          372   1e-121   
gb|AAC33198.1|  Similar to MtN21, gi|2598575, Megicago truncatula...    372   2e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010270887.1|  PREDICTED: WAT1-related protein At1g09380 is...    369   5e-121   
ref|XP_010314776.1|  PREDICTED: WAT1-related protein At1g09380-li...    365   5e-119   
ref|XP_004144805.1|  PREDICTED: auxin-induced protein 5NG4-like         365   6e-119   
ref|XP_009417762.1|  PREDICTED: WAT1-related protein At1g09380-like     360   9e-117   
ref|XP_009387482.1|  PREDICTED: WAT1-related protein At1g09380-like     358   3e-116   
emb|CDY64772.1|  BnaC08g49990D                                          352   2e-114   
emb|CDY06357.1|  BnaA09g48460D                                          347   7e-113   
ref|XP_003589590.1|  Auxin-induced protein 5NG4                         348   3e-112   
ref|XP_002455503.1|  hypothetical protein SORBIDRAFT_03g012300          348   7e-112   Sorghum bicolor [broomcorn]
ref|XP_009794905.1|  PREDICTED: WAT1-related protein At1g09380-like     345   7e-112   
ref|XP_009794851.1|  PREDICTED: WAT1-related protein At1g09380-li...    339   1e-109   
ref|XP_010230816.1|  PREDICTED: WAT1-related protein At1g09380-like     342   2e-109   
gb|EMS59309.1|  Auxin-induced protein 5NG4                              340   5e-109   
gb|KHN02821.1|  Auxin-induced protein 5NG4                              334   1e-107   
gb|EMT10029.1|  Auxin-induced protein 5NG4                              337   2e-107   
emb|CDM82961.1|  unnamed protein product                                337   2e-107   
ref|NP_001042809.1|  Os01g0297700                                       333   2e-106   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006604784.1|  PREDICTED: WAT1-related protein At1g09380-li...    330   5e-106   
ref|XP_008654544.1|  PREDICTED: hypothetical protein isoform X6         333   8e-106   
ref|NP_001145854.1|  hypothetical protein                               331   4e-105   Zea mays [maize]
ref|XP_004967586.1|  PREDICTED: WAT1-related protein At1g09380-like     330   7e-105   
gb|EAY73629.1|  hypothetical protein OsI_01515                          328   3e-104   Oryza sativa Indica Group [Indian rice]
ref|XP_006577206.1|  PREDICTED: WAT1-related protein At1g09380-li...    325   3e-104   
ref|XP_008654543.1|  PREDICTED: hypothetical protein isoform X5         324   2e-102   
ref|XP_009794852.1|  PREDICTED: WAT1-related protein At1g09380-li...    319   3e-102   
gb|KHN43359.1|  Auxin-induced protein 5NG4                              317   2e-100   
gb|AFK33606.1|  unknown                                                 313   5e-100   
ref|XP_006644097.1|  PREDICTED: WAT1-related protein At1g09380-like     313   2e-98    
ref|XP_009616810.1|  PREDICTED: WAT1-related protein At1g09380-li...    295   1e-92    
ref|XP_010531902.1|  PREDICTED: WAT1-related protein At1g68170-li...    297   3e-92    
ref|XP_010261295.1|  PREDICTED: WAT1-related protein At1g68170          298   4e-92    
ref|XP_008785911.1|  PREDICTED: WAT1-related protein At1g25270-like     295   9e-92    
ref|XP_007031216.1|  Nodulin MtN21 /EamA-like transporter family ...    293   1e-91    
ref|XP_010068198.1|  PREDICTED: WAT1-related protein At1g68170-like     296   1e-91    
ref|XP_010911986.1|  PREDICTED: WAT1-related protein At1g25270-like     294   4e-91    
ref|XP_006432264.1|  hypothetical protein CICLE_v10003704mg             293   1e-90    
ref|XP_009399308.1|  PREDICTED: WAT1-related protein At1g68170-like     291   3e-90    
ref|XP_004253026.2|  PREDICTED: WAT1-related protein At1g09380-li...    288   5e-90    
ref|XP_008654545.1|  PREDICTED: hypothetical protein isoform X7         291   6e-90    
ref|XP_004959978.1|  PREDICTED: WAT1-related protein At1g25270-like     290   2e-89    
ref|XP_002277022.1|  PREDICTED: WAT1-related protein At1g68170-li...    287   2e-88    Vitis vinifera
ref|XP_006851387.1|  hypothetical protein AMTR_s00040p00029850          285   5e-87    
dbj|BAJ87280.1|  predicted protein                                      284   5e-87    
ref|XP_010684310.1|  PREDICTED: WAT1-related protein At1g68170-like     283   7e-87    
gb|AES63368.2|  auxin-induced 5NG4-like protein                         283   7e-87    
ref|XP_002447365.1|  hypothetical protein SORBIDRAFT_06g033770          283   7e-87    Sorghum bicolor [broomcorn]
ref|XP_008781415.1|  PREDICTED: WAT1-related protein At1g68170-like     284   7e-87    
ref|XP_010068190.1|  PREDICTED: WAT1-related protein At1g68170-like     283   8e-87    
ref|XP_003593117.1|  Auxin-induced protein 5NG4                         283   9e-87    
gb|AES63302.2|  nodulin MtN21/EamA-like transporter family protein      283   1e-86    
ref|XP_002530977.1|  Auxin-induced protein 5NG4, putative               283   1e-86    Ricinus communis
ref|XP_010103862.1|  Auxin-induced protein 5NG4                         285   1e-86    
ref|NP_001172290.1|  Os01g0296900                                       282   1e-86    
ref|XP_003572197.1|  PREDICTED: WAT1-related protein At1g09380-like     281   2e-86    
ref|XP_004986753.1|  PREDICTED: WAT1-related protein At1g09380-like     282   2e-86    
ref|XP_003531568.1|  PREDICTED: WAT1-related protein At1g68170-like     283   2e-86    
ref|XP_003594304.1|  Auxin-induced protein 5NG4                         281   4e-86    
ref|XP_007148451.1|  hypothetical protein PHAVU_006G210000g             281   5e-86    
emb|CBI37609.3|  unnamed protein product                                280   1e-85    
ref|XP_011029206.1|  PREDICTED: WAT1-related protein At1g25270-like     280   1e-85    
gb|EYU35417.1|  hypothetical protein MIMGU_mgv1a006677mg                281   1e-85    
ref|XP_004485529.1|  PREDICTED: WAT1-related protein At1g68170-li...    281   2e-85    
ref|XP_004288677.1|  PREDICTED: auxin-induced protein 5NG4-like         280   2e-85    
ref|XP_003581229.2|  PREDICTED: WAT1-related protein At1g68170-like     279   3e-85    
ref|XP_009616814.1|  PREDICTED: WAT1-related protein At1g09380-like     277   3e-85    
ref|XP_008457270.1|  PREDICTED: WAT1-related protein At1g25270-like     279   5e-85    
gb|KHG16428.1|  Auxin-induced 5NG4                                      278   5e-85    
gb|KHN43349.1|  Auxin-induced protein 5NG4                              273   6e-85    
ref|XP_004166799.1|  PREDICTED: auxin-induced protein 5NG4-like         278   7e-85    
gb|EEC70465.1|  hypothetical protein OsI_01511                          277   7e-85    Oryza sativa Indica Group [Indian rice]
ref|XP_010068193.1|  PREDICTED: WAT1-related protein At1g68170-like     278   7e-85    
ref|XP_006491838.1|  PREDICTED: WAT1-related protein At1g68170-li...    279   7e-85    
ref|XP_003547067.2|  PREDICTED: WAT1-related protein At1g68170-like     278   9e-85    
ref|XP_010241528.1|  PREDICTED: WAT1-related protein At3g30340-li...    277   9e-85    
ref|XP_006364778.1|  PREDICTED: WAT1-related protein At5g07050-like     276   3e-84    
gb|EEE60997.1|  hypothetical protein OsJ_14806                          275   5e-84    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002530887.1|  Auxin-induced protein 5NG4, putative               276   7e-84    Ricinus communis
emb|CAE05944.3|  OSJNBb0088C09.3                                        275   7e-84    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001054334.1|  Os04g0687800                                       276   1e-83    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007148456.1|  hypothetical protein PHAVU_006G210300g             275   1e-83    
ref|XP_003593115.1|  Auxin-induced protein 5NG4                         275   1e-83    
ref|XP_004249118.1|  PREDICTED: WAT1-related protein At5g07050          275   1e-83    
ref|XP_010649426.1|  PREDICTED: WAT1-related protein At1g68170-li...    274   2e-83    
ref|XP_011087819.1|  PREDICTED: WAT1-related protein At1g25270-li...    275   2e-83    
ref|XP_008457201.1|  PREDICTED: WAT1-related protein At1g25270-like     274   2e-83    
ref|XP_004139017.1|  PREDICTED: auxin-induced protein 5NG4-like         274   3e-83    
gb|EMS59079.1|  Auxin-induced protein 5NG4                              273   3e-83    
ref|XP_009405190.1|  PREDICTED: WAT1-related protein At1g68170-like     274   4e-83    
gb|ABR16695.1|  unknown                                                 274   5e-83    Picea sitchensis
ref|XP_010941182.1|  PREDICTED: WAT1-related protein At3g30340-like     272   6e-83    
gb|EEC77269.1|  hypothetical protein OsI_15893                          271   8e-83    Oryza sativa Indica Group [Indian rice]
ref|XP_009780606.1|  PREDICTED: WAT1-related protein At3g30340-like     271   1e-82    
gb|KDP46086.1|  hypothetical protein JCGZ_06597                         273   1e-82    
ref|XP_002517269.1|  Auxin-induced protein 5NG4, putative               271   2e-82    Ricinus communis
ref|XP_006645793.1|  PREDICTED: WAT1-related protein At1g09380-like     275   2e-82    
ref|XP_003593114.1|  Auxin-induced protein 5NG4                         272   2e-82    
ref|XP_010934894.1|  PREDICTED: WAT1-related protein At3g30340-like     270   2e-82    
ref|XP_004163894.1|  PREDICTED: auxin-induced protein 5NG4-like         272   2e-82    
ref|XP_009785346.1|  PREDICTED: WAT1-related protein At3g30340-like     270   3e-82    
gb|KDP46080.1|  hypothetical protein JCGZ_06591                         271   3e-82    
ref|NP_001149226.1|  mtN21 nodulin protein-like                         271   4e-82    Zea mays [maize]
ref|XP_004486242.1|  PREDICTED: WAT1-related protein At1g68170-like     271   4e-82    
ref|XP_008378803.1|  PREDICTED: WAT1-related protein At1g25270-like     271   4e-82    
ref|XP_011045738.1|  PREDICTED: WAT1-related protein At1g25270-like     270   5e-82    
tpg|DAA36748.1|  TPA: mtN21 nodulin protein-like protein                270   7e-82    
ref|XP_010068192.1|  PREDICTED: WAT1-related protein At1g68170-like     270   8e-82    
ref|XP_003532973.1|  PREDICTED: WAT1-related protein At1g68170-li...    271   8e-82    
ref|XP_002277059.2|  PREDICTED: uncharacterized protein LOC100243646    280   1e-81    Vitis vinifera
ref|XP_007148455.1|  hypothetical protein PHAVU_006G210200g             271   1e-81    
ref|XP_007041588.1|  Mtn21-like protein, putative isoform 2             270   1e-81    
ref|XP_009341318.1|  PREDICTED: WAT1-related protein At1g25270-like     270   1e-81    
ref|XP_004485925.1|  PREDICTED: WAT1-related protein At3g30340-like     269   1e-81    
ref|XP_009790909.1|  PREDICTED: WAT1-related protein At5g07050-li...    270   2e-81    
ref|XP_009621489.1|  PREDICTED: WAT1-related protein At5g07050-li...    270   2e-81    
ref|XP_003593051.1|  Auxin-induced protein 5NG4                         271   2e-81    
ref|XP_008342773.1|  PREDICTED: WAT1-related protein At1g25270-like     270   2e-81    
ref|XP_007159054.1|  hypothetical protein PHAVU_002G204500g             269   2e-81    
ref|XP_009610629.1|  PREDICTED: WAT1-related protein At5g07050-li...    270   2e-81    
gb|ABK25095.1|  unknown                                                 269   2e-81    Picea sitchensis
ref|XP_009631686.1|  PREDICTED: WAT1-related protein At3g30340-li...    268   2e-81    
ref|XP_002298718.1|  hypothetical protein POPTR_0001s31530g             268   3e-81    Populus trichocarpa [western balsam poplar]
ref|XP_009354063.1|  PREDICTED: WAT1-related protein At1g25270-like     269   4e-81    
ref|XP_006477502.1|  PREDICTED: WAT1-related protein At3g30340-like     268   4e-81    
ref|XP_002447367.1|  hypothetical protein SORBIDRAFT_06g033810          268   5e-81    Sorghum bicolor [broomcorn]
ref|XP_003597788.1|  Auxin-induced protein 5NG4                         268   5e-81    
ref|XP_004294697.1|  PREDICTED: auxin-induced protein 5NG4-like         268   6e-81    
ref|XP_010030083.1|  PREDICTED: WAT1-related protein At1g68170-like     269   6e-81    
ref|XP_004486241.1|  PREDICTED: WAT1-related protein At1g68170-like     266   7e-81    
ref|XP_006585457.1|  PREDICTED: WAT1-related protein At1g68170-like     267   1e-80    
ref|XP_006439173.1|  hypothetical protein CICLE_v10020755mg             266   1e-80    
ref|XP_008367450.1|  PREDICTED: WAT1-related protein At3g30340-like     266   1e-80    
ref|XP_007148017.1|  hypothetical protein PHAVU_006G173600g             266   1e-80    
ref|XP_010110839.1|  Auxin-induced protein 5NG4                         266   1e-80    
gb|KHN26712.1|  Auxin-induced protein 5NG4-like protein                 266   2e-80    
gb|KHF97890.1|  Auxin-induced 5NG4                                      267   2e-80    
ref|XP_004288674.1|  PREDICTED: auxin-induced protein 5NG4-like         266   2e-80    
ref|XP_009620096.1|  PREDICTED: WAT1-related protein At5g07050-like     267   3e-80    
ref|XP_007041591.1|  Mtn21-like protein                                 266   3e-80    
ref|XP_009354252.1|  PREDICTED: WAT1-related protein At1g25270-like     266   3e-80    
ref|XP_009419851.1|  PREDICTED: WAT1-related protein At5g07050-like     266   3e-80    
gb|EYU20823.1|  hypothetical protein MIMGU_mgv1a008005mg                266   4e-80    
emb|CDM84603.1|  unnamed protein product                                266   4e-80    
gb|KEH36637.1|  auxin-induced 5NG4-like protein                         265   5e-80    
ref|XP_008378805.1|  PREDICTED: WAT1-related protein At1g25270-like     266   5e-80    
ref|XP_010068191.1|  PREDICTED: WAT1-related protein At1g68170-like     266   5e-80    
ref|XP_007041587.1|  Nodulin MtN21 /EamA-like transporter family ...    268   5e-80    
ref|XP_006349811.1|  PREDICTED: WAT1-related protein At3g30340-like     265   6e-80    
ref|NP_001130743.1|  hypothetical protein                               265   6e-80    Zea mays [maize]
ref|XP_008239274.1|  PREDICTED: WAT1-related protein At3g30340-like     265   6e-80    
ref|NP_001242267.1|  uncharacterized protein LOC100811617               266   6e-80    
ref|XP_003547068.1|  PREDICTED: WAT1-related protein At1g68170-like     266   7e-80    
ref|XP_009373697.1|  PREDICTED: WAT1-related protein At3g30340-like     265   8e-80    
dbj|BAK02715.1|  predicted protein                                      265   8e-80    
ref|XP_003581230.2|  PREDICTED: WAT1-related protein At1g68170          265   8e-80    
ref|XP_008788718.1|  PREDICTED: WAT1-related protein At3g30340          263   8e-80    
ref|XP_006604312.1|  PREDICTED: WAT1-related protein At5g07050-like     265   9e-80    
gb|AFK33485.1|  unknown                                                 264   1e-79    
ref|XP_006444680.1|  hypothetical protein CICLE_v10023809mg             264   1e-79    
ref|XP_006491488.1|  PREDICTED: WAT1-related protein At3g30340-like     264   1e-79    
gb|ADE76940.1|  unknown                                                 264   1e-79    
gb|KHN33488.1|  Auxin-induced protein 5NG4-like protein                 265   1e-79    
ref|XP_003572196.1|  PREDICTED: WAT1-related protein At1g09380-like     262   1e-79    
gb|EMS48876.1|  Auxin-induced protein 5NG4                              264   2e-79    
ref|XP_008365295.1|  PREDICTED: WAT1-related protein At1g25270-like     264   2e-79    
ref|XP_009788498.1|  PREDICTED: WAT1-related protein At5g07050-like     264   2e-79    
ref|XP_007041589.1|  Mtn21-like protein, putative isoform 1             263   3e-79    
gb|EMT31802.1|  Auxin-induced protein 5NG4                              263   4e-79    
ref|XP_010531911.1|  PREDICTED: WAT1-related protein At1g68170-li...    262   4e-79    
gb|KCW63054.1|  hypothetical protein EUGRSUZ_G00640                     263   4e-79    
ref|XP_010056060.1|  PREDICTED: WAT1-related protein At3g30340-li...    263   4e-79    
ref|XP_008375444.1|  PREDICTED: WAT1-related protein At1g43650-like     262   5e-79    
ref|XP_009341321.1|  PREDICTED: WAT1-related protein At1g68170-like     263   5e-79    
ref|XP_006444681.1|  hypothetical protein CICLE_v10020746mg             262   5e-79    
ref|XP_006580831.1|  PREDICTED: WAT1-related protein At1g25270-like     262   6e-79    
ref|XP_006491888.1|  PREDICTED: WAT1-related protein At1g25270-like     263   6e-79    
ref|XP_006491487.1|  PREDICTED: WAT1-related protein At3g30340-like     261   8e-79    
ref|XP_006482028.1|  PREDICTED: WAT1-related protein At5g07050-like     263   9e-79    
ref|XP_003541692.1|  PREDICTED: WAT1-related protein At3g30340-like     262   9e-79    
gb|KDO50616.1|  hypothetical protein CISIN_1g016076mg                   263   1e-78    
gb|ABR18253.1|  unknown                                                 263   1e-78    Picea sitchensis
ref|XP_009341320.1|  PREDICTED: WAT1-related protein At1g25270-like     262   2e-78    
ref|XP_010103868.1|  Auxin-induced protein 5NG4                         262   2e-78    
gb|AFK41401.1|  unknown                                                 261   2e-78    
ref|XP_003546041.1|  PREDICTED: WAT1-related protein At3g30340          261   2e-78    
gb|KHN47404.1|  Auxin-induced protein 5NG4                              261   3e-78    
ref|XP_008671311.1|  PREDICTED: WAT1-related protein At1g68170-like     261   3e-78    
gb|AFK34273.1|  unknown                                                 261   3e-78    
ref|XP_010240649.1|  PREDICTED: WAT1-related protein At1g25270-like     261   3e-78    
ref|XP_010649428.1|  PREDICTED: WAT1-related protein At1g68170-like     259   4e-78    
ref|XP_009591224.1|  PREDICTED: WAT1-related protein At3g30340-like     259   4e-78    
gb|KHN33486.1|  Auxin-induced protein 5NG4-like protein                 261   4e-78    
ref|XP_007209305.1|  hypothetical protein PRUPE_ppa007863mg             259   5e-78    
gb|KCW63055.1|  hypothetical protein EUGRSUZ_G00647                     257   5e-78    
ref|XP_002518955.1|  Auxin-induced protein 5NG4, putative               259   5e-78    Ricinus communis
ref|XP_009391606.1|  PREDICTED: WAT1-related protein At5g07050-like     260   6e-78    
ref|XP_011092392.1|  PREDICTED: WAT1-related protein At1g25270-like     261   6e-78    
ref|XP_009794118.1|  PREDICTED: WAT1-related protein At1g68170-like     259   7e-78    
ref|XP_004288673.1|  PREDICTED: auxin-induced protein 5NG4-like         260   7e-78    
ref|XP_004308748.1|  PREDICTED: auxin-induced protein 5NG4-like         259   8e-78    
emb|CDP06236.1|  unnamed protein product                                260   8e-78    
ref|XP_003564421.1|  PREDICTED: WAT1-related protein At5g07050          259   1e-77    
ref|XP_002302687.2|  hypothetical protein POPTR_0002s18350g             258   1e-77    
ref|XP_006471332.1|  PREDICTED: WAT1-related protein At5g07050-like     260   1e-77    
ref|XP_007208872.1|  hypothetical protein PRUPE_ppa026053mg             258   2e-77    
emb|CDO97499.1|  unnamed protein product                                259   2e-77    
ref|XP_011041376.1|  PREDICTED: WAT1-related protein At5g07050          259   2e-77    
ref|XP_002272105.2|  PREDICTED: WAT1-related protein At3g30340-like     258   2e-77    
ref|XP_008392675.1|  PREDICTED: WAT1-related protein At1g43650-li...    258   2e-77    
gb|ACR34989.1|  unknown                                                 259   2e-77    
ref|XP_011025313.1|  PREDICTED: WAT1-related protein At3g30340-like     258   3e-77    
ref|XP_006432378.1|  hypothetical protein CICLE_v10001335mg             259   3e-77    
ref|XP_011070079.1|  PREDICTED: WAT1-related protein At5g07050-like     259   3e-77    
ref|XP_006495057.1|  PREDICTED: WAT1-related protein At1g25270-like     258   4e-77    
dbj|BAK04850.1|  predicted protein                                      258   4e-77    
ref|XP_004229239.1|  PREDICTED: WAT1-related protein At3g30340-like     258   4e-77    
ref|XP_011040724.1|  PREDICTED: WAT1-related protein At5g07050          258   4e-77    
ref|XP_010251137.1|  PREDICTED: WAT1-related protein At3g30340-like     257   4e-77    
ref|XP_007051368.1|  Nodulin MtN21 /EamA-like transporter family ...    257   5e-77    
ref|XP_009620098.1|  PREDICTED: WAT1-related protein At5g07050-like     257   7e-77    
ref|XP_006644860.1|  PREDICTED: WAT1-related protein At5g07050-like     258   7e-77    
ref|XP_009591821.1|  PREDICTED: WAT1-related protein At1g68170-like     257   7e-77    
ref|XP_002518959.1|  Auxin-induced protein 5NG4, putative               257   7e-77    
ref|XP_009360246.1|  PREDICTED: WAT1-related protein At5g64700-like     256   7e-77    
ref|XP_003524084.1|  PREDICTED: WAT1-related protein At1g68170-like     257   7e-77    
gb|KFK25097.1|  hypothetical protein AALP_AA8G066000                    258   8e-77    
ref|XP_006654584.1|  PREDICTED: WAT1-related protein At5g07050-like     258   1e-76    
ref|XP_006399183.1|  hypothetical protein EUTSA_v10015938mg             257   1e-76    
dbj|BAB92246.1|  putative nodulin MtN21                                 257   1e-76    
ref|XP_010649427.1|  PREDICTED: WAT1-related protein At1g68170-li...    256   1e-76    
ref|XP_010456426.1|  PREDICTED: WAT1-related protein At5g07050-like     256   2e-76    
ref|XP_006838307.1|  hypothetical protein AMTR_s00103p00127060          254   2e-76    
gb|EAY98030.1|  hypothetical protein OsI_19945                          256   3e-76    
ref|XP_010056061.1|  PREDICTED: WAT1-related protein At3g30340-li...    255   3e-76    
ref|NP_001055529.2|  Os05g0409500                                       256   3e-76    
ref|XP_011015432.1|  PREDICTED: WAT1-related protein At5g07050-like     256   4e-76    
ref|XP_002272440.2|  PREDICTED: WAT1-related protein At3g30340-like     254   4e-76    
gb|EEC71658.1|  hypothetical protein OsI_04113                          256   5e-76    
ref|XP_009800321.1|  PREDICTED: WAT1-related protein At5g07050-like     256   5e-76    
ref|XP_011038034.1|  PREDICTED: WAT1-related protein At3g30340-li...    254   5e-76    
ref|XP_004249327.1|  PREDICTED: WAT1-related protein At5g07050-li...    255   6e-76    
ref|XP_004164693.1|  PREDICTED: auxin-induced protein 5NG4-like         254   6e-76    
ref|XP_006846485.1|  hypothetical protein AMTR_s00018p00139030          254   6e-76    
ref|XP_004309501.1|  PREDICTED: auxin-induced protein 5NG4-like         254   6e-76    
ref|XP_004977988.1|  PREDICTED: WAT1-related protein At1g09380-like     254   7e-76    
ref|XP_009341323.1|  PREDICTED: WAT1-related protein At1g25270-like     254   7e-76    
ref|XP_006586353.1|  PREDICTED: WAT1-related protein At1g25270          254   8e-76    
ref|XP_006851393.1|  hypothetical protein AMTR_s00040p00037300          253   9e-76    
ref|XP_003526345.1|  PREDICTED: WAT1-related protein At5g07050-like     254   1e-75    
ref|XP_006351047.1|  PREDICTED: WAT1-related protein At1g68170-like     254   1e-75    
ref|XP_004499808.1|  PREDICTED: WAT1-related protein At5g07050-like     254   1e-75    
ref|XP_008655310.1|  PREDICTED: uncharacterized protein LOC100384...    254   1e-75    
ref|XP_002534629.1|  Auxin-induced protein 5NG4, putative               254   1e-75    
ref|XP_010312462.1|  PREDICTED: WAT1-related protein At1g68170          253   2e-75    
ref|XP_010053988.1|  PREDICTED: WAT1-related protein At1g43650-like     253   2e-75    
ref|XP_004309044.1|  PREDICTED: auxin-induced protein 5NG4-like         253   2e-75    
emb|CDX70003.1|  BnaA10g23520D                                          254   2e-75    
ref|XP_010649471.1|  PREDICTED: WAT1-related protein At1g68170-like     254   2e-75    
ref|XP_009373689.1|  PREDICTED: WAT1-related protein At1g43650-like     253   2e-75    
ref|XP_004493327.1|  PREDICTED: WAT1-related protein At5g07050-li...    254   2e-75    
ref|XP_010053986.1|  PREDICTED: WAT1-related protein At1g43650-like     252   3e-75    
ref|NP_001240227.1|  uncharacterized protein LOC100791663               252   3e-75    
ref|NP_001150619.1|  nodulin-like protein                               254   3e-75    
ref|XP_006430497.1|  hypothetical protein CICLE_v10012013mg             253   3e-75    
gb|ACL54205.1|  unknown                                                 254   3e-75    
ref|XP_004230592.1|  PREDICTED: WAT1-related protein At1g68170-li...    253   3e-75    
ref|XP_009601128.1|  PREDICTED: WAT1-related protein At1g68170-like     253   3e-75    
ref|XP_004167156.1|  PREDICTED: auxin-induced protein 5NG4-like         253   3e-75    
ref|XP_007148806.1|  hypothetical protein PHAVU_005G015900g             253   4e-75    
gb|KGN59418.1|  hypothetical protein Csa_3G818270                       253   4e-75    
ref|XP_004136769.1|  PREDICTED: auxin-induced protein 5NG4-like         253   4e-75    
ref|XP_008437465.1|  PREDICTED: LOW QUALITY PROTEIN: WAT1-related...    252   4e-75    
ref|XP_008443233.1|  PREDICTED: WAT1-related protein At5g07050-like     253   5e-75    
ref|XP_002308862.2|  hypothetical protein POPTR_0006s03200g             253   5e-75    
ref|XP_009373690.1|  PREDICTED: WAT1-related protein At5g64700-like     252   5e-75    
ref|XP_007159057.1|  hypothetical protein PHAVU_002G204700g             251   5e-75    
ref|XP_004145962.1|  PREDICTED: auxin-induced protein 5NG4-like         251   5e-75    
ref|XP_002271697.1|  PREDICTED: WAT1-related protein At1g68170          253   6e-75    
ref|XP_004309563.1|  PREDICTED: auxin-induced protein 5NG4-like         251   6e-75    
ref|XP_006851384.1|  hypothetical protein AMTR_s00040p00026230          251   6e-75    
ref|XP_009122385.1|  PREDICTED: WAT1-related protein At5g07050          252   7e-75    
emb|CAB53493.1|  CAA303720.1 protein                                    251   8e-75    
ref|XP_006846978.1|  hypothetical protein AMTR_s00017p00096360          252   9e-75    
ref|XP_008375451.1|  PREDICTED: WAT1-related protein At3g30340          251   9e-75    
ref|XP_010649431.1|  PREDICTED: WAT1-related protein At1g68170-like     252   1e-74    
ref|XP_007153065.1|  hypothetical protein PHAVU_003G003600g             251   1e-74    
ref|XP_002873292.1|  hypothetical protein ARALYDRAFT_487525             252   1e-74    
ref|XP_006359736.1|  PREDICTED: WAT1-related protein At1g25270-like     252   1e-74    
ref|XP_006491840.1|  PREDICTED: WAT1-related protein At1g68170-li...    249   1e-74    
ref|XP_007048228.1|  Auxin-induced protein 5NG4, putative               251   2e-74    
ref|XP_010260942.1|  PREDICTED: WAT1-related protein At1g43650          250   2e-74    
ref|XP_010553571.1|  PREDICTED: WAT1-related protein At3g30340-like     250   2e-74    
gb|ADN33888.1|  nodulin-like protein                                    251   2e-74    
ref|XP_003531263.1|  PREDICTED: WAT1-related protein At3g30340-like     250   2e-74    
ref|XP_009360236.1|  PREDICTED: WAT1-related protein At3g30340-like     250   2e-74    
gb|AFW82369.1|  hypothetical protein ZEAMMB73_445023                    251   2e-74    
ref|XP_004309506.1|  PREDICTED: auxin-induced protein 5NG4-like         251   2e-74    
ref|XP_002441090.1|  hypothetical protein SORBIDRAFT_09g020200          251   2e-74    
gb|EMT23415.1|  Auxin-induced protein 5NG4                              250   3e-74    
ref|XP_004309502.1|  PREDICTED: auxin-induced protein 5NG4-like         249   3e-74    
emb|CBI37617.3|  unnamed protein product                                252   3e-74    
ref|XP_010107109.1|  Auxin-induced protein 5NG4                         249   3e-74    
ref|XP_010673090.1|  PREDICTED: WAT1-related protein At5g07050          251   3e-74    
emb|CBI37618.3|  unnamed protein product                                252   4e-74    
ref|XP_010423261.1|  PREDICTED: WAT1-related protein At5g07050          251   4e-74    
ref|XP_011070425.1|  PREDICTED: WAT1-related protein At4g01440-like     249   4e-74    
gb|KDP40571.1|  hypothetical protein JCGZ_24570                         250   5e-74    
ref|XP_008654546.1|  PREDICTED: hypothetical protein isoform X8         248   6e-74    
emb|CAH58631.1|  nodulin-like protein                                   249   6e-74    
ref|XP_002271832.1|  PREDICTED: WAT1-related protein At1g68170          250   6e-74    
ref|XP_008445949.1|  PREDICTED: WAT1-related protein At5g07050          249   6e-74    
ref|XP_008443232.1|  PREDICTED: WAT1-related protein At5g07050-like     249   7e-74    
gb|EYU35603.1|  hypothetical protein MIMGU_mgv1a008329mg                249   7e-74    
emb|CBI27639.3|  unnamed protein product                                254   8e-74    
ref|XP_004962102.1|  PREDICTED: WAT1-related protein At5g07050-like     250   8e-74    
ref|XP_007224835.1|  hypothetical protein PRUPE_ppa023190mg             249   9e-74    
gb|EEE54395.1|  hypothetical protein OsJ_01416                          247   1e-73    
ref|XP_009403831.1|  PREDICTED: WAT1-related protein At5g07050-like     250   1e-73    
ref|XP_010111209.1|  Auxin-induced protein 5NG4                         249   1e-73    
ref|XP_007048229.1|  Auxin-induced protein 5NG4, putative isoform 1     248   1e-73    
gb|KDP22890.1|  hypothetical protein JCGZ_01964                         248   2e-73    
ref|XP_010522881.1|  PREDICTED: WAT1-related protein At4g01440-li...    248   2e-73    
ref|XP_008788560.1|  PREDICTED: WAT1-related protein At5g07050-like     249   2e-73    
ref|XP_006289728.1|  hypothetical protein CARUB_v10003296mg             248   2e-73    
ref|XP_002323220.2|  hypothetical protein POPTR_0016s03120g             249   2e-73    
ref|XP_003568462.2|  PREDICTED: WAT1-related protein At5g07050-like     249   2e-73    
ref|XP_006588352.1|  PREDICTED: WAT1-related protein At3g30340-like     248   2e-73    
ref|XP_004151540.1|  PREDICTED: auxin-induced protein 5NG4-like         248   3e-73    
gb|EEC79453.1|  hypothetical protein OsI_20446                          248   3e-73    
ref|NP_001055921.1|  Os05g0493800                                       248   3e-73    
gb|KCW63050.1|  hypothetical protein EUGRSUZ_G00635                     247   3e-73    
ref|XP_004504932.1|  PREDICTED: WAT1-related protein At1g25270-like     247   4e-73    
ref|XP_007218191.1|  hypothetical protein PRUPE_ppa007702mg             247   4e-73    
emb|CBI37620.3|  unnamed protein product                                249   4e-73    
ref|XP_003551846.1|  PREDICTED: WAT1-related protein At1g25270-like     247   4e-73    
ref|XP_007039295.1|  Nodulin MtN21 /EamA-like transporter family ...    247   4e-73    
ref|XP_002458648.1|  hypothetical protein SORBIDRAFT_03g037390          248   5e-73    
emb|CBI37614.3|  unnamed protein product                                247   5e-73    
ref|XP_010244423.1|  PREDICTED: WAT1-related protein At5g07050          247   7e-73    
ref|XP_002277208.1|  PREDICTED: WAT1-related protein At1g68170-like     247   8e-73    
gb|KHN48009.1|  Auxin-induced protein 5NG4                              246   8e-73    
ref|XP_003581228.1|  PREDICTED: WAT1-related protein At1g68170-like     246   9e-73    
ref|XP_003535764.2|  PREDICTED: WAT1-related protein At3g30340-like     245   9e-73    
gb|EMT14666.1|  Auxin-induced protein 5NG4                              247   1e-72    
gb|EYU18591.1|  hypothetical protein MIMGU_mgv1a007543mg                247   1e-72    
ref|XP_009360245.1|  PREDICTED: WAT1-related protein At1g43650-like     246   1e-72    
ref|XP_010278027.1|  PREDICTED: WAT1-related protein At4g30420-like     246   1e-72    
ref|XP_004307206.1|  PREDICTED: auxin-induced protein 5NG4-like         247   1e-72    
ref|XP_010055591.1|  PREDICTED: WAT1-related protein At5g07050-like     247   1e-72    
ref|XP_006838306.1|  hypothetical protein AMTR_s00103p00126500          245   1e-72    
ref|XP_007039289.1|  Nodulin MtN21 /EamA-like transporter family ...    246   1e-72    
ref|XP_006339335.1|  PREDICTED: WAT1-related protein At5g07050-like     245   1e-72    
ref|XP_009341319.1|  PREDICTED: WAT1-related protein At1g25270-like     245   2e-72    
gb|KHN37373.1|  Auxin-induced protein 5NG4                              244   2e-72    
ref|XP_008378848.1|  PREDICTED: WAT1-related protein At1g25270-like     244   2e-72    
gb|KEH31275.1|  nodulin MtN21/EamA-like transporter family protein      245   3e-72    
ref|XP_004243056.1|  PREDICTED: WAT1-related protein At1g25270-like     245   3e-72    
ref|XP_006606618.1|  PREDICTED: WAT1-related protein At3g30340-like     245   3e-72    
ref|XP_006493303.1|  PREDICTED: WAT1-related protein At1g68170-like     245   3e-72    
ref|XP_010938846.1|  PREDICTED: WAT1-related protein At5g07050-like     246   4e-72    
ref|XP_007162036.1|  hypothetical protein PHAVU_001G118300g             246   4e-72    
ref|XP_008218842.1|  PREDICTED: WAT1-related protein At1g68170-like     245   4e-72    
ref|XP_004308749.1|  PREDICTED: auxin-induced protein 5NG4-like         244   4e-72    
ref|XP_011020462.1|  PREDICTED: WAT1-related protein At5g07050          245   5e-72    
gb|EYU26922.1|  hypothetical protein MIMGU_mgv1a007458mg                245   5e-72    
gb|KHG30626.1|  Auxin-induced 5NG4                                      244   6e-72    
gb|KEH31270.1|  nodulin MtN21/EamA-like transporter family protein      244   6e-72    
ref|XP_008795134.1|  PREDICTED: WAT1-related protein At5g07050-like     244   8e-72    
ref|XP_002271731.3|  PREDICTED: LOW QUALITY PROTEIN: WAT1-related...    244   9e-72    
ref|XP_010673219.1|  PREDICTED: WAT1-related protein At1g68170-like     243   9e-72    
ref|XP_011079091.1|  PREDICTED: WAT1-related protein At5g07050-like     244   9e-72    
emb|CDO97497.1|  unnamed protein product                                244   9e-72    
gb|KHG09563.1|  Auxin-induced 5NG4                                      245   1e-71    
ref|XP_006441413.1|  hypothetical protein CICLE_v10023533mg             243   1e-71    
ref|XP_002270961.1|  PREDICTED: WAT1-related protein At3g30340 is...    243   1e-71    
ref|XP_003523924.1|  PREDICTED: WAT1-related protein At5g07050-like     244   1e-71    
ref|XP_006351822.1|  PREDICTED: WAT1-related protein At1g68170-like     244   1e-71    
ref|XP_004498117.1|  PREDICTED: WAT1-related protein At3g30340-li...    242   2e-71    
ref|XP_006453494.1|  hypothetical protein CICLE_v10008665mg             243   2e-71    
ref|XP_010542799.1|  PREDICTED: WAT1-related protein At4g01440-like     242   2e-71    
ref|XP_011004369.1|  PREDICTED: WAT1-related protein At5g07050-li...    242   2e-71    
ref|XP_003628011.1|  Auxin-induced protein 5NG4                         243   2e-71    
ref|XP_010067678.1|  PREDICTED: WAT1-related protein At5g07050          243   2e-71    
ref|XP_004511088.1|  PREDICTED: WAT1-related protein At5g07050-like     243   3e-71    
ref|NP_196322.3|  nodulin MtN21 /EamA-like transporter family pro...    243   3e-71    
ref|XP_010241742.1|  PREDICTED: WAT1-related protein At1g43650-like     242   3e-71    
ref|XP_006856804.1|  hypothetical protein AMTR_s00055p00139380          242   3e-71    
ref|XP_007159055.1|  hypothetical protein PHAVU_002G204600g             243   4e-71    
ref|XP_006370734.1|  hypothetical protein POPTR_0001s45730g             243   4e-71    
gb|EEC77267.1|  hypothetical protein OsI_15886                          242   4e-71    
gb|KEH31268.1|  auxin-induced 5NG4-like protein                         241   5e-71    
ref|XP_007218075.1|  hypothetical protein PRUPE_ppa006848mg             242   5e-71    
gb|AES62961.2|  nodulin MtN21/EamA-like transporter family protein      241   5e-71    
dbj|BAK00515.1|  predicted protein                                      241   5e-71    
ref|XP_008810183.1|  PREDICTED: WAT1-related protein At5g07050-like     243   5e-71    
ref|XP_006441412.1|  hypothetical protein CICLE_v10020812mg             241   6e-71    
ref|XP_006474092.1|  PREDICTED: WAT1-related protein At4g30420-like     243   6e-71    
ref|XP_002283348.1|  PREDICTED: WAT1-related protein At5g07050          242   7e-71    
gb|KDO48741.1|  hypothetical protein CISIN_1g018219mg                   241   7e-71    
ref|XP_008244228.1|  PREDICTED: WAT1-related protein At3g30340-like     241   7e-71    
gb|KEH31266.1|  auxin-induced 5NG4-like protein                         241   7e-71    
ref|XP_004252899.1|  PREDICTED: WAT1-related protein At3g30340-like     241   8e-71    
ref|XP_010556632.1|  PREDICTED: WAT1-related protein At4g01440-like     241   8e-71    
ref|XP_010260949.1|  PREDICTED: WAT1-related protein At5g64700-like     240   8e-71    
ref|XP_006491839.1|  PREDICTED: WAT1-related protein At1g68170-li...    241   9e-71    
ref|XP_004249326.1|  PREDICTED: WAT1-related protein At5g07050          241   9e-71    
ref|XP_007133643.1|  hypothetical protein PHAVU_011G196800g             241   9e-71    
ref|XP_010906409.1|  PREDICTED: WAT1-related protein At5g07050-like     241   1e-70    
ref|XP_011085946.1|  PREDICTED: WAT1-related protein At5g07050          241   1e-70    
ref|XP_003566095.1|  PREDICTED: WAT1-related protein At5g07050-like     241   1e-70    
ref|XP_002267371.1|  PREDICTED: WAT1-related protein At5g07050          241   1e-70    
ref|XP_002515123.1|  Auxin-induced protein 5NG4, putative               241   1e-70    
ref|XP_007139152.1|  hypothetical protein PHAVU_008G005700g             239   1e-70    
ref|XP_002317651.2|  hypothetical protein POPTR_0011s15150g             240   2e-70    
ref|XP_002277147.1|  PREDICTED: WAT1-related protein At1g68170-like     239   2e-70    
ref|XP_011087820.1|  PREDICTED: WAT1-related protein At1g25270-li...    239   2e-70    



>dbj|BAF46315.1| nodulin-like protein [Ipomoea nil]
Length=255

 Score =   528 bits (1360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/255 (100%), Positives = 255/255 (100%), Gaps = 0/255 (0%)
 Frame = +2

Query  524   MIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNA  703
             MIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNA
Sbjct  1     MIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNA  60

Query  704   QPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHK  883
             QPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHK
Sbjct  61    QPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHK  120

Query  884   PTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGL  1063
             PTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGL
Sbjct  121   PTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGL  180

Query  1064  LQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELEL  1243
             LQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELEL
Sbjct  181   LQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELEL  240

Query  1244  SAHSIITVDQFPKKN  1288
             SAHSIITVDQFPKKN
Sbjct  241   SAHSIITVDQFPKKN  255



>ref|XP_004230332.1| PREDICTED: WAT1-related protein At1g09380-like [Solanum lycopersicum]
Length=358

 Score =   511 bits (1315),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 241/359 (67%), Positives = 298/359 (83%), Gaps = 6/359 (2%)
 Frame = +2

Query  155   MGVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERR  334
             MG DLL L+ M+IVQLGYA MNIISKLAMDSGMNPFVHVAYRQ+FA++AIAP AYF ER+
Sbjct  1     MGNDLLPLLTMVIVQLGYAGMNIISKLAMDSGMNPFVHVAYRQIFATIAIAPFAYFLERK  60

Query  335   IRPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGI  514
              RP++T SILF IFLCSIFG+S+NQITYFVGLKN+TPTI+CAL+NL PAVT+LLA+PFG+
Sbjct  61    TRPKLTPSILFQIFLCSIFGVSMNQITYFVGLKNTTPTISCALSNLTPAVTFLLAIPFGL  120

Query  515   EKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGS  694
             E++ + + AG+AK++GTILCVGGAMLLSFYHG  + I + +IHWKYA     Q+   N S
Sbjct  121   ERVGLGSKAGQAKMLGTILCVGGAMLLSFYHGSIVPIDQPNIHWKYA-----QDMTQNKS  175

Query  695   TNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICF  874
             T    NFILGPFL+I+SA+SW IWSI+Q ++S  Y APYSS+ALMC M+S QCV+  ICF
Sbjct  176   TTTHENFILGPFLLIISAVSWGIWSILQAKLSMVYAAPYSSSALMCLMASFQCVIVGICF  235

Query  875   DHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLS  1054
             DH  +DWSL   IRA S++Y+G+V TALAYCLMSWCIE+KGPLYVSVFNPLLLVIVA+LS
Sbjct  236   DHNISDWSLSHSIRAVSSIYSGVVCTALAYCLMSWCIERKGPLYVSVFNPLLLVIVAILS  295

Query  1055  WGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLE  1231
             WG+LQ+KIY+GT++GS+LIV+GLYGVLWGK  EL+++  +  DEE    E E ++  +E
Sbjct  296   WGVLQEKIYIGTVIGSILIVLGLYGVLWGKNNELKLLP-IEFDEEIGDIEKEKQKKDME  353



>ref|XP_006344799.1| PREDICTED: WAT1-related protein At1g09380-like isoform X1 [Solanum 
tuberosum]
Length=357

 Score =   510 bits (1313),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 242/359 (67%), Positives = 297/359 (83%), Gaps = 7/359 (2%)
 Frame = +2

Query  155   MGVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERR  334
             MG DLL  + M+IVQLGYA MNIISKLAMDSGMNPFVHVAYRQ+FA++AIAP AYF ER+
Sbjct  1     MGNDLLPFLTMVIVQLGYAGMNIISKLAMDSGMNPFVHVAYRQIFATIAIAPFAYFLERK  60

Query  335   IRPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGI  514
              RP++T SILF IFLCSIFG+S+NQITYFVGLKN+TPTI+CAL+NL PAVT+LLA+PFG+
Sbjct  61    TRPKLTPSILFQIFLCSIFGVSMNQITYFVGLKNTTPTISCALSNLTPAVTFLLAIPFGL  120

Query  515   EKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGS  694
             E++ + + AG+AK++GTILCVGGAMLLSFYHG  + I + +IHWKYA     Q+   N S
Sbjct  121   ERVGLGSKAGQAKMLGTILCVGGAMLLSFYHGSIVPIDQPNIHWKYA-----QDMTQNKS  175

Query  695   TNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICF  874
             T +  NFILGPFL+I+SA+SW IWSI+Q ++S  Y APYSS+ALMC M+S QCV+  ICF
Sbjct  176   TTSHGNFILGPFLLIISAVSWGIWSILQAKLSMVYAAPYSSSALMCLMASFQCVIVGICF  235

Query  875   DHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLS  1054
             DH  +DWSL   IRA S++Y+G+V TALAYCLMSWCIE+KGPLYVSVFNPLLLVIVA+LS
Sbjct  236   DHNISDWSLSHSIRAVSSIYSGVVCTALAYCLMSWCIERKGPLYVSVFNPLLLVIVAILS  295

Query  1055  WGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLE  1231
             WGLLQ+KIY+GT+VGS+LIV+GLYGVLWGK  EL++   +  DEE    E E ++  +E
Sbjct  296   WGLLQEKIYIGTVVGSILIVLGLYGVLWGKNNELKL--PIEFDEEIGDIEKEKQKKDME  352



>ref|XP_009794409.1| PREDICTED: WAT1-related protein At1g09380-like [Nicotiana sylvestris]
Length=370

 Score =   506 bits (1302),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 242/363 (67%), Positives = 295/363 (81%), Gaps = 8/363 (2%)
 Frame = +2

Query  164   DLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRP  343
             DLL  + M+IVQLGYA MNIISKLAMDSGMNPFVHVAYRQ+FA+++IAP AYF ER+ RP
Sbjct  5     DLLPFLTMVIVQLGYAGMNIISKLAMDSGMNPFVHVAYRQIFATISIAPFAYFLERKTRP  64

Query  344   QMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKL  523
             ++T SILF IFLCSIFG+S+NQITYFVGLKN+TPTIACAL+NL PAVT+LLA+PFG+E++
Sbjct  65    KLTPSILFQIFLCSIFGVSMNQITYFVGLKNTTPTIACALSNLTPAVTFLLAIPFGLERV  124

Query  524   MIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNA  703
              + T AG+AK++GTILCVGGAMLLSFYHG  + I + +IHWKYA  ++    +N  STN 
Sbjct  125   GLGTKAGQAKMLGTILCVGGAMLLSFYHGSIVPIDQPNIHWKYAQDMT----ENKSSTN-  179

Query  704   QPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHK  883
               NF+LGPFL+IVSA+SW +WSI+Q RVS  Y APYSS+ALMC M+S QC++   CFDH 
Sbjct  180   HGNFMLGPFLLIVSAVSWGVWSILQARVSMDYAAPYSSSALMCLMASFQCLIVGFCFDHN  239

Query  884   PTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGL  1063
              +DWSLR  IRA SA+YAG+V TALAYCLMSWCIE+KGPLYVSVFNPLLLVIVA+LSW L
Sbjct  240   LSDWSLRHSIRAVSAIYAGVVCTALAYCLMSWCIERKGPLYVSVFNPLLLVIVAILSWAL  299

Query  1064  LQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELEL  1243
             LQ+KIY+GT+VGSVLIV+GLYGVLWGK  E++ I     DEE        KE   +++ +
Sbjct  300   LQEKIYIGTVVGSVLIVLGLYGVLWGKNNEMKPI---KFDEEIGAEINGDKEKEKKDMAM  356

Query  1244  SAH  1252
               +
Sbjct  357   QLY  359



>ref|XP_009629514.1| PREDICTED: WAT1-related protein At1g09380-like [Nicotiana tomentosiformis]
Length=370

 Score =   503 bits (1296),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 240/342 (70%), Positives = 288/342 (84%), Gaps = 8/342 (2%)
 Frame = +2

Query  164   DLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRP  343
             DLL  + M+IVQLGYA MNIISKLAMDSGMNPFVHVAYRQ+FA+++IAP AYF ER+ RP
Sbjct  5     DLLPFLTMVIVQLGYAGMNIISKLAMDSGMNPFVHVAYRQIFATISIAPFAYFLERKTRP  64

Query  344   QMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKL  523
             ++T SILF IFLCSIFG+S+NQITYFVGLKN+TPTIACAL+NL PAVT+LLA+PFG+E++
Sbjct  65    KLTPSILFQIFLCSIFGVSMNQITYFVGLKNTTPTIACALSNLTPAVTFLLAIPFGLERV  124

Query  524   MIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNA  703
              + T AG+AK++GTILCVGGAMLLSFYHG  + I + +IHWKYA  ++    +N  STN 
Sbjct  125   GLGTKAGQAKMLGTILCVGGAMLLSFYHGSIVPIDQPNIHWKYAQDMT----ENKSSTN-  179

Query  704   QPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHK  883
               NF+LGPFL+IVSA+SW +WSI+Q RVS  Y APYSS+ALMC M+S QC++   CFDH 
Sbjct  180   HGNFMLGPFLLIVSAVSWGVWSILQARVSMDYAAPYSSSALMCLMASFQCLIIGFCFDHN  239

Query  884   PTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGL  1063
              +DWSLR  IRA SA+YAG+V TALAYCLMSWCIE+KGPLYVSVFNPLLLVIVA+LSW L
Sbjct  240   LSDWSLRHSIRAVSAIYAGVVCTALAYCLMSWCIERKGPLYVSVFNPLLLVIVAILSWAL  299

Query  1064  LQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEE  1189
             LQ+KIY+GT+VGSVLIV+GLYGVLWGK  E++ I     DEE
Sbjct  300   LQEKIYIGTVVGSVLIVLGLYGVLWGKNNEMKPI---KFDEE  338



>ref|XP_011087522.1| PREDICTED: WAT1-related protein At1g09380 [Sesamum indicum]
Length=368

 Score =   498 bits (1281),  Expect = 8e-171, Method: Compositional matrix adjust.
 Identities = 244/371 (66%), Positives = 296/371 (80%), Gaps = 11/371 (3%)
 Frame = +2

Query  164   DLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRP  343
             DLL  + M+IVQLGYA MNIISKLAMDSGMNPFVHVAYRQ+FA+VAIAP AYF ER+ RP
Sbjct  4     DLLPFLAMVIVQLGYAGMNIISKLAMDSGMNPFVHVAYRQVFATVAIAPFAYFMERKTRP  63

Query  344   QMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKL  523
             +MTLSI F+IFLCSIFG+++NQITYFVGLKNSTPTIACALTN+ PAVT+++A+PF +EKL
Sbjct  64    KMTLSIFFHIFLCSIFGVTVNQITYFVGLKNSTPTIACALTNINPAVTFIMALPFRLEKL  123

Query  524   MIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNA  703
              +++ AG+AK++GTI+CVGGA+LLSFYHG  + IGESSIHW YA    + N  N+     
Sbjct  124   GVKSKAGQAKILGTIVCVGGALLLSFYHGSAVDIGESSIHWNYAHKTGTNNSINH-----  178

Query  704   QPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHK  883
               N ILGPFL+IVSA+SWA+W IIQTRVS+KY APYSS+ALMC M+S+QCV+    FDH 
Sbjct  179   -VNLILGPFLLIVSAVSWAVWLIIQTRVSQKYAAPYSSSALMCLMASVQCVIVGFSFDHN  237

Query  884   PTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGL  1063
              + WSL   IR  S+VYAGIV +ALA+CLMSWCIE+KGPLYVSVF+PLLLVIVAVLSW L
Sbjct  238   LSAWSLSPSIRIVSSVYAGIVCSALAFCLMSWCIERKGPLYVSVFSPLLLVIVAVLSWAL  297

Query  1064  LQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELEL  1243
             L++K+YVGT+ GSVLIV+GLYGVLWGK +E+    + H+  EE     +T    LE L  
Sbjct  298   LEEKLYVGTVGGSVLIVLGLYGVLWGKNREMS--SIYHI--EEVDKATQTTAYDLESLS-  352

Query  1244  SAHSIITVDQF  1276
             S  S   +D F
Sbjct  353   SHQSKSGIDAF  363



>gb|EYU19418.1| hypothetical protein MIMGU_mgv1a009113mg [Erythranthe guttata]
Length=353

 Score =   493 bits (1269),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 235/359 (65%), Positives = 294/359 (82%), Gaps = 9/359 (3%)
 Frame = +2

Query  164   DLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRP  343
             DL   + M+IVQLGYA MNIISK+AMDSGMNP+VHVAYRQ+FA++AIAP AYF ER+ RP
Sbjct  4     DLFPFLTMVIVQLGYAGMNIISKVAMDSGMNPYVHVAYRQVFATIAIAPFAYFMERKTRP  63

Query  344   QMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKL  523
             +MT SI F IFLCSIFG+++NQITYFVGLKNSTPTIACALTN+ PAVT+++AVPFG+EK+
Sbjct  64    KMTASIFFQIFLCSIFGVTVNQITYFVGLKNSTPTIACALTNINPAVTFIMAVPFGLEKV  123

Query  524   MIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNA  703
              +++ AG+AKV+GTI+CVGGA+LLSFYHG  + IG+SSIHWKYA+   +++  N+     
Sbjct  124   GVKSKAGQAKVMGTIICVGGALLLSFYHGSIVDIGKSSIHWKYAEQTGTKSSINH-----  178

Query  704   QPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHK  883
               NFILGP L+IVSA+SWAIW IIQTRVS+KY APYSS+ALMC M++ QCV+ A  FDH 
Sbjct  179   -VNFILGPILLIVSAISWAIWLIIQTRVSQKYGAPYSSSALMCLMATFQCVVVAFFFDHN  237

Query  884   PTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGL  1063
              + WSL   IR  S+VY+GIV +ALA+CLMSWCIE+KGPLYVSVF+PLLLVIVA+LSW L
Sbjct  238   LSAWSLTSNIRIISSVYSGIVCSALAFCLMSWCIERKGPLYVSVFSPLLLVIVAILSWAL  297

Query  1064  LQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELE  1240
             L++K++VGT+ GSVLIV+GLYGVLWGK +E+    + H++EE A  +     D LE L 
Sbjct  298   LEEKLFVGTVAGSVLIVLGLYGVLWGKNREMS--SIYHIEEEAAEKKATPIYD-LESLS  353



>emb|CDP15218.1| unnamed protein product [Coffea canephora]
Length=367

 Score =   474 bits (1219),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 223/364 (61%), Positives = 289/364 (79%), Gaps = 14/364 (4%)
 Frame = +2

Query  155   MGVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERR  334
             M    L  + M+I+QLGYA MNI+SKLAMDSGMNPFVHVAYRQLFA+++IAP AYF ER 
Sbjct  1     MAGGFLPFLTMVILQLGYAGMNIVSKLAMDSGMNPFVHVAYRQLFATLSIAPFAYFLERE  60

Query  335   IRPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGI  514
              RP++T SILF+IF+CS+FG ++NQITYFVGLKNS+PTIACAL+NL PAVT++LAVP G+
Sbjct  61    TRPRLTFSILFHIFMCSVFGATVNQITYFVGLKNSSPTIACALSNLSPAVTFILAVPLGL  120

Query  515   EKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGS  694
             E   +R  AG+AKV+GT++CVGGA+LLSFYHG  +G+G+S IHWK+AD+L ++   N+  
Sbjct  121   ESAGLRAKAGQAKVLGTVVCVGGAILLSFYHGPVVGVGQSRIHWKFADNLRNKTVSNH--  178

Query  695   TNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICF  874
                  NF+LGPF++I S++SWA+W IIQ RV + Y APYSS+AL CFM+SIQC +   CF
Sbjct  179   ----VNFVLGPFMLIASSVSWAVWLIIQARVGKMYAAPYSSSALTCFMASIQCAIIGFCF  234

Query  875   DHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLS  1054
             DH  + WSL   IRA S++YAGIV TALA+CLMSWCIE+KGPLYVSVF+PLLLVIVA+LS
Sbjct  235   DHHLSAWSLYPAIRAVSSIYAGIVCTALAFCLMSWCIERKGPLYVSVFSPLLLVIVAILS  294

Query  1055  WGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVET-KEDHLE  1231
             W +LQ+K+Y+G ++GS LIV+GLY VLWGK +E++         +    EV++ K+  +E
Sbjct  295   WAILQEKLYIGMVIGSTLIVMGLYCVLWGKNEEMK-------PTKTPDQEVDSGKQFTME  347

Query  1232  ELEL  1243
             +LEL
Sbjct  348   DLEL  351



>ref|XP_006417578.1| hypothetical protein EUTSA_v10007900mg [Eutrema salsugineum]
 gb|ESQ35931.1| hypothetical protein EUTSA_v10007900mg [Eutrema salsugineum]
Length=385

 Score =   444 bits (1142),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 207/361 (57%), Positives = 275/361 (76%), Gaps = 11/361 (3%)
 Frame = +2

Query  164   DLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRP  343
             DLL  + M++VQ+GYA MNI SK+AMDSGM P + VAYRQ+FA++A  P+AYF ER+ RP
Sbjct  6     DLLPSLAMVLVQIGYAGMNITSKMAMDSGMKPLILVAYRQIFATIATFPVAYFIERKTRP  65

Query  344   QMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKL  523
             ++TL +L  +F CSI G + NQ+ YF+GL+NS+PTIACALTNL+PAVT++LA  F  E +
Sbjct  66    KITLRVLVQVFFCSITGATGNQVLYFIGLQNSSPTIACALTNLLPAVTFILAAIFRQEAV  125

Query  524   MIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNA  703
              I+ A+G+AKV+GT++CV GAM+LSFYHGH IGIGES IHW YA +++S   D+ GS   
Sbjct  126   GIKKASGQAKVIGTVVCVAGAMVLSFYHGHTIGIGESKIHWGYAQNITSHGPDSTGS---  182

Query  704   QPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHK  883
               NF LGPFLI+ +A+SWA+W IIQT++SE + APY+ST LMC M SIQC   A+  DHK
Sbjct  183   --NFFLGPFLIMAAAVSWAVWFIIQTKMSETFAAPYTSTLLMCLMGSIQCGAIALISDHK  240

Query  884   PTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGL  1063
              +DWSL   IR  SA+YAG+V +ALA+CLMSW I+ KGPLYVSVF+PLLLV+VAV SW  
Sbjct  241   LSDWSLTSPIRLISALYAGVVASALAFCLMSWAIQLKGPLYVSVFSPLLLVVVAVFSWTF  300

Query  1064  LQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELEL  1243
             L++K+Y GT VGS L+V+GLYGVLWGK +E+      +  EE   N+ + K+ H+ + ++
Sbjct  301   LEEKLYTGTFVGSALVVIGLYGVLWGKDREM------NGKEEGEENQKKVKQQHIVKRDI  354

Query  1244  S  1246
             +
Sbjct  355   N  355



>emb|CDX94976.1| BnaC05g06950D [Brassica napus]
Length=385

 Score =   442 bits (1138),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 203/354 (57%), Positives = 276/354 (78%), Gaps = 11/354 (3%)
 Frame = +2

Query  164   DLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRP  343
             DLL  + M++VQ+GYA MNI SK+AM+SGM P + VAYRQ+FA++A  P+A+F ER+ RP
Sbjct  6     DLLPSLAMVLVQIGYAGMNITSKMAMESGMKPLILVAYRQIFATIATFPVAFFLERKTRP  65

Query  344   QMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKL  523
             ++TL++L  IF CSI G++ NQ+ YF+GL+NS+PTIACALTNL+PAVT+LLA  F  E +
Sbjct  66    KITLTVLVQIFFCSITGVTGNQVLYFIGLQNSSPTIACALTNLLPAVTFLLAAIFRQEAV  125

Query  524   MIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNA  703
              IR A+G+AKV+GT++CV GAM+LSFYHGH IGIGES IHW YA ++++   D+NGS   
Sbjct  126   GIRKASGQAKVIGTVVCVAGAMVLSFYHGHTIGIGESKIHWAYAQNITNHGSDSNGS---  182

Query  704   QPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHK  883
               NF LGPF+I+ +A+SWA+W IIQT++SE + APY+ST LMC M SI+C   A+  DHK
Sbjct  183   --NFFLGPFMIMAAAVSWAVWFIIQTKMSETFAAPYTSTLLMCLMGSIECGGIALISDHK  240

Query  884   PTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGL  1063
               DWSL   +R  SA+YAG+V +ALA+CLMSW I+ KGPLYVSVF+PLLLV+VAV SW L
Sbjct  241   LADWSLSSPLRLISALYAGVVASALAFCLMSWAIQIKGPLYVSVFSPLLLVVVAVFSWTL  300

Query  1064  LQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDH  1225
             L++K+Y GT +GS L+V+GLYGVLWGK +E+      + +++E  N+ + K+++
Sbjct  301   LEEKLYTGTFMGSALVVIGLYGVLWGKDREM------NENQDEEENQKKVKQEY  348



>emb|CDX94974.1| BnaC05g06970D [Brassica napus]
Length=385

 Score =   441 bits (1134),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 202/359 (56%), Positives = 276/359 (77%), Gaps = 5/359 (1%)
 Frame = +2

Query  164   DLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRP  343
             DLL  + M++VQ+GYA MNI SK+AM+SGM P + VAYRQ+FA++A  P+A+F ER+ RP
Sbjct  6     DLLPSLAMVLVQIGYAGMNITSKMAMESGMKPLILVAYRQIFATIATFPVAFFLERKTRP  65

Query  344   QMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKL  523
             ++TL++L  IF CSI G++ NQ+ YF+GL+NS+PTIACALTNL+PAVT+LLA  F  E +
Sbjct  66    KITLTVLVQIFFCSITGVTGNQVLYFIGLQNSSPTIACALTNLLPAVTFLLAAIFRQEAV  125

Query  524   MIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNA  703
              IR A+G+AKV+GT++CV GAM+LSFYHGH IGIGES IHW YA ++++   D+NGS   
Sbjct  126   GIRKASGQAKVIGTVVCVAGAMVLSFYHGHTIGIGESKIHWAYAQNITNHGSDSNGS---  182

Query  704   QPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHK  883
               NF LGPF+I+ +A+SWA+W IIQT++SE + APY+ST LMC M SI+C   A+  DHK
Sbjct  183   --NFFLGPFMIMAAAVSWAVWFIIQTKMSETFAAPYTSTLLMCLMGSIECGGIALISDHK  240

Query  884   PTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGL  1063
               DWSL   +R  SA+YAG+V +ALA+CLMSW I+ KGPLYVSVF+PLLLV+VAV SW L
Sbjct  241   LADWSLSSPLRLISALYAGVVASALAFCLMSWAIQIKGPLYVSVFSPLLLVVVAVFSWTL  300

Query  1064  LQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELE  1240
             L++K+Y GT +GS L+V+GL+GVLWGK +E+        ++++ + +   K D  +++E
Sbjct  301   LEEKLYTGTFMGSALVVIGLFGVLWGKDREMNENQDQEDNQKKVKQQHTVKSDFKDDIE  359



>ref|XP_009148234.1| PREDICTED: WAT1-related protein At1g09380 [Brassica rapa]
Length=385

 Score =   438 bits (1127),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 204/343 (59%), Positives = 268/343 (78%), Gaps = 9/343 (3%)
 Frame = +2

Query  164   DLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRP  343
             DLL  + M++VQ+GYA MNI SK+AM+SGM P + VAYRQ+FA++A  P+A+F ER+ RP
Sbjct  6     DLLPSLAMVLVQIGYAGMNITSKMAMESGMKPLILVAYRQIFATIATFPVAFFLERKTRP  65

Query  344   QMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKL  523
             ++TL +L  IF CSI G++ NQ+ YF+GL+NS+PTIACALTNL+PAVT+LLA  F  E +
Sbjct  66    KITLRVLVQIFFCSITGVTGNQVLYFIGLQNSSPTIACALTNLLPAVTFLLAAIFRQEAV  125

Query  524   MIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNA  703
              IR A+G+AKV+GT++CV GAM+LSFYHGH IGIGES IHW YA ++++   D+NGS   
Sbjct  126   GIRKASGQAKVIGTVVCVAGAMVLSFYHGHTIGIGESKIHWAYAQNITNHGSDSNGS---  182

Query  704   QPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHK  883
               NF LGPF+I+ +A+SWA+W IIQT++SE + APY+ST LMC M SI+C   A+  DHK
Sbjct  183   --NFFLGPFMIMAAAVSWAVWFIIQTKMSETFAAPYTSTLLMCLMGSIECGGIALISDHK  240

Query  884   PTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGL  1063
               DWSL   +R  SA+YAG+V +ALA+CLMSW I+ KGPLYVSVF+PLLLV+VAV SW L
Sbjct  241   LADWSLSSPLRLISALYAGVVASALAFCLMSWAIQIKGPLYVSVFSPLLLVVVAVFSWTL  300

Query  1064  LQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEE  1192
             L++K+Y GT +GS L+V+GLYGVLWGK +E+      + DEEE
Sbjct  301   LEEKLYTGTFMGSALVVIGLYGVLWGKDREMN----ENQDEEE  339



>ref|XP_002277072.1| PREDICTED: WAT1-related protein At1g09380 [Vitis vinifera]
Length=356

 Score =   436 bits (1122),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 208/364 (57%), Positives = 269/364 (74%), Gaps = 17/364 (5%)
 Frame = +2

Query  155   MGVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERR  334
             MG D L  + M +VQ+GYA MNI  KLAMDSGMNPF+ VAYRQ+FA+VA+ P AYF ER+
Sbjct  1     MGGDYLPFLAMFLVQMGYAGMNIFVKLAMDSGMNPFILVAYRQIFATVAMIPFAYFLERK  60

Query  335   IRPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGI  514
              RP++T  +LF  FL SIFG +LNQI YF+GLK+S PT+ CA  NL PA+T+LLAVPF +
Sbjct  61    TRPKITRIVLFQAFLSSIFGATLNQILYFIGLKHSNPTLGCAFNNLFPAMTFLLAVPFRL  120

Query  515   EKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGS  694
             E + I+T  G+AKV+GT++C+GGAM+L+FY GH I IGES IHWKYA+ L +++  +   
Sbjct  121   ETVGIKTRPGQAKVLGTVVCIGGAMILTFYRGHAINIGESGIHWKYAEQLKTRDSQSGA-  179

Query  695   TNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICF  874
                  NFILGPFL+I S +SWAIW IIQ R+  K+ APY+S+ LMCFM+SI+C +  +  
Sbjct  180   -----NFILGPFLLITSCISWAIWFIIQGRMCVKFAAPYTSSTLMCFMASIECGVIGLFV  234

Query  875   DHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLS  1054
             DH+P+ WSL   IR  +A+Y+ IV TALA+CLMSW I++KGPLYVSVF+PLLLVIVA+LS
Sbjct  235   DHQPSAWSLNDSIRLIAALYSAIVCTALAFCLMSWTIQRKGPLYVSVFSPLLLVIVAILS  294

Query  1055  WGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEE  1234
             W LL+DK++ GT+VGS+ +V+GLY VLWGK K           EE  R   E  E+  E+
Sbjct  295   WALLRDKLHFGTVVGSLFVVLGLYAVLWGKGK-----------EENQRGSREEAEEGKED  343

Query  1235  LELS  1246
             LEL 
Sbjct  344   LELQ  347



>emb|CDY69907.1| BnaA06g37940D [Brassica napus]
Length=385

 Score =   437 bits (1125),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 203/343 (59%), Positives = 269/343 (78%), Gaps = 9/343 (3%)
 Frame = +2

Query  164   DLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRP  343
             DLL  + M++VQ+GYA MNI SK+AM+SGM P + VAYRQ+FA++A  P+A+F ER+ RP
Sbjct  6     DLLPSLAMVLVQIGYAGMNITSKMAMESGMKPLILVAYRQIFATIATFPVAFFLERKTRP  65

Query  344   QMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKL  523
             ++TL++L  IF CSI G++ NQ+ YF+GL+NS+PTIACALTNL+PAVT+LLA  F  E +
Sbjct  66    KITLTVLVQIFFCSITGVTGNQVLYFIGLQNSSPTIACALTNLLPAVTFLLAAIFRQEAV  125

Query  524   MIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNA  703
              IR A+G+AKV+GT++CV GAM+LSFYHGH IGIGES IHW YA ++++   D+NGS+  
Sbjct  126   GIRKASGQAKVIGTVVCVAGAMVLSFYHGHTIGIGESKIHWAYAQNITNHGSDSNGSS--  183

Query  704   QPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHK  883
                F LGPF+I+ +A+SWA+W IIQT++SE + APY+ST LMC M SI+C   A+  DHK
Sbjct  184   ---FFLGPFMIMAAAVSWAVWFIIQTKMSETFAAPYTSTLLMCLMGSIECGGIALISDHK  240

Query  884   PTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGL  1063
               DWSL   +R  SA+YAG+V +ALA+CLMSW I+ KGPLYVSVF+PLLLV+VAV SW L
Sbjct  241   LADWSLSSPLRLISALYAGVVASALAFCLMSWAIQIKGPLYVSVFSPLLLVVVAVFSWTL  300

Query  1064  LQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEE  1192
             L++K+Y GT +GS L+V+GLYGVLWGK +E+      + DEEE
Sbjct  301   LEEKLYTGTFMGSALVVIGLYGVLWGKDREMN----ENQDEEE  339



>gb|KDP23359.1| hypothetical protein JCGZ_23192 [Jatropha curcas]
Length=370

 Score =   435 bits (1119),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 214/361 (59%), Positives = 275/361 (76%), Gaps = 8/361 (2%)
 Frame = +2

Query  146   IDIMGVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFS  325
             +D++G DLL  + M++VQ G+A MNIISKLAMDSGM P V VAYRQ+FA++A+ P AYF 
Sbjct  1     MDVVG-DLLPFLAMVLVQFGFAGMNIISKLAMDSGMKPLVLVAYRQIFATIAMVPFAYFF  59

Query  326   ERRIRPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVP  505
             E + RP++T  +LF IF+CS+ G + NQ+ YF+GL+NSTPTI CALTN++PAVT++LAV 
Sbjct  60    EWKTRPKITKELLFQIFICSLTGATGNQVFYFIGLQNSTPTIGCALTNILPAVTFILAVL  119

Query  506   FGIEKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDN  685
                E + I+  +G+AK++GT +CVGGAMLLSFYHG  I +GESSIHWKYAD + SQN  N
Sbjct  120   LRQESVGIKKLSGQAKLLGTAICVGGAMLLSFYHGSRINVGESSIHWKYADDIGSQN-SN  178

Query  686   NGSTNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFA  865
             +GS   + NFILGP  I+ SA+ WAIW  IQ +VSEK+PAPY+ST L+CFM SIQCVL  
Sbjct  179   DGS---KSNFILGPLFILASAVCWAIWFTIQAKVSEKFPAPYTSTFLLCFMGSIQCVLIG  235

Query  866   ICFDHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVA  1045
                +H+  DWSLR   R  +A+YA IV +ALA+ L SW I+KKG LYVSVF+PLLLVIVA
Sbjct  236   FGANHEAADWSLRDPGRLVAALYAAIVCSALAFSLTSWSIQKKGALYVSVFSPLLLVIVA  295

Query  1046  VLSWGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDH  1225
             VLSW LL++K+YVGT+VGS LIV GLY VLWGK KE++   +  ++E EAR ++   E  
Sbjct  296   VLSWALLREKLYVGTVVGSALIVAGLYAVLWGKDKEMK---LKVIEEIEARKQINDLELQ  352

Query  1226  L  1228
             L
Sbjct  353   L  353



>ref|XP_010026174.1| PREDICTED: WAT1-related protein At1g09380-like [Eucalyptus grandis]
 gb|KCW58627.1| hypothetical protein EUGRSUZ_H01288 [Eucalyptus grandis]
Length=367

 Score =   433 bits (1114),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 203/371 (55%), Positives = 273/371 (74%), Gaps = 11/371 (3%)
 Frame = +2

Query  161   VDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIR  340
             VD +  + M+I+Q+GYA MNI SKLAMDSGMNPFV V YRQ+FA++A  P A   ER+ R
Sbjct  4     VDFMPFLAMVIIQVGYAGMNITSKLAMDSGMNPFVLVTYRQIFATLATVPFALILERKTR  63

Query  341   PQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEK  520
             P++T+ IL  IF+CS+ G  +NQ+ +F+GL NS+PTIACALTN++PA+T+L A+ F  E 
Sbjct  64    PKITMPILLQIFICSLTGAFMNQVFFFIGLNNSSPTIACALTNILPAMTFLFALIFRQES  123

Query  521   LMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTN  700
             L I++ AG+AKV+GT++CVGGAMLLSFYHG NIGIG S+IHWK+A+ ++ ++  N     
Sbjct  124   LGIKSRAGQAKVIGTLVCVGGAMLLSFYHGRNIGIGNSAIHWKFAEKMTDEHPTN-----  178

Query  701   AQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDH  880
              + NF LGPF I  S  +WA+W IIQ ++S K+PAPY++T LMC M+SI+CV+  +  +H
Sbjct  179   -KSNF-LGPFFIFASTAAWALWFIIQAKLSTKFPAPYTTTTLMCLMASIECVVVGVAVEH  236

Query  881   KPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWG  1060
                 WSL+ GIR  S VYAG V +ALA+C+M+WCIE+KGPLY SVF+PL+LVI AVLSW 
Sbjct  237   HVAAWSLKSGIRLISVVYAGFVCSALAFCVMTWCIERKGPLYTSVFSPLMLVITAVLSWA  296

Query  1061  LLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELE  1240
             LL++K++VGT+VGS+LI+VGLY VLWGK KE +   +     EE    V+ +E    EL+
Sbjct  297   LLREKLFVGTLVGSILIIVGLYSVLWGKDKEAKQANIT----EEMEAAVKNREKEDLELQ  352

Query  1241  LSAHSIITVDQ  1273
               AH     DQ
Sbjct  353   FQAHGNGGKDQ  363



>ref|XP_011038989.1| PREDICTED: WAT1-related protein At1g09380 [Populus euphratica]
Length=367

 Score =   433 bits (1113),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 215/365 (59%), Positives = 271/365 (74%), Gaps = 11/365 (3%)
 Frame = +2

Query  164   DLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRP  343
             D+L  + M IVQ GYA MNI SKLAMDSGM P V V YRQ+FA++A+ P AYF E R RP
Sbjct  5     DVLPFLAMAIVQFGYAGMNITSKLAMDSGMKPLVLVGYRQIFATIAMVPFAYFFEWRTRP  64

Query  344   QMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKL  523
             ++T+S+L  IF+CS+ G++ NQ+ YF+GL+NSTPTI CALTN++PAVT++LAV F  E +
Sbjct  65    KITMSLLLQIFICSLTGVTGNQVFYFIGLENSTPTIGCALTNILPAVTFILAVLFRQESV  124

Query  524   MIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNA  703
              I+ A+G+AK++GTI+CVGGAMLLSFYHGH I IGESSIHW YAD         N +TN 
Sbjct  125   GIKKASGQAKLLGTIVCVGGAMLLSFYHGHMINIGESSIHWNYAD------STGNSTTNK  178

Query  704   QPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHK  883
             + NF+LG   II SA+SWAIW  +Q +VS K+PAPY+ T LMCFM SI+CV+  I  +HK
Sbjct  179   KSNFVLGSLCIIASAISWAIWFTVQAKVSLKFPAPYTCTLLMCFMGSIECVVIGIGANHK  238

Query  884   PTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGL  1063
              ++WSLR   R  +A+YAGIV +ALA+ L SW I++KG LYVSVF+PLLLVIVAVLSW L
Sbjct  239   VSEWSLRSPGRLIAALYAGIVCSALAFSLTSWSIQRKGALYVSVFSPLLLVIVAVLSWAL  298

Query  1064  LQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELEL  1243
             L +KIYVGT VGS+LIV GLY VLWGK KEL+        EE    ++  KE +  +LEL
Sbjct  299   LHEKIYVGTAVGSILIVAGLYAVLWGKDKELK-----EEIEETKVMKLGNKEWNNHDLEL  353

Query  1244  SAHSI  1258
               H+I
Sbjct  354   QLHAI  358



>ref|XP_007031215.1| Nodulin MtN21 /EamA-like transporter family protein isoform 1 
[Theobroma cacao]
 gb|EOY11717.1| Nodulin MtN21 /EamA-like transporter family protein isoform 1 
[Theobroma cacao]
Length=369

 Score =   432 bits (1112),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 207/363 (57%), Positives = 276/363 (76%), Gaps = 7/363 (2%)
 Frame = +2

Query  164   DLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRP  343
             D +  +  ++VQLGYA MNI SKLAM+SGM P + VAYRQ+FA++AIAP AYF ER+ RP
Sbjct  4     DFVPFLANVLVQLGYAGMNITSKLAMESGMKPLILVAYRQIFATLAIAPFAYFLERKTRP  63

Query  344   QMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKL  523
             ++T  ILF IFLCS+ G + NQ+ YFVGL+NS+ T+ACAL N++PA T+ LA     E +
Sbjct  64    KITKHILFQIFLCSLTGATANQVFYFVGLENSSATVACALNNVLPAATFALAALCRQEAV  123

Query  524   MIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNA  703
              I+ A+G+AKV+GT++CVGGAMLLSFYHGH IGIG+SSIHW YAD ++S++  +NGS   
Sbjct  124   GIKKASGQAKVLGTLVCVGGAMLLSFYHGHTIGIGDSSIHWAYADKMTSKS-SSNGS---  179

Query  704   QPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHK  883
               NF LGPFL++ SA++WA+W IIQ + S+ +PAPY+ TALMCFM+SI+C +  I  DHK
Sbjct  180   --NFFLGPFLVMASAVAWAVWLIIQGQTSKNFPAPYTCTALMCFMASIECTIIGIFSDHK  237

Query  884   PTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGL  1063
              + WSL   +R  +A+YAGIV  A+ +C++SW I+KKGPLYVSVF+PLLLVIVAVLSW L
Sbjct  238   ISAWSLSSSMRLIAALYAGIVCNAMTFCVLSWSIQKKGPLYVSVFSPLLLVIVAVLSWAL  297

Query  1064  LQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELEL  1243
             L++K+YVGT+VGSVLIV GLY VLWGK +E++ +    ++  E   +   K D  ++LEL
Sbjct  298   LREKLYVGTVVGSVLIVGGLYAVLWGKDREIKQMKSNELETAEEATKAREK-DGKDDLEL  356

Query  1244  SAH  1252
               H
Sbjct  357   QLH  359



>gb|KFK43234.1| hypothetical protein AALP_AA1G097400 [Arabis alpina]
Length=387

 Score =   433 bits (1114),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 203/358 (57%), Positives = 273/358 (76%), Gaps = 4/358 (1%)
 Frame = +2

Query  167   LLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQ  346
             L+  + M++VQ+GYA MNI SK+AM+SGM P + VAYRQ+FA++A  P+A   ER+ RP+
Sbjct  7     LMPFLAMVLVQIGYAGMNITSKMAMESGMKPLILVAYRQIFATLATLPVALILERKTRPK  66

Query  347   MTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLM  526
             +TL +L  IFLCS+ G++ NQ+ YFVGL+NS+PTIACALTNL+PAVT+LLA     E + 
Sbjct  67    ITLRVLVQIFLCSVTGVTGNQVLYFVGLQNSSPTIACALTNLLPAVTFLLAALCRQEAVG  126

Query  527   IRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQ  706
             I+  +G+AKVVGTI+CV GAM+LSFYHGH IGIGES IHW Y  +++S   ++ GS+N  
Sbjct  127   IKKPSGQAKVVGTIVCVVGAMVLSFYHGHTIGIGESKIHWAYGQNITSHGTNSTGSSN--  184

Query  707   PNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKP  886
               F LGPFLI+ +A+SWA+W IIQT++SE + APY+ST LMC M SIQCV  A+  DHK 
Sbjct  185   --FFLGPFLIMAAAVSWAVWFIIQTKMSETFAAPYTSTLLMCLMGSIQCVAIALTSDHKL  242

Query  887   TDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLL  1066
             +DWSL   +R TSA+YAG+V +ALA+CLMSW I++KGPLYVSVF+PLLLV+VAV SW LL
Sbjct  243   SDWSLTSPLRLTSALYAGVVASALAFCLMSWAIQRKGPLYVSVFSPLLLVVVAVFSWSLL  302

Query  1067  QDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELE  1240
              +K+Y GT +GS L+V+GLYGVLWGK +E+         +++ + +   + DH E++E
Sbjct  303   DEKLYTGTFMGSALVVIGLYGVLWGKDREISEKEEEEEKQKKVKQQPIVRRDHNEDIE  360



>emb|CBI39638.3| unnamed protein product [Vitis vinifera]
Length=591

 Score =   439 bits (1128),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 209/378 (55%), Positives = 276/378 (73%), Gaps = 17/378 (4%)
 Frame = +2

Query  155   MGVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERR  334
             MG D L  + M +VQ+GYA MNI  KLAMDSGMNPF+ VAYRQ+FA+VA+ P AYF ER+
Sbjct  1     MGGDYLPFLAMFLVQMGYAGMNIFVKLAMDSGMNPFILVAYRQIFATVAMIPFAYFLERK  60

Query  335   IRPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGI  514
              RP++T  +LF  FL SIFG +LNQI YF+GLK+S PT+ CA  NL PA+T+LLAVPF +
Sbjct  61    TRPKITRIVLFQAFLSSIFGATLNQILYFIGLKHSNPTLGCAFNNLFPAMTFLLAVPFRL  120

Query  515   EKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGS  694
             E + I+T  G+AKV+GT++C+GGAM+L+FY GH I IGES IHWKYA+ L +++      
Sbjct  121   ETVGIKTRPGQAKVLGTVVCIGGAMILTFYRGHAINIGESGIHWKYAEQLKTRD------  174

Query  695   TNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICF  874
             + +  NFILGPFL+I S +SWAIW IIQ R+  K+ APY+S+ LMCFM+SI+C +  +  
Sbjct  175   SQSGANFILGPFLLITSCISWAIWFIIQGRMCVKFAAPYTSSTLMCFMASIECGVIGLFV  234

Query  875   DHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLS  1054
             DH+P+ WSL   IR  +A+Y+ IV TALA+CLMSW I++KGPLYVSVF+PLLLVIVA+LS
Sbjct  235   DHQPSAWSLNDSIRLIAALYSAIVCTALAFCLMSWTIQRKGPLYVSVFSPLLLVIVAILS  294

Query  1055  WGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEE  1234
             W LL+DK++ GT+VGS+ +V+GLY VLWGK K           EE  R   E  E+  E+
Sbjct  295   WALLRDKLHFGTVVGSLFVVLGLYAVLWGKGK-----------EENQRGSREEAEEGKED  343

Query  1235  LELSAHSIITVDQFPKKN  1288
             LEL  +  + + + P  +
Sbjct  344   LELQINGKLYIRKDPNPD  361



>ref|XP_002892502.1| hypothetical protein ARALYDRAFT_888180 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68761.1| hypothetical protein ARALYDRAFT_888180 [Arabidopsis lyrata subsp. 
lyrata]
Length=375

 Score =   431 bits (1107),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 200/365 (55%), Positives = 276/365 (76%), Gaps = 8/365 (2%)
 Frame = +2

Query  164   DLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRP  343
             D+L  + M++VQ+GYA MNI SK+AM++GM P + VAYRQ+FA++A  P+A+F ER+ RP
Sbjct  5     DMLPFLAMVLVQIGYAGMNITSKMAMEAGMKPLILVAYRQIFATIATFPVAFFLERKTRP  64

Query  344   QMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKL  523
             ++TL +L  +F CSI G + NQ+ YF+GL+NS+PTIACALTNL+PAVT+LLA  F  E +
Sbjct  65    KITLRVLVQVFFCSITGATGNQVLYFIGLQNSSPTIACALTNLLPAVTFLLAAIFRQETV  124

Query  524   MIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNA  703
              I+ A+G+AKV+GT++CV GAM+LSFYHGH IGIGES IHW YA++++ Q     GS++A
Sbjct  125   GIKKASGQAKVIGTLVCVIGAMVLSFYHGHTIGIGESKIHWAYAENITRQ-----GSSSA  179

Query  704   QPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHK  883
               NF LGPFLI+ +A+SWA W IIQT++SE + APY+ST LMC M SIQC   A+  DHK
Sbjct  180   HSNFFLGPFLIMAAAVSWAAWFIIQTKMSETFAAPYTSTLLMCLMGSIQCGAIALISDHK  239

Query  884   PTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGL  1063
              +DWSL   +R  SA+YAG+V +ALA+CLMSW +++KGPLYVSVF+PLLLV+VA+ SW L
Sbjct  240   LSDWSLSSPLRFISALYAGVVASALAFCLMSWAMQRKGPLYVSVFSPLLLVVVAIFSWAL  299

Query  1064  LQDKIYVGTIVGSVLIVVGLYGVLWGKQ---KELQVIGVVHVDEEEARNEVETKEDHLEE  1234
             L++K+Y GT +GS L+V+GLYGVLWGK     E +        ++ ++ + E+ ED    
Sbjct  300   LEEKLYTGTFMGSALVVIGLYGVLWGKDREVSEKEEEREKVKQQQRSKGKSESNEDIESR  359

Query  1235  LELSA  1249
             L +++
Sbjct  360   LPVAS  364



>ref|XP_006305109.1| hypothetical protein CARUB_v10009476mg [Capsella rubella]
 gb|EOA38007.1| hypothetical protein CARUB_v10009476mg [Capsella rubella]
Length=373

 Score =   429 bits (1102),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 203/360 (56%), Positives = 274/360 (76%), Gaps = 17/360 (5%)
 Frame = +2

Query  164   DLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRP  343
             D+L  + M++VQ+GYA MNI SK+AM++GM P + VAYRQ+FA++A  P+A F ER+ RP
Sbjct  6     DMLPFLAMVLVQIGYAGMNITSKMAMEAGMKPLILVAYRQIFATIATLPVAIFLERKTRP  65

Query  344   QMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKL  523
             ++TL +L  IF CSI G + NQ+ YF+GL+NS+PTIACALTNL+PAVT+LLA  F  E +
Sbjct  66    KITLKVLVQIFFCSITGATGNQVLYFIGLQNSSPTIACALTNLLPAVTFLLAAIFRQETV  125

Query  524   MIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNA  703
              I+ A+G+AKV+GT++CV GAM+LSFYHGH IGIGES IHW YA++++SQ     GS+++
Sbjct  126   GIKKASGQAKVIGTLVCVIGAMVLSFYHGHTIGIGESKIHWAYAENITSQ-----GSSSS  180

Query  704   QPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHK  883
               NF LGPFLI+ +A+SWA W IIQT++SE + APY+ST LMC M SIQC   A+  DHK
Sbjct  181   SSNFFLGPFLIMAAAVSWAAWFIIQTKMSETFAAPYTSTLLMCLMGSIQCGAIALISDHK  240

Query  884   PTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGL  1063
              +DWSL   +R  SA+YAG+V +ALA+CLMSW +++KGPLYVSVF+PLLLV+VA+ SW L
Sbjct  241   LSDWSLSSPLRFISALYAGVVASALAFCLMSWAMQRKGPLYVSVFSPLLLVVVAIFSWTL  300

Query  1064  LQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEE-------EARNEVETKED  1222
             L +K+Y GT +GS L+++GLYGVLWGK +E     V   DEE       + + ++E+ ED
Sbjct  301   LDEKLYTGTFLGSALVIIGLYGVLWGKDRE-----VTEKDEEAEKVKQQQHKVKIESNED  355



>ref|XP_010544146.1| PREDICTED: WAT1-related protein At1g09380 [Tarenaya hassleriana]
Length=385

 Score =   427 bits (1098),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 210/371 (57%), Positives = 280/371 (75%), Gaps = 9/371 (2%)
 Frame = +2

Query  152   IMGVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSER  331
             ++G D+L  + M++VQ+GYA MNI SK+AM++GM P + VAYRQ+FA+VA  P+AYF ER
Sbjct  1     MVGGDMLPFLAMVLVQIGYAGMNITSKMAMEAGMKPLILVAYRQIFATVATFPVAYFIER  60

Query  332   RIRPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFG  511
             + RP++TL++L   F CS+ G++ NQ+ YFVGL+NS+PTIACALTNL+PAVT+LLA  F 
Sbjct  61    KTRPKVTLNVLVQAFFCSVTGVTGNQVFYFVGLQNSSPTIACALTNLLPAVTFLLAAIFR  120

Query  512   IEKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNG  691
              E + I+  +G+AKVVGTI+CV GAMLLSFYHGH IGIGES IHW YA+ +SS       
Sbjct  121   QEVVGIKKKSGQAKVVGTIVCVAGAMLLSFYHGHTIGIGESKIHWTYAEKISSLG-----  175

Query  692   STNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAIC  871
             S++   +F LGPFL++  A+SWA W I+QT++ E + APY+ST LMC M SIQC   A+ 
Sbjct  176   SSSNGSSFFLGPFLVMAGAVSWAAWFILQTKMGETFAAPYTSTLLMCLMGSIQCGGIALI  235

Query  872   FDHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVL  1051
              DHK +DWSLR  IR  SAVYAG+V +ALA+CLMSW I+K+GPLYVSVF+P+LLV+VA++
Sbjct  236   SDHKLSDWSLRSPIRVISAVYAGVVASALAFCLMSWTIQKRGPLYVSVFSPMLLVVVAII  295

Query  1052  SWGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLE  1231
             SW LLQ+K+Y+GT+VGS L+V+GLYGVLWGK KE   +       +E ++ V+T +    
Sbjct  296   SWALLQEKLYLGTLVGSALVVIGLYGVLWGKDKETADME----QTQELKHNVKTDQKEDV  351

Query  1232  ELELSAHSIIT  1264
             E  LS  S +T
Sbjct  352   ESRLSPSSPVT  362



>ref|XP_010458220.1| PREDICTED: WAT1-related protein At1g09380-like [Camelina sativa]
Length=375

 Score =   426 bits (1095),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 198/364 (54%), Positives = 277/364 (76%), Gaps = 7/364 (2%)
 Frame = +2

Query  164   DLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRP  343
             DLL  + M++VQ+GYA MNI SK+AM++GM P + VAYRQ+FA++A  P+A+F ER+ RP
Sbjct  6     DLLPFLAMVLVQIGYAGMNITSKMAMEAGMKPLILVAYRQIFATIATFPVAFFLERKTRP  65

Query  344   QMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKL  523
             ++TL +L  IF CS+ G + NQ+ YF+GL+NS+PT+ACALTNL+PAVT+LLA  F  E +
Sbjct  66    KITLKVLVQIFFCSMTGATGNQVLYFIGLQNSSPTVACALTNLLPAVTFLLAAIFRQETV  125

Query  524   MIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNA  703
              I+ A+G+AKV+GT++CV GAM+LSFYHGH +GIGES IHW YA++++SQ     GS+++
Sbjct  126   GIKKASGQAKVIGTLVCVIGAMVLSFYHGHTLGIGESKIHWAYAENITSQ-----GSSSS  180

Query  704   QPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHK  883
               NF LGPFLI+ +A+SWA W IIQT++SE + APY+ST LMC M SIQC   A+  DHK
Sbjct  181   SSNFFLGPFLIMAAAVSWAAWFIIQTKMSETFAAPYTSTLLMCLMGSIQCGAIALITDHK  240

Query  884   PTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGL  1063
              +DWSL   +R  SA+YAG+V +ALA+CLMSW +++KGPLYVSVF+PLLLV+VA+ SW L
Sbjct  241   VSDWSLSSPLRFISALYAGVVASALAFCLMSWAMQRKGPLYVSVFSPLLLVVVAIFSWTL  300

Query  1064  LQDKIYVGTIVGSVLIVVGLYGVLWGKQK--ELQVIGVVHVDEEEARNEVETKEDHLEEL  1237
             L +K+Y GT +GS L+++GLYGVLWGK +    +      V +++ + + E+ ED    L
Sbjct  301   LDEKLYTGTFLGSALVIIGLYGVLWGKDREVSEKEEEAERVKQQQRKVKSESNEDIESRL  360

Query  1238  ELSA  1249
              +++
Sbjct  361   PVAS  364



>ref|XP_009118319.1| PREDICTED: WAT1-related protein At1g09380-like [Brassica rapa]
Length=364

 Score =   425 bits (1092),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 204/363 (56%), Positives = 269/363 (74%), Gaps = 13/363 (4%)
 Frame = +2

Query  164   DLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRP  343
             D+L  + M++VQ+GYA MNI SK+AM++GM P + VAYRQ+FAS+A  P+A+F ER+  P
Sbjct  6     DMLPSLAMVLVQIGYAGMNITSKMAMEAGMKPLILVAYRQIFASIATLPVAFFLERKTIP  65

Query  344   QMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKL  523
             ++T+ +L   F CSI G++ NQ+ YF+GL+NS+PTIACALTNL+PAVT+LLA  F  E +
Sbjct  66    KITMRVLVQAFFCSITGVTGNQVLYFIGLQNSSPTIACALTNLLPAVTFLLAAIFRQESV  125

Query  524   MIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNA  703
              IR  +G+AKV+GT++CV GAMLLSFYHGH IGIGES IHW YA ++++   D+ GS   
Sbjct  126   GIRKVSGQAKVIGTVVCVAGAMLLSFYHGHTIGIGESKIHWTYAQNITAHGSDSAGS---  182

Query  704   QPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHK  883
               NF LGPFLI+ +A+S A W IIQT++SE + APY+ST LMC M SIQC + A+  DHK
Sbjct  183   --NFFLGPFLIMAAAVSCAGWFIIQTKMSETFAAPYTSTLLMCLMGSIQCGVVALISDHK  240

Query  884   PTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGL  1063
               DWSL   +R  SA+YAG+V +ALA+CLMSW I  KGPLYVSVF+PL+LVIVAV SW L
Sbjct  241   LADWSLSSPLRLISALYAGVVASALAFCLMSWAINIKGPLYVSVFSPLVLVIVAVFSWTL  300

Query  1064  LQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEE----ARNEVETKEDHLE  1231
             L++K+Y GT +GS L+V+GLYGVLWGK +E+        DE E    A+ +   K D  E
Sbjct  301   LEEKLYTGTFMGSALVVIGLYGVLWGKDREMN----EKEDEVEIQKMAKQQPTVKRDINE  356

Query  1232  ELE  1240
             ++E
Sbjct  357   DIE  359



>ref|NP_172409.1| nodulin MtN21-like transporter family protein [Arabidopsis thaliana]
 sp|Q8GXB4.1|WTR2_ARATH RecName: Full=WAT1-related protein At1g09380 [Arabidopsis thaliana]
 dbj|BAC42941.1| putative nodulin protein N21 [Arabidopsis thaliana]
 gb|AAO64061.1| putative nodulin protein, N21 [Arabidopsis thaliana]
 gb|AEE28435.1| nodulin MtN21-like transporter family protein [Arabidopsis thaliana]
Length=374

 Score =   425 bits (1092),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 199/359 (55%), Positives = 273/359 (76%), Gaps = 7/359 (2%)
 Frame = +2

Query  164   DLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRP  343
             D+L  + M++VQ+GYA MNI SK+AM++GM P + VAYRQ+FA++A  P+A+F ER+ RP
Sbjct  5     DMLPFLAMVLVQIGYAGMNITSKMAMEAGMKPLILVAYRQIFATIATFPVAFFLERKTRP  64

Query  344   QMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKL  523
             ++TL IL  +F CSI G + NQ+ YFVGL+NS+PTIACALTNL+PAVT+LLA  F  E +
Sbjct  65    KITLRILVQVFFCSITGATGNQVLYFVGLQNSSPTIACALTNLLPAVTFLLAAIFRQETV  124

Query  524   MIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNA  703
              I+ A+G+AKV+GT++CV GAM+LSFYHGH IGIGES IHW YA+     N   +GS++ 
Sbjct  125   GIKKASGQAKVIGTLVCVIGAMVLSFYHGHTIGIGESKIHWAYAE-----NITKHGSSSG  179

Query  704   QPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHK  883
               NF LGPFLI+ +A+SWA W IIQT++SE + APY+ST LMC M SIQC   A+  DH 
Sbjct  180   HSNFFLGPFLIMAAAVSWAAWFIIQTKMSETFAAPYTSTLLMCLMGSIQCGAIALISDHT  239

Query  884   PTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGL  1063
              +DWSL   +R  SA+YAG+V +ALA+CLMSW +++KGPLYVSVF+PLLLV+VA+ SW L
Sbjct  240   ISDWSLSSPLRFISALYAGVVASALAFCLMSWAMQRKGPLYVSVFSPLLLVVVAIFSWAL  299

Query  1064  LQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELE  1240
             L++K+Y GT +GS L+V+GLYGVLWGK +E+          ++  ++V+++ +  E++E
Sbjct  300   LEEKLYTGTFMGSALVVIGLYGVLWGKDREVSEKEEEREKVKQQNHKVKSESN--EDIE  356



>ref|XP_010475772.1| PREDICTED: WAT1-related protein At1g09380 [Camelina sativa]
Length=375

 Score =   424 bits (1091),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 199/364 (55%), Positives = 277/364 (76%), Gaps = 5/364 (1%)
 Frame = +2

Query  164   DLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRP  343
             DLL  + M++VQ+GYA MNI SK+AM++GM P + VAYRQ+FA++A  P+A+F ER+ RP
Sbjct  6     DLLPFLAMVLVQIGYAGMNITSKMAMEAGMKPLILVAYRQIFATIATFPVAFFLERKTRP  65

Query  344   QMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKL  523
             ++TL +L  IF CSI G + NQ+ YF+GL+NS+PTIACALTNL+PAVT+LLA  F  E +
Sbjct  66    KITLKVLVQIFFCSITGATGNQVLYFIGLQNSSPTIACALTNLLPAVTFLLAAIFRQETV  125

Query  524   MIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNA  703
              I+ A+G+AKV+GT++CV GAM+LSFYHGH +GIGES IHW YA++++SQ     GS+++
Sbjct  126   GIKKASGQAKVIGTLVCVIGAMVLSFYHGHTLGIGESKIHWAYAENITSQ-----GSSSS  180

Query  704   QPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHK  883
               NF LGPFLI+ +A+SW+ W IIQT++SE + APY+ST LMC M SIQC   A+  DHK
Sbjct  181   SSNFFLGPFLIMAAAVSWSAWFIIQTKMSETFAAPYTSTLLMCLMGSIQCGAIALITDHK  240

Query  884   PTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGL  1063
              +DWSL   +R  SA+YAG+V +ALA+CLMSW +++KGPLYVSVF+PLLLV+VA+ SW L
Sbjct  241   VSDWSLSSPLRFISALYAGVVASALAFCLMSWAMQRKGPLYVSVFSPLLLVVVAIFSWTL  300

Query  1064  LQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELEL  1243
             L +K+Y GT +GS L+++GLYGVLWGK +E+          ++ + +V+++ +   E  L
Sbjct  301   LDEKLYTGTFLGSALVIIGLYGVLWGKDREVSEKEEEAEKVKQQQRKVKSESNEDIESRL  360

Query  1244  SAHS  1255
             +  S
Sbjct  361   AVAS  364



>ref|XP_009625723.1| PREDICTED: WAT1-related protein At1g09380-like isoform X1 [Nicotiana 
tomentosiformis]
Length=375

 Score =   422 bits (1085),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 206/373 (55%), Positives = 274/373 (73%), Gaps = 7/373 (2%)
 Frame = +2

Query  155   MGVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERR  334
             MG D L   +M++VQLG A   +ISKL MD GM+PFVH++YRQ+FA+++IAP AYF ER+
Sbjct  1     MGKDSLPFFLMVLVQLGGAGTAVISKLVMDEGMDPFVHLSYRQIFATISIAPFAYFFERK  60

Query  335   IRPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGI  514
              RP++T S +F IFLCSIFG++  Q+TY +GLKNST TI  AL NL+PA+T+LLA+  G+
Sbjct  61    TRPKLTPSTVFLIFLCSIFGVTAMQMTYLIGLKNSTATITTALANLVPAITFLLAILSGL  120

Query  515   EKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGS  694
             EK+ +RT AG AKV+GTILC+ GAMLLS YHG  + IG+  IHWKY++  S      N  
Sbjct  121   EKVGLRTKAGLAKVLGTILCICGAMLLSLYHGKVV-IGQLRIHWKYSEQTS-----KNIE  174

Query  695   TNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICF  874
              N+  NF LGPFL+I+S + +++W IIQ RV+E+Y APYSST LMCFM+S++CV+ A+C 
Sbjct  175   ANSHGNFFLGPFLVIISTIVYSLWLIIQPRVNERYAAPYSSTTLMCFMASLECVIVAVCV  234

Query  875   DHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLS  1054
             +H  T WSL   IRA S +Y GI+ +ALA+ LM+WCI++KGPLYVSVF PLLLVI A LS
Sbjct  235   NHDKTAWSLNP-IRAISVLYNGIISSALAFYLMTWCIKRKGPLYVSVFLPLLLVISAFLS  293

Query  1055  WGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEE  1234
             W LL +K+YVGT+VGS+L V+GLYG LWGK+K ++   VVHV EE+   E         E
Sbjct  294   WTLLGEKLYVGTVVGSILTVIGLYGFLWGKKKGMERTTVVHVKEEKVFKEKNQLTKIDLE  353

Query  1235  LELSAHSIITVDQ  1273
             L+ S  + +  ++
Sbjct  354   LQFSEKTNVNSNK  366



>ref|XP_010489953.1| PREDICTED: WAT1-related protein At1g09380-like [Camelina sativa]
Length=375

 Score =   420 bits (1079),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 197/364 (54%), Positives = 274/364 (75%), Gaps = 5/364 (1%)
 Frame = +2

Query  164   DLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRP  343
             DLL  + M++VQ+GYA MNI SK+AM++GM P + VAYRQ+FA++A  P+A+F ER+ RP
Sbjct  6     DLLPFLAMVLVQIGYAGMNITSKMAMEAGMKPLILVAYRQIFATIATFPVAFFLERKTRP  65

Query  344   QMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKL  523
             ++TL +L  I  CS+ G + NQ+ YF+GL+NS+PT+ACALTNL+PAVT+LLA  F  E +
Sbjct  66    KITLKVLVQICFCSMTGATGNQVLYFIGLQNSSPTVACALTNLLPAVTFLLAAIFRQETV  125

Query  524   MIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNA  703
              I+ A+G+AKV+GT++CV GAM+LSFYHGH +GIGES IHW YA++++SQ     GS+++
Sbjct  126   GIKKASGQAKVIGTLVCVIGAMVLSFYHGHTLGIGESKIHWAYAENITSQ-----GSSSS  180

Query  704   QPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHK  883
               NF LGPFLI+ +A+SWA W IIQT++SE + APY+ST LMC M SIQC   A+  DHK
Sbjct  181   SSNFFLGPFLIMAAAVSWAAWFIIQTKMSETFAAPYTSTLLMCLMGSIQCGTIALITDHK  240

Query  884   PTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGL  1063
              +DWSL   +R  SA+YAG+V +ALA+CLMSW +++KGPLYVSVF+PLLLV+VA+ SW L
Sbjct  241   VSDWSLSSPLRFISALYAGVVASALAFCLMSWAMQRKGPLYVSVFSPLLLVVVAIFSWTL  300

Query  1064  LQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELEL  1243
             L +K+Y GT +GS L+++GLYGVLWGK +E+           + + +V+++ +   E  L
Sbjct  301   LDEKLYTGTFLGSALVIIGLYGVLWGKDREVSEKEEEAEKVRQQQRKVKSESNEDIESRL  360

Query  1244  SAHS  1255
                S
Sbjct  361   PVAS  364



>ref|XP_009777189.1| PREDICTED: WAT1-related protein At1g09380-like isoform X1 [Nicotiana 
sylvestris]
Length=374

 Score =   419 bits (1076),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 206/373 (55%), Positives = 273/373 (73%), Gaps = 8/373 (2%)
 Frame = +2

Query  155   MGVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERR  334
             MG D L   +M++VQLG A   IISKL MD GM+PFVH++YRQ+FA+++IAP AYF ER+
Sbjct  1     MGKDSLPFFLMVMVQLGGAGTAIISKLVMDEGMDPFVHLSYRQIFATISIAPFAYFFERK  60

Query  335   IRPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGI  514
              RP++T S +F IFLCSIFG++  Q+TY +GLKNST TI  AL NL+PA+T+LLAV  G+
Sbjct  61    TRPKLTPSTVFLIFLCSIFGVTAMQMTYLIGLKNSTATITTALANLVPAITFLLAVLSGL  120

Query  515   EKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGS  694
             EK+ +RT AG+AKV+GTILC+ GA+LLS YHG  + IG+  IHWKY++  S      N  
Sbjct  121   EKVGLRTKAGQAKVLGTILCICGAILLSLYHGKVV-IGQLRIHWKYSEQTS-----KNIE  174

Query  695   TNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICF  874
              N   NF LGPFL+I+S + +++W IIQ RV+E+Y APYSST LMCFM+S++CV+ A+C 
Sbjct  175   ANTHGNFFLGPFLVIISTIVYSLWLIIQPRVNERYAAPYSSTTLMCFMASLECVIVAVCV  234

Query  875   DHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLS  1054
             +   T WSL   IRA S +Y GI+ +ALA+ LM+WCI++KGPLYVSVF PLLLVI A LS
Sbjct  235   NRDKTAWSLNP-IRAISVLYNGIISSALAFYLMTWCIKRKGPLYVSVFLPLLLVISAFLS  293

Query  1055  WGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEE  1234
             W LL +K+YVGT+VGS+L V+GLYG LWGK+KE++    VH+ EE+   E         E
Sbjct  294   WTLLGEKLYVGTVVGSILTVIGLYGFLWGKKKEMER-NTVHIKEEKVLKEKNQLTKIGLE  352

Query  1235  LELSAHSIITVDQ  1273
             L+ S  + +  +Q
Sbjct  353   LQFSKKTNVNPNQ  365



>gb|AFK39803.1| unknown [Lotus japonicus]
Length=374

 Score =   419 bits (1076),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 197/365 (54%), Positives = 267/365 (73%), Gaps = 7/365 (2%)
 Frame = +2

Query  158   GVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRI  337
             G  L+   +MI++QL YAVMNI SKLA+ SGMNP + VAYRQ+FA+++I P AYF E +I
Sbjct  6     GSSLIPFFIMILIQLAYAVMNITSKLAIQSGMNPLILVAYRQIFATISIIPFAYFFEWKI  65

Query  338   RPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIE  517
              P+MT  I+  IFL S+ G++ NQ+ YFVGLK ST TIACALTNL+PA T++LA+ F  E
Sbjct  66    LPRMTKRIMVQIFLSSLTGVTGNQVLYFVGLKYSTATIACALTNLLPAFTFVLALIFRQE  125

Query  518   KLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGST  697
              L I+  +G+ KV+GT+LCV GA+LLSFYHG  IG+GESSIHW YAD +  Q   +  S 
Sbjct  126   NLRIKKMSGQTKVLGTVLCVSGALLLSFYHGKTIGLGESSIHWSYADKM--QGGSSTSSA  183

Query  698   NAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFD  877
               + N +LGP  +I+SAL WA W IIQ  +S+ +P PY+ST  MCF++S QCV+ A+CF+
Sbjct  184   AGKTNLLLGPIALILSALVWAFWFIIQADMSKNFPVPYTSTGYMCFLASFQCVIIALCFE  243

Query  878   HKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSW  1057
             H+P+ WSL+  +R TS++YAG++ T L+YC++SW IE+KGPLYVSVF P+ LV+ A++SW
Sbjct  244   HRPSAWSLQNAMRLTSSLYAGVICTGLSYCVISWTIERKGPLYVSVFTPMQLVLTAIISW  303

Query  1058  GLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEEL  1237
              LLQ+K+YVGT +GS+LIV GLY VLWGK KE     VV  D  E  +  + +++   +L
Sbjct  304   SLLQEKLYVGTAIGSLLIVGGLYAVLWGKSKE-----VVKKDSTEEPDMEKMQDNEKNDL  358

Query  1238  ELSAH  1252
             EL  +
Sbjct  359   ELQPY  363



>gb|AAM65466.1| putative nodulin protein, N21 [Arabidopsis thaliana]
Length=363

 Score =   417 bits (1073),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 196/352 (56%), Positives = 268/352 (76%), Gaps = 7/352 (2%)
 Frame = +2

Query  185   MIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLSIL  364
             M++VQ+GYA MNI SK+AM++GM P + VAYRQ+FA++A  P+A+F ER+ RP++TL IL
Sbjct  1     MVLVQIGYAGMNITSKMAMEAGMKPLILVAYRQIFATIATFPVAFFLERKTRPKITLRIL  60

Query  365   FNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTAAG  544
               +F CSI G + NQ+ YFVGL+NS+PTIACALTNL+PAVT+LLA  F  E + I+ A+G
Sbjct  61    VQVFFCSITGATGNQVLYFVGLQNSSPTIACALTNLLPAVTFLLAAIFRQETVGIKKASG  120

Query  545   KAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFILG  724
             + KV+GT++CV GAM+LSFYHGH IGIGES IHW YA+     N   +GS++   NF LG
Sbjct  121   QTKVIGTLVCVIGAMVLSFYHGHTIGIGESKIHWAYAE-----NITKHGSSSGHSNFFLG  175

Query  725   PFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWSLR  904
             PFLI+ +A+SWA W IIQT++SE + APY+ST LMC M SIQC   A+  DH  +DWSL 
Sbjct  176   PFLIMAAAVSWAAWFIIQTKMSETFAAPYTSTLLMCLMGSIQCGAIALISDHTISDWSLS  235

Query  905   QGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKIYV  1084
               +R  SA+YAG+V +ALA+CLMSW +++KGPLYVSVF+PLLLV+VA+ SW LL++K+Y 
Sbjct  236   SPLRFISALYAGVVASALAFCLMSWAMQRKGPLYVSVFSPLLLVVVAIFSWALLEEKLYT  295

Query  1085  GTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELE  1240
             GT +GS L+V+GLYGVLWGK +E+          ++  ++V+++ +  E++E
Sbjct  296   GTFMGSALVVIGLYGVLWGKDREVSEKEEEREKVKQQNHKVKSESN--EDIE  345



>ref|XP_010674547.1| PREDICTED: WAT1-related protein At1g09380 [Beta vulgaris subsp. 
vulgaris]
Length=381

 Score =   418 bits (1075),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 211/364 (58%), Positives = 272/364 (75%), Gaps = 6/364 (2%)
 Frame = +2

Query  164   DLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRP  343
             +LL    M+IVQ+GYA MNI SK+AM+SGM P V VAYRQLFA++ + P AYFSER  RP
Sbjct  5     ELLPFFAMVIVQIGYAGMNISSKVAMESGMAPLVLVAYRQLFATIVLVPFAYFSEREKRP  64

Query  344   QMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKL  523
             ++T  ILF +FLCS+FG +LNQI YF+GLK +T TIACAL N++PA+T+LLAVPFG+E +
Sbjct  65    KITKQILFQVFLCSLFGATLNQICYFIGLKETTATIACALNNILPAMTFLLAVPFGLEAV  124

Query  524   MIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNA  703
              IR   G+AK+VGT++CVGGAMLLSFYHGH I I +  IHW Y D   S N  NNGS N+
Sbjct  125   GIRKRGGQAKIVGTLVCVGGAMLLSFYHGHLIYIRQPDIHWHY-DGDDSMNNRNNGS-NS  182

Query  704   QPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHK  883
               N  LGP L++ S L+ AIW I+Q ++S+ + APY+S+ALMC M++IQC + A C +HK
Sbjct  183   HLNLFLGPLLLLASNLAMAIWFILQAKMSKNFAAPYTSSALMCLMATIQCTVIAACTNHK  242

Query  884   PTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGL  1063
              +DWSL+  IR  S++YAGIVG+A+A CLMSW I+KKGPLYVSVFNPLLLVIVA+LSW L
Sbjct  243   ISDWSLKSHIRMVSSIYAGIVGSAVAVCLMSWTIQKKGPLYVSVFNPLLLVIVALLSWAL  302

Query  1064  LQDKIYVGTIVGSVLIVVGLYGVLWGKQKEL----QVIGVVHVDEEEARNEVETKEDHLE  1231
               +K+Y+GT +GS+ IV+GLY VLWGK KE+      IG+     EE +     KED  +
Sbjct  303   RMEKLYIGTAIGSLFIVLGLYAVLWGKNKEMLDDGNQIGLNGTHIEEGKYNDSEKEDLEK  362

Query  1232  ELEL  1243
             + +L
Sbjct  363   QQQL  366



>ref|XP_006344854.1| PREDICTED: WAT1-related protein At1g09380-like [Solanum tuberosum]
Length=376

 Score =   417 bits (1071),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 201/365 (55%), Positives = 272/365 (75%), Gaps = 8/365 (2%)
 Frame = +2

Query  155   MGVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERR  334
             MG DL    +M++VQLG A   IISK+ MD GMNP+VH++YRQ+ A+++IAP AYF ER 
Sbjct  1     MGKDLFPFFLMVLVQLGSAGTVIISKIVMDDGMNPYVHLSYRQIIATISIAPFAYFFERE  60

Query  335   IRPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGI  514
              RP++TLS LF IFLCSIFG++  Q+TY +GLKNST TI  AL NL+PA+T+LLAV  G+
Sbjct  61    TRPKLTLSTLFLIFLCSIFGVTGMQMTYLIGLKNSTATITTALANLVPAITFLLAVLSGL  120

Query  515   EKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGS  694
             EK+ +R+  G+AKV+GTILC+ GAMLLS YHG  + IG+  IHWKY+ H +S+N  ++ +
Sbjct  121   EKVGLRSKGGQAKVMGTILCICGAMLLSLYHGKML-IGQLKIHWKYSQHHTSKNIIHDPN  179

Query  695   TNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICF  874
              N   NF LGPFL+I+S + +++W IIQ RVSE+Y APYSST LMCFM+S++C + A+C 
Sbjct  180   NNTHGNFFLGPFLVIISGIVYSLWLIIQPRVSERYAAPYSSTTLMCFMASLECTIIALCV  239

Query  875   D-HKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVL  1051
             + H    WSL   IRA S +Y GI+ +ALA+ L++WCI++KGPLYVSVF PLLLVI A L
Sbjct  240   NNHNKNAWSLNP-IRAISVLYNGIISSALAFYLITWCIKRKGPLYVSVFLPLLLVISAFL  298

Query  1052  SWGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLE  1231
             SW LL +K+YVGTIVGS+L V+GLYG LWGK+KE++      + +E       +K++ L 
Sbjct  299   SWALLGEKLYVGTIVGSMLTVIGLYGFLWGKKKEME-----RIKKETEEKVFNSKKNQLT  353

Query  1232  ELELS  1246
             +++L 
Sbjct  354   KIDLD  358



>gb|KHG28119.1| Auxin-induced protein 5NG4 [Gossypium arboreum]
Length=374

 Score =   415 bits (1066),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 195/335 (58%), Positives = 265/335 (79%), Gaps = 5/335 (1%)
 Frame = +2

Query  155   MGVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERR  334
             M  D +  +  +++Q+GYA MNI SKLA++SGM P + VAYRQ+FA++AIAP A+F ER+
Sbjct  1     MLADFMPFLANVLLQVGYAGMNITSKLALESGMKPLILVAYRQIFATLAIAPFAFFLERK  60

Query  335   IRPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGI  514
              RP++T+ ILF IFLCS+ G + NQ+ YFVGL+N+T TIACAL N++PA T+LLA     
Sbjct  61    TRPKLTMPILFQIFLCSLTGATANQVFYFVGLQNTTATIACALNNVLPAATFLLAAICRQ  120

Query  515   EKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGS  694
             E + I+ A+G+AKV+GT++CVGGAMLLSFYHGH IGIGESSIHW YA+ +++ +      
Sbjct  121   EAVGIKKASGQAKVIGTLVCVGGAMLLSFYHGHIIGIGESSIHWNYANKMANSS-----P  175

Query  695   TNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICF  874
             + +  NF LGPFL++ SA++WA+W IIQ + S+ +PAPY+ST LMCFM+SI+C +  I  
Sbjct  176   SPSGSNFFLGPFLVMASAVAWALWFIIQGQTSKSFPAPYTSTTLMCFMASIECTIIGIFS  235

Query  875   DHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLS  1054
             D KP+ WSL   +R  +A+YAGI+  A+A+C+MSWCI+K+GPLYVSVF+PLLLVIVA+LS
Sbjct  236   DPKPSAWSLSSSMRLIAALYAGIICNAVAFCVMSWCIQKRGPLYVSVFSPLLLVIVAILS  295

Query  1055  WGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQ  1159
             W LL++K+YVGT+VGS+LIV GLY VLWGK KE++
Sbjct  296   WALLREKLYVGTVVGSLLIVGGLYAVLWGKDKEMK  330



>gb|AAO60108.1| nodulin-like protein [Gossypium hirsutum]
Length=376

 Score =   415 bits (1066),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 195/335 (58%), Positives = 265/335 (79%), Gaps = 5/335 (1%)
 Frame = +2

Query  155   MGVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERR  334
             M  D +  +  +++Q+GYA MNI SKLA++SGM P + VAYRQ+FA++AIAP A+F ER+
Sbjct  1     MLADFMPFLANVLLQVGYAGMNITSKLALESGMKPLILVAYRQIFATLAIAPFAFFLERK  60

Query  335   IRPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGI  514
              RP++T+ ILF IFLCS+ G + NQ+ YFVGL+N+T TIACAL N++PA T+LLA     
Sbjct  61    TRPKLTMPILFQIFLCSLTGATANQVFYFVGLQNTTATIACALNNVLPAATFLLAAICRQ  120

Query  515   EKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGS  694
             E + I+ A+G+AKV+GT++CVGGAMLLSFYHGH IGIGESSIHW YA+ +++ +      
Sbjct  121   EAVGIKKASGQAKVIGTLVCVGGAMLLSFYHGHIIGIGESSIHWNYANKMANSS-----P  175

Query  695   TNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICF  874
             + +  NF LGPFL++ SA++WA+W IIQ + S+ +PAPY+ST LMCFM+SI+C +  I  
Sbjct  176   SPSGSNFFLGPFLVMASAVAWALWFIIQGQTSKSFPAPYTSTTLMCFMASIECTIIGIFS  235

Query  875   DHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLS  1054
             D KP+ WSL   +R  +A+YAGI+  A+A+C+MSWCI+K+GPLYVSVF+PLLLVIVA+LS
Sbjct  236   DPKPSAWSLSSSMRLIAALYAGIICNAVAFCVMSWCIQKRGPLYVSVFSPLLLVIVAILS  295

Query  1055  WGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQ  1159
             W LL++K+YVGT+VGS+LIV GLY VLWGK KE++
Sbjct  296   WALLREKLYVGTVVGSLLIVGGLYAVLWGKDKEMK  330



>ref|XP_010026177.1| PREDICTED: WAT1-related protein At1g09380-like [Eucalyptus grandis]
 gb|KCW58638.1| hypothetical protein EUGRSUZ_H01299 [Eucalyptus grandis]
Length=367

 Score =   414 bits (1064),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 199/364 (55%), Positives = 263/364 (72%), Gaps = 11/364 (3%)
 Frame = +2

Query  161   VDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIR  340
             VD +  + M+ VQ+GYA M I SKLAMDSGMNPFV V YRQ+FA++A  P A   ER+ R
Sbjct  4     VDFVPFLAMVTVQVGYAGMMITSKLAMDSGMNPFVLVTYRQVFATLATIPFALLLERKTR  63

Query  341   PQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEK  520
             P++T+ IL +IFLCSI G  +NQ+ YFVGL NSTPTIACA+ N++PA+T+L A+ F  E 
Sbjct  64    PRITVPILLHIFLCSITGAFMNQVFYFVGLNNSTPTIACAMGNILPAMTFLFALIFRQES  123

Query  521   LMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTN  700
               I++ AG+AKV+GT++CVGGAMLLSFYHG  IGIG+S IHW YA+ ++ ++  N G   
Sbjct  124   FGIKSKAGQAKVIGTLVCVGGAMLLSFYHGPYIGIGDSRIHWTYANKMTDKHPTNKG---  180

Query  701   AQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDH  880
                NF+LGPFL++  + +WA+W IIQ ++S K+PAPY++T LM  M+SI+C +     +H
Sbjct  181   ---NFLLGPFLLLSISAAWALWFIIQAKLSRKFPAPYTTTTLMSLMASIECAVTGAAIEH  237

Query  881   KPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWG  1060
             + T WSL  GIR  SA+YAG + +ALA+C+MSWCIE+KGPLY +VFNPLLLVI A+LSW 
Sbjct  238   RVTAWSLSSGIRLISAIYAGCICSALAFCVMSWCIERKGPLYTAVFNPLLLVITAILSWA  297

Query  1061  LLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELE  1240
             LLQ+K+ VG +VGS LI+ GLY VLWGK KE +         EE    V  +E    EL+
Sbjct  298   LLQEKLTVGILVGSTLIIAGLYCVLWGKDKEAKA-----KIAEEMEAAVMCREREDLELQ  352

Query  1241  LSAH  1252
             L +H
Sbjct  353   LPSH  356



>ref|XP_009616803.1| PREDICTED: WAT1-related protein At1g09380-like isoform X1 [Nicotiana 
tomentosiformis]
Length=347

 Score =   413 bits (1062),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 201/362 (56%), Positives = 268/362 (74%), Gaps = 20/362 (6%)
 Frame = +2

Query  155   MGVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERR  334
             MG ++L  ++M+ VQ+GYA MNI+  L MD+GM+PFVH+AYRQ+ A++++ P AYF E +
Sbjct  1     MGNEVLPFLLMVTVQVGYAGMNIVGTLVMDAGMDPFVHIAYRQIIATISLVPFAYFFEWK  60

Query  335   IRPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGI  514
              +PQ+T SILF IFLCS+ G++ +QI YFVGLKNSTPTIACAL+NLIPA T+LLA+PFG+
Sbjct  61    TKPQLTSSILFWIFLCSLSGLTASQIAYFVGLKNSTPTIACALSNLIPAATFLLAIPFGL  120

Query  515   EKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGS  694
             EK+  R+ +G+AKV GTI+CVGGAMLLS YHG  I IG+S IHWK+A++   +N  ++  
Sbjct  121   EKVGFRSKSGQAKVWGTIICVGGAMLLSLYHG-PIVIGQSGIHWKFAENTEKKNSTDH--  177

Query  695   TNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICF  874
                  N ILGP L+IVS +S+++W I Q RVSEKY APY+ST LMC M+S QCV+  +  
Sbjct  178   ----VNLILGPLLLIVSTVSYSLWIIFQARVSEKYAAPYTSTMLMCLMASFQCVIIGVFV  233

Query  875   DHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLS  1054
              H    W L + +R  + +Y GIV TAL YCL SWCI++KGPLYVSVF PL+L+I AVLS
Sbjct  234   IHDKAAWFLDR-MRTIAVLYNGIVCTALGYCLTSWCIQRKGPLYVSVFYPLMLIITAVLS  292

Query  1055  WGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEE  1234
             W LL++K+Y+GT+VGS L VVG YGVLWGK            DEE++++E E  E   ++
Sbjct  293   WTLLREKLYLGTVVGSFLTVVGFYGVLWGK------------DEEKSKSETENLEIKTDK  340

Query  1235  LE  1240
             L+
Sbjct  341   LK  342



>gb|AAO60157.1| putative nodulin protein [Gossypium hirsutum]
Length=374

 Score =   414 bits (1063),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 195/335 (58%), Positives = 264/335 (79%), Gaps = 5/335 (1%)
 Frame = +2

Query  155   MGVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERR  334
             M  D +  +  +++Q+GYA MNI SKLA++SGM P + VAYRQ+FA++AIAP A+F ER+
Sbjct  1     MLADFMPFLANVLLQVGYAGMNITSKLALESGMKPLILVAYRQIFATLAIAPFAFFLERK  60

Query  335   IRPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGI  514
              RP++T+ ILF IFLCS+ G + NQ+ YFVGL+N+T TIACAL N++PA T+LLA     
Sbjct  61    TRPKLTMPILFQIFLCSLTGATANQVFYFVGLQNTTATIACALNNVLPAATFLLAAICRQ  120

Query  515   EKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGS  694
             E + I+ A+G+AKV+GT+ CVGGAMLLSFYHGH IGIGESSIHW YA+ +++ +      
Sbjct  121   EAVGIKKASGQAKVIGTLACVGGAMLLSFYHGHIIGIGESSIHWNYANKMANSS-----P  175

Query  695   TNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICF  874
             + +  NF LGPFL++ SA++WA+W IIQ + S+ +PAPY+ST LMCFM+SI+C +  I  
Sbjct  176   SPSGSNFFLGPFLVMASAVAWALWFIIQGQTSKSFPAPYTSTTLMCFMASIECTIIGIFS  235

Query  875   DHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLS  1054
             D KP+ WSL   +R  +A+YAGI+  A+A+C+MSWCI+K+GPLYVSVF+PLLLVIVA+LS
Sbjct  236   DPKPSAWSLSSSMRLIAALYAGIICNAVAFCVMSWCIQKRGPLYVSVFSPLLLVIVAILS  295

Query  1055  WGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQ  1159
             W LL++K+YVGT+VGS+LIV GLY VLWGK KE++
Sbjct  296   WALLREKLYVGTVVGSLLIVGGLYAVLWGKDKEMK  330



>ref|XP_006382304.1| hypothetical protein POPTR_0005s00820g [Populus trichocarpa]
 gb|ERP60101.1| hypothetical protein POPTR_0005s00820g [Populus trichocarpa]
Length=374

 Score =   410 bits (1055),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 202/339 (60%), Positives = 254/339 (75%), Gaps = 13/339 (4%)
 Frame = +2

Query  164   DLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRP  343
             D+L  + M IVQ GYA MNI SKLAMDSGM P V V YRQ+FA++A+ P AYF E + RP
Sbjct  5     DVLPFLAMAIVQFGYAGMNITSKLAMDSGMKPLVLVGYRQIFATIAMVPFAYFFEWKTRP  64

Query  344   QMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKL  523
             ++T+S+L  IF+CS+ G++ NQ+ YF+GL+NSTPTI CALTN++PAVT++LAV F  E +
Sbjct  65    KITMSLLLQIFICSLTGVTGNQVFYFIGLENSTPTIGCALTNILPAVTFILAVLFRQESV  124

Query  524   MIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNA  703
              I+  +G+AK++GTI+CVGGAMLLSFYHGH I IGESSIHW YAD         N ST+ 
Sbjct  125   GIKKTSGQAKLLGTIVCVGGAMLLSFYHGHMINIGESSIHWNYAD------STGNSSTDK  178

Query  704   QPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHK  883
             + N +LG   II SA+SWAIW  +Q +VS K+PAPY+ T LMCFM SI+C +  I  +HK
Sbjct  179   KSNLVLGSLFIIASAVSWAIWFTVQAKVSLKFPAPYTCTLLMCFMGSIECGVIGIGANHK  238

Query  884   PTDWSLRQGIRATSAVYA-------GIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIV  1042
              ++WSLR   R  +A+YA       GIV +ALA+ L SW I++KG LYVSVF+PLLLVIV
Sbjct  239   VSEWSLRSPGRLIAALYALFPSQFQGIVCSALAFSLTSWSIQRKGALYVSVFSPLLLVIV  298

Query  1043  AVLSWGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQ  1159
             AVLSW LL +KIYVGT VGS+LIV GLY VLWGK KEL+
Sbjct  299   AVLSWALLHEKIYVGTAVGSILIVAGLYAVLWGKDKELK  337



>gb|KHG28117.1| ADP-ribosylation factor 2 [Gossypium arboreum]
Length=538

 Score =   416 bits (1069),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 195/335 (58%), Positives = 265/335 (79%), Gaps = 5/335 (1%)
 Frame = +2

Query  155   MGVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERR  334
             M  D +  +  +++Q+GYA MNI SKLA++SGM P + VAYRQ+FA++AIAP A+F ER+
Sbjct  1     MLADFMPFLANVLLQVGYAGMNITSKLALESGMKPLILVAYRQIFATLAIAPFAFFLERK  60

Query  335   IRPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGI  514
              RP++T+ ILF IFLCS+ G + NQ+ YFVGL+N+T TIACAL N++PA T+LLA     
Sbjct  61    TRPKLTMPILFQIFLCSLTGATANQVFYFVGLQNTTATIACALNNVLPAATFLLAAICRQ  120

Query  515   EKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGS  694
             E + I+ A+G+AKV+GT++CVGGAMLLSFYHGH IGIGESSIHW YA+ +++ +      
Sbjct  121   EAVGIKKASGQAKVIGTLVCVGGAMLLSFYHGHIIGIGESSIHWNYANKMANSS-----P  175

Query  695   TNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICF  874
             + +  NF LGPFL++ SA++WA+W IIQ + S+ +PAPY+ST LMCFM+SI+C +  I  
Sbjct  176   SPSGSNFFLGPFLVMASAVAWALWFIIQGQTSKSFPAPYTSTTLMCFMASIECTIIGIFS  235

Query  875   DHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLS  1054
             D KP+ WSL   +R  +A+YAGI+  A+A+C+MSWCI+K+GPLYVSVF+PLLLVIVA+LS
Sbjct  236   DPKPSAWSLSSSMRLIAALYAGIICNAVAFCVMSWCIQKRGPLYVSVFSPLLLVIVAILS  295

Query  1055  WGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQ  1159
             W LL++K+YVGT+VGS+LIV GLY VLWGK KE++
Sbjct  296   WALLREKLYVGTVVGSLLIVGGLYAVLWGKDKEMK  330



>ref|XP_010270886.1| PREDICTED: WAT1-related protein At1g09380 isoform X1 [Nelumbo 
nucifera]
Length=362

 Score =   409 bits (1052),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 200/364 (55%), Positives = 267/364 (73%), Gaps = 9/364 (2%)
 Frame = +2

Query  164   DLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRP  343
             + L  I MI+VQ+GYA MNI+SKLA+DSGM+P V V YRQ+ A++ I+P AYF ER+ RP
Sbjct  4     EFLPCIAMIMVQIGYAGMNILSKLAIDSGMSPLVMVTYRQIVATIIISPFAYFWERKTRP  63

Query  344   QMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKL  523
             ++T + LF IFL S+FGI+ NQ  YF+GLK STPTI CALTNL+PAVT+++AVPFG+EK+
Sbjct  64    RITSATLFQIFLSSLFGIAGNQCLYFIGLKYSTPTIGCALTNLLPAVTFIMAVPFGMEKV  123

Query  524   MIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNA  703
              +R  AG+AKV+GT++CVGGAML+SFY G  I I +S+IHW+Y D ++     N+  T  
Sbjct  124   GLRRKAGQAKVLGTVMCVGGAMLMSFYKGIRIPIPDSAIHWRYVDSITESGSSNDKVT--  181

Query  704   QPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHK  883
                 +LG  ++I S +SW  W I+Q +VSE + APYSSTALMC M SI+C + A+  DH+
Sbjct  182   ----LLGSLILIASVISWGAWFIMQAKVSETFSAPYSSTALMCLMGSIECGIIAVTADHQ  237

Query  884   PTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGL  1063
              + WSL   IR  +++Y+G+V +A A  LMSWCIEKKGPLYVS F+PLLLVIVAV+ W L
Sbjct  238   VSAWSLHSSIRLITSLYSGLVASAFAIYLMSWCIEKKGPLYVSAFSPLLLVIVAVIGWAL  297

Query  1064  LQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELEL  1243
             L DK+Y+G++VGSVLIV+GLY VLWGK  E++      VDE+    E E  ++   +LEL
Sbjct  298   LADKLYMGSVVGSVLIVMGLYAVLWGKDMEMKEKN--SVDEKNLSLEGEEDKEK-GKLEL  354

Query  1244  SAHS  1255
               +S
Sbjct  355   PVYS  358



>ref|XP_003536035.1| PREDICTED: WAT1-related protein At1g09380-like [Glycine max]
 gb|KHN16036.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=377

 Score =   410 bits (1053),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 200/366 (55%), Positives = 269/366 (73%), Gaps = 4/366 (1%)
 Frame = +2

Query  155   MGVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERR  334
             M   ++ L+ MIIVQLGYA MNI SKLA+ SGM+P V VAYRQ+FA++++AP A++ ER 
Sbjct  1     MASSVIPLLAMIIVQLGYAGMNITSKLAIQSGMHPLVLVAYRQIFATISLAPFAFWLERN  60

Query  335   IRPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGI  514
               P+MT  I F I L S+ G++ NQI YF+GLK STPTIACAL NL+PA T++LAV    
Sbjct  61    TAPRMTKHIAFQILLSSLTGVTGNQILYFLGLKYSTPTIACALNNLLPAFTFILAVLSRQ  120

Query  515   EKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGS  694
             E L I+T AG AK +GT+L VGGA+LLSFYHG  +G+GES IHW+YA+++  ++  + G 
Sbjct  121   EYLRIKTRAGVAKALGTVLSVGGAVLLSFYHGKVLGLGESKIHWRYAENMQRESSSSGGG  180

Query  695   TNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICF  874
              N     +LGP  +IVSAL WA+W I+Q  +S+ YPAPY+ST  MC M+SIQCV+ A+  
Sbjct  181   RN----HLLGPVAVIVSALVWAVWFIVQKNMSKSYPAPYTSTFYMCLMASIQCVVIALAA  236

Query  875   DHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLS  1054
             +H  + WSL   IR TSA+YAG + TALAY L++W IE+KGPLYVSVF+PLLLVI+AV S
Sbjct  237   EHNVSAWSLHSTIRLTSALYAGTISTALAYVLLAWTIERKGPLYVSVFSPLLLVIIAVAS  296

Query  1055  WGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEE  1234
             W  L +++YVGT++GS+LIV+GLY VLWGK KE+  I VV V+        ++++D +++
Sbjct  297   WAFLHEQLYVGTVIGSLLIVLGLYFVLWGKNKEMNKIDVVEVEGTVMEAIKDSEKDEVKD  356

Query  1235  LELSAH  1252
             LEL  +
Sbjct  357   LELQPY  362



>ref|XP_004230335.1| PREDICTED: WAT1-related protein At1g09380 [Solanum lycopersicum]
Length=377

 Score =   409 bits (1052),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 202/366 (55%), Positives = 267/366 (73%), Gaps = 8/366 (2%)
 Frame = +2

Query  155   MGVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERR  334
             MG +L+  ++M+IVQ+ YA M IISKL MD GMN FV  AYR +FA+++IAP A+F ER+
Sbjct  1     MGNELMVFMIMVIVQVAYAGMIIISKLVMDGGMNAFVQSAYRPIFATISIAPFAFFLERK  60

Query  335   IRPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGI  514
              RP+MT S+LF IFLCSIFGI+ NQ  YF+GLKNSTPTI  A+ NLIPA T+++AVP GI
Sbjct  61    TRPKMTCSVLFQIFLCSIFGITANQNIYFIGLKNSTPTIVSAIDNLIPAFTFIIAVPLGI  120

Query  515   EKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGS  694
             EKL +R+ AG+ K  GTI+CVGGAMLLS YHG  + IG+   HWKYA++ S   KD N  
Sbjct  121   EKLGLRSIAGQTKFWGTIICVGGAMLLSLYHGKVV-IGQLGFHWKYAENTS---KDVN--  174

Query  695   TNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICF  874
              +A  NF LGPFL+IVS+L++AIW IIQ RV+EKY APY+ST LMC M+S++CV+   C 
Sbjct  175   -SANSNFFLGPFLLIVSSLTYAIWLIIQARVNEKYAAPYTSTTLMCLMASVECVIIGFCV  233

Query  875   DHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLS  1054
               K ++W L   IRA S VY G + T+  Y L SWCIEKKGPLYVS+FNPL LVI A LS
Sbjct  234   VPKLSEWKLNP-IRAVSVVYNGAMATSFTYFLSSWCIEKKGPLYVSMFNPLFLVISAFLS  292

Query  1055  WGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEE  1234
             W LL++K+Y+G ++GS+++V G+YG LWGK+ E     +  ++  + + ++ TK     E
Sbjct  293   WILLREKLYLGVVLGSIIVVAGMYGFLWGKKMETSAEDIDVLELTKEKKQLSTKLQVDLE  352

Query  1235  LELSAH  1252
             L+L+ +
Sbjct  353   LQLTQN  358



>ref|XP_003554607.1| PREDICTED: WAT1-related protein At1g09380-like isoform X1 [Glycine 
max]
 ref|XP_003554614.1| PREDICTED: WAT1-related protein At1g09380-like isoform X1 [Glycine 
max]
Length=367

 Score =   409 bits (1051),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 198/359 (55%), Positives = 262/359 (73%), Gaps = 8/359 (2%)
 Frame = +2

Query  155   MGVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERR  334
             MG  L+A ++M++VQL YAVMNI SKLA++SGM+P V VAYRQLFA+V+IAP AY+ E  
Sbjct  1     MGAGLVAFLLMVLVQLVYAVMNITSKLAIESGMSPLVLVAYRQLFATVSIAPFAYWLEWN  60

Query  335   IRPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGI  514
               P++T  ++  I   S+ G++ NQ+ YFVGLK S+ TIACALTNL+PA T++LAV F  
Sbjct  61    TLPRITQRLMIQILFSSLTGVTGNQMLYFVGLKYSSATIACALTNLLPAFTFILAVLFRQ  120

Query  515   EKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGS  694
             E L I+  AG AKV GTILCV GA+LLSFYHG  IG+G+SSIHW+YA+ +   +    G 
Sbjct  121   ENLGIKKRAGLAKVFGTILCVSGALLLSFYHGKTIGLGQSSIHWRYAEKMEGTSSSGKG-  179

Query  695   TNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICF  874
                  N  LGP ++I+S L WA W IIQ  +S+ +PAPY+ST LMCFM+S QCV+ A+C 
Sbjct  180   -----NMFLGPLVVILSTLVWAAWFIIQKDISKTFPAPYTSTGLMCFMASFQCVIIAVCV  234

Query  875   DHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLS  1054
             DH+ + WSL   +R +SA+YAGI  T LAYCLMSW IE+KGPLYVSVF PL LV+ A+LS
Sbjct  235   DHRASAWSLHNAMRLSSALYAGIFCTGLAYCLMSWTIERKGPLYVSVFTPLQLVLTAILS  294

Query  1055  WGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLE  1231
             W LL++K+YVGT VGS+LIV+GLY VLWGK +E+       ++E+  +  V+  ++ +E
Sbjct  295   WALLREKLYVGTAVGSLLIVLGLYSVLWGKSEEVNKGD--GIEEDAVKEAVKDSKNDME  351



>ref|XP_006341313.1| PREDICTED: WAT1-related protein At1g09380-like [Solanum tuberosum]
Length=353

 Score =   408 bits (1049),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 200/358 (56%), Positives = 273/358 (76%), Gaps = 17/358 (5%)
 Frame = +2

Query  158   GVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRI  337
             G DLL  I M+IVQ+GYA  N+++KL MD+GM+PFV  AYR +FA+++IAP AYF ER+ 
Sbjct  5     GSDLLPFIAMVIVQVGYAGSNVVTKLVMDTGMDPFVQTAYRPIFATISIAPFAYFLERKT  64

Query  338   RPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIE  517
             RP+++LS+ F IFLCSI GI+ NQ T+ +GLK +TPTI  AL NLIPA T++LAVPFG+E
Sbjct  65    RPKLSLSVFFQIFLCSIIGITANQYTFCIGLKYTTPTIVSALDNLIPAFTFVLAVPFGLE  124

Query  518   KLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGST  697
             KL +R+ AG+AK++GTI+CVGGAMLLS Y G  + IG+   HWKY ++ ++ +KD N + 
Sbjct  125   KLGLRSIAGQAKLIGTIVCVGGAMLLSLYRGPVV-IGQLGFHWKYVEN-TTDDKDVNST-  181

Query  698   NAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFD  877
                 NF+LGPF++I+S++++A+W IIQ RV+EKY APYSST LM FM+S QC++ + C  
Sbjct  182   --HTNFLLGPFILIISSITYALWLIIQARVNEKYAAPYSSTLLMFFMASFQCMIISFCVV  239

Query  878   HKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSW  1057
              K ++W+L   IRA S VY G V ++LA  L SWCIE+KGPLYVS+FNPLLLVI A LSW
Sbjct  240   PKASEWALNP-IRAISVVYNGTVCSSLALYLCSWCIERKGPLYVSMFNPLLLVIAAFLSW  298

Query  1058  GLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLE  1231
              LL++K+Y+G +VGS+L VVGLYG LWG++KE+          E+++NE+E +ED +E
Sbjct  299   ILLREKLYLGIVVGSILTVVGLYGFLWGQKKEM----------EQSKNEIE-EEDVVE  345



>ref|XP_004231303.1| PREDICTED: WAT1-related protein At1g09380-like [Solanum lycopersicum]
Length=376

 Score =   409 bits (1050),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 195/365 (53%), Positives = 271/365 (74%), Gaps = 8/365 (2%)
 Frame = +2

Query  155   MGVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERR  334
             MG +L    +M++VQLG A   IISK+ MD GMNP+VH++YRQ+ A+++IAP AYF ER 
Sbjct  1     MGKNLFPFFLMVLVQLGSAGTAIISKIVMDDGMNPYVHLSYRQIIATISIAPFAYFFERE  60

Query  335   IRPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGI  514
              RP++T S LF IFLCSIFG++  Q TY +GLKNST TI  AL NL+PA+T+LLAV  G+
Sbjct  61    TRPKLTPSTLFLIFLCSIFGVTGMQTTYLIGLKNSTATITTALANLVPAITFLLAVLSGL  120

Query  515   EKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGS  694
             EK+++R+  G+AKV+GT+LC+ GAMLLS YHG  + IG+  IHWKY+ H +S+N  ++ +
Sbjct  121   EKVVLRSKGGQAKVMGTMLCICGAMLLSLYHGKML-IGQLKIHWKYSQHHTSKNIIHDPN  179

Query  695   TNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICF  874
              N   NF LGPFL+I+S + +++W IIQ RV+E+Y APY+ST LMCFM+S++C + A+C 
Sbjct  180   NNTHGNFFLGPFLVIISCIVYSLWLIIQPRVNERYAAPYTSTTLMCFMASLECTIIALCV  239

Query  875   D-HKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVL  1051
             + H    WSL   IRA S +Y GI+ +ALA+ L++WCI++KGPLYVSVF PLLLVI + L
Sbjct  240   NNHDKNAWSLNP-IRAISVLYNGIISSALAFYLITWCIKRKGPLYVSVFLPLLLVISSFL  298

Query  1052  SWGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLE  1231
             SW LL +K+Y+GTIVGS+L V+GLYG LWGK+KE++      + +E       TK++ L 
Sbjct  299   SWALLGEKLYIGTIVGSMLTVIGLYGFLWGKKKEME-----RIKKETEEKVFNTKKNQLT  353

Query  1232  ELELS  1246
             +++L 
Sbjct  354   KIDLD  358



>ref|XP_003555788.1| PREDICTED: WAT1-related protein At1g09380-like [Glycine max]
Length=375

 Score =   408 bits (1049),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 202/366 (55%), Positives = 264/366 (72%), Gaps = 4/366 (1%)
 Frame = +2

Query  155   MGVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERR  334
             M   ++ L+ MIIVQLGYA MNI SKLA+ SGM P V VAYRQ+FA++++AP A++ ER 
Sbjct  1     MASSIIPLLAMIIVQLGYAGMNITSKLAIQSGMQPLVLVAYRQIFATISLAPFAFWFERN  60

Query  335   IRPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGI  514
               P+MT  I   I L S+ G++ NQI YF+GLK ST TIACAL NL+PA T++LAV    
Sbjct  61    TAPRMTKHIALQILLSSLTGVTGNQILYFLGLKYSTATIACALNNLLPAFTFVLAVLSRQ  120

Query  515   EKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGS  694
             E L I+T AG AK +GT+L VGGA+LLSFYHG  +G+GES IHW+YA+ +  ++  + G 
Sbjct  121   ENLRIKTRAGVAKALGTVLSVGGAVLLSFYHGEVLGLGESEIHWRYAEKMQRESSSSGGG  180

Query  695   TNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICF  874
             TN     ILGP  +IVSAL WA+W I+Q  +S+ YPAPY+ST  MC M+SIQCV  A+  
Sbjct  181   TN----LILGPVAVIVSALLWAVWFIVQANMSKSYPAPYTSTFYMCLMASIQCVAIALSA  236

Query  875   DHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLS  1054
             +H  + WSL   IR TSA+YAG + T LAY LMSW IE+KGPLYVSVF+PLLLVI+AV S
Sbjct  237   EHNVSAWSLHSTIRLTSALYAGTISTGLAYVLMSWTIERKGPLYVSVFSPLLLVIIAVAS  296

Query  1055  WGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEE  1234
             W LL +++YVGT +GS+LIV+GLY VLWGK KE+  I +V V+        E+++D +++
Sbjct  297   WALLHEQLYVGTAIGSLLIVLGLYFVLWGKNKEMNKIDMVEVEGTVMEAIKESEKDEVKD  356

Query  1235  LELSAH  1252
             LEL  +
Sbjct  357   LELQPY  362



>ref|XP_007208228.1| hypothetical protein PRUPE_ppa018179mg, partial [Prunus persica]
 gb|EMJ09427.1| hypothetical protein PRUPE_ppa018179mg, partial [Prunus persica]
Length=361

 Score =   408 bits (1048),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 197/360 (55%), Positives = 262/360 (73%), Gaps = 14/360 (4%)
 Frame = +2

Query  164   DLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRP  343
             D L  + M++VQ+ YA MNIISKLA++S MNP V VAYRQ+FA+++IAP AY+ E + RP
Sbjct  6     DYLPFLAMVLVQMSYAGMNIISKLAIESDMNPLVLVAYRQVFATLSIAPFAYWMEWKTRP  65

Query  344   QMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKL  523
             ++T+ ILF  FLCS+ G + NQ+ YFVGLK STPTIACALTN +PA+T++LA+ F  E  
Sbjct  66    RITMPILFQTFLCSLTGATANQVFYFVGLKTSTPTIACALTNTLPAMTFILALIFRQESA  125

Query  524   MIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQ-NKDNNGSTN  700
              I++  G +KV+GT++CV GAMLLSFYHGH IG+GES IHW YA  +  Q N  +NGS+ 
Sbjct  126   KIKSKPGLSKVMGTVVCVSGAMLLSFYHGHIIGLGESKIHWAYAQRMGEQANSSSNGSS-  184

Query  701   AQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDH  880
                   +GP  +I+S L WA W IIQ +V E +PAPY+ST LMC M+S +C + A+  DH
Sbjct  185   -----FVGPLCVIISTLGWAFWFIIQAKVGENFPAPYTSTTLMCLMASFECGIIAVIADH  239

Query  881   KPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWG  1060
             K + WSL+  +R  SA+Y GI+G+ALA+ L SW I++KGPLYVSVF+PLLL+IVA+ SW 
Sbjct  240   KVSAWSLKNPMRLISALYCGILGSALAFFLSSWSIQRKGPLYVSVFSPLLLIIVAISSWA  299

Query  1061  LLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELE  1240
             LL++K+Y+GT +GS+LIV GLY VLWGK KE +V       E+  +    TK DH +E E
Sbjct  300   LLEEKLYLGTAIGSILIVCGLYLVLWGKNKETEV-------EKPTKETDTTKADHAKEYE  352



>ref|XP_004252215.1| PREDICTED: WAT1-related protein At1g09380 [Solanum lycopersicum]
Length=351

 Score =   407 bits (1045),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 201/363 (55%), Positives = 274/363 (75%), Gaps = 17/363 (5%)
 Frame = +2

Query  158   GVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRI  337
             G DLL  I M+IVQ+GYA  N+++KL MD+GM+PFV  AYR +FA+++IAP AYF ER+ 
Sbjct  5     GSDLLPFIAMVIVQVGYAGSNVVTKLVMDTGMHPFVQTAYRPIFATISIAPFAYFLERKT  64

Query  338   RPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIE  517
             RP++TLS+ F IFLCSI G++ NQ T+ +GLK +TPTI  AL NLIPA T+LLA+ FG+E
Sbjct  65    RPKLTLSVFFQIFLCSIIGVTANQYTFCIGLKYTTPTIVSALDNLIPAFTFLLAILFGLE  124

Query  518   KLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGST  697
             KL +++ AG+AK++GTI+CVGGAMLLS Y G  + IG+   HWKYA++ ++ +KD N + 
Sbjct  125   KLGLKSLAGQAKLIGTIVCVGGAMLLSLYRGP-VLIGQLGFHWKYAEN-TTNDKDINST-  181

Query  698   NAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFD  877
                 NFILGPF++I+S++++A+W  IQ RV+EKY APYSST LM FM+S QC++ + C  
Sbjct  182   --HTNFILGPFILIISSITYALWLTIQARVNEKYAAPYSSTLLMFFMASFQCMIISFCVV  239

Query  878   HKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSW  1057
              K  +W+L   IRA S VY G V ++LA  L SWCIE+KGPLYVS+FNPLLLVI A LSW
Sbjct  240   PKAYEWALNP-IRAISVVYNGTVCSSLALYLSSWCIERKGPLYVSMFNPLLLVIAAFLSW  298

Query  1058  GLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEEL  1237
              LL++K+Y+G +VGS+L VVGLYG LWG++KE+          E+++NE+E +ED+  +L
Sbjct  299   ILLREKLYLGIVVGSILTVVGLYGFLWGQKKEM----------EQSKNEIE-EEDNKADL  347

Query  1238  ELS  1246
             EL 
Sbjct  348   ELQ  350



>ref|XP_007163305.1| hypothetical protein PHAVU_001G223600g [Phaseolus vulgaris]
 gb|ESW35299.1| hypothetical protein PHAVU_001G223600g [Phaseolus vulgaris]
Length=361

 Score =   405 bits (1041),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 192/355 (54%), Positives = 265/355 (75%), Gaps = 7/355 (2%)
 Frame = +2

Query  155   MGVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERR  334
             M   L+ LI+MI+VQL YA MNI SKLA+++GMNP + VAYRQLFA+++IAP AY+ E +
Sbjct  1     MASGLVPLILMIVVQLIYAGMNITSKLALEAGMNPLILVAYRQLFATLSIAPFAYWLEWK  60

Query  335   IRPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGI  514
               P++T  ++F + + S+ G++ NQI +F+GLK ST TIACALTNL+PA T++LAV F  
Sbjct  61    TLPRLTKPLMFRLLMSSLTGVTGNQILFFLGLKFSTATIACALTNLLPAFTFILAVMFRQ  120

Query  515   EKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGS  694
             E L I+  +G AK+ GTILCV GA+LLSFYHG  IG+G+SSIHW+YA+ +       +G 
Sbjct  121   ENLGIKQRSGLAKLSGTILCVSGALLLSFYHGKEIGLGQSSIHWRYAEKMEGTASSGSG-  179

Query  695   TNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICF  874
                  N  +GPFL+I S L WA+W +IQT +S+K+PAPY+ST LMCF++S QC++ A+CF
Sbjct  180   -----NMFIGPFLLIGSTLVWALWFVIQTDISKKFPAPYTSTGLMCFLASFQCIIIALCF  234

Query  875   DHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLS  1054
             +H  + WSL  GI+ +SA+YAG++ T L Y LMSW IE+KGPLYVSVF PL LV+ A+LS
Sbjct  235   NHSASAWSLHDGIKLSSALYAGVLSTGLGYSLMSWAIERKGPLYVSVFTPLQLVLTAILS  294

Query  1055  WGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVI-GVVHVDEEEARNEVETK  1216
             W LL++K+YVGT +GS+LIV+GLY VLWGK +E++ I   V    ++ +N+ E +
Sbjct  295   WALLREKLYVGTAIGSLLIVLGLYSVLWGKSEEVKTIDDAVKETVKDPKNDTEMQ  349



>ref|XP_003520787.1| PREDICTED: WAT1-related protein At1g09380-like isoform X1 [Glycine 
max]
 gb|KHN03917.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=366

 Score =   405 bits (1040),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 199/368 (54%), Positives = 263/368 (71%), Gaps = 16/368 (4%)
 Frame = +2

Query  155   MGVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERR  334
             MG  L+A ++M++VQL YAVMNI SKLA++SGM+P V VAYRQLFA+V+IAP AY+ E  
Sbjct  1     MGAGLVAFLLMVLVQLVYAVMNITSKLAIESGMSPLVLVAYRQLFATVSIAPFAYWLEWN  60

Query  335   IRPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGI  514
               P++T  ++  I   S+ G++ NQ+ YFVGLK S+ TIACALTNL+PA T++LAV F  
Sbjct  61    TLPRITKRLMLQILFSSLTGVTGNQMLYFVGLKYSSATIACALTNLLPAFTFILAVLFRQ  120

Query  515   EKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGS  694
             E L I+  AG AKV GTILCV GA+LLSFYHG  IG+G+SSIHW+YA+ +   +    G 
Sbjct  121   ENLGIKKRAGLAKVFGTILCVSGALLLSFYHGKTIGLGQSSIHWRYAEKMEGTSSSGKG-  179

Query  695   TNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICF  874
                  N  LGP ++I+S L WA W IIQ  +S+ + APY+ST LMCFM+S QC++ A+C 
Sbjct  180   -----NMFLGPLVVILSTLVWAAWFIIQKDISKTFSAPYTSTGLMCFMASFQCIIIAVCV  234

Query  875   DHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLS  1054
             DH  + WSL   +R +SA+YAGI  T LAYCLMSW IE+KGPLYVSVF PL LV+ A+LS
Sbjct  235   DHTASAWSLHNAMRLSSALYAGIFCTGLAYCLMSWTIERKGPLYVSVFTPLQLVLTAILS  294

Query  1055  WGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEV--ETKEDHL  1228
             W LL++K+YVGT VGS+LIV+GLY VLWGK +E        V++E+   +   E  +D  
Sbjct  295   WALLREKLYVGTAVGSLLIVLGLYSVLWGKSEE--------VNKEDGIEDAFKEAVKDPK  346

Query  1229  EELELSAH  1252
              ++EL ++
Sbjct  347   NDMELQSY  354



>ref|XP_002512549.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
 gb|EEF50001.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
Length=370

 Score =   404 bits (1038),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 205/365 (56%), Positives = 273/365 (75%), Gaps = 9/365 (2%)
 Frame = +2

Query  164   DLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRP  343
             D    + M+IVQ G+A MNI SKLAMDSGM P V V+YRQ+FA++A+ P AYF E + RP
Sbjct  6     DFFPFLAMVIVQFGFAGMNITSKLAMDSGMKPLVLVSYRQIFATIAMVPFAYFFEWKTRP  65

Query  344   QMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKL  523
             ++T  +L  IF+CS+ G++ NQ+ YF+GL+NSTPTI CALTN++PAVT++LAV    E +
Sbjct  66    KITKPLLIQIFICSLTGVTGNQVFYFIGLENSTPTIGCALTNILPAVTFILAVLLRQESV  125

Query  524   MIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNA  703
              I+  +G+AK++GT++CVGGAMLLSFYHG  I IGESSIHWKYAD   S N     S  A
Sbjct  126   GIKKISGQAKLLGTVICVGGAMLLSFYHGPMINIGESSIHWKYADETGSSN-----SAAA  180

Query  704   QPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHK  883
             + +FILGP  I+ SA+SWA+W  +Q +VS  +PAPY+ST LMCFM SI+CV+  +  +H+
Sbjct  181   KSSFILGPVFIMASAVSWAVWFTLQAKVSVTFPAPYTSTLLMCFMGSIECVVIGLGANHE  240

Query  884   PTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGL  1063
              + WSLR   R  +A+YAGIV +ALA+ L SW I+KKG LYVSVF+PLLLVIVAVLSW L
Sbjct  241   LSQWSLRSPGRLIAALYAGIVCSALAFSLTSWSIQKKGALYVSVFSPLLLVIVAVLSWAL  300

Query  1064  LQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLE-ELE  1240
             L++K+Y+GT+VGS LIV GLY VLWGK KE+++ G   +++ EA  +   KE+  + EL+
Sbjct  301   LREKLYLGTVVGSGLIVAGLYAVLWGKDKEMKMKG---IEDIEAIKQGGGKEERGDLELQ  357

Query  1241  LSAHS  1255
             L A+S
Sbjct  358   LPANS  362



>ref|XP_009768038.1| PREDICTED: WAT1-related protein At1g09380-like [Nicotiana sylvestris]
Length=372

 Score =   404 bits (1037),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 205/366 (56%), Positives = 270/366 (74%), Gaps = 10/366 (3%)
 Frame = +2

Query  155   MGVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERR  334
             MG DLLA ++M+IVQL +A M II+KL M+ GMNPFV  AYR +FA+++IAP A+F ER+
Sbjct  3     MGNDLLAFVVMVIVQLAFAGMIIITKLVMNGGMNPFVQSAYRPIFATISIAPFAFFLERK  62

Query  335   IRPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGI  514
              RP++T SILF IFLCSIFGI++NQ  YF+GLKNSTPT+  A+ NLIPA T+L+AVP G 
Sbjct  63    SRPKLTRSILFQIFLCSIFGITVNQYVYFIGLKNSTPTVVSAIDNLIPAFTFLIAVPMGA  122

Query  515   EKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGS  694
             EKL +R  AG+AK++GTI+CVGGAMLLS YHG  + IG+   HWKYA+   S  KD N S
Sbjct  123   EKLGLRNIAGQAKLLGTIICVGGAMLLSLYHGKVV-IGQLGFHWKYAE---STGKDVNSS  178

Query  695   TNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICF  874
              +   NF  GPFL+I+S+L++AIW IIQ +V+EKY APY+   LMC M+S++ V+   C 
Sbjct  179   GHG--NFFSGPFLVIMSSLTYAIWLIIQGKVNEKYAAPYTCITLMCLMASVESVIIGFCV  236

Query  875   DHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLS  1054
               K ++W+L   IRA S VY G+V T+ AY L SWCIE+KGPLYVS+FNPLLLVI A LS
Sbjct  237   VPKLSEWALNP-IRAISVVYNGVVCTSFAYFLSSWCIERKGPLYVSMFNPLLLVISAFLS  295

Query  1055  WGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEE  1234
             W LL++K+Y+G +VGS++IV+GLYG LWG++ E +    + V   + +N   TK D   E
Sbjct  296   WTLLREKLYLGVVVGSIIIVLGLYGFLWGQKMETRTDDDIEVMVNKEKNH-STKFDL--E  352

Query  1235  LELSAH  1252
             L+L  +
Sbjct  353   LQLPQN  358



>gb|EPS65422.1| hypothetical protein M569_09355 [Genlisea aurea]
Length=340

 Score =   401 bits (1031),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 195/357 (55%), Positives = 268/357 (75%), Gaps = 21/357 (6%)
 Frame = +2

Query  155   MGVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERR  334
             M  DL+ L  M  VQ+G+A MNIISK+AMDSGM+PFVHVAYRQ+ A++A+ P+AYF +R+
Sbjct  1     MAGDLVPLFSMAAVQVGFAGMNIISKIAMDSGMDPFVHVAYRQIVATLALLPLAYFFDRK  60

Query  335   IRPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGI  514
              RP+M+  ILF IFLCSIFG+++NQITY VGLK STPTIACAL N+ PAVTYL+A+P  +
Sbjct  61    TRPKMSGEILFLIFLCSIFGVTVNQITYIVGLKYSTPTIACALANISPAVTYLIALPLRL  120

Query  515   EKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGS  694
             E+L +R+ AG AKV+GT +CVGGA+LLSFYHG  I +G    H +       ++    G 
Sbjct  121   ERLGLRSKAGLAKVLGTGVCVGGALLLSFYHGSAINVGHFQTHHR-------ESPSAAGG  173

Query  695   TNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICF  874
                  N I+GPFL+++SA+S++IW IIQ+ V+ +Y AP+S++A+MC M+S +CV+ A+CF
Sbjct  174   GGGHANLIMGPFLLVLSAVSFSIWLIIQSGVNRRYNAPFSTSAMMCLMASFECVIAAVCF  233

Query  875   DH-KPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVL  1051
             D  KP+ W L   IR  S  Y+G+V +ALAYC+MSWC++ KGPLYVSVF+PL+LV+VA+L
Sbjct  234   DGLKPSAWGLSPYIRVLSCAYSGVVCSALAYCVMSWCVDVKGPLYVSVFSPLMLVVVAIL  293

Query  1052  SWGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKED  1222
             SWG+L +K+Y+GT++GS+LIV+G+YGVLWG             ++EEA   VE ++D
Sbjct  294   SWGILGEKLYLGTLMGSILIVLGVYGVLWG-------------NKEEATAAVEVEDD  337



>ref|XP_008246269.1| PREDICTED: WAT1-related protein At1g09380 [Prunus mume]
Length=372

 Score =   401 bits (1030),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 195/360 (54%), Positives = 260/360 (72%), Gaps = 14/360 (4%)
 Frame = +2

Query  164   DLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRP  343
             D L  + M++VQ+ YA MNIISKLA++S MNP V VAYRQ+FA+++IAP AY+ E + RP
Sbjct  6     DYLPFLAMVLVQMSYAGMNIISKLAIESDMNPLVLVAYRQVFATLSIAPFAYWMEWKTRP  65

Query  344   QMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKL  523
             ++T+ ILF  FLCS+ G + NQ+ YFVGLK STPTIACALTN +PA+T++LA+ F  E  
Sbjct  66    RITVPILFQTFLCSLTGATANQVFYFVGLKTSTPTIACALTNTLPAMTFILALIFRQESA  125

Query  524   MIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQ-NKDNNGSTN  700
              I++  G +KV+GT++CV GAMLLSFYHGH IG+GES IHW YA  +  Q N  +NGS+ 
Sbjct  126   KIKSKPGLSKVMGTVVCVSGAMLLSFYHGHIIGLGESKIHWAYAQRMGEQANSSSNGSS-  184

Query  701   AQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDH  880
                   +GP  +I+S L WA W IIQ +V E +PAPY+ST LMC M+S +C + A+  DH
Sbjct  185   -----FVGPLCVIISTLGWAFWFIIQAKVGENFPAPYTSTTLMCLMASFECGIIAVIADH  239

Query  881   KPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWG  1060
             K + WSL+  +   SA+Y GI+G+ALA+ L SW I++KGPLYVSVF+PLLL+IVA+ SW 
Sbjct  240   KVSAWSLKNPMWLISALYCGILGSALAFFLSSWSIQRKGPLYVSVFSPLLLIIVAISSWA  299

Query  1061  LLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELE  1240
             LL++K+Y+GT +GS+LIV GLY VLWGK  E +V       E+  +    TK DH +E E
Sbjct  300   LLEEKLYLGTAIGSILIVCGLYLVLWGKNNETEV-------EKPTKETDTTKADHAKEYE  352



>ref|XP_004166072.1| PREDICTED: LOW QUALITY PROTEIN: auxin-induced protein 5NG4-like 
[Cucumis sativus]
Length=371

 Score =   399 bits (1026),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 195/360 (54%), Positives = 263/360 (73%), Gaps = 10/360 (3%)
 Frame = +2

Query  164   DLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRP  343
             D L  ++M++VQ  YA +NI SKLAM+ GMNP V VAYRQ+FA++AIAP AY+ ER+ RP
Sbjct  6     DFLPXLVMLVVQFLYAGLNITSKLAMEFGMNPLVLVAYRQMFATIAIAPCAYWFERKGRP  65

Query  344   QMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKL  523
             ++T  ILF I LCS+ G + NQ+ Y+VGLK STPTIACALTN++PA T++LAV F  E +
Sbjct  66    KITKPILFQILLCSLTGATANQVFYYVGLKYSTPTIACALTNVLPAATFVLAVLFRQESV  125

Query  524   MIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNA  703
              I+T+ G AKV+GT++CVGGAMLLSFY G  I +G+S IHWKYA+ +  ++  N GS+  
Sbjct  126   GIKTSPGAAKVIGTVVCVGGAMLLSFYRGQTIELGKSGIHWKYAELMRGESSSNQGSS--  183

Query  704   QPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHK  883
                 I G   +I+S+++WA W +IQ RV+EK+PAPY+STALM FM++IQC   A+  +HK
Sbjct  184   ----IWGSLCLIISSVAWAAWFVIQARVNEKFPAPYTSTALMTFMATIQCGAIAVGVEHK  239

Query  884   P-TDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWG  1060
                 WSL+  IR   A+YAG+  + +A+CL SW I+K+GPLY SVF+P LLVIVA+ SW 
Sbjct  240   TLAAWSLKSSIRLVGALYAGVACSGMAFCLTSWSIQKRGPLYASVFSPFLLVIVAIFSWA  299

Query  1061  LLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVD--EEEARNEVETKEDHLEE  1234
               Q+K+YVGT+VGS+LIVVGLY VLWGK KE+++   + +    E   ++   KED LEE
Sbjct  300   FFQEKLYVGTVVGSLLIVVGLYSVLWGKTKEVKLQQHIEMTAAAEAKLDDYNNKED-LEE  358



>ref|XP_004139525.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
 gb|KGN65022.1| hypothetical protein Csa_1G181350 [Cucumis sativus]
Length=371

 Score =   398 bits (1023),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 195/360 (54%), Positives = 263/360 (73%), Gaps = 10/360 (3%)
 Frame = +2

Query  164   DLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRP  343
             D L  ++M++VQ  YA +NI SKLAM+ GMNP V VAYRQ+FA++AIAP AY+ ER+ RP
Sbjct  6     DFLPPLVMLVVQFLYAGLNITSKLAMEFGMNPLVLVAYRQMFATIAIAPCAYWFERKGRP  65

Query  344   QMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKL  523
             ++T  ILF I LCS+ G + NQ+ Y+VGLK STPTIACALTN++PA T++LAV F  E +
Sbjct  66    KITKPILFQILLCSLTGATANQVFYYVGLKYSTPTIACALTNVLPAATFVLAVLFRQESV  125

Query  524   MIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNA  703
              I+T+ G AKV+GT++CVGGAMLLSFY G  I +G+S IHWKYA+ +  ++  N GS+  
Sbjct  126   GIKTSPGAAKVIGTVVCVGGAMLLSFYRGQTIELGKSGIHWKYAELMRGESSSNQGSS--  183

Query  704   QPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHK  883
                 I G   +I+S+++WA W +IQ RV+EK+PAPY+STALM FM++IQC   A+  +HK
Sbjct  184   ----IWGSLCLIISSVAWAAWFVIQARVNEKFPAPYTSTALMTFMATIQCGAIAVGVEHK  239

Query  884   P-TDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWG  1060
                 WSL+  IR   A+YAG+  + +A+CL SW I+K+GPLY SVF+P LLVIVA+ SW 
Sbjct  240   TLAAWSLKSSIRLVGALYAGVACSGMAFCLTSWSIQKRGPLYASVFSPFLLVIVAIFSWA  299

Query  1061  LLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVD--EEEARNEVETKEDHLEE  1234
               Q+K+YVGT+VGS+LIVVGLY VLWGK KE+++   + +    E   ++   KED LEE
Sbjct  300   FFQEKLYVGTVVGSLLIVVGLYSVLWGKTKEVKLQQHIEMTAAAEAKLDDYNNKED-LEE  358



>ref|XP_009616806.1| PREDICTED: WAT1-related protein At1g09380-like isoform X3 [Nicotiana 
tomentosiformis]
 ref|XP_009616807.1| PREDICTED: WAT1-related protein At1g09380-like isoform X3 [Nicotiana 
tomentosiformis]
 ref|XP_009616808.1| PREDICTED: WAT1-related protein At1g09380-like isoform X3 [Nicotiana 
tomentosiformis]
 ref|XP_009616809.1| PREDICTED: WAT1-related protein At1g09380-like isoform X3 [Nicotiana 
tomentosiformis]
Length=327

 Score =   394 bits (1013),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 192/342 (56%), Positives = 253/342 (74%), Gaps = 20/342 (6%)
 Frame = +2

Query  215   MNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLSILFNIFLCSIFG  394
             MNI+  L MD+GM+PFVH+AYRQ+ A++++ P AYF E + +PQ+T SILF IFLCS+ G
Sbjct  1     MNIVGTLVMDAGMDPFVHIAYRQIIATISLVPFAYFFEWKTKPQLTSSILFWIFLCSLSG  60

Query  395   ISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTAAGKAKVVGTILC  574
             ++ +QI YFVGLKNSTPTIACAL+NLIPA T+LLA+PFG+EK+  R+ +G+AKV GTI+C
Sbjct  61    LTASQIAYFVGLKNSTPTIACALSNLIPAATFLLAIPFGLEKVGFRSKSGQAKVWGTIIC  120

Query  575   VGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFILGPFLIIVSALS  754
             VGGAMLLS YHG  I IG+S IHWK+A++   +N  ++       N ILGP L+IVS +S
Sbjct  121   VGGAMLLSLYHG-PIVIGQSGIHWKFAENTEKKNSTDH------VNLILGPLLLIVSTVS  173

Query  755   WAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWSLRQGIRATSAVY  934
             +++W I Q RVSEKY APY+ST LMC M+S QCV+  +   H    W L + +R  + +Y
Sbjct  174   YSLWIIFQARVSEKYAAPYTSTMLMCLMASFQCVIIGVFVIHDKAAWFLDR-MRTIAVLY  232

Query  935   AGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKIYVGTIVGSVLIV  1114
              GIV TAL YCL SWCI++KGPLYVSVF PL+L+I AVLSW LL++K+Y+GT+VGS L V
Sbjct  233   NGIVCTALGYCLTSWCIQRKGPLYVSVFYPLMLIITAVLSWTLLREKLYLGTVVGSFLTV  292

Query  1115  VGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELE  1240
             VG YGVLWGK            DEE++++E E  E   ++L+
Sbjct  293   VGFYGVLWGK------------DEEKSKSETENLEIKTDKLK  322



>ref|XP_009616805.1| PREDICTED: WAT1-related protein At1g09380-like isoform X2 [Nicotiana 
tomentosiformis]
Length=339

 Score =   395 bits (1014),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 192/342 (56%), Positives = 253/342 (74%), Gaps = 20/342 (6%)
 Frame = +2

Query  215   MNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLSILFNIFLCSIFG  394
             MNI+  L MD+GM+PFVH+AYRQ+ A++++ P AYF E + +PQ+T SILF IFLCS+ G
Sbjct  13    MNIVGTLVMDAGMDPFVHIAYRQIIATISLVPFAYFFEWKTKPQLTSSILFWIFLCSLSG  72

Query  395   ISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTAAGKAKVVGTILC  574
             ++ +QI YFVGLKNSTPTIACAL+NLIPA T+LLA+PFG+EK+  R+ +G+AKV GTI+C
Sbjct  73    LTASQIAYFVGLKNSTPTIACALSNLIPAATFLLAIPFGLEKVGFRSKSGQAKVWGTIIC  132

Query  575   VGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFILGPFLIIVSALS  754
             VGGAMLLS YHG  I IG+S IHWK+A++   +N  ++       N ILGP L+IVS +S
Sbjct  133   VGGAMLLSLYHG-PIVIGQSGIHWKFAENTEKKNSTDH------VNLILGPLLLIVSTVS  185

Query  755   WAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWSLRQGIRATSAVY  934
             +++W I Q RVSEKY APY+ST LMC M+S QCV+  +   H    W L + +R  + +Y
Sbjct  186   YSLWIIFQARVSEKYAAPYTSTMLMCLMASFQCVIIGVFVIHDKAAWFLDR-MRTIAVLY  244

Query  935   AGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKIYVGTIVGSVLIV  1114
              GIV TAL YCL SWCI++KGPLYVSVF PL+L+I AVLSW LL++K+Y+GT+VGS L V
Sbjct  245   NGIVCTALGYCLTSWCIQRKGPLYVSVFYPLMLIITAVLSWTLLREKLYLGTVVGSFLTV  304

Query  1115  VGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELE  1240
             VG YGVLWGK            DEE++++E E  E   ++L+
Sbjct  305   VGFYGVLWGK------------DEEKSKSETENLEIKTDKLK  334



>gb|KEH24463.1| nodulin MtN21/EamA-like transporter family protein [Medicago 
truncatula]
Length=382

 Score =   393 bits (1009),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 187/332 (56%), Positives = 249/332 (75%), Gaps = 2/332 (1%)
 Frame = +2

Query  164   DLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRP  343
              ++ L++MI++QL YA MNI SK+A+  GMNP + VAYRQ+FA+V+IAP AY+ ER + P
Sbjct  5     SIIPLVLMIVMQLAYAGMNITSKIAILGGMNPLILVAYRQIFATVSIAPFAYWLERDMVP  64

Query  344   QMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKL  523
             +MT  I+  I L SI G++ NQ+ YF GLK +T TIACALTNL+PA T++LA+ F  E L
Sbjct  65    RMTKRIMVQILLSSITGVTGNQVLYFAGLKYTTATIACALTNLLPAFTFVLAILFRQENL  124

Query  524   MIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNA  703
              I+  +G AKVVGT+LCVGGA+LLSFYHG  IGI ES IHW YA+ +  +   +N S   
Sbjct  125   GIKKKSGIAKVVGTVLCVGGAILLSFYHGQVIGIPESKIHWSYAERI--EGAGDNSSAAQ  182

Query  704   QPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHK  883
               N +LGP L+I+SAL W++W IIQ  +S+ +P PY+STA MCF++S QCV  A+CFDH+
Sbjct  183   SNNVLLGPILLILSALIWSLWFIIQADMSKNFPVPYTSTAYMCFLASFQCVFIALCFDHR  242

Query  884   PTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGL  1063
              + WSL   +R TS++YAGI+ T L+YC++SW IE+KGPLYVSVF PL L+I A +SW  
Sbjct  243   VSSWSLSDAMRLTSSLYAGIICTGLSYCIISWTIERKGPLYVSVFTPLQLIITAFISWAF  302

Query  1064  LQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQ  1159
             L++K+YVGT +GS+LIV GLY VLWGK KE+ 
Sbjct  303   LREKLYVGTALGSLLIVGGLYSVLWGKSKEVD  334



>ref|XP_004302299.1| PREDICTED: auxin-induced protein 5NG4-like [Fragaria vesca subsp. 
vesca]
Length=364

 Score =   392 bits (1006),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 189/365 (52%), Positives = 256/365 (70%), Gaps = 7/365 (2%)
 Frame = +2

Query  158   GVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRI  337
             G   L  + M+ VQ  YA MNI SKLA+++ M+P V VAYRQ+FA++AIAP AY+ E + 
Sbjct  6     GNSYLPFLAMVFVQACYAGMNITSKLALEAEMSPLVLVAYRQVFATLAIAPFAYWMEWKT  65

Query  338   RPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIE  517
             RPQ+T+ ILF IFLCS+ G + NQ+ YFVGL  S+ T+ACALTN +PA+T++LAV F  E
Sbjct  66    RPQITMPILFQIFLCSLTGATANQVLYFVGLNKSSATVACALTNTLPAMTFILAVLFRQE  125

Query  518   KLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGST  697
                +++ AG AKV+GT +CV GAM+LSFYHG NIGIGES IHW YA  +   +  NN   
Sbjct  126   SAKMKSKAGLAKVMGTAVCVCGAMILSFYHGKNIGIGESKIHWSYAQKMGESSSGNNA--  183

Query  698   NAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFD  877
                 N  +GP L++VS L WA+W IIQ +VS+ +PAPY+ST LMC M+S++C L A+  +
Sbjct  184   ----NSFVGPILVLVSTLGWAMWFIIQAKVSDSFPAPYTSTTLMCLMASLECGLIAVSVE  239

Query  878   HKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSW  1057
             H    W+L   ++ T+ +Y+GI+G+A+A+   SWCI++KGPLYVSVF+PLLL+IVAV SW
Sbjct  240   HNAQAWALTNPMKLTAGLYSGIMGSAVAFFFTSWCIQRKGPLYVSVFSPLLLIIVAVSSW  299

Query  1058  GLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEEL  1237
              LL +K+Y+GT +GS+LIV GLY VLWGK +E   +     D +   + V  KE    +L
Sbjct  300   ALLDEKLYLGTALGSILIVAGLYSVLWGKTRETAKLEGKETDADTKLDAV-FKEFEKNDL  358

Query  1238  ELSAH  1252
             EL  H
Sbjct  359   ELQLH  363



>ref|XP_006344801.1| PREDICTED: WAT1-related protein At1g09380-like isoform X1 [Solanum 
tuberosum]
Length=376

 Score =   392 bits (1006),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 205/378 (54%), Positives = 272/378 (72%), Gaps = 17/378 (4%)
 Frame = +2

Query  155   MGVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERR  334
             MG +L+  ++M+IVQ+ YA M IISKL MD GMN FV  AYR +FA+++IAP A+F ER+
Sbjct  1     MGNELMVFMIMVIVQVAYAGMVIISKLVMDGGMNAFVQSAYRPIFATISIAPFAFFLERK  60

Query  335   IRPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGI  514
              RP+MT SILF IFLCSIFGI+ NQ  YF+GLKNSTPTI  A+ NLIPA T+++AVP GI
Sbjct  61    TRPKMTRSILFQIFLCSIFGITANQNIYFIGLKNSTPTIVSAIDNLIPAFTFIIAVPLGI  120

Query  515   EKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGS  694
             EKL +R+ AG+ K  GTI+CVGGAMLLS YHG  + IG+   HWKYA++ S   KD N  
Sbjct  121   EKLGLRSIAGQTKFWGTIICVGGAMLLSLYHGKVV-IGQLGFHWKYAENTS---KDVN--  174

Query  695   TNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICF  874
              +A  NF LGPFL+I+S+L++AIW IIQ RV+EKY APY+ST LMC M+S++CV+   C 
Sbjct  175   -SANSNFFLGPFLLILSSLTYAIWLIIQARVNEKYAAPYTSTTLMCLMASVECVIIGFCV  233

Query  875   DHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLS  1054
               K ++W+L   IRA S VY G + T+  Y L SWCIEKKGPLYVS+FNPL LVI A LS
Sbjct  234   VPKLSEWTLNP-IRAVSVVYNGAMATSFTYFLSSWCIEKKGPLYVSMFNPLFLVISAFLS  292

Query  1055  WGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQV--IGVVHVDEEEARN-------EV  1207
             W LL++K+Y+G +VGS+++V G+YG LWGK+ E     I V+ + +E+ ++       E+
Sbjct  293   WILLREKLYLGVVVGSIIVVAGMYGFLWGKRMETNAEDIDVLELTKEKKQSTKLQADLEL  352

Query  1208  ETKEDHLEELELSAHSII  1261
             +  ++H +    +   II
Sbjct  353   QLPQNHKDNNNNNMKQII  370



>ref|XP_009366070.1| PREDICTED: WAT1-related protein At1g09380 [Pyrus x bretschneideri]
Length=372

 Score =   391 bits (1005),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 195/370 (53%), Positives = 262/370 (71%), Gaps = 21/370 (6%)
 Frame = +2

Query  170   LALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQM  349
             +  + M++VQ  YA MNIISKLA++S M+P V VAYRQ+FA+VAIAP+AY  E + RP++
Sbjct  8     MPFMAMVLVQASYAGMNIISKLAIESDMDPLVLVAYRQVFAAVAIAPLAYLLEWKTRPKI  67

Query  350   TLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMI  529
             TL+ILF  FLCS+ G + NQ+ YF+GLK+ST TIACALTN +PA+T++LAV F  E   +
Sbjct  68    TLAILFQTFLCSLTGATANQVFYFLGLKSSTATIACALTNTLPAMTFILAVIFRQESAKL  127

Query  530   RTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQP  709
             ++  G +KV+GTI+CV GAMLLSFYHGH IG+ ES IHW YA  +         S++ + 
Sbjct  128   KSKPGLSKVMGTIVCVSGAMLLSFYHGHIIGLSESKIHWTYAQRM------GEASSSTKS  181

Query  710   NFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPT  889
             +  +GP  +I+S L WA W IIQ RV E +PAPY+ST LMC M+S +C + A+  DHK  
Sbjct  182   SSFIGPLFVILSTLGWAFWFIIQARVGESFPAPYTSTTLMCLMASFECGIIAVIADHKVA  241

Query  890   DWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQ  1069
              WSL+   R  +++YAGI+G+ALA+ L SW I++KGPLYVSVF+PLLL+IVA+ SW LL+
Sbjct  242   SWSLKDPTRLIASLYAGIMGSALAFFLSSWSIQQKGPLYVSVFSPLLLIIVAIASWALLE  301

Query  1070  DKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEAR--------NEVETKEDH  1225
             +K+YVGT VGSVLIV GLY VLWGK KE +       DE+ A+        ++ +  E +
Sbjct  302   EKLYVGTAVGSVLIVAGLYLVLWGKNKETK-------DEKPAKATGMTNMTDQAKAYEKN  354

Query  1226  LEELELSAHS  1255
               EL+L  HS
Sbjct  355   DLELQLQGHS  364



>ref|XP_008364022.1| PREDICTED: LOW QUALITY PROTEIN: WAT1-related protein At1g09380-like 
[Malus domestica]
Length=365

 Score =   389 bits (999),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 192/370 (52%), Positives = 255/370 (69%), Gaps = 21/370 (6%)
 Frame = +2

Query  170   LALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQM  349
             +  + M++VQ  YA MNIISKLA++S M+P V VAYRQ+ A VAIAP+AY  E + RP++
Sbjct  1     MPFMAMVLVQASYAGMNIISKLAIESNMDPXVLVAYRQVXAXVAIAPLAYLLEWKTRPKI  60

Query  350   TLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMI  529
             TL ILF  FLCS+ G + NQ+ YF+GLK+ST TIACALTN +PA+T++LAV F  E   +
Sbjct  61    TLPILFQTFLCSLTGATANQVFYFLGLKSSTATIACALTNTLPAMTFILAVIFRQESAKL  120

Query  530   RTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQP  709
             ++ AG +KV+GTI+CV GAML+SFYH H IG+GES IHW YA      N     S+    
Sbjct  121   KSKAGISKVMGTIVCVSGAMLISFYHXHIIGLGESKIHWTYAQRTGEANSSTKSSS----  176

Query  710   NFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPT  889
                +GP  +I+S L W  W IIQ RV E +PAPY+ST LMC M+S +C + A+  DHK  
Sbjct  177   --FIGPLFVILSTLGWXFWFIIQARVGESFPAPYTSTTLMCLMASFECGIIAVIADHKVA  234

Query  890   DWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQ  1069
              WSL+   R  +++YAGI+G+ALA+ L SW I++KGPLYVSVF+PL L+IVA+ SWGLL+
Sbjct  235   SWSLKDPTRLIASLYAGIMGSALAFFLSSWSIQRKGPLYVSVFSPLRLIIVAIASWGLLE  294

Query  1070  DKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEAR--------NEVETKEDH  1225
             +K+YVGT VGSVLIV GLY +LWGK KE +       DE+  +        ++ +  E +
Sbjct  295   EKLYVGTAVGSVLIVAGLYXLLWGKNKETK-------DEKPTKATGMTNMTDQAKAYEKN  347

Query  1226  LEELELSAHS  1255
               EL+L  HS
Sbjct  348   DLELQLQGHS  357



>ref|XP_004230334.1| PREDICTED: WAT1-related protein At1g09380-like [Solanum lycopersicum]
Length=366

 Score =   388 bits (996),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 196/359 (55%), Positives = 263/359 (73%), Gaps = 13/359 (4%)
 Frame = +2

Query  155   MGVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERR  334
             MG +LLA ++M+IVQLG+A M IISKL MD GMNPFV  AYR +FA+++IAP A++ ER+
Sbjct  1     MGKELLAFVVMVIVQLGFAGMIIISKLVMDGGMNPFVQSAYRPIFATISIAPFAFYFERK  60

Query  335   IRPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGI  514
              + ++T+ +LF IFLCSIFGI+ NQ  +F+GL NSTPTIA A+ NLIPA T+++AVP GI
Sbjct  61    NKSKLTIFVLFQIFLCSIFGITANQYAWFIGLTNSTPTIASAIDNLIPAFTFIIAVPLGI  120

Query  515   EKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGS  694
             EKL +R+ AG+AK  GTI+CVGGAMLLS YHG  + IG+   HWK A++     KD N  
Sbjct  121   EKLGLRSIAGQAKFWGTIVCVGGAMLLSLYHGKVV-IGQLGFHWKLAEN---TGKDVN--  174

Query  695   TNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICF  874
              +A  NF LGPFL+IV +L++AIW IIQT+++EKY APY+   LMC M+S++ V+   C 
Sbjct  175   -SAHSNFFLGPFLLIVCSLTYAIWLIIQTKLNEKYAAPYTCITLMCCMASVESVIIGFCV  233

Query  875   DHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLS  1054
               K ++W L   IRA S VY G V T+L + L SWCIEKKGPLYVS+FNPLLLVI A LS
Sbjct  234   VPKLSEWKLNP-IRAISVVYNGAVSTSLVFFLSSWCIEKKGPLYVSMFNPLLLVISAFLS  292

Query  1055  WGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLE  1231
             W LL++K+Y+G +VGS+++V GLYG LWGK+ E      + V++E+     ++ +  L+
Sbjct  293   WTLLREKLYLGVVVGSMIVVAGLYGFLWGKKME-----DIKVNKEKMNQLSKSIDLELQ  346



>ref|XP_010026180.1| PREDICTED: WAT1-related protein At1g09380-like [Eucalyptus grandis]
 gb|KCW58640.1| hypothetical protein EUGRSUZ_H01303 [Eucalyptus grandis]
Length=367

 Score =   388 bits (996),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 186/363 (51%), Positives = 255/363 (70%), Gaps = 10/363 (3%)
 Frame = +2

Query  164   DLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRP  343
             D+++ + M+IVQ+G+  M+ ISKLAMD G+NPFV +AYRQ+ A+VAI P A F ER+ RP
Sbjct  5     DVMSFLAMVIVQVGFTGMSFISKLAMDDGINPFVLIAYRQIIATVAITPFALFLERKTRP  64

Query  344   QMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKL  523
             ++T+ ILF IFL SI G S+NQ+ +F+GL NS+P IA A+TN +P +T++ A+ F  E  
Sbjct  65    KITVPILFYIFLSSITGASVNQVFFFMGLNNSSPMIAGAMTNTLPVLTFVFALIFKQESF  124

Query  524   MIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNA  703
              I+T  G+AKV+GT+LCVGGAMLLSFYHGH I    S I W YA+ ++ +       +  
Sbjct  125   GIKTKTGQAKVIGTVLCVGGAMLLSFYHGHTIADSSSGIRWNYAEKMTDKR------STY  178

Query  704   QPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHK  883
             + + ILGPFL+  SA S A+W IIQ ++S K+PAPY++T LMC M+S++C +        
Sbjct  179   KSHSILGPFLLFCSACSCALWFIIQAKLSPKFPAPYTATMLMCLMASVECSIIGAATKCN  238

Query  884   PTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGL  1063
               DWSLR  IR  +  Y GIV +ALA+C+MSWC+ +KGPLY S+F+PLLLV+  +LSW L
Sbjct  239   VADWSLRSKIRLIAVFYVGIVCSALAFCIMSWCVHRKGPLYTSIFSPLLLVMSTILSWAL  298

Query  1064  LQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELEL  1243
             L +K+Y+GT+VG+VLI+VGLY VLWGK KE +   +   DE EA  +   KED   EL+L
Sbjct  299   LHEKLYIGTLVGTVLIIVGLYSVLWGKGKEAEQARI--ADEMEAAGKYREKED--SELQL  354

Query  1244  SAH  1252
               H
Sbjct  355   RPH  357



>ref|XP_008370594.1| PREDICTED: LOW QUALITY PROTEIN: WAT1-related protein At1g09380 
[Malus domestica]
Length=365

 Score =   387 bits (995),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 192/370 (52%), Positives = 254/370 (69%), Gaps = 21/370 (6%)
 Frame = +2

Query  170   LALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQM  349
             +  + M++VQ  YA MNIISKLA++S M+P V VAYRQ+ A VAIAP+AY  E + RP++
Sbjct  1     MPFMAMVLVQASYAGMNIISKLAIESNMDPXVLVAYRQVXAXVAIAPLAYLLEWKTRPKI  60

Query  350   TLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMI  529
             TL ILF  FLCS+ G + NQ+ YF+GLK+ST TIACALTN +PA+T++LAV F  E   +
Sbjct  61    TLPILFQTFLCSLTGATANQVFYFLGLKSSTATIACALTNTLPAMTFILAVIFRQESAKL  120

Query  530   RTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQP  709
             ++ AG +KV+GTI+CV GAML+SFYH H IG+GES IHW YA      N     S+    
Sbjct  121   KSKAGISKVMGTIVCVSGAMLISFYHXHIIGLGESKIHWTYAQRTGEANSSTKSSS----  176

Query  710   NFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPT  889
                +GP  +I+S L W  W IIQ RV E +PAPY+ST LMC M+S +C + A+  DHK  
Sbjct  177   --FIGPLFVILSTLGWXFWFIIQARVGESFPAPYTSTTLMCLMASFECGIIAVIADHKVA  234

Query  890   DWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQ  1069
              WSL+   R  +++YAGI+G+ALA+ L SW I++KGPLYVSVF+PL L+IVA+ SWGLL+
Sbjct  235   SWSLKDPTRLIASLYAGIMGSALAFFLSSWSIQRKGPLYVSVFSPLRLIIVAIASWGLLE  294

Query  1070  DKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEAR--------NEVETKEDH  1225
             +K+YVGT VGSVLIV GLY  LWGK KE +       DE+  +        ++ +  E +
Sbjct  295   EKLYVGTAVGSVLIVAGLYXCLWGKNKETK-------DEKPTKATGMTNMTDQAKXYEKN  347

Query  1226  LEELELSAHS  1255
               EL+L  HS
Sbjct  348   DLELQLQGHS  357



>ref|XP_008463595.1| PREDICTED: WAT1-related protein At1g09380-like [Cucumis melo]
Length=372

 Score =   387 bits (994),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 197/360 (55%), Positives = 261/360 (73%), Gaps = 10/360 (3%)
 Frame = +2

Query  164   DLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRP  343
             D L  ++M++VQ  YA +NI SKLAM+ GMNP V VAYRQ+FA++AIAP AY+ ER+ RP
Sbjct  7     DFLPPLVMLVVQFLYAGLNITSKLAMEFGMNPLVLVAYRQMFATIAIAPCAYWFERKGRP  66

Query  344   QMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKL  523
             ++T  ILF I LCS+ G + NQ+ Y+VGLK STPTIACALTN++PA T++LAV F  E +
Sbjct  67    KITKPILFQILLCSLTGATGNQVFYYVGLKYSTPTIACALTNVLPAATFVLAVLFRQESV  126

Query  524   MIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNA  703
              I+T+ G AKV+GT++CVGGAMLLSFY G  I +GES IHWKYA  +   +  N GS+  
Sbjct  127   RIKTSPGAAKVIGTVVCVGGAMLLSFYRGQTIELGESGIHWKYAGLMRGGSSSNQGSS--  184

Query  704   QPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHK  883
                 I G   +I+S+++WA W +IQ RV+EK+PAPY+STALM FM++IQC   A+  +HK
Sbjct  185   ----IWGSLCLIISSVAWAAWFVIQARVNEKFPAPYTSTALMTFMATIQCGAIAVGIEHK  240

Query  884   P-TDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWG  1060
                 WSL+  IR   A+YAG+  + +A+CL SW I+KKGPLY SVF+P LLVIVA+ SW 
Sbjct  241   TLAAWSLKSSIRLVGALYAGVACSGMAFCLTSWSIQKKGPLYASVFSPFLLVIVAIFSWA  300

Query  1061  LLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVD--EEEARNEVETKEDHLEE  1234
               Q+K+YVGT+VGS+LIVVGLY VLWGK KE+++   + +    E   ++   KED LEE
Sbjct  301   FFQEKLYVGTVVGSLLIVVGLYAVLWGKTKEVKLQQHIEMTAAAEAKLDDYNNKED-LEE  359



>ref|XP_006344855.1| PREDICTED: WAT1-related protein At1g09380-like [Solanum tuberosum]
Length=373

 Score =   387 bits (993),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 201/376 (53%), Positives = 273/376 (73%), Gaps = 19/376 (5%)
 Frame = +2

Query  155   MGVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERR  334
             MG +++  ++M+IVQ+ +A M II+KL MDSGM+PFV  AY+ +FA+++IAP AYF ER+
Sbjct  1     MGNEIMIFMVMVIVQVAFAGMIIITKLVMDSGMDPFVQSAYKPIFATISIAPFAYFLERK  60

Query  335   IRPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGI  514
              RP+MT SILF IFLCSIFGI+ NQ  YF+GL NSTPTIA A+ NLIPA T+++AVP G+
Sbjct  61    TRPKMTRSILFQIFLCSIFGITANQYAYFIGLNNSTPTIASAIDNLIPAFTFIIAVPLGV  120

Query  515   EKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGS  694
             EK+ +R+ AG+AK  GTI+CVGGAMLLS YHG  + IG+   HWKY ++     KD N S
Sbjct  121   EKMGLRSIAGQAKFWGTIVCVGGAMLLSLYHG-KVVIGQLGFHWKYEEN---TGKDVNSS  176

Query  695   TNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICF  874
                  NF+LGPFL+I+++L++AIW IIQ RVSEKY APY+   LMC M+S++ V+   C 
Sbjct  177   ---HSNFLLGPFLLIMASLTYAIWLIIQGRVSEKYAAPYTCITLMCLMASVESVIIGFCV  233

Query  875   DHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLS  1054
               K ++W+L   IRA S VY G+V T+ AY L SWCIEKKGPLYVS+FNPLLLVI A LS
Sbjct  234   VPKLSEWALNP-IRAISVVYNGVVSTSFAYFLSSWCIEKKGPLYVSMFNPLLLVISAFLS  292

Query  1055  WGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARN-----EVE---  1210
             W LL++K+Y+G +VGS+++V GLYG LWGK+ E      + V++E+ +      ++E   
Sbjct  293   WTLLREKLYLGVVVGSIIVVAGLYGFLWGKKMETSAEN-IEVNKEKMKQFNKSVDLELQL  351

Query  1211  --TKEDHLEELELSAH  1252
               + + HLE  ++S+ 
Sbjct  352   PKSNDHHLESKQISSE  367



>ref|XP_006428234.1| hypothetical protein CICLE_v10012006mg [Citrus clementina]
 ref|XP_006480702.1| PREDICTED: WAT1-related protein At1g09380-like [Citrus sinensis]
 gb|ESR41474.1| hypothetical protein CICLE_v10012006mg [Citrus clementina]
 gb|KDO46013.1| hypothetical protein CISIN_1g037942mg [Citrus sinensis]
Length=369

 Score =   386 bits (992),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 199/358 (56%), Positives = 260/358 (73%), Gaps = 8/358 (2%)
 Frame = +2

Query  164   DLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRP  343
             DL+  + M+ VQLGYA MN  SKLA+DSGM P V VAYRQ+FA++A  P AYF E + RP
Sbjct  6     DLMPFLAMVTVQLGYAGMNFTSKLALDSGMKPLVLVAYRQMFATLATIPFAYFIEWKTRP  65

Query  344   QMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKL  523
             ++T  ILF IFLCS+ G + NQ+ YFVGL+NSTPTI CALTN++PA+T++LAV F  E +
Sbjct  66    KITWPILFQIFLCSVTGATGNQVLYFVGLENSTPTIGCALTNILPAITFVLAVIFRQEYV  125

Query  524   MIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNA  703
              I+T  G+AKV GTI+CVGGAM+LSFYHG   GI  SSIHWKYA+ +S +N  N      
Sbjct  126   AIKTKPGQAKVFGTIICVGGAMVLSFYHGKTFGIPNSSIHWKYAEKMSEENSGN------  179

Query  704   QPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHK  883
             + N ILG   II S++SWA W IIQT++S+K+PAPY+ T LMC +SSI C +  +  + K
Sbjct  180   KSNLILGSIAIIASSISWAAWVIIQTKLSKKFPAPYTCTTLMCLISSIMCSVIGLIVERK  239

Query  884   PTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGL  1063
                W L   IR  SA+Y+GIV +ALA+CL+ W I++KGPLYVSVF+PLLLVIVA++SW L
Sbjct  240   RAAWKLNATIRLVSALYSGIVCSALAFCLIVWSIQRKGPLYVSVFSPLLLVIVAIVSWAL  299

Query  1064  LQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEEL  1237
              Q+K+++GT +GSVLIV GLY VLWGK KEL+   V  + E E   + E+ +   ++L
Sbjct  300   FQEKLFIGTAIGSVLIVTGLYAVLWGKDKELKPDNV--IVEPELTKDAESGDIGQQQL  355



>ref|XP_004230333.1| PREDICTED: WAT1-related protein At1g09380-like [Solanum lycopersicum]
Length=368

 Score =   384 bits (987),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 204/378 (54%), Positives = 266/378 (70%), Gaps = 22/378 (6%)
 Frame = +2

Query  155   MGVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERR  334
             MG +L+  ++M+IVQ+ +A M II+KL MDSGM+PFV  AY+ +FA+++IAP AY  ER+
Sbjct  1     MGNELMIFMVMVIVQVAFAGMIIITKLVMDSGMDPFVQSAYKPIFATISIAPFAYVLERK  60

Query  335   IRPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGI  514
              RP+MT S  F IFLCSIFGI+ NQ  YF+GL NSTPTIA A+ NLIPA T+++AVP G+
Sbjct  61    TRPKMTRSTFFQIFLCSIFGITANQYAYFIGLNNSTPTIASAIDNLIPAFTFIIAVPLGV  120

Query  515   EKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGS  694
             EKL +R+ AG+ K  GTI+CVGGAMLLS YHG  + IG+   HWKY ++     KD N S
Sbjct  121   EKLGLRSIAGQTKFWGTIVCVGGAMLLSLYHGKVV-IGQLGFHWKYEEN---TGKDVNSS  176

Query  695   TNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICF  874
                  NF LGPFL+I+++L++AIW IIQ RVSEKY APY+   LMCFM+S++ V+   C 
Sbjct  177   ---HSNFFLGPFLLIMASLTYAIWLIIQGRVSEKYAAPYTCITLMCFMASVESVIIGFCV  233

Query  875   DHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLS  1054
               K ++W+L   IRA S VY G+V T+ AY L SWCIEKKGPLYVS+FNPLLLVI A LS
Sbjct  234   VPKLSEWALNP-IRAISVVYNGVVSTSFAYFLSSWCIEKKGPLYVSMFNPLLLVISAFLS  292

Query  1055  WGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEE  1234
             W LL++K+Y+G +VGS+++V GLYG LWGK+ E  V   + V++E+   +     D    
Sbjct  293   WTLLREKLYLGVVVGSIIVVAGLYGFLWGKKMETSVEN-IEVNKEKMMKQFNKSVD----  347

Query  1235  LELSAHSIITVDQFPKKN  1288
             LEL         Q PK N
Sbjct  348   LEL---------QLPKSN  356



>ref|XP_009625724.1| PREDICTED: WAT1-related protein At1g09380-like isoform X2 [Nicotiana 
tomentosiformis]
Length=354

 Score =   382 bits (982),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 193/373 (52%), Positives = 257/373 (69%), Gaps = 28/373 (8%)
 Frame = +2

Query  155   MGVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERR  334
             MG D L   +M++VQLG A   +ISKL MD GM+PFVH++YRQ+FA+++IAP AYF ER 
Sbjct  1     MGKDSLPFFLMVLVQLGGAGTAVISKLVMDEGMDPFVHLSYRQIFATISIAPFAYFFER-  59

Query  335   IRPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGI  514
                                 ++  Q+TY +GLKNST TI  AL NL+PA+T+LLA+  G+
Sbjct  60    --------------------VTAMQMTYLIGLKNSTATITTALANLVPAITFLLAILSGL  99

Query  515   EKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGS  694
             EK+ +RT AG AKV+GTILC+ GAMLLS YHG  + IG+  IHWKY++  S      N  
Sbjct  100   EKVGLRTKAGLAKVLGTILCICGAMLLSLYHGKVV-IGQLRIHWKYSEQTS-----KNIE  153

Query  695   TNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICF  874
              N+  NF LGPFL+I+S + +++W IIQ RV+E+Y APYSST LMCFM+S++CV+ A+C 
Sbjct  154   ANSHGNFFLGPFLVIISTIVYSLWLIIQPRVNERYAAPYSSTTLMCFMASLECVIVAVCV  213

Query  875   DHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLS  1054
             +H  T WSL   IRA S +Y GI+ +ALA+ LM+WCI++KGPLYVSVF PLLLVI A LS
Sbjct  214   NHDKTAWSLNP-IRAISVLYNGIISSALAFYLMTWCIKRKGPLYVSVFLPLLLVISAFLS  272

Query  1055  WGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEE  1234
             W LL +K+YVGT+VGS+L V+GLYG LWGK+K ++   VVHV EE+   E         E
Sbjct  273   WTLLGEKLYVGTVVGSILTVIGLYGFLWGKKKGMERTTVVHVKEEKVFKEKNQLTKIDLE  332

Query  1235  LELSAHSIITVDQ  1273
             L+ S  + +  ++
Sbjct  333   LQFSEKTNVNSNK  345



>ref|XP_006344800.1| PREDICTED: WAT1-related protein At1g09380-like isoform X2 [Solanum 
tuberosum]
Length=275

 Score =   379 bits (973),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 179/277 (65%), Positives = 225/277 (81%), Gaps = 7/277 (3%)
 Frame = +2

Query  401   LNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTAAGKAKVVGTILCVG  580
             +NQITYFVGLKN+TPTI+CAL+NL PAVT+LLA+PFG+E++ + + AG+AK++GTILCVG
Sbjct  1     MNQITYFVGLKNTTPTISCALSNLTPAVTFLLAIPFGLERVGLGSKAGQAKMLGTILCVG  60

Query  581   GAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFILGPFLIIVSALSWA  760
             GAMLLSFYHG  + I + +IHWKYA     Q+   N ST +  NFILGPFL+I+SA+SW 
Sbjct  61    GAMLLSFYHGSIVPIDQPNIHWKYA-----QDMTQNKSTTSHGNFILGPFLLIISAVSWG  115

Query  761   IWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWSLRQGIRATSAVYAG  940
             IWSI+Q ++S  Y APYSS+ALMC M+S QCV+  ICFDH  +DWSL   IRA S++Y+G
Sbjct  116   IWSILQAKLSMVYAAPYSSSALMCLMASFQCVIVGICFDHNISDWSLSHSIRAVSSIYSG  175

Query  941   IVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKIYVGTIVGSVLIVVG  1120
             +V TALAYCLMSWCIE+KGPLYVSVFNPLLLVIVA+LSWGLLQ+KIY+GT+VGS+LIV+G
Sbjct  176   VVCTALAYCLMSWCIERKGPLYVSVFNPLLLVIVAILSWGLLQEKIYIGTVVGSILIVLG  235

Query  1121  LYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLE  1231
             LYGVLWGK  EL++   +  DEE    E E ++  +E
Sbjct  236   LYGVLWGKNNELKL--PIEFDEEIGDIEKEKQKKDME  270



>ref|XP_004494524.1| PREDICTED: WAT1-related protein At1g09380-like [Cicer arietinum]
Length=377

 Score =   383 bits (983),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 195/368 (53%), Positives = 263/368 (71%), Gaps = 11/368 (3%)
 Frame = +2

Query  167   LLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQ  346
             L+ L +MI++QL YA MNI SKLA+  GMNP + VAYRQ+FA+V+IAP AYF ER + P+
Sbjct  7     LVPLFLMILIQLAYAGMNITSKLAILGGMNPLILVAYRQIFATVSIAPFAYFLERNMVPR  66

Query  347   MTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLM  526
             MT  I+  I L S+ G++ NQ+ YFVGLK ST TIACALTNL+PA T++LA+ F  E L 
Sbjct  67    MTKRIMVQILLSSLTGVTGNQVLYFVGLKYSTATIACALTNLLPAFTFILAILFRQENLG  126

Query  527   IRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQ  706
             I+  +G AK +GTILCVGGA+LLSFYHG  IGIGESSIHW YA+ +    +  + S+ AQ
Sbjct  127   IKKKSGVAKTIGTILCVGGAILLSFYHGKVIGIGESSIHWGYAEKI----EGGSNSSAAQ  182

Query  707   PNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKP  886
              N + GP ++++SAL W+ W IIQ  +S+ +P PY+STA MCF++S QCV  A+CFD K 
Sbjct  183   SNSLKGPIVLVLSALIWSAWFIIQADMSKNFPVPYTSTAYMCFLASFQCVFIALCFDRKV  242

Query  887   TDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLL  1066
             + WSL   +R TS++YAG++ T L+YC++SW IE+KGPLYVSVF PL L++ A++SW  +
Sbjct  243   SSWSLHDAMRLTSSLYAGVICTGLSYCIISWTIERKGPLYVSVFTPLQLILTAIISWAFI  302

Query  1067  QDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKE------DHL  1228
             ++K+YVGT +GS+LIV GLY VLWGK KE+ VI     D E     +   E      D  
Sbjct  303   REKLYVGTALGSLLIVAGLYAVLWGKSKEV-VIKDPDADHEAVVMPLPVNELGRINGDLK  361

Query  1229  EELELSAH  1252
              ++EL ++
Sbjct  362   NDMELLSY  369



>ref|XP_008350587.1| PREDICTED: WAT1-related protein At1g09380-like [Malus domestica]
Length=371

 Score =   382 bits (980),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 189/368 (51%), Positives = 259/368 (70%), Gaps = 15/368 (4%)
 Frame = +2

Query  164   DLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRP  343
             + +  + M++VQ  YA MNIISKLA++S M+P V VAYRQ+FA+  IAP+AY  E + RP
Sbjct  6     EYMPFMAMVLVQASYAGMNIISKLAIESDMDPLVLVAYRQVFATAVIAPLAYLMEWKTRP  65

Query  344   QMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKL  523
             ++TL ILF  FLCS+ G + NQ+ YF+GLK ST TIACAL N +PA+T++LAV F  E  
Sbjct  66    KITLPILFQTFLCSLTGATANQVFYFLGLKTSTATIACALQNTLPAMTFILAVIFRQESA  125

Query  524   MIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNA  703
              +++ AG +K +GTI+CV GAMLLSFYHGH IG+G+S IHW YA  +         S++ 
Sbjct  126   KLKSKAGLSKAMGTIVCVSGAMLLSFYHGHIIGLGDSKIHWTYAQRM------GEASSST  179

Query  704   QPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHK  883
             + +  +GP  +I+S L WA W IIQ RV E +PAPY+ST LMC M+S +C + A+  DHK
Sbjct  180   KSSSFIGPLFVILSTLGWAFWFIIQARVGESFPAPYTSTTLMCLMASFECGIIAVIADHK  239

Query  884   PTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGL  1063
                WSL+  IR  ++++AGI+G+ALA+ L SW I++KGPLYVSVF+PLLL+IVA+ SW L
Sbjct  240   AVSWSLKDPIRLVASLFAGIMGSALAFFLSSWSIQRKGPLYVSVFSPLLLIIVAIASWAL  299

Query  1064  LQDKIYVGTIVGSVLIVVGLYGVLWGKQKE------LQVIGVVH-VDEEEA--RNEVETK  1216
             L +K+YVGT VGSVLIV GLY VLWGK KE       +  G+    DE +A  ++++E +
Sbjct  300   LDEKLYVGTAVGSVLIVAGLYLVLWGKNKETKDEKPTKATGMTKTTDEAKAYEKSDLELQ  359

Query  1217  EDHLEELE  1240
             + H + + 
Sbjct  360   QVHPKSIR  367



>ref|XP_010092938.1| Auxin-induced protein 5NG4 [Morus notabilis]
 gb|EXB52991.1| Auxin-induced protein 5NG4 [Morus notabilis]
Length=389

 Score =   382 bits (981),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 186/361 (52%), Positives = 256/361 (71%), Gaps = 5/361 (1%)
 Frame = +2

Query  164   DLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRP  343
             D +  ++M+ VQ+ YA MNI SK+A++SGMNP V VAYRQ+FA++AI P +Y  E +  P
Sbjct  10    DCVPFLVMVFVQVCYAGMNITSKVALESGMNPLVLVAYRQIFATMAIGPFSYIMEWKTMP  69

Query  344   QMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKL  523
             ++T  ILF IFLCS+ G   NQ+ YF+GLK S+  IA AL+N++PAVT+LLAV F  E  
Sbjct  70    KITFPILFQIFLCSLTGAVANQVFYFLGLKYSSAIIASALSNILPAVTFLLAVIFRQESA  129

Query  524   MIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNA  703
              IR  +G AK+VGTILCVGGAM+LSFY G  IG+GE +++W Y   +      N  + N+
Sbjct  130   EIRKKSGIAKIVGTILCVGGAMMLSFYQGKVIGLGEPNMNWSYLQKVRESTTSN--TVNS  187

Query  704   QPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHK  883
              P  +LGP  II+S + WA W IIQ  +SEK+PAPY+ST LMCFM++++C       +HK
Sbjct  188   NP--LLGPIFIILSTVGWAAWFIIQAGMSEKFPAPYTSTTLMCFMATVECGAIGFVLEHK  245

Query  884   PTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGL  1063
              + WSLR   R  +++YAGI+G+A+A+ L SW I++KGPLYVSVF+PLLL+IVA+LSW L
Sbjct  246   ISAWSLRNDTRLVASLYAGIMGSAIAFFLTSWSIQRKGPLYVSVFSPLLLIIVAILSWAL  305

Query  1064  LQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHL-EELE  1240
             L++KIY+GT++GS  I+ GLY VLWGK KE++ I  +    E+A    +   D + E+LE
Sbjct  306   LKEKIYIGTVLGSTFIIAGLYAVLWGKGKEMERIQEIMTIAEDAIKASKANHDKINEDLE  365

Query  1241  L  1243
             L
Sbjct  366   L  366



>ref|XP_006344802.1| PREDICTED: WAT1-related protein At1g09380-like isoform X2 [Solanum 
tuberosum]
Length=373

 Score =   379 bits (974),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 200/378 (53%), Positives = 271/378 (72%), Gaps = 20/378 (5%)
 Frame = +2

Query  155   MGVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERR  334
             MG +LLA ++M+IVQLG+A M IISKL MD GMNPFV  AYR +FA+++IAP A++ ER+
Sbjct  1     MGSELLAFVVMVIVQLGFAGMIIISKLVMDGGMNPFVQSAYRPIFATISIAPFAFYFERK  60

Query  335   IRPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGI  514
                ++T+S+LF IFLCSIFGI+ NQ  +F+GL NSTPTIA A+ NLIPA T+++AVP GI
Sbjct  61    NESKLTVSVLFQIFLCSIFGITANQYAWFIGLTNSTPTIASAIDNLIPAFTFIIAVPLGI  120

Query  515   EKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGS  694
             EKL +R+ AG+AK  GTI+CVGGAMLLS YHG  + IG+   HWK+A++     KD N  
Sbjct  121   EKLGLRSIAGQAKFWGTIVCVGGAMLLSLYHGKVV-IGQLGFHWKFAEN---TGKDVNS-  175

Query  695   TNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICF  874
                  NF LGPFL+IV +L++AIW IIQT+V+EKY APY+   LMC M+S++ V+   C 
Sbjct  176   -----NFFLGPFLLIVCSLTYAIWLIIQTKVNEKYAAPYTCITLMCLMASVESVIIGFCI  230

Query  875   DHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLS  1054
               K ++W+L   IRA S VY G V T+L + L SWCIEKKGPLYVS+FNPLLLVI A LS
Sbjct  231   VPKLSEWALNP-IRAISVVYNGAVSTSLVFFLSSWCIEKKGPLYVSMFNPLLLVISAFLS  289

Query  1055  WGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQV--IGVVHVDEEEARN-------EV  1207
             W LL++K+Y+G +VGS+++V G+YG LWGK+ E     I V+ + +E+ ++       E+
Sbjct  290   WTLLREKLYLGVVVGSIIVVAGMYGFLWGKRMETNAEDIDVLELTKEKKQSTKLQADLEL  349

Query  1208  ETKEDHLEELELSAHSII  1261
             +  ++H +    +   II
Sbjct  350   QLPQNHKDNNNNNMKQII  367



>ref|XP_009335510.1| PREDICTED: WAT1-related protein At1g09380-like [Pyrus x bretschneideri]
Length=371

 Score =   379 bits (973),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 189/368 (51%), Positives = 257/368 (70%), Gaps = 15/368 (4%)
 Frame = +2

Query  164   DLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRP  343
             + +  + M++VQ  YA MNIISKLA++S M+P V VAYRQ+FA+  IAP AY  E + RP
Sbjct  6     EYMPFMAMVLVQASYAGMNIISKLAIESDMDPLVLVAYRQVFATAVIAPFAYLMEWKTRP  65

Query  344   QMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKL  523
             ++TL ILF  FLCS+ G + NQ+ YF+GLK ST TIACAL N +PA+T++LAV F  E  
Sbjct  66    KITLPILFQTFLCSLTGATANQVFYFLGLKTSTATIACALQNTLPAMTFILAVIFRQESA  125

Query  524   MIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNA  703
              +++ AG +K +GTI+CV GAMLLSFYHGH IG+G+S IHW YA  +         S++ 
Sbjct  126   KLKSKAGLSKAMGTIVCVSGAMLLSFYHGHIIGLGDSKIHWTYAQRM------GEASSST  179

Query  704   QPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHK  883
             + +  +GP  +I+S L WA W IIQ RV E +PAPY+ST LMC M+S +C + A+  DHK
Sbjct  180   KSSSFIGPLFVILSTLGWAFWFIIQARVGESFPAPYTSTTLMCLMASFECGIIAVIADHK  239

Query  884   PTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGL  1063
                WSL+  IR  ++++AGI+G+ALA+ L SW I+ KGPLYVSVF+PLLL+IVA+ SW L
Sbjct  240   AASWSLKDPIRLVASLFAGIMGSALAFFLSSWSIQLKGPLYVSVFSPLLLIIVAIASWAL  299

Query  1064  LQDKIYVGTIVGSVLIVVGLYGVLWGKQKE------LQVIGVVH-VDEEEA--RNEVETK  1216
             L +K+YVGT VGSVLIV GLY VLWGK KE       +  G+    DE +A  ++++E +
Sbjct  300   LDEKLYVGTAVGSVLIVAGLYLVLWGKNKETKDEKPTKATGMTKTTDEAKAYEKSDLELQ  359

Query  1217  EDHLEELE  1240
             + H + + 
Sbjct  360   QVHPKSIR  367



>ref|XP_009777190.1| PREDICTED: WAT1-related protein At1g09380-like isoform X2 [Nicotiana 
sylvestris]
Length=353

 Score =   379 bits (972),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 193/373 (52%), Positives = 256/373 (69%), Gaps = 29/373 (8%)
 Frame = +2

Query  155   MGVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERR  334
             MG D L   +M++VQLG A   IISKL MD GM+PFVH++YRQ+FA+++IAP AYF ER 
Sbjct  1     MGKDSLPFFLMVMVQLGGAGTAIISKLVMDEGMDPFVHLSYRQIFATISIAPFAYFFER-  59

Query  335   IRPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGI  514
                                 ++  Q+TY +GLKNST TI  AL NL+PA+T+LLAV  G+
Sbjct  60    --------------------VTAMQMTYLIGLKNSTATITTALANLVPAITFLLAVLSGL  99

Query  515   EKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGS  694
             EK+ +RT AG+AKV+GTILC+ GA+LLS YHG  + IG+  IHWKY++  S      N  
Sbjct  100   EKVGLRTKAGQAKVLGTILCICGAILLSLYHGKVV-IGQLRIHWKYSEQTS-----KNIE  153

Query  695   TNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICF  874
              N   NF LGPFL+I+S + +++W IIQ RV+E+Y APYSST LMCFM+S++CV+ A+C 
Sbjct  154   ANTHGNFFLGPFLVIISTIVYSLWLIIQPRVNERYAAPYSSTTLMCFMASLECVIVAVCV  213

Query  875   DHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLS  1054
             +   T WSL   IRA S +Y GI+ +ALA+ LM+WCI++KGPLYVSVF PLLLVI A LS
Sbjct  214   NRDKTAWSLNP-IRAISVLYNGIISSALAFYLMTWCIKRKGPLYVSVFLPLLLVISAFLS  272

Query  1055  WGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEE  1234
             W LL +K+YVGT+VGS+L V+GLYG LWGK+KE++    VH+ EE+   E         E
Sbjct  273   WTLLGEKLYVGTVVGSILTVIGLYGFLWGKKKEMER-NTVHIKEEKVLKEKNQLTKIGLE  331

Query  1235  LELSAHSIITVDQ  1273
             L+ S  + +  +Q
Sbjct  332   LQFSKKTNVNPNQ  344



>ref|XP_008453225.1| PREDICTED: WAT1-related protein At1g09380 [Cucumis melo]
Length=357

 Score =   378 bits (970),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 183/352 (52%), Positives = 258/352 (73%), Gaps = 10/352 (3%)
 Frame = +2

Query  185   MIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLSIL  364
             MII+Q+ YA +NIISKLAM SGMNP V + YRQ+F ++AIAP A+F+ER+ RP++T ++L
Sbjct  1     MIILQICYAGINIISKLAMQSGMNPLVLLTYRQIFGTLAIAPFAFFTERKTRPKITFTVL  60

Query  365   FNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTAAG  544
             F IF+CS+ G + NQI +FVGLK + PTI+ A+ N++PA T++LAV F  E + I+T +G
Sbjct  61    FQIFVCSLSGATGNQIFFFVGLKYTNPTISSAMANVLPAATFILAVLFRQESVRIKTKSG  120

Query  545   KAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFILG  724
              AKV+GTI+CV GAMLLSFYHGH I +GES IHW Y + L  +    NG    Q   +LG
Sbjct  121   FAKVIGTIVCVSGAMLLSFYHGHIINLGESKIHWSYVERLIKETTPTNG----QGKHVLG  176

Query  725   PFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWSLR  904
               L+++S+ +WA+W +IQ R+S K+ APY+STAL+CFM+  QC L A+  +H    WSL+
Sbjct  177   SILLLLSSFAWALWFVIQARLSVKFKAPYTSTALLCFMAFFQCGLIAVISEHNIAAWSLK  236

Query  905   QGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKIYV  1084
               IR  +A+YAG+V +AL + + SW I++KGPLYVS+F+PLLL+IVA+LSW LL  +++V
Sbjct  237   STIRLIAALYAGVVCSALTFSITSWAIQRKGPLYVSIFSPLLLIIVAILSWALLHQQLHV  296

Query  1085  GTIVGSVLIVVGLYGVLWGKQKELQVIGVVH------VDEEEARNEVETKED  1222
             GT++GSVLI++GLY VLWGK KE++V    H      +++    + VE K+D
Sbjct  297   GTVIGSVLIIIGLYAVLWGKSKEMKVEDHQHNMEKATIEKHNGSHIVEEKDD  348



>ref|XP_010921389.1| PREDICTED: WAT1-related protein At1g09380 [Elaeis guineensis]
Length=397

 Score =   379 bits (973),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 175/335 (52%), Positives = 254/335 (76%), Gaps = 5/335 (1%)
 Frame = +2

Query  155   MGVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERR  334
             MG D    + M++VQ+G+A +N++SKLA+D GM+P+V +AYRQ+ A++ I+PIA+F ER+
Sbjct  1     MGGDCTPTLAMVLVQVGFAGLNVVSKLALDDGMSPYVMIAYRQIVATLFISPIAFFLERK  60

Query  335   IRPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGI  514
              R  ++  I+F IFLCS+FG ++NQ+ YF+GLK STPTIA AL N++PA+T+++AVPF I
Sbjct  61    TRMAISGKIIFQIFLCSLFGATMNQLLYFIGLKYSTPTIASALNNMLPAITFIMAVPFRI  120

Query  515   EKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGS  694
             E + IRT AG+AKV+GT+LCVGG+M ++ Y G  + I  S +HW+YA++++S +  + G 
Sbjct  121   ETIGIRTLAGQAKVIGTMLCVGGSMEMTLYKGSLVKIWSSHVHWRYAENMTSSSGSDGGH  180

Query  695   TNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICF  874
                  N  LG  L+I S  +WAIW IIQ ++SE + +PY+S+AL+CFM++IQC++     
Sbjct  181   -----NMALGAALVIASCTTWAIWFIIQAKMSESFSSPYTSSALLCFMAAIQCLVIGAGV  235

Query  875   DHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLS  1054
             + K + WSL   IR  +++Y GIVG+ LA  LMSWCIEKKGPLYVS+F+PL LV+VAVL 
Sbjct  236   ERKLSAWSLGWDIRLAASLYIGIVGSGLAVSLMSWCIEKKGPLYVSMFSPLQLVVVAVLG  295

Query  1055  WGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQ  1159
             W +L +K+YVG++ GS+LIV GLY VLWGK++EL+
Sbjct  296   WAILDEKLYVGSVAGSILIVAGLYFVLWGKRRELK  330



>ref|XP_009623882.1| PREDICTED: WAT1-related protein At1g09380-like [Nicotiana tomentosiformis]
Length=441

 Score =   375 bits (964),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 186/350 (53%), Positives = 256/350 (73%), Gaps = 20/350 (6%)
 Frame = +2

Query  194   VQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLSILFNI  373
              ++GYA MN+++K+AM++GMNPFVHVAYRQ FA++ + PIAYFSER  RP MT SIL  I
Sbjct  106   TKIGYAGMNLLTKMAMNTGMNPFVHVAYRQTFAALIMCPIAYFSERHSRPAMTRSILLKI  165

Query  374   FLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTAAGKAK  553
             F+CSIFG S+NQITY VGL+N   T+A ALTNL+PA T++LAV  G EK+   T  G AK
Sbjct  166   FMCSIFGGSINQITYIVGLQNCNTTVASALTNLMPAFTFVLAVITGHEKVRF-TRVGIAK  224

Query  554   VVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFILGPFL  733
             ++GT+L +GGAM+LS YHG  + IG+  I+WK  + ++  +   +  TN      LGP L
Sbjct  225   MMGTVLSIGGAMMLSIYHGPRLPIGQPKINWKLLEGIAHHS---SSGTN-----YLGPLL  276

Query  734   IIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWSLRQGI  913
             +I SALSW+IWSIIQ RV+++Y A YSSTALMCFM+S  C++F  CFDH  +DWSL  G+
Sbjct  277   VITSALSWSIWSIIQARVNQEYAATYSSTALMCFMASCICLVFGFCFDHDLSDWSLNSGV  336

Query  914   RATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKIYVGTI  1093
             RA S +Y+G+  +AL+Y +MSWCI+++GP +VS+FNPL +++VA LSW LL ++I+ GTI
Sbjct  337   RAISTIYSGVFCSALSYFVMSWCIQREGPFFVSIFNPLPIIVVAALSWLLLGEEIFTGTI  396

Query  1094  VGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKED-HLEELE  1240
             VGS+LIV+GL+ VLWG            V+ + AR  + +++D  +E+LE
Sbjct  397   VGSMLIVLGLFMVLWGNW----------VESKRARTIINSEQDMAVEDLE  436



>ref|XP_008781052.1| PREDICTED: WAT1-related protein At1g09380 [Phoenix dactylifera]
Length=377

 Score =   372 bits (956),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 174/344 (51%), Positives = 256/344 (74%), Gaps = 4/344 (1%)
 Frame = +2

Query  155   MGVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERR  334
             MG D +  + M++VQ+G+A +N++SKLA+D GM+P+V + YRQ+ A++ IAPIA+F ER+
Sbjct  1     MGGDCIPTLAMVLVQVGFAGLNVVSKLALDDGMSPYVMITYRQIVATLFIAPIAFFLERK  60

Query  335   IRPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGI  514
              R  ++  I+F IFLCS+FG + NQ+ YF+GLK STPTIA AL N++PA+T+++AVPF +
Sbjct  61    TRMAISGKIIFQIFLCSLFGATANQLLYFLGLKYSTPTIASALNNMLPAITFVMAVPFRM  120

Query  515   EKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGS  694
             E + IRT AG+AKV+GT+LCVGG+M ++FY G  + I  S IHW+YA+ ++S    + G 
Sbjct  121   ETIGIRTLAGQAKVIGTVLCVGGSMEMTFYKGSLVKIWSSRIHWRYAEGMAS----STGG  176

Query  695   TNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICF  874
             ++   +  LG  LII S ++WA+W IIQ ++SE + +PY+S+AL+CFM++IQC++     
Sbjct  177   SDDGRSMALGAALIIASCIAWAVWFIIQAKMSESFSSPYTSSALLCFMAAIQCLVIGAGV  236

Query  875   DHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLS  1054
             + K + W L   IR  + +Y G+VG+ALA  LMSWCIEKKGPLYVS+F+PL LV+VAVL 
Sbjct  237   ERKLSAWRLGWDIRLVTTLYNGVVGSALAVSLMSWCIEKKGPLYVSMFSPLQLVVVAVLG  296

Query  1055  WGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDE  1186
             W +L +++YVG++ GS+LIV GLY VLWGK +EL+ +  + V  
Sbjct  297   WAVLDERLYVGSVTGSILIVGGLYLVLWGKGRELKKLSNIGVKN  340



>gb|AAC33198.1| Similar to MtN21, gi|2598575, Megicago truncatula nodulation 
induced gene [Arabidopsis thaliana]
Length=385

 Score =   372 bits (955),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 184/370 (50%), Positives = 262/370 (71%), Gaps = 18/370 (5%)
 Frame = +2

Query  164   DLLALIMMIIVQLGYAVMNIISKLAMDSGMNP--FVHVAYRQLFASVAIA---------P  310
             D+L  + M++VQ+GYA MNI SK+AM++  +   F+++  +       +           
Sbjct  5     DMLPFLAMVLVQIGYAGMNITSKMAMEAENDEIIFININVKMNVKKNVVKKKKTKKWCRA  64

Query  311   IAYFSERRIRPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTY  490
             I    + + RP++TL IL  +F CSI G + NQ+ YFVGL+NS+PTIACALTNL+PAVT+
Sbjct  65    IFICQDTKTRPKITLRILVQVFFCSITGATGNQVLYFVGLQNSSPTIACALTNLLPAVTF  124

Query  491   LLAVPFGIEKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSS  670
             LLA  F  E + I+ A+G+AKV+GT++CV GAM+LSFYHGH IGIGES IHW YA++++ 
Sbjct  125   LLAAIFRQETVGIKKASGQAKVIGTLVCVIGAMVLSFYHGHTIGIGESKIHWAYAENIT-  183

Query  671   QNKDNNGSTNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQ  850
                  +GS++   NF LGPFLI+ +A+SWA W IIQT++SE + APY+ST LMC M SIQ
Sbjct  184   ----KHGSSSGHSNFFLGPFLIMAAAVSWAAWFIIQTKMSETFAAPYTSTLLMCLMGSIQ  239

Query  851   CVLFAICFDHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLL  1030
             C   A+  DH  +DWSL   +R  SA+YAG+V +ALA+CLMSW +++KGPLYVSVF+PLL
Sbjct  240   CGAIALISDHTISDWSLSSPLRFISALYAGVVASALAFCLMSWAMQRKGPLYVSVFSPLL  299

Query  1031  LVIVAVLSWGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVE  1210
             LV+VA+ SW LL++K+Y GT +GS L+V+GLYGVLWGK +E+          ++  ++V+
Sbjct  300   LVVVAIFSWALLEEKLYTGTFMGSALVVIGLYGVLWGKDREVSEKEEEREKVKQQNHKVK  359

Query  1211  TKEDHLEELE  1240
             ++ +  E++E
Sbjct  360   SESN--EDIE  367



>ref|XP_010270887.1| PREDICTED: WAT1-related protein At1g09380 isoform X2 [Nelumbo 
nucifera]
Length=331

 Score =   369 bits (948),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 181/333 (54%), Positives = 242/333 (73%), Gaps = 7/333 (2%)
 Frame = +2

Query  164   DLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRP  343
             + L  I MI+VQ+GYA MNI+SKLA+DSGM+P V V YRQ+ A++ I+P AYF ER+ RP
Sbjct  4     EFLPCIAMIMVQIGYAGMNILSKLAIDSGMSPLVMVTYRQIVATIIISPFAYFWERKTRP  63

Query  344   QMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKL  523
             ++T + LF IFL S+FGI+ NQ  YF+GLK STPTI CALTNL+PAVT+++AVPFG+EK+
Sbjct  64    RITSATLFQIFLSSLFGIAGNQCLYFIGLKYSTPTIGCALTNLLPAVTFIMAVPFGMEKV  123

Query  524   MIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNA  703
              +R  AG+AKV+GT++CVGGAML+SFY G  I I +S+IHW+Y D ++     N+  T  
Sbjct  124   GLRRKAGQAKVLGTVMCVGGAMLMSFYKGIRIPIPDSAIHWRYVDSITESGSSNDKVT--  181

Query  704   QPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHK  883
                 +LG  ++I S +SW  W I+Q +VSE + APYSSTALMC M SI+C + A+  DH+
Sbjct  182   ----LLGSLILIASVISWGAWFIMQAKVSETFSAPYSSTALMCLMGSIECGIIAVTADHQ  237

Query  884   PTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGL  1063
              + WSL   IR  +++Y+G+V +A A  LMSWCIEKKGPLYVS F+PLLLVIVAV+ W L
Sbjct  238   VSAWSLHSSIRLITSLYSGLVASAFAIYLMSWCIEKKGPLYVSAFSPLLLVIVAVIGWAL  297

Query  1064  LQDKIYVGTIVG-SVLIVVGLYGVLWGKQKELQ  1159
             L DK+Y+G I   S   +    G  +G ++E Q
Sbjct  298   LADKLYMGRICADSHGAICRPMGQGYGDEREKQ  330



>ref|XP_010314776.1| PREDICTED: WAT1-related protein At1g09380-like isoform X1 [Solanum 
lycopersicum]
Length=352

 Score =   365 bits (937),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 179/353 (51%), Positives = 254/353 (72%), Gaps = 10/353 (3%)
 Frame = +2

Query  155   MGVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERR  334
             MG D+L L++M+IVQLGYA   I+SKL MD GM+P+VH++YRQ+ A+++IAP AYF ER+
Sbjct  1     MGKDVLPLLLMVIVQLGYAGTAIVSKLVMDEGMDPYVHLSYRQILATISIAPFAYFFERK  60

Query  335   IRPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGI  514
              RP++T   LF IFLCS+ G++  Q+T  +GL+NST TI  A+ NLIPA T+LLA+   +
Sbjct  61    TRPKLTPFSLFLIFLCSVLGVTAMQMTCIIGLRNSTATITSAMANLIPANTFLLALICRL  120

Query  515   EKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGS  694
             EKL ++T AG+AK++GTI+C+GGAMLLS YHG  + IG+    WKY+ H      +N   
Sbjct  121   EKLGLKTKAGQAKMMGTIMCIGGAMLLSLYHG-KVVIGKLGFQWKYSQH------NNTSK  173

Query  695   TNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICF  874
              N+  NF  GPFL+I+S + +++W IIQ  V+ +Y APY+ST LM FM+S++CV+ AIC 
Sbjct  174   NNSHGNFFNGPFLVIISTMVYSLWLIIQPSVNMRYAAPYTSTTLMFFMASLECVIVAICV  233

Query  875   DH-KPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVL  1051
             +H   T WSL   IRA S +Y GIV +ALA  L++WCI++KGPLYVS+F PL L+  A L
Sbjct  234   NHDDKTAWSLNP-IRAISVLYNGIVSSALALYLVTWCIKRKGPLYVSMFLPLQLIFSAFL  292

Query  1052  SWGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVE  1210
             SW LL +K+Y GT +GS+  ++GLY  LWGK+K++     ++V EE ++ + +
Sbjct  293   SWTLLGEKLYTGTFIGSITTIIGLYCFLWGKKKDMND-NTINVKEEISKEKKQ  344



>ref|XP_004144805.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
 ref|XP_004158740.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
Length=357

 Score =   365 bits (937),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 182/360 (51%), Positives = 260/360 (72%), Gaps = 12/360 (3%)
 Frame = +2

Query  185   MIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLSIL  364
             MII+Q+ YA +NIISKLAM SGMNP V + YRQ+F ++AIAP A+ +ER+ RP++T ++L
Sbjct  1     MIILQICYAGINIISKLAMQSGMNPLVLLTYRQIFGTLAIAPFAFLTERKTRPKITFAVL  60

Query  365   FNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTAAG  544
             F IF+CS+ G + NQI +FVGLK + PTI+ A+ N++PA T++LAV F  E + I+T +G
Sbjct  61    FQIFVCSLSGATGNQIFFFVGLKYTNPTISSAMANVLPAATFILAVLFRQESVRIKTKSG  120

Query  545   KAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFILG  724
              AKV+GTI+CV GAMLLSFYHGH I +GES IHW Y + L  +    NG    Q   +LG
Sbjct  121   FAKVIGTIVCVSGAMLLSFYHGHTIDLGESRIHWSYVERLIKETTPTNG----QGKHVLG  176

Query  725   PFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWSLR  904
               L+++S+ SWA+W +IQ R+S K+ APY+STAL+CFM+  QC L A+  +H    WSL+
Sbjct  177   SILLLLSSFSWALWFVIQARLSVKFKAPYTSTALLCFMAFFQCGLIAVISEHNIAAWSLK  236

Query  905   QGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKIYV  1084
               IR  +A+YAG+V +AL + + SW I++KGPLYVS+F+PLLL+IVA++SW LL  +++ 
Sbjct  237   SSIRLVAALYAGVVCSALTFSITSWTIQRKGPLYVSIFSPLLLIIVAIISWALLHQQLHA  296

Query  1085  GTIVGSVLIVVGLYGVLWGKQKELQVIGVVH------VDEEEARNEVETKEDHLEELELS  1246
             GT++GSVLI+ GLY VLWGK KE++V    H      +++    + +E K+D   EL+++
Sbjct  297   GTVIGSVLIITGLYAVLWGKSKEMKVEDAQHNMEKPTIEKHNGSHIIEEKDDF--ELQIT  354



>ref|XP_009417762.1| PREDICTED: WAT1-related protein At1g09380-like [Musa acuminata 
subsp. malaccensis]
Length=376

 Score =   360 bits (924),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 176/351 (50%), Positives = 260/351 (74%), Gaps = 6/351 (2%)
 Frame = +2

Query  155   MGVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERR  334
             MG D    + M+ VQ+G+A +N++SKLAMD GM+PFV +AYRQ+ A++ ++PIA+F ER+
Sbjct  1     MGGDCTPTLAMVFVQVGFAGLNVLSKLAMDDGMSPFVMIAYRQIVATIFLSPIAFFLERK  60

Query  335   IRPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGI  514
                ++T  +LF IFLCS+FG + NQI YFVGLK S+PTIACAL+N++PA+T+++AVPF +
Sbjct  61    ASKEITGKVLFQIFLCSVFGATSNQILYFVGLKFSSPTIACALSNMLPAITFVIAVPFRM  120

Query  515   EKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGS  694
             E + IRT AG+AKVVGT+LCVGG+ML++FY G  I + +S +HW+YA+ +++      GS
Sbjct  121   ETVGIRTVAGQAKVVGTVLCVGGSMLMTFYRGGLIKMWQSPLHWRYAERMTT---GEAGS  177

Query  695   TNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICF  874
                +  F  G  L+I S  +WAIW IIQ ++S+ + +PY+S+A+MCFM+S+QC++ A   
Sbjct  178   DYQRMGF--GAVLVIASCFAWAIWFIIQAKMSQSFSSPYTSSAIMCFMASVQCIVVAAAV  235

Query  875   DHKP-TDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVL  1051
             + +  + W+L   IR  +++Y G+VG+ LA+ LMSWC++K+GPL+VS+F+PLLLV+VAVL
Sbjct  236   ERRRLSAWALGWNIRLAASLYIGLVGSGLAFALMSWCLQKRGPLFVSMFSPLLLVVVAVL  295

Query  1052  SWGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNE  1204
              W +L +K YVG++ GSV+IV GLY VLWGK +E +        E EA +E
Sbjct  296   GWAILDEKQYVGSVAGSVVIVGGLYLVLWGKGRETKKTRDASGKETEAEHE  346



>ref|XP_009387482.1| PREDICTED: WAT1-related protein At1g09380-like [Musa acuminata 
subsp. malaccensis]
Length=375

 Score =   358 bits (920),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 162/332 (49%), Positives = 246/332 (74%), Gaps = 4/332 (1%)
 Frame = +2

Query  164   DLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRP  343
             D    + M+ VQ+G+A +N++SKLA+D GM+PFV +AYRQL A++ ++P+A F ER+   
Sbjct  4     DCTPTLAMVAVQVGFAGLNVLSKLALDDGMSPFVMIAYRQLVATLFLSPLAIFLERKACR  63

Query  344   QMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKL  523
             ++T  ++  IF CS+FG +LNQ+ YF+GLK S+PTIACAL N++PA+T+++AVPF +E +
Sbjct  64    EITRRVIIQIFFCSVFGATLNQVLYFLGLKYSSPTIACALNNMLPAITFIMAVPFRMETV  123

Query  524   MIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNA  703
              IRT  G+AKV+GT+LCV G+ML++FY G  I +  S IHW+YA+ ++  + +N     +
Sbjct  124   GIRTLGGQAKVMGTLLCVSGSMLMTFYRGSLIKVWRSHIHWRYAEEMTISSANN----AS  179

Query  704   QPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHK  883
               N  +G  L+I S L+WA+W IIQ ++S+ + +PY+S+ALMCFM+ +QC + A   +  
Sbjct  180   DQNMAVGAALVISSCLAWAVWFIIQAKMSKSFSSPYTSSALMCFMAGVQCFVIAAGVERS  239

Query  884   PTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGL  1063
              + W+L   IR  +++Y G+VG+ LA  LMSWCI+K+GPL+VS+F+PLLLVIV++L W +
Sbjct  240   FSAWALGWDIRLAASLYTGLVGSGLAVSLMSWCIQKRGPLFVSMFSPLLLVIVSILGWAI  299

Query  1064  LQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQ  1159
             L +K+YVG++ GS LIV GLY VLWGK +E++
Sbjct  300   LDEKLYVGSVTGSALIVGGLYSVLWGKGREIK  331



>emb|CDY64772.1| BnaC08g49990D, partial [Brassica napus]
Length=303

 Score =   352 bits (902),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 167/300 (56%), Positives = 222/300 (74%), Gaps = 5/300 (2%)
 Frame = +2

Query  341   PQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEK  520
             P++T+ +L   F CSI G++ NQ+ YF+GL+NS+PTIACALTNL+PAVT+LLA  F  E 
Sbjct  4     PKITIRVLVQAFFCSITGVTGNQVLYFIGLQNSSPTIACALTNLLPAVTFLLAAIFRQEA  63

Query  521   LMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTN  700
             + IR  +G+AKV+GT++CV GAMLLSFYHGH IGIGES IHW YA ++++   D+ GS  
Sbjct  64    VGIRKVSGQAKVIGTVVCVAGAMLLSFYHGHTIGIGESKIHWTYAQNITTHGSDSAGS--  121

Query  701   AQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDH  880
                NF LGPFLI+ +A+S A W IIQT++SE + APY+ST LMC M SIQC + A+  DH
Sbjct  122   ---NFFLGPFLIMAAAVSCAGWFIIQTKMSETFAAPYTSTLLMCLMGSIQCGVVALISDH  178

Query  881   KPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWG  1060
             K  DWSL   +R  S +YAG+V +ALA+CLMSW I  KGPLYVSVF+PL+LVIVAV SW 
Sbjct  179   KLADWSLSSPLRLISVLYAGVVASALAFCLMSWAINIKGPLYVSVFSPLVLVIVAVFSWT  238

Query  1061  LLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELE  1240
             LL++K+Y GT +GS L+V+GLYGVLWGK +E+        ++++ + +   K D  E++E
Sbjct  239   LLEEKLYTGTFMGSALVVIGLYGVLWGKDREMNEKEDEVENQKKVKQQPTVKRDVNEDIE  298



>emb|CDY06357.1| BnaA09g48460D [Brassica napus]
Length=296

 Score =   347 bits (890),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 170/300 (57%), Positives = 219/300 (73%), Gaps = 13/300 (4%)
 Frame = +2

Query  353   LSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIR  532
             + +L   F CSI G++ NQ+ YF+GL+NS+PTIACALTNL+PAVT+LLA  F  E + IR
Sbjct  1     MRVLVQAFFCSITGVTGNQVLYFIGLQNSSPTIACALTNLLPAVTFLLAAIFRQESVGIR  60

Query  533   TAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPN  712
               +G+AKV+GT++CV GAMLLSFYHGH IGIGES IHW YA ++++   D+ GS     N
Sbjct  61    KVSGQAKVIGTVVCVAGAMLLSFYHGHTIGIGESKIHWTYAQNITAHGSDSAGS-----N  115

Query  713   FILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTD  892
             F LGPFLI+ +A+S A W IIQT++SE + APY+ST LMC M SIQC + A+  DHK  D
Sbjct  116   FFLGPFLIMAAAVSCAGWFIIQTKMSETFAAPYTSTLLMCLMGSIQCGVVALISDHKLAD  175

Query  893   WSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQD  1072
             WSL   +R  SA+YAG+V +ALA+CLMSW I  KGPLYVSVF+PL+LVIVAV SW LL++
Sbjct  176   WSLSSPLRLISALYAGVVASALAFCLMSWAINIKGPLYVSVFSPLVLVIVAVFSWTLLEE  235

Query  1073  KIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEE----ARNEVETKEDHLEELE  1240
             K+Y GT +GS L+V+GLYGVLWGK +E+        DE E    A+ +   K D  E++E
Sbjct  236   KLYTGTFMGSALVVIGLYGVLWGKDREMN----EKEDEVEIQKMAKQQPTVKRDINEDIE  291



>ref|XP_003589590.1| Auxin-induced protein 5NG4 [Medicago truncatula]
 gb|AES59841.1| nodulin MtN21/EamA-like transporter family protein [Medicago 
truncatula]
Length=373

 Score =   348 bits (894),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 175/367 (48%), Positives = 249/367 (68%), Gaps = 15/367 (4%)
 Frame = +2

Query  197   QLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLSILFNIF  376
             QL YA MNI SKL++  GMNP + VAYRQ+F +V+IAP AY+ ER   P+MT  I+  I 
Sbjct  16    QLAYAWMNITSKLSILGGMNPLILVAYRQIFGAVSIAPFAYWIERDKVPRMTKRIMVQIL  75

Query  377   LCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTAAGKAKV  556
             L S+ G++ +QI YF+GLK STP IACALTNL  A T++LA+ F  E L I+  +G AKV
Sbjct  76    LSSLTGVTGSQILYFIGLKYSTPIIACALTNLDTAFTFVLAILFRQENLGIKKKSGVAKV  135

Query  557   VGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFILGPFLI  736
             VGT+LC+GGA++LSFYH   I + ES +HW YA+ L   + + +    AQ   +LGP L+
Sbjct  136   VGTVLCIGGAVVLSFYHAKVIDVPESRVHWSYAEKLEHGHLNFSA---AQSTSLLGPVLL  192

Query  737   IVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWSLRQGIR  916
             I++AL W++W IIQ  +S+ +P PY+STA MC + SIQCV  A+CFDH  + WSL   +R
Sbjct  193   ILNALVWSLWFIIQADMSKNFPVPYTSTAYMCILGSIQCVFIALCFDHSVSAWSLHDAMR  252

Query  917   ATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKIYVGTIV  1096
               S++++G++ T +++ ++SW I +KGPLYVSVF PL L++ A +SW  +Q+K+YVGT +
Sbjct  253   LASSLHSGVICTGISFPIISWTIGRKGPLYVSVFTPLQLILTAFISWAFIQEKLYVGTAI  312

Query  1097  GSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEA-----RNEVETKEDHLEELELSAHSII  1261
             GS+LIV GLY  LWGK KE   +    VD +EA        ++  E +  ++EL ++   
Sbjct  313   GSLLIVGGLYAFLWGKSKE---VDNNKVDHDEAIVMTLPPPIKKDEVNKNDMELQSY---  366

Query  1262  TVDQFPK  1282
              + +FPK
Sbjct  367   -MHEFPK  372



>ref|XP_002455503.1| hypothetical protein SORBIDRAFT_03g012300 [Sorghum bicolor]
 gb|EES00623.1| hypothetical protein SORBIDRAFT_03g012300 [Sorghum bicolor]
Length=400

 Score =   348 bits (894),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 171/354 (48%), Positives = 245/354 (69%), Gaps = 3/354 (1%)
 Frame = +2

Query  155   MGVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERR  334
             MG + +  + M++VQLG+A MN++SKLA+++GM+P+V +AYR L A+  I+P+AYF ERR
Sbjct  1     MGKNCVPPVAMVLVQLGFAGMNVVSKLALEAGMSPYVLIAYRNLIAAAVISPVAYFVERR  60

Query  335   IRPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGI  514
                 +T  +L  IF  SIFG +LNQ+ YFVGLK+++PT+ACALTN +PA+T+++A    +
Sbjct  61    SGATITKKVLLQIFFSSIFGATLNQVLYFVGLKSTSPTVACALTNTLPALTFVMAAALKM  120

Query  515   EKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYA-DHLSSQNKDNNG  691
             E +   TAAG+AK+VGT +CVGG+M++ FY G  +G+  S IHW++A +H  +    +  
Sbjct  121   ESVRPGTAAGQAKLVGTAVCVGGSMVIPFYKGPELGLWASPIHWRFAEEHSIAAAPSSAA  180

Query  692   STNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAIC  871
             +       +LG  LII S ++WA+W I+ T++SE + APY+STA+MC M+ +QC   +  
Sbjct  181   AGGHAGAAVLGDVLIIASCVAWAVWFILHTKMSEGFSAPYTSTAIMCLMAGVQCAGVSAA  240

Query  872   FDHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVL  1051
              D     W L   IR  S +Y GIVG+ + + +MSWCI+ +GPLYVS+F+PLLLVIVAV+
Sbjct  241   MDRSLDVWKLGCDIRLYSVLYIGIVGSGIGFTVMSWCIQARGPLYVSMFSPLLLVIVAVV  300

Query  1052  SWGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHV--DEEEARNEV  1207
              W +L +KI VGT VGSVLIV GLY VLWGK +E+   GV +   DEE A   V
Sbjct  301   GWAILGEKIRVGTAVGSVLIVAGLYMVLWGKGREMDRPGVDNDKGDEESAGGAV  354



>ref|XP_009794905.1| PREDICTED: WAT1-related protein At1g09380-like, partial [Nicotiana 
sylvestris]
Length=321

 Score =   345 bits (886),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 171/317 (54%), Positives = 229/317 (72%), Gaps = 8/317 (3%)
 Frame = +2

Query  323   SERRIRPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAV  502
             + R+ RP++T S +F IFLCSIFG++  Q+TY +GLKNST TI  AL NL+PA+T+LLAV
Sbjct  4     NHRKTRPKLTPSTVFLIFLCSIFGVTAMQMTYLIGLKNSTATITTALANLVPAITFLLAV  63

Query  503   PFGIEKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKD  682
               G+EK+ +RT AG+AKV+GTILC+ GA+LLS YHG  + IG+  IHWKY++  S     
Sbjct  64    LSGLEKVGLRTKAGQAKVLGTILCICGAILLSLYHG-KVVIGQLRIHWKYSEQTS-----  117

Query  683   NNGSTNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLF  862
              N   N   NF LGPFL+I+S + +++W IIQ RV+E+Y APYSST LMCFM+S++CV+ 
Sbjct  118   KNIEANTHGNFFLGPFLVIISTIVYSLWLIIQPRVNERYAAPYSSTTLMCFMASLECVIV  177

Query  863   AICFDHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIV  1042
             A+C +   T WSL   IRA S +Y GI+ +ALA+ LM+WCI++KGPLYVSVF PLLLVI 
Sbjct  178   AVCVNRDKTAWSLNP-IRAISVLYNGIISSALAFYLMTWCIKRKGPLYVSVFLPLLLVIS  236

Query  1043  AVLSWGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKED  1222
             A LSW LL +K+YVGT+VGS+L V+GLYG LWGK+KE++    VH+ EE+   E      
Sbjct  237   AFLSWTLLGEKLYVGTVVGSILTVIGLYGFLWGKKKEMER-NTVHIKEEKVLKEKNQLTK  295

Query  1223  HLEELELSAHSIITVDQ  1273
                EL+ S  + +  +Q
Sbjct  296   IGLELQFSKKTNVNPNQ  312



>ref|XP_009794851.1| PREDICTED: WAT1-related protein At1g09380-like isoform X1 [Nicotiana 
sylvestris]
Length=299

 Score =   339 bits (869),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 170/305 (56%), Positives = 222/305 (73%), Gaps = 20/305 (7%)
 Frame = +2

Query  326   ERRIRPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVP  505
              R+ +PQ+T SILF IFLCS  G++++QI YFVGLKNSTPTIACAL+NLIPA T+LLA+P
Sbjct  10    SRKTKPQLTSSILFWIFLCSFSGLTVSQIAYFVGLKNSTPTIACALSNLIPAATFLLAIP  69

Query  506   FGIEKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDN  685
             FG+EK+  R+ AG+AK  GTI+CVGGAMLLS YHG  I IG+S IHWK+A++  ++ K++
Sbjct  70    FGLEKVGFRSKAGQAKACGTIICVGGAMLLSLYHGP-IVIGQSGIHWKFAEN--TEEKNS  126

Query  686   NGSTNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFA  865
              G      N ILGP L+IVS + +++W I Q RVSEKY APY+ST LMC M+S QCV+  
Sbjct  127   TGHV----NLILGPLLLIVSTIFYSLWIIFQARVSEKYAAPYTSTMLMCLMASFQCVIIG  182

Query  866   ICFDHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVA  1045
             +        WSL + +R  + +Y GIV TAL YCL SWCI++KGPLYVSVF PL+L+I A
Sbjct  183   VFVVRDKAAWSLDR-MRTIAVLYNGIVCTALGYCLTSWCIQRKGPLYVSVFYPLMLIITA  241

Query  1046  VLSWGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDH  1225
             VLSW LL++K+Y+GTIVGS L VVG YG LWGK            D+E+++ E E+ E  
Sbjct  242   VLSWTLLREKLYLGTIVGSFLTVVGFYGALWGK------------DKEKSKLETESLEIK  289

Query  1226  LEELE  1240
              ++L+
Sbjct  290   TDKLK  294



>ref|XP_010230816.1| PREDICTED: WAT1-related protein At1g09380-like [Brachypodium 
distachyon]
Length=396

 Score =   342 bits (877),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 167/366 (46%), Positives = 249/366 (68%), Gaps = 7/366 (2%)
 Frame = +2

Query  155   MGVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERR  334
             MG + L  I M++VQLG+A MN++SKLA+D+GM+P+V ++YR L A V +AP+AY+ ERR
Sbjct  1     MGRECLPTIAMVLVQLGFAGMNVLSKLALDTGMSPYVLISYRNLIAGVFLAPLAYYFERR  60

Query  335   IRPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGI  514
                 +T  +L  IF  SIFG +LNQ+ YFVGLK +T T+ACAL+N +PA+T+++A    +
Sbjct  61    SEMVITKKVLLQIFFSSIFGATLNQVLYFVGLKTTTATVACALSNTLPALTFVMAAVLKM  120

Query  515   EKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGS  694
             E + +RT +G AKV GT +CVGG+M++ FYHG  + +  S +HW+YA+H ++      GS
Sbjct  121   ETVRLRTYSGFAKVFGTAVCVGGSMVMPFYHGPLLKVWASPLHWRYAEHATNTAAPTTGS  180

Query  695   TNAQPNFILGPFLIIVSALSWAIWSIIQTRVS-EKYPAPYSSTALMCFMSSIQCVLFAIC  871
                    ++G  LII+S  +WAIW IIQ ++S E Y APY+ST +M  M+ +QC   +  
Sbjct  181   AA-----VVGDVLIILSCAAWAIWFIIQRKMSTEGYSAPYTSTTIMSLMAGVQCAGISAA  235

Query  872   FDHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVL  1051
              D     W L   IR  S +Y GIVG+ +A+ +MSWCI+ +GPL+VS+F+PL+LV+VA++
Sbjct  236   LDRNLAVWKLGLDIRLYSVLYIGIVGSGIAFAVMSWCIQSRGPLFVSMFSPLMLVVVAIV  295

Query  1052  SWGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKEL-QVIGVVHVDEEEARNEVETKEDHL  1228
              W +L++KI++GT +GSVLIV GLY VLWGK +E+ +     H D++ A +     E  +
Sbjct  296   GWAILEEKIHLGTAIGSVLIVAGLYLVLWGKGREMDRERADRHADDDGASSSGGVAETTM  355

Query  1229  EELELS  1246
               +EL+
Sbjct  356   IVMELN  361



>gb|EMS59309.1| Auxin-induced protein 5NG4 [Triticum urartu]
Length=385

 Score =   340 bits (873),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 161/343 (47%), Positives = 246/343 (72%), Gaps = 5/343 (1%)
 Frame = +2

Query  155   MGVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERR  334
             MG + L  + M++VQLG+A MN++SKLA+D+GM+P+V +AYR L A V +AP AY+ ERR
Sbjct  1     MGKECLPTVAMVLVQLGFAGMNVLSKLALDTGMSPYVLIAYRNLIAGVFLAPGAYYFERR  60

Query  335   IRPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGI  514
                 +T  +L  IF  SIFG +LNQ+ YFVGLK++TPT+ACAL+N +PA+T+++AV   +
Sbjct  61    SGMVITKKVLTQIFFSSIFGATLNQVLYFVGLKSTTPTVACALSNTLPALTFVMAVVLKM  120

Query  515   EKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGS  694
             E + + T +G+AKV GT++CVGG+M++ FY G  + +  S +HW+YA+H +      +G 
Sbjct  121   ETVRLGTPSGQAKVFGTVVCVGGSMIMPFYKGPLLKVWASPMHWRYAEHATDATALPSG-  179

Query  695   TNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICF  874
              NA    I+G  LII+S ++WA+W I+Q+++SE++ APY+ST +M  M+ +QC   +   
Sbjct  180   -NAA---IVGDVLIILSCVAWAVWFILQSKMSERFSAPYTSTTIMSLMAGVQCAGVSAVM  235

Query  875   DHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLS  1054
             D   + W L   IR  +A+Y G+VG+ +A+ +MSWCI+ +GPL+VS+F+PL+LV+VAV+ 
Sbjct  236   DRSVSAWKLGFDIRLYAALYVGVVGSGIAFAVMSWCIQSRGPLFVSMFSPLMLVVVAVVG  295

Query  1055  WGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVD  1183
             W +L++KI+VG+ +GS LIV GLY VLWGK +E+     +H D
Sbjct  296   WAILEEKIHVGSAIGSSLIVAGLYMVLWGKGREMTGPSDLHGD  338



>gb|KHN02821.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=311

 Score =   334 bits (856),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 166/303 (55%), Positives = 216/303 (71%), Gaps = 4/303 (1%)
 Frame = +2

Query  347   MTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLM  526
             MT  I   I L S+ G++ NQI YF+GLK ST TIACAL NL+PA T++LAV    E L 
Sbjct  1     MTKHIALQILLSSLTGVTGNQILYFLGLKYSTATIACALNNLLPAFTFVLAVLSRQENLR  60

Query  527   IRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQ  706
             I+T AG AK +GT+L VGGA+LLSFYHG  +G+GES IHW+YA+ +  ++  + G TN  
Sbjct  61    IKTRAGVAKALGTVLSVGGAVLLSFYHGEVLGLGESEIHWRYAEKMQRESSSSGGGTN--  118

Query  707   PNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKP  886
                ILGP  +IVSAL WA+W I+Q  +S+ YPAPY+ST  MC M+SIQCV  A+  +H  
Sbjct  119   --LILGPVAVIVSALLWAVWFIVQANMSKSYPAPYTSTFYMCLMASIQCVAIALSAEHNV  176

Query  887   TDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLL  1066
             + WSL   IR TSA+YAG + T LAY LMSW IE+KGPLYVSVF+PLLLVI+AV SW LL
Sbjct  177   SAWSLHSTIRLTSALYAGTISTGLAYVLMSWTIERKGPLYVSVFSPLLLVIIAVASWALL  236

Query  1067  QDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELELS  1246
              +++YVGT +GS+LIV+GLY VLWGK KE+  I +V V+        E+++D +++LEL 
Sbjct  237   HEQLYVGTAIGSLLIVLGLYFVLWGKNKEMNKIDMVEVEGTVMEAIKESEKDEVKDLELQ  296

Query  1247  AHS  1255
              + 
Sbjct  297   PYD  299



>gb|EMT10029.1| Auxin-induced protein 5NG4 [Aegilops tauschii]
Length=385

 Score =   337 bits (863),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 157/334 (47%), Positives = 243/334 (73%), Gaps = 5/334 (1%)
 Frame = +2

Query  155   MGVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERR  334
             MG + L  + M++VQLG+A MN++SKLA+D+GM+P+V +AYR L A V +AP AY+ E R
Sbjct  1     MGKECLPTVAMVLVQLGFAGMNVLSKLALDTGMSPYVLIAYRNLIAGVFLAPGAYYFEWR  60

Query  335   IRPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGI  514
                 +T  +L  IF  SIFG +LNQ+ YFVGLK++TPT+ACAL+N +PA+T+++A    +
Sbjct  61    SGMVITKKVLTQIFFSSIFGATLNQVLYFVGLKSTTPTVACALSNTLPALTFVMAAVLKM  120

Query  515   EKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGS  694
             E + + T +G+AKV+GT++CVGG+M++ FY G  + +  S +HW+YA+H +      +G 
Sbjct  121   ETVRLGTPSGQAKVLGTVVCVGGSMIMPFYKGPLLKVWASPMHWRYAEHATDATTLPSG-  179

Query  695   TNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICF  874
              NA    I+G  LII+S ++WA+W I+Q+++SE++ APY+ST +M  M+ +QC   ++  
Sbjct  180   -NAA---IVGDVLIILSCVAWAVWFILQSKMSERFSAPYTSTTIMSLMAGVQCAGISVVM  235

Query  875   DHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLS  1054
             D   + W L   IR  +A+Y G+VG+ +A+ +MSWCI+ +GPL+VS+F+PL+LV+VAV+ 
Sbjct  236   DRSVSAWKLGFDIRLYAALYVGVVGSGIAFAVMSWCIQSRGPLFVSMFSPLMLVVVAVVG  295

Query  1055  WGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKEL  1156
             W +L++KI+VG+ +GS LIV GLY VLWGK +E+
Sbjct  296   WAILEEKIHVGSAIGSSLIVAGLYMVLWGKGREM  329



>emb|CDM82961.1| unnamed protein product [Triticum aestivum]
Length=385

 Score =   337 bits (863),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 155/334 (46%), Positives = 241/334 (72%), Gaps = 5/334 (1%)
 Frame = +2

Query  155   MGVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERR  334
             MG + L  + M++VQLG+A MN++SKLA+D+GM+P+V +AYR L A V +AP AY+ ERR
Sbjct  1     MGKECLPTVAMVLVQLGFAGMNVLSKLALDTGMSPYVLIAYRNLIAGVFLAPGAYYFERR  60

Query  335   IRPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGI  514
                 +T  +L  IF  SIFG +LNQ+ YFVGLK++TP +ACAL+N +PA+T+++A    +
Sbjct  61    SGMVITKKVLTQIFFSSIFGATLNQVLYFVGLKSTTPIVACALSNTLPALTFVMAAVLKM  120

Query  515   EKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGS  694
             E + + T +G+AKV+GT++CVGG+M++ FY G  + +  S +HW+YA+H +      +G+
Sbjct  121   ETVRLGTPSGQAKVLGTVVCVGGSMIMPFYKGSLLKVWASPMHWRYAEHATDATALPSGN  180

Query  695   TNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICF  874
                    I+G  LII+S ++WA+W I+Q+++SE++ APY+ST +M  M+ +QC   +   
Sbjct  181   AA-----IVGDVLIILSCVAWAVWFILQSKMSERFSAPYTSTTIMSLMAGVQCAGVSAVM  235

Query  875   DHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLS  1054
             D   + W L   IR  +A+Y G+VG+ +A+ +MSWCI+ +GPL+VS+F+PL+LV+VAV+ 
Sbjct  236   DRSVSAWKLGFEIRLYAALYVGVVGSGIAFAVMSWCIQSRGPLFVSMFSPLMLVVVAVVG  295

Query  1055  WGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKEL  1156
             W +L++KI+VG+ +GS LIV GLY VLWGK +E+
Sbjct  296   WAILEEKIHVGSAIGSSLIVAGLYMVLWGKGREM  329



>ref|NP_001042809.1| Os01g0297700 [Oryza sativa Japonica Group]
 dbj|BAD86902.1| putative MtN21 [Oryza sativa Japonica Group]
 dbj|BAD86994.1| putative MtN21 [Oryza sativa Japonica Group]
 dbj|BAF04723.1| Os01g0297700 [Oryza sativa Japonica Group]
 gb|EAZ11555.1| hypothetical protein OsJ_01420 [Oryza sativa Japonica Group]
 dbj|BAG97761.1| unnamed protein product [Oryza sativa Japonica Group]
Length=378

 Score =   333 bits (855),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 160/334 (48%), Positives = 239/334 (72%), Gaps = 4/334 (1%)
 Frame = +2

Query  155   MGVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERR  334
             MG + L  + M++VQLG+A MN++SKLA+D+GM+P+V +AYR + A+V +AP AY+ ER+
Sbjct  1     MGRESLPTLAMVMVQLGFAGMNVVSKLALDTGMSPYVLIAYRNIIAAVFLAPFAYYFERK  60

Query  335   IRPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGI  514
                 +T  +L  IF  SIFG +LNQ+ YFVGLK++TPT+ACAL+N +PA+T+ +A  F +
Sbjct  61    SGMVITKKVLVQIFFSSIFGATLNQVLYFVGLKSTTPTVACALSNTLPALTFAMAAAFRM  120

Query  515   EKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGS  694
             E + +  AAG+AKV GT++CVGG+M++ FY G  + +  S IHW++A+  +S       +
Sbjct  121   ESVRLSAAAGQAKVFGTVVCVGGSMIMPFYKGPLLRLWASPIHWRFAESAASGAA----A  176

Query  695   TNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICF  874
               A    +LG  LII+S  +WA+W IIQT++SE++ APY+ST +MC M+ +QC   +   
Sbjct  177   PAAGGAAVLGDVLIILSCAAWAVWFIIQTKMSERFSAPYTSTTIMCLMAGVQCAGVSAAM  236

Query  875   DHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLS  1054
             D     W L   IR  S +Y G+VG+ +A+ LMSWCI+ +GPL+VS+F+PL+LV+VA++ 
Sbjct  237   DRSVAVWKLGFDIRLYSVLYIGVVGSGIAFALMSWCIQVRGPLFVSMFSPLMLVVVAIVG  296

Query  1055  WGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKEL  1156
             W +L +KI+VG+ +GSVLIV GLY VLWGK +E+
Sbjct  297   WAILDEKIHVGSAIGSVLIVAGLYMVLWGKAREM  330



>ref|XP_006604784.1| PREDICTED: WAT1-related protein At1g09380-like isoform X2 [Glycine 
max]
 ref|XP_006604787.1| PREDICTED: WAT1-related protein At1g09380-like isoform X2 [Glycine 
max]
Length=298

 Score =   330 bits (845),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 158/290 (54%), Positives = 208/290 (72%), Gaps = 8/290 (3%)
 Frame = +2

Query  362   LFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTAA  541
             +  I   S+ G++ NQ+ YFVGLK S+ TIACALTNL+PA T++LAV F  E L I+  A
Sbjct  1     MIQILFSSLTGVTGNQMLYFVGLKYSSATIACALTNLLPAFTFILAVLFRQENLGIKKRA  60

Query  542   GKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFIL  721
             G AKV GTILCV GA+LLSFYHG  IG+G+SSIHW+YA+ +   +    G      N  L
Sbjct  61    GLAKVFGTILCVSGALLLSFYHGKTIGLGQSSIHWRYAEKMEGTSSSGKG------NMFL  114

Query  722   GPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWSL  901
             GP ++I+S L WA W IIQ  +S+ +PAPY+ST LMCFM+S QCV+ A+C DH+ + WSL
Sbjct  115   GPLVVILSTLVWAAWFIIQKDISKTFPAPYTSTGLMCFMASFQCVIIAVCVDHRASAWSL  174

Query  902   RQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKIY  1081
                +R +SA+YAGI  T LAYCLMSW IE+KGPLYVSVF PL LV+ A+LSW LL++K+Y
Sbjct  175   HNAMRLSSALYAGIFCTGLAYCLMSWTIERKGPLYVSVFTPLQLVLTAILSWALLREKLY  234

Query  1082  VGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLE  1231
             VGT VGS+LIV+GLY VLWGK +E+       ++E+  +  V+  ++ +E
Sbjct  235   VGTAVGSLLIVLGLYSVLWGKSEEVNKGD--GIEEDAVKEAVKDSKNDME  282



>ref|XP_008654544.1| PREDICTED: hypothetical protein isoform X6 [Zea mays]
Length=397

 Score =   333 bits (853),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 168/348 (48%), Positives = 239/348 (69%), Gaps = 2/348 (1%)
 Frame = +2

Query  158   GVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRI  337
             G D +  + M++VQLG+AVMNI+SKLA+D+GM+P+V +AYR L A+  I+PIAY  ERR 
Sbjct  6     GKDCVPPVAMVLVQLGFAVMNIVSKLALDAGMSPYVLIAYRNLIAAAVISPIAYLLERRS  65

Query  338   RPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIE  517
                +T  +L  IF  SIFG +LNQ+ + VGLK+++ T+ACALTN +PA+T+++A    +E
Sbjct  66    GATITKKVLLQIFCSSIFGATLNQVLFVVGLKSTSATVACALTNTLPALTFVMAAALKME  125

Query  518   KLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGST  697
              +   TAAG+AK+VGT +CVGG+ML+ FY G  + +  S IHW++A+H S          
Sbjct  126   PVRPGTAAGQAKLVGTAVCVGGSMLIPFYKGPVLRVWASPIHWRFAEHASPPAAAAAAGA  185

Query  698   NAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFD  877
             +  P  +LG  L+I S ++WA+W I+ T++S+ + APY+STA+MC M+ +QC   +   D
Sbjct  186   HTGPAAVLGDVLVIASCVAWAVWFILHTKISQGFSAPYTSTAIMCLMAGVQCAGVSAALD  245

Query  878   HKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSW  1057
                  W L   IR  S +Y GIVG+   + LMSWCI+ +GPLYVS+F+PLLLVIVAV+ W
Sbjct  246   RSLAVWKLGFDIRLYSVLYIGIVGSGAGFTLMSWCIQVRGPLYVSMFSPLLLVIVAVVGW  305

Query  1058  GLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHV--DEEEA  1195
              +L DKI +G+ +GSVLIV GLY VLWGK +E+   G+ +   DEE A
Sbjct  306   AILGDKIRLGSAIGSVLIVAGLYMVLWGKGREMDRPGLDNDKGDEETA  353



>ref|NP_001145854.1| hypothetical protein [Zea mays]
 gb|ACL52732.1| unknown [Zea mays]
 tpg|DAA54313.1| TPA: hypothetical protein ZEAMMB73_784335 [Zea mays]
Length=391

 Score =   331 bits (848),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 159/334 (48%), Positives = 232/334 (69%), Gaps = 3/334 (1%)
 Frame = +2

Query  155   MGVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERR  334
             MG   +  + M++VQLG+A MN++SKLA+D+GM+P+V +AYR L A+  I+P+AY  ERR
Sbjct  1     MGKSCVPPVAMVLVQLGFAGMNVVSKLALDAGMSPYVLIAYRNLIAAAVISPVAYLLERR  60

Query  335   IRPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGI  514
                 +T  +L  IF+ SIFG +LNQ+ YFVGLK+++PT+ACALTN +PA+T+++A    +
Sbjct  61    SGATITKKVLLQIFVSSIFGATLNQVLYFVGLKSTSPTVACALTNTLPALTFVMAAALKM  120

Query  515   EKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGS  694
             E +   T AG+AK+VGT +CVGG+M++ FY G  +G+  S +HW++   ++        +
Sbjct  121   ESVRPGTPAGQAKLVGTAVCVGGSMVIPFYKGPVLGLWASPLHWRF---VADHAPSPAAA  177

Query  695   TNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICF  874
                    +LG  LII S ++WA+W I+ T++SE + APY+STA+MC M+ +QC   +   
Sbjct  178   AAHSGAAVLGDVLIIASCVAWAVWFILHTKMSEGFSAPYTSTAIMCLMAGVQCAGVSAAM  237

Query  875   DHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLS  1054
             D     W L   IR  S +Y GIVG+ + + LMSWCI+ +GPLYVS+F+PLLLV+VA++ 
Sbjct  238   DRSLDVWKLGCDIRLYSVLYIGIVGSGIGFTLMSWCIQVRGPLYVSMFSPLLLVVVAIIG  297

Query  1055  WGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKEL  1156
             W +L +KI VGT VGSVLIV GLY VLWGK +E+
Sbjct  298   WAILGEKIRVGTAVGSVLIVAGLYMVLWGKGREM  331



>ref|XP_004967586.1| PREDICTED: WAT1-related protein At1g09380-like [Setaria italica]
Length=392

 Score =   330 bits (846),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 166/349 (48%), Positives = 243/349 (70%), Gaps = 2/349 (1%)
 Frame = +2

Query  155   MGVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERR  334
             MG D +  + M++VQLG+A MN++SKLA+D+GM+P+V +AYR L A+  IAPIAY  E R
Sbjct  1     MGNDCVPPVAMVLVQLGFAGMNVVSKLALDAGMSPYVLIAYRNLIAAAFIAPIAYLLESR  60

Query  335   IRPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGI  514
                ++T  +L  IF+ SIFG +LNQ+ YFVGLK++TPT+ACAL+N +PA+T+++A    +
Sbjct  61    SGAKITKKVLLQIFISSIFGATLNQVLYFVGLKSTTPTVACALSNTLPALTFVMAAALKM  120

Query  515   EKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGS  694
             E +   T AG+AK+VGT +CVGG+M++ FY G  + + ES IHW++A+H S+ +     +
Sbjct  121   ETVRPGTPAGQAKLVGTAVCVGGSMIIPFYKGPVLRLWESPIHWRFAEHTSAASAPAAAA  180

Query  695   TNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICF  874
                    ILG  LII S  +WA+W ++QTR++E + APY+STA+MC M+  QC   +   
Sbjct  181   AGGHSGAILGDVLIIASCAAWAVWFVMQTRMAEDFSAPYTSTAIMCLMAGAQCAGVSAAM  240

Query  875   DHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLS  1054
             D     W L   IR  S +Y G+VG+ + + +MSWCI+ +GPLYVS+F+PLL+V+VA++ 
Sbjct  241   DRSLDVWKLGFDIRLYSVLYIGVVGSGIGFAIMSWCIQVRGPLYVSMFSPLLMVVVAIVG  300

Query  1055  WGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVD--EEEA  1195
             W +L +KI VG+ +GSVLIV GLY VLWGK +E+   G +  D  +EEA
Sbjct  301   WAILGEKIRVGSAIGSVLIVAGLYMVLWGKGREMDKPGGLDNDKGDEEA  349



>gb|EAY73629.1| hypothetical protein OsI_01515 [Oryza sativa Indica Group]
Length=375

 Score =   328 bits (841),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 158/334 (47%), Positives = 235/334 (70%), Gaps = 4/334 (1%)
 Frame = +2

Query  155   MGVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERR  334
             MG + L  + M++VQLG+A MN++SKLA+D+GM+P+V +AYR + A+V +AP AY+ ER+
Sbjct  1     MGRESLPTLAMVMVQLGFAGMNVVSKLALDTGMSPYVLIAYRNIIAAVFLAPFAYYFERK  60

Query  335   IRPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGI  514
                 +T  +L  IF  SIFG +LNQ+ YFVGLK++TPT+ACAL+N +PA+T+ +A  F +
Sbjct  61    SGMVITKKVLVQIFFSSIFGATLNQVLYFVGLKSTTPTVACALSNTLPALTFAMAAAFRM  120

Query  515   EKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGS  694
             E + +  AAG+AKV GT++CVGG+M++ FY G  + +  S IHW++A+  +S        
Sbjct  121   ESVRLSAAAGQAKVFGTVVCVGGSMIMPFYKGPLLRLWASPIHWRFAESAASGAAAPAAG  180

Query  695   TNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICF  874
               A    +LG  LII+S  +WA+W IIQT++SE++ APY+ST +MC M+ +QC   +   
Sbjct  181   GAA----VLGDVLIILSCAAWAVWFIIQTKMSERFSAPYTSTTIMCLMAGVQCAGVSAAM  236

Query  875   DHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLS  1054
             D     W L   IR  S +Y G+ G+ +A+ LMSWCI+ +GPL+VS+F+PL+LV V ++ 
Sbjct  237   DRSVAVWKLGFDIRLYSVLYIGVFGSGIAFALMSWCIQVRGPLFVSMFSPLMLVFVPIVG  296

Query  1055  WGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKEL  1156
             W +L +KI+VG+ +GSVLIV GLY VLWGK +E+
Sbjct  297   WAILDEKIHVGSAIGSVLIVAGLYMVLWGKAREM  330



>ref|XP_006577206.1| PREDICTED: WAT1-related protein At1g09380-like isoform X2 [Glycine 
max]
Length=297

 Score =   325 bits (833),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 159/299 (53%), Positives = 209/299 (70%), Gaps = 16/299 (5%)
 Frame = +2

Query  362   LFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTAA  541
             +  I   S+ G++ NQ+ YFVGLK S+ TIACALTNL+PA T++LAV F  E L I+  A
Sbjct  1     MLQILFSSLTGVTGNQMLYFVGLKYSSATIACALTNLLPAFTFILAVLFRQENLGIKKRA  60

Query  542   GKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFIL  721
             G AKV GTILCV GA+LLSFYHG  IG+G+SSIHW+YA+ +   +    G      N  L
Sbjct  61    GLAKVFGTILCVSGALLLSFYHGKTIGLGQSSIHWRYAEKMEGTSSSGKG------NMFL  114

Query  722   GPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWSL  901
             GP ++I+S L WA W IIQ  +S+ + APY+ST LMCFM+S QC++ A+C DH  + WSL
Sbjct  115   GPLVVILSTLVWAAWFIIQKDISKTFSAPYTSTGLMCFMASFQCIIIAVCVDHTASAWSL  174

Query  902   RQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKIY  1081
                +R +SA+YAGI  T LAYCLMSW IE+KGPLYVSVF PL LV+ A+LSW LL++K+Y
Sbjct  175   HNAMRLSSALYAGIFCTGLAYCLMSWTIERKGPLYVSVFTPLQLVLTAILSWALLREKLY  234

Query  1082  VGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEV--ETKEDHLEELELSAH  1252
             VGT VGS+LIV+GLY VLWGK +E        V++E+   +   E  +D   ++EL ++
Sbjct  235   VGTAVGSLLIVLGLYSVLWGKSEE--------VNKEDGIEDAFKEAVKDPKNDMELQSY  285



>ref|XP_008654543.1| PREDICTED: hypothetical protein isoform X5 [Zea mays]
Length=407

 Score =   324 bits (830),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 168/358 (47%), Positives = 239/358 (67%), Gaps = 12/358 (3%)
 Frame = +2

Query  158   GVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRI  337
             G D +  + M++VQLG+AVMNI+SKLA+D+GM+P+V +AYR L A+  I+PIAY  ERR 
Sbjct  6     GKDCVPPVAMVLVQLGFAVMNIVSKLALDAGMSPYVLIAYRNLIAAAVISPIAYLLERRS  65

Query  338   RPQMTLSILFNIFLCSIFG----------ISLNQITYFVGLKNSTPTIACALTNLIPAVT  487
                +T  +L  IF  SIFG           +LNQ+ + VGLK+++ T+ACALTN +PA+T
Sbjct  66    GATITKKVLLQIFCSSIFGYASGCMHGCRATLNQVLFVVGLKSTSATVACALTNTLPALT  125

Query  488   YLLAVPFGIEKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLS  667
             +++A    +E +   TAAG+AK+VGT +CVGG+ML+ FY G  + +  S IHW++A+H S
Sbjct  126   FVMAAALKMEPVRPGTAAGQAKLVGTAVCVGGSMLIPFYKGPVLRVWASPIHWRFAEHAS  185

Query  668   SQNKDNNGSTNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSI  847
                       +  P  +LG  L+I S ++WA+W I+ T++S+ + APY+STA+MC M+ +
Sbjct  186   PPAAAAAAGAHTGPAAVLGDVLVIASCVAWAVWFILHTKISQGFSAPYTSTAIMCLMAGV  245

Query  848   QCVLFAICFDHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPL  1027
             QC   +   D     W L   IR  S +Y GIVG+   + LMSWCI+ +GPLYVS+F+PL
Sbjct  246   QCAGVSAALDRSLAVWKLGFDIRLYSVLYIGIVGSGAGFTLMSWCIQVRGPLYVSMFSPL  305

Query  1028  LLVIVAVLSWGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHV--DEEEA  1195
             LLVIVAV+ W +L DKI +G+ +GSVLIV GLY VLWGK +E+   G+ +   DEE A
Sbjct  306   LLVIVAVVGWAILGDKIRLGSAIGSVLIVAGLYMVLWGKGREMDRPGLDNDKGDEETA  363



>ref|XP_009794852.1| PREDICTED: WAT1-related protein At1g09380-like isoform X2 [Nicotiana 
sylvestris]
Length=286

 Score =   319 bits (818),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 164/305 (54%), Positives = 210/305 (69%), Gaps = 33/305 (11%)
 Frame = +2

Query  326   ERRIRPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVP  505
              R+ +PQ+T SILF IFLCS  G++++QI YFVGLKNSTPTIACAL+NLIPA T+LLA+P
Sbjct  10    SRKTKPQLTSSILFWIFLCSFSGLTVSQIAYFVGLKNSTPTIACALSNLIPAATFLLAIP  69

Query  506   FGIEKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDN  685
             FG+EK+  R+ AG+AK  GTI+CVGGAMLLS YHG  I IG+S IHWK+A++   +N   
Sbjct  70    FGLEKVGFRSKAGQAKACGTIICVGGAMLLSLYHGP-IVIGQSGIHWKFAENTEEKN---  125

Query  686   NGSTNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFA  865
                +    N ILGP L+I              RVSEKY APY+ST LMC M+S QCV+  
Sbjct  126   ---STGHVNLILGPLLLIA-------------RVSEKYAAPYTSTMLMCLMASFQCVIIG  169

Query  866   ICFDHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVA  1045
             +        WSL + +R  + +Y GIV TAL YCL SWCI++KGPLYVSVF PL+L+I A
Sbjct  170   VFVVRDKAAWSLDR-MRTIAVLYNGIVCTALGYCLTSWCIQRKGPLYVSVFYPLMLIITA  228

Query  1046  VLSWGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDH  1225
             VLSW LL++K+Y+GTIVGS L VVG YG LWGK            D+E+++ E E+ E  
Sbjct  229   VLSWTLLREKLYLGTIVGSFLTVVGFYGALWGK------------DKEKSKLETESLEIK  276

Query  1226  LEELE  1240
              ++L+
Sbjct  277   TDKLK  281



>gb|KHN43359.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=349

 Score =   317 bits (812),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/272 (56%), Positives = 199/272 (73%), Gaps = 8/272 (3%)
 Frame = +2

Query  416   YFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTAAGKAKVVGTILCVGGAMLL  595
             YFVGLK S+ TIACALTNL+PA T++LAV F  E L I+  AG AKV GTILCV GA+LL
Sbjct  3     YFVGLKYSSATIACALTNLLPAFTFILAVLFRQENLGIKKRAGLAKVFGTILCVSGALLL  62

Query  596   SFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFILGPFLIIVSALSWAIWSII  775
             SFYHG  IG+G+SSIHW+YA+ +         S++ + N  LGP ++I+S L WA W II
Sbjct  63    SFYHGKTIGLGQSSIHWRYAEKMEGT------SSSGKGNMFLGPLVVILSTLVWAAWFII  116

Query  776   QTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWSLRQGIRATSAVYAGIVGTA  955
             Q  +S+ +PAPY+ST LMCFM+S QC++ A+C DH  + WSL   +R +SA+YAGI  T 
Sbjct  117   QKDISKTFPAPYTSTGLMCFMASFQCIIIAVCVDHTASAWSLHNAMRLSSALYAGIFCTG  176

Query  956   LAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKIYVGTIVGSVLIVVGLYGVL  1135
             LAYCLMSW IE+KGPLYVSVF PL LV+ A+LSW LL++K+YVGT VGS+LIV+GLY VL
Sbjct  177   LAYCLMSWTIERKGPLYVSVFTPLQLVLTAILSWALLREKLYVGTAVGSLLIVLGLYSVL  236

Query  1136  WGKQKELQVIGVVHVDEEEARNEVETKEDHLE  1231
             WGK +E+       ++E+  +  V+  ++ +E
Sbjct  237   WGKSEEVNKGD--GIEEDAVKEAVKDSKNDME  266



>gb|AFK33606.1| unknown [Lotus japonicus]
Length=278

 Score =   313 bits (803),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 146/270 (54%), Positives = 199/270 (74%), Gaps = 2/270 (1%)
 Frame = +2

Query  158  GVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRI  337
            G  L+   +MI++QL YAV+NI SKLA+ SGMNP + VAYRQ+FA+++I P AYF E +I
Sbjct  6    GSSLIPFFIMILIQLAYAVVNITSKLAIQSGMNPLILVAYRQIFATISIIPFAYFFEWKI  65

Query  338  RPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIE  517
             P+MT  I+  IFL S+ G++ NQ+ YFVGLK ST TIACALTNL+PA T++LA+ F  E
Sbjct  66   LPRMTKRIMVQIFLSSLTGVTGNQVLYFVGLKYSTATIACALTNLLPAFTFVLALIFRQE  125

Query  518  KLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGST  697
             L I+  +G+ KV+GT+LCV GA+LLSFYHG  IG+GESSIHW YAD +  Q   +  S 
Sbjct  126  NLRIKKMSGQTKVLGTVLCVSGALLLSFYHGKTIGLGESSIHWSYADKM--QGGSSTSSA  183

Query  698  NAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFD  877
              + N +LGP  +I+SAL WA W IIQ  +S+ +P PY+ST  MCF++S QCV+ A+CF+
Sbjct  184  AGKTNLLLGPIALILSALVWAFWFIIQADMSKNFPVPYTSTGYMCFLASFQCVIIALCFE  243

Query  878  HKPTDWSLRQGIRATSAVYAGIVGTALAYC  967
            H+P+ WSL+  +R TS++YAG++ T L+ C
Sbjct  244  HRPSAWSLQNAMRLTSSLYAGVICTGLSLC  273



>ref|XP_006644097.1| PREDICTED: WAT1-related protein At1g09380-like [Oryza brachyantha]
Length=382

 Score =   313 bits (802),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 161/335 (48%), Positives = 234/335 (70%), Gaps = 4/335 (1%)
 Frame = +2

Query  155   MGVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERR  334
             MG D L  + M++VQLG+A MN++SKLA+D+GM+P+V +AYR + A+V +AP AY+ ER+
Sbjct  1     MGRDSLPTLAMVMVQLGFAGMNVVSKLALDTGMSPYVLIAYRNIIAAVFLAPFAYYFERK  60

Query  335   IRPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGI  514
                 +T  +L  IF  SIFG +LNQ+ YFVGLK++TPT+ACAL+N +PA+T+ +A    +
Sbjct  61    SGMMITKKVLVQIFFSSIFGATLNQVLYFVGLKSTTPTVACALSNTLPALTFAMAAALRM  120

Query  515   EKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGS  694
             E + +R AAG+AKVVGT++CVGG+M++ FY G  + +  S IHW+              +
Sbjct  121   ESVRLRAAAGQAKVVGTVVCVGGSMIMPFYKGPLLRLWASPIHWRGGGGGGGGGA----A  176

Query  695   TNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICF  874
               A    +LG  LII+S  +WA+W IIQT++SE++ APY+ST +MC M+  QC   +   
Sbjct  177   PGAGHAAVLGDVLIILSCAAWAVWFIIQTKMSERFSAPYTSTTIMCLMAGAQCAGVSAAM  236

Query  875   DHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLS  1054
             D     W L   IR  S +Y G+VG+ +A+ LMSWCI+ +GPL+VS+F+PL+LV+VAV+ 
Sbjct  237   DRTVAVWKLGFDIRLYSVLYIGVVGSGIAFALMSWCIQVRGPLFVSMFSPLMLVVVAVVG  296

Query  1055  WGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQ  1159
             W +L +KI+VG+ +GSVLIV GLY VLWGK +E+ 
Sbjct  297   WAILDEKIHVGSAIGSVLIVAGLYVVLWGKAREMD  331



>ref|XP_009616810.1| PREDICTED: WAT1-related protein At1g09380-like isoform X4 [Nicotiana 
tomentosiformis]
Length=281

 Score =   295 bits (754),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/251 (56%), Positives = 188/251 (75%), Gaps = 7/251 (3%)
 Frame = +2

Query  155  MGVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERR  334
            MG ++L  ++M+ VQ+GYA MNI+  L MD+GM+PFVH+AYRQ+ A++++ P AYF E +
Sbjct  1    MGNEVLPFLLMVTVQVGYAGMNIVGTLVMDAGMDPFVHIAYRQIIATISLVPFAYFFEWK  60

Query  335  IRPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGI  514
             +PQ+T SILF IFLCS+ G++ +QI YFVGLKNSTPTIACAL+NLIPA T+LLA+PFG+
Sbjct  61   TKPQLTSSILFWIFLCSLSGLTASQIAYFVGLKNSTPTIACALSNLIPAATFLLAIPFGL  120

Query  515  EKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGS  694
            EK+  R+ +G+AKV GTI+CVGGAMLLS YHG  I IG+S IHWK+A++   +N  +   
Sbjct  121  EKVGFRSKSGQAKVWGTIICVGGAMLLSLYHG-PIVIGQSGIHWKFAENTEKKNSTD---  176

Query  695  TNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICF  874
                 N ILGP L+IVS +S+++W I Q RVSEKY APY+ST LMC M+S QCV+  +  
Sbjct  177  ---HVNLILGPLLLIVSTVSYSLWIIFQARVSEKYAAPYTSTMLMCLMASFQCVIIGVFV  233

Query  875  DHKPTDWSLRQ  907
             H    W L +
Sbjct  234  IHDKAAWFLDR  244



>ref|XP_010531902.1| PREDICTED: WAT1-related protein At1g68170-like isoform X1 [Tarenaya 
hassleriana]
Length=382

 Score =   297 bits (760),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 161/366 (44%), Positives = 232/366 (63%), Gaps = 19/366 (5%)
 Frame = +2

Query  179   IMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLS  358
             ++M++VQ+ +A +N++ KLA + GM+  V VAYR +F++  + P+A   ER  RP++T +
Sbjct  22    MLMVVVQVAFAGVNVLYKLAANDGMSLRVVVAYRFIFSAAFMVPVALIFERGKRPKITWT  81

Query  359   ILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTA  538
             +LF  FLC +FG SL Q  Y  GL  ++ T   ALTNLIPA+T++LA+ F +E+L +  A
Sbjct  82    VLFQAFLCGLFGGSLAQNLYLQGLALTSATFVSALTNLIPAITFILAISFRLERLELGKA  141

Query  539   AGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNF-  715
             AGKAKV+GT++ +GGAMLL+FY G  I   ++ I     D LSS    +  S  A     
Sbjct  142   AGKAKVLGTLMGIGGAMLLTFYKGFVIDFMKTDI-----DLLSSSGDRHVSSVRASSGHR  196

Query  716   ILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDW  895
             +LG  L + S  S+AIW IIQT++SEKYP  YSSTALM  M  IQ VLFA+C +   + W
Sbjct  197   VLGASLALGSCFSYAIWLIIQTKMSEKYPCYYSSTALMSIMGLIQAVLFALCVERDWSQW  256

Query  896   SLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDK  1075
              L   IR  +  ++GI+G+ L   LMSWC+  +GPL+VSVFNPLLLV+VA+     L +K
Sbjct  257   KLGWNIRLWTVAFSGIMGSGLMVTLMSWCVRLRGPLFVSVFNPLLLVLVAIAGALFLDEK  316

Query  1076  IYVGTIVGSVLIVVGLYGVLWGKQKEL-------------QVIGVVHVDEEEARNEVETK  1216
             +Y+G+++G++LIV GLY VLWGK KE+             + + VV       +   + K
Sbjct  317   LYLGSVLGAILIVCGLYVVLWGKGKEMKQMARLVPSRTLQETMDVVVESPGNIKATEKDK  376

Query  1217  EDHLEE  1234
             EDH+ +
Sbjct  377   EDHVNK  382



>ref|XP_010261295.1| PREDICTED: WAT1-related protein At1g68170, partial [Nelumbo nucifera]
Length=410

 Score =   298 bits (762),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 152/345 (44%), Positives = 229/345 (66%), Gaps = 10/345 (3%)
 Frame = +2

Query  179   IMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLS  358
             ++M++VQ+ +A +N+  KLA   GM+  V VAYR LFA+V +AP+A+F ER+ RP++T  
Sbjct  15    MVMVLVQVVFAGVNVFYKLAAIDGMSLRVLVAYRYLFATVFLAPLAFFVERKTRPKLTRM  74

Query  359   ILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTA  538
             +L   FLC +FG +L Q  Y   L  ++ T A A++NLIPA+T+++AV FG+E+L IRT 
Sbjct  75    VLLQAFLCGLFGGTLAQNLYVASLALTSATFASAMSNLIPAITFIMAVAFGLERLNIRTM  134

Query  539   AGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSI---HWKYADHLSSQNKDNNGSTNAQP  709
              GKAKVVGT+L + GAM+L+FY G  I +  S +   H  +  H++  + ++        
Sbjct  135   VGKAKVVGTLLGISGAMILTFYKGVEINLWSSKVDLTHRIHHGHVAESHAESG-------  187

Query  710   NFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPT  889
             N +LG  L + S  S+AIW IIQT++SE+YP  YSSTALMC M SIQ V+FA+C +   +
Sbjct  188   NRVLGSLLAVASCFSYAIWLIIQTKMSERYPCQYSSTALMCVMGSIQAVVFALCMERDWS  247

Query  890   DWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQ  1069
              W L   IR  +  Y+GI  + L   L++W +  +GPL+VSVFNPL+LV+VA++   LL 
Sbjct  248   QWKLGWNIRLFTVAYSGIFASGLVVSLIAWGVMVRGPLFVSVFNPLMLVLVALMGSILLN  307

Query  1070  DKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNE  1204
             +K+++G+++G+ LIV GLY VLWGK KE++ +  +   +    +E
Sbjct  308   EKLHLGSVIGAALIVCGLYVVLWGKGKEMKRMARLMPSKSSRESE  352



>ref|XP_008785911.1| PREDICTED: WAT1-related protein At1g25270-like [Phoenix dactylifera]
Length=356

 Score =   295 bits (755),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 149/337 (44%), Positives = 231/337 (69%), Gaps = 10/337 (3%)
 Frame = +2

Query  185   MIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLSIL  364
             M++VQL +A +NI  KLA++ GM+  + V YR LFA+  + P+A+F ER+ RP++T  +L
Sbjct  1     MVLVQLVFAGVNIFYKLAINDGMDMRILVTYRFLFATAFLGPLAFFLERKSRPKITWKVL  60

Query  365   FNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTAAG  544
                FLC +FG +L Q  Y   +K ++ T A A+TNLIPA+T++LAV F +E L   + +G
Sbjct  61    MLAFLCGLFGGALAQNLYVSSMKLTSATFASAMTNLIPAITFILAVLFRLESLGFHSISG  120

Query  545   KAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQP-NFIL  721
             +AKV+GT++ +GGAMLL+FY G +I +        ++ +L+  N +   + + +P N ++
Sbjct  121   QAKVLGTLVGIGGAMLLTFYKGVDINL--------WSTNLNLLNSERAAARHQEPGNHVM  172

Query  722   GPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWSL  901
             G  L + S + +AIW IIQ ++ ++YP  YSSTALMC M ++Q ++FA+C +     W L
Sbjct  173   GSLLAVASCVCYAIWLIIQAKMMKEYPCHYSSTALMCLMGTVQSIIFALCVEKDWGQWRL  232

Query  902   RQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKIY  1081
                IR  + VY+G+VG+AL   +++WCI+KKGPL+ S+FNPL+LVIVA+LS  LL +K+Y
Sbjct  233   GFDIRLLAVVYSGVVGSALILTVLAWCIKKKGPLFASIFNPLMLVIVALLSSLLLNEKLY  292

Query  1082  VGTIVGSVLIVVGLYGVLWGKQKELQV-IGVVHVDEE  1189
             +G+++G+VLIV+GLY VLWGK +E    +G +  DE 
Sbjct  293   LGSVLGAVLIVIGLYMVLWGKGREAAAKVGELPADES  329



>ref|XP_007031216.1| Nodulin MtN21 /EamA-like transporter family protein isoform 2 
[Theobroma cacao]
 gb|EOY11718.1| Nodulin MtN21 /EamA-like transporter family protein isoform 2 
[Theobroma cacao]
Length=302

 Score =   293 bits (749),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 139/241 (58%), Positives = 185/241 (77%), Gaps = 7/241 (3%)
 Frame = +2

Query  530   RTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQP  709
             R A+G+AKV+GT++CVGGAMLLSFYHGH IGIG+SSIHW YAD ++S++  +NGS     
Sbjct  59    RKASGQAKVLGTLVCVGGAMLLSFYHGHTIGIGDSSIHWAYADKMTSKS-SSNGS-----  112

Query  710   NFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPT  889
             NF LGPFL++ SA++WA+W IIQ + S+ +PAPY+ TALMCFM+SI+C +  I  DHK +
Sbjct  113   NFFLGPFLVMASAVAWAVWLIIQGQTSKNFPAPYTCTALMCFMASIECTIIGIFSDHKIS  172

Query  890   DWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQ  1069
              WSL   +R  +A+YAGIV  A+ +C++SW I+KKGPLYVSVF+PLLLVIVAVLSW LL+
Sbjct  173   AWSLSSSMRLIAALYAGIVCNAMTFCVLSWSIQKKGPLYVSVFSPLLLVIVAVLSWALLR  232

Query  1070  DKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELELSA  1249
             +K+YVGT+VGSVLIV GLY VLWGK +E++ +    ++  E   +   K D  ++LEL  
Sbjct  233   EKLYVGTVVGSVLIVGGLYAVLWGKDREIKQMKSNELETAEEATKAREK-DGKDDLELQL  291

Query  1250  H  1252
             H
Sbjct  292   H  292


 Score = 79.0 bits (193),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +2

Query  164  DLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRP  343
            D +  +  ++VQLGYA MNI SKLAM+SGM P + VAYRQ+FA++AIAP AYF ER+   
Sbjct  4    DFVPFLANVLVQLGYAGMNITSKLAMESGMKPLILVAYRQIFATLAIAPFAYFLERKASG  63

Query  344  Q  346
            Q
Sbjct  64   Q  64



>ref|XP_010068198.1| PREDICTED: WAT1-related protein At1g68170-like [Eucalyptus grandis]
Length=389

 Score =   296 bits (757),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 149/330 (45%), Positives = 227/330 (69%), Gaps = 6/330 (2%)
 Frame = +2

Query  164   DLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRP  343
             ++ AL+MM++VQ+ +A +NI+ KLA   GMN  + VAYR  FA++ +AP+A+F ER+ RP
Sbjct  3     EMKALLMMVVVQVAFAGVNILYKLAASDGMNLMILVAYRFTFATLFMAPLAFFLERKSRP  62

Query  344   QMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKL  523
             ++T ++L   F   +FG SL Q  Y   L  ++ T A A+ NL+PAVT++LAV  G+EK+
Sbjct  63    KITWTVLVQAFFSGLFGGSLGQNLYLASLSMTSATYATAMANLVPAVTFVLAVSLGLEKV  122

Query  524   MIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNA  703
              +RTAAGKAKV GT++ +GGAMLL+FY G  + +   S H     H+++  +   GS+N 
Sbjct  123   KMRTAAGKAKVAGTLMGIGGAMLLTFYKGMEVNMW--STHVNLLRHVAATQRGQEGSSNL  180

Query  704   QPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHK  883
                 +L     + S   +A+W IIQ ++SE++P PY+STALM FM+SIQ V++A+C +  
Sbjct  181   LLGSLLA----VASCFCYALWLIIQAKMSERFPCPYTSTALMTFMASIQAVVYALCRERD  236

Query  884   PTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGL  1063
              + W L   IR  +  Y+GIV + L Y L++WC+  +GP++VSVFNPL+LV VA++   +
Sbjct  237   WSQWKLGWNIRLLTVSYSGIVASGLCYALITWCVRMRGPVFVSVFNPLMLVTVALVGSMV  296

Query  1064  LQDKIYVGTIVGSVLIVVGLYGVLWGKQKE  1153
             L +K+++G+I+GS LIV+GLY VLWGK++E
Sbjct  297   LDEKLHLGSILGSGLIVLGLYAVLWGKKRE  326



>ref|XP_010911986.1| PREDICTED: WAT1-related protein At1g25270-like [Elaeis guineensis]
Length=374

 Score =   294 bits (753),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 149/336 (44%), Positives = 227/336 (68%), Gaps = 7/336 (2%)
 Frame = +2

Query  185   MIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLSIL  364
             M++VQ+ +A +N+  KLA++ GM+  V V YR LFASV + P+A+F ER+ RP++T  +L
Sbjct  18    MVLVQVVFAGVNVFYKLAINDGMDMRVLVTYRFLFASVFLGPLAFFLERKSRPKITWKVL  77

Query  365   FNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTAAG  544
                 LC +FG SL Q  Y   +K ++ T A A+TNLIPA+T++LAV F +E L I + +G
Sbjct  78    MLASLCGLFGGSLAQNLYVSSMKLTSATFASAMTNLIPAITFILAVLFRLESLGIHSLSG  137

Query  545   KAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQP-NFIL  721
             +AKV+GTI  + GAMLL+FY G +I I      W    +L   + +   + + +P N ++
Sbjct  138   QAKVLGTIFGISGAMLLTFYRGVDINI------WSTNINLLKSHSEGAAAPHQEPGNHVM  191

Query  722   GPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWSL  901
             G  L + S + +AIW IIQ ++ ++YP  YS+TALMC M ++Q ++FA+C +     W L
Sbjct  192   GSLLAVASCVCYAIWLIIQAKMMKEYPCHYSTTALMCLMGTVQSIIFALCVERDWEQWRL  251

Query  902   RQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKIY  1081
                IR  + +Y+G+VG+ L   +++WCI+KKGPLY S+FNPL+LVIVA+LS  LL +K++
Sbjct  252   CFDIRLLAVIYSGVVGSGLILTVLAWCIKKKGPLYASIFNPLMLVIVALLSSLLLNEKLH  311

Query  1082  VGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEE  1189
             +G+++G+VLIV+GLY VLWGK +E   +G +  DE 
Sbjct  312   LGSVLGAVLIVIGLYIVLWGKGREAAKVGELSADES  347



>ref|XP_006432264.1| hypothetical protein CICLE_v10003704mg, partial [Citrus clementina]
 gb|ESR45504.1| hypothetical protein CICLE_v10003704mg, partial [Citrus clementina]
Length=401

 Score =   293 bits (751),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 146/330 (44%), Positives = 224/330 (68%), Gaps = 8/330 (2%)
 Frame = +2

Query  179   IMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLS  358
             + M++VQ+ +A +N+  KLA ++GM+  V VAYR +FA+  + P+    ER+ RP++ L 
Sbjct  15    LTMVVVQVAFAGVNVFYKLAANNGMSLRVIVAYRFIFATAFMVPVTIILERKSRPKLNLK  74

Query  359   ILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTA  538
             ILF  FLC +FG SL+Q  Y   L  ++ T A A+ NL+PA+T++L++ FG+EKL IRT 
Sbjct  75    ILFQAFLCGLFGGSLSQNLYLESLVLTSATFASAMANLVPAITFVLSISFGLEKLGIRTR  134

Query  539   AGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYAD-HLSSQNKDNNGSTNAQPNF  715
             AGKAKV+G+++ +GGAM+L+FY G  I I  ++I+  +++ H++S + D           
Sbjct  135   AGKAKVLGSLIGIGGAMILTFYRGVEINIWSTNINLIHSNGHVASLHADPGKR-------  187

Query  716   ILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDW  895
              LG    + S   +AIW +IQ ++SE+YP  +SSTALMC M +IQ V+FA+C +   + W
Sbjct  188   FLGALFALGSCFGYAIWLVIQAKMSEEYPCQFSSTALMCVMGAIQAVVFALCMEKDWSQW  247

Query  896   SLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDK  1075
              L   IR  +  Y+GIV + L   L+SWC+  +GPL+ S+FNPL+LV+VA+LS  +L +K
Sbjct  248   KLGWNIRLLTVAYSGIVASGLMVTLISWCVRTRGPLFASIFNPLMLVVVAILSSLILDEK  307

Query  1076  IYVGTIVGSVLIVVGLYGVLWGKQKELQVI  1165
             +++G+I+G+ LIV GLY VLWGK KE++ I
Sbjct  308   LHLGSILGATLIVCGLYAVLWGKGKEMKKI  337



>ref|XP_009399308.1| PREDICTED: WAT1-related protein At1g68170-like [Musa acuminata 
subsp. malaccensis]
Length=369

 Score =   291 bits (746),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 147/357 (41%), Positives = 230/357 (64%), Gaps = 20/357 (6%)
 Frame = +2

Query  185   MIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLSIL  364
             M++VQ+ +A +NI  KLA++ GM+  + VAYR LFA+  + P+A+F ER+ RP+MT  +L
Sbjct  10    MVLVQVVFAGVNIFYKLALNDGMDSRILVAYRYLFAAAFLCPLAFFMERQTRPKMTWKVL  69

Query  365   FNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTAAG  544
                F   + G +++Q  Y   ++ ++ T A A+TNLIPA+T++LAV F +E L + T +G
Sbjct  70    MLSFFSGLLGGTISQNLYLSCVRITSATFASAMTNLIPAITFILAVLFRLESLAVLTVSG  129

Query  545   KAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQP-----  709
             +AK +GT+  VGGAMLL+FY G  I +  + I     D L S N +  G    QP     
Sbjct  130   QAKALGTLTGVGGAMLLTFYKGATINLWSTHI-----DLLRSHNDE--GGAQPQPQQASG  182

Query  710   NFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPT  889
             N ++G    ++S LS+A+W IIQTR+S++YP  Y+ TAL+CFM++ Q V++A+C D   +
Sbjct  183   NHVMGSLFAVISCLSYAMWLIIQTRMSKQYPCHYTGTALLCFMAAAQSVVYALCGDRSMS  242

Query  890   DWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQ  1069
              W +R  +R  + +Y+G+  + +   ++SWCI+K+GPL+ S+FNPL+L+IVA+LS  LL 
Sbjct  243   SWRMRLDVRLLTTIYSGVAASGIILIVLSWCIKKRGPLFASIFNPLMLIIVALLSTFLLN  302

Query  1070  DKIYVGTIVGSVLIVVGLYGVLWGKQKEL--------QVIGVVHVDEEEARNEVETK  1216
             +++++G+++GS LIV GLY VLWGK +E         ++  V  VD   A    E K
Sbjct  303   EQLHLGSVIGSALIVAGLYAVLWGKSREAAKVEESPPELTDVFVVDASNATGYQEKK  359



>ref|XP_004253026.2| PREDICTED: WAT1-related protein At1g09380-like isoform X2 [Solanum 
lycopersicum]
Length=299

 Score =   288 bits (738),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 151/352 (43%), Positives = 217/352 (62%), Gaps = 61/352 (17%)
 Frame = +2

Query  155   MGVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERR  334
             MG D+L L++M+IVQLGYA   I+SKL MD GM+P+VH++YRQ+ A+++IAP AYF ER+
Sbjct  1     MGKDVLPLLLMVIVQLGYAGTAIVSKLVMDEGMDPYVHLSYRQILATISIAPFAYFFERK  60

Query  335   IRPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGI  514
              RP++T   LF IFLCS+ G++  Q+T  +GL+NST TI  A+ NLIPA T+LLA+   +
Sbjct  61    TRPKLTPFSLFLIFLCSVLGVTAMQMTCIIGLRNSTATITSAMANLIPANTFLLALICRL  120

Query  515   EKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGS  694
             EKL ++T AG+AK++GTI+C+GGAMLLS YHG  + IG+    WKY+ H      +N   
Sbjct  121   EKLGLKTKAGQAKMMGTIMCIGGAMLLSLYHGKVV-IGKLGFQWKYSQH------NNTSK  173

Query  695   TNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICF  874
              N+  NF  GPFL+I+S + +++W IIQ  VS                            
Sbjct  174   NNSHGNFFNGPFLVIISTMVYSLWLIIQGIVS----------------------------  205

Query  875   DHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLS  1054
                                      +ALA  L++WCI++KGPLYVS+F PL L+  A LS
Sbjct  206   -------------------------SALALYLVTWCIKRKGPLYVSMFLPLQLIFSAFLS  240

Query  1055  WGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVE  1210
             W LL +K+Y GT +GS+  ++GLY  LWGK+K++     ++V EE ++ + +
Sbjct  241   WTLLGEKLYTGTFIGSITTIIGLYCFLWGKKKDMND-NTINVKEEISKEKKQ  291



>ref|XP_008654545.1| PREDICTED: hypothetical protein isoform X7 [Zea mays]
Length=384

 Score =   291 bits (745),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 150/327 (46%), Positives = 218/327 (67%), Gaps = 10/327 (3%)
 Frame = +2

Query  158   GVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRI  337
             G D +  + M++VQLG+AVMNI+SKLA+D+GM+P+V +AYR L A+  I+PIAY  ERR 
Sbjct  6     GKDCVPPVAMVLVQLGFAVMNIVSKLALDAGMSPYVLIAYRNLIAAAVISPIAYLLERRS  65

Query  338   RPQMTLSILFNIFLCSIFG----------ISLNQITYFVGLKNSTPTIACALTNLIPAVT  487
                +T  +L  IF  SIFG           +LNQ+ + VGLK+++ T+ACALTN +PA+T
Sbjct  66    GATITKKVLLQIFCSSIFGYASGCMHGCRATLNQVLFVVGLKSTSATVACALTNTLPALT  125

Query  488   YLLAVPFGIEKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLS  667
             +++A    +E +   TAAG+AK+VGT +CVGG+ML+ FY G  + +  S IHW++A+H S
Sbjct  126   FVMAAALKMEPVRPGTAAGQAKLVGTAVCVGGSMLIPFYKGPVLRVWASPIHWRFAEHAS  185

Query  668   SQNKDNNGSTNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSI  847
                       +  P  +LG  L+I S ++WA+W I+ T++S+ + APY+STA+MC M+ +
Sbjct  186   PPAAAAAAGAHTGPAAVLGDVLVIASCVAWAVWFILHTKISQGFSAPYTSTAIMCLMAGV  245

Query  848   QCVLFAICFDHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPL  1027
             QC   +   D     W L   IR  S +Y GIVG+   + LMSWCI+ +GPLYVS+F+PL
Sbjct  246   QCAGVSAALDRSLAVWKLGFDIRLYSVLYIGIVGSGAGFTLMSWCIQVRGPLYVSMFSPL  305

Query  1028  LLVIVAVLSWGLLQDKIYVGTIVGSVL  1108
             LLVIVAV+ W +L DKI +G++  +VL
Sbjct  306   LLVIVAVVGWAILGDKIRLGSLEYTVL  332



>ref|XP_004959978.1| PREDICTED: WAT1-related protein At1g25270-like [Setaria italica]
Length=401

 Score =   290 bits (743),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 150/330 (45%), Positives = 224/330 (68%), Gaps = 5/330 (2%)
 Frame = +2

Query  185   MIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLSIL  364
             M++VQ+ +A +NI  KLA+  GM+  V VAYR LFAS  +AP+AYF ERR R ++T  ++
Sbjct  17    MVLVQVIFAGVNIFYKLAVCDGMDMRVLVAYRYLFASAFLAPLAYFIERRNRTKLTWRVV  76

Query  365   FNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTAAG  544
                F+C + G SL Q  Y  G+K ++ T A A TNLIPA T++LA+ F  E+L IRT +G
Sbjct  77    VLSFICGLTGGSLAQNLYISGMKLTSATFASATTNLIPAATFVLALIFRYERLAIRTFSG  136

Query  545   KAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFILG  724
             +AK+ GT+L VGGAMLL+FY G ++    SS+     + ++ Q++          N ++G
Sbjct  137   QAKLAGTLLGVGGAMLLTFYKGADVTPWHSSV-----NLVAHQHRQQLEVVAEATNRVMG  191

Query  725   PFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWSLR  904
               L I S   +AIW I+Q ++S++YP  YSSTALMC MS++Q V FA+C+D  P  W L 
Sbjct  192   SLLCISSCFFYAIWLILQAKLSKEYPFHYSSTALMCAMSTLQSVAFALCYDRDPGQWRLG  251

Query  905   QGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKIYV  1084
               +R  S VY+G++ + +   ++SWC++++GPL+ SVFNPL+L++VAVLS  LL +K+++
Sbjct  252   FDVRLLSVVYSGVLASGVMLVVLSWCVKRRGPLFASVFNPLMLLVVAVLSSLLLGEKLHL  311

Query  1085  GTIVGSVLIVVGLYGVLWGKQKELQVIGVV  1174
             G+ +G+VLIV+GLY VLWGK +E ++   V
Sbjct  312   GSALGAVLIVMGLYAVLWGKGRETELAAKV  341



>ref|XP_002277022.1| PREDICTED: WAT1-related protein At1g68170-like isoform X1 [Vitis 
vinifera]
Length=382

 Score =   287 bits (735),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 144/327 (44%), Positives = 212/327 (65%), Gaps = 5/327 (2%)
 Frame = +2

Query  179   IMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLS  358
             I+M++ QL    + I+ KLA++ GMN  V +AYR +FA+  I+ +A+  ER+ RP++T  
Sbjct  16    IVMVVAQLASGGVQILYKLAINDGMNTRVLIAYRYIFATAFISSLAFILERKSRPRLTWM  75

Query  359   ILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTA  538
             I    FLC +FG +L Q  Y   +  ++PT + A+ NLIPAVT++ A+  G+EKL IRT 
Sbjct  76    IALQGFLCGLFGGALGQNLYVESMVLTSPTFSAAMANLIPAVTFIFAIFLGLEKLAIRTW  135

Query  539   AGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFI  718
             AGKAKV GT+L +GGAM+L+FY G  I I  + +H      L  +N+    S     N +
Sbjct  136   AGKAKVTGTLLGIGGAMVLTFYKGPQINIWSTKVH-----LLKHKNQHVAASHRGMDNRV  190

Query  719   LGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWS  898
             LG  L + S  S+A W IIQ ++ E+YP  YSSTALMC  +S+Q V++A+C +   + W 
Sbjct  191   LGSLLAVASCFSYATWYIIQAKMGERYPFDYSSTALMCASASVQTVVYAMCKETNWSAWK  250

Query  899   LRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKI  1078
             L   IR  +  Y G + +     L +WC+ K+GPL+VSVFNPLLLV VA+L   LL +K+
Sbjct  251   LGWNIRLLTVAYTGYLSSGFMVVLANWCVRKRGPLFVSVFNPLLLVFVAILDSLLLDEKL  310

Query  1079  YVGTIVGSVLIVVGLYGVLWGKQKELQ  1159
             ++G+I+G VLIV+GLY +LW K++E++
Sbjct  311   HLGSIIGGVLIVIGLYAMLWAKREEMK  337



>ref|XP_006851387.1| hypothetical protein AMTR_s00040p00029850 [Amborella trichopoda]
 gb|ERN12968.1| hypothetical protein AMTR_s00040p00029850 [Amborella trichopoda]
Length=413

 Score =   285 bits (728),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 158/374 (42%), Positives = 242/374 (65%), Gaps = 15/374 (4%)
 Frame = +2

Query  164   DLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRP  343
              L  + +M+ VQ+G+A MNI  KLA+++GM+  V VAYR    +  + PIA+F ER+IRP
Sbjct  9     SLKPIALMVAVQVGFAGMNIFYKLAINAGMDLRVLVAYRFAIGAAFLGPIAFFLERKIRP  68

Query  344   QMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKL  523
             ++T ++LF  FLC +FG ++NQ  Y  G+K ++ T  CA+TN+IPAVT++LA+ F +E++
Sbjct  69    KLTWTVLFQTFLCGLFGGTMNQNLYAAGMKLTSATFVCAMTNVIPAVTFILALFFRLEEV  128

Query  524   MIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNA  703
              I T + +AKVVGT++ VGGAML++FY G  I +  SS+    A    S +K  NG    
Sbjct  129   AIGTISSQAKVVGTLVGVGGAMLMTFYKGLAIHMQSSSVQLMNASSPLSPHKPGNGH---  185

Query  704   QPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHK  883
                 ++G  L++ S  S+AIW IIQ ++SEK+PA YSSTALMCFM+++Q   +A   +  
Sbjct  186   ----VIGSLLVVASCFSFAIWLIIQAKLSEKFPAYYSSTALMCFMAAVQSFCYAKIMNRS  241

Query  884   PTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGL  1063
              + W L   ++  + VYAG+V +AL   +MSWCI ++GPL+VS+FNPL+L++VA+     
Sbjct  242   WSAWKLGWDVKLLTVVYAGVVVSALLVSMMSWCIRRRGPLFVSMFNPLMLILVAIAGSFF  301

Query  1064  LQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELEL  1243
             L + +++G I+GS+LI+ GLY VLWGK KE+++       +E      E   D ++E   
Sbjct  302   LGETLHLGNILGSILIIAGLYMVLWGKNKEMKM-------DEAQLPVTEPSHDSVKEGST  354

Query  1244  SA-HSIITVDQFPK  1282
             S  H I+ +   P+
Sbjct  355   SPDHPILVIGCKPQ  368



>dbj|BAJ87280.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=385

 Score =   284 bits (726),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 159/362 (44%), Positives = 234/362 (65%), Gaps = 19/362 (5%)
 Frame = +2

Query  185   MIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLSIL  364
             M++VQ  +A +NI  KLA+  GM+  V VAYR LFAS  +APIAYF ER+ R ++T  +L
Sbjct  13    MVVVQFVFAGVNIFYKLAVSDGMDMRVLVAYRFLFASAVLAPIAYFVERKKRTKVTWRVL  72

Query  365   FNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTAAG  544
                F+C + G SL Q  Y  G+K ++ T A A+TNLIPA+T++LAV F  E+L IRT AG
Sbjct  73    LLSFVCGLCGGSLAQNLYISGMKLTSATFASAMTNLIPAITFVLAVLFRYERLAIRTLAG  132

Query  545   KAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSS--QNKDNNGSTNA-QP--  709
             +AKV GT+L VGGAMLL+FY G  + +   + H   A  L++  Q+ D+N +++A  P  
Sbjct  133   QAKVTGTMLGVGGAMLLTFYKGAQVTLWPPT-HINLAAQLAARHQHDDHNHASSAVHPDS  191

Query  710   -NFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKP  886
              N  +G  L   S   +A+W I+Q R+S +YP  YS+TALMC MS++Q   FA+CFD   
Sbjct  192   GNRAMGSLLCTGSCFFYALWLILQARLSREYPFHYSTTALMCAMSALQSAAFALCFDRDL  251

Query  887   TDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLL  1066
               W L  G+R  + +Y G+V + +   ++SWC++++GPL+ SVFNP++LV+VAVLS  LL
Sbjct  252   LQWRLSSGVRLLAVLYTGVVASGVMLVVLSWCVKRRGPLFASVFNPMMLVVVAVLSSLLL  311

Query  1067  QDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELELS  1246
              +++++G+++G+VLIV GLY VLWGK +            E A+NE     + L  +++ 
Sbjct  312   GEELHLGSVLGAVLIVTGLYAVLWGKGR------------EAAQNEPAKAGNELPHIDIV  359

Query  1247  AH  1252
              H
Sbjct  360   VH  361



>ref|XP_010684310.1| PREDICTED: WAT1-related protein At1g68170-like [Beta vulgaris 
subsp. vulgaris]
Length=391

 Score =   283 bits (725),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 143/328 (44%), Positives = 216/328 (66%), Gaps = 7/328 (2%)
 Frame = +2

Query  176   LIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTL  355
             ++ MI+VQ  +A +NI  KLA   GMN  V VAYR LFA+  I P+A+F ER+ RP++T 
Sbjct  14    IVFMILVQTSFAGVNIFYKLAAIDGMNLRVLVAYRILFAAAFIVPLAFFLERKSRPKLTW  73

Query  356   SILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRT  535
             ++L   FLC +FG SL Q  Y   L  ++ T   A+ NLIPAVT++LAV F +EK+ +++
Sbjct  74    TVLGQAFLCGLFGGSLVQNLYLESLVLTSATFTAAMANLIPAVTFILAVCFRLEKVSLKS  133

Query  536   AAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNF  715
              +GKAK++GT+L +GGAM+L+FY G  + +      W    H   Q        + Q N 
Sbjct  134   VSGKAKILGTLLGIGGAMILTFYKGIEVKL------WSTNSHFLKQTTMGLVIHDGQ-NR  186

Query  716   ILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDW  895
             ++G FL + S  S+A W I+Q ++SE Y +PYSSTALM  M S+Q V+FA+C D   + W
Sbjct  187   LVGSFLALGSCFSYAAWLIVQAKMSESYGSPYSSTALMSIMGSVQAVVFALCVDRDLSLW  246

Query  896   SLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDK  1075
              L   IR  +  Y+GIV + ++  +++WC+  +GPL+VS+FNPL L++VA+    +L +K
Sbjct  247   KLGWNIRLLTVAYSGIVASGVSVTVIAWCVRVRGPLFVSIFNPLTLILVALAGSLILDEK  306

Query  1076  IYVGTIVGSVLIVVGLYGVLWGKQKELQ  1159
             +Y+G+++G++LIV GLY V+WGK KE++
Sbjct  307   LYIGSVIGAILIVFGLYAVIWGKGKEIK  334



>gb|AES63368.2| auxin-induced 5NG4-like protein [Medicago truncatula]
Length=394

 Score =   283 bits (725),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 146/330 (44%), Positives = 220/330 (67%), Gaps = 12/330 (4%)
 Frame = +2

Query  179   IMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLS  358
             ++M++VQ+ +A +N++ KLA++ GM+  + VAYR +FA+  IAPIA+  ER+ R +MT +
Sbjct  18    LLMVMVQIAFAGVNVLYKLAVNDGMSLRIVVAYRFIFATAFIAPIAFILERKKRAKMTWT  77

Query  359   ILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTA  538
             ILF  FLC +FG SL Q  Y   L  ++ T A A+ NLIPAVT+++AV  G+EKL +RT 
Sbjct  78    ILFQSFLCGLFGGSLAQNFYLQALTLTSATFASAMANLIPAVTFIMAVSLGMEKLNLRTK  137

Query  539   AGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNG---STNAQP  709
             AGKAK++GT+  +GGAM+L+F  G  I +G  S H     H        NG    T +  
Sbjct  138   AGKAKILGTLTGIGGAMVLTFVKGVEIKMG--SFHLNLLHH-------QNGVVTHTISTA  188

Query  710   NFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPT  889
             N I G    + S++S+A+W IIQT++SE+YP  YSSTAL+ F +S+  ++ A+CF+   +
Sbjct  189   NTISGSLCALASSISYALWLIIQTKMSERYPTHYSSTALISFWASLVSIVLALCFERDLS  248

Query  890   DWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQ  1069
              W L   IR  +  YAGIV +     ++SWC+  +GPL+ SVF PL+L++VA+    +L 
Sbjct  249   QWKLGWNIRLLTVAYAGIVVSGAMVAVISWCVHMRGPLFASVFTPLMLLMVALAGCTILN  308

Query  1070  DKIYVGTIVGSVLIVVGLYGVLWGKQKELQ  1159
             +K+++G+I+G+VLIV GLY V+WGK KE++
Sbjct  309   EKLHLGSIIGAVLIVCGLYAVVWGKSKEMK  338



>ref|XP_002447365.1| hypothetical protein SORBIDRAFT_06g033770 [Sorghum bicolor]
 gb|EES11693.1| hypothetical protein SORBIDRAFT_06g033770 [Sorghum bicolor]
Length=374

 Score =   283 bits (724),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 147/353 (42%), Positives = 228/353 (65%), Gaps = 6/353 (2%)
 Frame = +2

Query  185   MIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLSIL  364
             M++ Q+ +A +NI  KLA+  GM+  V +AYR LFAS  +AP+AYF ER+ R ++T  +L
Sbjct  13    MVVFQILFAGLNIFYKLAVSDGMDLRVLIAYRYLFASAFLAPLAYFLERKTRTKLTWRVL  72

Query  365   FNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTAAG  544
                F+C + G ++ Q  Y  G+K ++ T A A TNL+PA T+++A+ F  E+L IR  + 
Sbjct  73    MLSFVCGLSGGTVAQNLYIAGMKLTSATFASATTNLLPAWTFVIALVFRYERLDIRAFSS  132

Query  545   KAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTN--AQPNFI  718
             +AKV GT+L +GGAMLL+ Y G +I    S  H      L+ ++    G++   ++ N+ 
Sbjct  133   QAKVTGTLLSIGGAMLLTLYKGVDITPWHS--HLNLVATLAQRHGGQVGASAMASKTNYG  190

Query  719   LGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWS  898
             +G  + + S   +A+W ++Q ++S +YP  YSSTALMC M S+Q  +FAICFD   + W 
Sbjct  191   MGSLMCVSSCFFYALWIVVQAKLSNEYPFHYSSTALMCIMISLQSAVFAICFDRDASQWR  250

Query  899   LRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKI  1078
             L+  IR  S  Y+GI  + +A  +M+WC++++GPL+VSVF+PL+L++VAVLS  LL +K+
Sbjct  251   LKFNIRLLSCAYSGIFASGIALVIMAWCVKQRGPLFVSVFSPLMLLMVAVLSSLLLGEKL  310

Query  1079  YVGTIVGSVLIVVGLYGVLWGKQKE--LQVIGVVHVDEEEARNEVETKEDHLE  1231
             ++GT +G+VLIV+GLY VLWGK +E   +   V   D   A  EV+  + H+ 
Sbjct  311   HLGTALGAVLIVMGLYAVLWGKGREAAAEAAKVRVSDHPAATTEVKDNKQHVS  363



>ref|XP_008781415.1| PREDICTED: WAT1-related protein At1g68170-like [Phoenix dactylifera]
Length=407

 Score =   284 bits (726),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 154/351 (44%), Positives = 227/351 (65%), Gaps = 13/351 (4%)
 Frame = +2

Query  182   MMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLSI  361
             +M++VQ+ +A +NI  KLA++ GM+  V VAYR +FA   I P+A+F ER+ RP +T  I
Sbjct  18    LMVLVQVAFAGLNIFCKLALNDGMDVRVLVAYRYIFAITFIGPLAFFLERKSRPSLTWMI  77

Query  362   LFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTAA  541
             L   FLC +FG +L Q  Y   LK ++ T A AL+NL+PA T++LAV F +E L IR A+
Sbjct  78    LLQSFLCGLFGGTLAQNLYVASLKLTSATFANALSNLMPASTFILAVSFRLEILRIRQAS  137

Query  542   GKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPN-FI  718
             G+AKV+GT++ +GGA LL+FY G  I    ++++         Q  D++ +   +P+  I
Sbjct  138   GQAKVLGTLVGLGGATLLTFYKGPEINPWSTNLNLLKIH----QEGDHHQALPHEPSKRI  193

Query  719   LGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWS  898
             +G FL+I S   +++W IIQ ++S  YP  YSS+ALM  M +IQ +L A+C +     W 
Sbjct  194   MGAFLVIASCFFYSLWLIIQAKMSRAYPCHYSSSALMNLMGAIQTILIALCTNRDMNKWR  253

Query  899   LRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKI  1078
             L   +R  +  YAG+V + L   ++ WCI+KKGPLY SVFNPL LVIVA+LS  LL +++
Sbjct  254   LGFDVRLLTISYAGVVASGLIIAVLMWCIKKKGPLYTSVFNPLQLVIVALLSSPLLGERL  313

Query  1079  YVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLE  1231
             ++G+I+G+VLIV+GLY VLWGK+KE  V           ++ VE K + +E
Sbjct  314   HLGSILGAVLIVIGLYLVLWGKKKEATVAA--------EKSLVEAKSESVE  356



>ref|XP_010068190.1| PREDICTED: WAT1-related protein At1g68170-like [Eucalyptus grandis]
Length=392

 Score =   283 bits (725),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 144/327 (44%), Positives = 217/327 (66%), Gaps = 6/327 (2%)
 Frame = +2

Query  173   ALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMT  352
             A +MM++VQ+ +A +NI+ KLA   GMN  V +AYR +FA+  +AP+A+F ER+ RP++T
Sbjct  3     AALMMVVVQVAFAGVNILYKLAASDGMNLSVVIAYRFMFATALLAPLAFFLERKSRPKIT  62

Query  353   LSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIR  532
              ++L   F C +FG S+ Q  Y   L  ++ T A A+ NL+PAVT++LAV  G EK+ +R
Sbjct  63    WTVLVQAFFCGLFGGSMGQNLYLASLSMTSATYASAMANLVPAVTFVLAVFLGFEKVRVR  122

Query  533   TAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPN  712
             T AGKAK  GT++ +GGAMLL+FY G  + +   S H     H+++  +   GS++    
Sbjct  123   TVAGKAKAAGTLMGIGGAMLLTFYKGAEVNLW--STHVNLLRHVAATQRGQEGSSDLLLG  180

Query  713   FILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTD  892
              +L     + S   +A W IIQ ++SE +P  Y+STALM FM SIQ  ++A+C +   + 
Sbjct  181   SLLA----VASCFCYASWLIIQAKMSEGFPHQYTSTALMTFMGSIQAAVYALCRERDWSQ  236

Query  893   WSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQD  1072
             W L   IR  +  Y+GIV +AL Y L++WC+  +GP++VS+FNPL+LV VA+    +L +
Sbjct  237   WKLGWNIRLLTVSYSGIVASALCYTLIAWCVRMRGPVFVSIFNPLMLVTVALAGSMVLDE  296

Query  1073  KIYVGTIVGSVLIVVGLYGVLWGKQKE  1153
             K+++G+I+GS LIV+GLY VLWGK+KE
Sbjct  297   KLHMGSILGSGLIVLGLYAVLWGKRKE  323



>ref|XP_003593117.1| Auxin-induced protein 5NG4 [Medicago truncatula]
Length=392

 Score =   283 bits (725),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 146/330 (44%), Positives = 220/330 (67%), Gaps = 12/330 (4%)
 Frame = +2

Query  179   IMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLS  358
             ++M++VQ+ +A +N++ KLA++ GM+  + VAYR +FA+  IAPIA+  ER+ R +MT +
Sbjct  16    LLMVMVQIAFAGVNVLYKLAVNDGMSLRIVVAYRFIFATAFIAPIAFILERKKRAKMTWT  75

Query  359   ILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTA  538
             ILF  FLC +FG SL Q  Y   L  ++ T A A+ NLIPAVT+++AV  G+EKL +RT 
Sbjct  76    ILFQSFLCGLFGGSLAQNFYLQALTLTSATFASAMANLIPAVTFIMAVSLGMEKLNLRTK  135

Query  539   AGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNG---STNAQP  709
             AGKAK++GT+  +GGAM+L+F  G  I +G  S H     H        NG    T +  
Sbjct  136   AGKAKILGTLTGIGGAMVLTFVKGVEIKMG--SFHLNLLHH-------QNGVVTHTISTA  186

Query  710   NFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPT  889
             N I G    + S++S+A+W IIQT++SE+YP  YSSTAL+ F +S+  ++ A+CF+   +
Sbjct  187   NTISGSLCALASSISYALWLIIQTKMSERYPTHYSSTALISFWASLVSIVLALCFERDLS  246

Query  890   DWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQ  1069
              W L   IR  +  YAGIV +     ++SWC+  +GPL+ SVF PL+L++VA+    +L 
Sbjct  247   QWKLGWNIRLLTVAYAGIVVSGAMVAVISWCVHMRGPLFASVFTPLMLLMVALAGCTILN  306

Query  1070  DKIYVGTIVGSVLIVVGLYGVLWGKQKELQ  1159
             +K+++G+I+G+VLIV GLY V+WGK KE++
Sbjct  307   EKLHLGSIIGAVLIVCGLYAVVWGKSKEMK  336



>gb|AES63302.2| nodulin MtN21/EamA-like transporter family protein [Medicago 
truncatula]
Length=409

 Score =   283 bits (725),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 161/381 (42%), Positives = 239/381 (63%), Gaps = 13/381 (3%)
 Frame = +2

Query  179   IMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLS  358
             ++MI+V++ +A  N++ KLA++ GMN  + VAYR +FA++ IAP+A+  ER+ R ++T +
Sbjct  17    LLMILVKIAFACANVLYKLAVNDGMNLRIVVAYRFIFATLFIAPLAFILERKKRTKLTWT  76

Query  359   ILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTA  538
             ILF  FLC +FG S  Q  Y   L  ++ T A A+ NL+PAVT+++ V  G+EKL +RT 
Sbjct  77    ILFQSFLCGLFGGSFVQNFYLESLALTSATFASAMANLVPAVTFIMVVSLGMEKLNLRTK  136

Query  539   AGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFI  718
             AGKAK+VGTI+ +GGAM+L+F  G  I +G  S H     H +     ++ +T +  N I
Sbjct  137   AGKAKIVGTIIGIGGAMILTFIKGVEIKMG--SFHLNLLHHQNDVGSHSHATTISTGNTI  194

Query  719   LGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWS  898
             LG    +VSA+S+A+W IIQ +++E+YP  YSST LM F +S+   +FA+CFD   + W 
Sbjct  195   LGSLYAMVSAISYALWLIIQAKMNERYPTHYSSTTLMSFWASLLSTMFALCFDRDLSQWR  254

Query  899   LRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKI  1078
             L   IR     YAGIV +     ++SWC+  +GPL+ S FNPL+LVIVA+ S  +L + +
Sbjct  255   LGWNIRLLIVAYAGIVASGAMVVVISWCVHMRGPLFASAFNPLVLVIVALASCTMLNENL  314

Query  1079  YVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELELSAHSI  1258
             Y+G+I+GSVLIV GLY V+WGK KE++      +   ++ NE +T E  +  +       
Sbjct  315   YLGSIIGSVLIVCGLYAVVWGKSKEMKKNN--QLVPSQSSNEFDTVEIVVRHV-------  365

Query  1259  ITVDQFPKKN*NN*FSLHSKE  1321
               VD     N NN  S  S+E
Sbjct  366   --VDDKRNHNSNNGLSNTSQE  384



>ref|XP_002530977.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
 gb|EEF31412.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
Length=385

 Score =   283 bits (723),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 146/336 (43%), Positives = 216/336 (64%), Gaps = 11/336 (3%)
 Frame = +2

Query  173   ALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMT  352
             A+++M+ +Q+ Y  +N++ KLA   GM+  +  AYR +FA+  + P+A   ER+ RP++T
Sbjct  16    AVLVMVTIQVAYTAVNVLYKLAASDGMSVRIITAYRFIFATAFMVPLALIFERKNRPKLT  75

Query  353   LSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIR  532
              +ILF  F C +FG SL+Q  Y   L  ++ T A A+ NL+PAVT++LA  FG+EK+ IR
Sbjct  76    WTILFQAFFCGLFGGSLSQNMYLESLVLTSATFATAIFNLVPAVTFILAFSFGLEKVEIR  135

Query  533   TAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHW--KYADH---LSSQNKDNNGST  697
             T  GKAKV+GT+L + GAMLL+FY G  I I  + I+    Y  H   L+S +  ++GS 
Sbjct  136   TPPGKAKVIGTLLGISGAMLLTFYKGTEINIWRTHINLIKDYQSHEGGLASSDHHHHGS-  194

Query  698   NAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFD  877
                    LG  L + +  S+A W IIQ ++SE+YP PYSSTALM FM+SIQ V++A+C +
Sbjct  195   -----LALGSLLAVANCFSYAFWLIIQAKMSERYPCPYSSTALMSFMASIQAVVYALCVE  249

Query  878   HKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSW  1057
                  W L   IR  +A YAGI    +   L+ WC+  KGPL+VS+F+PLLL+  A+   
Sbjct  250   KDFEQWKLGWNIRLLTAAYAGIAVAGIMVTLVIWCVRLKGPLFVSIFSPLLLICTAIAGS  309

Query  1058  GLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVI  1165
              LL + +++G+I+G  LI+ GLYGVLW K  E++++
Sbjct  310   ILLNETLHLGSILGGTLIICGLYGVLWAKSLEMKIV  345



>ref|XP_010103862.1| Auxin-induced protein 5NG4 [Morus notabilis]
 gb|EXB97303.1| Auxin-induced protein 5NG4 [Morus notabilis]
Length=455

 Score =   285 bits (729),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 143/324 (44%), Positives = 217/324 (67%), Gaps = 0/324 (0%)
 Frame = +2

Query  191   IVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLSILFN  370
             +VQ  +  +N++ KLA + GMN  V VAYR +FA+  I P+A F ER+ R ++T +ILF 
Sbjct  74    LVQFVFTGVNVLYKLAANDGMNLKVIVAYRLVFATAFILPLALFIERKSRRKLTWTILFQ  133

Query  371   IFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTAAGKA  550
              FLC +FG SL Q  Y   L  ++ T+A A+TNLIPA+T+ LAV F +EKL   T  GKA
Sbjct  134   AFLCGLFGASLPQNLYLESLVLTSATLASAMTNLIPAITFFLAVIFRLEKLNFGTPGGKA  193

Query  551   KVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFILGPF  730
             KV+G++L VGGA++L+FY G +I I  + +   + DH  +    ++ +     N +LG  
Sbjct  194   KVLGSLLGVGGALILTFYKGVDINIWSTHVDLLHRDHHHNNMASSHDAAAGSGNHVLGCL  253

Query  731   LIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWSLRQG  910
             L + S+  +++W I+Q ++SEKYP  YSSTALM  M++IQ ++FA+C +   + W L   
Sbjct  254   LAVASSACFSVWFILQAKMSEKYPCYYSSTALMSIMATIQTIIFALCTERDWSQWKLGWN  313

Query  911   IRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKIYVGT  1090
             IR  +  Y+G V + L   L++WC++KKGPLY SVFNPL+LV+V ++   +L +K+++G+
Sbjct  314   IRLLTVAYSGTVASGLMMTLIAWCVQKKGPLYASVFNPLMLVLVTIVGSLVLNEKLHLGS  373

Query  1091  IVGSVLIVVGLYGVLWGKQKELQV  1162
             ++ +VLIV GLY VLWGK KE+++
Sbjct  374   VLAAVLIVFGLYFVLWGKGKEMKM  397



>ref|NP_001172290.1| Os01g0296900 [Oryza sativa Japonica Group]
 dbj|BAB55753.1| putative MtN21 [Oryza sativa Japonica Group]
 dbj|BAH91020.1| Os01g0296900 [Oryza sativa Japonica Group]
Length=358

 Score =   282 bits (721),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 148/353 (42%), Positives = 220/353 (62%), Gaps = 28/353 (8%)
 Frame = +2

Query  170   LALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQM  349
             L L+ M++VQLG A +N++SKL M SGM+P+V +AYR   A+  +APIA+  ER      
Sbjct  10    LPLLAMVLVQLGLAGLNVMSKLTMASGMSPYVLLAYRNFIAAAFLAPIAFLVERA-----  64

Query  350   TLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMI  529
                             +LNQ+ YFVGLK S+PT+A AL N +PAVT+LLA    +E +  
Sbjct  65    ----------------TLNQVLYFVGLKYSSPTVASALNNTLPAVTFLLAALLKMEPVAG  108

Query  530   RTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQP  709
             R  AG+AKV GT LCV G+ML++FY G  +    S +HW Y   +         +     
Sbjct  109   R--AGRAKVAGTALCVAGSMLMTFYRGPLVRTLASPVHWPY---VQGTMAAEAAAHAGGH  163

Query  710   NFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPT  889
               +LG  L+I S ++WAIW IIQ  +S+ +  PY+STALM  ++S+QC   A   + + +
Sbjct  164   AVVLGAVLVIGSNVAWAIWFIIQKNLSKSFACPYTSTALMALIASVQCAAIAGAAERRFS  223

Query  890   DWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQ  1069
              W L   IR   A+YAGIV + +   +MSWCI+++GP++VS+F+PL+L++VAV+ WG+L 
Sbjct  224   AWELGLDIRLVGALYAGIVASGMVCTVMSWCIQERGPVFVSMFSPLMLIVVAVVGWGILG  283

Query  1070  DKIYVGTIVGSVLIVVGLYGVLWGKQKELQ--VIGVVHVDEEEARNEVETKED  1222
             +KI+VG+++G+V+IVVGLY VLWGK ++L    + +  +  +E  N V   +D
Sbjct  284   EKIHVGSVIGAVIIVVGLYTVLWGKGRDLDGAAVAIASLPGDEEMNGVVGADD  336



>ref|XP_003572197.1| PREDICTED: WAT1-related protein At1g09380-like [Brachypodium 
distachyon]
Length=361

 Score =   281 bits (720),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 141/352 (40%), Positives = 233/352 (66%), Gaps = 6/352 (2%)
 Frame = +2

Query  179   IMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLS  358
             + M++VQ+G+A MN++SK+A+D+GM+P+V VAYR L A+V +AP+A + ER +   MT  
Sbjct  7     VAMLLVQIGFAGMNLLSKMALDNGMSPYVLVAYRSLVAAVFLAPLAVYFERDMWKLMTKK  66

Query  359   ILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTA  538
             +   I L S  G++L ++ +FVG ++++ T+A A+ N++PA+T+ +A    +E    RTA
Sbjct  67    VTIEIILSSSLGMTLCELLFFVGFQSTSATVASAIVNIVPALTFAIAAALKMEPFRPRTA  126

Query  539   AGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFI  718
             A +AKV+GT++CVGG+M++ FY G  + + +S IHW YA+H  +       +  A  +  
Sbjct  127   ASQAKVIGTVVCVGGSMVMPFYKGPQLKLWDSPIHWHYAEHAVAA------AAPAPASSA  180

Query  719   LGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWS  898
             +G  LII+SA+SWA W ++  + SE +PAPY+ST +M  +  ++C   +   D   + WS
Sbjct  181   VGDVLIILSAVSWAGWLLMTNKTSESFPAPYTSTTIMSLIVGVECGAVSAAVDRSLSAWS  240

Query  899   LRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKI  1078
             L  GIR  S +Y GI+G  + + +M+WCI+ +GPL+VS+F+P++LV+VA+L W  L +K+
Sbjct  241   LGLGIRLYSVLYMGIIGWGVTFAVMTWCIQVRGPLFVSMFSPVVLVVVALLGWAFLDEKL  300

Query  1079  YVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEE  1234
             ++G+ +G+VLIVVGLY VLWGK +E+            ++  + +KE+  E 
Sbjct  301   HLGSAIGAVLIVVGLYMVLWGKGREIISRPAQLHGNRASKEGLGSKENDAEN  352



>ref|XP_004986753.1| PREDICTED: WAT1-related protein At1g09380-like [Setaria italica]
Length=373

 Score =   282 bits (721),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 157/334 (47%), Positives = 221/334 (66%), Gaps = 4/334 (1%)
 Frame = +2

Query  185   MIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLSIL  364
             M+  Q+ +A +NI  KLA+  GM+  V VAYR LFAS  +AP+AYF ER+ R ++T  +L
Sbjct  18    MVSFQVVFAGLNIFYKLAVSDGMDLRVLVAYRYLFASAFLAPLAYFLERKSRTKVTWRVL  77

Query  365   FNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTAAG  544
                F+C + G S+ Q  Y  G+K +T T A A TNL+PA T+LLA+ F  E+L IRT +G
Sbjct  78    GLSFVCGLTGGSVAQNLYIAGMKVTTATFATATTNLLPAATFLLALAFRQERLAIRTFSG  137

Query  545   KAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFILG  724
             +AKV GT L +GGAMLL+FY G +I    SS++   A   +S +    G+  A  N+ +G
Sbjct  138   QAKVAGTFLGIGGAMLLTFYKGVDITPWHSSVNLIAA---TSHHPAAAGN-EATANYAMG  193

Query  725   PFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWSLR  904
               L I S   +A+W +IQ+++S +YP  Y+STALMC M+++Q   FA+CFD     W LR
Sbjct  194   SLLCITSCFFYALWLVIQSKLSREYPHHYTSTALMCVMTTLQSSAFALCFDRDAVQWRLR  253

Query  905   QGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKIYV  1084
               IR  + VYAGI+ + +   +MSWC++++GPL+VSVFNPL+L++VAVLS  LL +K+++
Sbjct  254   FDIRLLAVVYAGIMASGVMLVVMSWCVKRRGPLFVSVFNPLMLLVVAVLSSLLLGEKMHL  313

Query  1085  GTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDE  1186
             GT +G+VLIV GLY VLWGK  E     V  V E
Sbjct  314   GTALGAVLIVAGLYTVLWGKGHETPANEVAKVSE  347



>ref|XP_003531568.1| PREDICTED: WAT1-related protein At1g68170-like [Glycine max]
 gb|KHN26710.1| Auxin-induced protein 5NG4-like protein [Glycine soja]
Length=405

 Score =   283 bits (723),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 161/393 (41%), Positives = 234/393 (60%), Gaps = 21/393 (5%)
 Frame = +2

Query  176   LIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTL  355
             +++M++VQ+ Y  +N++ KLA++ GM+  V  AYR  F S    P+A  SER  RP+MT 
Sbjct  17    VLLMVLVQIAYTAVNVLFKLAINDGMSVKVATAYRLTFGSAFTVPLALISERNKRPKMTW  76

Query  356   SILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRT  535
              +LF   LC +FG SL Q  ++  L  ++ T A AL NLIPA+T++LA+  G E+L +R 
Sbjct  77    RVLFMACLCGLFGGSLFQNLFYESLALTSATFASALYNLIPAITFVLAISCGFERLNLRV  136

Query  536   AAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYAD-----HLSSQNKDNNGSTN  700
             AAG+AKV+GT+L +GGAMLL+F  G  I I    I+  + D     H++S N D+     
Sbjct  137   AAGRAKVLGTLLGIGGAMLLTFIKGAEINIWPFHINLMHPDQHQNSHVASLNTDSGN---  193

Query  701   AQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDH  880
                N +LG    + S  S+A+W  IQ ++S++YP  YSSTALM    +IQ   F  CF+ 
Sbjct  194   ---NKLLGAICSLASCFSFALWLTIQAKMSKEYPCHYSSTALMSTAGAIQATAFGFCFER  250

Query  881   KPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWG  1060
               T W L   IR  +  Y+GIV + +   + +WCI+ +GPL+ SVFNPL+LV+VA+    
Sbjct  251   DLTQWKLGWNIRLLAVAYSGIVASGIVVIITAWCIQMRGPLFASVFNPLMLVLVAIAGSL  310

Query  1061  LLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELE  1240
             +L + +YVG++VG+VLIV GLY VLWGK KE++ I  + V  E  R          E +E
Sbjct  311   MLNENLYVGSVVGAVLIVCGLYMVLWGKSKEMKNITQL-VPSETIREA--------EAIE  361

Query  1241  LSAHSIITVDQFPKKN*NN*FSLH-SKENCHPL  1336
             +   SI T   + K + NN    +  KE+C  L
Sbjct  362   VVVMSISTPIDYEKCDQNNQGERNVDKEDCDDL  394



>ref|XP_003594304.1| Auxin-induced protein 5NG4 [Medicago truncatula]
 gb|ABD28596.1| Protein of unknown function DUF6, transmembrane [Medicago truncatula]
 gb|AES64555.1| nodulin MtN21/EamA-like transporter family protein [Medicago 
truncatula]
Length=366

 Score =   281 bits (718),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 142/327 (43%), Positives = 216/327 (66%), Gaps = 7/327 (2%)
 Frame = +2

Query  179   IMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLS  358
             ++M++VQ+ YA +N+  KLA ++GM+  V  AYR +FA+    PIA   ER+ RP++T  
Sbjct  15    LLMLMVQISYASLNVFYKLATNNGMSVKVLTAYRLIFATATTIPIAIIFERKNRPKLTWR  74

Query  359   ILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTA  538
             ++F  F C +FG +L Q  +F  L   + T   A+ NL PAVT++LAV FG E+L + TA
Sbjct  75    VVFMSFFCGLFGATLFQNLFFESLALISATFVSAVFNLTPAVTFILAVCFGFERLNLETA  134

Query  539   AGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFI  718
             AGK KV+GTI+C+GGAM+L+F  G  I I      W +  +L  + K      ++    I
Sbjct  135   AGKTKVLGTIICIGGAMILTFLKGVEINI------WTFHINLLHEGKSGTMHVHSGSK-I  187

Query  719   LGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWS  898
             LG FL + S+ S+A+W IIQ ++S++Y   YSST+LM  M +IQ   FA+C +   + W 
Sbjct  188   LGIFLGLASSFSFALWLIIQAKMSKEYQGHYSSTSLMSLMGAIQSTGFALCAEKDWSQWR  247

Query  899   LRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKI  1078
             L   IR  +A+Y+GIV + +    ++WC+E++GPLY SVFNPL+LV+VA+    +L +K+
Sbjct  248   LGWNIRLLTALYSGIVASGIMVIAIAWCVERRGPLYCSVFNPLMLVLVAIAGSMMLNEKL  307

Query  1079  YVGTIVGSVLIVVGLYGVLWGKQKELQ  1159
             Y+G+++G+VL++VGLY VLWGK KE++
Sbjct  308   YLGSVIGAVLVIVGLYLVLWGKSKEMK  334



>ref|XP_007148451.1| hypothetical protein PHAVU_006G210000g [Phaseolus vulgaris]
 gb|ESW20445.1| hypothetical protein PHAVU_006G210000g [Phaseolus vulgaris]
Length=402

 Score =   281 bits (720),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 146/343 (43%), Positives = 226/343 (66%), Gaps = 10/343 (3%)
 Frame = +2

Query  179   IMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLS  358
             ++M++VQ+GYA +NI  KLA++ GMN  + VAYR LFA++ +AP+A   ER+ R +M+  
Sbjct  15    LVMLVVQVGYAGVNIFYKLAVNDGMNLRIVVAYRFLFATIFMAPLALILERKKRTKMSWR  74

Query  359   ILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTA  538
             ILF  F C +FG SL Q  Y   L  ++ T   A+ NL+P +T++LA+ FG+E+L +RTA
Sbjct  75    ILFQSFFCGLFGGSLAQNFYLQALSLTSATFTSAMANLVPGITFILALCFGLERLNLRTA  134

Query  539   AGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFI  718
             AGKAK+ GT++ +GGAM+L+F  G  I IG  + H+    +L  QN     +  +    +
Sbjct  135   AGKAKIAGTLIGIGGAMVLTFVKGKEIKIG--TFHF----NLLHQNGARPPAQASGAKTV  188

Query  719   LGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWS  898
             LG    + S +S+A+W IIQ ++ E+YP PYSSTALM    ++  ++ A+C +   T W 
Sbjct  189   LGSLSALASGVSYALWLIIQAKMIERYPCPYSSTALMSMWGALVSIVIALCLERDWTQWR  248

Query  899   LRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKI  1078
             L   IR  +A Y+GIV + +   ++SWCI  +GPL+ SVFNPL+LV+VA+ S  +L++ +
Sbjct  249   LGWNIRLWTAAYSGIVVSGIMVVMISWCIRMRGPLFASVFNPLMLVLVALASSTMLKETL  308

Query  1079  YVGTIVGSVLIVVGLYGVLWGKQKEL----QVIGVVHVDEEEA  1195
             ++G I+G+VLIV+GLY VLWGK +E+    Q++   +  E+E+
Sbjct  309   HLGCIIGAVLIVLGLYLVLWGKSEEMKKKNQLVAAENPHEDES  351



>emb|CBI37609.3| unnamed protein product [Vitis vinifera]
Length=366

 Score =   280 bits (715),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 140/342 (41%), Positives = 215/342 (63%), Gaps = 6/342 (2%)
 Frame = +2

Query  185   MIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIR-PQMTLSI  361
             M++ QLG+  +NI  KLA++ GMN  V +AYR +FA+  I P+A+  ERR   P++T  I
Sbjct  1     MVVAQLGFGGVNIFYKLAVNDGMNVRVLIAYRFIFATAFICPLAFILERRKSGPRLTWMI  60

Query  362   LFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTAA  541
                 FLC +FG +L Q  Y   L  ++PT + A+ NLIPAVT++ A+  G+E+L IRT A
Sbjct  61    ALQGFLCGLFGGALGQNLYLESLALTSPTFSAAMANLIPAVTFIFALFLGLERLKIRTWA  120

Query  542   GKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFIL  721
             G+AKV+GT+L +GGAM+L+FY G  I I  + +     + L  +++    S     N +L
Sbjct  121   GRAKVIGTVLGIGGAMVLTFYKGPQINIWSTKV-----NLLKHKDQHVAASHGELDNHVL  175

Query  722   GPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWSL  901
             G  L + S  S+AIW IIQ ++ E+YP  YS TALMC  +++Q +++A+C +   + W L
Sbjct  176   GSILAVASCFSYAIWLIIQAKMGERYPFDYSCTALMCASATVQAIVYAMCKEKNWSAWKL  235

Query  902   RQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKIY  1081
                IR  +  Y G   +     L+SWC+ K+GPL+VS+FNPL+LV VA+L   +L +K++
Sbjct  236   GWNIRLLTVAYTGFFASGFMVVLVSWCVRKRGPLFVSIFNPLMLVFVAILGSLILDEKLH  295

Query  1082  VGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEV  1207
             +G+I+G VLIV+GLY +LW K  E++ +  +   +     E+
Sbjct  296   LGSIIGGVLIVIGLYAMLWAKGAEMKSMATLSHSKSSKEAEI  337



>ref|XP_011029206.1| PREDICTED: WAT1-related protein At1g25270-like [Populus euphratica]
Length=376

 Score =   280 bits (715),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 140/352 (40%), Positives = 227/352 (64%), Gaps = 20/352 (6%)
 Frame = +2

Query  179   IMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLS  358
             ++M++VQ+ +A +N++ KLA + GMN  + VAYR +FA+  +AP+A+  ER+ R ++T +
Sbjct  15    LLMVLVQVAFAAVNVLYKLAANDGMNLKIIVAYRFIFATAFMAPLAFIVERKNRGELTWT  74

Query  359   ILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTA  538
             I+   F C +FG S  Q  Y   L   + T ACA+ NLIPAVT++LA+ F +E++ + +A
Sbjct  75    IIIQAFFCGLFGCSFAQNAYIESLALISATFACAMANLIPAVTFILALIFRMERMELASA  134

Query  539   AGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSI----HWKYADHLSSQNKDNNGSTNAQ  706
              GKAK +GT++ +GGAMLL+FY G  I  G + +    H +YA   SS            
Sbjct  135   KGKAKAIGTLMGIGGAMLLTFYKGVEINNGSAKVNLLHHRQYAHAASSHGHGR-------  187

Query  707   PNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKP  886
                ILG F+ +++ LS++ W I+Q ++S +Y + YS++AL+C M +IQ  +FA+C +   
Sbjct  188   ---ILGFFMALLNCLSYSSWLIVQAKMSARYRSHYSNSALVCAMGAIQATVFALCLERDW  244

Query  887   TDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLL  1066
               W L   IR  +A ++G+ G+ L   L+SWC+  +GPL+V++F+PL+LV+VA+    LL
Sbjct  245   NQWKLGWNIRLLTAAFSGVAGSGLMGILISWCLAMRGPLFVAIFSPLMLVLVAIAGSLLL  304

Query  1067  QDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKED  1222
              +K+Y+G+IVG++LI+ GLY VLWGK KE++        ++ A +E ET ++
Sbjct  305   AEKLYLGSIVGALLIICGLYFVLWGKSKEMK------AKKQLAPSETETSQE  350



>gb|EYU35417.1| hypothetical protein MIMGU_mgv1a006677mg [Erythranthe guttata]
Length=435

 Score =   281 bits (720),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 154/355 (43%), Positives = 227/355 (64%), Gaps = 10/355 (3%)
 Frame = +2

Query  179   IMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLS  358
             IMMI+ Q  +AV+NI  KLA + GM   + VAYR LF++  I P+A+F ER+ RP++T  
Sbjct  18    IMMIVFQAVFAVVNIGYKLAANDGMRLPILVAYRFLFSAAFIIPVAFFVERKKRPKLTWK  77

Query  359   ILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTA  538
             +    FLC +FG +L Q  Y   L  ++ T   A+TNLIPA+T+++AV   +E+L   TA
Sbjct  78    VASYGFLCGLFGGALGQNLYLKALDLTSATFVSAMTNLIPAMTFIVAVCLRLERLGWNTA  137

Query  539   AGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQ---P  709
             AGKAKV+GT+L + GAMLL+FY G  I + ++ I+      L+  N+ +NGST       
Sbjct  138   AGKAKVLGTLLGISGAMLLTFYKGPEINLWDTHIN---LLELTKSNR-SNGSTQVHHGGQ  193

Query  710   NFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPT  889
             N +LG  L +VS + +++W I+Q + + KYP PYS TA+M F +SIQ V FA+C + +  
Sbjct  194   NLVLGSILALVSCVCYSLWLIVQAKAAAKYPCPYSITAMMSFWASIQGVGFALCMEREWN  253

Query  890   DWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQ  1069
             DW  R  I   +A  AGI+G+ + +  ++WC+  +GPL+VSVFNPLLLV+VA+     L+
Sbjct  254   DWIPRLNIGLLTAAVAGILGSGVMFVFVAWCVRMRGPLFVSVFNPLLLVMVAIAGSLFLE  313

Query  1070  DKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEE  1234
             +K++ G ++G +LIV GLY VLWGK +EL+    V     +A NE +T +   EE
Sbjct  314   EKLHWGMVLGGILIVAGLYIVLWGKGRELK---QVSQQTPQAENEEQTPQAENEE  365



>ref|XP_004485529.1| PREDICTED: WAT1-related protein At1g68170-like isoform X1 [Cicer 
arietinum]
Length=413

 Score =   281 bits (718),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 151/339 (45%), Positives = 230/339 (68%), Gaps = 5/339 (1%)
 Frame = +2

Query  149   DIMGV--DLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYF  322
             DI  V  DL   ++M++VQ+ +A++NI+ KLA++ GMN  + VAYR +F++  IAP+A+F
Sbjct  3     DICNVVQDLKPTLLMVVVQIAFAIVNILYKLAVNDGMNLRIVVAYRYIFSTAFIAPLAFF  62

Query  323   SERRIRPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAV  502
              ER+ R +M+  ILF  FLC +FG +L Q  Y   L  ++ T A A+ NLIPAVT+++A+
Sbjct  63    LERKKRTKMSWMILFQSFLCGLFGGALAQNFYLEALALTSATYASAMANLIPAVTFIMAL  122

Query  503   PFGIEKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKD  682
               G+EKL +RT AGKAK++GT++ +GGAM+L+F  G  I +G  S H     H +     
Sbjct  123   SLGMEKLNLRTKAGKAKIIGTLIGIGGAMVLTFVKGVEIKMG--SFHLNLLHHQNGVVSH  180

Query  683   NNGSTNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLF  862
              + + ++   F LG    + S++S+A+W IIQ ++SE+YP  YSSTALM F  S+ C++F
Sbjct  181   PHVTISSGKTF-LGSLCALASSISYALWLIIQAKMSERYPTHYSSTALMSFWGSLLCIVF  239

Query  863   AICFDHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIV  1042
             A+CF+     W L   IR  +  YAGIV +     ++SWC+  +GPL+ SVF+PL+LVIV
Sbjct  240   ALCFERDWNQWKLGWNIRLLTVTYAGIVVSGAMVAVVSWCVHLRGPLFASVFSPLMLVIV  299

Query  1043  AVLSWGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQ  1159
             A++S  +L +K+++G+I+G+VLIV GLY V+WGK KE++
Sbjct  300   ALVSCTMLNEKLHLGSIIGAVLIVCGLYAVVWGKSKEMK  338



>ref|XP_004288677.1| PREDICTED: auxin-induced protein 5NG4-like [Fragaria vesca subsp. 
vesca]
Length=402

 Score =   280 bits (716),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 151/342 (44%), Positives = 223/342 (65%), Gaps = 5/342 (1%)
 Frame = +2

Query  167   LLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQ  346
             L  ++ M+ VQ+ YA M I  KLA DSGMN  + VAYR +F+S  + P+A   ER  RP+
Sbjct  21    LKPVMTMVAVQIAYAAMGIFYKLAADSGMNLNILVAYRLMFSSAIMIPLALIVERNSRPK  80

Query  347   MTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLM  526
             +TL +LF  FLC +FG SL+Q  Y  GL  ++PT + A  NLIPA+TY+ A+ F +EKL 
Sbjct  81    LTLVVLFQAFLCGLFGGSLSQNLYIKGLALTSPTFSAAAANLIPAITYITAICFRLEKLT  140

Query  527   IRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQ  706
             + + AGKAK+VGT++ + GAM+ +FY G      E SI   + D L   +   + S  + 
Sbjct  141   LGSHAGKAKLVGTVVGIAGAMVFTFYKGP-----EFSIWSVHVDLLRGHHPAPSSSHGST  195

Query  707   PNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKP  886
              + +LG F    SA+++++W I+Q ++S++YP PYSSTAL+  M SIQ V+FA+C +   
Sbjct  196   GSHLLGAFFAFGSAVAYSMWLIVQAKMSKRYPCPYSSTALLSVMGSIQSVIFAVCVERDW  255

Query  887   TDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLL  1066
             + W L   I+  +A Y GIV + +   ++SWC+ K+GPL+VSVF PL LVIVA+ S  LL
Sbjct  256   SRWKLGWNIKLFTAAYTGIVASGMVVVMISWCVRKRGPLFVSVFAPLCLVIVAIASSLLL  315

Query  1067  QDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEE  1192
              + + +G+++G  LIV GLY VLWGK KE++ +  V+ D+E+
Sbjct  316   NENLSLGSVLGGTLIVCGLYMVLWGKSKEMKRVIDVNSDQEQ  357



>ref|XP_003581229.2| PREDICTED: WAT1-related protein At1g68170-like [Brachypodium 
distachyon]
Length=374

 Score =   279 bits (713),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 146/368 (40%), Positives = 225/368 (61%), Gaps = 7/368 (2%)
 Frame = +2

Query  185   MIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLSIL  364
             M+ +Q+ ++V+ I  KLA++ GM+  V VAYR +FA+  + PIA+F +R+ RP +T+ ++
Sbjct  1     MVGLQVLFSVLQIFIKLALNDGMDARVLVAYRYMFAAAFLCPIAFFVDRKKRPPLTMKVV  60

Query  365   FNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTAAG  544
               +FLC + G ++NQ    + +K ++ T   A++NL PA T+LL++   +E L +R  AG
Sbjct  61    LYLFLCGLLGFAINQNLCVLAIKLTSATFVTAISNLTPATTFLLSILTRLETLKLRNPAG  120

Query  545   KAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFILG  724
             +AK+VGT++ +GGAMLL+FY G    +       +   H++  +  N  ST+ Q   ILG
Sbjct  121   QAKLVGTLVGMGGAMLLTFYKGPEFTLLRRLPRPRLV-HITEAHHSNQQSTSNQ---ILG  176

Query  725   PFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWSLR  904
              FL IVS  S+A W+++Q +V E YP  YS  A++C   ++Q  + A+C  H    W L 
Sbjct  177   SFLGIVSCFSYAAWAVVQAKVGELYPCHYSMAAMVCLFGALQSTVVAVCVQHDMAHWRLG  236

Query  905   QGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKIYV  1084
               IR  SA YAG + T  A+ ++SWC+ KKGPL+V+VFNPL+LV VA LS  LL + +Y+
Sbjct  237   LHIRLYSAAYAGFIATGSAFPVLSWCLRKKGPLFVAVFNPLMLVFVAALSSILLDEALYL  296

Query  1085  GTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELELSAHSIIT  1264
             G+ +GS+LIV GLY VLWGK KE   +     DE+  +  +       +  ++  H I T
Sbjct  297   GSGLGSILIVCGLYLVLWGKAKEQSDMS---KDEDLGKKSIAVTATSEDGKDMENHEIST  353

Query  1265  VDQFPKKN  1288
             +    KKN
Sbjct  354   ISFSKKKN  361



>ref|XP_009616814.1| PREDICTED: WAT1-related protein At1g09380-like, partial [Nicotiana 
tomentosiformis]
Length=320

 Score =   277 bits (708),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 155/287 (54%), Positives = 207/287 (72%), Gaps = 10/287 (3%)
 Frame = +2

Query  383   SIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTAAGKAKVVG  562
             +I  I++NQ  YF+GLKNSTPT+  A+ NLIPA T+L+AVP G EKL +R+ AG+AK++G
Sbjct  27    AICRITVNQYVYFIGLKNSTPTVVSAIDNLIPAFTFLIAVPVGAEKLRLRSIAGQAKLLG  86

Query  563   TILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFILGPFLIIV  742
             TI+CVGGAMLLS YHG  + IG+   HWKYA+   S  KD N S +   NF  GPFL+I+
Sbjct  87    TIVCVGGAMLLSLYHGKVV-IGQLGFHWKYAE---STGKDVNSSGHG--NFFSGPFLVIM  140

Query  743   SALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWSLRQGIRAT  922
             S+L++AIW IIQ +V+EKY APY+   LMC M+S++ V+   C   K ++W+L   IRA 
Sbjct  141   SSLTYAIWLIIQGKVNEKYAAPYTCITLMCLMASVESVIIGFCVVPKLSEWALNP-IRAI  199

Query  923   SAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKIYVGTIVGS  1102
             S VY G+V T+ AY L SWCIE+KGPLYVS+FNPLLLVI A LSW LL++K+Y+G +VGS
Sbjct  200   SVVYNGVVCTSFAYFLSSWCIERKGPLYVSMFNPLLLVISAFLSWTLLREKLYLGVVVGS  259

Query  1103  VLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELEL  1243
             ++IV+GLYG LWG++ E      + V   + +N+  TK D   EL+L
Sbjct  260   IIIVIGLYGFLWGQKMETSTDDDIEVVVNKEKNQ-STKIDL--ELQL  303



>ref|XP_008457270.1| PREDICTED: WAT1-related protein At1g25270-like [Cucumis melo]
Length=392

 Score =   279 bits (713),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 154/362 (43%), Positives = 231/362 (64%), Gaps = 22/362 (6%)
 Frame = +2

Query  170   LALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQM  349
             L  I+MI+VQ G+A +NI  KLA   GM+  + +AYR LFAS  I PIA+F ER  RP++
Sbjct  10    LPTIVMILVQFGFAGVNICYKLAAADGMSFRIIIAYRFLFASAFILPIAFFLERGRRPKL  69

Query  350   TLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMI  529
             T S++F  FLC +FG SL+Q  Y   L  ++ T A A+ NL+PA+T++LAV F +E++ I
Sbjct  70    TWSVIFYAFLCGLFGGSLSQNLYVESLALTSATYASAIGNLVPAITFILAVSFRLERMNI  129

Query  530   RTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQP  709
              T  GKAKV+GT++ +GGAM+L+FY G         +H  ++  +   +K +N + +A P
Sbjct  130   GTMRGKAKVMGTLIGIGGAMILTFYKG-------VELH-PWSTRVDLLHKAHNSTGHAAP  181

Query  710   ------NFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAIC  871
                   + +LG  + + S  S+A+W I+Q ++SE YP  YSSTALMC M S+Q V FA+C
Sbjct  182   PEHKIHSQVLGSVMGVGSCFSYALWLIVQAKMSECYPCHYSSTALMCMMGSVQAVGFALC  241

Query  872   FDHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVL  1051
              + + + W L   IR  S  Y GIV + +   L++WC+  +GP++VSVF+PL+L++VA+ 
Sbjct  242   VETQWSRWKLGWNIRLFSVAYTGIVASGVMVTLITWCVRMRGPMFVSVFSPLILLLVAIA  301

Query  1052  SWGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLE  1231
             +   LQ+K+Y+G +VG +L+V GLY VLWGK KE++ I             VE+ E  L+
Sbjct  302   ASLFLQEKLYIGCVVGGMLMVCGLYMVLWGKSKEIRKI--------TQLAPVESIEAQLQ  353

Query  1232  EL  1237
             +L
Sbjct  354   QL  355



>gb|KHG16428.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=381

 Score =   278 bits (712),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 142/329 (43%), Positives = 219/329 (67%), Gaps = 7/329 (2%)
 Frame = +2

Query  179   IMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLS  358
             ++M+++Q+ +A ++++ KLA + GM+  + VAYR LFA+  + P+A   ER  RP++T +
Sbjct  15    MLMVVIQVIFAGVSVLYKLAANDGMSLRIIVAYRFLFATAVMVPVALLVERE-RPKLTWT  73

Query  359   ILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTA  538
             IL   FLC++ G +L+Q  Y   +  ++ T   A+ NL PA+T+ +A+  G+EKL  RT 
Sbjct  74    ILLQAFLCALLGGTLSQNLYIESMALTSATFVSAMANLTPAITFTMAIIMGLEKLGFRTM  133

Query  539   AGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFI  718
             AG+AKV+GT++ VGGAMLL+FY G  I IG +  H   +    S N     STN   + +
Sbjct  134   AGRAKVLGTVIGVGGAMLLTFYKGLQINIGSTHFHLLLSHGPISSNAP---STN---HHL  187

Query  719   LGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWS  898
             LG  L   S +S+++W  IQ ++SE YP  YSSTAL+C + +IQ V FA+C +   + W 
Sbjct  188   LGALLAFTSCISYSLWLNIQAKMSENYPCYYSSTALICIIGTIQAVAFALCMEKDMSQWK  247

Query  899   LRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKI  1078
             L   IR  +  Y+GI+ + L + ++SWC+  KGPLYVSVF+PL++V+VA+     L++K+
Sbjct  248   LGWNIRLLTVAYSGILASGLVFSVVSWCVRMKGPLYVSVFSPLMVVLVALAGTLFLEEKL  307

Query  1079  YVGTIVGSVLIVVGLYGVLWGKQKELQVI  1165
             Y+G+I+G+VLIV+GLY VLWGK KE +V+
Sbjct  308   YLGSIIGAVLIVMGLYVVLWGKSKETKVV  336



>gb|KHN43349.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=251

 Score =   273 bits (699),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 129/239 (54%), Positives = 170/239 (71%), Gaps = 8/239 (3%)
 Frame = +2

Query  515   EKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGS  694
             E L I+  AG AKV GTILCV GA+LLSFYHG  IG+G+SSIHW+YA+ +   +    G 
Sbjct  5     ENLGIKKRAGLAKVFGTILCVSGALLLSFYHGKTIGLGQSSIHWRYAEKMEGTSSSGKG-  63

Query  695   TNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICF  874
                  N  LGP ++I+S L WA W IIQ  +S+ +PAPY+ST LMCFM+S QC++ A+C 
Sbjct  64    -----NMFLGPLVVILSTLVWAAWFIIQKDISKTFPAPYTSTGLMCFMASFQCIIIAVCV  118

Query  875   DHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLS  1054
             DH  + WSL   +R +SA+YAGI  T LAYCLMSW IE+KGPLYVSVF PL LV+ A+LS
Sbjct  119   DHTASAWSLHNAMRLSSALYAGIFCTGLAYCLMSWTIERKGPLYVSVFTPLQLVLTAILS  178

Query  1055  WGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLE  1231
             W LL++K+YVGT VGS+LIV+GLY VLWGK +E+       ++E+  +  V+  ++ +E
Sbjct  179   WALLREKLYVGTAVGSLLIVLGLYSVLWGKSEEVNKGD--GIEEDAVKEAVKDSKNDME  235



>ref|XP_004166799.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
Length=384

 Score =   278 bits (711),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 144/352 (41%), Positives = 223/352 (63%), Gaps = 7/352 (2%)
 Frame = +2

Query  164   DLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRP  343
             D   + +M + Q  YA +N++ KLA++ GMN  + +A+R LFAS+ + P+A+F ER+ RP
Sbjct  15    DAKPVFLMALTQSVYAGVNVLYKLAINDGMNLMILIAFRFLFASLFMLPLAFFLERKKRP  74

Query  344   QMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKL  523
             +MT SILF  F C +FG +L+Q  Y   L  ++ T   A+ NL PA+T+LLA+ F +EKL
Sbjct  75    KMTWSILFYGFFCGLFGGTLSQNLYVQSLAMTSATFVSAMQNLSPAITFLLALSFRMEKL  134

Query  524   MIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNA  703
              ++   G AKV+GT+L +GGAM+L+ Y G  I I  + ++  +  H+S   ++++     
Sbjct  135   NVKKKEGVAKVLGTLLGIGGAMILTLYKGFEINIWTTRVNLLHGRHMSHLPQNSHSH---  191

Query  704   QPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHK  883
               N +LG  L   S LS++ W I+Q ++ + YP  YSSTALMC M +IQ V  +IC +  
Sbjct  192   --NLLLGSLLAFASCLSYSSWLILQAKMMKIYPCQYSSTALMCVMGAIQGVAISICVERD  249

Query  884   PTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGL  1063
                W L   IR  +  +AGIVG+     +M+WC+  +GPLYVSVF+PL+L+IVA+     
Sbjct  250   WKQWKLGWNIRLITVTFAGIVGSGAMVTVMAWCVRMRGPLYVSVFSPLMLLIVAIAGSLF  309

Query  1064  LQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKE  1219
             L +K+++G++VG++LIV GLY VLWGK KE+     + +   E+  ++E K+
Sbjct  310   LDEKLHLGSVVGAMLIVCGLYMVLWGKSKEMN--KCLQLTPSESIGQLELKD  359



>gb|EEC70465.1| hypothetical protein OsI_01511 [Oryza sativa Indica Group]
Length=344

 Score =   277 bits (708),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 147/361 (41%), Positives = 218/361 (60%), Gaps = 40/361 (11%)
 Frame = +2

Query  185   MIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLSIL  364
             M++VQLG A +N++SKL M SGM+P+V +AYR   A+  +APIA+  ER           
Sbjct  1     MVLVQLGLAGLNVMSKLTMASGMSPYVLLAYRNFIAAAFLAPIAFLVERA----------  50

Query  365   FNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTAAG  544
                        +LNQ+ YFVGLK S+PT+A AL N +PAVT+LLA    +E +  R  AG
Sbjct  51    -----------TLNQVLYFVGLKYSSPTVASALNNTLPAVTFLLAALLKMEPVAGR--AG  97

Query  545   KAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFILG  724
             +AKV GT LCV G+ML++FY G  +    S +HW Y   +         +       +LG
Sbjct  98    RAKVAGTALCVAGSMLMTFYRGPLVRTLASPVHWPY---VQGTMAAEAAAHAGGHAVVLG  154

Query  725   PFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWSLR  904
               L+I S ++WAIW IIQ  +S+ +  PY+STALM  ++S+QC   A   + + + W L 
Sbjct  155   AVLVIGSNVAWAIWFIIQKNLSKSFACPYTSTALMALIASVQCAAIAGAAERRFSAWELG  214

Query  905   QGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKIYV  1084
               IR   A+YAGIV + +   +MSWCI+++GP++VS+F+PL+L++VAV+ WG+L +KI+V
Sbjct  215   LDIRLVGALYAGIVASGMVCTVMSWCIQERGPVFVSMFSPLMLIVVAVVGWGILGEKIHV  274

Query  1085  GTIVGSVLIVVGLYGVLWGKQKEL--------------QVIGVVHVDEEEARNEVETKED  1222
             G+++G+V+IVVGLY VLWG  ++L              ++ GVV  D+   R   + +  
Sbjct  275   GSVIGAVIIVVGLYTVLWGNGRDLDGAAVAIASFPGDEEMNGVVGADDTTGRAPPDGQTR  334

Query  1223  H  1225
             H
Sbjct  335   H  335



>ref|XP_010068193.1| PREDICTED: WAT1-related protein At1g68170-like [Eucalyptus grandis]
Length=393

 Score =   278 bits (712),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 141/327 (43%), Positives = 217/327 (66%), Gaps = 6/327 (2%)
 Frame = +2

Query  173   ALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMT  352
             A +MM++VQ+ +  +NI+ KL + +GMN  V +AYR +FA+  +AP+A+F ER+ RP++T
Sbjct  3     AALMMVVVQVAFGGINILYKLTVSNGMNLSVVIAYRFMFATAVLAPLAFFLERKSRPKIT  62

Query  353   LSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIR  532
              ++L   F C++ G S+ Q  Y   L  ++ T A A+ NL+PAVT++LAV  G+EK+ +R
Sbjct  63    WTVLVQAFFCALLGGSMGQNLYLASLSMTSATYASAMANLVPAVTFVLAVSLGLEKVRVR  122

Query  533   TAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPN  712
             T AGKAK  GT++ +GGAMLL+FY G  + +   S H     H+++  +   GS++    
Sbjct  123   TVAGKAKAAGTLMGIGGAMLLTFYKGAEVNLW--STHVNLLRHVAATRRGQVGSSDLLLG  180

Query  713   FILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTD  892
              +L     + S   +A W IIQ ++SE +P  Y+STALM F+ SIQ  ++A+C +   + 
Sbjct  181   SLLA----VASCFCYASWLIIQAKMSEDFPYQYTSTALMTFLGSIQATVYALCRERDWSQ  236

Query  893   WSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQD  1072
             W L   IR  +  YAGIV + L Y L+ WC+  +GP++VSVFNPL+LV VA++   +L +
Sbjct  237   WKLGWNIRLLTVSYAGIVASGLCYTLIVWCVRMRGPVFVSVFNPLMLVTVALVGSMVLDE  296

Query  1073  KIYVGTIVGSVLIVVGLYGVLWGKQKE  1153
             K+++G+I+GS LIV+GLY VLWGK+KE
Sbjct  297   KLHMGSILGSGLIVLGLYAVLWGKRKE  323



>ref|XP_006491838.1| PREDICTED: WAT1-related protein At1g68170-like isoform X1 [Citrus 
sinensis]
Length=408

 Score =   279 bits (713),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 140/313 (45%), Positives = 209/313 (67%), Gaps = 8/313 (3%)
 Frame = +2

Query  230   KLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLSILFNIFLCSIFGISLNQ  409
             KLA ++GM+  V VAYR +FA+  + P+A   ER+ RP++ L ILF  FLC +FG SL+Q
Sbjct  38    KLAANNGMSLRVIVAYRFIFATAFMVPVALILERKSRPKLNLKILFQAFLCGLFGGSLSQ  97

Query  410   ITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTAAGKAKVVGTILCVGGAM  589
               Y   L  ++ T A A+ NL+PA+T++L++  G+EKL IRT AGKAKV+G+++ +GGAM
Sbjct  98    NLYLESLVLTSATFASAMANLVPAITFVLSISIGLEKLGIRTRAGKAKVLGSLIGIGGAM  157

Query  590   LLSFYHGHNIGIGESSIHW-KYADHLSSQNKDNNGSTNAQPNFILGPFLIIVSALSWAIW  766
             +L+FY G  I I  ++I+  +   H++S + D            LG    + S   +AIW
Sbjct  158   ILTFYRGVEINIWSTNINLIRSNGHVASLHADPGKR-------FLGALFALGSCFGYAIW  210

Query  767   SIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWSLRQGIRATSAVYAGIV  946
              +IQ ++SE+YP  +SSTALMC M +IQ V+FA+C +   + W L   IR  +  Y+GIV
Sbjct  211   LVIQAKMSEEYPCQFSSTALMCVMGAIQAVVFALCMEKDWSQWKLGWNIRLLTVAYSGIV  270

Query  947   GTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKIYVGTIVGSVLIVVGLY  1126
              + L   L+SWC+  +GPL+ S+FNPL+LV+VA+L   +L +K+++G+I+G+ LIV GLY
Sbjct  271   ASGLMVTLISWCVRTRGPLFASIFNPLMLVVVAILGSLILDEKLHLGSILGATLIVCGLY  330

Query  1127  GVLWGKQKELQVI  1165
              VLWGK KE++ I
Sbjct  331   AVLWGKGKEMKKI  343



>ref|XP_003547067.2| PREDICTED: WAT1-related protein At1g68170-like [Glycine max]
Length=404

 Score =   278 bits (712),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 152/356 (43%), Positives = 219/356 (62%), Gaps = 13/356 (4%)
 Frame = +2

Query  167   LLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQ  346
             L  +++M++VQ+ Y  +N++ KLA++ GM+  V  AYR  F S    P+A  SER  RP+
Sbjct  14    LKPVLLMVLVQIAYTAVNVLFKLAINDGMSVKVATAYRLAFGSAFTVPLALISERNKRPK  73

Query  347   MTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLM  526
             MT  +LF   LC +FG SL Q  ++  L  ++ T A AL NLIPA+T++LA+  G E+L 
Sbjct  74    MTWRVLFMACLCGLFGGSLFQNLFYESLALTSATFASALYNLIPAITFVLAISCGFERLN  133

Query  527   IRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNG---ST  697
             ++ AAGKAKV+GT+L +GGAMLL+F  G  I I      W +  +L   ++  NG   S 
Sbjct  134   LKAAAGKAKVLGTLLGIGGAMLLTFIKGAEINI------WPFHINLMHPHQHQNGQVASL  187

Query  698   NAQP--NFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAIC  871
             NA    N +LG    + S  S+A+W IIQ ++S++YP  YSSTALM    +IQ   F  C
Sbjct  188   NADSGNNKLLGAICSLASCFSFALWLIIQAKMSKEYPCHYSSTALMSTAGAIQATAFGFC  247

Query  872   FDHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVL  1051
             F+   T W L   IR  +  Y+GIV + +   + +WCI+ +GPL+ SVFNPL+LV+VA+ 
Sbjct  248   FERDLTQWKLGWNIRLLAVAYSGIVASGIVVIITAWCIQMRGPLFASVFNPLMLVLVAIT  307

Query  1052  SWGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKE  1219
                +L + +YVG++VG+VLIV GLY VLWGK KE++   +  +   E   E E  E
Sbjct  308   GSLMLNENLYVGSVVGAVLIVCGLYMVLWGKSKEMK--NITQLVPSETIREAEAIE  361



>ref|XP_010241528.1| PREDICTED: WAT1-related protein At3g30340-like isoform X3 [Nelumbo 
nucifera]
 ref|XP_010241529.1| PREDICTED: WAT1-related protein At3g30340-like isoform X3 [Nelumbo 
nucifera]
Length=357

 Score =   277 bits (708),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 131/343 (38%), Positives = 226/343 (66%), Gaps = 5/343 (1%)
 Frame = +2

Query  182   MMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLSI  361
             +M+ +    A++NI+ K  +D GMN  V + YRQ  A+  +APIAYF ER+ RP++T  I
Sbjct  15    VMVAINFFLAIVNILLKKVLDEGMNNLVIITYRQCLATSFLAPIAYFWERKSRPKLTSRI  74

Query  362   LFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTAA  541
             L +IFL +I G +L Q  + +G++ ++ T +CA  N++P +T+L+A+PFG+E + +++ A
Sbjct  75    LCHIFLGAIVGPTLTQYFFLLGIQYTSATFSCAFINVVPVLTFLMALPFGLETVNLKSKA  134

Query  542   GKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFIL  721
             G+AK++GT++CVGGAM+L+ Y G  +    SS   + +  +++Q             + +
Sbjct  135   GRAKLLGTVVCVGGAMMLTLYKGLPLTNRPSS---QASTQMTNQASSRFSPQKRAERWTI  191

Query  722   GPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWSL  901
             G   ++  ++ W+ W +IQ R+S++YP  YSSTA+M F S+IQ  + ++  +   + W L
Sbjct  192   GTIALVAGSIFWSSWFLIQARISKQYPCQYSSTAIMSFFSAIQSAVLSLVIERDISLWVL  251

Query  902   RQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKIY  1081
             R      + +YAGI+G+ L++  MSWC++K+GPL+ S F+PL+ +IVA++ + +L +++ 
Sbjct  252   RGKAAILTVLYAGIMGSGLSFVGMSWCVKKRGPLFTSAFSPLIQIIVAIIDFFILHEQLN  311

Query  1082  VGTIVGSVLIVVGLYGVLWGKQKELQ--VIGVVHVDEEEARNE  1204
             +G+++GSVL+++GLY +LWGK KE Q  +I    V+EEEA  E
Sbjct  312   LGSVLGSVLVIIGLYILLWGKSKEAQSCMIKPQAVEEEEAHQE  354



>ref|XP_006364778.1| PREDICTED: WAT1-related protein At5g07050-like [Solanum tuberosum]
Length=382

 Score =   276 bits (707),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 142/350 (41%), Positives = 229/350 (65%), Gaps = 15/350 (4%)
 Frame = +2

Query  179   IMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLS  358
             I MI +Q GYA MN+I+K++++ GM+ +V V YR  FA++AIAP A   ER++RP+MT  
Sbjct  22    IAMISLQFGYAGMNVITKVSLNGGMSHYVLVVYRHAFATLAIAPFALLLERKLRPKMTFM  81

Query  359   ILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTA  538
             +   IF+  + G  ++Q  Y+ GLK ++PT +CA++N++PA+T+++AV   +EK+ I+  
Sbjct  82    MFLQIFILGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTFVMAVLCRMEKVHIKKL  141

Query  539   AGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFI  718
               +AKV+GTI+ V GAML++ Y GH I     ++ W   ++ S+ ++ N  S     +++
Sbjct  142   RCQAKVIGTIVTVAGAMLMTLYKGHVI-----NLVWANTNNTSNVSQSNETSDK---DWL  193

Query  719   LGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWS  898
              G  L+I +  +WA + I+Q     KY AP S TAL+CFM ++Q +   +  +HKP+ W+
Sbjct  194   KGSILLIGATFAWASFFILQAITMRKYTAPLSLTALVCFMGTLQSIAVTLVMEHKPSAWA  253

Query  899   LRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKI  1078
             +   +   +AVYAGIV ++LAY +    +EK+GP++V+ F+PL+++IVA++   +L +KI
Sbjct  254   IGFDMNLLAAVYAGIVSSSLAYYVQGLVMEKRGPVFVTAFSPLMMIIVAIMGSFILAEKI  313

Query  1079  YVGTIVGSVLIVVGLYGVLWGKQKELQ-------VIGVVHVDEEEARNEV  1207
             Y+G ++G+VLIV GLY VLWGK KE Q       + GVV  D E   +EV
Sbjct  314   YLGGVLGAVLIVAGLYSVLWGKYKEYQEKEIEGPLKGVVTNDIEMQTSEV  363



>gb|EEE60997.1| hypothetical protein OsJ_14806 [Oryza sativa Japonica Group]
Length=345

 Score =   275 bits (702),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 138/352 (39%), Positives = 224/352 (64%), Gaps = 7/352 (2%)
 Frame = +2

Query  185   MIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLSIL  364
             M+ +QL ++ + +  KLA++ GM+  V VAYR +FA+  + PIA+  ER+ RP +T+ ++
Sbjct  1     MVSLQLLFSALQVFIKLALNDGMDARVLVAYRFMFAATFLCPIAFLRERKKRPPLTMKVV  60

Query  365   FNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTAAG  544
               +FLC +FG S+NQ  Y + +K ++ T   A++NL PA T+LLA+   +E L ++  AG
Sbjct  61    LQLFLCGLFGFSINQNLYVLAIKLTSATFITAISNLTPATTFLLAILTRLETLKLKKPAG  120

Query  545   KAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFILG  724
             +AK++GT++ +GGAMLL+FY G  I + +   H K+A HL+   + +  ST  Q   I+G
Sbjct  121   QAKLLGTLVGMGGAMLLTFYKGPKIMVLDQLPHPKFA-HLTENPQSHPISTGNQ---IIG  176

Query  725   PFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWSLR  904
              FL I+S  ++A W +IQ +VS+ YP  YS  A++C   ++Q  + A+C       W L 
Sbjct  177   SFLGIISCFTYATWLVIQAKVSKVYPCHYSIAAMVCLFGALQSTVMALCVHRDMEHWRLG  236

Query  905   QGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKIYV  1084
               IR  S+ YAG++ +  A+ L+SWC+ KKGPL++SVF+PL+L+ VA++S  +L + +++
Sbjct  237   LNIRLYSSAYAGLIASGSAFPLLSWCLRKKGPLFISVFSPLMLIFVALMSSIILNEALHL  296

Query  1085  GTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELE  1240
             G+++GSVLIV GLY VLWGK KE      +  DE + +  +        E++
Sbjct  297   GSVLGSVLIVGGLYMVLWGKAKE---AADLSEDENQGKESIPVTTGGENEMK  345



>ref|XP_002530887.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
 gb|EEF31493.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
Length=391

 Score =   276 bits (705),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 141/365 (39%), Positives = 226/365 (62%), Gaps = 22/365 (6%)
 Frame = +2

Query  179   IMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLS  358
             I M++V      +NI+ KLA +  +N  + VAYR +FA+  + P+A   ER+ RPQ+T  
Sbjct  16    IGMVVVHFALTGVNILYKLAANQELNLRILVAYRWIFATAFLVPLALIIERKKRPQLTWM  75

Query  359   ILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTA  538
             ++F  FLC +FG  + Q  Y   +  ++ T   A++NL+PA+T +LAV F +EKLM++T 
Sbjct  76    VVFQAFLCGLFGGVVTQNMYVESIALTSATYVSAMSNLLPALTLILAVSFRLEKLMLKTT  135

Query  539   AGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFI  718
              GKAK++GT++ +GGAM+L+FY G  I I      W    +L   N+  NG +N   ++ 
Sbjct  136   IGKAKLMGTLIEIGGAMILTFYKGLEINI------WSIDTNLMKHNQQQNGQSNGNGSYF  189

Query  719   LGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWS  898
             LG  L + S +S+A+W I+QT++S++YP PYSS ALM  M+SIQCV+FA+  +   + W 
Sbjct  190   LGSLLALGSVISYAVWLIVQTKMSKRYPCPYSSAALMSIMASIQCVIFALSTERNWSAWK  249

Query  899   LRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKI  1078
             LR  +    AVY+GI+ + +   L++WC+  + P++V+ FNPL L++ A++   LL++K+
Sbjct  250   LRWNLMLLIAVYSGIMISGVVVILIAWCVHVRDPVFVANFNPLSLLLTAIMESLLLEEKL  309

Query  1079  YVGTIVGSVLIVVGLYGVLWGKQKELQ----------------VIGVVHVDEEEARNEVE  1210
             ++G+I+G+ LIV GLY VLWGK KE+                 V+ V   D++ +++   
Sbjct  310   HIGSILGAGLIVCGLYMVLWGKGKEMNEQAKLVPTPSSTKFDTVVVVTEDDKDISKDNPL  369

Query  1211  TKEDH  1225
              KE H
Sbjct  370   PKEQH  374



>emb|CAE05944.3| OSJNBb0088C09.3 [Oryza sativa Japonica Group]
 emb|CAH66932.1| H0525E10.16 [Oryza sativa Indica Group]
Length=356

 Score =   275 bits (702),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 139/356 (39%), Positives = 226/356 (63%), Gaps = 7/356 (2%)
 Frame = +2

Query  173   ALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMT  352
             A+  M+ +QL ++ + +  KLA++ GM+  V VAYR +FA+  + PIA+  ER+ RP +T
Sbjct  8     AVAAMVSLQLLFSALQVFIKLALNDGMDARVLVAYRFMFAATFLCPIAFLRERKKRPPLT  67

Query  353   LSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIR  532
             + ++  +FLC +FG S+NQ  Y + +K ++ T   A++NL PA T+LLA+   +E L ++
Sbjct  68    MKVVLQLFLCGLFGFSINQNLYVLAIKLTSATFITAISNLTPATTFLLAILTRLETLKLK  127

Query  533   TAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPN  712
               AG+AK++GT++ +GGAMLL+FY G  I + +   H K+A HL+   + +  ST  Q  
Sbjct  128   KPAGQAKLLGTLVGMGGAMLLTFYKGPKIMVLDQLPHPKFA-HLTENPQSHPISTGNQ--  184

Query  713   FILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTD  892
              I+G FL I+S  ++A W +IQ +VS+ YP  YS  A++C   ++Q  + A+C       
Sbjct  185   -IIGSFLGIISCFTYATWLVIQAKVSKVYPCHYSIAAMVCLFGALQSTVMALCVHRDMEH  243

Query  893   WSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQD  1072
             W L   IR  S+ YAG++ +  A+ L+SWC+ KKGPL++SVF+PL+L+ VA++S  +L +
Sbjct  244   WRLGLNIRLYSSAYAGLIASGSAFPLLSWCLRKKGPLFISVFSPLMLIFVALMSSIILNE  303

Query  1073  KIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELE  1240
              +++G+++GSVLIV GLY VLWGK KE      +  DE + +  +        E++
Sbjct  304   ALHLGSVLGSVLIVGGLYMVLWGKAKE---AADLSEDENQGKESIPVTTGGENEMK  356



>ref|NP_001054334.1| Os04g0687800 [Oryza sativa Japonica Group]
 emb|CAD41942.2| OSJNBa0070M12.19 [Oryza sativa Japonica Group]
 emb|CAJ86141.1| H0701F11.7 [Oryza sativa Indica Group]
 dbj|BAF16248.1| Os04g0687800 [Oryza sativa Japonica Group]
 gb|EAY96135.1| hypothetical protein OsI_18014 [Oryza sativa Indica Group]
 gb|EAZ32493.1| hypothetical protein OsJ_16712 [Oryza sativa Japonica Group]
 dbj|BAG98032.1| unnamed protein product [Oryza sativa Japonica Group]
Length=412

 Score =   276 bits (705),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 146/314 (46%), Positives = 206/314 (66%), Gaps = 3/314 (1%)
 Frame = +2

Query  215   MNIISKLAM-DSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLSILFNIFLCSIF  391
             +NI  KLA+   GM+  V VAYR LFAS  +AP+AYF ER+ R +MT  +L   F+C + 
Sbjct  26    VNIFYKLAVVCDGMDMRVLVAYRYLFASAVLAPLAYFVERKNRTKMTWRVLMLSFVCGLS  85

Query  392   GISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTAAGKAKVVGTIL  571
             G SL Q  Y  G+K ++ T A A+TNLIPAVT++LAV    E+L IRT AG+AKV GT+L
Sbjct  86    GGSLAQNLYISGMKLTSATFATAMTNLIPAVTFVLAVLCRYERLAIRTVAGQAKVAGTLL  145

Query  572   CVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFILGPFLIIVSAL  751
              VGGAMLL+ Y G  +    +  H      L +++     +T      I+G  L++ S +
Sbjct  146   GVGGAMLLTLYKGAELNPWHT--HLDLVAALEARHPAAAAATGNNDRVIMGSMLVVGSCV  203

Query  752   SWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWSLRQGIRATSAV  931
              +A+W I+Q ++S +YP  Y+STALMC MS  Q   FA+  D +P  W L   IR  S V
Sbjct  204   FYAVWLILQAKLSREYPFHYTSTALMCVMSGAQSAAFALLVDREPARWRLGLDIRLLSVV  263

Query  932   YAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKIYVGTIVGSVLI  1111
             Y+G++ + +   ++SWC++++GPL+ SVFNPL+LV+VAVL   LL +K++VGT++G+ LI
Sbjct  264   YSGVLASGVMLVVLSWCVKRRGPLFASVFNPLMLVVVAVLGSLLLDEKMHVGTLLGAALI  323

Query  1112  VVGLYGVLWGKQKE  1153
             VVGLY VLWGK +E
Sbjct  324   VVGLYAVLWGKGRE  337



>ref|XP_007148456.1| hypothetical protein PHAVU_006G210300g [Phaseolus vulgaris]
 gb|ESW20450.1| hypothetical protein PHAVU_006G210300g [Phaseolus vulgaris]
Length=398

 Score =   275 bits (704),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 158/389 (41%), Positives = 233/389 (60%), Gaps = 24/389 (6%)
 Frame = +2

Query  146   IDIMGV-----DLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAP  310
             ++I GV     +L  +++M++VQ+ Y+ +N++ KLA++ GM+  V  AYR  F S    P
Sbjct  2     VEIKGVMNAMHELKPVLLMVLVQIAYSAVNVLFKLAINDGMSVKVATAYRLAFGSAFTVP  61

Query  311   IAYFSERRIRPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTY  490
             +A  SER  RP+MT  +LF   LC +FG SL Q  ++  L  ++ T A AL NLIPA+T+
Sbjct  62    LALISERNKRPKMTWRVLFMACLCGLFGGSLFQNLFYESLAITSATFASALYNLIPAITF  121

Query  491   LLAVPFGIEKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSI-----HWKYA  655
             +LA+  G E+L +R AAG+AKV+GTI+ +GGAMLL+F  G  I I    I     H    
Sbjct  122   VLAISCGFERLNLRAAAGRAKVLGTIIGIGGAMLLTFIKGAEINIWPFHINLMHPHQHQD  181

Query  656   DHLSSQNKDNNGSTNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCF  835
              H++  + D++       N +LG    I S  S+++W  IQ ++S++YP  YSSTALM  
Sbjct  182   SHVAQFHSDSS-------NKLLGALCSIASCFSFSLWLTIQAKMSKEYPCHYSSTALMST  234

Query  836   MSSIQCVLFAICFDHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSV  1015
               +IQ   F  C +   + W L   IR  +  Y+GIV + +   + +WCI+K+GPL+ SV
Sbjct  235   AGAIQATAFGFCVERDLSQWKLGWNIRLLAVAYSGIVASGIVVIITAWCIQKRGPLFASV  294

Query  1016  FNPLLLVIVAVLSWGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKEL----QVIGVVHVD  1183
             FNPL+LV+VA+    +L + +YVG++VG+VLIV GLY VLWGK KE+    Q++    + 
Sbjct  295   FNPLMLVLVAIAGSLMLNENLYVGSVVGAVLIVFGLYMVLWGKSKEMKNITQLVPSETIR  354

Query  1184  EEEARN--EVETKEDHLEELELSAHSIIT  1264
             E EA     V T  DH E+ +    S IT
Sbjct  355   EAEAIEVVVVSTPMDH-EKRDHKNRSQIT  382



>ref|XP_003593115.1| Auxin-induced protein 5NG4 [Medicago truncatula]
 gb|AES63366.1| auxin-induced 5NG4-like protein [Medicago truncatula]
Length=395

 Score =   275 bits (703),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 152/373 (41%), Positives = 232/373 (62%), Gaps = 22/373 (6%)
 Frame = +2

Query  179   IMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLS  358
             +MM++VQ+ +A +N++ K A++ GM+  V  AYR +FA+    P+A   ER+ RPQ+T  
Sbjct  15    MMMLMVQIAFASVNVLYKFAINDGMSVRVLTAYRLIFAAATTIPLALIFERKNRPQLTWR  74

Query  359   ILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTA  538
             ++F  F C +FG SL Q  YF  L   + T A A+ NLIPAVT++LAV FG E+L  +TA
Sbjct  75    VVFMSFFCGLFGGSLFQNLYFESLALISATFASAVYNLIPAVTFILAVSFGYERLNFQTA  134

Query  539   AGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQP-NF  715
             AGKAKV+GTI  +GGAMLL+F  G  I I      W +  H++  +K  NG+ +    + 
Sbjct  135   AGKAKVLGTITGIGGAMLLTFLKGVEINI------WTF--HINLLHKGKNGTLDDNSGSK  186

Query  716   ILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDW  895
             +LG F  + S   +A+W IIQ ++S++Y   YSSTALM  M +IQ  LFA+C +   + W
Sbjct  187   LLGIFFGLGSCFCFALWLIIQAKMSKEYQGHYSSTALMSLMGAIQATLFALCVEKDLSQW  246

Query  896   SLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDK  1075
              L   IR  ++ Y+GIV + +   +++WC+  +GPLY S FNPL+LV+VA+    +L + 
Sbjct  247   RLGLSIRLLTSAYSGIVASGIMVIVIAWCVGIRGPLYASAFNPLMLVLVAIAGSLMLDEN  306

Query  1076  IYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELELSAHS  1255
             +Y+G+++G++LI++GLY VLWGK KE          ++E   E+ ++   L+E+++   S
Sbjct  307   LYLGSVIGAILIMIGLYMVLWGKSKE---------TKKETHLEITSE---LQEIQVVVTS  354

Query  1256  IITVDQFPKKN*N  1294
              I VD     N N
Sbjct  355   TI-VDHDCSNNNN  366



>ref|XP_004249118.1| PREDICTED: WAT1-related protein At5g07050 [Solanum lycopersicum]
Length=383

 Score =   275 bits (702),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 137/350 (39%), Positives = 229/350 (65%), Gaps = 14/350 (4%)
 Frame = +2

Query  179   IMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLS  358
             I MI +Q GYA MN+I+K++++ GM+ +V V YR  FA++AIAP A   ER++RP+MT  
Sbjct  22    IAMISLQFGYAGMNVITKVSLNGGMSHYVLVVYRHAFATLAIAPFALLLERKLRPKMTFM  81

Query  359   ILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTA  538
             + F IF+  + G  ++Q  Y+ GLK ++PT +CA++N++PA+T+++AV   +EK+ I+  
Sbjct  82    MFFQIFILGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTFVMAVLCRMEKVHIKKL  141

Query  539   AGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFI  718
               +AKV+GTI+ V GAML++ Y GH I +        +++++ + N  +  +  +  +++
Sbjct  142   RCQAKVIGTIVTVAGAMLMTLYKGHVINL-------VWSNNIHTNNNVSQSNETSDKDWL  194

Query  719   LGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWS  898
              G  L+I +  +WA + I+Q    +KY AP S T L+CFM ++Q +   +  +HKP+ W+
Sbjct  195   KGSILLIGATFAWASFFILQAITMKKYTAPLSLTTLVCFMGTLQSIAVTLVMEHKPSAWA  254

Query  899   LRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKI  1078
             +   +   +A YAGIV ++LAY +    +EK+GP++V+ F+PL+++IVA++   +L +KI
Sbjct  255   VGFDMNLLAAAYAGIVSSSLAYYVQGLVMEKRGPVFVTAFSPLMMIIVAIMGSFILAEKI  314

Query  1079  YVGTIVGSVLIVVGLYGVLWGKQKELQ-------VIGVVHVDEEEARNEV  1207
             Y+G ++G+VLIV GLY VLWGK KE Q       + GV+  D E   +EV
Sbjct  315   YLGGVLGAVLIVAGLYSVLWGKYKEYQEKEIEGPLKGVMTNDIEMQTSEV  364



>ref|XP_010649426.1| PREDICTED: WAT1-related protein At1g68170-like isoform X2 [Vitis 
vinifera]
Length=377

 Score =   274 bits (701),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 142/327 (43%), Positives = 208/327 (64%), Gaps = 10/327 (3%)
 Frame = +2

Query  179   IMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLS  358
             I+M++ QL    + I+ KLA++ GMN  V +AYR +FA+  I+ +A+  ER     +T  
Sbjct  16    IVMVVAQLASGGVQILYKLAINDGMNTRVLIAYRYIFATAFISSLAFILER-----LTWM  70

Query  359   ILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTA  538
             I    FLC +FG +L Q  Y   +  ++PT + A+ NLIPAVT++ A+  G+EKL IRT 
Sbjct  71    IALQGFLCGLFGGALGQNLYVESMVLTSPTFSAAMANLIPAVTFIFAIFLGLEKLAIRTW  130

Query  539   AGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFI  718
             AGKAKV GT+L +GGAM+L+FY G  I I  + +H      L  +N+    S     N +
Sbjct  131   AGKAKVTGTLLGIGGAMVLTFYKGPQINIWSTKVH-----LLKHKNQHVAASHRGMDNRV  185

Query  719   LGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWS  898
             LG  L + S  S+A W IIQ ++ E+YP  YSSTALMC  +S+Q V++A+C +   + W 
Sbjct  186   LGSLLAVASCFSYATWYIIQAKMGERYPFDYSSTALMCASASVQTVVYAMCKETNWSAWK  245

Query  899   LRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKI  1078
             L   IR  +  Y G + +     L +WC+ K+GPL+VSVFNPLLLV VA+L   LL +K+
Sbjct  246   LGWNIRLLTVAYTGYLSSGFMVVLANWCVRKRGPLFVSVFNPLLLVFVAILDSLLLDEKL  305

Query  1079  YVGTIVGSVLIVVGLYGVLWGKQKELQ  1159
             ++G+I+G VLIV+GLY +LW K++E++
Sbjct  306   HLGSIIGGVLIVIGLYAMLWAKREEMK  332



>ref|XP_011087819.1| PREDICTED: WAT1-related protein At1g25270-like isoform X1 [Sesamum 
indicum]
Length=397

 Score =   275 bits (703),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 146/345 (42%), Positives = 220/345 (64%), Gaps = 5/345 (1%)
 Frame = +2

Query  179   IMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLS  358
             ++M++VQ   +++NI  KLA + GM   V VAYR +F +  I P+A   ER+ RP++T +
Sbjct  18    LIMVLVQTLLSLVNIGYKLAANDGMTLSVLVAYRLIFGAACIIPVAIVVERKKRPKLTWT  77

Query  359   ILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTA  538
             +    FLC +FG SL Q  Y   L  ++ T   A+TNLIPA+T+++A+   +EKL   T 
Sbjct  78    VALYGFLCGLFGGSLGQNLYLKSLVLTSATFISAMTNLIPAITFIIAISLRLEKLGWNTI  137

Query  539   AGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFI  718
             AGKAKV GT+L +GGAM+ +FY G  + IG++ I     + L   +      T   PN +
Sbjct  138   AGKAKVFGTLLGIGGAMVFTFYKGPELHIGKTGI-----NLLKMTSSRGQAQTQNHPNLV  192

Query  719   LGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWS  898
             +G  L +V+ L++++W IIQ + +EKYP PYS T +M F  SIQ V++AIC +   + W 
Sbjct  193   VGLLLSLVTCLTYSLWLIIQAKAAEKYPCPYSLTGMMTFWGSIQSVIYAICVERDRSQWI  252

Query  899   LRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKI  1078
             L   IR  +A+ AG++G+ L + L++WC+  +GPL+VS+FNPLLLVIVA++    L +K+
Sbjct  253   LGWNIRLLAALVAGVLGSGLMFTLVAWCVRMRGPLFVSIFNPLLLVIVAIVGILFLDEKL  312

Query  1079  YVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVET  1213
             ++G I G++LIV GLY VLWGK KE +    +  + +E R  VET
Sbjct  313   HLGMIFGAILIVCGLYIVLWGKSKESKNANQILPESQENRQHVET  357



>ref|XP_008457201.1| PREDICTED: WAT1-related protein At1g25270-like [Cucumis melo]
Length=365

 Score =   274 bits (700),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 145/348 (42%), Positives = 217/348 (62%), Gaps = 11/348 (3%)
 Frame = +2

Query  185   MIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLSIL  364
             M +VQ  YA +N++ KLA++ GMN  + +A+R LFAS+ + P+A+F ER  RP+MT S L
Sbjct  1     MALVQSVYAGVNVLYKLAVNDGMNLMILIAFRFLFASLFMLPLAFFLERNKRPKMTWSFL  60

Query  365   FNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTAAG  544
             F  F C +FG +L+Q  Y   L  ++ T   A+ NL PA+T+LLA+ F +EKL I+   G
Sbjct  61    FYGFFCGLFGGTLSQNLYVQSLAMTSATFVSAMQNLCPAITFLLALSFRMEKLKIKKKEG  120

Query  545   KAKVVGTILCVGGAMLLSFYHGHNIGIGESSI---HWKYADHLSSQNKDNNGSTNAQPNF  715
              AKV+GT++ +GGAM+L+FY G  I I  + +   H +   HL   +  ++       N 
Sbjct  121   VAKVLGTLMGIGGAMILTFYKGFEINIWTTHVDLLHGRNVSHLPPHSHSHS------HNL  174

Query  716   ILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDW  895
             +LG  L + S LS++ W I+Q ++ + YP  YSSTALMC M +IQ V  +IC +     W
Sbjct  175   LLGSVLALASCLSYSFWLILQAKMMKIYPCQYSSTALMCVMGAIQGVAISICTERDWKQW  234

Query  896   SLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDK  1075
              L   IR  +  +AGIVGT     + +WC+  KGPLYVSVF+PL+L+IVA+     L +K
Sbjct  235   KLGWNIRLLTVTFAGIVGTGATVTITAWCVRMKGPLYVSVFSPLMLLIVAIAGSLFLDEK  294

Query  1076  IYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKE  1219
             +++G++VG++LIV GLY VLWGK KE+     + +   E+  ++  K+
Sbjct  295   LHLGSVVGAMLIVCGLYMVLWGKSKEMN--KCLQLTPSESIGQLALKD  340



>ref|XP_004139017.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
 gb|KGN61512.1| hypothetical protein Csa_2G151030 [Cucumis sativus]
Length=392

 Score =   274 bits (701),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 150/356 (42%), Positives = 227/356 (64%), Gaps = 10/356 (3%)
 Frame = +2

Query  170   LALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQM  349
             L  I+M++VQ G+A +NI  KLA   GM+  + +AYR LFAS  I PIA+F ER  RP++
Sbjct  10    LPTIVMMLVQFGFAGVNIFYKLAAADGMSFRIIIAYRFLFASAFILPIAFFLERGRRPKL  69

Query  350   TLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMI  529
             T S++F  FLC +FG SL+Q  Y   L  ++ T A A+ NL PA+T++LAV F +E++ I
Sbjct  70    TWSVIFYAFLCGLFGGSLSQNLYVESLALTSATYASAIGNLAPAITFILAVSFRLERMNI  129

Query  530   RTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQP  709
              T  GKAKV+GT++ + GAM+L+FY G  +    + +   +  H S+++      T    
Sbjct  130   GTMRGKAKVMGTLIGIVGAMILTFYKGVELHPWSTRVDLLHKGHNSTEHVAPTEHT--IH  187

Query  710   NFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPT  889
             + +LG  + + S  S+A+W I+Q ++SE YP  YSSTALMC M S+Q V FA+C + + +
Sbjct  188   SHVLGSVMGVGSCFSYALWLIVQAKMSECYPCHYSSTALMCMMGSVQAVGFALCVETQWS  247

Query  890   DWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQ  1069
              W L   IR  S  Y GIV + +   L++WC+  +GP++VSVF+PL+LV+VA+ +   LQ
Sbjct  248   RWKLGWNIRLLSVAYTGIVASGVMVTLITWCVRIRGPMFVSVFSPLILVLVAIAASLFLQ  307

Query  1070  DKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEEL  1237
             +K+Y+G +VG +L+V GLY VLWGK KE++ I             +E+ E+ L++L
Sbjct  308   EKLYLGCVVGGMLMVCGLYMVLWGKSKEIRKI--------TQLAPMESIEEQLQQL  355



>gb|EMS59079.1| Auxin-induced protein 5NG4 [Triticum urartu]
Length=381

 Score =   273 bits (699),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 149/327 (46%), Positives = 221/327 (68%), Gaps = 5/327 (2%)
 Frame = +2

Query  185   MIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLSIL  364
             M++VQ  +A +NI  KLA+  GM+  V VAYR LFAS  ++PIAYF ER+ R ++T  +L
Sbjct  13    MVVVQFVFAGVNIFYKLAVSDGMDMRVLVAYRFLFASAVLSPIAYFVERKKRTKVTWRVL  72

Query  365   FNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTAAG  544
                F+C + G SL Q  Y  G+K ++ T A A+TNLIPA+T++LAV F  E+L IRT AG
Sbjct  73    LLSFVCGLCGGSLAQNLYISGMKLTSATFASAMTNLIPAITFVLAVLFRYERLAIRTLAG  132

Query  545   KAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNK-DNNGSTNAQP---N  712
             +AKV GT+L VGGAMLL+FY G  +     + H   A  L+++++ ++   ++  P   N
Sbjct  133   QAKVTGTMLGVGGAMLLTFYKGAQVTPWPPT-HINLAAQLAARHQHEDQPPSSLHPDSGN  191

Query  713   FILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTD  892
               +G  L   S   +A+W I+Q R+S +YP  YS+TALMC MS++Q   FA+CFD     
Sbjct  192   RAMGCLLCTGSCFFYALWLILQARLSREYPFHYSTTALMCAMSALQSAAFALCFDRDLIQ  251

Query  893   WSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQD  1072
             W L  G+R  + +Y G+V + +   ++SWC++++GPL+ SVFNP++LV+VAVLS  LL +
Sbjct  252   WRLSSGVRLLAVLYTGVVASGVMLVVLSWCVKRRGPLFASVFNPMMLVVVAVLSSLLLGE  311

Query  1073  KIYVGTIVGSVLIVVGLYGVLWGKQKE  1153
             ++++G+++G+VLIV GLY VLWGK +E
Sbjct  312   ELHLGSVLGAVLIVTGLYSVLWGKGRE  338



>ref|XP_009405190.1| PREDICTED: WAT1-related protein At1g68170-like [Musa acuminata 
subsp. malaccensis]
Length=396

 Score =   274 bits (700),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 154/348 (44%), Positives = 228/348 (66%), Gaps = 20/348 (6%)
 Frame = +2

Query  185   MIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLSIL  364
             M+++Q  +A +NI+ KLA++ GM+  V VAYR +FA+  I+P+A+F ER+ RP++T  IL
Sbjct  19    MVLIQTSFAGVNILYKLALNDGMDVKVLVAYRYIFAAAFISPVAFFIERKRRPKITWKIL  78

Query  365   FNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTAAG  544
                FLC +FG +  Q  Y   +K ++ T   A+ NL+PAVT++LAV F +E+L IRT  G
Sbjct  79    GLTFLCGLFGATFAQNLYVSSMKLTSATFTSAMANLVPAVTFILAVSFRLERLGIRTNYG  138

Query  545   KAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQP-----  709
             +AKV+GT+L +GGAMLL+FY G  I +  ++I+        S+ +D+ G   A P     
Sbjct  139   RAKVLGTLLGLGGAMLLTFYKGAGIELWSTNINL-------SEQQDHGGHHLAAPHSESG  191

Query  710   NFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPT  889
             N ++G FL + S L +A+W IIQ +++E YP  YS+ ALMC M SIQ  + A+C +    
Sbjct  192   NRVMGSFLAVASCLCYALWLIIQAKLAEAYPCHYSNAALMCLMGSIQASILALCVERHRI  251

Query  890   DWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQ  1069
              W L   IR  +A Y+GI  + +++ L+ WCI+KKGP+Y SVFNPL+L++VA+LS  LL 
Sbjct  252   QWRLGFDIRLLTAAYSGIFASGMSFTLLGWCIKKKGPVYASVFNPLMLLLVAILSSLLLN  311

Query  1070  DKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEE---EARNE  1204
             +K+Y+G ++G+ LIV+GLY VLWGK +E        +DEE   EA  E
Sbjct  312   EKLYLGCLLGAALIVIGLYIVLWGKGRE-----ASKIDEESPAEATRE  354



>gb|ABR16695.1| unknown [Picea sitchensis]
Length=406

 Score =   274 bits (701),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 142/384 (37%), Positives = 237/384 (62%), Gaps = 21/384 (5%)
 Frame = +2

Query  179   IMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLS  358
             I MI +Q GYA MNI++K++++ GMN +V V YR   A++A+AP A+F ER++RP++T  
Sbjct  20    IAMISLQFGYAGMNIMTKVSLNRGMNHYVLVVYRHAIATIAMAPFAFFFERKVRPKLTFL  79

Query  359   ILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTA  538
                 IF   + G  ++Q  Y+ GLK +TPT +CAL+N +PA+T+++A+ F +E+L ++  
Sbjct  80    TFCLIFALGLLGPVIDQNVYYAGLKLTTPTFSCALSNTLPAMTFVMAIVFRMERLSMKQV  139

Query  539   AGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKD-NNGSTNAQPNF  715
               +AK+VGT+L VGGAML++ Y G        ++H  ++ H    +K   + S     ++
Sbjct  140   RSQAKIVGTLLSVGGAMLMTLYKG-------PAVHMFWSPHHHHHDKYVKSASAVPDKDW  192

Query  716   ILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDW  895
             I G  L+I S L+WA + ++Q  V++KY A  S T L+CF+ ++Q     +  +HKP+ W
Sbjct  193   IKGSLLVIASCLAWAGFFVLQAFVAKKYSAQLSLTTLICFLGTLQSAALTLVIEHKPSVW  252

Query  896   SLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDK  1075
             ++   +   +AVY+G++ + +AY + S C+E KGP++ + F+PL+++IVAV+   +L + 
Sbjct  253   AIGWDMNLLTAVYSGVIASGIAYYVQSLCMELKGPVFATAFSPLMMIIVAVMGSIILAET  312

Query  1076  IYVGTIVGSVLIVVGLYGVLWGKQKE---------LQVIGVVHV----DEEEARNEVETK  1216
             IY+G+++G++LIVVGLY VLWGK K+         LQV+    V    D E A N++   
Sbjct  313   IYLGSVLGAILIVVGLYAVLWGKVKDHKIPSGKNSLQVLPTEDVKANYDTEAAYNKITEA  372

Query  1217  EDHLEELELSAHSIITVDQFPKKN  1288
                 +E E +    I   +F  +N
Sbjct  373   VKRGDENEQTESKNIGSQEFHGQN  396



>ref|XP_010941182.1| PREDICTED: WAT1-related protein At3g30340-like [Elaeis guineensis]
Length=350

 Score =   272 bits (695),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 129/355 (36%), Positives = 220/355 (62%), Gaps = 16/355 (5%)
 Frame = +2

Query  176   LIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTL  355
             + +M+ V++ YA MN + K A D GMN  + +  RQL A++ +AP+AYF ER+ RP++T 
Sbjct  10    IFVMLAVEVAYAAMNTVIKTATDEGMNGLIFITLRQLIATLFMAPVAYFRERKTRPKLTT  69

Query  356   SILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRT  535
              I+  +F  ++FG SL Q  +F GL+N+T T ACA  N++P +T+L+A+PF +E L ++T
Sbjct  70    EIIVYLFFSAMFGTSLTQYLFFFGLRNTTATFACAFLNMVPVLTFLIALPFRLETLNVKT  129

Query  536   AAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNF  715
              AG AK++GTI+C+ GA LL+FY G  +    ++ H      +S Q    N S + +  +
Sbjct  130   RAGIAKLLGTIICLVGATLLTFYKGVAL---TNTTH---QSSVSKQQGRYNASYSTK-QW  182

Query  716   ILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDW  895
             ++G    +   LSW+ W ++Q++V +KYPA YS + L+ F+  +Q  + ++      + W
Sbjct  183   MMGSMAYLAGCLSWSSWFLLQSKVGKKYPALYSGSFLIFFLGFLQGAVLSLATQKSFSVW  242

Query  896   SLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDK  1075
              L++ +   + + +GI G+   +  MSWC+EK+GP++ + F PLL ++VA + + +L + 
Sbjct  243   VLKKKVEIITVIVSGIAGSGFCFLAMSWCVEKRGPVFTAAFTPLLQILVAGIDFSILHEP  302

Query  1076  IYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELE  1240
             +Y+G+++GSVL++ GLY +LWGK+KE Q           A    E  E+H  +L+
Sbjct  303   LYLGSVLGSVLVIPGLYFLLWGKRKEAQ---------SSAAKTTEENEEHQVQLQ  348



>gb|EEC77269.1| hypothetical protein OsI_15893 [Oryza sativa Indica Group]
Length=345

 Score =   271 bits (694),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 138/352 (39%), Positives = 224/352 (64%), Gaps = 7/352 (2%)
 Frame = +2

Query  185   MIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLSIL  364
             M+ +QL ++ + +  KLA++ GM+  V VAYR +FA+  + PIA+  ER+ RP +T+ ++
Sbjct  1     MVSLQLLFSALQVFIKLALNDGMDARVLVAYRFMFAASFLWPIAFLRERKKRPPLTMKVV  60

Query  365   FNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTAAG  544
               +FLC +FG S+NQ  Y + +K ++ T   A++NL PA T+LLA+   +E L ++  AG
Sbjct  61    LQLFLCGLFGFSINQNLYVLAIKLTSATYITAISNLTPATTFLLAILTRLETLKLKKPAG  120

Query  545   KAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFILG  724
             +AK++GT++ +GGAMLL+FY G  I + +   H K+A HL+   + +  ST  Q   I+G
Sbjct  121   QAKLLGTLVGMGGAMLLTFYKGPKIMVLDQLPHPKFA-HLTENPQSHPISTGNQ---IIG  176

Query  725   PFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWSLR  904
              FL I+S  ++A W +IQ +VS+ YP  YS  A++C   ++Q  + A+C       W L 
Sbjct  177   SFLGIISCFTYATWLVIQAKVSKVYPCHYSIAAMVCLFGALQSTVMALCVHRDMEHWRLG  236

Query  905   QGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKIYV  1084
               IR  S+ YAG++ +  A+ L+SWC+ KKGPL++SVF+PL+L+ VA++S  +L + +++
Sbjct  237   LNIRLYSSAYAGLIASGSAFPLLSWCLRKKGPLFISVFSPLMLIFVALMSSIILNEALHL  296

Query  1085  GTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELE  1240
             G+++GSVLIV GLY VLWGK KE      +  DE + +  +        E++
Sbjct  297   GSVLGSVLIVGGLYMVLWGKAKE---AADLSEDENQGKESIPVTTGGENEMK  345



>ref|XP_009780606.1| PREDICTED: WAT1-related protein At3g30340-like [Nicotiana sylvestris]
Length=359

 Score =   271 bits (694),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/357 (35%), Positives = 221/357 (62%), Gaps = 8/357 (2%)
 Frame = +2

Query  161   VDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIR  340
             V+   + +M+ +   +A+ NI+ K  +  GMN  V + YRQ  +++ +APIA+F ER  R
Sbjct  5     VEWYPIFVMLSIDFAFAISNILLKKIIMDGMNHLVFITYRQSVSTIFLAPIAFFLERNTR  64

Query  341   PQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEK  520
             P++T  IL  +FL +I G SL Q  + +G++ ++ T ACA  N++P +T+L+A+PFG+E 
Sbjct  65    PKLTSRILCYLFLSAIVGASLTQYLFLLGIQYTSATFACAFVNMVPVITFLMALPFGLET  124

Query  521   LMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTN  700
             +  +  +G+AKV+GT++C+GGA+LL+FY G  +      IH+      S   +++N S+ 
Sbjct  125   INTKDRSGRAKVIGTLICLGGALLLTFYKGIPL------IHFSDQQTASQSMEEHNSSSK  178

Query  701   AQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDH  880
              +  +I G  ++    L W+ W ++Q+ + +KYP  YSST +M F S+IQ  +     + 
Sbjct  179   RKERWIFGSLILFAGTLLWSSWFLLQSNIGKKYPCQYSSTVIMTFFSAIQSAILTFSINR  238

Query  881   KPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWG  1060
             + + W  ++ I   S +Y G++G+ L Y  MSWC++K+GP++ + F+PL+ V+ A+L   
Sbjct  239   RLSIWIPKEMIDMLSVIYTGLIGSGLCYVGMSWCVKKRGPVFTAAFSPLVQVMAAMLDVP  298

Query  1061  LLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVI--GVVHVDEEEARNEVETKEDH  1225
              L +++ +G+++GSV+++VGLY +LWGK KE+Q +        ++E R +V    D 
Sbjct  299   FLHEQLNLGSVMGSVIVIVGLYFLLWGKTKEIQKVPQETAEKKDKELRFQVHESNDE  355



>gb|KDP46086.1| hypothetical protein JCGZ_06597 [Jatropha curcas]
Length=395

 Score =   273 bits (697),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 148/335 (44%), Positives = 212/335 (63%), Gaps = 7/335 (2%)
 Frame = +2

Query  164   DLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRP  343
             +L  +++M++ QL ++ +N+  KLA   GMN  V +AYR +FAS  + P+A   ER+IRP
Sbjct  11    ELKPILLMVVAQLSFSGVNVFYKLASYDGMNLRVLIAYRFIFASAFLIPLALIFERKIRP  70

Query  344   QMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKL  523
             ++T +ILF  FLC   G SL Q  Y  GL  ++ T A A+TNL PAVT++LA+ FG+EK+
Sbjct  71    KLTKTILFQAFLCGFIGGSLTQTLYVEGLVLTSATFASAMTNLTPAVTFVLAILFGLEKM  130

Query  524   MIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNA  703
              +RT AGKAKV+GT+L +GGAMLL F+ G  I I      W    +L    K + G   A
Sbjct  131   GLRTLAGKAKVMGTLLGIGGAMLLIFFKGAEIDI------WSTHVNLMKLVKPHGGHVAA  184

Query  704   QPNF-ILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDH  880
               +  +LG  L I + +S+++W IIQ ++S  +P PYSS ALM  +++I  V+F +C D 
Sbjct  185   SDSTRVLGSLLSICNCISFSVWLIIQAKMSANFPCPYSSAALMASVAAILQVVFTLCIDR  244

Query  881   KPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWG  1060
               + W L   IR  +A YAGIV   +   L++WC+  KGPLY S+FNPL LV  A+    
Sbjct  245   DLSQWKLGWNIRLFTAAYAGIVVQGVTITLITWCVSIKGPLYASIFNPLQLVFSALEGSL  304

Query  1061  LLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVI  1165
             L+ + ++VG+I+G+ LIV GLY VLWGK  E + I
Sbjct  305   LIDEPLHVGSILGATLIVCGLYTVLWGKDTEAKKI  339



>ref|XP_002517269.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
 gb|EEF45062.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
Length=372

 Score =   271 bits (694),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 136/369 (37%), Positives = 239/369 (65%), Gaps = 16/369 (4%)
 Frame = +2

Query  179   IMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLS  358
             I MI +Q GYA MNII+K++++ GM+ +V V YR  FA++AIAP A   ER++RP++T  
Sbjct  18    IAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATLAIAPFALVLERKVRPKITFP  77

Query  359   ILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTA  538
             +   IF+  + G  ++Q  Y+ GLK ++PT +CA++N++PA+T+++AV   +EK+ I+  
Sbjct  78    MFMQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTFVMAVLCRMEKVDIKKV  137

Query  539   AGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGST-NAQPNF  715
               +AKV+GTI+ V GAML++ Y GH        I++ +++H+ SQ      +T ++  ++
Sbjct  138   RCQAKVIGTIVTVAGAMLMTLYKGH-------VINFIWSEHVHSQTSAPAATTGSSDKDW  190

Query  716   ILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDW  895
             + G  L+I++ L+WA + I+Q     +Y A  S T+L+CFM ++Q +      +HKP+ W
Sbjct  191   LKGSILLIIATLAWASFFILQAVTLRRYAAQLSLTSLVCFMGTLQSIAVTFVMEHKPSAW  250

Query  896   SLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDK  1075
             ++   +   +A YAGIV + +AY +    ++K+GP++V+ F+PL+++IVA++   +L +K
Sbjct  251   TIGWDMNLLAAAYAGIVSSGIAYYVQGLVMQKRGPVFVTAFSPLMMIIVAIMGSFILTEK  310

Query  1076  IYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELELSAHS  1255
             I++G ++G+VLIV GLY VLWGK +E       +++++    +   KE+   ++E+SA S
Sbjct  311   IFLGGVLGAVLIVAGLYAVLWGKYRE-------YIEKDCETTQGVIKENETNDIEMSAGS  363

Query  1256  IITVDQFPK  1282
               T  Q P+
Sbjct  364   FPT-SQPPR  371



>ref|XP_006645793.1| PREDICTED: WAT1-related protein At1g09380-like [Oryza brachyantha]
Length=487

 Score =   275 bits (703),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 157/384 (41%), Positives = 235/384 (61%), Gaps = 14/384 (4%)
 Frame = +2

Query  149   DIMGVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSE  328
             D M    L ++ M++VQL  A +N++SKL M SGM+P+V +AYR   A+  +APIA+  E
Sbjct  4     DSMITACLPVLAMVLVQLALAGLNVMSKLTMASGMSPYVLLAYRNFNAAAFLAPIAFLFE  63

Query  329   RRIRPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPF  508
             R+    ++  ILF IF+CS  G +LNQ+ YFVGLK S+PT+A AL N +PAVT+LLA   
Sbjct  64    RKTWTAISKKILFQIFVCSRIGATLNQVLYFVGLKYSSPTVASALNNTLPAVTFLLAAAL  123

Query  509   GIEKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNI-GIGESSIHWKYADHLSSQNKDN  685
              +E L  R  AG+AKV GT +CV G+ML++FY G  +  +  S + W Y     +     
Sbjct  124   NMEPLEGR--AGRAKVAGTAVCVAGSMLMTFYRGPLVRTLPASPVRWPYVQGTMAAAHAG  181

Query  686   NGSTNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFA  865
               +       +LG  L+I S ++WAIW IIQ  +S+ + +PY+ST LM  ++S+QC   A
Sbjct  182   GHAV------VLGAVLVIASNVAWAIWFIIQKTLSKSFASPYTSTVLMALIASVQCAAIA  235

Query  866   ICFDHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVA  1045
                + +   W L   IR   A+YAGIV + +   +MSWCI+++GP++VS+F+PL+LV+VA
Sbjct  236   GAAERRLAAWELGLDIRLVGALYAGIVASGIVCTVMSWCIQERGPVFVSMFSPLVLVVVA  295

Query  1046  VLSWGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQ----VIGVVHVDEEEARNEVET  1213
             V+ W +L +K +VG+++G+ LIVVGLY VLWGK +++        +    +EE    + T
Sbjct  296   VVGWAILGEKTHVGSVIGAALIVVGLYTVLWGKGRDMDAAAAAAAIASAGDEEMAGAIGT  355

Query  1214  KEDHLEELELSAHSIITVDQFPKK  1285
              ED  E   +S     +  + P K
Sbjct  356   -EDFEEAAGVSPLPRPSTSRDPIK  378



>ref|XP_003593114.1| Auxin-induced protein 5NG4 [Medicago truncatula]
 gb|AES63365.1| auxin-induced 5NG4-like protein [Medicago truncatula]
Length=394

 Score =   272 bits (695),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 148/377 (39%), Positives = 225/377 (60%), Gaps = 16/377 (4%)
 Frame = +2

Query  176   LIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTL  355
             +I+M++VQ+ YA +N++ KLA++ GM   V  AYR  F S    P+A  SER  RP++T 
Sbjct  14    VILMVLVQIAYAAVNVLYKLAINDGMTVKVATAYRLAFGSAFTVPLALISERNKRPKLTW  73

Query  356   SILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRT  535
              +LF  FLC +FG SL Q  ++  L  ++ T A A+ NLIPA+T+++A+  G E+L +R 
Sbjct  74    RVLFMAFLCGLFGGSLFQNLFYEALALTSATFASAIYNLIPAITFIMAISCGFERLNLRA  133

Query  536   AAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNF  715
             AAGKAKV+GT++ +GGAM+L F  G  I I    I+  +  H       N+   +   +F
Sbjct  134   AAGKAKVLGTLIGIGGAMMLIFLKGLEINIWPFHINLMHPHH----QHQNSHVASVHADF  189

Query  716   ---ILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKP  886
                 LG    + S  S+A+W IIQ ++S++YP+ YSSTALM  M +IQ   F +C +   
Sbjct  190   GSKWLGVLCAVASCFSFALWLIIQAKMSKEYPSHYSSTALMSTMGAIQATAFGLCVERDW  249

Query  887   TDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLL  1066
             + W L   IR  +  Y+G+V + L   + SWCI+ +GPL+ SVFNPL+L+ V +++  +L
Sbjct  250   SQWKLGWNIRLLAVAYSGVVASGLVVIVTSWCIKMRGPLFASVFNPLMLLFVTIVASLML  309

Query  1067  QDKIYVGTIVGSVLIVVGLYGVLWGKQKEL----QVIGVVHVDEEEARNEVETKEDHLEE  1234
              +K+Y+G+ +G+VLIV GLY VLWGK KE+    Q++   +  E EA   V      +++
Sbjct  310   DEKLYLGSAIGAVLIVCGLYMVLWGKSKEMKRIAQLVPSKNTQEAEAIQVVVMSTPMVDD  369

Query  1235  LELSAHSIITVDQFPKK  1285
                  H  + VD   K 
Sbjct  370   -----HDKLHVDNLSKN  381



>ref|XP_010934894.1| PREDICTED: WAT1-related protein At3g30340-like [Elaeis guineensis]
Length=350

 Score =   270 bits (691),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 131/342 (38%), Positives = 216/342 (63%), Gaps = 8/342 (2%)
 Frame = +2

Query  185   MIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLSIL  364
             M+ V +  A MN + K  +D GMN  V +  RQL A++ +APIAYF ER+ RP++T+ I 
Sbjct  13    MLAVNVALAAMNTMIKSVIDEGMNRLVLITLRQLVATLFMAPIAYFGERKTRPKLTVEIF  72

Query  365   FNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTAAG  544
               +F  ++FG SL Q  +F+GLK +T T ACA  N+ P +T+LLA+PF +E L ++T AG
Sbjct  73    VYLFFSAMFGASLTQYLFFLGLKYTTATFACAFLNMAPVLTFLLALPFRLETLNLKTKAG  132

Query  545   KAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFILG  724
              AK++G I+C+ GAM+L+FY G  +    ++ H   A     Q   N G +  Q  +ILG
Sbjct  133   IAKLLGAIICLTGAMVLTFYKGEAL---TNTSHQLVASE--QQQGHNAGYSTKQ--WILG  185

Query  725   PFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWSLR  904
                 +   LSW+ W +IQ++V +KYPA YS TA++ F+S +Q  + ++  +   + W+L+
Sbjct  186   STAYLAGCLSWSSWFLIQSKVGKKYPALYSGTAMIFFLSFLQAAILSLVTEKSFSVWALK  245

Query  905   QGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKIYV  1084
             + +   + + +GI G+   +  MSWC+EK+GP++ + F PL+ ++VA + + +L + +Y+
Sbjct  246   RKLEIITVIVSGIAGSGFGFLAMSWCVEKRGPVFTAAFTPLVQIMVAAIDFSILHEPLYL  305

Query  1085  GTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVE  1210
             G+++GS+L++ GLY +LWGK KE +      V EE   ++V+
Sbjct  306   GSVLGSILVIAGLYFLLWGKTKEARSSAAKTV-EENGEHQVQ  346



>ref|XP_004163894.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
Length=392

 Score =   272 bits (695),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 149/356 (42%), Positives = 226/356 (63%), Gaps = 10/356 (3%)
 Frame = +2

Query  170   LALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQM  349
             L  I+M++VQ G+A +NI  KLA   GM+  + +AYR LFAS  I PIA+F ER  RP++
Sbjct  10    LPTIVMMLVQFGFAGVNIFYKLAAADGMSFRIIIAYRFLFASAFILPIAFFLERGRRPKL  69

Query  350   TLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMI  529
             T S++F  FLC +FG SL+Q  Y   L  ++   A A+ NL PA+T++LAV F +E++ I
Sbjct  70    TWSVIFYAFLCGLFGGSLSQNLYVESLALTSAIYASAIGNLAPAITFILAVSFRLERMNI  129

Query  530   RTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQP  709
              T  GKAKV+GT++ + GAM+L+FY G  +    + +   +  H S+++      T    
Sbjct  130   GTMRGKAKVMGTLIGIVGAMILTFYKGVELHPWSTRVDLLHKGHNSTEHVAPTEHT--IH  187

Query  710   NFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPT  889
             + +LG  + + S  S+A+W I+Q ++SE YP  YSSTALMC M S+Q V FA+C + + +
Sbjct  188   SHVLGSVMGVGSCFSYALWLIVQAKMSECYPCHYSSTALMCMMGSVQAVGFALCVETQWS  247

Query  890   DWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQ  1069
              W L   IR  S  Y GIV + +   L++WC+  +GP++VSVF+PL+LV+VA+ +   LQ
Sbjct  248   RWKLGWNIRLLSVAYTGIVASGVMVTLITWCVRIRGPMFVSVFSPLILVLVAIAASLFLQ  307

Query  1070  DKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEEL  1237
             +K+Y+G +VG +L+V GLY VLWGK KE++ I             +E+ E+ L++L
Sbjct  308   EKLYLGCVVGGMLMVCGLYMVLWGKSKEIRKI--------TQLAPMESIEEQLQQL  355



>ref|XP_009785346.1| PREDICTED: WAT1-related protein At3g30340-like [Nicotiana sylvestris]
Length=359

 Score =   270 bits (691),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/367 (35%), Positives = 229/367 (62%), Gaps = 13/367 (4%)
 Frame = +2

Query  161   VDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIR  340
             V+   + +M+ +   +A+ NI+ K  +  GMN  V + YRQ  +++ +APIA+F ER  R
Sbjct  5     VEWYPIFIMLAIDFAFAISNILLKKIILDGMNHLVFITYRQSISTIFLAPIAFFLERNTR  64

Query  341   PQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEK  520
             P++T  IL N+FL +I G SL Q  + +G++ ++ T +CA  N++P +T+L+A+PFG+E 
Sbjct  65    PKLTPQILCNLFLSAIVGASLTQYLFLLGIEYTSATFSCAFVNMVPVITFLMALPFGLET  124

Query  521   LMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTN  700
             + I+  +G AK++GT++CVGGA +L+FY G  +      IH+    ++S  +     S+ 
Sbjct  125   INIKHGSGIAKLIGTLICVGGAFILTFYKGIPL------IHFSDLQYVSPSSDAAISSSK  178

Query  701   AQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDH  880
              +  +ILG   +      W+ W ++Q+ +  +YP  YSST +M F S+IQ  +  +  D 
Sbjct  179   IKERWILGSLALFAGTFLWSSWFLLQSFIGNRYPCKYSSTVIMTFFSAIQSAILTLSIDR  238

Query  881   KPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWG  1060
             + + W  R+ I   + +YAG++G+ + Y  MSWC++K+GP++ + F+PL+ ++ A+    
Sbjct  239   RLSMWIPREKIDMLTIIYAGLIGSGMCYVGMSWCVKKRGPVFTAAFSPLVQIMAAMFDVP  298

Query  1061  LLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELE  1240
             +L +++++G+++GS +++ GLY +LWGK +E+Q   VVH  E E +N+   KE   ++LE
Sbjct  299   ILHEQLHLGSVIGSAIVIAGLYFLLWGKNREMQ--KVVH--ETEEKND---KELTFKDLE  351

Query  1241  LSAHSII  1261
              ++ S I
Sbjct  352   TNSESRI  358



>gb|KDP46080.1| hypothetical protein JCGZ_06591 [Jatropha curcas]
Length=392

 Score =   271 bits (694),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 151/358 (42%), Positives = 219/358 (61%), Gaps = 11/358 (3%)
 Frame = +2

Query  176   LIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTL  355
             +++M++ QL ++ +N+  KLA   GMN  V +AYR +FAS  + P+A   ER+IRP++T 
Sbjct  15    ILLMVVAQLSFSGVNVFYKLASYDGMNLRVLIAYRFIFASAFLIPLALIFERKIRPKLTK  74

Query  356   SILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRT  535
             +ILF  FLC   G SL Q  Y  GL  ++ T A A+TNL PAVT++LA+ FG+EK+ +RT
Sbjct  75    TILFQAFLCGFIGGSLTQTLYVEGLVLTSATFASAMTNLTPAVTFVLAILFGLEKMGLRT  134

Query  536   AAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNF  715
              AGKAKV+GT+L +GGAMLL F+ G  I I      W    +L    K + G   A  + 
Sbjct  135   LAGKAKVMGTLLGIGGAMLLIFFKGAEIDI------WSTHVNLMKLVKPHGGHVAASDST  188

Query  716   -ILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTD  892
              +LG  L I + +S+++W IIQ ++S  +P PYSS ALM  +++I  V+F +C D   + 
Sbjct  189   RVLGSLLSICNCISFSVWLIIQAKMSANFPCPYSSAALMASVAAILQVVFTLCIDRDLSQ  248

Query  893   WSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQD  1072
             W L   IR  +A YAGIV   +   L++WC+  KGPLY S+FNPL LV  A+    L+ +
Sbjct  249   WKLGWNIRLFTAAYAGIVVQGVTITLITWCVSIKGPLYASIFNPLQLVFSALEGSLLIDE  308

Query  1073  KIYVGTIVGSVLIVVGLYGVLWGKQKEL----QVIGVVHVDEEEARNEVETKEDHLEE  1234
              ++VG+I+G+ LIV GLY VLWGK  E     Q+I +   +E E  +   +   + E 
Sbjct  309   PLHVGSILGATLIVCGLYTVLWGKDTEAKKISQLIPLKISEEIEIMSTTNSNSQNCEN  366



>ref|NP_001149226.1| mtN21 nodulin protein-like [Zea mays]
 gb|ACG34629.1| mtN21 nodulin protein-like [Zea mays]
Length=373

 Score =   271 bits (692),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 143/352 (41%), Positives = 227/352 (64%), Gaps = 7/352 (2%)
 Frame = +2

Query  197   QLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLSILFNIF  376
             Q+ +A +NI  KLA+  GM+  V +AYR LF S  + P+AYF ER+ R ++T  ++F  F
Sbjct  17    QIIFAFVNIFYKLAVSDGMDLRVLIAYRYLFGSAFLGPLAYFVERKNRTKLTWRVVFLSF  76

Query  377   LCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTAAGKAKV  556
              C + G ++ Q  Y  G+K ++ T A A TNL+PA T+++A+ F  EK  IR+ + +AKV
Sbjct  77    ACGLSGGTMAQNLYIAGMKFTSATFASATTNLLPACTFVIALVFRYEKFAIRSLSSQAKV  136

Query  557   VGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFILGPFLI  736
              GT+L VGGAMLL+FY G +I    S++     + +++  + ++ +T    N+ +G  L 
Sbjct  137   AGTLLGVGGAMLLTFYKGVDITPWHSNL-----NLVATLTQHHHHTTTTTTNYAMGSLLC  191

Query  737   IVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWSLRQGIR  916
             + S   +A+W ++Q ++S +YP  YSSTALMC M+++Q  +FA+CFD   + W L+  IR
Sbjct  192   VCSCFFYALWIVVQAKLSNEYPFHYSSTALMCIMTTLQSSIFALCFDRDASQWRLKFDIR  251

Query  917   ATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKIYVGTIV  1096
               S  Y+GI  + +A  +M+WC++++GPL+VSVF+PL+L+IVAVLS  LL +K+++GT +
Sbjct  252   LLSCAYSGIFASGVALVIMAWCVQQRGPLFVSVFSPLMLLIVAVLSSLLLGEKLHLGTAL  311

Query  1097  GSVLIVVGLYGVLWGK--QKELQVIGVVHVDEEEARNEVETKEDHLEELELS  1246
             G+VLIV+GLY VLWGK  +   +   V   D     N   ++ED  ++  +S
Sbjct  312   GAVLIVMGLYAVLWGKGREAAAEAARVSVNDHPTTSNSNSSEEDDDKKRHVS  363



>ref|XP_004486242.1| PREDICTED: WAT1-related protein At1g68170-like [Cicer arietinum]
Length=391

 Score =   271 bits (693),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 144/353 (41%), Positives = 223/353 (63%), Gaps = 12/353 (3%)
 Frame = +2

Query  179   IMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLS  358
             +MM++VQ+ +A ++++ K A+++GM+  V  AYR +FA+    P+A   ER+ RP++T  
Sbjct  15    LMMVLVQITFASVHVLYKFAINNGMSVRVLTAYRLIFAAACTIPLALIFERKNRPKLTWR  74

Query  359   ILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTA  538
             ++F  F C +FG SL Q  YF  L   + T A A+ NLIPAVT++ AV  G E+L ++TA
Sbjct  75    VVFMSFFCGLFGGSLFQNLYFESLALVSATFASAVYNLIPAVTFIFAVCCGYERLNLQTA  134

Query  539   AGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQP-NF  715
              GKAKV+GTI  +GGAM+L+F  G  I I      W +  H+   +KD  G+ N      
Sbjct  135   PGKAKVLGTITGIGGAMMLTFLKGVEINI------WNF--HIKLLHKDQKGTLNHDSVTK  186

Query  716   ILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDW  895
             +LG F  + S   +A+W IIQT++S++Y   YSS A+MC M +IQ  +FA+  +   + W
Sbjct  187   LLGIFCGLGSCFCFALWLIIQTKMSKEYEGNYSSIAMMCLMGAIQATVFALFVEKDWSQW  246

Query  896   SLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDK  1075
              L   IR  +A Y GIVG+ + Y +++WC+   GPLY SVFNPL+LV+V ++   +L ++
Sbjct  247   RLGWNIRLLTAAYTGIVGSGIMYIVIAWCVGMIGPLYASVFNPLMLVLVVIVGSLILDEE  306

Query  1076  IYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEV---ETKEDH  1225
             +Y+G+++G++LI++GLY VLWGK KE++ +    +  E  + EV    T  DH
Sbjct  307   LYLGSVIGTILIMIGLYTVLWGKSKEMEKVIHFEITSEIEKVEVVITSTTIDH  359



>ref|XP_008378803.1| PREDICTED: WAT1-related protein At1g25270-like [Malus domestica]
Length=393

 Score =   271 bits (693),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 146/353 (41%), Positives = 224/353 (63%), Gaps = 17/353 (5%)
 Frame = +2

Query  176   LIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTL  355
             +++M++VQ  +A +N++ KLA + GMN  + VAYR +FA+  I PIA F ER+ RP++T 
Sbjct  16    VLLMVVVQFAFAGVNVLYKLAANDGMNLRILVAYRFIFATAFILPIALFIERKSRPKLTW  75

Query  356   SILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRT  535
              +L   FL  +FG SL+Q  Y   L  ++ T A A+  L PA+T++LA+ F +E L +R+
Sbjct  76    MVLLQGFLSGLFGGSLSQNLYIESLALTSATFASAIVQLTPAITFILAITFRLENLSLRS  135

Query  536   AAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNF  715
              AGKAK++GT++ +GGAMLL+FY G    I  + +   ++ HL+S    ++G      N 
Sbjct  136   PAGKAKMLGTLMGIGGAMLLTFYKGVEFNIWSTHVDLLHS-HLASSPHTDSG------NR  188

Query  716   ILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDW  895
             +LG  L + S   +A W IIQT++S  Y   YSSTALM  M SIQ V FA+C + + + W
Sbjct  189   LLGCLLALGSCFCYATWLIIQTKMSATYTCYYSSTALMSAMGSIQAVGFALCKEREWSQW  248

Query  896   SLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDK  1075
              L   IR  +A Y+G + T L+   ++ CI  +GPL+VSVFNPL+LV+VA++   +L +K
Sbjct  249   KLGWNIRLLTAAYSGTMATGLSVTFIALCIRMRGPLFVSVFNPLMLVLVAIVGSLVLDEK  308

Query  1076  IYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEE  1234
             +++G+++G+VLIV+GLY VLWGK KE+          E+  N V +   H ++
Sbjct  309   LHLGSVLGAVLIVIGLYAVLWGKGKEI----------EKMSNSVPSTSFHHQD  351



>ref|XP_011045738.1| PREDICTED: WAT1-related protein At1g25270-like [Populus euphratica]
Length=366

 Score =   270 bits (690),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 142/326 (44%), Positives = 207/326 (63%), Gaps = 7/326 (2%)
 Frame = +2

Query  179   IMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLS  358
             I MI VQ+ +  +NI  KL ++ GM+  V VAYR LF +  + PIA   ER  RP++T  
Sbjct  13    IAMIFVQIVFGGINIFYKLVINDGMSIRVAVAYRLLFGAAFLCPIALIVERNKRPKLTWV  72

Query  359   ILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTA  538
             + F IF  ++FG S+    Y   L  ++ T A AL NL PA TY++A+ F +E L +  A
Sbjct  73    VFFQIFFLALFGGSIYHNLYLASLNLTSMTFAAALYNLSPAFTYIVALLFRMETLSLNNA  132

Query  539   AGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHW-KYADHLSSQNKDNNGSTNAQPNF  715
              G A V GT +C+GGAMLL+FY G  I I  ++I+  KY  +    +++  GST  Q   
Sbjct  133   RGIANVAGTAICIGGAMLLTFYQGIEINIWHTNINLLKYHQN---HHQNTVGSTKQQ---  186

Query  716   ILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDW  895
             + G  + +++ + +A W IIQ +++E+YP  YSSTALM  M SIQ +++A+CF+ K +DW
Sbjct  187   MFGLAIALIACVFYAFWVIIQAKINERYPCFYSSTALMSLMGSIQAIIYALCFERKWSDW  246

Query  896   SLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDK  1075
              L   IR  S +Y G + + L   LM+WCI K+GPLYV+ FNPL+L++VAV    + Q+K
Sbjct  247   KLESNIRLISVIYLGFLASGLNITLMAWCIAKRGPLYVATFNPLMLLVVAVAGSLVFQEK  306

Query  1076  IYVGTIVGSVLIVVGLYGVLWGKQKE  1153
             +++G+I+G VLI+ GLY VLWGK K 
Sbjct  307   LHLGSILGGVLIITGLYTVLWGKSKN  332



>tpg|DAA36748.1| TPA: mtN21 nodulin protein-like protein [Zea mays]
Length=374

 Score =   270 bits (690),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 144/352 (41%), Positives = 222/352 (63%), Gaps = 6/352 (2%)
 Frame = +2

Query  197   QLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLSILFNIF  376
             Q+ +A +NI  KLA+  GM+  V +AYR LF S  + P+AYF ER+ R ++T  ++F  F
Sbjct  17    QIIFAFVNIFYKLAVSDGMDLRVLIAYRYLFGSAFLGPLAYFVERKNRTKLTWRVVFLSF  76

Query  377   LCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTAAGKAKV  556
              C + G ++ Q  Y  G+K ++ T A A TNL+PA T+++A+ F  EK  IR+ A +AKV
Sbjct  77    ACGLSGGTMAQNLYIAGMKFTSATFASATTNLLPACTFVIALVFRYEKFAIRSLASQAKV  136

Query  557   VGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFILGPFLI  736
              GT+L VGGAMLL+FY G +I    S+++          +     +T    N+ +G  L 
Sbjct  137   AGTLLGVGGAMLLTFYKGVDITPWHSNLNLVATLTQHHHHH----TTTTTTNYAMGSLLC  192

Query  737   IVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWSLRQGIR  916
             + S   +A+W ++Q ++S +YP  YSSTALMC M+++Q  +FA+CFD   + W L+  IR
Sbjct  193   VCSCFFYALWIVVQAKLSNEYPFHYSSTALMCIMTTLQSSIFALCFDRDASQWRLKFDIR  252

Query  917   ATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKIYVGTIV  1096
               S  Y+GI  + +A  +M+WC++++GPL+VSVF+PL+L+IVAVLS  LL +K+++GT +
Sbjct  253   LLSCAYSGIFASGVALVIMAWCVQQRGPLFVSVFSPLMLLIVAVLSSLLLGEKLHLGTAM  312

Query  1097  GSVLIVVGLYGVLWGK--QKELQVIGVVHVDEEEARNEVETKEDHLEELELS  1246
             G+VLIV+GLY VLWGK  +   +   V   D     N   ++ED  ++  +S
Sbjct  313   GAVLIVMGLYAVLWGKGREAAAEAARVSVNDHPTTSNSNSSEEDDDKKRHVS  364



>ref|XP_010068192.1| PREDICTED: WAT1-related protein At1g68170-like [Eucalyptus grandis]
Length=393

 Score =   270 bits (691),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 145/381 (38%), Positives = 231/381 (61%), Gaps = 22/381 (6%)
 Frame = +2

Query  164   DLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRP  343
             ++ A +MM++VQ+ +A +NI+ KLA   GMN  V +AYR +FA+  +AP+A+F ER+ R 
Sbjct  10    EMKAALMMVVVQVAFAGVNILYKLAASDGMNLSVVIAYRFMFATAVLAPLAFFLERKSRT  69

Query  344   QMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKL  523
             ++T ++L   F C++FG S+ Q  Y   L  ++ T A A+ NL+PAVT++LAV  G+EK+
Sbjct  70    KITWTVLVQAFFCALFGGSMGQNLYLASLSMTSATYASAMANLVPAVTFVLAVSLGLEKV  129

Query  524   MIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNA  703
              +RT AGKAK  GT++ +GGAMLL+FY G  + +   S H     H++   +   GS++ 
Sbjct  130   RVRTVAGKAKAAGTLMGIGGAMLLTFYKGAEVNLW--STHVNLLRHVAGTPRGQVGSSDL  187

Query  704   QPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHK  883
                 +L     + S   +A W IIQ ++ E +P  Y+STALM FM SIQ  ++ +C +  
Sbjct  188   LLGSLLA----VASCFCYAAWLIIQAKMIEGFPYQYTSTALMTFMGSIQEAVYTLCREGD  243

Query  884   PTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGL  1063
              + W L   +R  +  Y+GIV + L Y L+ WC+  +GP++VSVFNPL+LV VA+    +
Sbjct  244   WSQWKLGWNVRLLTVSYSGIVASGLCYTLIIWCVRMRGPVFVSVFNPLMLVTVALAGSMV  303

Query  1064  LQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQV----------------IGVVHVDEEEA  1195
             L +K+++G+I+GS LI++ LY VLWGK+++ +                 I V  +DE + 
Sbjct  304   LDEKLHMGSILGSGLIILSLYAVLWGKKEDKKANRLVPLSRPSKSNSIEIVVASLDENDV  363

Query  1196  RNEVETKEDHLEELELSAHSI  1258
             R   + +E   +E E+   S+
Sbjct  364   REGDDVREPSQKESEVMKESL  384



>ref|XP_003532973.1| PREDICTED: WAT1-related protein At1g68170-like isoform X1 [Glycine 
max]
 gb|KHN26711.1| Auxin-induced protein 5NG4-like protein [Glycine soja]
Length=413

 Score =   271 bits (693),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 139/355 (39%), Positives = 223/355 (63%), Gaps = 11/355 (3%)
 Frame = +2

Query  167   LLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQ  346
             L  +++M++VQ+  A +N++ KLA++ GMN  + VAYR +FA+  IAP+A+  ER+ R +
Sbjct  10    LKPILLMVLVQVANAWVNVLYKLALNDGMNLSIIVAYRYVFATAFIAPLAFIVERKTRTK  69

Query  347   MTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLM  526
             MT +ILF  FLC + G +L Q      +  ++ T   A++NLIPA+T+++++ FG+E+L 
Sbjct  70    MTWTILFQAFLCGLIGGALPQNLNMEAIALTSVTFTTAISNLIPAITFIISLSFGLERLN  129

Query  527   IRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQ  706
             +R A GKAK++GTI  + GAMLL+F  G  + +   S H    +H +      + ++   
Sbjct  130   LRRAGGKAKIIGTITGISGAMLLTFIKGPEVKM--LSFHVNLFNHRNGHVVHPHATSGLM  187

Query  707   PNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKP  886
                I G    + S +S+A+W IIQ ++SE+YP PYSSTALM  M ++  + FA C +   
Sbjct  188   T--IFGALASVASNVSYAMWLIIQAKMSERYPCPYSSTALMSLMGAVLSISFAFCVERDL  245

Query  887   TDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLL  1066
             + W L   IR  +  YAGIV + +   ++SWC+  +GPL+VS+F+PL+LV+VA     +L
Sbjct  246   SQWRLGWNIRLLTVAYAGIVVSGVMVAVISWCVRTRGPLFVSIFSPLMLVVVAFAGSTIL  305

Query  1067  QDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLE  1231
              +K+Y+G+I+GS+LI+ GLY VLWGK KE++         +  ++E   K D +E
Sbjct  306   DEKLYLGSIIGSMLIICGLYVVLWGKSKEMK-------KNQSGQSESTHKSDTIE  353



>ref|XP_002277059.2| PREDICTED: uncharacterized protein LOC100243646 [Vitis vinifera]
Length=754

 Score =   280 bits (716),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 141/344 (41%), Positives = 217/344 (63%), Gaps = 6/344 (2%)
 Frame = +2

Query  179   IMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIR-PQMTL  355
             I+M++ QLG+  +NI  KLA++ GMN  V +AYR +FA+  I P+A+  ERR   P++T 
Sbjct  387   IVMVVAQLGFGGVNIFYKLAVNDGMNVRVLIAYRFIFATAFICPLAFILERRKSGPRLTW  446

Query  356   SILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRT  535
              I    FLC +FG +L Q  Y   L  ++PT + A+ NLIPAVT++ A+  G+E+L IRT
Sbjct  447   MIALQGFLCGLFGGALGQNLYLESLALTSPTFSAAMANLIPAVTFIFALFLGLERLKIRT  506

Query  536   AAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNF  715
              AG+AKV+GT+L +GGAM+L+FY G  I I  + +     + L  +++    S     N 
Sbjct  507   WAGRAKVIGTVLGIGGAMVLTFYKGPQINIWSTKV-----NLLKHKDQHVAASHGELDNH  561

Query  716   ILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDW  895
             +LG  L + S  S+AIW IIQ ++ E+YP  YS TALMC  +++Q +++A+C +   + W
Sbjct  562   VLGSILAVASCFSYAIWLIIQAKMGERYPFDYSCTALMCASATVQAIVYAMCKEKNWSAW  621

Query  896   SLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDK  1075
              L   IR  +  Y G   +     L+SWC+ K+GPL+VS+FNPL+LV VA+L   +L +K
Sbjct  622   KLGWNIRLLTVAYTGFFASGFMVVLVSWCVRKRGPLFVSIFNPLMLVFVAILGSLILDEK  681

Query  1076  IYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEV  1207
             +++G+I+G VLIV+GLY +LW K  E++ +  +   +     E+
Sbjct  682   LHLGSIIGGVLIVIGLYAMLWAKGAEMKSMATLSHSKSSKEAEI  725


 Score =   166 bits (421),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 91/209 (44%), Positives = 130/209 (62%), Gaps = 6/209 (3%)
 Frame = +2

Query  176  LIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTL  355
            +I+M+ VQL +  +NI+ KLA++ GMN  V VAYR +FA+  I+P+A+  ER+  P++T 
Sbjct  32   VIVMVAVQLVFGGVNILYKLAINDGMNTRVLVAYRFIFATAFISPLAFILERKSSPRLTW  91

Query  356  SILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRT  535
             I    FLC +FG +L Q  Y   L  ++PT + A+ NLIPAVT++ A+  G+EKL IRT
Sbjct  92   MIALQGFLCGLFGGALGQNLYLESLALTSPTFSAAMVNLIPAVTFIFAISLGLEKLAIRT  151

Query  536  AAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNF  715
             AGKAKV GT+L +GGAM+L+FY G  I I      W    HL ++++    S     N 
Sbjct  152  WAGKAKVGGTLLGIGGAMVLTFYKGPQINI------WSTKVHLLNKDQHVAASHRMMDNH  205

Query  716  ILGPFLIIVSALSWAIWSIIQTRVSEKYP  802
            +LG  L + S  S+AIW II +  S  +P
Sbjct  206  VLGSLLDVASCFSYAIWLIIHSIFSPMHP  234



>ref|XP_007148455.1| hypothetical protein PHAVU_006G210200g [Phaseolus vulgaris]
 gb|ESW20449.1| hypothetical protein PHAVU_006G210200g [Phaseolus vulgaris]
Length=409

 Score =   271 bits (692),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 145/366 (40%), Positives = 227/366 (62%), Gaps = 18/366 (5%)
 Frame = +2

Query  179   IMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLS  358
             ++M++VQ+ +A +N++ K A++ GM+  V  AYR +FA+ +  P+A   ER+  P +T  
Sbjct  15    LLMLMVQIAFASVNVLYKFALNDGMSVSVITAYRLMFAAASTVPLALIFERKNIPTLTWR  74

Query  359   ILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTA  538
             ++   F C +FG SL Q  YF  LK  + T   A+ NLIPAVT++LAV  G EKL  + A
Sbjct  75    VILKAFFCGLFGGSLFQNLYFESLKLISATFGSAVYNLIPAVTFILAVTCGFEKLNFQRA  134

Query  539   AGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFI  718
             +GKAKV+GTI  VGGAM+L+F  G  I I  S I+  +         D++GS       +
Sbjct  135   SGKAKVLGTITGVGGAMMLTFLKGVEINIWTSHINLLHKKGTRGTQNDDSGSK------V  188

Query  719   LGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWS  898
             LG F    S   +A+W I+Q ++S+++P  +SSTALM  M +IQ  ++A+C +   + W 
Sbjct  189   LGVFCGFGSCFCFALWLIVQAQMSKEFPGHHSSTALMSVMGAIQATIYALCVEKDWSQWR  248

Query  899   LRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKI  1078
             L   IR  +A Y+GIV + +   +++WC+  +GP+Y SVFNPLLLV+VA+    +L +K+
Sbjct  249   LGWSIRLLTAAYSGIVCSGIMVVVIAWCVRMRGPMYASVFNPLLLVLVAIAGSLMLDEKL  308

Query  1079  YVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELELSAHSI  1258
             Y+G+++G+VLIV+GLY VLWGK KE++ +           + +ET  + LEE+E+   S 
Sbjct  309   YIGSVMGAVLIVMGLYMVLWGKSKEMKRV-----------SHLETTPE-LEEIEVHDQSR  356

Query  1259  ITVDQF  1276
              + D++
Sbjct  357   CSNDKY  362



>ref|XP_007041588.1| Mtn21-like protein, putative isoform 2 [Theobroma cacao]
 gb|EOX97419.1| Mtn21-like protein, putative isoform 2 [Theobroma cacao]
Length=374

 Score =   270 bits (689),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 140/341 (41%), Positives = 213/341 (62%), Gaps = 7/341 (2%)
 Frame = +2

Query  179   IMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLS  358
             ++M++VQ  +A MN++ KLA + GM+  +  AYR +FA   + P+A   ER+ RP++T +
Sbjct  15    MVMVVVQTTFAGMNLLYKLAANDGMSLRIITAYRFVFAVPVMVPLALLVERK-RPKLTWA  73

Query  359   ILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTA  538
             ILF  FLC +FG +L+Q  Y   L  ++ T   A+TNLIP  T++LAV   +EKL   T 
Sbjct  74    ILFQAFLCGLFGGALSQNLYIASLALTSATFVSAMTNLIPVTTFILAVFLRMEKLAFGTM  133

Query  539   AGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFI  718
             AGKAKV+GT++ +GGAMLL+FY G  I +      W     L         S +A  + +
Sbjct  134   AGKAKVLGTLIGIGGAMLLTFYKGVQIKM------WSTHIDLVHHGGHGASSHSASAHIL  187

Query  719   LGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWS  898
              G  L   S +++ +W I+Q ++S+KYP PYS+TALMC M +IQ +++A+C +   + W 
Sbjct  188   WGALLAFTSCITYTLWLIVQAKMSKKYPCPYSTTALMCVMGAIQSIVYALCTERDWSQWK  247

Query  899   LRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKI  1078
             L   +R  +  YAGIV + L   ++ WC+  KGPLY S+FNPL++V+VA+     L  K+
Sbjct  248   LGWNVRLLTVAYAGIVVSGLTCVMVCWCVRIKGPLYGSIFNPLMVVLVALAETLFLGAKL  307

Query  1079  YVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARN  1201
             Y+G+I+G+VLIV+GLY VLWGK KE++ +     +    R+
Sbjct  308   YLGSILGAVLIVLGLYVVLWGKGKEMEKVAAPSKEGPSTRS  348



>ref|XP_009341318.1| PREDICTED: WAT1-related protein At1g25270-like [Pyrus x bretschneideri]
Length=391

 Score =   270 bits (690),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 155/385 (40%), Positives = 234/385 (61%), Gaps = 26/385 (7%)
 Frame = +2

Query  176   LIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTL  355
             +++M++VQ  +A +N++ KLA + GMN  + VAYR +FA+  + PIA F ER+ RP++T 
Sbjct  16    VLLMVVVQFAFAGVNVLYKLAANDGMNLRILVAYRFIFATAFLLPIAIFIERKSRPKLTW  75

Query  356   SILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRT  535
              +L   FL  +FG SL Q  Y  GL  ++ T A A+  L PA+T++LA+ F +E L +R+
Sbjct  76    MVLLQGFLSGLFGGSLTQNLYIEGLALTSATFASAIVQLTPAITFILAITFRLENLSLRS  135

Query  536   AAGKAKVVGTILCVGGAMLLSFYHG--HNIGIGESSIHWKYADHLSSQNKDNNGSTNAQP  709
              AGKAK++GT++ +GGAMLL+FY G   NI      +H     HL++    ++G      
Sbjct  136   PAGKAKMLGTLMGIGGAMLLTFYKGVEFNISTHVDLLH----SHLATSLHTDSG------  185

Query  710   NFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPT  889
             N +LG  L + S L +A W IIQT++S  Y   YSSTALM  M SIQ V FA+C + + +
Sbjct  186   NRLLGCLLALGSCLCYATWLIIQTKMSATYTCYYSSTALMSAMGSIQAVGFALCKEREWS  245

Query  890   DWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQ  1069
              W L   IR  +A Y+G + T L+   ++ CI  +GPL+VSVF+PL+LV+VA++   +L 
Sbjct  246   QWKLGWNIRLLTAAYSGTMATGLSVTFIALCIRMRGPLFVSVFSPLMLVLVAIVGSLVLD  305

Query  1070  DKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELELSA  1249
             +K+++G+++G+VLIV+GLY VLWGK KE+          E+  N V +   H ++    +
Sbjct  306   EKLHLGSVLGAVLIVIGLYAVLWGKGKEI----------EKMSNSVPSTSFHHQD----S  351

Query  1250  HSIITVDQFPKKN*NN*FSLHSKEN  1324
              SI  V   P  N  N  +  S  N
Sbjct  352   GSIDIVVMSPDNNKGNSNNTESLSN  376



>ref|XP_004485925.1| PREDICTED: WAT1-related protein At3g30340-like [Cicer arietinum]
Length=362

 Score =   269 bits (687),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/328 (38%), Positives = 213/328 (65%), Gaps = 9/328 (3%)
 Frame = +2

Query  176   LIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTL  355
              ++MI +   +A +NI+ K  +D GMN  V + YR   A++ +API YF ER  RP++TL
Sbjct  10    FMIMIAIDFSFAAVNILLKKVLDEGMNHLVFITYRLSIATIFVAPIGYFRERNSRPRLTL  69

Query  356   SILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRT  535
              IL  +FL +I G S+ Q  + +G++N++ T ACA  N++P VT+LLA+PFG+E + I+ 
Sbjct  70    RILCYLFLSAIVGASVTQYFFLLGIENTSATFACAFVNMVPVVTFLLALPFGLETVDIKC  129

Query  536   AAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNF  715
              +G+AK+VGT++C+ GA+LL+ Y G  +        + ++ H  S +     ST     +
Sbjct  130   NSGRAKIVGTLVCIVGALLLTLYKGKGL--------FNFSQHDQSSSV-KLASTRTPEKW  180

Query  716   ILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDW  895
              +G   +I+  L W+ W I+Q+++S+ YP  YSSTA+M F  +IQ  +  +  DH  + W
Sbjct  181   SIGVIALILGTLFWSFWFILQSKISKTYPCQYSSTAIMSFFGAIQSAVICLFIDHNLSIW  240

Query  896   SLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDK  1075
              LR  I+  + +YAGI+G+ L +  MSWC++K+GP++ + F+P + ++ A++   +L ++
Sbjct  241   VLRGKIQIIAILYAGIIGSGLCFVGMSWCVKKRGPVFTAAFSPFVQIMAAMIDIPVLHEQ  300

Query  1076  IYVGTIVGSVLIVVGLYGVLWGKQKELQ  1159
             +Y+G ++GS+L+++GLY +LWGK KE++
Sbjct  301   LYLGNVMGSILVMIGLYILLWGKSKEMK  328



>ref|XP_009790909.1| PREDICTED: WAT1-related protein At5g07050-like isoform X1 [Nicotiana 
sylvestris]
Length=397

 Score =   270 bits (690),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 139/358 (39%), Positives = 231/358 (65%), Gaps = 9/358 (3%)
 Frame = +2

Query  179   IMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLS  358
             I MI +Q GYA MN+I+K++++ GM+ +V V YR  FA+ AIAP A   ER++RP+MT  
Sbjct  19    IAMISLQFGYAGMNVITKVSLNGGMSHYVLVVYRHAFATAAIAPFALVLERKLRPKMTFM  78

Query  359   ILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTA  538
             +   IF+  + G  ++Q  Y++GLK ++PT +CA++N++PA+T+++AV   +EK+ I+  
Sbjct  79    MFLQIFVLGLLGPVIDQNFYYMGLKFTSPTFSCAMSNMLPAMTFVMAVLCRMEKVHIKKL  138

Query  539   AGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQN-KDNNGSTNAQPNF  715
               +AKVVGTI+ V GAML++ Y GH I     ++ W    H ++ N  ++N  T+   ++
Sbjct  139   RCQAKVVGTIVTVAGAMLMTLYKGHVI-----NLVWSNNIHTNTSNVPESNEPTDK--DW  191

Query  716   ILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDW  895
             + G  L+I++  +WA + I+Q     KY AP S TAL+CFM ++Q +   +  +HK + W
Sbjct  192   LKGSILLILATFAWASFFILQNVTMRKYTAPLSLTALVCFMGTLQSIAVTLVMEHKASAW  251

Query  896   SLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDK  1075
             ++   +   +A YAGIV ++LAY +    +EK+GP++V+ F+PL+++IVA++   +L +K
Sbjct  252   AIGFDMNLLAAAYAGIVSSSLAYYVQGLVMEKRGPVFVTAFSPLMMIIVAIMGSFILAEK  311

Query  1076  IYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKE-DHLEELELS  1246
             IY+G ++G+VLIV GLY VLWGK KE +   +     E  +   E  +   LE+ E++
Sbjct  312   IYLGGVLGAVLIVAGLYSVLWGKYKEYKEKEIEAAIPEPVKGITENNQMMRLEDREVN  369



>ref|XP_009621489.1| PREDICTED: WAT1-related protein At5g07050-like isoform X1 [Nicotiana 
tomentosiformis]
Length=397

 Score =   270 bits (689),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 140/355 (39%), Positives = 228/355 (64%), Gaps = 10/355 (3%)
 Frame = +2

Query  179   IMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLS  358
             I MI +Q GYA MN+I+K++++ GM+ +V V YR  FA+ AIAP A   ER++RP+MT  
Sbjct  19    IAMISLQFGYAGMNVITKVSLNGGMSHYVLVVYRHAFATAAIAPFALVLERKLRPKMTFM  78

Query  359   ILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTA  538
             +   IF+  + G  ++Q  Y++GLK ++PT +CA++N++PA+T+++AV   +EK+ I+  
Sbjct  79    MFLQIFVLGLLGPVIDQNFYYMGLKFTSPTFSCAMSNMLPAMTFVMAVLCRMEKVHIKKL  138

Query  539   AGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQN-KDNNGSTNAQPNF  715
               +AKVVGTI+ V GAML++ Y GH I     ++ W    H ++ N  + N  T+   + 
Sbjct  139   RCQAKVVGTIVTVAGAMLMTLYKGHVI-----NLVWSNNIHTNTSNVPEPNEVTDK--DL  191

Query  716   ILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDW  895
             + G  L+I++  +WA + I+Q     KY AP S TAL+CFM ++Q +   +  +HK + W
Sbjct  192   LKGSILLILATFAWASFFILQNVTMRKYTAPLSLTALVCFMGTLQSIAVTLVMEHKTSAW  251

Query  896   SLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDK  1075
             ++   +   +A YAGIV ++LAY +    +EK+GP++V+ F+PL+++IVA++   +L +K
Sbjct  252   AIGFDMNLLAAAYAGIVSSSLAYYVQGLVMEKRGPVFVTAFSPLMMIIVAIMGSFILAEK  311

Query  1076  IYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELE  1240
             IY+G ++G+VLIV GLY VLWGK KE +   +     E  +  V TK + +  LE
Sbjct  312   IYIGGVLGAVLIVAGLYSVLWGKYKEYKEKEIEAAIPEPVK--VVTKNNQMMILE  364



>ref|XP_003593051.1| Auxin-induced protein 5NG4 [Medicago truncatula]
Length=430

 Score =   271 bits (692),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 161/402 (40%), Positives = 239/402 (59%), Gaps = 34/402 (8%)
 Frame = +2

Query  179   IMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLS  358
             ++MI+V++ +A  N++ KLA++ GMN  + VAYR +FA++ IAP+A+  ER+ R ++T +
Sbjct  17    LLMILVKIAFACANVLYKLAVNDGMNLRIVVAYRFIFATLFIAPLAFILERKKRTKLTWT  76

Query  359   ILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFG---------  511
             ILF  FLC +FG S  Q  Y   L  ++ T A A+ NL+PAVT+++ V  G         
Sbjct  77    ILFQSFLCGLFGGSFVQNFYLESLALTSATFASAMANLVPAVTFIMVVSLGGWLGILKFA  136

Query  512   ------------IEKLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYA  655
                         +EKL +RT AGKAK+VGTI+ +GGAM+L+F  G  I +G  S H    
Sbjct  137   PLRSQVRRFPLVMEKLNLRTKAGKAKIVGTIIGIGGAMILTFIKGVEIKMG--SFHLNLL  194

Query  656   DHLSSQNKDNNGSTNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCF  835
              H +     ++ +T +  N ILG    +VSA+S+A+W IIQ +++E+YP  YSST LM F
Sbjct  195   HHQNDVGSHSHATTISTGNTILGSLYAMVSAISYALWLIIQAKMNERYPTHYSSTTLMSF  254

Query  836   MSSIQCVLFAICFDHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSV  1015
              +S+   +FA+CFD   + W L   IR     YAGIV +     ++SWC+  +GPL+ S 
Sbjct  255   WASLLSTMFALCFDRDLSQWRLGWNIRLLIVAYAGIVASGAMVVVISWCVHMRGPLFASA  314

Query  1016  FNPLLLVIVAVLSWGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEA  1195
             FNPL+LVIVA+ S  +L + +Y+G+I+GSVLIV GLY V+WGK KE++      +   ++
Sbjct  315   FNPLVLVIVALASCTMLNENLYLGSIIGSVLIVCGLYAVVWGKSKEMKKNN--QLVPSQS  372

Query  1196  RNEVETKEDHLEELELSAHSIITVDQFPKKN*NN*FSLHSKE  1321
              NE +T E  +  +         VD     N NN  S  S+E
Sbjct  373   SNEFDTVEIVVRHV---------VDDKRNHNSNNGLSNTSQE  405



>ref|XP_008342773.1| PREDICTED: WAT1-related protein At1g25270-like [Malus domestica]
Length=396

 Score =   270 bits (689),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 148/384 (39%), Positives = 229/384 (60%), Gaps = 10/384 (3%)
 Frame = +2

Query  176   LIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTL  355
             ++MM++VQ  Y  MNI  KL  + GM+  V VAYR +F++  + P+A   ER+ RP++TL
Sbjct  19    VLMMLVVQTAYTGMNIFYKLVAEVGMSLTVLVAYRNMFSAALMLPLALICERKSRPKLTL  78

Query  356   SILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRT  535
              IL   FL  + G ++ Q  Y   L  ++ T   A  NL+P +T ++AV F +E L + T
Sbjct  79    DILLQGFLSGLLGATMAQNFYIESLALTSTTYVAACNNLVPVITLIIAVCFRLESLALGT  138

Query  536   AAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHW-KYADHLSSQNKDNNGSTNAQPN  712
              AG+AKVVGT++C+GG ML +FY G  I +  +  +  +   H SS     + +T+ Q  
Sbjct  139   HAGRAKVVGTLVCIGGTMLFTFYKGKPIAMWSTHFNLLRNCLHESSHVASLHKNTHTQ--  196

Query  713   FILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTD  892
              +LG FL + S+ S+A W I QT++++ YP  YSSTALM  M+SIQ V+FA+C +     
Sbjct  197   -LLGSFLALCSSTSFACWLIFQTKMTKXYPCHYSSTALMSLMASIQSVVFALCKERDWNQ  255

Query  893   WSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQD  1072
             W L   IR  +A+Y G+V T L   L +WC+  +GPL+VSVFNPL L+++A  +  LL +
Sbjct  256   WKLGWDIRLLAALYTGVVTTGLVVTLTAWCVRMRGPLFVSVFNPLCLLLIAFAAPLLLNE  315

Query  1073  KIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELELSAH  1252
             K+Y+G+I+G +L+V GLY VLWGK KE++++       +  +  ++ +  H  ++  S+ 
Sbjct  316   KLYLGSILGGLLVVCGLYTVLWGKSKEMKMM------TQLPQPPLQDQHSHSIDMATSSV  369

Query  1253  SIITVDQFPKKN*NN*FSLHSKEN  1324
                T D   +   N   +   KEN
Sbjct  370   HTTTCDSNAQPMSNAPMNNGLKEN  393



>ref|XP_007159054.1| hypothetical protein PHAVU_002G204500g [Phaseolus vulgaris]
 gb|ESW31048.1| hypothetical protein PHAVU_002G204500g [Phaseolus vulgaris]
Length=379

 Score =   269 bits (687),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 143/347 (41%), Positives = 218/347 (63%), Gaps = 6/347 (2%)
 Frame = +2

Query  164   DLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRP  343
             D   +++M++VQ+ Y+ +N++ KLA++ GM+  V  AYR +FA V    +A+  ER+ RP
Sbjct  10    DFKPVLLMVLVQITYSSVNVLYKLAINDGMSIRVVTAYRLIFAVVFTFSLAFIFERKSRP  69

Query  344   QMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKL  523
             ++T  +LF  F   +FG SL    +   L   +PT A A+ NL+PAVT++LA+  G+EKL
Sbjct  70    KLTSRVLFMSFFSGLFGASLLHNLFLEALDLVSPTFATAIYNLVPAVTFILAISCGLEKL  129

Query  524   MIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNA  703
              +RT AGKAKVVGTI+ +GG+MLL+F+ G  + +   S H    D L   N+     T++
Sbjct  130   NMRTTAGKAKVVGTIIGIGGSMLLTFFKGQELNV--KSFH---TDLLHKNNQVVTLHTDS  184

Query  704   QPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHK  883
                F LG      S  S+A+W IIQ++++++YP+ +SSTALM  M +IQ   FA+  +  
Sbjct  185   SHKF-LGALCGFGSCFSFALWLIIQSKINKEYPSHHSSTALMSLMGAIQATAFALYAEKD  243

Query  884   PTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGL  1063
                W L   IR  + VY GIV + L    ++WC++ +GPL+VSVFNPL+LV+VAV    +
Sbjct  244   WNQWKLGSSIRILTVVYTGIVASGLVVIAIAWCVKMRGPLFVSVFNPLMLVLVAVADCLM  303

Query  1064  LQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNE  1204
             L + +YVG+++G VLIV GLY  LWGK KE++ + +    E   ++E
Sbjct  304   LGENLYVGSVIGGVLIVCGLYMFLWGKSKEVKKVNMTVSSEITQKHE  350



>ref|XP_009610629.1| PREDICTED: WAT1-related protein At5g07050-like isoform X1 [Nicotiana 
tomentosiformis]
Length=397

 Score =   270 bits (689),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 145/377 (38%), Positives = 242/377 (64%), Gaps = 17/377 (5%)
 Frame = +2

Query  179   IMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLS  358
             I MI +Q GYA MN+I+K++++ GM+ +V V YR  FA+ AIAP A   ER++RP+MT  
Sbjct  19    IAMISLQFGYAGMNVITKVSLNGGMSHYVLVVYRHAFATAAIAPFALVLERKLRPKMTFM  78

Query  359   ILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTA  538
             +   IF+  + G  ++Q  Y++GLK ++PT +CA++N++PA+T+++AV   +EK+ I+  
Sbjct  79    MFLQIFVLGLLGPVIDQNFYYMGLKFTSPTFSCAMSNMLPAMTFVMAVLCRMEKVHIKKL  138

Query  539   AGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQN-KDNNGSTNAQPNF  715
               +AKVVGTI+ V GAML++ Y GH I     ++ W    H ++ N  + N +T+   ++
Sbjct  139   RCQAKVVGTIVTVAGAMLMTLYKGHVI-----NLVWSNNIHTNTSNVPEPNEATDK--DW  191

Query  716   ILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDW  895
             + G  L+I++  +WA + I+Q     KY AP S TAL+CFM ++Q +   +  +HK + W
Sbjct  192   LKGSILLILATFAWASFFILQNVTMRKYTAPLSLTALVCFMGTLQSIAVTLVMEHKTSAW  251

Query  896   SLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDK  1075
             ++   +   +A YAGIV ++LAY +    +EK+GP++V+ F+PL+++IVA++   +L +K
Sbjct  252   AIGFDMNLLAAAYAGIVSSSLAYYVQGLVMEKRGPVFVTAFSPLMMIIVAIMGSFILAEK  311

Query  1076  IYVGTIVGSVLIVVGLYGVLWGKQKEL---QVIGVVH-----VDEEEARNEVETKEDHLE  1231
             IY+G ++G+VLIV GLY VLWGK KE    ++ G +      V E      +E +E +  
Sbjct  312   IYLGGVLGAVLIVAGLYSVLWGKYKEYKEKEIEGAIPEPVKGVTENNQMMILEDREVNDI  371

Query  1232  ELELSAHSI-ITVDQFP  1279
             E++ SA +I +++ Q P
Sbjct  372   EMQSSAVAISVSMSQPP  388



>gb|ABK25095.1| unknown [Picea sitchensis]
Length=392

 Score =   269 bits (688),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 137/359 (38%), Positives = 231/359 (64%), Gaps = 8/359 (2%)
 Frame = +2

Query  179   IMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLS  358
             + MI +Q GYA MNII+K++++ GMN FV V YR   A+V +AP A+F ER++RP++T S
Sbjct  12    VAMISLQFGYAGMNIITKVSLNRGMNHFVLVVYRHAAATVVLAPFAFFIERKVRPKLTFS  71

Query  359   ILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTA  538
             I   IF+  + G  ++Q  Y++GLK ++PT ACAL+N++PA+T+++A+ F +E + I+  
Sbjct  72    IFCQIFVLGLLGPVIDQNFYYLGLKLTSPTYACALSNVLPAMTFVIALLFRMENVNIKKL  131

Query  539   AGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFI  718
               +AK+VGTI+CVGGAML++ Y G  +      + W  A H S Q        N   N+I
Sbjct  132   RSQAKIVGTIVCVGGAMLMTLYKGPIV-----KMVWS-AHHQSPQTSAAAAIDN--KNWI  183

Query  719   LGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWS  898
             +G  LII + L+W+   I+Q  V +KY A  S   L+CF+ ++Q  + ++     P+ W+
Sbjct  184   IGSVLIIAATLAWSGLFILQAAVLKKYSAQLSLATLICFLGTLQATVLSLAVVRDPSQWA  243

Query  899   LRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKI  1078
             L   +   +AVY+G+V +A+AY +   C+  KGP++ + F+PL+++IVA+++  +L + I
Sbjct  244   LGWDLNLLTAVYSGVVASAIAYYVQGLCMRVKGPVFATAFSPLMMIIVAIMASIILAENI  303

Query  1079  YVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELELSAHS  1255
             ++G+++G VLIV+GLY VLWGK K+ +++   +  E  + ++V   E+  +  ++ A S
Sbjct  304   FLGSVLGGVLIVIGLYAVLWGKVKDSKILTDKNSTEVLSNSQVMLPENQNKADDIEAAS  362



>ref|XP_009631686.1| PREDICTED: WAT1-related protein At3g30340-like isoform X1 [Nicotiana 
tomentosiformis]
Length=359

 Score =   268 bits (685),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/357 (35%), Positives = 222/357 (62%), Gaps = 6/357 (2%)
 Frame = +2

Query  161   VDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIR  340
             V+   +I+M+ +   +A+ NI+ K  +  GMN  V + YRQ  +++ +APIA+F ER  R
Sbjct  5     VEWYPIIVMLAIDFAFAISNILLKKIIMDGMNHLVFITYRQSISTIFLAPIAFFLERNTR  64

Query  341   PQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEK  520
             P++T  IL  +FL +I G SL Q  + +G++ ++ T ACA  N++P  T+L+A+PFG+E 
Sbjct  65    PKLTPQILCYLFLSAIVGASLTQYLFLLGIQYTSATFACAFVNMVPVTTFLMALPFGLET  124

Query  521   LMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTN  700
             + I+  +G+AKV+GT++C+GGA+LL+FY G  +      IH+      S   +++  S+ 
Sbjct  125   INIKDRSGRAKVIGTLICLGGALLLTFYKGIPL------IHFSDQQTESQSMEEHISSSK  178

Query  701   AQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDH  880
              +  +I G  ++    L W+ W ++Q+ + +KYP  YSST +M F S+IQ  +     + 
Sbjct  179   RKERWIFGSLILFAGTLLWSSWFLLQSFIGKKYPCQYSSTVIMTFFSAIQSAILTFSINR  238

Query  881   KPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWG  1060
             + + W  ++ I   S +Y G++G+ L Y  MSWC++K+GP++ + F+PL+ V+ A+L   
Sbjct  239   RLSIWIPKEMIDMLSVIYTGLIGSGLCYVGMSWCVKKRGPVFTAAFSPLVQVMAAMLDVP  298

Query  1061  LLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLE  1231
              L +++ +G+++GSV+++VGLY +LWGK KE+Q +     ++++     +  E + E
Sbjct  299   FLHEQLNLGSVMGSVIVIVGLYFLLWGKTKEIQKVPQETAEKKDKELTFQVHESNDE  355



>ref|XP_002298718.1| hypothetical protein POPTR_0001s31530g [Populus trichocarpa]
 gb|EEE83523.1| hypothetical protein POPTR_0001s31530g [Populus trichocarpa]
Length=367

 Score =   268 bits (685),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 140/325 (43%), Positives = 204/325 (63%), Gaps = 5/325 (2%)
 Frame = +2

Query  179   IMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLS  358
             I MI VQ+ +  +NI  KL ++ GM+  V VAYR LF +  + PIA   ER  RP++T  
Sbjct  13    IAMIFVQIVFGGINIFYKLVINDGMSIRVAVAYRLLFGAAFLCPIALIVERNKRPKLTWV  72

Query  359   ILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTA  538
             + F IF  ++FG S+    Y   L  ++ T A AL NL PA TY++A+ F +E L +  A
Sbjct  73    VFFQIFFLALFGGSIYHNLYLASLNLTSMTFAAALYNLSPAFTYIVALLFRMETLSLNNA  132

Query  539   AGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFI  718
              G A V GT +C+GGAMLL+FY G  I I  ++I+     H   QN    GS   Q   +
Sbjct  133   RGIANVAGTAICIGGAMLLTFYKGIEINIWHTNINLLKYHHNHHQNTV--GSVKQQ---M  187

Query  719   LGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWS  898
              G  + +++ + +A W I+Q +++E+YP  YSSTALM  M SIQ +++A+CF+ K +DW 
Sbjct  188   FGLAISLIACVFYAFWVILQAKINERYPCFYSSTALMSLMGSIQAIIYALCFERKWSDWK  247

Query  899   LRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKI  1078
             L   IR  S +Y G + + L   LM+WCI K+GPLYV++FNPL+L++VA+    + Q+K+
Sbjct  248   LESNIRLISVIYLGFLASGLNITLMAWCIAKRGPLYVAIFNPLMLLVVALAGSLVFQEKL  307

Query  1079  YVGTIVGSVLIVVGLYGVLWGKQKE  1153
             ++G+I+G VLI+ GLY VLWGK K 
Sbjct  308   HLGSILGGVLIITGLYTVLWGKSKN  332



>ref|XP_009354063.1| PREDICTED: WAT1-related protein At1g25270-like [Pyrus x bretschneideri]
Length=398

 Score =   269 bits (687),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 155/388 (40%), Positives = 230/388 (59%), Gaps = 25/388 (6%)
 Frame = +2

Query  176   LIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTL  355
             +++M+++Q   A +NI+ KLA   GMN  + VAYR +F +  + PIA F ER+ RP++T 
Sbjct  16    VLLMVVIQFALAGVNILYKLAAHDGMNLRILVAYRFIFGTAFLLPIALFIERKSRPKLTW  75

Query  356   SILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRT  535
              +L   FL  +FG SL Q  Y   L  ++     A+  LIPA+T++LAV F +EKL ++ 
Sbjct  76    MVLLQGFLSGLFGGSLAQNLYIESLALTSAIFGSAIAQLIPAITFILAVIFRLEKLNLKN  135

Query  536   AAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQP--  709
              AGKAKV+GT++ +GGAML++FY G  I I      W     L   N+  +    + P  
Sbjct  136   LAGKAKVMGTLMGIGGAMLMTFYKGMEINI------WSTHVDLIHTNRQQHSQLASTPHT  189

Query  710   ---NFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDH  880
                N +LG  L   S L +AIW IIQ ++   YP  YSSTALM  M SIQ V +A+C + 
Sbjct  190   DTGNQLLGCLLAFASCLCYAIWLIIQAKMGVTYPCYYSSTALMSAMGSIQAVGYALCKER  249

Query  881   KPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWG  1060
             + + W L   IR  +  Y+GI+ T L+  +++ CI  +GPL+VSVFNPL+LV+VA+L+  
Sbjct  250   EWSQWKLGWNIRLLTVAYSGIMATGLSVTIIALCIRMRGPLFVSVFNPLMLVLVAILASL  309

Query  1061  LLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELE  1240
             +L++K+++G+++G+VLIV GLYGVLWGK KE+          E+  N V +   H ++  
Sbjct  310   VLEEKLHLGSVLGAVLIVCGLYGVLWGKGKEI----------EKMSNSVPSTTFHHQD--  357

Query  1241  LSAHSIITVDQFPKKN*NN*FSLHSKEN  1324
               + SI  V   P  N  N  ++ S  N
Sbjct  358   --SGSIDIVTMPPDNNKGNSNNIESLTN  383



>ref|XP_006477502.1| PREDICTED: WAT1-related protein At3g30340-like [Citrus sinensis]
 gb|KDO76790.1| hypothetical protein CISIN_1g017940mg [Citrus sinensis]
Length=363

 Score =   268 bits (684),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 132/358 (37%), Positives = 220/358 (61%), Gaps = 9/358 (3%)
 Frame = +2

Query  176   LIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTL  355
             LI MI V+ G+A +NI  K  ++ GMN  V +  R L A++ +API YF ER  RP++TL
Sbjct  10    LIAMIAVEFGFATVNIFLKKVLEEGMNELVFITCRLLVATILLAPIGYFWERNSRPKLTL  69

Query  356   SILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRT  535
              ILF +F  +I G SL Q  + +G++ ++ T ACA  N++P +T+++A+PFG+E + I+ 
Sbjct  70    RILFCLFFSAIVGTSLTQYFFLLGIQYTSATFACAFINMVPVITFVIALPFGLETVDIKG  129

Query  536   AAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNF  715
              +GKAKVVGT++C+GGAMLL+ Y G  +          Y+   ++ N  +   T     +
Sbjct  130   ISGKAKVVGTLVCIGGAMLLTLYKGMPL------FDHSYSQAETAINVMHMHPTRKTERW  183

Query  716   ILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDW  895
               G   + V  L WA W  IQ+ + ++YP  YSSTA++    +IQ  +  +  +   + W
Sbjct  184   TFGTIALTVGTLLWASWFPIQSYIGKRYPCKYSSTAILSLFGAIQAAILCLATNRNHSAW  243

Query  896   SLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDK  1075
             S +  I   S +YAGIVG+ L Y  ++WC++KKGP++ + F+PL+ ++ A+    LL ++
Sbjct  244   SFKGKIEIISVLYAGIVGSGLCYVGLTWCVKKKGPVFTAAFSPLVQIMAAMFDIPLLHER  303

Query  1076  IYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELELSA  1249
             +++G+++GS+ +++GLY +LWGK KE+Q    V    +EA  +++ +E  L  + +SA
Sbjct  304   LHIGSLLGSITVIIGLYILLWGKNKEMQ--NCVSKVTQEAE-DIKEQEPQLPVITVSA  358



>ref|XP_002447367.1| hypothetical protein SORBIDRAFT_06g033810 [Sorghum bicolor]
 gb|EES11695.1| hypothetical protein SORBIDRAFT_06g033810 [Sorghum bicolor]
Length=377

 Score =   268 bits (685),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 146/329 (44%), Positives = 212/329 (64%), Gaps = 11/329 (3%)
 Frame = +2

Query  185   MIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLSIL  364
             M+ +Q+  A +NI  KLA+  GM+  V VAYR LFAS  +AP+AYF ER+ R ++T  +L
Sbjct  1     MVAIQVMSAGVNIFYKLAVSDGMDMRVLVAYRYLFASAFLAPLAYFIERKRRTKLTWRVL  60

Query  365   FNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTAAG  544
                F+C + G SL Q  Y  G+K ++ T A A TNLIP VT++LA+ F  E L IR A+G
Sbjct  61    VMSFICGLTGGSLAQNLYISGMKLTSATFASATTNLIPGVTFVLALIFRYEGLAIRAASG  120

Query  545   KAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYAD----HLSSQNKDNNGSTNAQPN  712
             +AKV GT+L V GAMLL+FY G +I    S ++   A     H      D+  +     N
Sbjct  121   QAKVAGTLLGVAGAMLLTFYKGADITPWHSHVNLARAGAGAVHHHPPPDDDQAA-----N  175

Query  713   FILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKP--  886
              ++G  L I S + +A+W I+Q ++S++YP  YSSTALMC MS++Q V  A+ +      
Sbjct  176   RVMGSLLCISSCVFYALWLILQAKLSKEYPFHYSSTALMCVMSTLQSVALALIWSRHDVV  235

Query  887   TDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLL  1066
               W L   +R  S  Y+G++ + +   ++SWC++K+GPL+ SVFNPL+L++VAVLS  LL
Sbjct  236   AQWRLGLDVRLLSVAYSGVLASGVMLVVLSWCVKKRGPLFASVFNPLMLLVVAVLSSLLL  295

Query  1067  QDKIYVGTIVGSVLIVVGLYGVLWGKQKE  1153
              +K+Y+G+ +G+VLIV+GLY VLWGK +E
Sbjct  296   GEKLYLGSALGAVLIVLGLYAVLWGKGRE  324



>ref|XP_003597788.1| Auxin-induced protein 5NG4 [Medicago truncatula]
 gb|AES68039.1| auxin-induced 5NG4-like protein [Medicago truncatula]
Length=372

 Score =   268 bits (684),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 155/383 (40%), Positives = 233/383 (61%), Gaps = 22/383 (6%)
 Frame = +2

Query  167   LLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQ  346
             L A  +M++VQL YAV+ I+ KL  + GM+  V VAYR LFAS+ + P+AYF ER+  P+
Sbjct  11    LKAAFLMVLVQLAYAVVGILYKLVANDGMSLCVLVAYRYLFASIFMVPLAYFVERKSNPK  70

Query  347   MTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLM  526
             +T  +LF  FLC +FG +L Q  Y   +  +  T A  + N IPA T++LAV FG+E+L 
Sbjct  71    ITAEVLFQAFLCGLFGATLQQNLYVEVVVLAGVTYATVMYNFIPAATFILAVCFGLERLN  130

Query  527   IRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQ  706
             I T  GKAK+VGT+L + GAM+L+FY    I +  + I     + L  Q   N  + N  
Sbjct  131   IGTLTGKAKIVGTLLGISGAMILTFYKSIEIHLWSTHI-----NLLKHQQPKNVSADN--  183

Query  707   PNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKP  886
                ILG  L + + +S++IW IIQ R+SEK+P  Y+S ALM  M+SIQ ++FA+  +   
Sbjct  184   ---ILGSSLALGTCISYSIWLIIQARMSEKFPWHYTSAALMSVMASIQSIIFALFKERDD  240

Query  887   -TDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGL  1063
                W L   I+  +A+++GIV + + + L++WC+  KGPLY SVFNPL L++VA+    L
Sbjct  241   WNQWKLGWDIKLFTALFSGIVASGIVWVLIAWCVCIKGPLYASVFNPLFLILVAIGGSLL  300

Query  1064  LQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELEL  1243
             L +++++G+++GS+LIV+GLY VLWGK +EL+ I       E  R  V+     ++ LE+
Sbjct  301   LDERLHLGSVIGSLLIVIGLYIVLWGKGRELKQI------IEHTRGSVQ-----VQPLEI  349

Query  1244  SAHSIITVDQFPKKN*NN*FSLH  1312
                 ++        N N+  S H
Sbjct  350   ITTKLVDAKSLDIDNNNDIKSSH  372



>ref|XP_004294697.1| PREDICTED: auxin-induced protein 5NG4-like [Fragaria vesca subsp. 
vesca]
Length=380

 Score =   268 bits (684),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 133/341 (39%), Positives = 224/341 (66%), Gaps = 15/341 (4%)
 Frame = +2

Query  179   IMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLS  358
             I MI +Q GYA MNII+K++++ GM+ +V V YR  FA+ AIAP A   ER+IRP++T  
Sbjct  19    IAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAAIAPFALVLERKIRPKITFP  78

Query  359   ILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTA  538
             +   +F+  + G  ++Q  Y+ GLK ++PT +CA++N++PA+T+++AV   +EKL ++  
Sbjct  79    VFMKLFVLGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTFVMAVLCRMEKLEMKKV  138

Query  539   AGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFI  718
               +AK++GTI+ V GAML++ Y G NI      I + ++ H ++ N  ++ + N   +++
Sbjct  139   RCQAKLIGTIVTVAGAMLMTLYKG-NI------ISFPWSAHSNNTNNASSATNNEDKDWL  191

Query  719   LGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWS  898
              G  L+I++  +WA + IIQ    ++Y AP S TA++CF+ ++Q +      +HKP  W+
Sbjct  192   KGSILLILATFAWASFFIIQAVTQKRYQAPLSLTAIVCFLGTLQSIAVTFVMEHKPAAWT  251

Query  899   LRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKI  1078
             +   +   +A YAGIV ++LAY +    ++K GP++V+ F+PL+++IVAV+   +L +KI
Sbjct  252   IGWDMNLLAAAYAGIVSSSLAYYIQGLVMQKTGPVFVTAFSPLMMIIVAVMGSFILAEKI  311

Query  1079  YVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARN  1201
             Y+G ++G+VLIV+GLY VLWGK KE +        E+EA +
Sbjct  312   YLGGVLGAVLIVMGLYSVLWGKYKEYK--------EKEAES  344



>ref|XP_010030083.1| PREDICTED: WAT1-related protein At1g68170-like [Eucalyptus grandis]
Length=418

 Score =   269 bits (687),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 142/336 (42%), Positives = 215/336 (64%), Gaps = 15/336 (4%)
 Frame = +2

Query  179   IMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLS  358
             I+M+ VQ  +A +N++ KLA + GMN  + VAYR LFA+  I+PIA F ER+ RP++T  
Sbjct  17    ILMVTVQASFAGVNVVYKLAANDGMNLRLVVAYRLLFATAFISPIALFLERKKRPKLTGM  76

Query  359   ILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTA  538
             +LF  F C  FG SL    Y   L  ++ T A A+ NL PA+TY++AV FG+E+++I   
Sbjct  77    VLFQAFCCGFFGGSLTHNLYLESLALTSATYAAAMLNLAPAITYIMAVSFGLERVVIGRI  136

Query  539   AGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSI----HWKY----ADHLSS-QNKDNNG  691
              GKAKV+GT++ +GGAM+L+FY G  I +  + +    H  +    ADH  +  N+  +G
Sbjct  137   EGKAKVLGTLIGIGGAMVLTFYKGFEIRMWSTHVDLLHHHSHQPLPADHHPAFSNRTEHG  196

Query  692   STNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAIC  871
             +       +LG  L + S  S+++W IIQT+++E+YP  YSSTAL     SIQ V FA+ 
Sbjct  197   A------HVLGSMLAVGSCASYSLWLIIQTKMAERYPCHYSSTALTSLFGSIQAVGFALF  250

Query  872   FDHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVL  1051
              +   ++W L   IR  +  Y G+V + +   L+ WC+ K+GPL+ SVFNPL+LV+VA+ 
Sbjct  251   TERDWSEWKLGWNIRLLTVAYTGLVASGICVSLIGWCVHKRGPLFASVFNPLMLVLVALA  310

Query  1052  SWGLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQ  1159
                LL +K+++G+++G+ LIV GLY VLWGK +E++
Sbjct  311   GSFLLDEKLHLGSVLGAGLIVCGLYVVLWGKHREMK  346



>ref|XP_004486241.1| PREDICTED: WAT1-related protein At1g68170-like, partial [Cicer 
arietinum]
Length=353

 Score =   266 bits (681),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 139/336 (41%), Positives = 213/336 (63%), Gaps = 11/336 (3%)
 Frame = +2

Query  176   LIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTL  355
             +++M++VQ+ YA +N++ KLA++ GM   V  AYR  F SV   P+A  +ER  RP++T 
Sbjct  14    VMLMVLVQIAYAAVNVLYKLAINDGMTVKVATAYRLAFGSVFTIPLALITERNKRPKLTW  73

Query  356   SILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRT  535
              +LF  FLC +FG SL Q  ++  L  ++ T A A+ NLIPA+T+++A+  G E+L +R 
Sbjct  74    RVLFMAFLCGLFGGSLFQNLFYEALALTSATFASAIYNLIPAITFIMAISCGFERLNLRA  133

Query  536   AAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNF  715
             AAGKAKV+GT++ +GGAM+L F  G  I I      W +  +L   ++D N    A  + 
Sbjct  134   AAGKAKVLGTVIGIGGAMMLIFLKGVEIDI------WPFHINLLHPHEDKNRHVAAAVDS  187

Query  716   I-----LGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDH  880
                    G    + S  S+A+W IIQ ++S++YP+ YSSTALM  M +IQ   F +  + 
Sbjct  188   DCGSKWFGVVCAVASCFSFALWLIIQAKMSKEYPSHYSSTALMSTMGAIQATAFGVSVER  247

Query  881   KPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWG  1060
               + W L   IR  +  Y+GIV + L   + SWCI+ +GPL+ SVFNPL+L+ V +++  
Sbjct  248   DFSQWKLAWNIRLLAVAYSGIVASGLVVIVTSWCIKMRGPLFASVFNPLMLLFVTLVASL  307

Query  1061  LLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIG  1168
             +L +K+Y+G+++G+VLIV GLY VLWGK+KE++ I 
Sbjct  308   MLDEKLYLGSMIGAVLIVCGLYMVLWGKRKEMKKIA  343



>ref|XP_006585457.1| PREDICTED: WAT1-related protein At1g68170-like [Glycine max]
Length=386

 Score =   267 bits (683),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 149/349 (43%), Positives = 225/349 (64%), Gaps = 6/349 (2%)
 Frame = +2

Query  167   LLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQ  346
             L  +++M++VQ+ +A +N+  K A++ GM+  V VAYR +FA+V IAP+A   ER+ R +
Sbjct  11    LKPVLLMVVVQIAFAGVNVFYKFAVNDGMSLRVVVAYRFVFATVFIAPLALIVERKKRTK  70

Query  347   MTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLM  526
             MT ++LF  FLC +FG SL Q  Y   L  ++ T A A++NLIP +T++LAV FG+E+L 
Sbjct  71    MTWTVLFQSFLCGLFGGSLAQNFYLQALALTSATFASAMSNLIPGITFILAVCFGMERLN  130

Query  527   IRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQ  706
             +RTAAGKAK+VGT++ +GGAM+L+F  G +I  G  S H    + L  QN  +  S    
Sbjct  131   LRTAAGKAKIVGTLIGIGGAMVLTFVKGVHIEFG--SFH---LNLLHPQNGTHAHSATG-  184

Query  707   PNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKP  886
              + +LG    + S +S+A+W IIQ ++SE YP PYSSTALM    S+  ++ A+C +   
Sbjct  185   AHTLLGSLCALASGISYALWLIIQAKMSESYPRPYSSTALMSLWGSLLSIVLALCVERDW  244

Query  887   TDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLL  1066
             + W L   IR  +A Y GIV + +   ++SWC+  +GPL+ SVF+PL+LV VA+    +L
Sbjct  245   SQWRLGWNIRLLTAAYTGIVVSGVMVVVISWCVHMRGPLFASVFSPLMLVTVALAGSTIL  304

Query  1067  QDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVET  1213
              +K+++G ++G+VLIV GLY VLWGK KE++    +   +    NE  T
Sbjct  305   NEKLHLGCVIGAVLIVCGLYVVLWGKSKEMKKKNQLVPAQSPHDNESNT  353



>ref|XP_006439173.1| hypothetical protein CICLE_v10020755mg [Citrus clementina]
 gb|ESR52413.1| hypothetical protein CICLE_v10020755mg [Citrus clementina]
Length=363

 Score =   266 bits (681),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 131/358 (37%), Positives = 220/358 (61%), Gaps = 9/358 (3%)
 Frame = +2

Query  176   LIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTL  355
             LI MI V+ G+A +NI  K  ++ GMN  V +  R L A++ +API YF ER  RP++TL
Sbjct  10    LIAMIAVEFGFATVNIFLKKVLEEGMNDLVFITCRLLVATILLAPIGYFWERNSRPKLTL  69

Query  356   SILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRT  535
              ILF +F  +I G SL Q  + +G++ ++ T ACA  N++P +T+++A+PFG+E + I+ 
Sbjct  70    RILFCLFFSAIVGTSLTQYFFLLGIQYTSATFACAFINMVPVITFVIALPFGLETVDIKG  129

Query  536   AAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNF  715
              +GKAKVVGT++C+GGAM+L+ Y G  +          Y+   ++ N  +   T     +
Sbjct  130   ISGKAKVVGTLVCIGGAMVLTLYKGMPL------FDHSYSQAETAINVMHMHPTRKTERW  183

Query  716   ILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDW  895
               G   + V  L WA W  IQ+ + ++YP  YSSTA++    +IQ  +  +  +   + W
Sbjct  184   TFGTIALTVGTLLWASWFPIQSYIGKRYPCKYSSTAILSLFGAIQAAILCLATNRNHSAW  243

Query  896   SLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDK  1075
             S +  I   S +YAGIVG+ L Y  ++WC++KKGP++ + F+PL+ ++ A+    LL ++
Sbjct  244   SFKGKIEIISVLYAGIVGSGLCYVGLTWCVKKKGPVFTAAFSPLVQIMAAMFDIPLLHER  303

Query  1076  IYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELELSA  1249
             +++G+++GS+ +++GLY +LWGK KE+Q    V    +EA  +++ +E  L  + +SA
Sbjct  304   LHIGSLLGSITVIIGLYILLWGKNKEMQ--NCVSKVTQEAE-DIKEQEPQLPVITVSA  358



>ref|XP_008367450.1| PREDICTED: WAT1-related protein At3g30340-like [Malus domestica]
Length=368

 Score =   266 bits (681),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/364 (34%), Positives = 222/364 (61%), Gaps = 15/364 (4%)
 Frame = +2

Query  176   LIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTL  355
              I+MI +   +A++NI+ K  +D GMN  V + YR   +++ +API+YF ER  RP++TL
Sbjct  13    FIVMIAIDFSFAIVNILLKKVLDEGMNHLVLITYRLTISTIFLAPISYFGERNTRPKLTL  72

Query  356   SILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRT  535
              I   +FL +I G SL Q  + +G++ ++ T ACA  N++P +T+++A+PFG+E + ++ 
Sbjct  73    RIACFLFLSAILGTSLTQYFFLLGIQYTSATFACAFVNMVPVITFIVALPFGLETVNLKC  132

Query  536   AAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNG----STNA  703
              +G+AKV G ++C+GGA++L+ Y G  +        + Y+   +S    ++G    ST  
Sbjct  133   NSGRAKVFGAVVCIGGALILTLYKGVPL--------FDYSKSTTSTQAKDHGIHLSSTRN  184

Query  704   QPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHK  883
                + +G   ++   L W+ W ++QT +S+ YP  YSST +M F  +IQ  +  +C    
Sbjct  185   HERWTVGSIALVGGTLLWSSWFLVQTNISKMYPCQYSSTTIMNFFGAIQSAILGVCTGRN  244

Query  884   PTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGL  1063
              + W LR   +  + +++G++ + L +  MSWC+ K+GP++ + F+PL+ ++ A++S  +
Sbjct  245   LSMWVLRGRTQVITVLFSGMIASGLGFVGMSWCVRKRGPVFTAAFSPLVQIMAALISIPI  304

Query  1064  LQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELEL  1243
               +++++G+++GSV+++ GLY +LWGK+KE+Q      V E EA  E   +E HL  + +
Sbjct  305   FHERLHLGSVLGSVIVIAGLYILLWGKKKEMQKCATKLVQESEAIKE---QESHLPAITV  361

Query  1244  SAHS  1255
             S  S
Sbjct  362   SVDS  365



>ref|XP_007148017.1| hypothetical protein PHAVU_006G173600g [Phaseolus vulgaris]
 gb|ESW20011.1| hypothetical protein PHAVU_006G173600g [Phaseolus vulgaris]
Length=371

 Score =   266 bits (681),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 120/362 (33%), Positives = 229/362 (63%), Gaps = 10/362 (3%)
 Frame = +2

Query  176   LIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTL  355
              I+MI     +AV+N++ K  ++ G+N  V + YR   A++ IAP+AYF ER  RP++T 
Sbjct  11    FIVMIASDFSFAVVNVLLKKVLEEGVNHLVFITYRLTIATIFIAPVAYFRERNDRPRLTF  70

Query  356   SILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRT  535
              IL  +F  +I G S+ Q    +G++ ++ T +CA  N++P VT+++A+PFG+E + I+ 
Sbjct  71    RILCYLFCSAIVGASVTQYFVLLGIQYTSATFSCAFINMVPVVTFMMALPFGLETVKIKC  130

Query  536   AAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNK---DNNGSTNAQ  706
              +G+AK++G+++C+GGA++L+ Y G  +       H+ + +  +S  K   +   STN  
Sbjct  131   KSGRAKILGSLVCIGGALMLTLYKGKPL------FHFSHHESAASMTKSSAEKPYSTNTT  184

Query  707   PNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKP  886
               + +G   +++  + W+ W I+Q+++S++YP  YSSTA+M F  ++Q  +   C DH  
Sbjct  185   GRWTIGVIAMVMGTMFWSSWYILQSKISKRYPCQYSSTAIMSFFGAVQAAVICFCTDHNF  244

Query  887   TDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLL  1066
             + W L+  ++  + +++G+VG+ L +  MSWC++K+GP++ + F+PL+ +I A++   +L
Sbjct  245   SIWVLKGKMQIIAFLFSGVVGSGLCFVGMSWCVKKRGPVFTAAFSPLVQIIAAMIDIPVL  304

Query  1067  QDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELELS  1246
              +++++G+++GS+L+++GLY VLWGK  E++   +  V E E   E E  +  +++L + 
Sbjct  305   HEQLHLGSVMGSILVIIGLYIVLWGKSIEMKNRVIKLVQEAEETKEQEA-QPQIQQLTVY  363

Query  1247  AH  1252
              H
Sbjct  364   VH  365



>ref|XP_010110839.1| Auxin-induced protein 5NG4 [Morus notabilis]
 gb|EXC28318.1| Auxin-induced protein 5NG4 [Morus notabilis]
Length=365

 Score =   266 bits (681),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 131/370 (35%), Positives = 233/370 (63%), Gaps = 16/370 (4%)
 Frame = +2

Query  158   GVDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRI  337
             G +    + M+ V L +AV+NI+ K  +D GM+  V V YR   +++ +APIAYF ER  
Sbjct  5     GEEWKPFMAMVGVDLAFAVVNILLKKVLDEGMDHLVLVTYRLSISAIFLAPIAYFWERDS  64

Query  338   RPQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIE  517
             RP++TL IL  +FL +I G SL Q  + +G++ ++ T +CA  N++P +T+L+A+PFGIE
Sbjct  65    RPRLTLRILCYLFLSAIIGASLTQYLFLLGIQYTSATFSCAFINMVPVLTFLMALPFGIE  124

Query  518   KLMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNN---  688
              + ++  +G+AKV+GT++C+GG  LL+ Y G +  + E+S       H++++  D+    
Sbjct  125   AVNLKCNSGRAKVIGTLVCIGGGALLTLYKGPS--LFENS-------HVTNRMMDSTIGI  175

Query  689   GSTNAQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAI  868
              S      + +G   +++  LSW+ W ++Q+ + ++YP  YSSTA+M F  +IQ  + + 
Sbjct  176   SSAKKAERWTIGTIALVIGTLSWSSWFLLQSSIGKRYPCQYSSTAIMSFFGAIQSAILSF  235

Query  869   CFDHKPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAV  1048
                   + W LR  I+  + ++AG+VG+ L Y  MSWC++K+GP++ + F+PL+ ++ A+
Sbjct  236   STGSHFSVWILRGWIQVATVMFAGMVGSGLGYVTMSWCVKKRGPVFTAAFSPLVQIMAAM  295

Query  1049  LSWGLLQDKIYVG-TIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDH  1225
             +   +L ++ Y+G +++GS+ +++GLY +LWGK+KE+Q        E E   E +T+E H
Sbjct  296   IDIPVLHERFYLGSSLLGSIAVIIGLYILLWGKKKEMQNFATKLAQEAE---ENKTQEPH  352

Query  1226  LEELELSAHS  1255
             L+ + +S+ S
Sbjct  353   LQVITVSSDS  362



>gb|KHN26712.1| Auxin-induced protein 5NG4-like protein [Glycine soja]
Length=370

 Score =   266 bits (680),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 145/325 (45%), Positives = 216/325 (66%), Gaps = 6/325 (2%)
 Frame = +2

Query  185   MIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLSIL  364
             M++VQ+ +A +N+  K A++ GM+  V VAYR +FA+V IAP+A   ER+ R +MT ++L
Sbjct  1     MVVVQIAFAGVNVFYKFAVNDGMSLRVVVAYRFVFATVFIAPLALIVERKKRTKMTWTVL  60

Query  365   FNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTAAG  544
             F  FLC +FG SL Q  Y   L  ++ T A A++NLIP +T++LAV FG+E+L +RTAAG
Sbjct  61    FQSFLCGLFGGSLAQNFYLQALALTSATFASAMSNLIPGITFILAVCFGMERLNLRTAAG  120

Query  545   KAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFILG  724
             KAK+VGT++ +GGAM+L+F  G +I  G  S H    + L  QN  +  S     + +LG
Sbjct  121   KAKIVGTLIGIGGAMVLTFVKGVHIEFG--SFH---LNLLHPQNGTHAHSATG-AHTLLG  174

Query  725   PFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWSLR  904
                 + S +S+A+W IIQ ++SE YP PYSSTALM    S+  ++ A+C +   + W L 
Sbjct  175   SLCALASGISYALWLIIQAKMSESYPRPYSSTALMSLWGSLLSIVLALCVERDWSQWRLG  234

Query  905   QGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKIYV  1084
               IR  +A Y GIV + +   ++SWC+  +GPL+ SVF+PL+LV VA+    +L +K+++
Sbjct  235   WNIRLLTAAYTGIVVSGVMVVVISWCVHMRGPLFASVFSPLMLVTVALAGSTILNEKLHL  294

Query  1085  GTIVGSVLIVVGLYGVLWGKQKELQ  1159
             G ++G+VLIV GLY VLWGK KE++
Sbjct  295   GCVIGAVLIVCGLYVVLWGKSKEMK  319



>gb|KHF97890.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=389

 Score =   267 bits (682),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 140/328 (43%), Positives = 216/328 (66%), Gaps = 3/328 (1%)
 Frame = +2

Query  179   IMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLS  358
             ++M++VQ+ +A +N++ KLA + GM+  V V+YR +FAS  + P+A   ER+ RP++T +
Sbjct  15    MLMVVVQVVFAGVNVLYKLAENDGMSSKVMVSYRFIFASAVMIPLALIVERK-RPKLTWT  73

Query  359   ILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTA  538
             +L   F C + G SL+Q  Y V +  ++ T   A+TNLIP +T+++AV  G+EK+   T 
Sbjct  74    VLLQAFFCGLLGGSLSQNLYIVSMTLTSATFVSAMTNLIPGITFIVAVTIGLEKVGFGTM  133

Query  539   AGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFI  718
             AGKAKV+GT++ +GGAMLL+FY G  I  G  S+H     H       +  S  +  + +
Sbjct  134   AGKAKVLGTLIGIGGAMLLTFYKGVQINTG--SVHVDLVHHQHHGASSSYSSHPSSAHHL  191

Query  719   LGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWS  898
              G  L + S +S+A+W  +Q ++ EKYP  YSSTAL C M++IQ  +FA+C +   + W 
Sbjct  192   WGALLALGSCISYALWLNVQAKMGEKYPCYYSSTALTCIMAAIQSTVFALCLEKDWSQWK  251

Query  899   LRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKI  1078
             L   +R  +  +AGI+G+ L + L++WC+  KGPLY SVFNPLLLV+VA      L++ +
Sbjct  252   LGWNVRLLTVAFAGILGSGLMFSLVAWCVRLKGPLYASVFNPLLLVLVAFAGSFFLEENL  311

Query  1079  YVGTIVGSVLIVVGLYGVLWGKQKELQV  1162
             Y+G+I+G+VLIV+GLY VLWGK KE+++
Sbjct  312   YLGSIMGAVLIVMGLYIVLWGKGKEMEM  339



>ref|XP_004288674.1| PREDICTED: auxin-induced protein 5NG4-like [Fragaria vesca subsp. 
vesca]
Length=395

 Score =   266 bits (681),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 142/348 (41%), Positives = 215/348 (62%), Gaps = 2/348 (1%)
 Frame = +2

Query  167   LLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQ  346
             L  +++M++ Q  +A +NI  KLA + GMN  V VAYR LFA+  I P+A + ER  RP+
Sbjct  14    LKPVLLMVVAQAAFAGVNIFYKLAANDGMNTSVVVAYRFLFATAFITPLALYLERNSRPK  73

Query  347   MTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLM  526
             +T  ++    LC  FG S+ Q   F  +  ++ T   A+T LIPA+T+++AV F +E+L 
Sbjct  74    LTWMVVLQASLCGFFGGSMTQNMQFESIALTSATFTAAITQLIPAITFVMAVFFRLERLD  133

Query  527   IRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQ  706
             +R+  G+AKV+GT++ +GGAML++FY G  I I  + ++  +     S       S +  
Sbjct  134   LRSGGGRAKVLGTLMGIGGAMLMTFYKGVEINIWSTHVNLLHKSEQPSHYLAAPTSKSEY  193

Query  707   PNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKP  886
              + +LG  L I S+  +A + I Q ++ EKYP  YSSTALM  M SIQ V FA+C +   
Sbjct  194   TDHVLGSLLAIGSSFGYAFFFIFQAKMVEKYPCYYSSTALMSLMGSIQSVGFALCMERDW  253

Query  887   TDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLL  1066
               W L   IR  +  Y GIV T ++  +++ C+  KGPL+V+VFNPLLLVIVA +   LL
Sbjct  254   NQWKLGWNIRLLTVAYTGIVATGISLTILALCVRMKGPLFVAVFNPLLLVIVAFVGSLLL  313

Query  1067  QDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVI--GVVHVDEEEARNE  1204
              +K+++G+++GS++IV GLY VLWGK K+++++   V    EEE   E
Sbjct  314   DEKLHLGSVLGSIIIVGGLYAVLWGKSKDIKMMTQSVPTSFEEEKYAE  361



>ref|XP_009620096.1| PREDICTED: WAT1-related protein At5g07050-like [Nicotiana tomentosiformis]
Length=411

 Score =   267 bits (683),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 131/325 (40%), Positives = 216/325 (66%), Gaps = 11/325 (3%)
 Frame = +2

Query  179   IMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLS  358
             I MI +Q GYA MNII+K++++ GM+ +V V YR  FA+  IAP A   ER+IRP+M+L 
Sbjct  19    IAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIAPFALILERKIRPKMSLM  78

Query  359   ILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTA  538
             +   IF+  + G  ++Q  Y+ GLK ++PT +CA++N++PA+T+++AV   +EK+ I+  
Sbjct  79    MFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTFVMAVICRMEKVDIKKV  138

Query  539   AGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNK----DNNGSTNAQ  706
               +AKV+GTI+ V GAML++ Y GH        ++  +++H++S       + +G+TN+ 
Sbjct  139   RCQAKVLGTIVTVAGAMLMTLYKGH-------VVNLLWSNHINSTTNSSISETSGATNSD  191

Query  707   PNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKP  886
              ++  G  L+I +  +WA + I+Q     KY AP S TAL+CFM ++Q +      +HKP
Sbjct  192   KDWFKGSILLIFATFAWASFFILQNITMRKYTAPLSLTALVCFMGTLQSIAVTFVMEHKP  251

Query  887   TDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLL  1066
             + W++   +   +A YAGIV +++AY +    +EK+GP++V+ F+PL+++IVA++   +L
Sbjct  252   SVWTIGFDMNLLAAAYAGIVSSSIAYYVQGLVMEKRGPVFVTAFSPLMMIIVAIMGSFIL  311

Query  1067  QDKIYVGTIVGSVLIVVGLYGVLWG  1141
              +KIY+G I+G+VLIV GLY VLWG
Sbjct  312   AEKIYIGGILGAVLIVAGLYSVLWG  336



>ref|XP_007041591.1| Mtn21-like protein [Theobroma cacao]
 gb|EOX97422.1| Mtn21-like protein [Theobroma cacao]
Length=377

 Score =   266 bits (680),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 143/327 (44%), Positives = 215/327 (66%), Gaps = 7/327 (2%)
 Frame = +2

Query  179   IMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLS  358
             ++M++VQ+ +A +N++ KLA + GM+  + VAYR +FA+  + P+A   ER+ RP++T +
Sbjct  15    MLMVVVQVVFAGVNVLYKLAANDGMSLRIIVAYRFIFATAVMIPLALILERK-RPKLTWT  73

Query  359   ILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTA  538
             +L   F C + G SL+Q  Y   L  ++ T   A+TNLIPA+T+++AV  G+EKL   T 
Sbjct  74    VLIQAFFCGLLGGSLSQNLYIESLALTSATFVSAMTNLIPAITFIMAVTIGLEKLAFGTM  133

Query  539   AGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFI  718
             AG+AKV+GT++ +GGAMLL+FY G  I +G  S H     H       + GS +     +
Sbjct  134   AGRAKVLGTVIGIGGAMLLTFYKGFQINMG--SKHLDLLRHGRHGASSHAGSAHHLLGAL  191

Query  719   LGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWS  898
             L     + S +S+A+W  IQ ++SEKYP  YSSTAL+C M +IQ V+FA+C +   + W 
Sbjct  192   L----ALCSCISYALWLNIQAKMSEKYPCYYSSTALICIMGAIQAVVFALCTEKDRSQWK  247

Query  899   LRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKI  1078
             L   IR  +  Y GI+ + L + L+SWC+  +GPLY SVFNPL+LV+VA      L++K+
Sbjct  248   LGWNIRLLTVAYGGILASGLMFSLVSWCVRMRGPLYASVFNPLMLVMVAFAGSLFLEEKL  307

Query  1079  YVGTIVGSVLIVVGLYGVLWGKQKELQ  1159
             Y+G+I+G+VLIV+GLY VLWGK KE++
Sbjct  308   YLGSIIGAVLIVLGLYVVLWGKGKEMK  334



>ref|XP_009354252.1| PREDICTED: WAT1-related protein At1g25270-like [Pyrus x bretschneideri]
Length=395

 Score =   266 bits (681),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 142/370 (38%), Positives = 223/370 (60%), Gaps = 18/370 (5%)
 Frame = +2

Query  176   LIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTL  355
             ++MM++VQ  Y  MNI  KL  + GM+  V VAYR +F++  + P+A   ER+ RP++TL
Sbjct  19    VLMMLMVQTAYTGMNIFYKLVAEVGMSLTVLVAYRNMFSAALMLPLALICERKSRPKLTL  78

Query  356   SILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRT  535
              IL   FL  + G ++ Q  Y   L  ++ T   A  NL+P +T ++AV F +E L + T
Sbjct  79    DILLQGFLSGLLGATMAQNFYIESLALTSTTYVAACNNLVPVITLIIAVCFRLESLALGT  138

Query  536   AAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSI-----HWKYADHLSSQNKDNNGSTN  700
              AG+AKV GT++C+GG ML +FY G  I +  +       H     H++S +K+    T+
Sbjct  139   HAGRAKVAGTLVCIGGTMLFTFYKGKPIAMWSTHFNLLRNHLHENSHVASLHKN----TH  194

Query  701   AQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDH  880
              Q   +LG FL + S+ S+A W I QT+++++YP  YSSTALM  M+SIQ V+FA+C + 
Sbjct  195   TQ---LLGSFLALCSSTSFACWLIFQTKMTKRYPCHYSSTALMSLMASIQSVVFALCKER  251

Query  881   KPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWG  1060
                 W L   IR  +A+Y G+V T L   L +WC+  +GPL+VS+FNPL L+++   +  
Sbjct  252   DWNQWKLGWDIRLLAALYTGVVTTGLVVTLTAWCVRTRGPLFVSIFNPLCLLLITFAAPF  311

Query  1061  LLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELE  1240
             LL +K+Y+G+++G +L+V GLY VLWGK KE++++       +  +  ++ +  H  ++ 
Sbjct  312   LLNEKLYLGSMLGGLLVVCGLYTVLWGKSKEMKMM------TQLPQPPLQDQYSHSIDMA  365

Query  1241  LSAHSIITVD  1270
              SA    T D
Sbjct  366   TSAVHTTTCD  375



>ref|XP_009419851.1| PREDICTED: WAT1-related protein At5g07050-like [Musa acuminata 
subsp. malaccensis]
Length=381

 Score =   266 bits (679),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 142/370 (38%), Positives = 228/370 (62%), Gaps = 29/370 (8%)
 Frame = +2

Query  185   MIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLSIL  364
             MI +Q GYA MNIISK++++ GM+ +V V YR  FA+++IAP A   ER +RP++T  I 
Sbjct  17    MISLQFGYAGMNIISKVSLNHGMSHYVLVVYRHAFATLSIAPFALIFERNVRPKITFPIF  76

Query  365   FNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTAAG  544
               IF+  + G  ++Q  Y+VGL+ ++PT +CAL+N++PA+T++LAV   +EKL +R    
Sbjct  77    LQIFVLGLLGPVIDQNFYYVGLRLTSPTFSCALSNMLPAMTFVLAVICRMEKLHMRKVRC  136

Query  545   KAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHW-KYADHLSSQNKDNNGSTNAQPNFIL  721
             +AKV GT++ V GAML++ Y G  + +G     W K+AD     N     +     +++ 
Sbjct  137   QAKVAGTLVTVAGAMLMTLYKGPIMEMG-----WAKHADP-HQGNVPAAAADGTDKDWLK  190

Query  722   GPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWSL  901
             G   +I++ L+WA   I+Q    +KY AP S T+L+CFM ++Q +   +  +HKP+ W +
Sbjct  191   GCVFVIIATLAWASLFILQAATMKKYDAPLSLTSLICFMGTLQAIAVTLIMEHKPSVWRI  250

Query  902   RQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKIY  1081
                +   +A YAGIV +++AY + S  ++ +GP++ S F+PL+++IVA++   +L + IY
Sbjct  251   GFDMNLLAAAYAGIVTSSIAYYVQSLVMQDRGPVFASAFSPLMMIIVAIMGSFILAENIY  310

Query  1082  VGTIVGSVLIVVGLYGVLWGKQKE------------LQVIGVVHVDEEE----------A  1195
             +G +VG+VLIVVGLY VLWGK K+            L V G + +DE+E          A
Sbjct  311   LGGVVGAVLIVVGLYSVLWGKHKDNKEKKPEAMDIPLAVKGTMKLDEDELETSKANNSVA  370

Query  1196  RNEVETKEDH  1225
              N V+T ++ 
Sbjct  371   ENSVKTDKEE  380



>gb|EYU20823.1| hypothetical protein MIMGU_mgv1a008005mg [Erythranthe guttata]
Length=388

 Score =   266 bits (680),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 134/363 (37%), Positives = 234/363 (64%), Gaps = 12/363 (3%)
 Frame = +2

Query  179   IMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLS  358
             I MI +Q GYA MNII+K++++SGM+ +V V YR  FA+ AIAP A   ER++RP++T +
Sbjct  16    IAMICLQFGYAGMNIITKVSLNSGMSHYVLVVYRHAFATAAIAPFALLLERKVRPKITFT  75

Query  359   ILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTA  538
             I   +F+  + G  ++Q  Y+ GLK ++PT +CA++N++PA+T+++AV   +EK+ I+  
Sbjct  76    IFMQLFVLGLLGPVIDQNFYYAGLKYTSPTFSCAMSNMLPAMTFVMAVLCRMEKVDIKKV  135

Query  539   AGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFI  718
               +AKV+GT++ V GAML++ Y GH I     ++ W    H  S N + +   NA  +++
Sbjct  136   RCQAKVIGTVVTVAGAMLMTVYKGHVI-----NMFWSNYIHPRSNNNNPSTPQNADKDWL  190

Query  719   LGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWS  898
             +G  L+I++ L+WA + I+Q     KY A  S TA++CF+ ++Q +   +  +HK   W 
Sbjct  191   MGSILLILATLAWASFFILQAITLRKYTAQLSLTAIVCFLGTLQSIAVTLVMEHKTDAWK  250

Query  899   LRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKI  1078
             +   +   +A YAGIV +++AY +    ++K+GP++V+ F+PL+++IVA++   +L + I
Sbjct  251   IGFDMNLLAAAYAGIVSSSIAYYVQGLVMQKRGPVFVTAFSPLMMIIVAIMGSFILAENI  310

Query  1079  YVGTIVGSVLIVVGLYGVLWG------KQKELQVIGVVHVDEEEARNE-VETKEDHLEEL  1237
             Y+G ++G+VLIV+GLY VLWG      +++  ++  +V V + E +NE +E     ++  
Sbjct  311   YLGGVLGAVLIVIGLYSVLWGKYKEFKEKEAEEIQEIVKVGKGENQNEDIEANCGEIQRN  370

Query  1238  ELS  1246
             EL+
Sbjct  371   ELN  373



>emb|CDM84603.1| unnamed protein product [Triticum aestivum]
Length=387

 Score =   266 bits (679),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 130/327 (40%), Positives = 210/327 (64%), Gaps = 7/327 (2%)
 Frame = +2

Query  179   IMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLS  358
             I MI +Q GYA MN+I+K++++ GM+ +V V YR  FA+V+IAP A   ER++RP+MT S
Sbjct  15    IAMICLQFGYAGMNVITKVSLNGGMSHYVLVVYRHAFATVSIAPFALIFERKVRPKMTWS  74

Query  359   ILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTA  538
                 IF+ ++ G  ++Q  Y+VGLK + PT ACA++N++PA+T+++A  F +EK+ +R  
Sbjct  75    SFLQIFVLALLGPVIDQNFYYVGLKYTGPTFACAMSNILPAMTFVMAFIFRMEKVDLRKV  134

Query  539   AGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFI  718
               +AKV GT++ V GAML++ Y G         I   +  H      ++         + 
Sbjct  135   RCQAKVAGTVVTVAGAMLMTLYKG-------PLIRMAWTSHGQPHGGEDPAVDPTGREWF  187

Query  719   LGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWS  898
             LG   II++ L+WA   I+Q    ++Y AP S T L+CF+ ++Q ++  +  +H+P+ W+
Sbjct  188   LGSLFIIIATLAWASLFILQAHTLKQYSAPLSLTTLICFVGTLQAIVVTLAMEHRPSVWT  247

Query  899   LRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKI  1078
             +   +   +A YAGIV +++AY +    I+K GP++ S F+PL++++VAV+   +L +KI
Sbjct  248   IGFDMNLLAAAYAGIVTSSIAYYVQGLVIQKTGPVFASAFSPLMMIVVAVMGSFILSEKI  307

Query  1079  YVGTIVGSVLIVVGLYGVLWGKQKELQ  1159
             Y+G ++GSVLIV+GLY VLWGK KE Q
Sbjct  308   YLGGVLGSVLIVIGLYSVLWGKHKETQ  334



>gb|KEH36637.1| auxin-induced 5NG4-like protein [Medicago truncatula]
Length=363

 Score =   265 bits (677),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 123/351 (35%), Positives = 220/351 (63%), Gaps = 11/351 (3%)
 Frame = +2

Query  176   LIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTL  355
              ++MI + + +AV+NI+ K  +D GMN  V + YR   A++ +  I YF ER  RP +T 
Sbjct  10    FMIMIAIDISFAVVNILLKKVLDEGMNHLVFITYRLSIATIFVGSIGYFRERNSRPPLTF  69

Query  356   SILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRT  535
              IL  +F  ++ G S+ Q  + +G++ ++ T ACA  N++P VT+LLA+PFGIE + I+ 
Sbjct  70    RILCYLFFSAVVGASVTQYFFLLGIQYTSATFACAFVNMVPVVTFLLALPFGIETVNIKC  129

Query  536   AAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNF  715
              +G+AK+ GT++C+ GA++L+ Y G  +        + ++ H SS       +T     +
Sbjct  130   NSGRAKIFGTLVCIVGALMLTLYKGKGL--------FNFSHHESSVKL---AATRTPEKW  178

Query  716   ILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDW  895
              +G   +I+  L W+ W I+Q+++S++YP  YSSTA+M F  +IQ  +  +  DH  + W
Sbjct  179   TIGVIALILGTLFWSSWFILQSKISKRYPCQYSSTAIMSFFGAIQSAVICLFIDHDLSIW  238

Query  896   SLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDK  1075
              LR  I+  + +YAGI+G+ L +  MSWC++K+GP++ + F+P + ++ A++   +L ++
Sbjct  239   VLRGKIQIIAILYAGIIGSGLCFVGMSWCVKKRGPVFTAAFSPFVQIMAALIDIPVLHEQ  298

Query  1076  IYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHL  1228
             +Y+G+++GS+L+++GLY +LWGK KE++   ++  ++ E   E E +  HL
Sbjct  299   LYLGSVLGSILVMLGLYILLWGKSKEMKNRLIMLAEKAEETKEQEPQIQHL  349



>ref|XP_008378805.1| PREDICTED: WAT1-related protein At1g25270-like [Malus domestica]
Length=392

 Score =   266 bits (679),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 148/365 (41%), Positives = 226/365 (62%), Gaps = 19/365 (5%)
 Frame = +2

Query  167   LLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQ  346
             L  ++MM++VQ  Y VMNI  KL  + G N  + +AYR LF++  + P+A   ER+ RP+
Sbjct  11    LKPVMMMLVVQTAYVVMNIFYKLVAEVGTNFTILIAYRNLFSAALMLPLALTFERKSRPK  70

Query  347   MTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLM  526
             +TL IL + F+  + G +L Q  Y   L  ++ T   A +NL+P +T+++A+ F IE+L 
Sbjct  71    LTLDILVHGFISGLLGATLTQNFYIESLALTSATYVVACSNLVPVITFIIALCFRIERLA  130

Query  527   IRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHW-KYADHLSSQNKDNNGSTNA  703
             + T  G+AKVVGT+ C+GG ML +FY G +IGI  + ++  +   H +S+    +  T  
Sbjct  131   LGTHTGRAKVVGTLFCIGGTMLFTFYKGKHIGIWSTHVNLLRNYSHENSRVASLHRHTRT  190

Query  704   QPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHK  883
             Q    LG FL + S+ S+A W I QT++++KYP  YSSTALM  M+SIQ V FA+C +  
Sbjct  191   QS---LGSFLALCSSTSFASWLIFQTKMTKKYPCQYSSTALMSVMASIQSVAFALCKERD  247

Query  884   PTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGL  1063
              + W L   I+  +AVY+G+V T L   L +WC+  +GPL+VS+FNPL L+++A+ +  L
Sbjct  248   WSQWKLGWDIKLFTAVYSGVVTTGLVLTLTAWCVRMRGPLFVSIFNPLGLLLIALAATFL  307

Query  1064  LQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELEL  1243
             L +K+Y+G+I+G  LIV GLY VLWGK KE++++               T++     LE 
Sbjct  308   LNEKLYLGSILGGTLIVCGLYMVLWGKSKEMKMM---------------TQQTQQPPLED  352

Query  1244  SAHSI  1258
              +HSI
Sbjct  353   QSHSI  357



>ref|XP_010068191.1| PREDICTED: WAT1-related protein At1g68170-like [Eucalyptus grandis]
Length=393

 Score =   266 bits (679),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 144/327 (44%), Positives = 217/327 (66%), Gaps = 6/327 (2%)
 Frame = +2

Query  173   ALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMT  352
             A +MM++VQ+ +A +NI+ KLA   GMN  V +AYR +FA+  +AP+A F ER+ RP++T
Sbjct  3     AALMMVVVQVAFAGVNILYKLAASDGMNLSVVIAYRFMFATALLAPLALFLERKSRPKIT  62

Query  353   LSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIR  532
              ++L   F C +FG S+ Q  Y   L  ++ T A A+ NL+PAVT++LAV  G+EK+ +R
Sbjct  63    WTVLVQAFFCGLFGGSMGQNLYLASLSMTSATYASAMANLVPAVTFVLAVFLGLEKVRVR  122

Query  533   TAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPN  712
             T AGKAK  GT++ +GGAMLL+FY G  + +   S H     H+++  +   GS++    
Sbjct  123   TVAGKAKAAGTLMGIGGAMLLTFYKGAEVNLW--STHVNLLRHVAATQRGQEGSSDLLLG  180

Query  713   FILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTD  892
              +L     + S   +A W IIQ ++SE +P  Y+STALM FM SIQ  ++A+C +   + 
Sbjct  181   SLLA----VASCFCYASWLIIQAKMSEGFPHQYTSTALMTFMGSIQAAVYALCRERDWSQ  236

Query  893   WSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQD  1072
             W L   IR  +  Y+GIV +AL Y L++WC+  +GP++VS+FNPL+LV VA+    +L +
Sbjct  237   WKLGWNIRLLTVSYSGIVASALCYTLIAWCVRMRGPVFVSIFNPLMLVTVALAGSMVLDE  296

Query  1073  KIYVGTIVGSVLIVVGLYGVLWGKQKE  1153
             K+++G+I+GS LIV+GLY VLWGK+KE
Sbjct  297   KLHMGSILGSGLIVLGLYAVLWGKRKE  323



>ref|XP_007041587.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOX97418.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
isoform 1 [Theobroma cacao]
Length=481

 Score =   268 bits (686),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 140/341 (41%), Positives = 213/341 (62%), Gaps = 7/341 (2%)
 Frame = +2

Query  179   IMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLS  358
             ++M++VQ  +A MN++ KLA + GM+  +  AYR +FA   + P+A   ER+ RP++T +
Sbjct  15    MVMVVVQTTFAGMNLLYKLAANDGMSLRIITAYRFVFAVPVMVPLALLVERK-RPKLTWA  73

Query  359   ILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTA  538
             ILF  FLC +FG +L+Q  Y   L  ++ T   A+TNLIP  T++LAV   +EKL   T 
Sbjct  74    ILFQAFLCGLFGGALSQNLYIASLALTSATFVSAMTNLIPVTTFILAVFLRMEKLAFGTM  133

Query  539   AGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFI  718
             AGKAKV+GT++ +GGAMLL+FY G  I +      W     L         S +A  + +
Sbjct  134   AGKAKVLGTLIGIGGAMLLTFYKGVQIKM------WSTHIDLVHHGGHGASSHSASAHIL  187

Query  719   LGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWS  898
              G  L   S +++ +W I+Q ++S+KYP PYS+TALMC M +IQ +++A+C +   + W 
Sbjct  188   WGALLAFTSCITYTLWLIVQAKMSKKYPCPYSTTALMCVMGAIQSIVYALCTERDWSQWK  247

Query  899   LRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKI  1078
             L   +R  +  YAGIV + L   ++ WC+  KGPLY S+FNPL++V+VA+     L  K+
Sbjct  248   LGWNVRLLTVAYAGIVVSGLTCVMVCWCVRIKGPLYGSIFNPLMVVLVALAETLFLGAKL  307

Query  1079  YVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARN  1201
             Y+G+I+G+VLIV+GLY VLWGK KE++ +     +    R+
Sbjct  308   YLGSILGAVLIVLGLYVVLWGKGKEMEKVAAPSKEGPSTRS  348



>ref|XP_006349811.1| PREDICTED: WAT1-related protein At3g30340-like [Solanum tuberosum]
Length=360

 Score =   265 bits (676),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 125/334 (37%), Positives = 213/334 (64%), Gaps = 7/334 (2%)
 Frame = +2

Query  161   VDLLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIR  340
             V+   +I+M+ +    ++ NI+ K  +  GMN FV + YRQ  ++V +AP+A+F ER  R
Sbjct  5     VEWYPIIIMLAIDFALSICNILLKKIIMDGMNHFVFITYRQSISTVFLAPVAFFFERNKR  64

Query  341   PQMTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEK  520
             P++T  ILF +FL +I G SL Q  + +G++ ++ T ACA  N++P VT+L+A+ FG+E 
Sbjct  65    PKLTPQILFYLFLSAIVGASLTQYLFLLGIQYTSATFACAFLNMVPVVTFLMALLFGLET  124

Query  521   LMIRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTN  700
               I+  +G+AKV+GT++C+GGA LL+FY G  +      IH+ +   LS   ++   S+ 
Sbjct  125   TNIKDRSGRAKVIGTLICLGGAFLLTFYKGKPL------IHFSHFKDLSQTLEEPISSSK  178

Query  701   AQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDH  880
                 +I G  ++    + W+ W +IQ ++ +KYP  YSST +M F S+IQ  +     D 
Sbjct  179   RNVQWIFGSMILFAGTILWSSWFLIQAKIGKKYPCQYSSTVIMTFFSAIQSAILTFSTDR  238

Query  881   KPTDWSLRQG-IRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSW  1057
               + W  ++  I   S VY G++G+ L +  MSWC++K+GP++ + F+PL+ V+ AVL  
Sbjct  239   TLSIWIPKEKIIDMLSVVYTGLIGSGLCFVGMSWCVKKRGPVFTAAFSPLIQVMAAVLDV  298

Query  1058  GLLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQ  1159
              +L +++++G+++GSV++++GLY +LWGK KE+Q
Sbjct  299   PILHEQLHLGSVIGSVIVILGLYFLLWGKAKEMQ  332



>ref|NP_001130743.1| hypothetical protein [Zea mays]
 gb|ACF79083.1| unknown [Zea mays]
 gb|ACR38032.1| unknown [Zea mays]
 tpg|DAA36757.1| TPA: hypothetical protein ZEAMMB73_680552 [Zea mays]
Length=378

 Score =   265 bits (677),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 141/316 (45%), Positives = 206/316 (65%), Gaps = 7/316 (2%)
 Frame = +2

Query  209   AVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLSILFNIFLCSI  388
             A +NI  KLA+  GM+  V VAYR LFAS  +AP+AYF ER+ R ++T  +L   FLC +
Sbjct  20    AGVNIFYKLAVLDGMDMRVLVAYRYLFASAFLAPLAYFIERKRRTKLTWRVLVISFLCGL  79

Query  389   FGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTAAGKAKVVGTI  568
              G SL Q  Y  G+K ++ T A A TNLIP VT++LA+ F  E+L +R ++G+AKV GT+
Sbjct  80    TGGSLAQNLYISGMKLTSATFASATTNLIPGVTFVLALIFRYERLAVRASSGQAKVAGTL  139

Query  569   LCVGGAMLLSFYHGHNIGIGESSIHW-KYADHLSSQNKDNNGSTNAQPNFILGPFLIIVS  745
             L V GAMLL+FY G +I        W  + + ++S +  +     A  N ++G  L I S
Sbjct  140   LGVAGAMLLTFYKGADI------TPWHTHVNLVASSSAHHAADEAADANRVMGSLLCIAS  193

Query  746   ALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWSLRQGIRATS  925
              + +A+W I+Q  +S  YP  YSSTALMC MS++Q V  A+  D  P  W L   +R  +
Sbjct  194   CVFYALWLILQANLSRDYPFHYSSTALMCVMSTLQSVALALWADRDPARWRLGLDVRLLA  253

Query  926   AVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKIYVGTIVGSV  1105
             + Y+G++ + +   ++SWC+ K+GPL+ SVFNPL+L++VA+LS  LL +++Y+G+ +G+V
Sbjct  254   SAYSGVLASGVMLVVLSWCVRKRGPLFASVFNPLMLLLVAILSSLLLGERLYLGSALGAV  313

Query  1106  LIVVGLYGVLWGKQKE  1153
             LIV GLY VLWGK +E
Sbjct  314   LIVGGLYAVLWGKGRE  329



>ref|XP_008239274.1| PREDICTED: WAT1-related protein At3g30340-like [Prunus mume]
Length=367

 Score =   265 bits (676),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 119/360 (33%), Positives = 224/360 (62%), Gaps = 8/360 (2%)
 Frame = +2

Query  176   LIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTL  355
              I M+ +   +A++NI+ K  +D GMN  V + YR   +++ +API+YF ER  RP++TL
Sbjct  13    FIAMVAIDFCFAIVNILLKKVLDEGMNHLVLITYRLTISTIFLAPISYFRERTSRPKLTL  72

Query  356   SILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRT  535
              ILF +FL +I G S+ Q  + +G++ ++ T ACA  N++P +T+++A+PFG+E++ ++ 
Sbjct  73    RILFFLFLSAIVGTSITQYFFLLGIQYTSATFACAFINMVPMITFIMALPFGLERVNLKC  132

Query  536   AAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNF  715
              +G+AKV+GT++C+GGA +L+ Y G  +     +   +  DH +  +   N     +  +
Sbjct  133   NSGRAKVIGTLVCIGGAFMLTLYKGAPLFDHSKTTTTQAMDHGTKLSHIRN-----KERW  187

Query  716   ILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDW  895
              +G   ++V  L W+ W ++Q+ +S+ YP  YSST +M F  +IQ  +   C     + W
Sbjct  188   TIGSIALVVGTLLWSSWFLVQSNISKMYPCQYSSTTIMTFFGAIQSAILGFCTGRNLSMW  247

Query  896   SLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDK  1075
              LR   +  + +++G++ + L +  MSWC++K+GP++ + F+PL+ ++ A++   +  ++
Sbjct  248   VLRGRTQVITVLFSGMIASGLGFVGMSWCVKKRGPVFTAAFSPLVQILAALIGIPIFHEQ  307

Query  1076  IYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELELSAHS  1255
             +++G+++GSV++++GLY +LWGK+KE+Q      V E +A  E   +E HL  + +S  S
Sbjct  308   LHLGSLLGSVIVIIGLYILLWGKKKEMQKCVTKLVQETDAIKE---QEPHLPAIAVSIDS  364



>ref|NP_001242267.1| uncharacterized protein LOC100811617 [Glycine max]
 gb|ACU19947.1| unknown [Glycine max]
Length=393

 Score =   266 bits (679),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 133/344 (39%), Positives = 222/344 (65%), Gaps = 13/344 (4%)
 Frame = +2

Query  179   IMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLS  358
             I MI +Q G+A MNII+K++++ GM+ +V V YR  FA+ AIAP A   ER++RP++T  
Sbjct  18    IAMISLQFGFAGMNIITKVSLNRGMSHYVLVVYRHAFATAAIAPFAIVLERKVRPKITFL  77

Query  359   ILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTA  538
             +   IF+  + G  ++Q  Y+ GLK ++PT +CA++N++PA T+++A  F +EKL +R  
Sbjct  78    MFMQIFVLGLLGPVIDQNLYYAGLKFTSPTYSCAISNMLPATTFVMAAIFRMEKLNVRKV  137

Query  539   AGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFI  718
               +AKV+GT++ V GAML++ Y G  I    S +  KY  H  +   +NN + + + ++ 
Sbjct  138   RCQAKVIGTVVTVAGAMLMTLYKGQVI----SFLGSKYMHHPRNYVPENN-TDSGEKDWF  192

Query  719   LGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWS  898
              G  L++++ LSWA + I+Q     KYPA  S TAL+C + ++Q +      +HKP+ W+
Sbjct  193   KGSVLLVLATLSWASFFILQAVTLRKYPAQLSLTALVCALGTLQSIAVTFVMEHKPSVWT  252

Query  899   LRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKI  1078
             +   +   +A YAGI+ + +AY +    ++KKGP++V+ F+PL+++IVA++   +L +KI
Sbjct  253   IGWDMNLLAAAYAGIISSGIAYYVQGIVMQKKGPVFVTAFSPLMMIIVAIMGTFILAEKI  312

Query  1079  YVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVE  1210
             Y+G ++G++LIV+GLY VLWGK KE +        E+EA   +E
Sbjct  313   YLGGVIGAILIVMGLYSVLWGKHKENK--------EKEAEITIE  348



>ref|XP_003547068.1| PREDICTED: WAT1-related protein At1g68170-like [Glycine max]
 gb|KHN33487.1| Auxin-induced protein 5NG4-like protein [Glycine soja]
Length=414

 Score =   266 bits (680),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 134/331 (40%), Positives = 213/331 (64%), Gaps = 4/331 (1%)
 Frame = +2

Query  167   LLALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQ  346
             L  +++M++VQ+  A +N++ KLA++ GMN  V VAYR +FA+  IAP+A+  ER+ R +
Sbjct  10    LKPVMLMVLVQVANAWVNVLYKLALNDGMNLSVIVAYRYVFATAFIAPLAFILERKTRTK  69

Query  347   MTLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLM  526
             MT  ILF  FLC + G  L Q      +  ++ T   A++NLIPA+T+++++ FG+E+L 
Sbjct  70    MTWRILFQAFLCGLIGGVLPQNLNMEAIALTSVTFTTAISNLIPAITFIISLSFGLERLN  129

Query  527   IRTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQ  706
             ++T  GKAK++GTI  + GAM+L+F  G  + +   S H    +H +     ++ S+   
Sbjct  130   LKTKGGKAKIIGTITGISGAMILTFIKGPEVKM--LSFHVNLFNHQNGHVVHSHASSGLM  187

Query  707   PNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKP  886
                I G    + S +S+A+W IIQ ++SE+YP PYSSTALM  M ++  + FA C +   
Sbjct  188   T--IFGALASVASNVSYAMWLIIQAKMSERYPCPYSSTALMSLMGALLSISFAFCVERDL  245

Query  887   TDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLL  1066
             + W L   +R  +  YAGIV + +   ++SWC+  +GPL+VSVF+PL+LV+VA     +L
Sbjct  246   SQWRLDWNVRLLTVAYAGIVVSGVMVAVISWCVRTRGPLFVSVFSPLMLVVVAFAGSTIL  305

Query  1067  QDKIYVGTIVGSVLIVVGLYGVLWGKQKELQ  1159
              +K+Y+G+ +GS+LI+ GLY VLWGK KE++
Sbjct  306   DEKLYLGSFIGSMLIICGLYAVLWGKSKEMK  336



>ref|XP_009373697.1| PREDICTED: WAT1-related protein At3g30340-like [Pyrus x bretschneideri]
Length=368

 Score =   265 bits (676),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 121/364 (33%), Positives = 221/364 (61%), Gaps = 15/364 (4%)
 Frame = +2

Query  176   LIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTL  355
              I+MI +   +A++NI+ K  +D GMN  V + YR   +++ +API+YF ER  RP++TL
Sbjct  13    FIVMIAIDFSFAIVNILLKKVLDEGMNHLVLITYRLTISTIFLAPISYFGERNTRPKLTL  72

Query  356   SILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRT  535
              I   +FL +I G SL Q  + +G++ ++ T ACA  N++P +T+++A+PFG+E +  + 
Sbjct  73    RIACFLFLSAILGTSLTQYFFLLGIQYTSATFACAFVNMVPVITFIVALPFGLETVNFKC  132

Query  536   AAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNG----STNA  703
              +G+AKV G ++C+GGA++L+ + G  +        + Y+   +S    ++G    ST  
Sbjct  133   NSGRAKVFGAVVCIGGALILTLFKGVPL--------FDYSKSTTSTQAKDHGIHLSSTRN  184

Query  704   QPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHK  883
                + +G   ++   L W+ W ++QT +S+ YP  YSST +M F  +IQ  +  +C    
Sbjct  185   HERWTVGSIALVGGTLLWSSWFLVQTNISKMYPCQYSSTTIMNFFGAIQSAILGVCTGRN  244

Query  884   PTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGL  1063
              + W LR   +  + +++G++ + L +  MSWC+ K+GP++ + F+PL+ ++ A++S  +
Sbjct  245   LSMWVLRGRTQVITVLFSGMIASGLGFVGMSWCVRKRGPVFTAAFSPLVQIMAAIISIPI  304

Query  1064  LQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELEL  1243
               +++++G+++GSV+++ GLY +LWGK+KE+Q      V E EA  E   +E HL  + +
Sbjct  305   FHERLHLGSLLGSVIVIAGLYILLWGKKKEMQKCATKLVQESEAIKE---QESHLPAITV  361

Query  1244  SAHS  1255
             S  S
Sbjct  362   SVDS  365



>dbj|BAK02715.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=391

 Score =   265 bits (678),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 130/327 (40%), Positives = 211/327 (65%), Gaps = 7/327 (2%)
 Frame = +2

Query  179   IMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLS  358
             I MI +Q GYA MN+I+K++++ GM+ +V V YR +FA+V+IAP A   ER++RP+MT S
Sbjct  19    IAMICLQFGYAGMNVITKVSLNGGMSHYVLVVYRHVFATVSIAPFALILERKVRPKMTWS  78

Query  359   ILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTA  538
                 IF+ ++ G  ++Q  Y+VGLK + PT ACA++N++PA+T+++A  F +EK+ +R  
Sbjct  79    SFLQIFVLALLGPVIDQNFYYVGLKYTGPTFACAMSNILPAMTFVMAFIFRMEKVDLRKV  138

Query  539   AGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFI  718
               +AKV GT++ V GAML++ Y G         +   + +H  +   +          + 
Sbjct  139   RCQAKVAGTVVTVAGAMLMTLYKG-------PLMRMAWTNHGQANGGEAPAIDPTGREWF  191

Query  719   LGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWS  898
             LG   II++ L+WA   I+Q    ++Y AP S T L+CF+ ++Q ++     +H+P+ W+
Sbjct  192   LGSLFIIIATLAWASLFILQAHTLKQYSAPLSLTTLICFVGTLQAIVVTFAMEHRPSVWT  251

Query  899   LRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKI  1078
             +   +   +A YAGIV +++AY +    I+K GP++ S F+PL++++VAV+   +L +KI
Sbjct  252   IGFDMNLLAAAYAGIVTSSIAYYVQGLVIQKTGPVFASAFSPLMMIVVAVMGSFILSEKI  311

Query  1079  YVGTIVGSVLIVVGLYGVLWGKQKELQ  1159
             Y+G I+GSVLIV+GLY VLWGK KE Q
Sbjct  312   YLGGILGSVLIVIGLYSVLWGKHKETQ  338



>ref|XP_003581230.2| PREDICTED: WAT1-related protein At1g68170 [Brachypodium distachyon]
Length=389

 Score =   265 bits (677),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 140/355 (39%), Positives = 219/355 (62%), Gaps = 9/355 (3%)
 Frame = +2

Query  185   MIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLSIL  364
             M+ +Q+ +AV+ I  KLA++ GM+  V VAYR +FA+  + P+A+  ER+ RP +T+ ++
Sbjct  27    MVGLQVLFAVLQIFFKLALNDGMDARVLVAYRFMFAAAVLCPVAFLVERKKRPPLTMKVV  86

Query  365   FNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTAAG  544
               +FLC +FGI++NQ  Y + +K ++ T   A+ NL PA T+LLA+   +E L +R  AG
Sbjct  87    QYLFLCGLFGIAINQNLYVLAIKLTSATFVTAIANLAPATTFLLAILTRLETLKLRNPAG  146

Query  545   KAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFILG  724
             +AK+VGT++ +GGAMLL+FY G  + +       +      + +  +  ST  Q   ILG
Sbjct  147   QAKLVGTLVGMGGAMLLTFYKGTELTLLRRLPRPRLVHITEAHHHSHPPSTGNQ---ILG  203

Query  725   PFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWSLR  904
              FL I+S  S+A W +IQ +V E YP  YS  A++C   ++Q  + A+C       W L 
Sbjct  204   SFLGIMSCFSYAAWVVIQAKVGEDYPCHYSIAAMVCLFGALQSTVVAVCVHRDMAHWRLG  263

Query  905   QGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKIYV  1084
               IR  S+ YAG++ +  A+ L+SWC+ KKGPL+++VF+PL+L+ VAV+S  +L + +Y+
Sbjct  264   LNIRLYSSAYAGLIASGSAFPLLSWCLRKKGPLFIAVFSPLMLIFVAVMSSIVLDEPLYL  323

Query  1085  GTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEV---ETKEDHLEELE  1240
             G+ +GS+LIV GLY VLWGK KE      V  DE+  +  +    T E  + + E
Sbjct  324   GSGLGSILIVCGLYLVLWGKAKEQT---DVSKDEDLGKESIPVTATSESGVRQGE  375



>ref|XP_008788718.1| PREDICTED: WAT1-related protein At3g30340 [Phoenix dactylifera]
Length=345

 Score =   263 bits (673),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 128/336 (38%), Positives = 213/336 (63%), Gaps = 6/336 (2%)
 Frame = +2

Query  179   IMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLS  358
             + M+ V +  A MN + K  +D GMN  V +  RQL A++ +APIA+F ER+ RP++T+ 
Sbjct  11    LAMLGVAVSLAAMNTMIKSVIDEGMNRLVLITLRQLVATLFMAPIAHFRERKTRPKLTVE  70

Query  359   ILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTA  538
                 +F  ++FG SL Q  +F+GLK +T T ACA  N+ P  T+LLA+PF +E L ++T 
Sbjct  71    SFVYLFFSALFGASLTQYLFFLGLKYTTATFACAFLNMAPVFTFLLALPFRLETLDVKTR  130

Query  539   AGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFI  718
             AG AK++G I+C+ GAMLL+FY G  + +  +S H   A   S Q + ++ +  +   +I
Sbjct  131   AGTAKLLGAIICLSGAMLLTFYKG--VALTNTS-HQPVA---SEQQEGHSTAGYSTKKWI  184

Query  719   LGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWS  898
             +G    +   L+W+ W +IQ++V++KYP+ YS TAL+ F+S +Q  +  +  +   + W+
Sbjct  185   MGSIAYLAGCLTWSSWFLIQSKVAKKYPSLYSGTALIFFLSFLQAAVLTLATERSFSVWA  244

Query  899   LRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKI  1078
             L++ +   + + AGI G+   +  MSWC+EK+GP++ + F PL+ +IVA + + +L + +
Sbjct  245   LQRKLEIITVIVAGIAGSGFGFLAMSWCVEKRGPVFTAAFTPLVQIIVAGIDFSILHEPL  304

Query  1079  YVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDE  1186
             Y+G+++GSVL++ GLY +LWGK KE        V+E
Sbjct  305   YLGSVLGSVLVIAGLYFLLWGKSKEASSSAGKTVEE  340



>ref|XP_006604312.1| PREDICTED: WAT1-related protein At5g07050-like [Glycine max]
 gb|KHN08914.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=392

 Score =   265 bits (677),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 134/344 (39%), Positives = 221/344 (64%), Gaps = 13/344 (4%)
 Frame = +2

Query  179   IMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLS  358
             I M+ +Q G+A MNII+K++++ GM+ +V V YR  FA+ AIAP A   ER++RP+MT  
Sbjct  18    IAMVSLQFGFAGMNIITKVSLNRGMSHYVLVVYRHAFATAAIAPFAIVLERKVRPKMTFL  77

Query  359   ILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTA  538
             +   IF+  + G  ++Q  Y+ GLK ++PT +CA++N++PA+T+++A  F +EKL +R  
Sbjct  78    MFMQIFVLGLLGPVIDQNLYYAGLKFTSPTYSCAISNILPAMTFVMAAIFRMEKLDMRKV  137

Query  539   AGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFI  718
               +AKV+GTI+ V GAML++ Y G  I    S +  KY  H  +   +N  + + + ++ 
Sbjct  138   RCQAKVIGTIVTVAGAMLMTLYKGQVI----SFLGSKYMHHPRNYVPENT-TDSGEKDWF  192

Query  719   LGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWS  898
              G  L+I++ LSWA + I+Q     KYPA  S TAL+C + ++Q +      +HKP+ W+
Sbjct  193   KGSILLILATLSWASFFILQAVTLRKYPAQLSLTALVCALGTLQSIAVTFVMEHKPSVWT  252

Query  899   LRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKI  1078
             +   +   +A YAGI+ + + Y +    ++KKGP++V+ F+PL+++IVA++   +L +KI
Sbjct  253   IGWDMNLLAAAYAGIISSGITYYVQGIVMQKKGPVFVTAFSPLMMIIVAIMGAFILAEKI  312

Query  1079  YVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVE  1210
             Y+G +VG++LIV+GLY VLWGK KE +        E+EA   +E
Sbjct  313   YLGGVVGAILIVMGLYSVLWGKHKENK--------EKEAETTME  348



>gb|AFK33485.1| unknown [Medicago truncatula]
Length=363

 Score =   264 bits (674),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/351 (35%), Positives = 219/351 (62%), Gaps = 11/351 (3%)
 Frame = +2

Query  176   LIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTL  355
              ++MI + + +AV+NI+ K  +D GMN  V + YR   A++ +  I YF ER  RP +T 
Sbjct  10    FMIMIAIDISFAVVNILLKKVLDEGMNHLVFITYRLSIATIFVGSIGYFRERNSRPPLTF  69

Query  356   SILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRT  535
              IL  +F  ++ G S+ Q  + +G++ ++ T ACA  N++P VT+LLA+PFGIE + I+ 
Sbjct  70    RILCYLFFSAVVGASVTQYFFLLGIQYTSATFACAFVNMVPVVTFLLALPFGIETVNIKC  129

Query  536   AAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNF  715
              +G+AK+ GT++C+ GA++L+ Y G  +        + ++ H SS       +T     +
Sbjct  130   NSGRAKIFGTLVCIVGALMLTLYKGKGL--------FNFSHHESSVKL---AATRTPEKW  178

Query  716   ILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDW  895
              +G   +I+  L W+ W I+Q+++S++YP  YSSTA+M F  +IQ  +  +  DH  + W
Sbjct  179   TIGVIALILGTLFWSSWFILQSKISKRYPCQYSSTAIMSFFGAIQSAVICLFIDHDLSIW  238

Query  896   SLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDK  1075
              LR  I+  + +YAGI G+ L +  MSWC++K+GP++ + F+P + ++ A++   +L ++
Sbjct  239   VLRGKIQIIAILYAGITGSGLCFVGMSWCVKKRGPVFTAAFSPFVQIMAALIDIPVLHEQ  298

Query  1076  IYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHL  1228
             +Y+G+++GS+L+++GLY +LWGK KE++   ++  ++ E   E E +  HL
Sbjct  299   LYLGSVLGSILVMLGLYILLWGKSKEMKNRLIMLAEKAEETKEQEPQIQHL  349



>ref|XP_006444680.1| hypothetical protein CICLE_v10023809mg [Citrus clementina]
 gb|ESR57920.1| hypothetical protein CICLE_v10023809mg [Citrus clementina]
Length=362

 Score =   264 bits (674),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 122/352 (35%), Positives = 214/352 (61%), Gaps = 4/352 (1%)
 Frame = +2

Query  170   LALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQM  349
             + ++MM+ V  G+A +N   +  +D G+N  V VAYRQ  + V +API YF ER+ RP++
Sbjct  8     MPVLMMVAVNFGFATVNAFLRKIIDRGLNHLVIVAYRQSISVVFLAPIVYFRERKNRPKL  67

Query  350   TLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMI  529
             T+ IL  +F  ++ G++L Q     GL+ ++ T  CA  N +P +T+LLA+PFG+EK+ +
Sbjct  68    TIHILCQLFFSALIGLTLTQYFLLRGLEYTSATFLCAFLNTVPVITFLLALPFGLEKVNV  127

Query  530   RTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQP  709
                AGK KV+GT++CVGGA+LL+ Y G  I    S+ H    ++  + +     S+    
Sbjct  128   NGLAGKTKVLGTVVCVGGAVLLTLYKGKLI----SNPHLPATNYNVTSHAKMMISSKKTE  183

Query  710   NFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPT  889
              +I+G   +I    +W+ W ++Q R+ +++P  YSST ++ F  +IQ  + ++  +    
Sbjct  184   RWIIGSIFLIAGCTTWSSWFLMQARIGKRFPCQYSSTTIISFFGAIQSAILSLIIERNLP  243

Query  890   DWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQ  1069
              W L+  +     +Y G+VG+ L Y  MSWC++K+GP++ S F+PL  ++VA+  + +L+
Sbjct  244   GWVLKGKLETIGVIYCGMVGSGLCYVGMSWCVKKRGPVFTSAFSPLTQIVVAIFDFSVLR  303

Query  1070  DKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDH  1225
             ++IY+G+ +GS+L++VG+Y +LWGK KE++    +   +   ++E      H
Sbjct  304   ERIYLGSALGSILVIVGMYILLWGKSKEIEEFDQMKQGQAAQQDERCDAASH  355



>ref|XP_006491488.1| PREDICTED: WAT1-related protein At3g30340-like [Citrus sinensis]
 gb|KDO86675.1| hypothetical protein CISIN_1g041425mg [Citrus sinensis]
Length=366

 Score =   264 bits (674),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 122/353 (35%), Positives = 215/353 (61%), Gaps = 4/353 (1%)
 Frame = +2

Query  170   LALIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQM  349
             + ++MM+ V  G+A +N   +  +D G+N  V VAYRQ  + V +API YF ER+ RP++
Sbjct  8     MPVLMMVAVNFGFATVNAFLRKIIDRGLNHLVIVAYRQSISVVFLAPIVYFRERKNRPKL  67

Query  350   TLSILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMI  529
             T+ IL  +F  ++ G++L Q     GL+ ++ T  CA  N +P +T+LLA+PFG+EK+ +
Sbjct  68    TIHILCQLFFSALIGLTLTQYFLLRGLEYTSATFLCAFLNTVPVITFLLALPFGLEKVNV  127

Query  530   RTAAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQP  709
                AGK KV+GT++CVGGA+LL+ Y G  I    S+ H    ++  + +     S+    
Sbjct  128   NGLAGKTKVLGTVVCVGGAVLLTLYKGKLI----SNPHLPATNYNVTSHAKMMISSKKTE  183

Query  710   NFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPT  889
              +I+G   +I    +W+ W ++Q R+ +++P  YSST ++ F  +IQ  + ++  +    
Sbjct  184   RWIIGSIFLIAGCTTWSSWFLMQARIGKRFPCQYSSTTIISFFGAIQSAILSLIIERNLP  243

Query  890   DWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQ  1069
              W L+  +     +Y G+VG+ L Y  MSWC++K+GP++ S F+PL  ++VA+  + +L+
Sbjct  244   GWVLKGKLETIGVIYCGMVGSGLCYVGMSWCVKKRGPVFTSAFSPLTQIVVAIFDFSVLR  303

Query  1070  DKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHL  1228
             ++IY+G+ +GS+L++VG+Y +LWGK KE++    +   +   ++E      H+
Sbjct  304   ERIYLGSALGSILVIVGMYILLWGKSKEIEEFDQMKQGQAAQQDERCDAASHV  356



>gb|ADE76940.1| unknown [Picea sitchensis]
Length=371

 Score =   264 bits (675),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 144/347 (41%), Positives = 207/347 (60%), Gaps = 22/347 (6%)
 Frame = +2

Query  179   IMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLS  358
             I  + VQ+ YA MNII+++A+  GMN FV V YRQ+ A++ IAP+AY  ER  RP +T S
Sbjct  15    IAQVAVQVAYAGMNIITRVALVDGMNNFVFVTYRQIVATLVIAPLAYVLEREQRPPLTRS  74

Query  359   ILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTA  538
             I   IFL ++ GI++NQ  YF GL  +  T A A TNLIP VT+++A     EK+ IR  
Sbjct  75    IFLQIFLLALCGITVNQNLYFAGLYYTNSTFASATTNLIPVVTFVMATVLRYEKVEIRKM  134

Query  539   AGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFI  718
              GKAKVVGT +CVGGAM+++ Y G  I +            L++ N   N +       +
Sbjct  135   RGKAKVVGTTICVGGAMVITLYKGPVIKL------------LTAYNSTANYNNILGSKRV  182

Query  719   LGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQC-VLFAICFDHKPTDW  895
             LG  L+  S  +W+ W   Q  V++KYPA  S TALMC + ++Q  VL  IC    P+ W
Sbjct  183   LGCILLFASVFTWSSWITFQVPVAKKYPAELSLTALMCMLGAVQSGVLAFICEYKTPSVW  242

Query  896   SLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDK  1075
             S+   I   S VY G++ +A A+ + +WC+  KGP++ ++FNPL  ++VA+L   +  D 
Sbjct  243   SISWNIEPLSYVYTGVLCSAFAFFVQTWCVHTKGPVFAAIFNPLSTILVALLECLVFHDN  302

Query  1076  IYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETK  1216
             ++ G++VG+VLIV GLY VLWGK K+         +E + R E E +
Sbjct  303   LHAGSVVGAVLIVGGLYSVLWGKAKD---------NEIDQRGESEAE  340



>gb|KHN33488.1| Auxin-induced protein 5NG4-like protein [Glycine soja]
Length=406

 Score =   265 bits (677),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 147/347 (42%), Positives = 225/347 (65%), Gaps = 10/347 (3%)
 Frame = +2

Query  185   MIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLSIL  364
             M++VQ+ +A +N+  KLA++ GM+  V VAYR +FA+V IAP+A   ER+ R +MT ++L
Sbjct  1     MVMVQITFAGVNVFYKLAVNDGMSLRVVVAYRFVFATVFIAPLALIVERKKRTKMTWTVL  60

Query  365   FNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTAAG  544
             F  FLC +FG SL Q  Y   L  ++ T A A++NL+P +T++LAV FG+E+L + TAAG
Sbjct  61    FQSFLCGLFGGSLAQNFYLQALALTSATFASAMSNLLPGITFILAVCFGLERLNLTTAAG  120

Query  545   KAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQ--PNFI  718
             KAK+VGT++ +GGAM+L+F  G  I +G        + HL+  +  N    +A    + +
Sbjct  121   KAKIVGTLIGIGGAMVLTFVKGEEIELG--------SFHLNLLHPPNGTHAHATTGADTL  172

Query  719   LGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWS  898
             LG    + S +S+A+W IIQ ++ E+YP+PYSSTALM    S+  ++FA+C +   + W 
Sbjct  173   LGSLCALGSGISYALWLIIQAKMIERYPSPYSSTALMSLWGSLLSIVFALCVERDWSQWR  232

Query  899   LRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKI  1078
             L   IR  +A Y GIV + +   ++SWC+  +GPL+VSVF+PL+LV+VA+    +L +K+
Sbjct  233   LGWNIRLLTAAYTGIVVSGVMVVVISWCVHMRGPLFVSVFSPLMLVMVALAGPTMLNEKL  292

Query  1079  YVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKE  1219
             ++G  +G+VLIV GLY VLWGK KE++    +   +    NE  T E
Sbjct  293   HLGCAIGTVLIVCGLYVVLWGKSKEMKKKNQLVPAQSPHDNESNTVE  339



>ref|XP_003572196.1| PREDICTED: WAT1-related protein At1g09380-like [Brachypodium 
distachyon]
Length=329

 Score =   262 bits (670),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 131/327 (40%), Positives = 223/327 (68%), Gaps = 5/327 (2%)
 Frame = +2

Query  179   IMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLS  358
             + M++VQ+G+A MN++SK+A+D+GM+P+V V YR L A+V ++P A + ER +   MT  
Sbjct  7     VAMLLVQIGFAGMNLLSKMALDNGMSPYVLVTYRSLIAAVFLSPFAVYFERNMWILMTKK  66

Query  359   ILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTA  538
             ++  IFL S  G++L+++ +F G + ++ T+A A+ N++PA+T+++A    +E + ++TA
Sbjct  67    VIIQIFLSSSLGMTLSEVLFFTGFRWTSATVAVAIGNIVPALTFVIAAALKMETVQLKTA  126

Query  539   AGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFI  718
             AG+AKV+GT +CVGG+M++  Y G  + +  S IHW+YA+H ++       ++ A     
Sbjct  127   AGQAKVMGTAVCVGGSMIMPIYKGPLLKVWASPIHWRYAEHAAAAAAAPTPASAA-----  181

Query  719   LGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWS  898
             LG  LII+S +SWA W ++  + SE + APY+S+ +M  +   +    +   D     W 
Sbjct  182   LGDVLIILSCVSWAAWLVMTNKTSESFSAPYTSSTIMSLIVGAESAAVSAAVDRSLWAWK  241

Query  899   LRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKI  1078
             L  GIR  S +Y GI+G  + + +M+WC++ +GPL+VS+FNP++LV+VA+L W  L +++
Sbjct  242   LGLGIRLYSVLYMGIIGWGVTFAVMTWCVQTRGPLFVSMFNPVVLVVVALLGWAFLDEQL  301

Query  1079  YVGTIVGSVLIVVGLYGVLWGKQKELQ  1159
             ++G+++G+VLIVVGLY VLWGK+KE+ 
Sbjct  302   HLGSVIGAVLIVVGLYMVLWGKRKEID  328



>gb|EMS48876.1| Auxin-induced protein 5NG4 [Triticum urartu]
Length=389

 Score =   264 bits (675),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 133/331 (40%), Positives = 214/331 (65%), Gaps = 11/331 (3%)
 Frame = +2

Query  179   IMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLS  358
             I MI +Q GYA MN+++K++++ GM+ +V V YR  FA++AIAP A F ER++RP+MT S
Sbjct  15    ISMISLQFGYAGMNVLTKVSLNGGMSHYVLVVYRHAFATLAIAPFALFLERKVRPKMTWS  74

Query  359   ILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTA  538
             I F IF+ ++ G  ++Q  Y+VGLK + PT ACA++N++PA+T+++AV F +EK+ ++  
Sbjct  75    IFFQIFVLALLGPVIDQNFYYVGLKYTGPTFACAMSNILPAMTFVMAVIFRMEKIELKKV  134

Query  539   AGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYAD-HLSSQNKDNNGSTNAQP--  709
               +AK+ GT++ V GAML++ Y G         +H  + + H      + +G+    P  
Sbjct  135   RCQAKIFGTVVTVAGAMLMTLYKG-------PLMHLPWTNGHAQPSGGEASGAAGVDPTA  187

Query  710   -NFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKP  886
               + LG   II++ L+WA   I+QT    KY A  S T L+CF+ +IQ +      + + 
Sbjct  188   REWFLGSLFIIIATLAWASLFILQTHTIRKYTAQLSLTTLICFIGTIQAIAVTFVMERRV  247

Query  887   TDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLL  1066
             + W++   +   +A YAGIV +++AY +    I+K GP++ S F+PL+++IVAV+   +L
Sbjct  248   SVWTIGFDMNLLAAAYAGIVTSSIAYYVQGLVIQKTGPVFASAFSPLMMIIVAVMGSFIL  307

Query  1067  QDKIYVGTIVGSVLIVVGLYGVLWGKQKELQ  1159
              +KIY+G ++G+V+IVVGLY VLWGK KE Q
Sbjct  308   SEKIYLGAVLGAVVIVVGLYAVLWGKHKEKQ  338



>ref|XP_008365295.1| PREDICTED: WAT1-related protein At1g25270-like [Malus domestica]
Length=400

 Score =   264 bits (675),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 155/388 (40%), Positives = 236/388 (61%), Gaps = 25/388 (6%)
 Frame = +2

Query  176   LIMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTL  355
             +++M++VQ  +A +NI+ KLA + GMN  + VAYR +F +  + PIA F ER+ RP++T 
Sbjct  18    VLLMVVVQFAFAGVNILYKLAANDGMNLRILVAYRFIFGTAFLLPIALFIERKNRPKLTW  77

Query  356   SILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRT  535
              +L   FL  +FG SL+Q  Y   L  ++ T A A++ LIPA+T++LA+ F +EKL +R+
Sbjct  78    MVLLQGFLSGLFGGSLSQNLYIESLALTSATFASAISQLIPAITFILAITFRLEKLNLRS  137

Query  536   AAGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYAD-----HLSSQNKDNNGSTN  700
               GKAKV+GT++ +GGAMLL+FY G  I I  + +   +       HL+S    ++G   
Sbjct  138   LTGKAKVLGTLMGIGGAMLLAFYEGVEIKIWSTHVDLLHTSQQQHSHLASLPHRDSG---  194

Query  701   AQPNFILGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDH  880
                + +LG  L   S +  AIW II T++S  YP  YSSTALM  M SIQ V FA+C + 
Sbjct  195   ---DRLLGCLLAFGSCICXAIWLIILTKMSATYPCYYSSTALMSAMGSIQAVGFALCKES  251

Query  881   KPTDWSLRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWG  1060
             + + W L   IR  +  Y+GI+ T L+  +++ CI  +GPL+VSVFNPL+LV+VA++   
Sbjct  252   EWSQWMLGWNIRLLTVAYSGIMVTGLSAAIIALCIGMRGPLFVSVFNPLMLVLVAIVGSL  311

Query  1061  LLQDKIYVGTIVGSVLIVVGLYGVLWGKQKELQVIGVVHVDEEEARNEVETKEDHLEELE  1240
             +L +K+++G+++G+VLIV GLY VLWGK KE+          ++  N V +   H ++  
Sbjct  312   VLDEKLHLGSVLGAVLIVCGLYAVLWGKGKEI----------DKMSNSVPSTSFHHQD--  359

Query  1241  LSAHSIITVDQFPKKN*NN*FSLHSKEN  1324
               + SI  V   P  N  N  ++ S  N
Sbjct  360   --SGSIDIVIMPPDNNKGNSNNIESLTN  385



>ref|XP_009788498.1| PREDICTED: WAT1-related protein At5g07050-like [Nicotiana sylvestris]
Length=389

 Score =   264 bits (674),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 131/321 (41%), Positives = 214/321 (67%), Gaps = 6/321 (2%)
 Frame = +2

Query  179   IMMIIVQLGYAVMNIISKLAMDSGMNPFVHVAYRQLFASVAIAPIAYFSERRIRPQMTLS  358
             I MI +Q GYA MNII+K++++ GM+ +V V YR  FA+  IAP A   ER+IRP+M+L 
Sbjct  19    IAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIAPFALILERKIRPKMSLM  78

Query  359   ILFNIFLCSIFGISLNQITYFVGLKNSTPTIACALTNLIPAVTYLLAVPFGIEKLMIRTA  538
             +   IF+  + G  ++Q  Y+ GLK ++PT +CA++N++PA+T+++AV   +EK+ I+  
Sbjct  79    MFLQIFVLGLLGPVIDQNFYYAGLKYTSPTFSCAMSNMLPAMTFVMAVICRMEKVDIKKV  138

Query  539   AGKAKVVGTILCVGGAMLLSFYHGHNIGIGESSIHWKYADHLSSQNKDNNGSTNAQPNFI  718
               +AKV+GTI+ V GAML++ Y GH +     ++ W     ++S  ++ +G+ N+  ++ 
Sbjct  139   RCQAKVLGTIVTVAGAMLMTLYKGHVV-----NLLWSNHTTINSSVQETSGA-NSDKDWF  192

Query  719   LGPFLIIVSALSWAIWSIIQTRVSEKYPAPYSSTALMCFMSSIQCVLFAICFDHKPTDWS  898
              G  L+I + L+WA + I+Q     KY AP S TAL+CFM ++Q +      +HKP+ W+
Sbjct  193   KGSILLIFATLAWASFFILQNIAMRKYTAPLSLTALVCFMGTLQSIAVTFVMEHKPSVWT  252

Query  899   LRQGIRATSAVYAGIVGTALAYCLMSWCIEKKGPLYVSVFNPLLLVIVAVLSWGLLQDKI  1078
             +   +   +A YAGIV +++AY +    +EK+GP++V+ F+PL+++IVA +   +L +KI
Sbjct  253   IGFDMNLLAAAYAGIVSSSIAYYVQGVVMEKRGPVFVTAFSPLMMIIVATMGSFILAEKI  312

Query  1079  YVGTIVGSVLIVVGLYGVLWG  1141
             Y+G I+G+VLIV GLY VLWG
Sbjct  313   YIGGILGAVLIVAGLYSVLWG  333



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4003296049571