BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c74050_g1_i1 len=108 path=[1:0-107]

Length=108
                                                                      Score     E

emb|CDP07913.1|  unnamed protein product                              50.8    9e-06   
ref|XP_010271933.1|  PREDICTED: disease resistance protein RPM1-like  49.7    2e-05   
emb|CBI26378.3|  unnamed protein product                              49.7    2e-05   
emb|CAN75824.1|  hypothetical protein VITISV_004157                   50.1    2e-05   Vitis vinifera
ref|XP_010650011.1|  PREDICTED: disease resistance protein RPM1-l...  50.1    2e-05   
emb|CDP19241.1|  unnamed protein product                              49.3    3e-05   
emb|CDP05397.1|  unnamed protein product                              48.5    4e-05   
emb|CDP21782.1|  unnamed protein product                              48.1    5e-05   
emb|CDP20055.1|  unnamed protein product                              48.1    7e-05   
ref|XP_010324303.1|  PREDICTED: disease resistance protein RPM1-like  48.1    8e-05   
emb|CDP20168.1|  unnamed protein product                              47.8    9e-05   
ref|XP_006366513.1|  PREDICTED: disease resistance protein RPM1-like  47.8    1e-04   
emb|CDP05648.1|  unnamed protein product                              47.0    1e-04   
gb|ABO15685.1|  NBS-NBS-LRR type disease resistance protein           47.4    2e-04   Ipomoea batatas [batate]
emb|CDP12947.1|  unnamed protein product                              47.0    2e-04   
tpg|DAA46393.1|  TPA: hypothetical protein ZEAMMB73_472907            47.0    2e-04   
gb|EMT08877.1|  Disease resistance protein RPM1                       47.0    2e-04   
ref|XP_010652579.1|  PREDICTED: disease resistance protein RPM1       46.6    2e-04   
ref|XP_009623392.1|  PREDICTED: disease resistance protein RPM1-like  46.6    2e-04   
emb|CDP20878.1|  unnamed protein product                              46.6    2e-04   
dbj|BAJ89839.1|  predicted protein                                    46.6    2e-04   
dbj|BAJ95229.1|  predicted protein                                    46.6    2e-04   
emb|CDP21483.1|  unnamed protein product                              46.6    2e-04   
ref|XP_010271941.1|  PREDICTED: disease resistance protein RPM1-like  46.6    3e-04   
emb|CDP19366.1|  unnamed protein product                              46.2    3e-04   
ref|XP_009605820.1|  PREDICTED: disease resistance protein RPM1-like  46.2    3e-04   
emb|CBI37307.3|  unnamed protein product                              46.2    3e-04   
ref|XP_004250512.1|  PREDICTED: disease resistance protein RPM1-like  46.2    3e-04   
ref|XP_003631469.1|  PREDICTED: disease resistance protein RPM1-like  46.2    4e-04   
ref|XP_009805068.1|  PREDICTED: disease resistance protein RPM1-like  46.2    4e-04   
emb|CAN74463.1|  hypothetical protein VITISV_032893                   46.2    4e-04   Vitis vinifera
emb|CDP20142.1|  unnamed protein product                              45.4    4e-04   
emb|CDP11695.1|  unnamed protein product                              45.1    8e-04   
ref|XP_009406550.1|  PREDICTED: LOW QUALITY PROTEIN: disease resi...  45.1    9e-04   



>emb|CDP07913.1| unnamed protein product [Coffea canephora]
Length=926

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  7    LKVLDLRGAQLEEIPEQVFNLFQLKYLSLRGT  102
            LKVLDL GA+L+ IP+QVF LF L+YL+LRGT
Sbjct  579  LKVLDLHGAELDNIPKQVFKLFHLRYLNLRGT  610



>ref|XP_010271933.1| PREDICTED: disease resistance protein RPM1-like [Nelumbo nucifera]
Length=562

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  7    LKVLDLRGAQLEEIPEQVFNLFQLKYLSLRGTKL  108
            LKVLDLRGA LEE PE+  N F L+YLS+R TK+
Sbjct  481  LKVLDLRGAPLEEFPEEFTNCFHLRYLSVRNTKI  514



>emb|CBI26378.3| unnamed protein product [Vitis vinifera]
Length=558

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  7    LKVLDLRGAQLEEIPEQVFNLFQLKYLSLRGTKL  108
            L+VLDLRG  LE+ PE V NLF L+YLSLRGTK+
Sbjct  256  LRVLDLRGLPLEKFPEGVVNLFHLRYLSLRGTKV  289



>emb|CAN75824.1| hypothetical protein VITISV_004157 [Vitis vinifera]
Length=1512

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  7    LKVLDLRGAQLEEIPEQVFNLFQLKYLSLRGTKL  108
            L+VLDLRG  LE+ PE V NLF L+YLSLRGTK+
Sbjct  533  LRVLDLRGLPLEKFPEGVVNLFHLRYLSLRGTKV  566



>ref|XP_010650011.1| PREDICTED: disease resistance protein RPM1-like isoform X1 [Vitis 
vinifera]
 ref|XP_010650012.1| PREDICTED: disease resistance protein RPM1-like isoform X2 [Vitis 
vinifera]
Length=924

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  7    LKVLDLRGAQLEEIPEQVFNLFQLKYLSLRGTKL  108
            L+VLDLRG  LE+ PE V NLF L+YLSLRGTK+
Sbjct  578  LRVLDLRGLPLEKFPEGVVNLFHLRYLSLRGTKV  611



>emb|CDP19241.1| unnamed protein product [Coffea canephora]
Length=728

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  7    LKVLDLRGAQLEEIPEQVFNLFQLKYLSLRGT  102
            LKVLDL GA+L+ IP+QVF LF L+YLSL GT
Sbjct  510  LKVLDLDGAELDNIPKQVFKLFHLRYLSLNGT  541



>emb|CDP05397.1| unnamed protein product, partial [Coffea canephora]
Length=566

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  7    LKVLDLRGAQLEEIPEQVFNLFQLKYLSLRGT  102
            LKVLDL GA+L+ IP+QVF LF L+YL+L GT
Sbjct  468  LKVLDLHGAELDNIPKQVFKLFHLRYLNLSGT  499



>emb|CDP21782.1| unnamed protein product, partial [Coffea canephora]
Length=422

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  7    LKVLDLRGAQLEEIPEQVFNLFQLKYLSLRGT  102
            LKVLDL GA+L+ IP+QVF LF L+YL+L GT
Sbjct  324  LKVLDLDGAELDSIPKQVFKLFHLRYLNLSGT  355



>emb|CDP20055.1| unnamed protein product [Coffea canephora]
Length=925

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  7    LKVLDLRGAQLEEIPEQVFNLFQLKYLSLRGTKL  108
            LKVL L GA+L+ IP++VF LF LKYL+LRGT++
Sbjct  579  LKVLGLEGAELDNIPKEVFKLFHLKYLNLRGTRV  612



>ref|XP_010324303.1| PREDICTED: disease resistance protein RPM1-like [Solanum lycopersicum]
Length=971

 Score = 48.1 bits (113),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  7    LKVLDLRGAQLEEIPEQVFNLFQLKYLSLRGTKL  108
            L+VLDLRGA L+ IPE VF LF L+YLSLR T +
Sbjct  600  LRVLDLRGAPLKMIPETVFQLFHLRYLSLRNTNV  633



>emb|CDP20168.1| unnamed protein product [Coffea canephora]
Length=735

 Score = 47.8 bits (112),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  7    LKVLDLRGAQLEEIPEQVFNLFQLKYLSLRGT  102
            LKVLDL GA+L+ IP+QVF LF L+YL+L GT
Sbjct  388  LKVLDLDGAELDNIPKQVFKLFHLRYLNLSGT  419



>ref|XP_006366513.1| PREDICTED: disease resistance protein RPM1-like [Solanum tuberosum]
Length=949

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  7    LKVLDLRGAQLEEIPEQVFNLFQLKYLSLRGTKL  108
            L+VLDLRGA L  IPE VF LF L+YLSLR T +
Sbjct  578  LRVLDLRGAPLNMIPETVFQLFHLRYLSLRNTNV  611



>emb|CDP05648.1| unnamed protein product [Coffea canephora]
Length=534

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +1

Query  7    LKVLDLRGAQLEEIPEQVFNLFQLKYLSLRGT  102
            LKVLDL GA+L+ IP+ VF LF LKYL+L GT
Sbjct  187  LKVLDLDGAELDNIPKHVFKLFHLKYLNLNGT  218



>gb|ABO15685.1| NBS-NBS-LRR type disease resistance protein [Ipomoea batatas]
Length=888

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 28/36 (78%), Gaps = 1/36 (3%)
 Frame = +1

Query  4    PLKVLDL-RGAQLEEIPEQVFNLFQLKYLSLRGTKL  108
            PL+VLD  RG  LEEIP+ V+ LF LKYLSLRGT L
Sbjct  555  PLEVLDFSRGTILEEIPKGVYKLFNLKYLSLRGTML  590



>emb|CDP12947.1| unnamed protein product [Coffea canephora]
Length=958

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  7    LKVLDLRGAQLEEIPEQVFNLFQLKYLSLRGTKL  108
            LKVLDLRG ++EE P ++F+L  L YLSL GTK+
Sbjct  589  LKVLDLRGEEIEETPNEIFSLLHLTYLSLYGTKV  622



>tpg|DAA46393.1| TPA: hypothetical protein ZEAMMB73_472907 [Zea mays]
Length=566

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  7    LKVLDLRGAQLEEIPEQVFNLFQLKYLSLRGTKL  108
            L  LDL+GAQ+ E+P++VFNLF L++LSLR T++
Sbjct  225  LSTLDLQGAQIVELPDEVFNLFNLRFLSLRNTEV  258



>gb|EMT08877.1| Disease resistance protein RPM1 [Aegilops tauschii]
Length=1081

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/36 (53%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    NPLKVLDLRGAQLEEIPEQVFNLFQLKYLSLRGTKL  108
            N L +LDL+G +++ +P++VFNLF L+YL LRGT++
Sbjct  480  NLLSMLDLQGTRIKMLPDEVFNLFNLRYLGLRGTEI  515



>ref|XP_010652579.1| PREDICTED: disease resistance protein RPM1 [Vitis vinifera]
Length=548

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  7    LKVLDLRGAQLEEIPEQVFNLFQLKYLSLRGTKL  108
            LKVLDL GA L+ IPE + NLF L+YLSLR TK+
Sbjct  332  LKVLDLGGAPLDRIPEDLGNLFHLRYLSLRKTKV  365



>ref|XP_009623392.1| PREDICTED: disease resistance protein RPM1-like [Nicotiana tomentosiformis]
Length=486

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  7    LKVLDLRGAQLEEIPEQVFNLFQLKYLSLRGTKL  108
            L+VLDLR A LE IPE VF LF L+YLSLR T +
Sbjct  156  LRVLDLRRAPLEMIPETVFQLFHLRYLSLRNTSV  189



>emb|CDP20878.1| unnamed protein product [Coffea canephora]
Length=549

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  7    LKVLDLRGAQLEEIPEQVFNLFQLKYLSLRGTKL  108
            LKVLDL GA+L+ IP++VF LF L+YL L GT++
Sbjct  205  LKVLDLAGAELDNIPKEVFKLFHLEYLDLSGTRV  238



>dbj|BAJ89839.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=918

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  7    LKVLDLRGAQLEEIPEQVFNLFQLKYLSLRGTKL  108
            L VLDL+G+Q+  IP QVF+LF L++L LRGT++
Sbjct  578  LSVLDLQGSQIRSIPVQVFSLFNLRFLGLRGTEI  611



>dbj|BAJ95229.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=918

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  7    LKVLDLRGAQLEEIPEQVFNLFQLKYLSLRGTKL  108
            L VLDL+G+Q+  IP QVF+LF L++L LRGT++
Sbjct  578  LSVLDLQGSQIRSIPVQVFSLFNLRFLGLRGTEI  611



>emb|CDP21483.1| unnamed protein product [Coffea canephora]
Length=767

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  7    LKVLDLRGAQLEEIPEQVFNLFQLKYLSLRGT  102
            LKVLDLRGA+L+ IP+QVF LF L+YL+L  T
Sbjct  459  LKVLDLRGAKLDSIPKQVFKLFHLRYLNLART  490



>ref|XP_010271941.1| PREDICTED: disease resistance protein RPM1-like [Nelumbo nucifera]
Length=1434

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  7     LKVLDLRGAQLEEIPEQVFNLFQLKYLSLRGTKL  108
             LKVL+LR A LE  P +V NLF L+YLSLRGTK+
Sbjct  1086  LKVLELRDAPLEVFPAEVVNLFHLRYLSLRGTKV  1119



>emb|CDP19366.1| unnamed protein product [Coffea canephora]
Length=490

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +1

Query  13   VLDLRGAQLEEIPEQVFNLFQLKYLSLRGT  102
            VLDL GA+L+ IP+ VF LF LKYLSL GT
Sbjct  232  VLDLHGAELDNIPKHVFKLFHLKYLSLNGT  261



>ref|XP_009605820.1| PREDICTED: disease resistance protein RPM1-like [Nicotiana tomentosiformis]
Length=910

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  7    LKVLDLRGAQLEEIPEQVFNLFQLKYLSLRGTKL  108
            LKVLDL GA L +IPE+VF +F LK+L+LR TK+
Sbjct  581  LKVLDLTGAPLVKIPEEVFEMFHLKFLNLRKTKI  614



>emb|CBI37307.3| unnamed protein product [Vitis vinifera]
Length=591

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  7    LKVLDLRGAQLEEIPEQVFNLFQLKYLSLRGTKL  108
            LKVLDL GA L+ IPE + NLF L+YLSLR TK+
Sbjct  425  LKVLDLGGAPLDRIPEDLGNLFHLRYLSLRKTKV  458



>ref|XP_004250512.1| PREDICTED: disease resistance protein RPM1-like [Solanum lycopersicum]
Length=907

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  7    LKVLDLRGAQLEEIPEQVFNLFQLKYLSLRGTKL  108
            LKVLDL  A+L +IPE+VF LF LK+L+LR TK+
Sbjct  577  LKVLDLTEARLTKIPEEVFELFHLKFLNLRSTKI  610



>ref|XP_003631469.1| PREDICTED: disease resistance protein RPM1-like [Vitis vinifera]
Length=931

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  7    LKVLDLRGAQLEEIPEQVFNLFQLKYLSLRGTKL  108
            LKVLDL+GA LE IP +V+NLF L+YLSL  TK+
Sbjct  586  LKVLDLQGAPLEIIPNEVWNLFNLRYLSLSRTKV  619



>ref|XP_009805068.1| PREDICTED: disease resistance protein RPM1-like [Nicotiana sylvestris]
Length=910

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  7    LKVLDLRGAQLEEIPEQVFNLFQLKYLSLRGTKL  108
            LKVLDL GA L +IPE+VF +F LK+L+LR TK+
Sbjct  581  LKVLDLTGAPLVKIPEEVFEMFHLKFLNLRKTKI  614



>emb|CAN74463.1| hypothetical protein VITISV_032893 [Vitis vinifera]
Length=931

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  7    LKVLDLRGAQLEEIPEQVFNLFQLKYLSLRGTKL  108
            LKVLDL+GA LE IP +V+NLF L+YLSL  TK+
Sbjct  586  LKVLDLQGAPLEIIPNEVWNLFNLRYLSLSRTKV  619



>emb|CDP20142.1| unnamed protein product, partial [Coffea canephora]
Length=382

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +1

Query  7    LKVLDLRGAQLEEIPEQVFNLFQLKYLSLRGT  102
            LKVLDL GA+L+ IP+QVF LF L+YLSL  T
Sbjct  85   LKVLDLDGAELDNIPKQVFKLFHLRYLSLTRT  116



>emb|CDP11695.1| unnamed protein product [Coffea canephora]
Length=894

 Score = 45.1 bits (105),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  7    LKVLDLRGAQLEEIPEQVFNLFQLKYLSLRGTKL  108
            LKVL+L GA+L+ IP++VF LF L+YL L GT++
Sbjct  580  LKVLNLTGAELDNIPKEVFKLFHLQYLDLSGTRV  613



>ref|XP_009406550.1| PREDICTED: LOW QUALITY PROTEIN: disease resistance protein RPM1-like 
[Musa acuminata subsp. malaccensis]
Length=835

 Score = 45.1 bits (105),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  7    LKVLDLRGAQLEEIPEQVFNLFQLKYLSLRGTKL  108
            L+VLDL  A L E+P +V NLF L+YLS+RGT+L
Sbjct  516  LRVLDLENASLVELPGEVGNLFHLRYLSVRGTRL  549



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 524198921584