BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7401_g1_i1 len=1066 path=[1:0-848 850:849-1065]

Length=1066
                                                                      Score     E

ref|XP_009799661.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    476   4e-165   
ref|XP_009616144.1|  PREDICTED: probable 2-oxoglutarate-dependent...    469   3e-162   
ref|XP_004241717.1|  PREDICTED: probable 2-oxoglutarate-dependent...    459   3e-158   
emb|CDO98089.1|  unnamed protein product                                432   4e-148   
ref|XP_011072311.1|  PREDICTED: probable 2-oxoglutarate-dependent...    432   1e-147   
emb|CDP10327.1|  unnamed protein product                                426   2e-145   
ref|XP_009616143.1|  PREDICTED: probable 2-oxoglutarate-dependent...    344   2e-113   
ref|XP_004241716.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    344   2e-113   
ref|XP_002280670.1|  PREDICTED: probable 2-oxoglutarate-dependent...    343   7e-113   Vitis vinifera
emb|CAN77851.1|  hypothetical protein VITISV_030994                     343   1e-112   Vitis vinifera
ref|XP_009799663.1|  PREDICTED: probable 2-oxoglutarate-dependent...    342   3e-112   
ref|XP_006356186.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    340   7e-112   
gb|KDP37163.1|  hypothetical protein JCGZ_06219                         337   2e-110   
ref|XP_002284983.1|  PREDICTED: probable inactive 2-oxoglutarate-...    333   3e-109   Vitis vinifera
ref|XP_008228622.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    331   3e-108   
ref|XP_007024003.1|  2-oxoglutarate-dependent dioxygenase               331   3e-108   
emb|CBI36206.3|  unnamed protein product                                336   4e-108   
ref|XP_007217562.1|  hypothetical protein PRUPE_ppa021035mg             331   4e-108   
ref|XP_010033904.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    330   1e-107   
ref|XP_002298131.1|  hypothetical protein POPTR_0001s17670g             328   7e-107   Populus trichocarpa [western balsam poplar]
ref|XP_009339602.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    328   7e-107   
ref|XP_002298127.1|  oxidoreductase family protein                      327   1e-106   Populus trichocarpa [western balsam poplar]
emb|CAN80139.1|  hypothetical protein VITISV_028513                     327   1e-106   Vitis vinifera
ref|XP_002284974.1|  PREDICTED: probable 2-oxoglutarate-dependent...    327   2e-106   Vitis vinifera
gb|EYU21585.1|  hypothetical protein MIMGU_mgv1a010381mg                327   2e-106   
ref|XP_008377591.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    325   1e-105   
ref|XP_011045371.1|  PREDICTED: probable 2-oxoglutarate-dependent...    324   2e-105   
ref|XP_006392868.1|  hypothetical protein EUTSA_v10011672mg             323   5e-105   
emb|CDO98090.1|  unnamed protein product                                322   7e-105   
gb|EYU21582.1|  hypothetical protein MIMGU_mgv1a010360mg                322   9e-105   
ref|XP_002517548.1|  Gibberellin 20 oxidase, putative                   322   1e-104   Ricinus communis
ref|XP_010463426.1|  PREDICTED: probable 2-oxoglutarate-dependent...    322   2e-104   
ref|XP_011045368.1|  PREDICTED: probable 2-oxoglutarate-dependent...    320   4e-104   
ref|XP_010500899.1|  PREDICTED: probable 2-oxoglutarate-dependent...    320   6e-104   
gb|KFK35767.1|  hypothetical protein AALP_AA4G033600                    319   1e-103   
ref|XP_006306220.1|  hypothetical protein CARUB_v10011908mg             319   1e-103   
emb|CDP10326.1|  unnamed protein product                                318   2e-103   
ref|XP_010481152.1|  PREDICTED: probable 2-oxoglutarate-dependent...    321   5e-103   
ref|XP_008226092.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    318   6e-103   
ref|XP_006427132.1|  hypothetical protein CICLE_v10027083mg             317   7e-103   
ref|NP_175689.1|  oxidoreductase, 2OG-Fe(II) oxygenase family pro...    317   1e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006465514.1|  PREDICTED: probable 2-oxoglutarate-dependent...    317   1e-102   
ref|XP_007214491.1|  hypothetical protein PRUPE_ppa020361mg             316   2e-102   
emb|CDP17011.1|  unnamed protein product                                316   3e-102   
gb|AFC36356.1|  2-oxoglutarate-dependent dioxygenase                    316   4e-102   
ref|XP_006427129.1|  hypothetical protein CICLE_v10027545mg             316   4e-102   
ref|XP_006465516.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    315   6e-102   
ref|XP_010061960.1|  PREDICTED: probable inactive 2-oxoglutarate-...    315   6e-102   
ref|XP_011072270.1|  PREDICTED: probable 2-oxoglutarate-dependent...    315   7e-102   
ref|XP_006427128.1|  hypothetical protein CICLE_v10027501mg             315   1e-101   
ref|XP_004302942.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3-...    314   2e-101   
ref|XP_009147660.1|  PREDICTED: probable 2-oxoglutarate-dependent...    311   1e-100   
ref|XP_006465422.1|  PREDICTED: probable 2-oxoglutarate-dependent...    311   3e-100   
ref|XP_011072310.1|  PREDICTED: probable 2-oxoglutarate-dependent...    308   4e-99    
ref|XP_007145552.1|  hypothetical protein PHAVU_007G248200g             306   2e-98    
emb|CDY26054.1|  BnaC06g05700D                                          306   3e-98    
ref|XP_010034855.1|  PREDICTED: probable 2-oxoglutarate-dependent...    305   5e-98    
ref|XP_007215723.1|  hypothetical protein PRUPE_ppa008973mg             304   9e-98    
ref|XP_010061959.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    303   3e-97    
ref|XP_007024008.1|  2-oxoglutarate-dependent dioxygenase, putative     302   7e-97    
ref|XP_008228621.1|  PREDICTED: probable 2-oxoglutarate-dependent...    300   3e-96    
ref|XP_007216862.1|  hypothetical protein PRUPE_ppa021358mg             300   5e-96    
ref|XP_006427131.1|  hypothetical protein CICLE_v10027420mg             300   7e-96    
gb|EYU31921.1|  hypothetical protein MIMGU_mgv1a010132mg                300   8e-96    
ref|XP_006427130.1|  hypothetical protein CICLE_v10027182mg             300   1e-95    
ref|XP_010110322.1|  Gibberellin 20 oxidase 1                           301   1e-95    
ref|XP_008228619.1|  PREDICTED: probable 2-oxoglutarate-dependent...    299   1e-95    
emb|CDO98091.1|  unnamed protein product                                299   1e-95    
gb|KDO58207.1|  hypothetical protein CISIN_1g037660mg                   299   1e-95    
ref|XP_008377592.1|  PREDICTED: probable 2-oxoglutarate-dependent...    299   1e-95    
ref|XP_006465515.1|  PREDICTED: probable 2-oxoglutarate-dependent...    299   1e-95    
ref|XP_010535123.1|  PREDICTED: probable 2-oxoglutarate-dependent...    298   2e-95    
ref|XP_002517546.1|  Gibberellin 20 oxidase, putative                   298   3e-95    Ricinus communis
ref|XP_007145554.1|  hypothetical protein PHAVU_007G248400g             296   2e-94    
emb|CDY26055.1|  BnaC06g05690D                                          295   2e-94    
emb|CDY68239.1|  BnaA06g37440D                                          295   4e-94    
ref|XP_009339601.1|  PREDICTED: probable 2-oxoglutarate-dependent...    295   5e-94    
ref|XP_003533058.1|  PREDICTED: probable 2-oxoglutarate-dependent...    295   6e-94    
ref|XP_009147661.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    294   7e-94    
ref|XP_010665883.1|  PREDICTED: probable 2-oxoglutarate-dependent...    294   9e-94    
ref|XP_006465423.1|  PREDICTED: probable 2-oxoglutarate-dependent...    293   2e-93    
ref|XP_006392867.1|  hypothetical protein EUTSA_v10011672mg             291   4e-93    
ref|XP_010110313.1|  Gibberellin 3-beta-dioxygenase 4                   292   4e-93    
ref|XP_002284968.1|  PREDICTED: probable 2-oxoglutarate-dependent...    292   5e-93    Vitis vinifera
ref|XP_002284985.1|  PREDICTED: probable 2-oxoglutarate-dependent...    291   9e-93    Vitis vinifera
ref|XP_009379331.1|  PREDICTED: probable 2-oxoglutarate-dependent...    291   1e-92    
ref|XP_002298129.1|  2-oxoglutarate-dependent dioxygenase-related...    291   1e-92    Populus trichocarpa [western balsam poplar]
ref|XP_007024335.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...    301   2e-92    
ref|XP_002517541.1|  Gibberellin 20 oxidase, putative                   290   3e-92    Ricinus communis
ref|XP_004302943.1|  PREDICTED: gibberellin 20 oxidase 1-like           290   3e-92    
emb|CAN80138.1|  hypothetical protein VITISV_028512                     289   7e-92    Vitis vinifera
ref|XP_003528366.1|  PREDICTED: probable 2-oxoglutarate-dependent...    289   1e-91    
emb|CDP08458.1|  unnamed protein product                                288   2e-91    
ref|XP_004302952.1|  PREDICTED: leucoanthocyanidin dioxygenase-like     288   3e-91    
ref|NP_175688.1|  oxidoreductase, 2OG-Fe(II) oxygenase family pro...    287   4e-91    Arabidopsis thaliana [mouse-ear cress]
gb|KDO58204.1|  hypothetical protein CISIN_1g038676mg                   286   8e-91    
ref|XP_008228620.1|  PREDICTED: probable 2-oxoglutarate-dependent...    286   1e-90    
gb|KHN01361.1|  Gibberellin 20 oxidase 1                                286   1e-90    
ref|XP_007024009.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    286   1e-90    
ref|XP_007216816.1|  hypothetical protein PRUPE_ppa023108mg             286   1e-90    
ref|XP_006392870.1|  hypothetical protein EUTSA_v10011669mg             286   2e-90    
ref|XP_009780364.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    285   2e-90    
gb|KDO58208.1|  hypothetical protein CISIN_1g044747mg                   285   4e-90    
gb|KFK35768.1|  hypothetical protein AALP_AA4G033700                    285   4e-90    
emb|CDP21179.1|  unnamed protein product                                285   5e-90    
ref|XP_006427127.1|  hypothetical protein CICLE_v10027219mg             284   5e-90    
ref|XP_004151475.1|  PREDICTED: gibberellin 20 oxidase 1-B-like         285   6e-90    
ref|XP_002517690.1|  Gibberellin 20 oxidase, putative                   283   1e-89    Ricinus communis
ref|XP_010110312.1|  Gibberellin 3-beta-dioxygenase 4                   283   1e-89    
ref|XP_009339603.1|  PREDICTED: probable 2-oxoglutarate-dependent...    283   2e-89    
gb|KDP37168.1|  hypothetical protein JCGZ_06224                         283   2e-89    
ref|XP_004136074.1|  PREDICTED: gibberellin 20 oxidase 1-like           283   2e-89    
emb|CAN66061.1|  hypothetical protein VITISV_007808                     283   2e-89    Vitis vinifera
ref|XP_010545796.1|  PREDICTED: probable 2-oxoglutarate-dependent...    282   5e-89    
ref|XP_009771248.1|  PREDICTED: probable 2-oxoglutarate-dependent...    281   6e-89    
ref|XP_002517547.1|  Gibberellin 20 oxidase, putative                   281   7e-89    Ricinus communis
ref|XP_007135718.1|  hypothetical protein PHAVU_010G152400g             281   9e-89    
ref|XP_006367750.1|  PREDICTED: probable 2-oxoglutarate-dependent...    275   3e-88    
gb|KHG05406.1|  2'-deoxymugineic-acid 2'-dioxygenase                    280   3e-88    
ref|XP_003553391.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    280   3e-88    
ref|XP_009588351.1|  PREDICTED: probable 2-oxoglutarate-dependent...    279   5e-88    
ref|XP_004171510.1|  PREDICTED: LOW QUALITY PROTEIN: gibberellin ...    280   5e-88    
ref|XP_008461058.1|  PREDICTED: probable inactive 2-oxoglutarate-...    279   6e-88    
gb|KEH28749.1|  2-oxoglutarate-dependent dioxygenase                    279   8e-88    
ref|XP_008377588.1|  PREDICTED: probable 2-oxoglutarate-dependent...    278   3e-87    
gb|ACU24369.1|  unknown                                                 277   3e-87    Glycine max [soybeans]
ref|XP_004165032.1|  PREDICTED: gibberellin 20 oxidase 1-B-like         277   4e-87    
ref|XP_004293154.1|  PREDICTED: gibberellin 3-beta-dioxygenase 4-...    277   5e-87    
emb|CDY26044.1|  BnaC06g05800D                                          277   5e-87    
ref|XP_003535849.1|  PREDICTED: probable 2-oxoglutarate-dependent...    276   6e-87    
ref|XP_010032029.1|  PREDICTED: probable 2-oxoglutarate-dependent...    276   6e-87    
ref|XP_006305421.1|  hypothetical protein CARUB_v10009821mg             276   6e-87    
ref|XP_010061957.1|  PREDICTED: probable 2-oxoglutarate-dependent...    276   7e-87    
ref|XP_004241720.1|  PREDICTED: probable 2-oxoglutarate-dependent...    276   7e-87    
ref|XP_004506877.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...    275   2e-86    
ref|XP_011045369.1|  PREDICTED: probable 2-oxoglutarate-dependent...    275   2e-86    
gb|KHN31409.1|  Gibberellin 20 oxidase 1                                275   2e-86    
ref|XP_008454372.1|  PREDICTED: probable 2-oxoglutarate-dependent...    275   2e-86    
gb|AFK40822.1|  unknown                                                 275   2e-86    
ref|XP_009347560.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    275   2e-86    
ref|XP_009147658.1|  PREDICTED: probable 2-oxoglutarate-dependent...    275   3e-86    
gb|KDP37164.1|  hypothetical protein JCGZ_06220                         275   3e-86    
ref|XP_009375961.1|  PREDICTED: probable inactive 2-oxoglutarate-...    275   4e-86    
ref|XP_010110314.1|  Gibberellin 3-beta-dioxygenase 4                   274   5e-86    
emb|CDP19783.1|  unnamed protein product                                274   7e-86    
ref|XP_010479801.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    273   8e-86    
ref|XP_010462133.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    273   9e-86    
gb|KDP37370.1|  hypothetical protein JCGZ_06824                         274   9e-86    
ref|XP_009371496.1|  PREDICTED: probable 2-oxoglutarate-dependent...    273   1e-85    
ref|XP_009621185.1|  PREDICTED: probable 2-oxoglutarate-dependent...    273   1e-85    
ref|XP_004306704.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3-...    273   1e-85    
ref|XP_011072273.1|  PREDICTED: probable 2-oxoglutarate-dependent...    273   2e-85    
ref|XP_006356178.1|  PREDICTED: probable 2-oxoglutarate-dependent...    272   4e-85    
ref|XP_007135717.1|  hypothetical protein PHAVU_010G152300g             272   4e-85    
ref|XP_007024010.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    272   5e-85    
ref|XP_006392865.1|  hypothetical protein EUTSA_v10011667mg             271   9e-85    
ref|XP_004152262.1|  PREDICTED: gibberellin 20 oxidase 1-B-like         271   9e-85    
ref|XP_010110321.1|  Gibberellin 20 oxidase 1                           271   9e-85    
ref|XP_003521152.1|  PREDICTED: probable 2-oxoglutarate-dependent...    271   1e-84    
ref|XP_010061956.1|  PREDICTED: probable 2-oxoglutarate-dependent...    271   1e-84    
ref|XP_010033902.1|  PREDICTED: probable 2-oxoglutarate-dependent...    270   2e-84    
ref|XP_008366303.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    270   3e-84    
ref|XP_010545794.1|  PREDICTED: probable 2-oxoglutarate-dependent...    270   4e-84    
ref|XP_006305391.1|  hypothetical protein CARUB_v10009783mg             270   4e-84    
emb|CDO98088.1|  unnamed protein product                                269   5e-84    
ref|XP_009375959.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    269   6e-84    
ref|XP_010033901.1|  PREDICTED: probable 2-oxoglutarate-dependent...    269   6e-84    
ref|XP_009603180.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    269   8e-84    
ref|XP_010061958.1|  PREDICTED: probable 2-oxoglutarate-dependent...    268   9e-84    
ref|NP_175691.1|  putative 2-oxoglutarate-dependent dioxygenase         268   2e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008384915.1|  PREDICTED: probable inactive 2-oxoglutarate-...    268   2e-83    
gb|KDP37380.1|  hypothetical protein JCGZ_06834                         267   2e-83    
gb|AFK47428.1|  unknown                                                 267   3e-83    
ref|XP_008390710.1|  PREDICTED: probable inactive 2-oxoglutarate-...    267   4e-83    
ref|XP_010462134.1|  PREDICTED: probable 2-oxoglutarate-dependent...    267   4e-83    
ref|XP_008377590.1|  PREDICTED: probable 2-oxoglutarate-dependent...    266   4e-83    
ref|XP_008372275.1|  PREDICTED: probable inactive 2-oxoglutarate-...    266   5e-83    
ref|XP_010500907.1|  PREDICTED: probable 2-oxoglutarate-dependent...    266   5e-83    
ref|XP_008386022.1|  PREDICTED: probable inactive 2-oxoglutarate-...    266   7e-83    
emb|CDP08459.1|  unnamed protein product                                266   8e-83    
ref|XP_009344329.1|  PREDICTED: probable inactive 2-oxoglutarate-...    265   2e-82    
gb|KEH28750.1|  2-oxoglutarate-dependent dioxygenase                    265   3e-82    
ref|XP_010542274.1|  PREDICTED: probable 2-oxoglutarate-dependent...    265   3e-82    
ref|XP_009354842.1|  PREDICTED: probable inactive 2-oxoglutarate-...    265   4e-82    
ref|XP_007162137.1|  hypothetical protein PHAVU_001G127200g             264   4e-82    
gb|KDP24591.1|  hypothetical protein JCGZ_25507                         264   5e-82    
ref|XP_004301787.1|  PREDICTED: gibberellin 3-beta-dioxygenase 4-...    265   6e-82    
ref|XP_004506878.1|  PREDICTED: S-norcoclaurine synthase 1-like         263   1e-81    
ref|XP_009364342.1|  PREDICTED: probable inactive 2-oxoglutarate-...    263   1e-81    
ref|XP_010500906.1|  PREDICTED: probable 2-oxoglutarate-dependent...    262   3e-81    
emb|CDP14980.1|  unnamed protein product                                262   4e-81    
ref|XP_008344774.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    261   7e-81    
ref|XP_007145555.1|  hypothetical protein PHAVU_007G248500g             261   8e-81    
ref|XP_011045370.1|  PREDICTED: probable 2-oxoglutarate-dependent...    261   8e-81    
emb|CDP19495.1|  unnamed protein product                                260   1e-80    
ref|XP_008382989.1|  PREDICTED: probable inactive 2-oxoglutarate-...    260   1e-80    
ref|XP_004148019.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3-...    261   2e-80    
ref|XP_008784635.1|  PREDICTED: probable 2-oxoglutarate-dependent...    259   4e-80    
ref|XP_004136073.1|  PREDICTED: gibberellin 2-beta-dioxygenase 8-...    258   7e-80    
ref|XP_010110319.1|  Protein SRG1                                       258   8e-80    
ref|XP_010479810.1|  PREDICTED: probable 2-oxoglutarate-dependent...    258   1e-79    
ref|XP_004241719.1|  PREDICTED: probable 2-oxoglutarate-dependent...    257   3e-79    
ref|XP_009785369.1|  PREDICTED: probable 2-oxoglutarate-dependent...    257   3e-79    
ref|XP_004241718.1|  PREDICTED: probable 2-oxoglutarate-dependent...    256   4e-79    
ref|XP_003625060.1|  Gibberellin 20 oxidase                             256   5e-79    
gb|KDP32296.1|  hypothetical protein JCGZ_13221                         256   6e-79    
ref|XP_003553825.1|  PREDICTED: probable 2-oxoglutarate-dependent...    255   1e-78    
ref|XP_010462135.1|  PREDICTED: probable 2-oxoglutarate-dependent...    255   1e-78    
gb|KHN06108.1|  Gibberellin 3-beta-dioxygenase 3                        255   1e-78    
ref|XP_010500908.1|  PREDICTED: probable 2-oxoglutarate-dependent...    254   1e-78    
ref|XP_011019740.1|  PREDICTED: probable 2-oxoglutarate-dependent...    256   2e-78    
ref|XP_008461057.1|  PREDICTED: probable 2-oxoglutarate-dependent...    254   3e-78    
emb|CDO98087.1|  unnamed protein product                                254   3e-78    
emb|CDP20247.1|  unnamed protein product                                254   4e-78    
ref|XP_002298128.2|  hypothetical protein POPTR_0001s17630g             253   7e-78    Populus trichocarpa [western balsam poplar]
ref|XP_004252327.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    252   2e-77    
emb|CBI36205.3|  unnamed protein product                                250   2e-77    
ref|XP_011026516.1|  PREDICTED: probable 2-oxoglutarate-dependent...    252   5e-77    
gb|AFK38656.1|  unknown                                                 251   5e-77    
emb|CDP08608.1|  unnamed protein product                                251   1e-76    
ref|XP_002309592.1|  hypothetical protein POPTR_0006s26410g             250   1e-76    Populus trichocarpa [western balsam poplar]
gb|AFK44600.1|  unknown                                                 251   1e-76    
ref|XP_002324836.1|  hypothetical protein POPTR_0018s01190g             249   3e-76    Populus trichocarpa [western balsam poplar]
ref|XP_004229768.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    249   4e-76    
ref|XP_006348005.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    248   5e-76    
ref|XP_007145557.1|  hypothetical protein PHAVU_007G248700g             248   5e-76    
ref|XP_008227259.1|  PREDICTED: probable inactive 2-oxoglutarate-...    248   8e-76    
ref|XP_006365982.1|  PREDICTED: probable 2-oxoglutarate-dependent...    248   8e-76    
ref|XP_006348004.1|  PREDICTED: probable 2-oxoglutarate-dependent...    248   1e-75    
ref|XP_009802367.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    246   3e-75    
ref|XP_010047771.1|  PREDICTED: probable 2-oxoglutarate-dependent...    246   3e-75    
ref|XP_009608401.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    246   4e-75    
ref|XP_003555065.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    246   6e-75    
ref|XP_003547720.1|  PREDICTED: probable inactive 2-oxoglutarate-...    245   9e-75    
gb|KDO58205.1|  hypothetical protein CISIN_1g045288mg                   243   1e-74    
ref|XP_002515914.1|  Flavonol synthase/flavanone 3-hydroxylase, p...    245   1e-74    Ricinus communis
ref|XP_007214111.1|  hypothetical protein PRUPE_ppa017120mg             244   1e-74    
ref|XP_007024016.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    245   1e-74    
emb|CDP21546.1|  unnamed protein product                                245   2e-74    
emb|CDP10138.1|  unnamed protein product                                244   2e-74    
gb|KHN27538.1|  Gibberellin 20 oxidase 1                                243   4e-74    
emb|CDP21180.1|  unnamed protein product                                243   6e-74    
gb|KHN45675.1|  Gibberellin 20 oxidase 1                                241   8e-74    
ref|XP_009621187.1|  PREDICTED: probable 2-oxoglutarate-dependent...    241   8e-74    
ref|XP_010026428.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    241   1e-73    
gb|KFK30901.1|  hypothetical protein AALP_AA6G040900                    242   2e-73    
ref|XP_006346585.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    242   2e-73    
ref|XP_006301978.1|  hypothetical protein CARUB_v10022458mg             242   2e-73    
ref|XP_008227273.1|  PREDICTED: probable 2-oxoglutarate-dependent...    242   2e-73    
ref|XP_002515597.1|  Gibberellin 2-beta-dioxygenase, putative           242   2e-73    Ricinus communis
ref|XP_008227260.1|  PREDICTED: probable 2-oxoglutarate-dependent...    242   2e-73    
ref|XP_006289716.1|  hypothetical protein CARUB_v10003282mg             241   5e-73    
ref|XP_002517543.1|  Flavonol synthase/flavanone 3-hydroxylase, p...    241   5e-73    Ricinus communis
ref|XP_010049940.1|  PREDICTED: probable 2-oxoglutarate-dependent...    241   6e-73    
ref|XP_010500900.1|  PREDICTED: probable 2-oxoglutarate-dependent...    238   7e-73    
gb|KFK30904.1|  hypothetical protein AALP_AA6G041200                    240   8e-73    
ref|XP_007162138.1|  hypothetical protein PHAVU_001G127300g             240   9e-73    
ref|XP_007212875.1|  hypothetical protein PRUPE_ppa021625mg             240   1e-72    
ref|XP_006598543.1|  PREDICTED: probable 2-oxoglutarate-dependent...    238   1e-72    
ref|XP_009785373.1|  PREDICTED: probable 2-oxoglutarate-dependent...    238   1e-72    
ref|XP_008794218.1|  PREDICTED: probable 2-oxoglutarate-dependent...    240   1e-72    
emb|CDY22099.1|  BnaA09g01280D                                          240   1e-72    
ref|XP_004229769.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    240   1e-72    
gb|KFK30903.1|  hypothetical protein AALP_AA6G041100                    239   2e-72    
ref|XP_007013772.1|  2-oxoglutarate-dependent dioxygenase               239   2e-72    
ref|XP_010249917.1|  PREDICTED: probable 2-oxoglutarate-dependent...    239   3e-72    
gb|KCW69003.1|  hypothetical protein EUGRSUZ_F02563                     237   3e-72    
gb|KCW69007.1|  hypothetical protein EUGRSUZ_F02567                     236   4e-72    
gb|KHN14925.1|  Gibberellin 20 oxidase 1                                238   5e-72    
ref|XP_002517544.1|  Flavonol synthase/flavanone 3-hydroxylase, p...    238   5e-72    Ricinus communis
ref|XP_004288730.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3-...    237   1e-71    
ref|XP_003554144.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    237   1e-71    
ref|XP_008792974.1|  PREDICTED: probable 2-oxoglutarate-dependent...    238   1e-71    
ref|XP_006356185.1|  PREDICTED: probable 2-oxoglutarate-dependent...    237   1e-71    
ref|XP_010429979.1|  PREDICTED: probable 2-oxoglutarate-dependent...    237   2e-71    
gb|AAL14645.1|AF417857_1  AOP1                                          237   2e-71    Arabidopsis lyrata [lyrate rockcress]
emb|CDY21938.1|  BnaC09g00440D                                          237   2e-71    
emb|CDP14441.1|  unnamed protein product                                237   2e-71    
ref|XP_008227261.1|  PREDICTED: probable inactive 2-oxoglutarate-...    237   2e-71    
gb|KDP40827.1|  hypothetical protein JCGZ_24826                         237   2e-71    
ref|XP_009134375.1|  PREDICTED: probable 2-oxoglutarate-dependent...    237   2e-71    
ref|XP_006367751.1|  PREDICTED: probable 2-oxoglutarate-dependent...    236   2e-71    
ref|XP_010532145.1|  PREDICTED: probable 2-oxoglutarate-dependent...    236   4e-71    
gb|KDP24586.1|  hypothetical protein JCGZ_25502                         237   5e-71    
ref|XP_010472950.1|  PREDICTED: probable 2-oxoglutarate-dependent...    236   6e-71    
gb|AAL14687.1|  2-oxoglutarate-dependent dioxygenase                    234   6e-71    
emb|CDY17965.1|  BnaC03g30370D                                          235   8e-71    
ref|XP_010472949.1|  PREDICTED: probable 2-oxoglutarate-dependent...    235   1e-70    
emb|CDP21163.1|  unnamed protein product                                233   2e-70    
ref|XP_002298124.1|  hypothetical protein POPTR_0001s17580g             234   2e-70    
ref|XP_009122188.1|  PREDICTED: probable 2-oxoglutarate-dependent...    234   3e-70    
ref|XP_002284931.1|  PREDICTED: probable 2-oxoglutarate-dependent...    234   3e-70    
ref|XP_011072272.1|  PREDICTED: probable 2-oxoglutarate-dependent...    231   3e-70    
emb|CDP11139.1|  unnamed protein product                                233   3e-70    
ref|XP_008447674.1|  PREDICTED: probable 2-oxoglutarate-dependent...    236   3e-70    
ref|XP_002515925.1|  Flavonol synthase/flavanone 3-hydroxylase, p...    233   6e-70    
emb|CDP19784.1|  unnamed protein product                                233   6e-70    
gb|KDP40826.1|  hypothetical protein JCGZ_24825                         231   2e-69    
ref|XP_011045372.1|  PREDICTED: probable 2-oxoglutarate-dependent...    231   2e-69    
emb|CDY37587.1|  BnaA02g19830D                                          232   2e-69    
ref|XP_010041295.1|  PREDICTED: probable 2-oxoglutarate-dependent...    231   2e-69    
ref|XP_009128434.1|  PREDICTED: probable 2-oxoglutarate-dependent...    231   3e-69    
gb|KDP40825.1|  hypothetical protein JCGZ_24824                         231   3e-69    
ref|XP_006367749.1|  PREDICTED: probable 2-oxoglutarate-dependent...    231   3e-69    
ref|XP_006339306.1|  PREDICTED: probable 2-oxoglutarate-dependent...    230   6e-69    
gb|EYU21581.1|  hypothetical protein MIMGU_mgv1a010326mg                230   8e-69    
ref|XP_002889297.1|  predicted protein                                  230   1e-68    
ref|XP_003554143.1|  PREDICTED: probable 2-oxoglutarate-dependent...    229   1e-68    
gb|KHN14924.1|  Gibberellin 20 oxidase 3                                229   1e-68    
ref|XP_007162139.1|  hypothetical protein PHAVU_001G127400g             229   2e-68    
gb|KFK42423.1|  hypothetical protein AALP_AA2G254300                    229   2e-68    
ref|NP_178148.1|  2-oxoglutarate (2OG) and Fe(II)-dependent oxyge...    229   2e-68    
emb|CDY38659.1|  BnaC02g23200D                                          229   3e-68    
sp|Q945B6.1|AOP1L_ARATH  RecName: Full=Probable 2-oxoglutarate-de...    228   4e-68    
gb|KHG09549.1|  Flavonol synthase/flavanone 3-hydroxylase               227   1e-67    
ref|XP_006396533.1|  hypothetical protein EUTSA_v10028799mg             227   1e-67    
emb|CDP11141.1|  unnamed protein product                                227   2e-67    
gb|EYU21589.1|  hypothetical protein MIMGU_mgv1a024911mg                224   2e-67    
gb|AAL14701.1|  2-oxoglutarate-dependent dioxygenase                    226   3e-67    
ref|XP_004291427.1|  PREDICTED: gibberellin 20 oxidase 1-B-like i...    226   3e-67    
ref|XP_010467243.1|  PREDICTED: probable 2-oxoglutarate-dependent...    226   4e-67    
ref|NP_192216.1|  oxidoreductase AOP1                                   226   4e-67    
ref|XP_010654922.1|  PREDICTED: probable inactive 2-oxoglutarate-...    223   4e-67    
gb|KHG02339.1|  2'-deoxymugineic-acid 2'-dioxygenase                    226   4e-67    
ref|XP_007210837.1|  hypothetical protein PRUPE_ppa016751mg             225   7e-67    
gb|KHG07058.1|  hypothetical protein F383_33647                         225   8e-67    
ref|XP_010912205.1|  PREDICTED: LOW QUALITY PROTEIN: 2-oxoglutara...    224   1e-66    
emb|CDY17969.1|  BnaC03g30410D                                          224   1e-66    
gb|EYU21580.1|  hypothetical protein MIMGU_mgv1a010552mg                223   2e-66    
gb|KCW82770.1|  hypothetical protein EUGRSUZ_C04146                     224   2e-66    
gb|AAL14686.1|  2-oxoglutarate-dependent dioxygenase                    223   3e-66    
ref|XP_010532147.1|  PREDICTED: probable 2-oxoglutarate-dependent...    223   5e-66    
ref|XP_009122199.1|  PREDICTED: probable 2-oxoglutarate-dependent...    223   6e-66    
ref|XP_002890109.1|  predicted protein                                  223   6e-66    
ref|XP_007224636.1|  hypothetical protein PRUPE_ppa026475mg             222   7e-66    
gb|AAL14683.1|  2-oxoglutarate-dependent dioxygenase                    222   7e-66    
ref|XP_008229693.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    222   9e-66    
gb|KHG02338.1|  Flavonol synthase/flavanone 3-hydroxylase -like p...    222   1e-65    
gb|AAL14698.1|  2-oxoglutarate-dependent dioxygenase                    221   1e-65    
ref|XP_006389780.1|  hypothetical protein EUTSA_v10018872mg             221   3e-65    
emb|CDP11140.1|  unnamed protein product                                221   3e-65    
ref|XP_010915540.1|  PREDICTED: probable 2-oxoglutarate-dependent...    221   3e-65    
emb|CDY22098.1|  BnaA09g01270D                                          221   4e-65    
ref|XP_008219866.1|  PREDICTED: probable 2-oxoglutarate-dependent...    220   4e-65    
ref|XP_004287966.1|  PREDICTED: gibberellin 3-beta-dioxygenase 4-...    218   5e-65    
gb|AAL14699.1|  2-oxoglutarate-dependent dioxygenase                    219   6e-65    
ref|XP_004233541.1|  PREDICTED: probable 2-oxoglutarate-dependent...    220   6e-65    
ref|XP_009147662.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    217   1e-64    
ref|XP_006406954.1|  hypothetical protein EUTSA_v10021145mg             219   2e-64    
ref|XP_010050517.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    219   2e-64    
ref|XP_004291426.1|  PREDICTED: gibberellin 20 oxidase 1-B-like i...    219   2e-64    
gb|EYU21579.1|  hypothetical protein MIMGU_mgv1a010719mg                218   2e-64    
ref|XP_007224725.1|  hypothetical protein PRUPE_ppa024900mg             218   3e-64    
emb|CDY21937.1|  BnaC09g00430D                                          219   3e-64    
ref|XP_010050515.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    218   4e-64    
gb|KHG17593.1|  2'-deoxymugineic-acid 2'-dioxygenase                    217   8e-64    
ref|XP_007162140.1|  hypothetical protein PHAVU_001G127500g             216   9e-64    
ref|XP_009349432.1|  PREDICTED: probable inactive 2-oxoglutarate-...    216   1e-63    
ref|XP_010913592.1|  PREDICTED: probable inactive 2-oxoglutarate-...    216   2e-63    
ref|XP_008373756.1|  PREDICTED: probable inactive 2-oxoglutarate-...    216   2e-63    
gb|KCW79744.1|  hypothetical protein EUGRSUZ_C01088                     216   2e-63    
sp|Q944Z5.1|AOP1V_ARATH  RecName: Full=Probable 2-oxoglutarate-de...    215   2e-63    
ref|XP_006304019.1|  hypothetical protein CARUB_v10009745mg             215   6e-63    
ref|XP_009371876.1|  PREDICTED: probable inactive 2-oxoglutarate-...    214   7e-63    
ref|XP_010050518.1|  PREDICTED: probable 2-oxoglutarate-dependent...    214   7e-63    
ref|XP_004233539.1|  PREDICTED: probable 2-oxoglutarate-dependent...    214   8e-63    
gb|KFK30902.1|  hypothetical protein AALP_AA6G041000                    214   2e-62    
ref|XP_006416895.1|  hypothetical protein EUTSA_v10008198mg             213   3e-62    
ref|XP_004233542.1|  PREDICTED: probable 2-oxoglutarate-dependent...    213   3e-62    
ref|XP_009107019.1|  PREDICTED: probable 2-oxoglutarate-dependent...    213   4e-62    
ref|XP_006476205.1|  PREDICTED: probable 2-oxoglutarate-dependent...    212   5e-62    
ref|XP_006450545.1|  hypothetical protein CICLE_v10010426mg             212   6e-62    
ref|XP_010479807.1|  PREDICTED: probable 2-oxoglutarate-dependent...    212   1e-61    
ref|XP_010050512.1|  PREDICTED: probable 2-oxoglutarate-dependent...    214   1e-61    
ref|XP_009371875.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    211   2e-61    
gb|AAL14685.1|  2-oxoglutarate-dependent dioxygenase                    209   3e-61    
gb|EYU41035.1|  hypothetical protein MIMGU_mgv1a013300mg                207   3e-61    
gb|EYU24677.1|  hypothetical protein MIMGU_mgv1a010266mg                210   4e-61    
ref|XP_010455020.1|  PREDICTED: probable 2-oxoglutarate-dependent...    209   5e-61    
ref|XP_009395077.1|  PREDICTED: probable 2-oxoglutarate-dependent...    209   6e-61    
ref|XP_008366657.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    210   6e-61    
ref|XP_008356477.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    209   7e-61    
gb|KHG05318.1|  2'-deoxymugineic-acid 2'-dioxygenase                    209   8e-61    
ref|XP_008373690.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    209   9e-61    
ref|XP_008346506.1|  PREDICTED: probable inactive 2-oxoglutarate-...    209   1e-60    
ref|XP_004513386.1|  PREDICTED: probable flavonol synthase 5-like       209   1e-60    
ref|XP_010500902.1|  PREDICTED: probable 2-oxoglutarate-dependent...    209   1e-60    
ref|XP_002517545.1|  Leucoanthocyanidin dioxygenase, putative           209   1e-60    
ref|XP_009400518.1|  PREDICTED: probable inactive 2-oxoglutarate-...    209   1e-60    
gb|KCW79743.1|  hypothetical protein EUGRSUZ_C01086                     208   2e-60    
ref|XP_004501289.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    207   3e-60    
ref|XP_008348454.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    207   3e-60    
gb|AAL14696.1|  2-oxoglutarate-dependent dioxygenase                    206   4e-60    
ref|XP_004228723.2|  PREDICTED: probable 2-oxoglutarate-dependent...    207   4e-60    
ref|XP_007161252.1|  hypothetical protein PHAVU_001G054800g             207   5e-60    
ref|XP_009400516.1|  PREDICTED: probable inactive 2-oxoglutarate-...    207   6e-60    
gb|EYU21577.1|  hypothetical protein MIMGU_mgv1a0102781mg               204   6e-60    
ref|XP_006854891.1|  hypothetical protein AMTR_s00052p00016200          207   6e-60    
ref|XP_008238357.1|  PREDICTED: probable inactive 2-oxoglutarate-...    207   6e-60    
emb|CBI20990.3|  unnamed protein product                                205   6e-60    
ref|XP_008243039.1|  PREDICTED: probable inactive 2-oxoglutarate-...    207   7e-60    
ref|XP_007211257.1|  hypothetical protein PRUPE_ppa021247mg             206   7e-60    
ref|XP_007203886.1|  hypothetical protein PRUPE_ppa008799mg             207   7e-60    
ref|XP_009382147.1|  PREDICTED: probable 2-oxoglutarate-dependent...    209   7e-60    
gb|AAL14700.1|  2-oxoglutarate-dependent dioxygenase                    205   8e-60    
ref|XP_009147659.1|  PREDICTED: probable 2-oxoglutarate-dependent...    206   9e-60    
gb|KGN64234.1|  hypothetical protein Csa_1G044830                       204   1e-59    
ref|XP_010110316.1|  Gibberellin 20 oxidase 1                           209   1e-59    
ref|XP_009400514.1|  PREDICTED: probable inactive 2-oxoglutarate-...    207   1e-59    
ref|XP_009377501.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    206   2e-59    
ref|XP_007213118.1|  hypothetical protein PRUPE_ppa023886mg             204   2e-59    
ref|XP_009393623.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    206   2e-59    
gb|AAL14702.1|  2-oxoglutarate-dependent dioxygenase                    204   2e-59    
ref|XP_006354215.1|  PREDICTED: probable 2-oxoglutarate-dependent...    205   3e-59    
ref|XP_008394038.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    206   3e-59    
ref|XP_006392866.1|  hypothetical protein EUTSA_v10011658mg             205   3e-59    
ref|XP_009372949.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    205   4e-59    
ref|XP_009341226.1|  PREDICTED: probable inactive 2-oxoglutarate-...    204   5e-59    
gb|KDP37165.1|  hypothetical protein JCGZ_06221                         204   6e-59    
gb|KCW82320.1|  hypothetical protein EUGRSUZ_C03724                     204   6e-59    
gb|KFK35765.1|  hypothetical protein AALP_AA4G033400                    209   6e-59    
emb|CDX97295.1|  BnaA02g20860D                                          203   7e-59    
gb|AAL14692.1|  2-oxoglutarate-dependent dioxygenase                    203   7e-59    
gb|KGN45318.1|  hypothetical protein Csa_7G434950                       202   8e-59    
ref|XP_003522635.1|  PREDICTED: probable inactive 2-oxoglutarate-...    204   8e-59    
ref|XP_010112085.1|  Gibberellin 20 oxidase 1                           204   9e-59    
emb|CDY20136.1|  BnaA01g28660D                                          204   1e-58    
ref|XP_009115437.1|  PREDICTED: probable 2-oxoglutarate-dependent...    204   1e-58    
ref|XP_008351637.1|  PREDICTED: probable inactive 2-oxoglutarate-...    203   2e-58    
ref|XP_010060704.1|  PREDICTED: probable inactive 2-oxoglutarate-...    203   2e-58    
emb|CDP19785.1|  unnamed protein product                                199   7e-58    
emb|CDX91263.1|  BnaC02g26740D                                          201   8e-58    
ref|XP_009771249.1|  PREDICTED: probable 2-oxoglutarate-dependent...    199   8e-58    
gb|AAL14684.1|  2-oxoglutarate-dependent dioxygenase                    200   1e-57    
gb|KCW67512.1|  hypothetical protein EUGRSUZ_F01241                     200   1e-57    
ref|XP_008386393.1|  PREDICTED: probable inactive 2-oxoglutarate-...    200   1e-57    
gb|AAL14680.1|  2-oxoglutarate-dependent dioxygenase                    199   2e-57    
ref|XP_009372397.1|  PREDICTED: probable inactive 2-oxoglutarate-...    200   2e-57    
ref|XP_009373457.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    200   2e-57    
ref|XP_009340682.1|  PREDICTED: probable inactive 2-oxoglutarate-...    200   2e-57    
ref|XP_006406953.1|  hypothetical protein EUTSA_v10021144mg             201   2e-57    
ref|XP_009339369.1|  PREDICTED: probable 2-oxoglutarate-dependent...    198   8e-57    
ref|XP_003523702.1|  PREDICTED: probable inactive 2-oxoglutarate-...    199   8e-57    
ref|XP_006304540.1|  hypothetical protein CARUB_v10011508mg             199   1e-56    
ref|XP_010026663.1|  PREDICTED: probable 2-oxoglutarate-dependent...    197   1e-56    
ref|XP_009340689.1|  PREDICTED: probable inactive 2-oxoglutarate-...    198   1e-56    
gb|AAL14678.1|  2-oxoglutarate-dependent dioxygenase                    197   1e-56    
ref|XP_008346484.1|  PREDICTED: probable 2-oxoglutarate-dependent...    197   2e-56    
ref|XP_006853001.1|  hypothetical protein AMTR_s00174p00019750          198   2e-56    
ref|XP_009340685.1|  PREDICTED: probable inactive 2-oxoglutarate-...    197   2e-56    
emb|CDY71515.1|  BnaCnng73240D                                          197   3e-56    
ref|XP_008373535.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    197   3e-56    
ref|XP_002441559.1|  hypothetical protein SORBIDRAFT_09g029340          197   3e-56    
ref|XP_004253465.1|  PREDICTED: probable 2-oxoglutarate-dependent...    197   3e-56    
ref|XP_008356475.1|  PREDICTED: 2-oxoglutarate-dependent dioxygen...    196   3e-56    
gb|AAL14695.1|  2-oxoglutarate-dependent dioxygenase                    196   4e-56    
ref|XP_009148950.1|  PREDICTED: probable 2-oxoglutarate-dependent...    197   4e-56    
ref|XP_009146228.1|  PREDICTED: probable 2-oxoglutarate-dependent...    197   4e-56    
emb|CDP12471.1|  unnamed protein product                                194   4e-56    
ref|XP_006655618.1|  PREDICTED: probable 2-oxoglutarate-dependent...    196   6e-56    
gb|KGN58142.1|  hypothetical protein Csa_3G555690                       195   6e-56    
gb|AAL14681.1|  2-oxoglutarate-dependent dioxygenase                    194   1e-55    
gb|AAL14691.1|  2-oxoglutarate-dependent dioxygenase                    194   1e-55    
emb|CDY39662.1|  BnaC05g11910D                                          197   1e-55    
ref|XP_009372418.1|  PREDICTED: probable inactive 2-oxoglutarate-...    195   1e-55    
emb|CDY36571.1|  BnaA06g10240D                                          196   1e-55    
emb|CDY39112.1|  BnaA01g29440D                                          196   2e-55    
ref|XP_009373458.1|  PREDICTED: probable 2-oxoglutarate-dependent...    195   2e-55    
gb|KGN52785.1|  hypothetical protein Csa_4G001530                       193   2e-55    
emb|CDP22145.1|  unnamed protein product                                191   2e-55    
ref|XP_002298125.1|  hypothetical protein POPTR_0001s17610g             194   2e-55    
ref|XP_004292967.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3-...    195   2e-55    
ref|XP_010476645.1|  PREDICTED: probable 2-oxoglutarate-dependent...    195   3e-55    
gb|AAL14677.1|  2-oxoglutarate-dependent dioxygenase                    193   4e-55    
gb|KDP37167.1|  hypothetical protein JCGZ_06223                         194   4e-55    
ref|XP_010476643.1|  PREDICTED: probable 2-oxoglutarate-dependent...    194   4e-55    
ref|XP_010497232.1|  PREDICTED: probable 2-oxoglutarate-dependent...    194   6e-55    
ref|XP_010112800.1|  Gibberellin 2-beta-dioxygenase 2                   196   7e-55    
ref|NP_001140777.1|  hypothetical protein                               194   8e-55    
ref|XP_004963576.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    196   8e-55    
ref|XP_008650052.1|  PREDICTED: probable 2-oxoglutarate-dependent...    194   1e-54    
ref|XP_003588694.1|  2-oxoglutarate-dependent dioxygenase               192   1e-54    
gb|AAL14689.1|  2-oxoglutarate-dependent dioxygenase                    191   2e-54    
ref|NP_173007.1|  2-oxoglutarate (2OG) and Fe(II)-dependent oxyge...    193   2e-54    
gb|AAL14688.1|  2-oxoglutarate-dependent dioxygenase                    191   3e-54    
gb|KDP32297.1|  hypothetical protein JCGZ_13222                         192   3e-54    
ref|XP_009116922.1|  PREDICTED: probable 2-oxoglutarate-dependent...    192   4e-54    
ref|XP_006303647.1|  hypothetical protein CARUB_v10011635mg             192   4e-54    
emb|CDY53798.1|  BnaA06g01850D                                          187   4e-54    
ref|XP_007137065.1|  hypothetical protein PHAVU_009G096800g             192   4e-54    
ref|XP_010459094.1|  PREDICTED: probable 2-oxoglutarate-dependent...    191   5e-54    
ref|XP_010459095.1|  PREDICTED: probable 2-oxoglutarate-dependent...    191   5e-54    
ref|NP_174124.1|  2-oxoglutarate (2OG) and Fe(II)-dependent oxyge...    191   5e-54    
ref|XP_004291497.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    191   5e-54    
gb|AFK42467.1|  unknown                                                 191   6e-54    
emb|CDP19782.1|  unnamed protein product                                187   8e-54    
ref|XP_004228709.1|  PREDICTED: probable inactive 2-oxoglutarate-...    191   1e-53    
gb|KHG27363.1|  hypothetical protein F383_12181                         190   1e-53    
gb|KHF99371.1|  hypothetical protein F383_19520                         191   1e-53    
gb|KFK38898.1|  hypothetical protein AALP_AA3G175300                    190   2e-53    



>ref|XP_009799661.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP3-like [Nicotiana 
sylvestris]
Length=317

 Score =   476 bits (1225),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 224/318 (70%), Positives = 273/318 (86%), Gaps = 2/318 (1%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGSL    +LLVVDFNNE+L+PG+ +W   CKDIR A E+HGCFI L DK+SPQL  SIF
Sbjct  1     MGSLTASPQLLVVDFNNEELRPGTATWEFTCKDIRFAFENHGCFIALYDKISPQLQKSIF  60

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              ASQQLF+LP EKKILNTNEKPYHGYVGQIPF+P HEAFGID+ATT +G+QSFSNLMW  
Sbjct  61    QASQQLFELPLEKKILNTNEKPYHGYVGQIPFLPNHEAFGIDYATTSQGIQSFSNLMWPQ  120

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN  FSE+S +FSKIVAEL++KV+RMLFESYG+EK+ +SY+EST YLLRY+KY+ P  + 
Sbjct  121   GNDFFSENSLTFSKIVAELDQKVVRMLFESYGIEKNCESYLESTTYLLRYLKYDAP-NTK  179

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
             EN++VFP HTDKTF TVLYQ N +SGLE+Q R+G+W++  FPPSSF+VMAGEA +GWSN 
Sbjct  180   ENSMVFPPHTDKTFTTVLYQ-NHISGLEIQTRDGQWLTLDFPPSSFVVMAGEAFRGWSND  238

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             RVL P+HKV MD +G E RY+VGIF+FLK++K IEV EELVD+EHPLQF+PFVH+D+IKF
Sbjct  239   RVLTPVHKVIMDISGNETRYTVGIFTFLKDNKMIEVAEELVDEEHPLQFQPFVHIDLIKF  298

Query  981   FDSDKGRRSKNLLKDFCG  1034
             FD+++GRRS+NL+KDFCG
Sbjct  299   FDTERGRRSQNLVKDFCG  316



>ref|XP_009616144.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Nicotiana tomentosiformis]
Length=317

 Score =   469 bits (1206),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 220/318 (69%), Positives = 271/318 (85%), Gaps = 2/318 (1%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGSL    +LLVV+FNNE+L+PG+ +W   CK+IR A E+HG FI L DK+SPQL  SIF
Sbjct  1     MGSLTASPQLLVVNFNNEELRPGTATWESTCKEIRFAFENHGSFIALYDKISPQLQKSIF  60

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              ASQQLF+LP EKK+LNTNEKPYHGYVGQIPF+P+HEAFGID+ATT +G+QSFSNLMW  
Sbjct  61    QASQQLFELPLEKKVLNTNEKPYHGYVGQIPFLPHHEAFGIDYATTSQGIQSFSNLMWPQ  120

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN  F E+S  FSKIVAEL++KV+RMLFESYG+ K+ +SY+EST YLLRY+KY+ P  + 
Sbjct  121   GNDFFGENSLMFSKIVAELDQKVVRMLFESYGIGKNCESYLESTTYLLRYLKYDAP-NTK  179

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
             EN++VFP HTDKTF T+LYQ N++SGLEVQ R+G+WI+ +FPPSSF+VMAGEA +GWSN 
Sbjct  180   ENSMVFPPHTDKTFTTILYQ-NRISGLEVQTRDGQWINMEFPPSSFVVMAGEACRGWSND  238

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             RVL P+HKV MD +G E RY+VGIF+FLK+ K IEV EELVD+EHPLQFKPFVH+D+IKF
Sbjct  239   RVLTPVHKVIMDISGNETRYTVGIFTFLKDDKMIEVAEELVDEEHPLQFKPFVHIDLIKF  298

Query  981   FDSDKGRRSKNLLKDFCG  1034
             FD+++GRRS++LLKDFCG
Sbjct  299   FDTERGRRSQDLLKDFCG  316



>ref|XP_004241717.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Solanum lycopersicum]
Length=318

 Score =   459 bits (1180),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 218/319 (68%), Positives = 268/319 (84%), Gaps = 3/319 (1%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGSL TP KLLVVDFNNE+L+PG+T+W   CK+IR A E+HGCFI L DK+SPQL  SIF
Sbjct  1     MGSLTTPPKLLVVDFNNEELRPGTTTWESTCKEIRHAFENHGCFIALYDKISPQLQKSIF  60

Query  261   H-ASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWS  437
                SQQLF+LP E+K+LN +EKPYHGYVGQI F+P HEAFGID+ATT +G+Q+FSNLMW 
Sbjct  61    QDNSQQLFELPLERKVLNISEKPYHGYVGQISFLPNHEAFGIDYATTSQGIQTFSNLMWP  120

Query  438   GGNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAES  617
              GN SF ESS  FSKIVA L+ KV+RMLFESYG+ K+ +SYVEST YLLRY+KY  P ++
Sbjct  121   QGNDSFCESSLMFSKIVAALDNKVVRMLFESYGITKNCESYVESTTYLLRYLKYNTP-KT  179

Query  618   DENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSN  797
              E ++VFP HTDKTF T+LYQ N +SGLEVQ R+ +WI+ +FPPSSF+VMAGEA++GWSN
Sbjct  180   KETSMVFPPHTDKTFTTILYQ-NHISGLEVQTRDLQWITLEFPPSSFVVMAGEALRGWSN  238

Query  798   SRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIK  977
              RVL PIH+V MD NG E RY++G+F+FLKN K IEV EEL+D+EHPL+FKPFVHLD+IK
Sbjct  239   DRVLTPIHRVIMDINGSETRYTIGLFTFLKNDKIIEVDEELIDEEHPLKFKPFVHLDLIK  298

Query  978   FFDSDKGRRSKNLLKDFCG  1034
             FFD+++GRRS+NL++DFCG
Sbjct  299   FFDTERGRRSQNLVEDFCG  317



>emb|CDO98089.1| unnamed protein product [Coffea canephora]
Length=314

 Score =   432 bits (1112),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 208/318 (65%), Positives = 263/318 (83%), Gaps = 5/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS+ TPT LLVVDF N++LKPGS+ W+ AC DIR ALE+HGCFI L DK+S +L  +IF
Sbjct  1     MGSV-TPTNLLVVDFTNKELKPGSSCWSLACNDIRHALENHGCFIALYDKISQELDKAIF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
             HA+  LFDLP + K+ NTNEKPYHGYVGQIPF+P HE  GID+ATT++GVQSF+NLMW  
Sbjct  60    HAADDLFDLPTQLKVQNTNEKPYHGYVGQIPFVPLHEGLGIDYATTLDGVQSFTNLMWPQ  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN SFSESS SF+K VA+L+E V++MLFESYGVEK+ DS+VES+ YLLR++KY  P E +
Sbjct  120   GNKSFSESSFSFAKTVAKLDEMVIKMLFESYGVEKYSDSHVESSTYLLRFLKYRAP-EVN  178

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
             E  + FP HTDK+F+T+LYQ N +SGLE++ R+GEWI+  FPP SF+VMAG+A + WSN 
Sbjct  179   ETTMAFPSHTDKSFLTILYQ-NHISGLEIRTRDGEWITVDFPPRSFVVMAGDACQAWSND  237

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
              VL+P HKVTMDANGKE R+++ +FSFL  SK ++VPEELVDDE PLQFKPFVH+D++ F
Sbjct  238   GVLSPNHKVTMDANGKETRHTIALFSFL--SKMVQVPEELVDDEKPLQFKPFVHVDLLNF  295

Query  981   FDSDKGRRSKNLLKDFCG  1034
             + +D+GRRS+N+LKDFCG
Sbjct  296   YATDQGRRSQNILKDFCG  313



>ref|XP_011072311.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Sesamum indicum]
Length=314

 Score =   432 bits (1110),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 206/318 (65%), Positives = 258/318 (81%), Gaps = 5/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGSL  P +L+V+D +NE LK GS+SW+ ACKDIR ALE+HGCFI L DK+SPQLH SIF
Sbjct  1     MGSLNLP-ELVVIDLSNEGLKAGSSSWSSACKDIRQALENHGCFIALYDKISPQLHRSIF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              A+ QLFDLP E K+ N NEKPYHGYVGQ+P +P HE  GID+ATT+EG QSF+ LMW  
Sbjct  60    QAADQLFDLPTEVKVQNINEKPYHGYVGQMPIVPLHEGLGIDYATTLEGAQSFTKLMWPD  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN SF E++ SF+K VA++E+  +R+LFESYGV+K+ DS+VE+T YLLR++KY  P E +
Sbjct  120   GNDSFCETAMSFAKTVADIEKIAVRLLFESYGVQKYTDSHVEATTYLLRFLKYRAPEEGE  179

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
              NN  FP HTDK+F TVL+Q N +SGLEV+ARNGEWI+  FPPSSF+VMAG+A + WSN+
Sbjct  180   SNN-AFPSHTDKSFFTVLHQ-NHISGLEVRARNGEWINVVFPPSSFVVMAGDACQAWSNN  237

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             RVL+P HKV++D NGKE RY++  FSFL  SK +EVPEELVDDEHPLQFKPF H+D++ F
Sbjct  238   RVLSPNHKVSLDKNGKETRYTMAQFSFL--SKMVEVPEELVDDEHPLQFKPFAHVDLLNF  295

Query  981   FDSDKGRRSKNLLKDFCG  1034
             + +D GRRS+N+LKDFCG
Sbjct  296   YATDHGRRSQNILKDFCG  313



>emb|CDP10327.1| unnamed protein product [Coffea canephora]
Length=314

 Score =   426 bits (1096),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 205/318 (64%), Positives = 259/318 (81%), Gaps = 5/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS   P KLLVVDF NE+LKPGS+SWA AC DI+ ALE+HGCFI L +KVSP+L  +IF
Sbjct  1     MGS-PAPRKLLVVDFTNEELKPGSSSWASACNDIQRALENHGCFIALYNKVSPELDKAIF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              A+  LFDLP E K+ N NEKPYHGY+GQIPF+P HE  GID+ATT++GVQSF+NLMWS 
Sbjct  60    QAADDLFDLPTELKVQNINEKPYHGYIGQIPFVPLHEGLGIDYATTLDGVQSFTNLMWSK  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN SFSESS SF+K VA+L+E V++MLFESYGVEK+ DS+++ST YLLR++KY  P E +
Sbjct  120   GNKSFSESSFSFAKTVAKLDEMVIKMLFESYGVEKYSDSHIDSTRYLLRFLKYRAP-EMN  178

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
             E  + FP HTDK+F+T+LYQ N +SGLE++ R+ EWI   FP  SF+VMAG+A + WSN 
Sbjct  179   ETTMAFPSHTDKSFLTILYQ-NHISGLEIRTRDDEWIKVDFPQKSFVVMAGDACQAWSND  237

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             RVL+  HKVTMDANGKE RY++ +FSFL  SK ++VPEELV+DE PLQFKPFVH+D++ F
Sbjct  238   RVLSSNHKVTMDANGKETRYTIALFSFL--SKMVQVPEELVNDEKPLQFKPFVHIDLLNF  295

Query  981   FDSDKGRRSKNLLKDFCG  1034
             + +D+GR+S+N+LKDFCG
Sbjct  296   YATDQGRKSQNILKDFCG  313



>ref|XP_009616143.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Nicotiana tomentosiformis]
Length=315

 Score =   344 bits (883),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 160/318 (50%), Positives = 237/318 (75%), Gaps = 4/318 (1%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             M SL    KL ++DF  E+L+PG+ SW+  CK+   ALE++GCF+ L DK+S ++HN +F
Sbjct  1     MDSLTVSHKLPIIDFTKENLEPGTNSWSKVCKEAVCALEEYGCFVALSDKISLKIHNEVF  60

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              A +++FDLP + KI N + KP +GYVGQIPFIP +E+ GID+A T+EG+Q+F+N MWS 
Sbjct  61    GALEKVFDLPIQTKIQNKSTKPLYGYVGQIPFIPLYESMGIDNANTLEGIQNFTNFMWSS  120

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN++FS++  ++SK  AELEE V+RM+FESYGVEK+Y+S+++S  YL R MKY+  A+ +
Sbjct  121   GNNAFSQALLAYSKAAAELEEMVVRMVFESYGVEKNYESHIKSVNYLARVMKYK-EAQLE  179

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
             E  + F  HTDK+FM+ ++Q NQV+GLE++ ++G+W   +  PSS +VMAG+AI  WSN+
Sbjct  180   EPKLGFVAHTDKSFMSTIHQ-NQVNGLEIKGKDGQWFGVELSPSSIVVMAGDAIMAWSNN  238

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+ +P H+V M+  GK +RYS+  FSF++++  +E P+E VD+EHPL+FKPF HLD + F
Sbjct  239   RIKSPHHRVMME--GKGERYSIAQFSFMEDTVMVETPKEFVDEEHPLKFKPFNHLDYLHF  296

Query  981   FDSDKGRRSKNLLKDFCG  1034
             F  ++ RR +  LK +CG
Sbjct  297   FSKEENRRLECALKTYCG  314



>ref|XP_004241716.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP2-like [Solanum 
lycopersicum]
Length=317

 Score =   344 bits (883),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 164/320 (51%), Positives = 235/320 (73%), Gaps = 6/320 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGSL    KL V+DF  E+L+PG+ SW+ A K+   ALE++GCF+ L DKVS ++H+ +F
Sbjct  1     MGSLTVTHKLPVIDFTMENLEPGTNSWSKASKEAVCALEEYGCFVALYDKVSSKIHDDVF  60

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              A ++LFDLP +KK+ N + KP +GYVGQIPFIP +E+ GID+A T+EG+Q+F+N MW  
Sbjct  61    QALEELFDLPTQKKVQNKSSKPLYGYVGQIPFIPLYESMGIDNANTLEGIQNFTNFMWPN  120

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN+ FSE+  ++SK  AELEE V++M+FESYGVEK+Y+S+++S  YL R MKY   A+ +
Sbjct  121   GNNDFSEALLAYSKAAAELEEMVVKMVFESYGVEKYYESHIKSVNYLARVMKYR-EAQVE  179

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
             E  + F  HTDK+FM+ ++Q NQV+GLE++ ++G+W   +  PSS +VMAG+AI  WSN+
Sbjct  180   EAKLGFVAHTDKSFMSTIHQTNQVNGLEIKGKDGQWFKVELSPSSIVVMAGDAIMAWSNN  239

Query  801   RVLAPIHKVTMDANGKEK--RYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMI  974
             R+ +P H+V M   G+EK  RYS+  FSF+++S  +E P+ELVDD+HPL F  F HLD +
Sbjct  240   RIKSPHHRVMM---GEEKGARYSIAQFSFMEDSLMVETPKELVDDDHPLLFNSFNHLDYL  296

Query  975   KFFDSDKGRRSKNLLKDFCG  1034
             KFF  ++ RR +  LK +CG
Sbjct  297   KFFSKEENRRLECALKSYCG  316



>ref|XP_002280670.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Vitis vinifera]
 emb|CBI36208.3| unnamed protein product [Vitis vinifera]
Length=317

 Score =   343 bits (880),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 172/318 (54%), Positives = 236/318 (74%), Gaps = 7/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS  +  K+ VVDF+ E+L PGS+SW+  CKD+  ALE+ GCFI + DKV  +L N +F
Sbjct  1     MGS-HSSAKIPVVDFSKENLNPGSSSWSATCKDVLLALEEFGCFIAVYDKVPSELQNKLF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              A ++LF+LP E K+ N + KPYHGYVGQ   +P HE+ GID+ATT+EG+QSF+NLMW  
Sbjct  60    SALEELFNLPTETKMQNAHNKPYHGYVGQHSRLPLHESIGIDNATTLEGMQSFANLMWPA  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN  F E ++ FSKI  EL+  V +M+FESYGV K+YDS++E  +YLLR +K++ P +  
Sbjct  120   GNDHFCEITREFSKIALELDHLVTKMIFESYGVGKYYDSHLEPMSYLLRVLKHKAP-KVK  178

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
             E N+ F  HTDK+F+TVLYQ NQV GLEV+ ++GEWIS +  PSSF V+AG+A+  WSN 
Sbjct  179   EPNLGFARHTDKSFITVLYQ-NQVKGLEVETKDGEWISLELSPSSFAVIAGDALVAWSNG  237

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+ +P HKV M  N  E+RYS+G+F F  +S  I++PEEL DDEHPLQFK F HL +++F
Sbjct  238   RLHSPYHKVMMSGN--EERYSLGLFQF--SSGMIQIPEELGDDEHPLQFKSFNHLGLLRF  293

Query  981   FDSDKGRRSKNLLKDFCG  1034
             F +++G++SK+L+K +CG
Sbjct  294   FHTEEGQKSKSLIKSYCG  311



>emb|CAN77851.1| hypothetical protein VITISV_030994 [Vitis vinifera]
Length=317

 Score =   343 bits (879),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 172/318 (54%), Positives = 235/318 (74%), Gaps = 7/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS  +  K+ VVDF+ E+L PGS+SW+  CKD+  ALE+ GCFI + DKV  +L N +F
Sbjct  1     MGS-HSSAKIPVVDFSKENLNPGSSSWSATCKDVLLALEEFGCFIAVYDKVPSELQNKLF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              A ++LF+LP E K+ N + KPYHGYVGQ   +P HE+ GID+ATT+EG QSF+NLMW  
Sbjct  60    SALEELFNLPTETKMQNAHNKPYHGYVGQHSXLPLHESIGIDNATTLEGXQSFANLMWPA  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN  F E ++ FSKI  EL+  V +M+FESYGV K+YDS++E  +YLLR +K++ P +  
Sbjct  120   GNDHFCEITREFSKIALELDHLVTKMIFESYGVGKYYDSHLEPMSYLLRVLKHKAP-KVK  178

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
             E N+ F  HTDK+F+TVLYQ NQV GLEV+ ++GEWIS +  PSSF V+AG+A+  WSN 
Sbjct  179   EPNLGFARHTDKSFITVLYQ-NQVKGLEVETKDGEWISLELSPSSFAVIAGDALVAWSNG  237

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+ +P HKV M  N  E+RYS+G+F F  +S  I++PEEL DDEHPLQFK F HL +++F
Sbjct  238   RLHSPYHKVMMSGN--EERYSLGLFQF--SSGMIQIPEELGDDEHPLQFKSFDHLGLLRF  293

Query  981   FDSDKGRRSKNLLKDFCG  1034
             F +++G++SK+L+K +CG
Sbjct  294   FHTEEGQKSKSLIKSYCG  311



>ref|XP_009799663.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Nicotiana sylvestris]
Length=315

 Score =   342 bits (876),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 162/318 (51%), Positives = 235/318 (74%), Gaps = 4/318 (1%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             M SL    KL ++DF  E+L+PG+ SW   CK++  ALE++GCF+ L DK+S ++HN +F
Sbjct  1     MDSLTVFHKLPIIDFTKENLEPGTNSWFKVCKEVVCALEEYGCFVALYDKISLKIHNEVF  60

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              A ++LF+LP + KI N + KP +GYVGQIPFIP +E+ GID+A TIEG+Q+FSN MW  
Sbjct  61    QALEELFNLPTQTKIQNKSTKPLYGYVGQIPFIPLYESMGIDNANTIEGIQNFSNFMWPN  120

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN+ FSE+  ++SK  AE+EE V+RM+FESYGVEK+Y+S+++S  YL R MKY+  A+  
Sbjct  121   GNNCFSEALLAYSKAAAEVEEMVVRMVFESYGVEKYYESHIKSVNYLARVMKYK-EAQVQ  179

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
             E  + F  HTDK+FM+ ++Q NQV+GLE++ ++G+W   +  PSS +VMAG+AI  WSN+
Sbjct  180   EPKLGFVAHTDKSFMSTIHQ-NQVNGLEIKGKDGQWFGVELSPSSIVVMAGDAIMAWSNN  238

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+ +P H+V M+  GK +RYS+  FSF++++  +E PEELVD+EHPL+FK F HLD + F
Sbjct  239   RIKSPHHRVMME--GKGERYSIAQFSFMEDTVMVETPEELVDEEHPLKFKSFNHLDYLHF  296

Query  981   FDSDKGRRSKNLLKDFCG  1034
             F  ++ RR ++ LK +CG
Sbjct  297   FSKEENRRLESALKTYCG  314



>ref|XP_006356186.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP2-like [Solanum 
tuberosum]
Length=317

 Score =   340 bits (873),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 163/320 (51%), Positives = 234/320 (73%), Gaps = 6/320 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGSL    KL V+DF  E+L+PG+ SW+ A K+   ALE++GCF+ L DKVS  +H+ +F
Sbjct  1     MGSLTVSHKLPVIDFTMENLEPGTNSWSKASKEAVCALEEYGCFVALYDKVSLNIHDDVF  60

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              A ++LFDLP +KK+ N + KP +GYVGQIPFIP +E+ GID+A T+EG+Q+F+N MW  
Sbjct  61    QALEELFDLPTQKKVQNKSSKPLYGYVGQIPFIPLYESMGIDNANTLEGIQNFTNFMWPN  120

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             G++ FS++  ++SK  AELEE V++M+FESYGVEK+Y+S+V+S  YL R MKY   A+ +
Sbjct  121   GHNDFSQALLAYSKASAELEEMVVKMVFESYGVEKYYESHVKSVNYLARVMKYR-EAQVE  179

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
             E  + F  HTDK+FM+ ++Q NQV+GLE++ ++G+W   +  PSS +VMAG+AI  WSN+
Sbjct  180   EAKLGFVAHTDKSFMSTIHQTNQVNGLEIKGKDGQWFGVELSPSSIVVMAGDAIMAWSNN  239

Query  801   RVLAPIHKVTMDANGKEK--RYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMI  974
             R+ +P H+V M   G+EK  RYS+  FSF+++S  +E P+ELVD+EHPL F  F HLD +
Sbjct  240   RIKSPHHRVMM---GEEKGARYSIAQFSFMEDSLMVETPKELVDEEHPLLFNSFNHLDYL  296

Query  975   KFFDSDKGRRSKNLLKDFCG  1034
             KFF  ++ RR +  LK +CG
Sbjct  297   KFFSKEENRRLECALKSYCG  316



>gb|KDP37163.1| hypothetical protein JCGZ_06219 [Jatropha curcas]
Length=312

 Score =   337 bits (863),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 171/318 (54%), Positives = 230/318 (72%), Gaps = 7/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS+  P KL V+DF  E+LKPGS+ W   C ++R ALE++GCFIV  +K+SP+L NS+F
Sbjct  1     MGSVLAP-KLPVLDFTQENLKPGSSFWVKTCSEVRQALEEYGCFIVKYNKLSPELRNSVF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              A + LFDLP E K+ N   KP +GYVGQIP IP HE+ GID+AT++E + SF+ LMW  
Sbjct  60    GALKDLFDLPTETKMQNKYVKPLNGYVGQIPKIPLHESLGIDNATSLEALLSFTKLMWPD  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN  FSE    ++K+ AEL+  V RM+FESYGVEK +DSY+ ST YLLR +K  VP + D
Sbjct  120   GNLRFSEPIFEYAKLAAELDYMVTRMVFESYGVEKLHDSYIGSTTYLLRLLKNRVP-KGD  178

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
             E N+ F  HTDK+F T+L+Q NQV GLEV  R+GE I  +F PSSF+V+AG+A+  WSN 
Sbjct  179   EPNLGFITHTDKSFTTILHQ-NQVDGLEVDTRDGEKIMVEFSPSSFVVIAGDALMAWSND  237

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+++P H+V M  NGK  RYS G+F+F  NS  I+VP+ELVD+EHPL +KP  H+ ++ F
Sbjct  238   RIMSPSHRVMM--NGKVDRYSTGLFAF--NSGKIQVPQELVDEEHPLMYKPLDHIGLLYF  293

Query  981   FDSDKGRRSKNLLKDFCG  1034
             + +D+G +SK  +K +CG
Sbjct  294   YRTDEGYKSKCPVKAYCG  311



>ref|XP_002284983.1| PREDICTED: probable inactive 2-oxoglutarate-dependent dioxygenase 
AOP2 [Vitis vinifera]
Length=313

 Score =   333 bits (855),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 170/319 (53%), Positives = 234/319 (73%), Gaps = 8/319 (3%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS ET  KL ++DF+ E+LKPGS SW   C D+R ALE++GCF+   ++V  +LHN IF
Sbjct  1     MGS-ETHPKLPIIDFSEENLKPGSDSWFSVCHDVRHALEEYGCFMAYYNQVPLELHNKIF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
             +A  +LFDLP E K+ NT++KP HGY+GQIP  P HE+ GIDHAT +E +QSF+ LMW  
Sbjct  60    NALGELFDLPTEIKVKNTSDKPSHGYIGQIPAYPLHESMGIDHATNLEEIQSFAKLMWPA  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN  F E   S++ ++AELE+ V+RM+ +SYG+EK++DS++ ST YLLR +K  VP + +
Sbjct  120   GNEHFCEVVHSYTSLLAELEQVVMRMVLQSYGIEKYFDSHIASTRYLLRCLKNRVP-KMN  178

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFP-PSSFIVMAGEAIKGWSN  797
             EN++ FP H+DK+FMT+L Q N VSGLEV  ++G+ I    P PS FIV+AG+A   WSN
Sbjct  179   ENDIAFPTHSDKSFMTILQQ-NHVSGLEVDTKDGKSIGFGPPSPSVFIVIAGDAFMAWSN  237

Query  798   SRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIK  977
              R+  P H+V M AN  E+RYS+ +F+F KN   I+VPEELVDD+HPLQFKPF H+  I+
Sbjct  238   GRIHPPKHRVIMRAN--EERYSLALFAF-KNG-MIKVPEELVDDKHPLQFKPFDHVGFIR  293

Query  978   FFDSDKGRRSKNLLKDFCG  1034
             FF +++GR+S + +K +CG
Sbjct  294   FFHTEEGRKSNSAIKAYCG  312



>ref|XP_008228622.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP2-like [Prunus 
mume]
Length=312

 Score =   331 bits (849),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 171/318 (54%), Positives = 225/318 (71%), Gaps = 7/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS   P KL V+DF+ E LKPG+ SW  ACKD+R ALE+ GCF+VL DK+SP+  N+  
Sbjct  1     MGSEGQP-KLPVLDFSKEALKPGTNSWLLACKDVRQALEEFGCFVVLYDKISPEFRNAFL  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              A Q+LFDLP + K+ N  EKP +GYVGQIP +P HE+ GID+AT +   Q F+ LMW G
Sbjct  60    VALQELFDLPTQTKMTNKYEKPLNGYVGQIPKLPLHESLGIDNATKLVETQKFTKLMWPG  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN  F ES+ SF+K+  EL++ V RM+FESYGVEK+Y+SYV S +YLLR +K   P E +
Sbjct  120   GNDKFCESAYSFAKVAEELDQMVTRMIFESYGVEKYYESYVGSISYLLRLLKNRSPQE-N  178

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
             E ++ F  HTDK+F T+LYQ N V+ LEV+ R+ EWI  +FPPSSFIVMAG+A+  WSN 
Sbjct  179   EPSLGFVAHTDKSFTTILYQ-NHVNALEVETRSHEWIRVEFPPSSFIVMAGDALMAWSND  237

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+L+P H+V M  +G E RYS+  FSF  +   I VPEEL D+EHPL++K F H  +++F
Sbjct  238   RILSPNHRVIM--SGNETRYSLAQFSF--SDGAIHVPEELADEEHPLRYKSFDHPGLLRF  293

Query  981   FDSDKGRRSKNLLKDFCG  1034
             F SD    S + +K +CG
Sbjct  294   FRSDDRFNSNSAIKAYCG  311



>ref|XP_007024003.1| 2-oxoglutarate-dependent dioxygenase [Theobroma cacao]
 gb|EOY26625.1| 2-oxoglutarate-dependent dioxygenase [Theobroma cacao]
Length=313

 Score =   331 bits (849),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 164/319 (51%), Positives = 231/319 (72%), Gaps = 8/319 (3%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS  +P  +  +DF++EDLKPG+ +W  ACK +R ALE++GCFI+  +K   +LHN +F
Sbjct  1     MGSESSPN-VPFLDFSDEDLKPGTDTWLLACKKVRQALEEYGCFILEYNKFPLELHNQVF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
                ++LFDLP E K+ N  EKP +GYVGQIP +P HE+ GID+A T+EG + F+NLMW  
Sbjct  60    AVLEELFDLPTETKMKNRYEKPLNGYVGQIPKLPLHESMGIDNANTLEGTRFFTNLMWPQ  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN  F E    ++K+ AEL++ V RM+FESYG++K+ D+Y+++T YLLR +K   P E +
Sbjct  120   GNDRFCEYIYKYAKVAAELDQMVTRMIFESYGLDKYSDAYIDTTTYLLRLLKNRAPRE-N  178

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQF-PPSSFIVMAGEAIKGWSN  797
             E N+ F  HTDK+F T+L+Q NQV+ LEV+ R+G WI   F  PSSF+V+AG+A+  WSN
Sbjct  179   EPNLGFITHTDKSFTTILHQ-NQVNALEVETRDGTWIDVDFSSPSSFVVIAGDALMAWSN  237

Query  798   SRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIK  977
              RVL+P H+V M   G   RYS+G+F+F  NS TI+VPEELVD+EHPL++K F HL +++
Sbjct  238   DRVLSPSHRVVM--RGNMDRYSLGLFAF--NSGTIQVPEELVDEEHPLKYKAFEHLGLLR  293

Query  978   FFDSDKGRRSKNLLKDFCG  1034
             F+ +DKG +SK  +K +CG
Sbjct  294   FYRTDKGYKSKCPIKAYCG  312



>emb|CBI36206.3| unnamed protein product [Vitis vinifera]
Length=461

 Score =   336 bits (862),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 172/323 (53%), Positives = 236/323 (73%), Gaps = 8/323 (2%)
 Frame = +3

Query  69    KKKNMGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLH  248
             K K MGS ET  KL ++DF+ E+LKPGS SW   C D+R ALE++GCF+   ++V  +LH
Sbjct  145   KTKIMGS-ETHPKLPIIDFSEENLKPGSDSWFSVCHDVRHALEEYGCFMAYYNQVPLELH  203

Query  249   NSIFHASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNL  428
             N IF+A  +LFDLP E K+ NT++KP HGY+GQIP  P HE+ GIDHAT +E +QSF+ L
Sbjct  204   NKIFNALGELFDLPTEIKVKNTSDKPSHGYIGQIPAYPLHESMGIDHATNLEEIQSFAKL  263

Query  429   MWSGGNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVP  608
             MW  GN  F E   S++ ++AELE+ V+RM+ +SYG+EK++DS++ ST YLLR +K  VP
Sbjct  264   MWPAGNEHFCEVVHSYTSLLAELEQVVMRMVLQSYGIEKYFDSHIASTRYLLRCLKNRVP  323

Query  609   AESDENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFP-PSSFIVMAGEAIK  785
              + +EN++ FP H+DK+FMT+L Q N VSGLEV  ++G+ I    P PS FIV+AG+A  
Sbjct  324   -KMNENDIAFPTHSDKSFMTILQQ-NHVSGLEVDTKDGKSIGFGPPSPSVFIVIAGDAFM  381

Query  786   GWSNSRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHL  965
              WSN R+  P H+V M AN  E+RYS+ +F+F KN   I+VPEELVDD+HPLQFKPF H+
Sbjct  382   AWSNGRIHPPKHRVIMRAN--EERYSLALFAF-KNG-MIKVPEELVDDKHPLQFKPFDHV  437

Query  966   DMIKFFDSDKGRRSKNLLKDFCG  1034
               I+FF +++GR+S + +K +CG
Sbjct  438   GFIRFFHTEEGRKSNSAIKAYCG  460


 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 68/87 (78%), Gaps = 4/87 (5%)
 Frame = +3

Query  480  KIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNVVFPCHTDKT  659
            K+++ELE+ V+RM+ ESYG+E   D ++ S  +L+R++KY VP + +E ++  P HTDK+
Sbjct  56   KLLSELEQIVMRMVLESYGIEN--DFHIGSATFLIRFLKYRVP-KMNETSISVPPHTDKS  112

Query  660  FMTVLYQLNQVSGLEVQARNGEWISAQ  740
            F+++L+Q NQV+GLE++ ++G+WIS Q
Sbjct  113  FISILHQ-NQVNGLEIETKDGKWISHQ  138



>ref|XP_007217562.1| hypothetical protein PRUPE_ppa021035mg [Prunus persica]
 gb|EMJ18761.1| hypothetical protein PRUPE_ppa021035mg [Prunus persica]
Length=313

 Score =   331 bits (848),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 168/318 (53%), Positives = 222/318 (70%), Gaps = 6/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS   P KL V+DF+ E LKPG+  W   CKD+R ALE+ GCF+ L DK+SP+  N+  
Sbjct  1     MGSEGQP-KLPVLDFSKEALKPGTNPWLSVCKDVRQALEEFGCFVALYDKISPEFRNAFL  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              A Q+LFDLP   K+ N  EKP +GYVGQIP +P HE+ GID+AT +E  Q F+ LMW G
Sbjct  60    GALQELFDLPTRTKMTNKYEKPLNGYVGQIPKLPLHESLGIDNATNLEETQKFTKLMWPG  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN  F ES+ SF+K+  EL++ V RM+FESYGVEK+Y+SYV S +YLLR +K   P E +
Sbjct  120   GNDKFCESAYSFAKVAEELDQMVTRMIFESYGVEKYYESYVGSISYLLRLLKNRSPQE-N  178

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
             E ++ F  HTDK+F T+LYQ N V+ LEV+ R+ EWI  +FPPSSFIVMAG+A+  WSN 
Sbjct  179   EPSLGFVAHTDKSFTTILYQNNHVNALEVETRSHEWIRVEFPPSSFIVMAGDALMAWSND  238

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+L+P H+V M  +G E RYS+  FSF  +   I VPEEL D+EHPL++K F H  +++F
Sbjct  239   RILSPNHRVIM--SGNETRYSLAQFSF--SDGEIHVPEELADEEHPLRYKSFDHPGLLRF  294

Query  981   FDSDKGRRSKNLLKDFCG  1034
             F +D    S + +K +CG
Sbjct  295   FRNDDRFNSNSAIKAYCG  312



>ref|XP_010033904.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP3-like [Eucalyptus 
grandis]
 gb|KCW53770.1| hypothetical protein EUGRSUZ_J03023 [Eucalyptus grandis]
Length=318

 Score =   330 bits (845),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 163/319 (51%), Positives = 234/319 (73%), Gaps = 7/319 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSP-QLHNSI  257
             MGS  +P KL +++F++E+LKPG+TSW   CK++  ALE+ G F+V  D+V P Q+H++ 
Sbjct  1     MGSEGSP-KLPILNFSSENLKPGTTSWVATCKEVIQALEEFGFFVVNYDEVIPSQVHDAT  59

Query  258   FHASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWS  437
             F    +LF LP E K+ N  +KP +GYVGQI  +P HE+ GID AT++E  Q F++LMW 
Sbjct  60    FRVLHELFALPTETKMKNRYQKPLNGYVGQIAKLPLHESLGIDDATSLEATQKFTDLMWP  119

Query  438   GGNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAES  617
              GN+ F +   SF+K+ AEL++ V RM+FESY  EKHYDSY+EST YLLR +K   P E 
Sbjct  120   DGNNRFRDIMNSFAKLAAELDQIVTRMIFESYNSEKHYDSYIESTTYLLRLLKNRAPLE-  178

Query  618   DENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSN  797
             +E N+ F  HTDK+F T+L+Q ++V GLEV+ R+GEWI+ +  PS F+V+AG+A+  WSN
Sbjct  179   NEPNLGFINHTDKSFTTILHQDSEVHGLEVETRDGEWITVEMSPSKFVVIAGDALMAWSN  238

Query  798   SRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIK  977
              R+ +P HKVT+  NGKE RYS+ +F+F  N+ T++VPEELVDD+HPL++KPF HL +++
Sbjct  239   DRIQSPNHKVTI--NGKEDRYSLALFAF--NNGTLQVPEELVDDDHPLKYKPFEHLGLLR  294

Query  978   FFDSDKGRRSKNLLKDFCG  1034
             F+ +D+G +SK  +K +CG
Sbjct  295   FYRTDEGYKSKCPIKAYCG  313



>ref|XP_002298131.1| hypothetical protein POPTR_0001s17670g [Populus trichocarpa]
 gb|EEE82936.1| hypothetical protein POPTR_0001s17670g [Populus trichocarpa]
Length=313

 Score =   328 bits (840),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 164/319 (51%), Positives = 235/319 (74%), Gaps = 8/319 (3%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGSL +P +L V+DF+ E++KPG++SW   CKD+  ALE++GCF+ + DKV   LHN +F
Sbjct  1     MGSL-SPPELPVIDFSKENMKPGTSSWLSTCKDVMYALEEYGCFVAVYDKVPLTLHNDLF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIP-YHEAFGIDHATTIEGVQSFSNLMWS  437
                + LFDLP E K  N ++ PY+GYVG  PFIP  +E  GID+A T+EG + F++ MW 
Sbjct  60    STLKDLFDLPIETKRKNVSDLPYYGYVGNQPFIPSLYEGMGIDNAITLEGTEDFADTMWP  119

Query  438   GGNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAES  617
             GGN  F ++  S+S +V+ELE+ V+RM+FESYGV +H+DS+ EST YL R MKY  P E 
Sbjct  120   GGNDHFCKTVLSYSMLVSELEQMVVRMVFESYGVYQHHDSHKESTTYLFRMMKYRGP-EK  178

Query  618   DENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSN  797
             +E NV    HTDK+F+TVL+Q NQVSGLEV++++G+W+  +  PSSFIVMAGEA+ GWSN
Sbjct  179   NEANVGCDAHTDKSFITVLHQ-NQVSGLEVKSKDGQWMGFKPSPSSFIVMAGEALLGWSN  237

Query  798   SRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIK  977
              R+ AP H+V M  +  E RYSVG+FSF+K    I+VPE+L+D+++PL+FKPF +  +++
Sbjct  238   DRINAPFHRVVMSES--EPRYSVGLFSFIKG--IIKVPEKLIDEKNPLRFKPFENFGLLR  293

Query  978   FFDSDKGRRSKNLLKDFCG  1034
             +F +++GR  ++ +K +CG
Sbjct  294   YFFTEEGRGKESTIKAYCG  312



>ref|XP_009339602.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP2 [Pyrus x 
bretschneideri]
Length=313

 Score =   328 bits (840),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 165/318 (52%), Positives = 223/318 (70%), Gaps = 6/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS E   KL V+DF+ E LKPG+ SW  AC D++ ALE+ GCF+VL DK+S +  N++ 
Sbjct  1     MGS-EVEQKLPVLDFSKEALKPGTNSWLLACNDVQQALEEFGCFVVLYDKISDEFRNALL  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              + ++LFDLP E K+ N  EKP +GYVGQIP +P HE+ GID+AT  E  Q F+ LMW  
Sbjct  60    RSLEELFDLPTETKMTNKYEKPLNGYVGQIPKLPLHESLGIDNATNFEETQKFTKLMWPA  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN  F E++ +F+K+  EL++ V RM+F+SYGVEK+YDSYV S +YLLR ++   P E +
Sbjct  120   GNDKFCEAAYAFAKVAEELDQMVARMIFQSYGVEKYYDSYVGSISYLLRILQNRSPKE-N  178

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
             E+N+ F  HTDK+F TVLYQ NQV  LEV+ RN EWI  +FPPSSFIVMAG+A+  WSN 
Sbjct  179   EHNLGFVAHTDKSFTTVLYQNNQVHALEVETRNHEWIKVEFPPSSFIVMAGDALMAWSND  238

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+L+P H+V M  +G E RYS+  F+F  +   I VPEEL ++E PL++K F H  +++F
Sbjct  239   RILSPNHRVIM--SGNETRYSLAQFAF--SDGEIHVPEELGNEERPLRYKSFDHPGLLRF  294

Query  981   FDSDKGRRSKNLLKDFCG  1034
             F S  G  S + +K +CG
Sbjct  295   FRSQDGYISNSAIKAYCG  312



>ref|XP_002298127.1| oxidoreductase family protein [Populus trichocarpa]
 gb|EEE82932.1| oxidoreductase family protein [Populus trichocarpa]
Length=313

 Score =   327 bits (838),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 157/318 (49%), Positives = 231/318 (73%), Gaps = 6/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS E P+KL ++DF  EDLKPG++SW  AC D+R ALE++GCF+V  +++  +L + +F
Sbjct  1     MGSNELPSKLPILDFAKEDLKPGTSSWLKACSDVRLALEEYGCFVVEYNRLPLELRDKVF  60

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
                ++LFDLP E K+ N  EKP +GYVGQI  +P HE+ GID+AT+++  Q+F++LMW  
Sbjct  61    GVLKELFDLPTETKMQNKYEKPLNGYVGQIAKLPLHESMGIDNATSLDATQNFTDLMWPN  120

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN  F E    ++ + AEL+  V RM+FESYGVEK++DSYVEST YLLR +K   P + D
Sbjct  121   GNDRFCECVLKYANLAAELDRMVTRMVFESYGVEKYHDSYVESTTYLLRLLKNR-PPKVD  179

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
             E+N+ F  HTDK+F T+L+Q N+++GLEV  ++G+ I+ +  PSSF+V+AG+A+  WSN 
Sbjct  180   EHNLGFVTHTDKSFTTILHQ-NEINGLEVDTKDGKKINVELSPSSFVVIAGDALMAWSND  238

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             RV++P H+V M  NGK  RYS+ +F+F  N   ++VPEELVD+EHPL +KP  H+ ++ F
Sbjct  239   RVISPSHRVIM--NGKIDRYSLALFAF--NKGILQVPEELVDEEHPLMYKPLDHIGLLHF  294

Query  981   FDSDKGRRSKNLLKDFCG  1034
             + +++G +SK  +K +CG
Sbjct  295   YRTEEGYKSKCPIKAYCG  312



>emb|CAN80139.1| hypothetical protein VITISV_028513 [Vitis vinifera]
Length=311

 Score =   327 bits (838),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 161/318 (51%), Positives = 235/318 (74%), Gaps = 8/318 (3%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS E P +L V++F+   LKPG+ SW  ACKD+  ALE++GCF+ + DKVS +L N+ F
Sbjct  1     MGS-EAP-RLPVLNFSTGTLKPGTRSWLLACKDVLHALEEYGCFVAVYDKVSSELDNTTF  58

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
                ++LFDLP E K+ NT++KPY GY+GQ P IP HE+ GI+ ATT++GV+SF+N+MW  
Sbjct  59    CQLEELFDLPTETKVKNTSDKPYFGYIGQHPLIPLHESMGIEDATTLKGVESFTNIMWPA  118

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN  F E+  S+SK+V+ELE+ V +M+FESY  EK+YDS+++ST YLLR +KY  P + +
Sbjct  119   GNDHFCETVLSYSKLVSELEQMVKKMVFESYDAEKYYDSHIQSTTYLLRLIKYRGP-QKN  177

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
             E  +   CHTDK+F+TVL+Q N+V GLE++ ++GEWIS +  PSS++VMAG+A+  WSN 
Sbjct  178   ETCIGTSCHTDKSFITVLHQ-NEVCGLEIRTKDGEWISFKPSPSSYVVMAGDALLAWSNG  236

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+ +P H+V M  NG + RYS+G+F++ +    IE+PEEL D+EHPLQFKPF H  ++ F
Sbjct  237   RIHSPEHRVIM--NGNKARYSIGLFAYHRG--IIEIPEELADEEHPLQFKPFNHYGLLHF  292

Query  981   FDSDKGRRSKNLLKDFCG  1034
             + ++K  ++++  K +CG
Sbjct  293   YFTNKAGQTESTAKAYCG  310



>ref|XP_002284974.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Vitis vinifera]
 emb|CBI36203.3| unnamed protein product [Vitis vinifera]
Length=311

 Score =   327 bits (837),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 161/318 (51%), Positives = 235/318 (74%), Gaps = 8/318 (3%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS E P +L V++F+   LKPG+ SW  ACKD+  ALE++GCF+ + DKVS +L N+ F
Sbjct  1     MGS-EAP-RLPVLNFSTGTLKPGTRSWLLACKDVLHALEEYGCFVAVYDKVSSELDNTTF  58

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
                ++LFDLP E K+ NT++KPY GY+GQ P IP HE+ GI+ ATT++GV+SF+N+MW  
Sbjct  59    CQLEELFDLPTETKVKNTSDKPYFGYIGQHPLIPLHESMGIEDATTLKGVESFTNIMWPA  118

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN  F E+  S+SK+V+ELE+ V +M+FESY  EK+YDS+++ST YLLR +KY  P + +
Sbjct  119   GNDHFCETVLSYSKLVSELEQMVKKMVFESYDAEKYYDSHIQSTTYLLRLIKYRGP-QKN  177

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
             E  +   CHTDK+F+TVL+Q N+V GLE++ ++GEWIS +  PSS++VMAG+A+  WSN 
Sbjct  178   ETCIGTSCHTDKSFITVLHQ-NEVCGLEIRTKDGEWISFKPSPSSYVVMAGDALLAWSNG  236

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+ +P H+V M  NG + RYS+G+F++ +    IE+PEEL D+EHPLQFKPF H  ++ F
Sbjct  237   RIHSPEHRVIM--NGNKARYSIGLFAYHRG--IIEIPEELADEEHPLQFKPFNHYGLLHF  292

Query  981   FDSDKGRRSKNLLKDFCG  1034
             + ++K  ++++  K +CG
Sbjct  293   YFTNKAGQAESTAKAYCG  310



>gb|EYU21585.1| hypothetical protein MIMGU_mgv1a010381mg [Erythranthe guttata]
Length=314

 Score =   327 bits (837),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 155/319 (49%), Positives = 235/319 (74%), Gaps = 7/319 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGSL    KL V++F++++LKPG+ SW+  C ++ +ALE +GCF+   DK++ + H ++F
Sbjct  1     MGSLSQEHKLDVIEFSDKNLKPGTESWSKTCNEVVSALEKYGCFVASYDKLTQETHTTVF  60

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              A ++LFDLP + K+ N + KP +GYVGQIPFIP +E+ GID+A T++G+Q+F+ +MW  
Sbjct  61    KALEELFDLPTQTKVQNKSTKPLYGYVGQIPFIPLYESMGIDNADTLQGIQNFAKVMWPN  120

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             G + FSE   S++K+ AELE+ V+RM+FE YGV KHY+S + S  YL R MKY  P +S+
Sbjct  121   GYNDFSEKLVSYTKLAAELEKIVVRMVFERYGVGKHYESLIGSANYLCRVMKYREP-KSN  179

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISA-QFPPSSFIVMAGEAIKGWSN  797
             ENN+ F  HTDK+FM+ ++Q NQV GLE++ ++G+W    Q   SS IVMAG+AI  WSN
Sbjct  180   ENNMGFVSHTDKSFMSTIHQ-NQVDGLEIKTKDGDWFGVHQLSSSSVIVMAGDAIMAWSN  238

Query  798   SRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIK  977
             +R+ +P H+VTM+A  K+ RYS+  FSFL+  KT+E+P+ELVD++HP+Q+KPF HL+ + 
Sbjct  239   NRIKSPHHRVTMEA--KKARYSIAQFSFLE--KTVEIPQELVDEDHPMQYKPFEHLEFLD  294

Query  978   FFDSDKGRRSKNLLKDFCG  1034
             F+  ++ RR ++ ++ +CG
Sbjct  295   FYSKEENRRLESAIRTYCG  313



>ref|XP_008377591.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP2 [Malus domestica]
Length=313

 Score =   325 bits (832),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 166/318 (52%), Positives = 221/318 (69%), Gaps = 6/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS E   KL V+DF+ E LKPG+ SW  ACKD++ ALE+ GCF+VL DK+S +  N+  
Sbjct  1     MGS-EVEQKLPVLDFSKEALKPGTNSWLLACKDVQRALEEFGCFVVLYDKISDEFRNAFV  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              + ++LFDLP E K+ N  EKP +GYVGQIP +P HE+ GID AT  E  + F+ LMW  
Sbjct  60    GSLEELFDLPTETKMTNKYEKPLNGYVGQIPKLPLHESLGIDCATNFEETKKFTKLMWPA  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN  F E + +F+K+  EL++ V RM+FESYGVEK+YDSYV S +YLLR ++   P E +
Sbjct  120   GNDKFCERAYAFAKVAEELDQMVARMIFESYGVEKYYDSYVGSISYLLRILQNRSPKE-N  178

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
             E+N+ F  HTDK+F TVLYQ NQV+ LEV+ RN EWI  +FPPSSFIVMAG+A+  WSN 
Sbjct  179   EHNLGFVAHTDKSFTTVLYQNNQVNALEVETRNHEWIKVEFPPSSFIVMAGDALMAWSND  238

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+L+P H+V M  +G E RYS+  F+F  +   I VPEEL D+E PL++K F H  +++F
Sbjct  239   RILSPNHRVIM--SGNETRYSLAQFAF--SDGEIHVPEELGDEERPLRYKSFDHPGLLRF  294

Query  981   FDSDKGRRSKNLLKDFCG  1034
             F S     S + +K +CG
Sbjct  295   FRSQDRYISNSAIKAYCG  312



>ref|XP_011045371.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Populus euphratica]
Length=313

 Score =   324 bits (831),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 156/318 (49%), Positives = 229/318 (72%), Gaps = 6/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS E P+KL ++DF  EDLKPG++SW  AC D+  ALE++GCF+V  +++  +L + +F
Sbjct  1     MGSNELPSKLPILDFAKEDLKPGTSSWLKACSDVTLALEEYGCFVVEYNRLPLELRDKVF  60

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
                ++LFDLP E K+ N  +KP +GYVGQI  +P HE+ GID+AT+++  Q+F++LMW  
Sbjct  61    GVLKELFDLPTETKMQNKYQKPLNGYVGQIAKLPLHESMGIDNATSLDATQNFTDLMWPN  120

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN  F E    ++ + AEL+  V RM+FESYGVEK++DSYVEST YLLR +K   P + D
Sbjct  121   GNDRFCEYVFKYANLAAELDRMVTRMVFESYGVEKYHDSYVESTTYLLRLLKNR-PPKVD  179

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
             E+N+ F  HTDK+F T+L+Q N+++GLEV  ++G+ I+ +  PSSF+V+AG+A+  WSN 
Sbjct  180   EHNLGFITHTDKSFTTILHQ-NEINGLEVDTKDGKKINVELSPSSFVVIAGDALMAWSND  238

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             RV++P H+V M  NGK  RYS+ +F+F  N   I+VPEELVD+EHPL +KP  H  ++ F
Sbjct  239   RVISPSHRVIM--NGKRDRYSLALFAF--NKGIIQVPEELVDEEHPLMYKPLDHTGLLHF  294

Query  981   FDSDKGRRSKNLLKDFCG  1034
             + +++G +SK  +K +CG
Sbjct  295   YRTEEGYKSKCPIKAYCG  312



>ref|XP_006392868.1| hypothetical protein EUTSA_v10011672mg [Eutrema salsugineum]
 gb|ESQ30154.1| hypothetical protein EUTSA_v10011672mg [Eutrema salsugineum]
Length=315

 Score =   323 bits (828),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 162/320 (51%), Positives = 231/320 (72%), Gaps = 8/320 (3%)
 Frame = +3

Query  81    MGSL-ETPTKLLVVDFNNE-DLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNS  254
             MGS+ ++ +K+ ++D  ++ DLKP +++W    K+   ALE+ GCF+V+ D V+ QL +S
Sbjct  1     MGSIVKSSSKVPILDLTSQQDLKPNTSTWRSISKEACEALEEFGCFVVVHDGVTQQLDDS  60

Query  255   IFHASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMW  434
             IF A+++LFDLP E K  N NEKPYHGYVGQ+P IP HE  GID+ T  E  Q F++LMW
Sbjct  61    IFAAAEELFDLPTETKRKNVNEKPYHGYVGQMPVIPLHEGLGIDYVTNKEYAQRFTHLMW  120

Query  435   SGGNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAE  614
               GNH F  +  +FS  VAE+++ V+RM+FE+YGVEKHYDS+V S  YLL+++KY  P E
Sbjct  121   PQGNHQFCATVHAFSNAVAEIDQLVVRMIFENYGVEKHYDSHVGSKTYLLKFLKYLAPPE  180

Query  615   SDENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWS  794
             S  +   FP HTDKTF+++L+Q N V+GLEV++++GEWIS Q P  S++VMAG+   GWS
Sbjct  181   SI-SMPAFPQHTDKTFLSILHQ-NDVNGLEVKSKDGEWISLQLPSKSYVVMAGDISMGWS  238

Query  795   NSRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMI  974
             N R+ +  H+VTMD  G + RYS G+FSF+  +  + VP+ELVDDEHPL +KPF ++ +I
Sbjct  239   NDRIRSCEHRVTMD--GGKTRYSFGLFSFV--TGMVSVPKELVDDEHPLMYKPFDNIALI  294

Query  975   KFFDSDKGRRSKNLLKDFCG  1034
              F+ + +GR +K+ LK +CG
Sbjct  295   NFYATKEGREAKSTLKAYCG  314



>emb|CDO98090.1| unnamed protein product [Coffea canephora]
Length=311

 Score =   322 bits (826),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 162/318 (51%), Positives = 229/318 (72%), Gaps = 8/318 (3%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGSL T  KL  +DF+ EDLKPG+T+W    K++ +ALE++GCF+   +K+ PQL +++F
Sbjct  1     MGSL-TLHKLPTIDFSKEDLKPGTTAWIKIRKEVMSALEEYGCFVASYEKI-PQLQDAVF  58

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              A ++LFDLP + K+ N + KP HGYVGQIP +P +E+ GID A T EG+Q+F+  MW  
Sbjct  59    GALEELFDLPSQIKMQNKSSKPMHGYVGQIPVVPLYESMGIDDANTSEGMQAFTYAMWPN  118

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN  FSE   +++K+ AELEE V+RM+FESYGVEK+YD++++S  YL R MKY   A+ +
Sbjct  119   GNEGFSEKLLAYTKLAAELEEIVVRMIFESYGVEKYYDNHLQSVGYLSRVMKYR-EAKEN  177

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
             E  + F  HTDK+FM+ ++Q NQV+GLE++A++GE+ S     SS +VMAG+AI  WSN+
Sbjct  178   ETKLGFVSHTDKSFMSTIHQ-NQVNGLEIKAKDGEYFSVDLSRSSVVVMAGDAIMAWSNN  236

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+ +P H+V M+  GK  RYS+  FSF+    T++ PEELVDDEHPLQFKPF HL+ + F
Sbjct  237   RIKSPHHQVIME--GKGPRYSIAQFSFMDG--TVQTPEELVDDEHPLQFKPFDHLEYLSF  292

Query  981   FDSDKGRRSKNLLKDFCG  1034
             F  ++ RR +  LK +CG
Sbjct  293   FSKEENRRLECALKTYCG  310



>gb|EYU21582.1| hypothetical protein MIMGU_mgv1a010360mg [Erythranthe guttata]
Length=314

 Score =   322 bits (826),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 159/318 (50%), Positives = 230/318 (72%), Gaps = 5/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGSLE PT L ++DF+ ++L+PGS SW    + +  ALED+GCFI    K SP++H SIF
Sbjct  1     MGSLENPT-LPIIDFSEKNLEPGSPSWFTTAEKVVHALEDYGCFIATYSKFSPEMHRSIF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
               S+QLFDLP + KILNT+  P HGYVGQ P IP +E  GI++ATT  GV++F++L+W  
Sbjct  60    GVSEQLFDLPTDVKILNTSGTPSHGYVGQEPIIPLYEGLGIENATTHTGVETFTSLLWPS  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GNH F E++  +S++VAELE++V+RM+ ++YG+E  Y S V +T+YLLR++KY  P + D
Sbjct  120   GNHHFGETALEYSRLVAELEQEVMRMVSKNYGIEDSYQSLVGATSYLLRFIKYRAPGK-D  178

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
             E  +    HTDK+FM++L+Q  QV GL++Q +NG+W+     PS F+VMAG+A   W+N 
Sbjct  179   ETGLGIVPHTDKSFMSILHQ-RQVKGLQIQTKNGDWLLVDPSPSYFVVMAGDACMAWTNG  237

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+    H+V +D  G E RYS+G+F+F+K+ K I+VPEELVDD++P +FKPF H   I F
Sbjct  238   RIEPSKHRVIID-EGSEDRYSLGLFTFIKDVK-IQVPEELVDDDNPSRFKPFDHYKYIHF  295

Query  981   FDSDKGRRSKNLLKDFCG  1034
             + +++G+RSK  +KD+CG
Sbjct  296   YYTEEGKRSKCPIKDYCG  313



>ref|XP_002517548.1| Gibberellin 20 oxidase, putative [Ricinus communis]
 gb|EEF44712.1| Gibberellin 20 oxidase, putative [Ricinus communis]
Length=313

 Score =   322 bits (826),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/319 (50%), Positives = 232/319 (73%), Gaps = 8/319 (3%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKV-SPQLHNSI  257
             MGS   P KL V+DF  E+LKPG++ WA AC ++R ALE++GCFIV  + + SP+L + +
Sbjct  1     MGSAAQP-KLPVLDFTLENLKPGTSCWAKACGEVRQALEEYGCFIVEYNNILSPKLRDGV  59

Query  258   FHASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWS  437
             F++ ++LFDLP E K+ N  +KP +GYVGQI  +P HE+ GID+AT +E  Q F+ LMW 
Sbjct  60    FNSLKELFDLPTETKMQNKYQKPLNGYVGQIAKLPLHESMGIDNATCLEATQDFTTLMWP  119

Query  438   GGNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAES  617
              GN +F E    ++K+ AE+++ V RM+FESYG EK++DSYVEST YLLR +K  +P + 
Sbjct  120   DGNDNFCECVYEYAKLTAEIDQMVTRMIFESYGAEKYHDSYVESTNYLLRLLKNRLP-KG  178

Query  618   DENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSN  797
             DE N+ F  HTDK+F T+L+Q N ++GLEV  ++G+ I+ +F PSSF+V+AG+A+  WSN
Sbjct  179   DEPNLGFITHTDKSFTTILHQ-NHINGLEVDTKDGQKINIEFSPSSFVVIAGDALMVWSN  237

Query  798   SRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIK  977
              R+++P H+V +  NGKE RYS+G+F+F  NS  I VPEEL+D +HPL +KP  H+ ++ 
Sbjct  238   DRIISPSHRVII--NGKEDRYSMGLFAF--NSGIIRVPEELIDKDHPLMYKPLDHIGLLY  293

Query  978   FFDSDKGRRSKNLLKDFCG  1034
             F+ +D+G +SK  +K FCG
Sbjct  294   FYRTDEGYKSKCPVKAFCG  312



>ref|XP_010463426.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Camelina sativa]
Length=320

 Score =   322 bits (824),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 159/320 (50%), Positives = 226/320 (71%), Gaps = 7/320 (2%)
 Frame = +3

Query  78    NMGSLETPTKLLVVDFNNE-DLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNS  254
             NM S+   TK+ ++DF  E DLKP +++W    +    ALE++GCF+ + D V+ QL NS
Sbjct  4     NMESILNTTKVPILDFTREQDLKPRTSAWRSISRAACEALEEYGCFVAVYDGVTQQLDNS  63

Query  255   IFHASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMW  434
             +F A++ LFDLP E K+ N NEKPYHGYVGQ+P IP HE  GID+ T  E  + F+NLMW
Sbjct  64    VFAAAKDLFDLPTETKMKNVNEKPYHGYVGQMPIIPLHEGLGIDYVTNKEDAKKFTNLMW  123

Query  435   SGGNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAE  614
               GN  F ++   FS  VAEL+  V+R++FE+YGVEKHY+S+V++  YLL+++ Y  P E
Sbjct  124   PQGNDQFCKTIHRFSNAVAELDRLVVRIIFENYGVEKHYESHVKAKTYLLKFLMYLAPPE  183

Query  615   SDENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWS  794
             S  +   FP HTDKTF+T+L+Q N V+GLEV++++GEWIS Q P  S++VMAG+   GWS
Sbjct  184   SI-SMPAFPQHTDKTFLTILHQ-NDVNGLEVKSKDGEWISLQLPLKSYVVMAGDISMGWS  241

Query  795   NSRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMI  974
             N R+ +  H+VTM+  G + RY++G+FSF+  S  + +PEELVDDEHPL +KPF ++ +I
Sbjct  242   NDRIRSCEHRVTME--GDKVRYTIGLFSFVTGS--VSIPEELVDDEHPLMYKPFNNIALI  297

Query  975   KFFDSDKGRRSKNLLKDFCG  1034
              FF + +GR + + LK +CG
Sbjct  298   NFFATKEGREANSTLKAYCG  317



>ref|XP_011045368.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Populus euphratica]
Length=313

 Score =   320 bits (821),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 161/319 (50%), Positives = 232/319 (73%), Gaps = 8/319 (3%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             M SL +P +L V+DF+ E+LKPG++SW   CKD+  ALE++GCF+ + DKV   LHN +F
Sbjct  1     MDSL-SPPELPVIDFSKENLKPGTSSWLSTCKDVMYALEEYGCFVAVYDKVPLTLHNDLF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIP-YHEAFGIDHATTIEGVQSFSNLMWS  437
                + LFDLP E K  N ++ PY+GYVG  PF+P  +E  GID+A  +EG + F++ MW 
Sbjct  60    STLKDLFDLPLETKRKNVSDLPYYGYVGNQPFVPSLYEGMGIDNAIALEGTEDFADTMWP  119

Query  438   GGNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAES  617
             GGN  F ++  S+S +V+ELE+ V+RM+FESYGV +H+DS+ EST YL R MKY  P E 
Sbjct  120   GGNDHFCKTVLSYSMLVSELEQMVVRMVFESYGVYQHHDSHKESTTYLFRMMKYRGP-EK  178

Query  618   DENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSN  797
             +E NV    HTDK+F+TVL+Q NQVSGLEV++++G+W+  +  PSSFIVMAG+A+ GWSN
Sbjct  179   NEANVGCDAHTDKSFITVLHQ-NQVSGLEVKSKDGQWMGFKPSPSSFIVMAGDALLGWSN  237

Query  798   SRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIK  977
              R+ AP H+V M  +  E RYSVG+FSF+K    I+VPE+L+D+++PL+FKPF +  +++
Sbjct  238   DRINAPFHRVVMSES--EPRYSVGLFSFIKG--IIKVPEKLIDEKNPLRFKPFENFGLLR  293

Query  978   FFDSDKGRRSKNLLKDFCG  1034
             +F +++GR  +  +K +CG
Sbjct  294   YFITEEGRGKEFTIKAYCG  312



>ref|XP_010500899.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
isoform X1 [Camelina sativa]
Length=320

 Score =   320 bits (821),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 161/320 (50%), Positives = 225/320 (70%), Gaps = 7/320 (2%)
 Frame = +3

Query  78    NMGSLETPTKLLVVDFNNE-DLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNS  254
             NM S+   TK+ ++DF  E DLKP +++W    +D   ALE++GCF+ + D ++ QL +S
Sbjct  4     NMESILNTTKVPILDFTREQDLKPRTSAWRSISRDACEALEEYGCFVAVYDGITQQLDDS  63

Query  255   IFHASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMW  434
             +F A++ LFDLP E K+ N NEKPYHGYVGQ+P IP HE  GID+ T  E  + F+NLMW
Sbjct  64    VFAAAKDLFDLPTETKMKNVNEKPYHGYVGQMPIIPLHEGLGIDYVTNKEDAKKFTNLMW  123

Query  435   SGGNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAE  614
               GN  F ++  SFS  VAEL+  V+RMLFE+Y VEK+Y+S+ ES  YLL+++ Y  P E
Sbjct  124   PQGNDQFCKTIHSFSNAVAELDRLVVRMLFENYDVEKYYESHFESKTYLLKFLMYLAPPE  183

Query  615   SDENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWS  794
             S  +   FP HTDKTF+T+L+Q N V+GLEV++++GEWIS Q P  S++VMAG+   GWS
Sbjct  184   S-VSMPAFPQHTDKTFLTILHQ-NDVNGLEVKSKDGEWISLQLPLQSYVVMAGDISMGWS  241

Query  795   NSRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMI  974
             N R+ +  H+VTM   G + RY++G+FSFL  S  + +PEELVDDEHPL +KPF ++ +I
Sbjct  242   NDRIRSCEHRVTM--VGDKVRYTIGLFSFLTGS--VSIPEELVDDEHPLMYKPFNNIALI  297

Query  975   KFFDSDKGRRSKNLLKDFCG  1034
              FF + +GR + + LK +CG
Sbjct  298   NFFATKEGREANSTLKAYCG  317



>gb|KFK35767.1| hypothetical protein AALP_AA4G033600 [Arabis alpina]
Length=313

 Score =   319 bits (818),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 157/312 (50%), Positives = 227/312 (73%), Gaps = 7/312 (2%)
 Frame = +3

Query  102   TKLLVVDFNNE-DLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQQL  278
             +K+ ++D  ++ DLKP +++W    K+   ALE++GCF+ + D V+ QL +S F A+++L
Sbjct  7     SKVPILDLTSQQDLKPNTSTWRSISKEACEALEEYGCFVAVYDGVTKQLDDSAFAAAKEL  66

Query  279   FDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHsfs  458
             FDLP E K  N NEKPYHGYVGQ+P IP HE  GID+ T  E  Q F++LMW  GNH F 
Sbjct  67    FDLPTETKRKNVNEKPYHGYVGQMPIIPLHEGLGIDYITNKEDAQRFTHLMWPQGNHHFC  126

Query  459   essqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNVVF  638
             E+ Q+FS  VAEL++ V+RM+FE+YGVEK+Y+S+VES  YLL+++KY  P ES      F
Sbjct  127   ETVQAFSTAVAELDKLVVRMIFENYGVEKNYESHVESKTYLLKFLKYLAPPESTSMQ-AF  185

Query  639   PCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRVLAPI  818
             P HTDKTF+++L+Q N V+GLEV++++GEWIS Q PP S++VMAG+   GWSN R+ +  
Sbjct  186   PQHTDKTFLSILHQ-NDVNGLEVKSKDGEWISLQLPPKSYVVMAGDISMGWSNDRIRSCE  244

Query  819   HKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSDKG  998
             H+VTM+  G + RY++G+FSF+  +  + VPE+LVDDEHPL +KPF ++ +I F+ + +G
Sbjct  245   HRVTME--GDKTRYTLGLFSFV--TGMVSVPEDLVDDEHPLMYKPFDNIALINFYATKEG  300

Query  999   RRSKNLLKDFCG  1034
             R + + LK +CG
Sbjct  301   REANSTLKAYCG  312



>ref|XP_006306220.1| hypothetical protein CARUB_v10011908mg [Capsella rubella]
 gb|EOA39118.1| hypothetical protein CARUB_v10011908mg [Capsella rubella]
Length=315

 Score =   319 bits (818),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 157/316 (50%), Positives = 228/316 (72%), Gaps = 7/316 (2%)
 Frame = +3

Query  90    LETPTKLLVVDFNNE-DLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHA  266
             L+T +K+ ++DF ++ DLKP +++W    ++   ALE++GCF+ + D V+ +L +++F A
Sbjct  5     LKTTSKVPILDFTSQQDLKPNTSAWRSISREACEALEEYGCFVAVYDGVTQKLEDNVFAA  64

Query  267   SQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGN  446
             ++ LF LP E K+ N NEKPYHGYVGQ+P IP HE  GID+ T  E  Q F+NLMW  GN
Sbjct  65    AKDLFHLPTETKMKNVNEKPYHGYVGQMPIIPLHEGLGIDYVTNKEDAQRFTNLMWPQGN  124

Query  447   HsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDEN  626
               F ++  SFS  VAEL++ V+RM+FE+YGVEKHY+S+V S  YLL+++ Y  P ES  +
Sbjct  125   DQFCKTIHSFSNAVAELDKLVVRMIFENYGVEKHYESHVGSKTYLLKFLMYLAPPESI-S  183

Query  627   NVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRV  806
                FP HTDKTF+T+L+Q N V+GLEV++++GEWIS Q P  S++VMAG+   GWSN R+
Sbjct  184   MPAFPQHTDKTFLTILHQ-NDVNGLEVKSKDGEWISLQLPLKSYVVMAGDISMGWSNDRI  242

Query  807   LAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFD  986
              + +H+VTM+  G + RYS+G+FSFL  +  + +PEELVDDEHPL +KPF ++ +I FF 
Sbjct  243   RSCVHRVTME--GDKVRYSIGLFSFL--TGLVSIPEELVDDEHPLMYKPFDNIALINFFA  298

Query  987   SDKGRRSKNLLKDFCG  1034
             + +GR + + LK +CG
Sbjct  299   TKEGRETNSTLKAYCG  314



>emb|CDP10326.1| unnamed protein product [Coffea canephora]
Length=313

 Score =   318 bits (816),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 161/318 (51%), Positives = 233/318 (73%), Gaps = 6/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             M SL T   L V+DF  ++L P S+ W    + +  ALED+GCFI L D+V+ +L+ +IF
Sbjct  1     MCSL-TQNYLPVIDFTKKNLDPSSSFWPSTRQAVVRALEDYGCFIALYDEVTLELNEAIF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              AS++LFDLP E K+LNT+  P HGYVGQ P IP +E  GI++ATT++GV+ F+NL+W  
Sbjct  60    RASEELFDLPTEIKVLNTSNTPSHGYVGQEPIIPLYEGLGIENATTLDGVEKFTNLLWPN  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GNHSFSE++ S+SKIVAEL++ V+RM+ E+YG+EK+Y+S + S +YLLR +KY  P E++
Sbjct  120   GNHSFSETAFSYSKIVAELDQMVMRMVSEAYGIEKNYESLLGSMSYLLRLIKYRRPHENE  179

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
             +N  + P HTDK+FM++L Q +QV GLE++ ++GEW+     P SFIVMAG+    W+N 
Sbjct  180   KNLGIVP-HTDKSFMSILQQ-DQVKGLEIKTKDGEWMVIDPSPFSFIVMAGDVCMAWTNG  237

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+  P H+V M  N   +RYS+G+F+F+++   ++VPEELVDDEHPLQFKPF H   I +
Sbjct  238   RIEPPHHRVVMTENA--ERYSLGLFTFIRD-LIVQVPEELVDDEHPLQFKPFDHYKYIDY  294

Query  981   FDSDKGRRSKNLLKDFCG  1034
             + +D+G+RSK  ++D+CG
Sbjct  295   YYTDEGKRSKCPIRDYCG  312



>ref|XP_010481152.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Camelina sativa]
Length=404

 Score =   321 bits (823),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 159/322 (49%), Positives = 226/322 (70%), Gaps = 7/322 (2%)
 Frame = +3

Query  69    KKKNMGSLETPTKLLVVDFNNE-DLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQL  245
             K  NM S+   TK+ ++DF ++ DLKP ++ W    +D   ALE++GCF+ + D V+ QL
Sbjct  87    KYPNMKSILKTTKVPILDFTSQQDLKPNTSVWRSISRDACEALEEYGCFVAVYDGVTQQL  146

Query  246   HNSIFHASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSN  425
              +S+F A++ LFDLP E K+ N NEKPYHGYVGQ+P IP HE  GID+ T  E  + F+N
Sbjct  147   DDSVFAAAKDLFDLPAETKMKNVNEKPYHGYVGQMPIIPLHEGLGIDYVTNKEDAKKFTN  206

Query  426   LMWSGGNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEV  605
             LMW  GN  F ++  +FS  VAEL+  V+RM+FE YGV+K+Y+S+ ES  YLL+++ Y  
Sbjct  207   LMWPQGNDRFCKTIHAFSNAVAELDRLVVRMIFEIYGVKKYYESHFESKTYLLKFLMYLA  266

Query  606   PAESDENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIK  785
             P ES  +   FP HTDKTF+T+L+Q N V+GLEV++++GEWIS Q P  S++VMAG+   
Sbjct  267   PPES-VSMPAFPQHTDKTFLTILHQ-NDVNGLEVKSKDGEWISLQLPLKSYVVMAGDISM  324

Query  786   GWSNSRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHL  965
             GWSN R+ +  H+VTM+  G + RY++G+FSFL  S  + +PEELVDDEHPL +KPF ++
Sbjct  325   GWSNDRIRSCEHRVTME--GDKVRYTIGLFSFLTGS--VSIPEELVDDEHPLMYKPFTNI  380

Query  966   DMIKFFDSDKGRRSKNLLKDFC  1031
              +I FF + +GR + + LK +C
Sbjct  381   ALINFFATKEGREANSTLKAYC  402


 Score = 72.4 bits (176),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 53/80 (66%), Gaps = 1/80 (1%)
 Frame = +3

Query  81   MGSLETPTKLLVVDFNNE-DLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSI  257
            M S+   TK+ ++DF ++ DLKP ++ W    +D   ALE++GCF+ + D V+ QL +S+
Sbjct  1    MKSILKTTKVPILDFTSQQDLKPNTSVWRSISRDACEALEEYGCFVAVYDGVTQQLDDSV  60

Query  258  FHASQQLFDLPFEKKILNTN  317
            F A++ LFDLP E K+ N N
Sbjct  61   FAAAKDLFDLPAETKMKNVN  80



>ref|XP_008226092.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP2-like [Prunus 
mume]
Length=315

 Score =   318 bits (814),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 163/320 (51%), Positives = 221/320 (69%), Gaps = 8/320 (3%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNED--LKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNS  254
             MGS   P KL V+DF+ E   LKPG+ SW  ACKD+R ALE+ GCF V  DK+ P+  N 
Sbjct  1     MGSDGQP-KLPVLDFSKEAEALKPGTNSWLSACKDVRQALEEFGCFFVSYDKLPPEFQNG  59

Query  255   IFHASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMW  434
                A Q+LFDLP + K+ N +E P  GY GQIP +P HE  GI++AT +E  Q F+ LMW
Sbjct  60    FLGALQELFDLPTQTKMTNKSENPSSGYFGQIPSLPLHEGLGIENATNLEETQKFTKLMW  119

Query  435   SGGNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAE  614
             +GGN +F ES+ SF+K+  EL + V RM+FESYG+EK+YDSYV S +YLLR +K   P E
Sbjct  120   AGGNDNFCESTHSFAKVAEELNQMVTRMIFESYGMEKYYDSYVGSVSYLLRLLKNRTPQE  179

Query  615   SDENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWS  794
              +E ++ F  HTDK+F T+LYQ NQ  GLEV+ ++ EWI A+FPPSSF+VMAG+A+  WS
Sbjct  180   -NEPSLGFVAHTDKSFTTLLYQNNQAHGLEVETKSHEWIRAEFPPSSFLVMAGDALMAWS  238

Query  795   NSRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMI  974
             N R+L+P H+V M  +G E RYS+  F+F  +   I VPEEL D++HPL++K F H  ++
Sbjct  239   NDRILSPNHRVIM--SGNEARYSLAQFAF--SDGEIHVPEELADEQHPLRYKSFDHPGLL  294

Query  975   KFFDSDKGRRSKNLLKDFCG  1034
              FF +++   S + +K +CG
Sbjct  295   VFFRTNESYISNSAIKAYCG  314



>ref|XP_006427132.1| hypothetical protein CICLE_v10027083mg [Citrus clementina]
 gb|ESR40372.1| hypothetical protein CICLE_v10027083mg [Citrus clementina]
 gb|KDO58209.1| hypothetical protein CISIN_1g043442mg [Citrus sinensis]
Length=309

 Score =   317 bits (813),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 155/312 (50%), Positives = 222/312 (71%), Gaps = 8/312 (3%)
 Frame = +3

Query  105   KLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDK--VSPQLHNSIFHASQQL  278
             KL VVDF+N+DLKPG+ SW  AC D+R ALE+ GCFI+ C+   +S +  + +F A + L
Sbjct  3     KLPVVDFSNKDLKPGTNSWIKACNDVRQALEEFGCFIIECNHNLISSEFRSEVFGALKNL  62

Query  279   FDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHsfs  458
             FDLP E K+ N  E+P  GYVGQIP +P HE+ GID+AT++E  QSF+ +MW  GN SF 
Sbjct  63    FDLPTETKMKNKYERPLTGYVGQIPKLPLHESMGIDNATSLEAAQSFTKIMWPQGNDSFC  122

Query  459   essqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNVVF  638
             +   S++ + AEL+  V RM+FESY +EK++DSY+ES  YLLR +K   P    E N+ F
Sbjct  123   KIVHSYATLAAELDRTVSRMIFESYSLEKYHDSYIESITYLLRVLKNRAPI-GGEPNLGF  181

Query  639   PCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRVLAPI  818
               HTDK+F T+L+Q NQ++GLE+  R+G+ I+ +  PSSF+V+AG+A+  WSN R+ +P 
Sbjct  182   VTHTDKSFTTILHQ-NQINGLEIDTRDGQKINVELSPSSFVVVAGDALMAWSNDRIHSPS  240

Query  819   HKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSDKG  998
             H+V M  NG   RYS+ +FSF  +S  ++VP+ELVDDEHPL++KPF H  ++++F +D+G
Sbjct  241   HRVIM--NGAVDRYSLALFSF--SSGIVKVPDELVDDEHPLKYKPFEHFGLLRYFRTDEG  296

Query  999   RRSKNLLKDFCG  1034
              +SK  +K +CG
Sbjct  297   YKSKCPIKAYCG  308



>ref|NP_175689.1| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis 
thaliana]
 gb|AAG52291.1|AC019018_28 putative oxidoreductase; 33116-34434 [Arabidopsis thaliana]
 gb|AAY78650.1| oxidoreductase [Arabidopsis thaliana]
 gb|AEE32853.1| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis 
thaliana]
Length=314

 Score =   317 bits (812),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 155/319 (49%), Positives = 227/319 (71%), Gaps = 7/319 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNE-DLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSI  257
             M S+   TK+ ++D  ++ +LKP +++W    ++   ALE++GCF+ + D V+ QL +SI
Sbjct  1     MASILKTTKVPILDLTSQQELKPNTSTWRSVSREACEALEEYGCFLAVYDGVTQQLDDSI  60

Query  258   FHASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWS  437
             F A+++LFDLP E K  N NEKPYHGYVGQ+P IP HE  G+D+ T  E  Q F++LMW 
Sbjct  61    FAAAEELFDLPTETKKKNVNEKPYHGYVGQMPVIPLHEGLGVDYVTNKEIAQRFTHLMWP  120

Query  438   GGNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAES  617
              GN  F  +  +FS  VAEL+  V+RM+FE+YGVEKHY+S+V S  YLL+++KY  P ES
Sbjct  121   QGNDRFCNTVHTFSNAVAELDRLVVRMIFENYGVEKHYESHVGSKTYLLKFLKYLAPPES  180

Query  618   DENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSN  797
               +   FP HTDKTF+++L+Q N V+GLEV++++GEWIS Q PP S++VMAG+   GWSN
Sbjct  181   I-SMPAFPQHTDKTFLSILHQ-NDVNGLEVKSKDGEWISLQLPPKSYVVMAGDISMGWSN  238

Query  798   SRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIK  977
              R+ +  H+VTM+  G + RY++G+FSFL +   + +PEELVDD+HPL +KPF ++ +I 
Sbjct  239   DRIRSCEHRVTME--GDKTRYTLGLFSFLTD--LVSIPEELVDDKHPLMYKPFDNIALIN  294

Query  978   FFDSDKGRRSKNLLKDFCG  1034
             F+ + +GR + + LK +CG
Sbjct  295   FYTTKEGREANSTLKAYCG  313



>ref|XP_006465514.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1-like, 
partial [Citrus sinensis]
Length=314

 Score =   317 bits (811),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 156/316 (49%), Positives = 222/316 (70%), Gaps = 8/316 (3%)
 Frame = +3

Query  93    ETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDK--VSPQLHNSIFHA  266
             E   KL VVDF+N+DLKPG+ SW  AC D+R ALE+ GCFI+ C+   +S +  + +F A
Sbjct  4     EAMLKLPVVDFSNKDLKPGTNSWIKACNDVRQALEEFGCFIIECNHNLISSEFRSEVFGA  63

Query  267   SQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGN  446
              + LFDLP E K+ N  E+P  GYVGQIP +P HE+ GID+AT++E  QSF+ +MW  GN
Sbjct  64    LKNLFDLPSETKMKNKYERPLTGYVGQIPKLPLHESMGIDNATSLEAAQSFTKIMWPQGN  123

Query  447   HsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDEN  626
              SF +   S++ + AEL+  V RM+FESY +EK++DSY+ES  YLLR +K   P    E 
Sbjct  124   DSFCKIVNSYATLAAELDRTVSRMIFESYSLEKYHDSYIESITYLLRVLKNRAPI-GGEP  182

Query  627   NVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRV  806
             N+ F  HTDK+F T+L+Q NQ++GLE+  R+G+ I+    PSSF+V+AG+A+  WSN R+
Sbjct  183   NLGFVTHTDKSFTTILHQ-NQINGLEIDTRDGQKINVGLSPSSFVVVAGDALMAWSNDRI  241

Query  807   LAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFD  986
              +P H+V M  NG   RYS+ +FSF  +S  ++VP+ELVDDEHPL++KPF H  ++++F 
Sbjct  242   HSPSHRVIM--NGAVDRYSLALFSF--SSGIVKVPDELVDDEHPLKYKPFEHFGLLRYFR  297

Query  987   SDKGRRSKNLLKDFCG  1034
             +D+G +SK  +K +CG
Sbjct  298   TDEGYKSKCPIKAYCG  313



>ref|XP_007214491.1| hypothetical protein PRUPE_ppa020361mg [Prunus persica]
 gb|EMJ15690.1| hypothetical protein PRUPE_ppa020361mg [Prunus persica]
Length=315

 Score =   316 bits (810),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 162/320 (51%), Positives = 220/320 (69%), Gaps = 8/320 (3%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNED--LKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNS  254
             MGS   P KL V+DF+ E   LKPG+ SW  ACKD+R ALE+ GCF V  DK+ P+  N 
Sbjct  1     MGSDGQP-KLPVLDFSKEAEALKPGTNSWVSACKDVRQALEEFGCFFVSYDKLPPEFQNG  59

Query  255   IFHASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMW  434
                  ++LFDLP + K+ N +E P  GY GQIP +P HE  GI++AT +E  Q F+ LMW
Sbjct  60    FLGTLKELFDLPTQTKMTNKSENPSSGYFGQIPSLPLHEGLGIENATNLEETQKFTKLMW  119

Query  435   SGGNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAE  614
              GGN +F ES+ SF+K+  EL++ V RM+FESYG+EK+YDSYV S +YLLR +K   P E
Sbjct  120   PGGNDNFCESAHSFAKVAEELDQMVTRMIFESYGMEKYYDSYVGSVSYLLRLLKNRTPQE  179

Query  615   SDENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWS  794
              +E ++ F  HTDK+F T+LYQ NQ  GLEV+ ++ EWI A+FPPSSF+VMAG+A+  WS
Sbjct  180   -NEPSLGFVAHTDKSFTTLLYQNNQAHGLEVETKSHEWIRAEFPPSSFLVMAGDALMAWS  238

Query  795   NSRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMI  974
             N R+L+P H+V M  NG E RYS+  F+F  +   I VPEEL D++HPL++K F H  ++
Sbjct  239   NDRILSPNHRVIM--NGNEARYSLAQFAF--SDGEIHVPEELADEQHPLRYKSFDHPGLL  294

Query  975   KFFDSDKGRRSKNLLKDFCG  1034
              FF +++   S + +K +CG
Sbjct  295   VFFRTNESYVSNSAIKAYCG  314



>emb|CDP17011.1| unnamed protein product [Coffea canephora]
Length=313

 Score =   316 bits (809),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 168/318 (53%), Positives = 226/318 (71%), Gaps = 6/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGSL    KL V+DF  ++L PGS+SW    + +  ALE++GCFI L DKVS +LH +IF
Sbjct  1     MGSL-AQHKLPVIDFTKKNLDPGSSSWLSTRQAVVGALEEYGCFIALYDKVSLELHEAIF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              AS+ LFDLP E K+LNT  KP  GYVGQ P  P +E+ GID AT+I+GVQ F+ LMW  
Sbjct  60    RASEDLFDLPTETKLLNTCHKPAPGYVGQNPRFPLYESLGIDDATSIDGVQKFTTLMWPN  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN SF ES+ S+SK+VAEL++ V+RM+ E+YGVEK Y++ + ST+YLLR +KY  P E++
Sbjct  120   GNDSFCESASSYSKLVAELDQMVMRMVSETYGVEKSYETLLGSTSYLLRLIKYREPQENE  179

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
              N  + P HTDK+FM++L Q +QV GLE++ ++G W+     PSSFI+MAGEA   W+N 
Sbjct  180   TNLGIVP-HTDKSFMSILQQ-HQVKGLEIKTKDGRWMEIDPFPSSFIIMAGEAFMAWTNG  237

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+ AP H+V M  N   +RYSVG+F+F+ +   I+VPEELVD EHPLQFKPF H    +F
Sbjct  238   RIEAPHHRVIMPGNA--ERYSVGLFTFIWD-LLIQVPEELVDVEHPLQFKPFDHHKFHQF  294

Query  981   FDSDKGRRSKNLLKDFCG  1034
               +++G RSK  +K +CG
Sbjct  295   HTTEEGMRSKCAIKSYCG  312



>gb|AFC36356.1| 2-oxoglutarate-dependent dioxygenase [Salvia miltiorrhiza]
Length=316

 Score =   316 bits (809),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 154/319 (48%), Positives = 222/319 (70%), Gaps = 7/319 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS ET  KL V++F +++  P + SW+  CK +  ALE++GCF+ + DK++ ++H   F
Sbjct  1     MGS-ETVHKLGVIEFTDKNTNPETESWSETCKKVVDALEEYGCFVAVYDKLTHEIHKQAF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              + QQLFDLP + K+ N + KP +GYVGQIPF+P +E+ GID A TI+G+Q+FSN+MW  
Sbjct  60    SSLQQLFDLPTQTKVQNKSSKPLYGYVGQIPFLPLYESMGIDDAHTIQGIQNFSNVMWHN  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN +F E+   ++K+ AE+E   +RM+ ESYGV KHYDSYVES  YL R MKY  P +  
Sbjct  120   GNPAFDENLVVYTKLAAEVERIAVRMVCESYGVGKHYDSYVESANYLCRVMKYREP-KIG  178

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISA-QFPPSSFIVMAGEAIKGWSN  797
             EN + F  HTDK+FM+ ++Q NQV GL+++A++GEW +     PSS IVMAG+AI  WSN
Sbjct  179   ENKMAFVTHTDKSFMSTIHQ-NQVDGLQIKAKDGEWFTVHHLSPSSIIVMAGDAIMAWSN  237

Query  798   SRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIK  977
              R+ +P H+VTM+ N  E RYS+  FSF++    +  P+E VD++HPLQ+KPF HL  + 
Sbjct  238   KRIKSPHHRVTMEGN--EARYSIAQFSFMEKD-MVATPDEFVDEDHPLQYKPFDHLKFLD  294

Query  978   FFDSDKGRRSKNLLKDFCG  1034
             FF  ++ RR ++ +  +CG
Sbjct  295   FFSQEENRRLESAITTYCG  313



>ref|XP_006427129.1| hypothetical protein CICLE_v10027545mg, partial [Citrus clementina]
 gb|ESR40369.1| hypothetical protein CICLE_v10027545mg, partial [Citrus clementina]
Length=339

 Score =   316 bits (810),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 155/332 (47%), Positives = 232/332 (70%), Gaps = 9/332 (3%)
 Frame = +3

Query  45    VNIYIELRKKKNMGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLC  224
             ++  ++ + K  MGS E   KL +VD + E+LKPGS+SW  AC +IR ALE++GCF+ L 
Sbjct  14    LSCLVQRQSKAKMGS-EAAQKLPIVDLSQENLKPGSSSWQTACNEIRLALEEYGCFVALY  72

Query  225   DKVSPQLHNSIFHASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIE  404
             DK+ P+  N +F + ++LFDLP E K+ N N KP HGY+G+I   P HE  GI++AT   
Sbjct  73    DKLLPEFRNKVFDSLEELFDLPQETKMKNVNPKPAHGYMGKISAFPLHEGMGIEYATNRG  132

Query  405   GVQSFSNLMWSGGNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLL  584
               + F++LMW  GN+ F E + +++ IVAEL++ V++MLFESYGVEK Y+S  EST YLL
Sbjct  133   ECEKFTSLMWPQGNYQFCEVAHTYANIVAELQQLVMKMLFESYGVEKLYESQKESTTYLL  192

Query  585   RYMKYEVPAESDENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIV  764
             R++KY   +++D  N+ F  HTDK+ +++L+  N V GLE++ ++GEWI  +  PSSF++
Sbjct  193   RFLKYR-KSQTDTTNLAFKGHTDKSLVSILHS-NHVKGLELRTKDGEWIHFEPSPSSFVI  250

Query  765   MAGEAIKGWSNSRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQ  944
             +AG+    WSN R+ +  H+V +D  G E RY++G+FSFL  S  I+ PEELVDDEHPLQ
Sbjct  251   IAGDVCMAWSNDRIKSCYHRVIVD--GPEVRYALGLFSFL--SGVIQTPEELVDDEHPLQ  306

Query  945   FKPFVHLDMIKFF--DSDKGRRSKNLLKDFCG  1034
             +KPF H  +++F+  +SD+ +  +N++K +CG
Sbjct  307   YKPFDHAGLLQFYLSNSDQNKGERNMMKAYCG  338



>ref|XP_006465516.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP2-like [Citrus 
sinensis]
 ref|XP_006495319.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP2-like [Citrus 
sinensis]
Length=315

 Score =   315 bits (807),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 158/320 (49%), Positives = 237/320 (74%), Gaps = 10/320 (3%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGSL  P KL VV+ + E+LKPG++SW    + +R ALE+ GCF+ L D+VS +LHN+IF
Sbjct  1     MGSLSVP-KLPVVNLSKENLKPGASSWLGTSRKVREALEEFGCFVALYDEVSLELHNAIF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIP-YHEAFGIDHATTIEGVQSFSNLMWS  437
              A+++LF+LP E K  N +EKPY+GY+G  P +P  +E  G+D+A TIEG Q+F+NL+W 
Sbjct  60    SAAEELFNLPIEIKEKNVSEKPYYGYLGNNPLVPAIYEGMGVDYANTIEGTQNFTNLIWP  119

Query  438   GGNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAES  617
              GN +F ++  S+S++V+ELE+ V RM+FESYGV+++YDS +ES+ YLLR MKY  P E+
Sbjct  120   EGNENFCKTVVSYSRLVSELEQMVKRMVFESYGVDQYYDSVLESSTYLLRIMKYRCP-ET  178

Query  618   DENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFP-PSSFIVMAGEAIKGWS  794
             +ENN+    HTDK+F+TVL+Q N+V+ LE++ ++G WI    P PSSFIV+AG+A   WS
Sbjct  179   NENNLGCDVHTDKSFITVLHQ-NEVNVLEIRTKDGCWIGFNDPTPSSFIVLAGDAFLAWS  237

Query  795   NSRVLAPIHKVTMDANG-KEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDM  971
             N R+ +P+H+V +  NG K+ RYS+G+F++  N   I++PEELVDDEHPL+FK F H  +
Sbjct  238   NGRIHSPVHRVIL--NGIKQARYSLGLFTY--NDGIIQIPEELVDDEHPLKFKSFEHFGL  293

Query  972   IKFFDSDKGRRSKNLLKDFC  1031
             ++++  ++G++++   K +C
Sbjct  294   LRYYLKEEGQKAECTAKAYC  313



>ref|XP_010061960.1| PREDICTED: probable inactive 2-oxoglutarate-dependent dioxygenase 
AOP2 [Eucalyptus grandis]
Length=318

 Score =   315 bits (807),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 153/307 (50%), Positives = 217/307 (71%), Gaps = 5/307 (2%)
 Frame = +3

Query  114   VVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQQLFDLPF  293
             V+DFN +DLK G+++W    K +   LE+ GCFI L   V P+L ++ F A+ +LFDLP 
Sbjct  11    VIDFNGKDLKQGTSAWDSTMKQMCHGLEEFGCFIALYAGVPPELDDATFKAADELFDLPT  70

Query  294   EKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHsfsessqs  473
             E K  N N+KPYHGYVGQ+  IP HE  GID+AT  E V  F+ LMW  GN  F E + S
Sbjct  71    EIKSQNVNDKPYHGYVGQVSIIPLHEGLGIDNATDPEEVGKFTKLMWPHGNDHFGEVAYS  130

Query  474   fsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNVVFPCHTD  653
             +S  VAEL+  V+RM+FE+YGVEKHYDS+V S +YLLR++KY  P   D+ +   P HTD
Sbjct  131   YSMKVAELDHMVVRMIFENYGVEKHYDSHVASKSYLLRFLKYRAPETIDQGDNAIPRHTD  190

Query  654   KTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRVLAPIHKVTM  833
             KTF+++L+Q N+++GLE++ + GEWI    PP++F+VMAG+A+ GWSN R+ +  H+V M
Sbjct  191   KTFLSILHQ-NRINGLEIKTKEGEWIGFDLPPNAFVVMAGDALMGWSNDRIRSCDHRVAM  249

Query  834   DANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSDKGRRSKN  1013
              A+    RY++G+FSFL  S  ++VP+ELVD+ HPL++KPF ++ MI F+ SD+GR+ + 
Sbjct  250   KAS--TTRYTLGLFSFL--SGIVQVPQELVDENHPLKYKPFDNVAMIHFYASDEGRKHEY  305

Query  1014  LLKDFCG  1034
              +K +CG
Sbjct  306   TVKAYCG  312



>ref|XP_011072270.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
isoform X1 [Sesamum indicum]
Length=313

 Score =   315 bits (807),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 157/318 (49%), Positives = 225/318 (71%), Gaps = 6/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGSL  PT L  + F+ ++L+PGST+W    KD+  ALED+GCF     K S  +H +IF
Sbjct  1     MGSLVNPT-LPTIHFSGKNLEPGSTAWMSTSKDVVRALEDYGCFAATYSKFSLGMHKAIF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
               S++LFDLP   K+ NT++ P HGYVGQ P IP +E  GI++ATT EGV+ F+NL+W  
Sbjct  60    RCSEELFDLPTNVKVQNTSDTPSHGYVGQEPIIPLYEGLGIENATTREGVKKFTNLLWPS  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN  F E++  +S++VAEL++ V+RM+ ESYG+E  Y+S + +T+YLLR +KY  P E  
Sbjct  120   GNDRFCETALEYSRLVAELDQVVMRMVSESYGIESSYESLLGATSYLLRIIKYRKP-EKG  178

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
             EN +    HTDK+FMT+++Q  QV+GLE++ ++G+WI+    PSSFIVMAG+A  GW+N 
Sbjct  179   ENGLGIVPHTDKSFMTIIHQC-QVNGLEIKTKDGDWITVDPSPSSFIVMAGDACMGWTNG  237

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+   IH+V +   G E+RYS+G+F+F+++ K I+VPEELVDD HP QFKPF H   I F
Sbjct  238   RIEPSIHRVII--KGSEERYSLGLFTFIRDLK-IQVPEELVDDHHPAQFKPFDHYKFIHF  294

Query  981   FDSDKGRRSKNLLKDFCG  1034
             + +++GR+S   L+ +CG
Sbjct  295   YYTEEGRKSNCPLRAYCG  312



>ref|XP_006427128.1| hypothetical protein CICLE_v10027501mg [Citrus clementina]
 gb|ESR40368.1| hypothetical protein CICLE_v10027501mg [Citrus clementina]
Length=338

 Score =   315 bits (808),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 158/328 (48%), Positives = 238/328 (73%), Gaps = 9/328 (3%)
 Frame = +3

Query  57    IELRKKKNMGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVS  236
             + + K      LE   KL VV+ + E+ KPG++SW    + +R ALE+ GCF+ L D+VS
Sbjct  15    LPIAKDLQAKGLEVFPKLPVVNLSKENFKPGASSWLGTSRKVREALEEFGCFVALYDEVS  74

Query  237   PQLHNSIFHASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIP-YHEAFGIDHATTIEGVQ  413
              +LHN+IF A+++LF+LP E K  N +EKPY+GY+G  P +P  +E  G+D+A TIEG Q
Sbjct  75    LELHNAIFSAAEELFNLPIEIKEKNVSEKPYYGYLGNNPLVPAIYEGMGVDYANTIEGTQ  134

Query  414   SFSNLMWSGGNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYM  593
             +F+NL+W  GN +F ++  S+S++V+ELE+ V RM+FESYGV+K+YDS +ES+ YLLR M
Sbjct  135   NFTNLIWPEGNENFCKTVVSYSRLVSELEQMVKRMVFESYGVDKYYDSVLESSTYLLRIM  194

Query  594   KYEVPAESDENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFP-PSSFIVMA  770
             KY  P E++E N+    HTDK+F+TVL+Q N+V+GLE++ ++G WI    P PSSFIV+A
Sbjct  195   KYRCP-ETNEKNLGCDVHTDKSFITVLHQ-NEVNGLEIRTKDGCWIGFDDPTPSSFIVLA  252

Query  771   GEAIKGWSNSRVLAPIHKVTMDANG-KEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQF  947
             G+A   WSNSR+ +P+H+V +  NG K+ RYS+G+F+F  N   I++PEELVDDEHPL+F
Sbjct  253   GDAFLAWSNSRIHSPVHRVIL--NGIKQARYSLGLFTF--NDGIIQIPEELVDDEHPLKF  308

Query  948   KPFVHLDMIKFFDSDKGRRSKNLLKDFC  1031
             K F H  +++++ +++G++++   K +C
Sbjct  309   KSFEHFGLLRYYLTEEGQKAECTAKAYC  336



>ref|XP_004302942.1| PREDICTED: gibberellin 3-beta-dioxygenase 3-like [Fragaria vesca 
subsp. vesca]
Length=320

 Score =   314 bits (804),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 162/317 (51%), Positives = 223/317 (70%), Gaps = 7/317 (2%)
 Frame = +3

Query  93    ETPTKLLVVDFNN-EDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHAS  269
             + P KL V+DF+N E L PG+ SW  A K ++ ALE+ GCF+VL D +SP   N++    
Sbjct  7     QVPLKLPVLDFSNKESLNPGTNSWLSARKHVQGALEEFGCFVVLYDGISPDFRNTLLATM  66

Query  270   QQLFDLPFEKKILNTNE-KPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGN  446
             Q+LFDLP + K+ N  E KP +GYVGQIP +P HE+ GID+AT++E  Q F+ LMW GGN
Sbjct  67    QELFDLPTKTKMTNKYEAKPLNGYVGQIPKLPLHESMGIDNATSLEETQRFTELMWPGGN  126

Query  447   HsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDEN  626
              +F ES  SF+K+  EL++ V RM+FESYGVEK YDSYV S  YLLR +K ++P E ++ 
Sbjct  127   DNFCESVYSFAKVAEELDKMVTRMIFESYGVEKCYDSYVGSITYLLRLLKNKLPQE-NQP  185

Query  627   NVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRV  806
             N+ F  HTDK+F T+LYQ NQV  LE++ RN EW   +FPPSSFIVMAG+A+  WSN R+
Sbjct  186   NLGFVPHTDKSFTTILYQNNQVHALEIETRNHEWFKVEFPPSSFIVMAGDALMAWSNDRI  245

Query  807   LAPIHKVTMDANGK-EKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFF  983
             L+P H+V M    + E RYS+  F+F  ++  I VP+ELVDD+HPL++KPF H+ +++FF
Sbjct  246   LSPNHRVVMSTGHETEARYSMAQFAF--SNGEIRVPDELVDDQHPLRYKPFDHVGLLRFF  303

Query  984   DSDKGRRSKNLLKDFCG  1034
              + +   S + +K +CG
Sbjct  304   RTAED-NSNSAIKAYCG  319



>ref|XP_009147660.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Brassica rapa]
Length=315

 Score =   311 bits (798),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 154/307 (50%), Positives = 220/307 (72%), Gaps = 7/307 (2%)
 Frame = +3

Query  114   VVDFNN-EDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQQLFDLP  290
             V+D  + +DL P +++W    ++   ALE++GCF+ L D V+ +L +SIF A+++LFDLP
Sbjct  13    VLDLTSRQDLNPNTSTWRSISREACEALEEYGCFVALYDGVTQELDDSIFAAAEELFDLP  72

Query  291   FEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHsfsessq  470
              + K  N NEKPYHGYVGQ+P IP HE  GID+ T  E  Q F++LMW  GNH F E++ 
Sbjct  73    TDTKRKNVNEKPYHGYVGQMPVIPLHEGLGIDYVTNKEEAQRFTHLMWPQGNHQFCETAH  132

Query  471   sfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNVVFPCHT  650
              FS  VAEL+  V+RM+F++YGVEKHYDS+V S  YLL+++KY  P ES  +   FP HT
Sbjct  133   GFSNAVAELDRLVVRMIFDNYGVEKHYDSHVGSKTYLLKFLKYLAPPESI-SMAAFPQHT  191

Query  651   DKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRVLAPIHKVT  830
             DKTF+++L+Q N V+GLEV++++G WIS   PP S++VMAG+   GWSN R+ +  H+VT
Sbjct  192   DKTFLSILHQ-NGVNGLEVKSKDGGWISLHLPPKSYVVMAGDISMGWSNDRIRSCEHRVT  250

Query  831   MDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSDKGRRSK  1010
             M+  G + RY++G+FSF+K    + VPEELVDDEHPL +KPF ++ +I F+ + +GR +K
Sbjct  251   ME--GDKTRYTLGLFSFIKG--LVSVPEELVDDEHPLMYKPFDNIALINFYATKEGREAK  306

Query  1011  NLLKDFC  1031
             + LK +C
Sbjct  307   STLKAYC  313



>ref|XP_006465422.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1.2-like 
[Citrus sinensis]
 gb|KDO58206.1| hypothetical protein CISIN_1g046776mg [Citrus sinensis]
Length=314

 Score =   311 bits (796),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 153/320 (48%), Positives = 225/320 (70%), Gaps = 9/320 (3%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS E   KL +VD + E+LKPGS+SW  AC +IR ALE++GCF+ L DK  P+  N +F
Sbjct  1     MGS-EAAQKLPIVDLSQENLKPGSSSWQTACNEIRLALEEYGCFVALYDKHLPEFRNKVF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              + ++LFDLP E K+ N N KP HGY+G+I   P HE  GI++AT     + F++LMW  
Sbjct  60    DSLEELFDLPQETKMKNVNPKPAHGYMGKISAFPLHEGMGIEYATNRGECEKFTSLMWPQ  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN+ F E + +++ IVAEL++ V++MLFESYG+EK Y+S  EST YLLR++KY   +++D
Sbjct  120   GNYQFCEVAHTYANIVAELQQLVMKMLFESYGIEKLYESQKESTTYLLRFLKYR-KSQTD  178

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
               N+ F  HTDK+ +++L+  N V GLE++ ++GEWI  +  PSSF+++AG+    WSN 
Sbjct  179   TTNLAFKGHTDKSLVSILHS-NHVKGLELRTKDGEWIHFEPSPSSFVIIAGDVCMAWSND  237

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+ +  H+V +D  G E RY++G+FSFL  S  I+ PEELVDDEHPLQ+KPF H  +++F
Sbjct  238   RIKSCYHRVIVD--GPEVRYALGLFSFL--SGVIQTPEELVDDEHPLQYKPFDHAGLLQF  293

Query  981   F--DSDKGRRSKNLLKDFCG  1034
             +  +SD+ +  +N++K +CG
Sbjct  294   YLSNSDQNKGERNMMKAYCG  313



>ref|XP_011072310.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Sesamum indicum]
Length=314

 Score =   308 bits (788),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 144/319 (45%), Positives = 226/319 (71%), Gaps = 7/319 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGSL T  KL V+ F  E+ KPG+ +W+  C+ + +AL+++GCF+   D+++ ++H  +F
Sbjct  1     MGSL-TLHKLPVIAFTEENSKPGTETWSKTCRQVISALQEYGCFVAAYDQITQRIHTGVF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              A ++LFD+P E+K+ N + KP +GYVGQIP IP +E+ GID+A T+EG+QSF+ +MW  
Sbjct  60    EALEELFDIPTERKVQNKSAKPLYGYVGQIPLIPLYESMGIDNANTLEGIQSFAKVMWPN  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN  FSE    ++K+ AELE+ V++M+FE YGV ++Y+S++ S  YL R M+Y  P +  
Sbjct  120   GNDGFSEKLLLYTKLAAELEKIVVQMVFEGYGVGQYYESHISSANYLCRVMQYRQP-KMQ  178

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQ-FPPSSFIVMAGEAIKGWSN  797
             EN + F  HTDK+FM+ ++Q NQV GLE++A++GEW       PSS +VMAG+AI  WSN
Sbjct  179   ENRMGFVSHTDKSFMSTIHQ-NQVDGLEIKAKDGEWFGVHDLSPSSLVVMAGDAIMAWSN  237

Query  798   SRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIK  977
             +R+ +P H+VTM  N  E RYS+  FSF++ S  ++ P+EL++D++P Q+KPF HL  ++
Sbjct  238   NRIRSPPHRVTMQGN--EARYSLAQFSFIEKS-MVQTPQELINDDNPQQYKPFDHLKFLE  294

Query  978   FFDSDKGRRSKNLLKDFCG  1034
             F+  ++ RR ++ ++ +CG
Sbjct  295   FYSKEENRRLESAIRTYCG  313



>ref|XP_007145552.1| hypothetical protein PHAVU_007G248200g [Phaseolus vulgaris]
 gb|ESW17546.1| hypothetical protein PHAVU_007G248200g [Phaseolus vulgaris]
Length=315

 Score =   306 bits (784),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 147/314 (47%), Positives = 220/314 (70%), Gaps = 6/314 (2%)
 Frame = +3

Query  96    TPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQQ  275
             + + L +VD ++E+LKPG+  W  ACK +RTALEDHGC++V CDK+  +L N++  A +Q
Sbjct  5     SASPLPIVDLSDENLKPGTEPWLSACKVVRTALEDHGCYVVRCDKIGEELRNAVVSAMEQ  64

Query  276   LFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHsf  455
              F+LP + K   T++K +HGY GQ+ F+P +E+ GIDH  T+ G Q F+++MW  GNH F
Sbjct  65    AFELPVDTKRQKTSDKIFHGYYGQVSFLPLYESLGIDHPLTMAGCQKFAHIMWPQGNHRF  124

Query  456   sessqsfsKIVAELEEKVLRMLFESYGVE-KHYDSYVESTAYLLRYMKYEVPAESDENNV  632
             SES   ++K++ E++   +RM+FESYGVE K ++S++EST YLLR  KY V AE  EN+V
Sbjct  125   SESVNEYAKVLGEIDGVTMRMVFESYGVEMKKWESFMESTNYLLRSFKYRV-AEKGENDV  183

Query  633   VFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRVLA  812
                 HTD +  ++L+QLN + GLEV+ +NGEW+     PS F+V+AG+A++ WSN R+ +
Sbjct  184   GIHSHTDMSVTSILHQLNNLDGLEVKLKNGEWLKLHASPSFFLVLAGDALQCWSNGRIRS  243

Query  813   PIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSD  992
               H+VTM  N K+ RYS+G+ S+  N+  +E+P+ELVD +HPL++KPF H   + FFD +
Sbjct  244   CEHRVTM--NAKKTRYSMGLSSY--NTHMVEIPKELVDQQHPLRYKPFHHYGYLHFFDKE  299

Query  993   KGRRSKNLLKDFCG  1034
             K +   + LK +CG
Sbjct  300   KIKDPNSRLKAYCG  313



>emb|CDY26054.1| BnaC06g05700D [Brassica napus]
Length=315

 Score =   306 bits (783),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 153/307 (50%), Positives = 218/307 (71%), Gaps = 7/307 (2%)
 Frame = +3

Query  114   VVDFNN-EDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQQLFDLP  290
             V+D  + +DL P +++W    ++   ALE++GCF+ L D V+ +L +SIF A+++LFDLP
Sbjct  13    VLDLTSRQDLNPNTSTWRSISREACEALEEYGCFVALYDGVTQELDDSIFAAAEELFDLP  72

Query  291   FEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHsfsessq  470
              + K  N NEKPYHGYVGQ+P IP HE  GID+ T  E  Q F++LMW  GNH F E++ 
Sbjct  73    TDTKRKNVNEKPYHGYVGQMPVIPLHEGLGIDYVTNKEEAQRFTHLMWPRGNHQFCETAH  132

Query  471   sfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNVVFPCHT  650
              FS  VAEL+  V+RM+FE+YGVEKHYDS+  S  YLL+++KY  P ES  +   FP HT
Sbjct  133   GFSNSVAELDRLVVRMIFENYGVEKHYDSHEGSKTYLLKFLKYLAPPESI-SMPAFPQHT  191

Query  651   DKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRVLAPIHKVT  830
             DKTF+++L+Q N V+GLEV++++G WIS   PP S++VMAG+   GWSN R+ +  H+VT
Sbjct  192   DKTFLSILHQ-NGVNGLEVKSKDGGWISLHLPPKSYVVMAGDISMGWSNDRIRSCEHRVT  250

Query  831   MDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSDKGRRSK  1010
             M+  G + RY++G+FSF+K    + VP ELVDDEHPL +KPF ++ +I F+ + +GR +K
Sbjct  251   ME--GDKTRYTLGLFSFIKG--LVSVPGELVDDEHPLMYKPFDNIALINFYATKEGREAK  306

Query  1011  NLLKDFC  1031
             + LK +C
Sbjct  307   STLKAYC  313



>ref|XP_010034855.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Eucalyptus grandis]
 gb|KCW53769.1| hypothetical protein EUGRSUZ_J03022 [Eucalyptus grandis]
Length=315

 Score =   305 bits (781),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 154/310 (50%), Positives = 216/310 (70%), Gaps = 5/310 (2%)
 Frame = +3

Query  105   KLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQQLFD  284
             +L V++F+ E+L PG+  W    K +  ALE++GCFI  C   + Q HN IFHA  +LFD
Sbjct  10    ELSVIEFSRENLDPGTDLWISTSKRVVFALEEYGCFIATCSDFTSQAHNEIFHALDELFD  69

Query  285   LPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHsfses  464
             LP E K  NT+EKPY GYVGQ P IP +E+ GID ATT++GVQSF+NL+W  GN  F + 
Sbjct  70    LPTEIKSRNTSEKPYFGYVGQHPSIPLYESLGIDDATTLKGVQSFTNLLWPAGNERFRDG  129

Query  465   sqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNVVFPC  644
             + +FSK V+ELE+ V RM+FE YGV+K+YDS+V S+ YLLR+MKY  P E +E N     
Sbjct  130   ALAFSKKVSELEQMVKRMVFERYGVKKYYDSHVMSSTYLLRFMKYRAP-EMNETNRGCDV  188

Query  645   HTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRVLAPIHK  824
             HTDK+F+T+L+Q NQ+ GLEV+ ++G+WI+ +  PSSF+VMAG+A   WSN R+ +P+H+
Sbjct  189   HTDKSFVTILHQ-NQIDGLEVKTKDGDWIAFEPSPSSFLVMAGDAFLAWSNGRIHSPLHQ  247

Query  825   VTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSDKGRR  1004
             V M    K  RYS+G+F+F  +S  IE+P+EL D E+PL+FK F H  ++++F  D   +
Sbjct  248   VVMKEK-KSPRYSLGLFTF--HSGIIEIPQELADPENPLKFKAFDHYGLLRYFCQDGVPQ  304

Query  1005  SKNLLKDFCG  1034
                  + +CG
Sbjct  305   DVCTAQAYCG  314



>ref|XP_007215723.1| hypothetical protein PRUPE_ppa008973mg [Prunus persica]
 gb|EMJ16922.1| hypothetical protein PRUPE_ppa008973mg [Prunus persica]
Length=312

 Score =   304 bits (779),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 160/318 (50%), Positives = 222/318 (70%), Gaps = 7/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS ET  KL V+D +NE+LKPG+ +W  A K ++ ALE++GCF  +  KV  QLHNSIF
Sbjct  1     MGS-ETQPKLPVIDLSNENLKPGTEAWVLASKHVKYALEEYGCFEAVFHKVPLQLHNSIF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
                + LFDLP E K   T+E+PYH Y GQ  F+P +E+ G+D+ TT+EG + F+ +MW  
Sbjct  60    SVVEDLFDLPIETKRQQTSERPYHSYFGQYSFLPLYESLGVDNPTTVEGAKGFTKIMWPA  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN  F ES+QSFSK+VAEL++ V RM+F+ YGVE+ YDS++ ST YLLR  KY    E +
Sbjct  120   GNDHFCESAQSFSKLVAELDQMVTRMVFDIYGVERLYDSHMASTTYLLRCFKYREQKE-N  178

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
             E NV    H DKTF ++L+Q +QV GL+V++++G+WI A+  PSSF+VMAG+A   WSN 
Sbjct  179   ETNVGLRPHKDKTFTSILHQ-SQVHGLQVRSKDGQWIEAEPSPSSFLVMAGDAFMAWSND  237

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             RV +  H+V M  N  + RYSVG+FSF  NS  ++VPEEL DD+HPL +KPF H   ++F
Sbjct  238   RVRSCDHQVIMKEN--KTRYSVGLFSF--NSGILQVPEELTDDQHPLLYKPFDHFSFLRF  293

Query  981   FDSDKGRRSKNLLKDFCG  1034
               + + ++S+  +K +CG
Sbjct  294   DQTPEAKKSECPIKAYCG  311



>ref|XP_010061959.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP3-like [Eucalyptus 
grandis]
 gb|KCW69006.1| hypothetical protein EUGRSUZ_F02566 [Eucalyptus grandis]
Length=313

 Score =   303 bits (776),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 157/320 (49%), Positives = 217/320 (68%), Gaps = 10/320 (3%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS   P  +  +D   E+ KP S+SW   C D+R ALE+HG F+   DK+SP L   I 
Sbjct  1     MGSQTMP--IPTIDLTLENSKPQSSSWVTTCNDVRLALEEHGWFVAKYDKLSPHLREVIL  58

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
                 +LF LP+E KI NT++KP  GYVG+I  IP HE  GID AT +   Q F+ LMW  
Sbjct  59    SDVVELFKLPYETKIQNTSDKPAFGYVGKIAAIPLHEGLGIDRATDLGECQKFTKLMWPS  118

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN  F E++Q ++K VAELE+ V+RMLFESYGVEKH +S++ +T YLLR++ Y  P E+D
Sbjct  119   GNDRFCENAQLYAKTVAELEQTVVRMLFESYGVEKHCESHLGATTYLLRFLNYRRP-END  177

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
             E N+ F  HTDK+F+++L+Q N V GLE++ ++GEWI  +  PSSF+V+AG+A   WSN+
Sbjct  178   EANLAFVTHTDKSFISILHQ-NHVRGLELRNKDGEWIGFEPSPSSFLVLAGDACMAWSNN  236

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             RV    H+V M   G E RY++G+FSF      IE PEEL+DDEHP+Q+KPF H+ +++F
Sbjct  237   RVRPGYHRVVM--KGNEARYALGLFSF--RGGLIETPEELIDDEHPMQYKPFDHVGLLRF  292

Query  981   FDS-DKGRRSKN-LLKDFCG  1034
             +D+ D   R+K+ + K +CG
Sbjct  293   YDTVDVRERAKHTMTKAYCG  312



>ref|XP_007024008.1| 2-oxoglutarate-dependent dioxygenase, putative [Theobroma cacao]
 gb|EOY26630.1| 2-oxoglutarate-dependent dioxygenase, putative [Theobroma cacao]
Length=312

 Score =   302 bits (773),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 155/318 (49%), Positives = 221/318 (69%), Gaps = 7/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MG L++  KL V+DF+  +L PG+++W  AC D+R ALE+ GCF    DKV  QLH+++F
Sbjct  1     MG-LQSQFKLPVIDFSEGNLNPGTSTWVSACNDVRQALEEQGCFEARFDKVPLQLHDTVF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
               + +LFDLP E K+ NT+ KPY  Y GQ   +P +E+  +D+ TT  G QSF+NLMW  
Sbjct  60    ATAAELFDLPTELKMRNTSNKPYFDYFGQYRSLPLYESLAMDNPTTHSGTQSFTNLMWPA  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN  F ES+QSFS++VAEL+  V+RMLFESYGV  +YD Y++ST YLLR+ KY  P E +
Sbjct  120   GNDRFRESAQSFSELVAELDRTVMRMLFESYGVGNYYDYYIKSTNYLLRFYKYRKP-EMN  178

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
             E++   P HTD+T +++++Q  ++SGL+V+ ++G+W+  Q  P+SF VMAG+A+  WSN 
Sbjct  179   ESDTGLPPHTDRTLLSIIHQ-GRISGLQVKLKDGQWVGVQPSPTSFAVMAGDALMAWSND  237

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+    H+VTM    KE RYS+G+FSF+  S  I + EELVD+ HPL++K F H   + F
Sbjct  238   RIPPCYHQVTMKE--KETRYSIGMFSFI--SGIIHILEELVDETHPLKYKSFDHFQFLHF  293

Query  981   FDSDKGRRSKNLLKDFCG  1034
               SD+G++SK  +K FCG
Sbjct  294   DRSDEGKKSKCSIKAFCG  311



>ref|XP_008228621.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Prunus mume]
Length=312

 Score =   300 bits (769),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 159/318 (50%), Positives = 220/318 (69%), Gaps = 7/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS ET  KL V+D +NE+LKPG+ +W  A K ++ ALE++GCF  +  KV  QLHNSIF
Sbjct  1     MGS-ETQPKLPVIDLSNENLKPGTEAWVLASKHVKYALEEYGCFEAVFHKVPLQLHNSIF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
                + LFDLP E K   T+E+PYH Y GQ  F+P +E+ G+D+ TT+EG Q F+ +MW  
Sbjct  60    SVVEDLFDLPIETKRQQTSERPYHSYFGQYSFLPLYESLGVDNPTTVEGAQGFTKIMWPA  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN  F ES+QSFSK+VAEL++ V RM+F+ YGVE+ YDS++ ST YL R  KY    E +
Sbjct  120   GNDHFCESAQSFSKLVAELDQMVTRMVFDIYGVERLYDSHMASTTYLFRCFKYREQKE-N  178

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
             E NV    H DKTF ++L+Q +QV GL+V++++ +WI A+  PSSF+VMAG+A   WSN 
Sbjct  179   ETNVGLRPHKDKTFTSILHQ-SQVHGLQVRSKDCQWIDAEPSPSSFLVMAGDAFMAWSND  237

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             RV +  H+V M  N  + RYS+G+FSF  NS  +EVPEEL DD+HPL +KPF H   ++F
Sbjct  238   RVRSCDHQVIMKEN--KTRYSLGLFSF--NSGILEVPEELTDDQHPLLYKPFDHFGFLRF  293

Query  981   FDSDKGRRSKNLLKDFCG  1034
               + + ++S+  +K +CG
Sbjct  294   DQTPEAKKSECPIKAYCG  311



>ref|XP_007216862.1| hypothetical protein PRUPE_ppa021358mg [Prunus persica]
 gb|EMJ18061.1| hypothetical protein PRUPE_ppa021358mg [Prunus persica]
Length=321

 Score =   300 bits (769),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 151/318 (47%), Positives = 219/318 (69%), Gaps = 5/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS ETP KL V+DF+N+ L PG+T W      +  ALE++GCF  L +KV P +  SIF
Sbjct  1     MGS-ETPLKLPVIDFSNQSLTPGTTEWNTVRAQVHNALEEYGCFEALFNKVPPHIRKSIF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              + ++LFDLP + K+ N ++KP+HGYVGQ P +P +E+ G+D A   E VQS +N +W  
Sbjct  60    PSIEELFDLPLQTKLQNVSKKPFHGYVGQYPMVPLYESMGVDDANVYEQVQSLTNTLWPQ  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN SF ++ QSFS+ V+EL++ + RM+ ES G+EK+ + ++EST YLLR MKY+ P +++
Sbjct  120   GNPSFCKTIQSFSEQVSELDQIIRRMILESLGLEKYLEEHLESTNYLLRVMKYKGP-QTN  178

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
             E  +    HTDK  +T+LYQ NQV GLEVQ ++G+WI+ +  P SFI M G+++  W+N 
Sbjct  179   ETKLGLNAHTDKNIVTILYQ-NQVDGLEVQNKDGKWINVKPSPDSFIAMIGDSLYAWTNG  237

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+ +P H+V M  +G E RYS G+FS  K    I+ PEE+VD+EHPL FKPF H+  + F
Sbjct  238   RLHSPYHRVMM--SGNEVRYSTGLFSIPKEGYIIKAPEEVVDEEHPLLFKPFDHVQFLGF  295

Query  981   FDSDKGRRSKNLLKDFCG  1034
             + S+ G+R+ + LK +CG
Sbjct  296   YYSEAGQRAHSALKTYCG  313



>ref|XP_006427131.1| hypothetical protein CICLE_v10027420mg [Citrus clementina]
 gb|ESR40371.1| hypothetical protein CICLE_v10027420mg [Citrus clementina]
Length=314

 Score =   300 bits (767),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 147/318 (46%), Positives = 215/318 (68%), Gaps = 5/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS +T +K+ V+D + +DLK G+++W   CKD+R A E+ GCF  +  K+S +  + + 
Sbjct  1     MGS-QTKSKIPVIDLSKQDLKSGTSTWLSTCKDVRHAFEEFGCFEAIYQKISQEFRSEVL  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              ++++LFD+P E K+ NT+ KPY  Y GQ   IP +E+  ID+  T    QSF+NLMW  
Sbjct  60    ASTEELFDVPIEIKVKNTSTKPYFEYYGQYTIIPLYESLAIDYPDTRNATQSFTNLMWPA  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN  F ESS S S++V EL++ V RMLFESYGVE +YDSY+ S  YLLRY KY  P E +
Sbjct  120   GNDCFCESSLSMSELVVELDKMVTRMLFESYGVEGYYDSYIGSVNYLLRYFKYRAP-EPN  178

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
             E  +    HTDKT  ++++Q+N ++GL+VQA++GEWI  +  PSSFIVMAG+A+  W N 
Sbjct  179   ETKMGLTPHTDKTMTSIIHQINHINGLQVQAKDGEWIDVEPSPSSFIVMAGDALMAWGND  238

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+    H+V MD N  E RYS+G+FSF  +S  +++P+EL D+  PL++KPF H   + F
Sbjct  239   RIRPCRHQVIMD-NASETRYSLGLFSF--SSGVVDIPKELGDETQPLKYKPFDHFGFLHF  295

Query  981   FDSDKGRRSKNLLKDFCG  1034
               S++G++S + +K +CG
Sbjct  296   NQSEEGKKSASSIKAYCG  313



>gb|EYU31921.1| hypothetical protein MIMGU_mgv1a010132mg [Erythranthe guttata]
Length=321

 Score =   300 bits (767),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 145/321 (45%), Positives = 220/321 (69%), Gaps = 6/321 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             M + + P+K+ + D + ++L PGS+SW  ACK+++ ALE++G FI   D+V  +L   +F
Sbjct  1     MANSQEPSKVPIFDLSPKNLNPGSSSWPQACKNVKQALEEYGFFIAHYDRVPYELDKQLF  60

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
                Q+LFDLP E K  NT++  ++GYVGQ+P  P HE+ GI   TT + VQ+F+NLMW  
Sbjct  61    EELQELFDLPLETKTRNTSDLVFYGYVGQLPHAPLHESMGIPDVTTFDAVQNFTNLMWPS  120

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN +F ES  S++K+V+ELE+ V +M+FESYG +KHY S++EST YLLR +KY VP  +D
Sbjct  121   GNKTFCESILSYAKLVSELEQIVDKMVFESYGTQKHYKSHIESTTYLLRTIKYSVPKIAD  180

Query  621   E---NNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGW  791
             +   +N+    HTDK+F+++L+Q NQ++GL +Q RNGEW++ + PP SF+VMAG+A + W
Sbjct  181   DKSKDNIGTNVHTDKSFLSILHQ-NQINGLYIQLRNGEWLAVEVPPGSFVVMAGDAYQAW  239

Query  792   SNSRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDM  971
             SN R+ A  H+V M  + +  R+ + +FSF  N     VPEELVD EHPL+F PF +  +
Sbjct  240   SNGRIFAAKHQVVMKGDVRMPRFCLALFSF--NHGMTHVPEELVDPEHPLRFNPFDNFGL  297

Query  972   IKFFDSDKGRRSKNLLKDFCG  1034
              +F+ S   + +++  + +CG
Sbjct  298   ARFYLSGVTQMTESTAQAYCG  318



>ref|XP_006427130.1| hypothetical protein CICLE_v10027182mg, partial [Citrus clementina]
 gb|ESR40370.1| hypothetical protein CICLE_v10027182mg, partial [Citrus clementina]
Length=323

 Score =   300 bits (767),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 146/318 (46%), Positives = 223/318 (70%), Gaps = 7/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS +T  K+LVVD  NE+LKPG+++W   C +IR A+ED GCF  + +K+  +LHN IF
Sbjct  12    MGS-QTQPKILVVDLCNENLKPGTSTWISTCNEIRQAMEDTGCFEAIYNKIPLELHNEIF  70

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              A+ +LFDLP E K+ NT++KPYH Y GQ   IP +E+  ID  T +   QSF++ MW  
Sbjct  71    KAADELFDLPIETKMQNTSDKPYHEYFGQYTGIPLYESLAIDDPTNLTATQSFTDRMWPN  130

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN  F ES  SF+KI+ E+++ V+RM+ ESYG+EK+YDS++E++ YLLR+ KY  P E +
Sbjct  131   GNPPFCESVHSFAKIIVEVDQLVMRMIMESYGIEKYYDSHIETSNYLLRFFKYRKP-EIN  189

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
             E+NV    HTDK  +++++Q N ++GL+++A++GEWI  +  PSSF++MA + +  WSN 
Sbjct  190   EHNVGLYPHTDKNMVSIIHQ-NHINGLQIKAKDGEWIDLEPSPSSFVIMAADGLLAWSNG  248

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+ +  H+V ++A+  E RYS+G+FSF  N   + +PEE VD+ HPL+++PF   + ++F
Sbjct  249   RIRSCEHQVIINAH--ETRYSMGLFSF--NRGIVHIPEEFVDELHPLRYRPFDIYEFLRF  304

Query  981   FDSDKGRRSKNLLKDFCG  1034
              DSD+G+++   +  FCG
Sbjct  305   HDSDEGKKTDGSITSFCG  322



>ref|XP_010110322.1| Gibberellin 20 oxidase 1 [Morus notabilis]
 gb|EXC25842.1| Gibberellin 20 oxidase 1 [Morus notabilis]
Length=372

 Score =   301 bits (771),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 153/317 (48%), Positives = 221/317 (70%), Gaps = 6/317 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MG      KL V+DF+ E LKPG+ SW  A KD++ A E++GCF+V  + +S +L N++F
Sbjct  1     MGFPVVEPKLPVLDFSKETLKPGTKSWELARKDVQRAFEEYGCFLVTYEAISCELRNAMF  60

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              A ++LFDLP E K+ N  EKP +GYVGQ P +P HE+ GID+AT  EG+QSF+NL+W  
Sbjct  61    GALEELFDLPTETKMKNKYEKPLNGYVGQNPVVPLHESLGIDNATAKEGIQSFTNLLWPV  120

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN  FSES+ SF+K+ AE+++ V RM+FESY +EK+Y++Y+ S  YLLR +K+  P  +D
Sbjct  121   GNDRFSESAHSFAKLAAEIDQIVTRMIFESYSLEKYYEAYIGSITYLLRLLKHNAPQGND  180

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
                + F  HTDK+F T+L+Q N V+ LEV+ +NG+WI  +  PSSF+V AG+A+  WSN 
Sbjct  181   P-QLGFVAHTDKSFTTILHQ-NHVNALEVETKNGDWIKVELSPSSFVVFAGDALMAWSND  238

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+++P H+V +  +G E RYS+  FSF      +EVPEELVD++HPL++KPF HL  + F
Sbjct  239   RIVSPKHRVVV--SGNEDRYSLAQFSF--GDGMVEVPEELVDEQHPLKYKPFNHLGFLGF  294

Query  981   FDSDKGRRSKNLLKDFC  1031
             F  +  +R +  +K +C
Sbjct  295   FAENAYKRLECPIKAYC  311



>ref|XP_008228619.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Prunus mume]
Length=321

 Score =   299 bits (766),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 151/318 (47%), Positives = 218/318 (69%), Gaps = 5/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS ETP KL V+DF+N+ L PG+T W      +  ALE++GCF  L +KV   +  SIF
Sbjct  1     MGS-ETPPKLPVIDFSNQSLTPGTTEWNAVRAQVHNALEEYGCFEALFNKVPSHIRKSIF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              + ++LFDLP + K+ N ++KPYHGYVGQ P +P +E+ G+D A   E VQS +N +W  
Sbjct  60    PSIEELFDLPLQTKLQNVSKKPYHGYVGQYPMVPLYESMGVDGANVYEQVQSLTNTLWPR  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN SF ++ QSFS+ V+EL++ + RM+ ES G+EK+ + ++EST YLLR MKY+ P +++
Sbjct  120   GNPSFCKAIQSFSEQVSELDQIIRRMILESLGLEKYLEEHLESTNYLLRVMKYKGP-QTN  178

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
             E  +    HTDK  +T+LYQ NQV GLEVQ ++G+WI+ +  P SFI M G+++  W+N 
Sbjct  179   ETKLGLNAHTDKNIVTILYQ-NQVDGLEVQNKDGKWINVKPSPDSFIAMIGDSLYAWTNG  237

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+ +P H+V M  +G E RYS G+FS  K    I+ PEE+VD+EHPL FKPF H+  + F
Sbjct  238   RLHSPYHRVMM--SGNEARYSTGLFSIPKEGYIIKAPEEVVDEEHPLLFKPFDHVQFLGF  295

Query  981   FDSDKGRRSKNLLKDFCG  1034
             + S+ G+R+ + LK +CG
Sbjct  296   YYSEAGQRAHSALKTYCG  313



>emb|CDO98091.1| unnamed protein product [Coffea canephora]
Length=314

 Score =   299 bits (765),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 154/319 (48%), Positives = 224/319 (70%), Gaps = 7/319 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS+    +L V+DF  E L P ST W    +++  ALE++GCFI   DKVS +LH +IF
Sbjct  1     MGSVTRQIQLPVLDFTGETLNPSSTRWPSTREEVVRALEEYGCFIANYDKVSLELHQAIF  60

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              ASQ+LF+LP E K+LNT++ P HGY+     IP  EA GI++ATT++GVQ F+N++W  
Sbjct  61    LASQELFELPTETKVLNTSDSPSHGYIAH-RRIPLLEALGIENATTVDGVQRFTNVLWPN  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN+ FSE++ S+SK+VAEL   V+RM+ E+YGVEK  +S + S  YLLR +KY  P E +
Sbjct  120   GNNHFSETALSYSKLVAELNHVVMRMVAETYGVEKDCESLLGSIYYLLRLIKYRAPREDE  179

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISA-QFPPSSFIVMAGEAIKGWSN  797
              N  +FP H D+TFM++L+Q  QV+GLE+  +NG+W+      PSSFIVMAG+    W+N
Sbjct  180   SNVGLFP-HADQTFMSILHQ-AQVNGLEIMTKNGDWMLIDSLSPSSFIVMAGDVCMAWTN  237

Query  798   SRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIK  977
              R+  P+H+VTM  +G E+RYS+ +F+F+++   ++VPE+LVDDEHPLQ+KPF     + 
Sbjct  238   GRIEPPLHRVTM--SGSEERYSLSLFAFMRDV-MVQVPEKLVDDEHPLQYKPFDPFKYLL  294

Query  978   FFDSDKGRRSKNLLKDFCG  1034
             F  +++G++SK  +K +CG
Sbjct  295   FCVTEEGQKSKCQIKSYCG  313



>gb|KDO58207.1| hypothetical protein CISIN_1g037660mg [Citrus sinensis]
Length=312

 Score =   299 bits (765),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 146/318 (46%), Positives = 223/318 (70%), Gaps = 7/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS +T  K+LVVD  NE+LKPG+++W   C +IR A+ED GCF  + +K+  +LHN IF
Sbjct  1     MGS-QTQPKILVVDLCNENLKPGTSTWISTCNEIRQAMEDTGCFEAIYNKIPLELHNEIF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              A+ +LFDLP E K+ NT++KPYH Y GQ   IP +E+  ID  T +   QSF++ MW  
Sbjct  60    KAADELFDLPIETKMQNTSDKPYHEYFGQYTGIPLYESLAIDDPTNLTATQSFTDRMWPN  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN  F ES  SF+KI+ E+++ V+RM+ ESYG+EK+YDS++E++ YLLR+ KY  P E +
Sbjct  120   GNPPFCESVHSFAKIIVEVDQLVMRMIMESYGIEKYYDSHIETSNYLLRFFKYRKP-EIN  178

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
             E+NV    HTDK  +++++Q N ++GL+++A++GEWI  +  PSSF++MA + +  WSN 
Sbjct  179   EHNVGLYPHTDKNMVSIIHQ-NHINGLQIKAKDGEWIDLEPSPSSFVIMAADGLLAWSNG  237

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+ +  H+V ++A+  E RYS+G+FSF  N   + +PEE VD+ HPL+++PF   + ++F
Sbjct  238   RIRSCEHQVIINAH--ETRYSMGLFSF--NRGIVHIPEEFVDELHPLRYRPFDIYEFLRF  293

Query  981   FDSDKGRRSKNLLKDFCG  1034
              DSD+G+++   +  FCG
Sbjct  294   HDSDEGKKTDGSITSFCG  311



>ref|XP_008377592.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Malus domestica]
Length=312

 Score =   299 bits (765),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 153/318 (48%), Positives = 221/318 (69%), Gaps = 7/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS ET  KL V+D ++E+LKPG+ +W  ACK+I+ ALE++GCF  +  K+  +LHNSIF
Sbjct  1     MGS-ETQPKLPVIDLSDENLKPGTDAWLLACKEIKDALEEYGCFEAIYHKIPLELHNSIF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              A + LF LP E K   T+++PYH Y GQ  F+P +E+ G+D+ TT+EG Q F+++MW  
Sbjct  60    SAMEDLFGLPLETKKQKTSDRPYHSYFGQYSFLPLYESLGVDNPTTVEGAQGFTSIMWPQ  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN  F E++ SFSK+VAEL + V RM+F+ YGV++ +DS++EST YLLR  KY    E +
Sbjct  120   GNAHFCETAHSFSKLVAELSQMVTRMVFDMYGVQRLFDSHMESTTYLLRCFKYRT-QEEN  178

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
             E NV    HTDKTF+++L Q NQV+GL++  ++G+WI     PSSF+++AG+A   WSN 
Sbjct  179   ETNVGLHPHTDKTFISILNQ-NQVNGLQIGTKDGQWIDVNPSPSSFLILAGDAFMAWSND  237

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             RV +  H+VTM  N  + RYS+G+F+F   S  I+VPEEL+D++HPL +KPF H   + F
Sbjct  238   RVPSCDHQVTMKEN--KTRYSLGLFAF--KSGIIQVPEELIDEKHPLLYKPFDHFSFLDF  293

Query  981   FDSDKGRRSKNLLKDFCG  1034
               + + R+ K  +K +CG
Sbjct  294   DRTPEARKLKCSIKAYCG  311



>ref|XP_006465515.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1.2-like 
[Citrus sinensis]
Length=314

 Score =   299 bits (765),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 149/318 (47%), Positives = 215/318 (68%), Gaps = 5/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS +T +K+ V+D + +DLK G+++W   CKDIR A E+ GCF  +  K S +L + + 
Sbjct  1     MGS-QTKSKIPVIDLSKQDLKSGTSTWLSTCKDIRHAFEEFGCFEAIYQKFSQELRSEVL  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              ++++LFD+P E K+ NT+ KPY  Y GQ   IP +E+  ID+  T    QSF+NLMW  
Sbjct  60    ASTEELFDVPIEIKVKNTSTKPYFEYYGQYTIIPLYESLAIDYPDTRNATQSFTNLMWPA  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN  F ESS S S++V EL++ V RMLFESYGVE +YDSY+ S  YLLRY KY  P E +
Sbjct  120   GNDCFCESSLSMSELVVELDKMVTRMLFESYGVEGYYDSYIGSVNYLLRYFKYRAP-EPN  178

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
             E  +    HTDKT  ++++Q+N ++GL+VQA++GEWI  +  PSSFIVMAG+A+K W N 
Sbjct  179   ETKMGLTPHTDKTMTSIIHQINHINGLQVQAKDGEWIDVEPSPSSFIVMAGDALKAWGND  238

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+    H+V MD N  E RYS+G+FSF  +S  +++P+EL  +  PL++KPF H   + F
Sbjct  239   RIRPCRHQVIMD-NASETRYSLGLFSF--SSGVVDIPKELGVETQPLKYKPFDHFGFLHF  295

Query  981   FDSDKGRRSKNLLKDFCG  1034
               S++G++S + +K +CG
Sbjct  296   NQSEEGKKSASSIKAYCG  313



>ref|XP_010535123.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Tarenaya hassleriana]
Length=314

 Score =   298 bits (764),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 150/319 (47%), Positives = 225/319 (71%), Gaps = 8/319 (3%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS+ T TK+ V+DF N+DL P +  W     +   ALE++GCF+ +     P L  + F
Sbjct  1     MGSIST-TKIPVLDFTNQDLIPDTPLWVSTSVEACKALEEYGCFVAVYGGAPPHLAGAAF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              A+++LF LP E K  N N+KPYHGYVGQ+  IP HE  GID+ T  + V+ F+ LMW  
Sbjct  60    SAAEELFCLPTETKRKNVNDKPYHGYVGQMSVIPLHEGLGIDYVTDRDHVRKFTELMWPQ  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN  F E+  SFS  +AEL+  V+RM+FE+Y V K+Y+S++ S  YLL+++KY  P E++
Sbjct  120   GNDPFCETVYSFSNAIAELDRLVVRMIFENYRVGKYYESHIGSKTYLLKFLKYSPPPEAN  179

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
                  FP HTDKTF+++L Q N V+GLEV++++GEWI+ + PP+S++VMAG+   GWSN 
Sbjct  180   PTP-AFPMHTDKTFLSILRQ-NDVNGLEVKSKDGEWIALELPPNSYVVMAGDVSMGWSND  237

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDD-EHPLQFKPFVHLDMIK  977
             R+ +  H+VTM  +G +KRY++G+FSF+  + TI VPEELVD+ ++PL++KPF ++ +I+
Sbjct  238   RIRSCEHRVTM--SGNKKRYTLGLFSFV--TGTISVPEELVDEKDYPLKYKPFDNISLIE  293

Query  978   FFDSDKGRRSKNLLKDFCG  1034
             F+ +D+GR+++N LK +CG
Sbjct  294   FYATDEGRKAENTLKAYCG  312



>ref|XP_002517546.1| Gibberellin 20 oxidase, putative [Ricinus communis]
 gb|EEF44710.1| Gibberellin 20 oxidase, putative [Ricinus communis]
Length=321

 Score =   298 bits (763),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 153/320 (48%), Positives = 219/320 (68%), Gaps = 9/320 (3%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS   P K+ V+DF+ E+LKPG++SW   CK++  ALE++GCFI + +K+  +L +S +
Sbjct  1     MGS-RIPPKIPVIDFSQENLKPGTSSWVSTCKNVLRALEEYGCFIAVYEKIPLELQSSFY  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFI-PYHEAFGIDHATTIEGVQSFSNLMWS  437
             +    LFDLP + K  N +  PY+GYVG  PF+ P +E  GI++A T+EG   F+N+MW 
Sbjct  60    NKLITLFDLPIDTKRKNVSAIPYYGYVGNQPFVPPLYEGMGINNAATMEGTLDFTNIMWP  119

Query  438   GGNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAES  617
              G+  F ++  S+SK VAELE+ V RM+FE YGV+  YD+  E T YL R MKY  P E 
Sbjct  120   NGDDDFCKTVFSYSKWVAELEQMVTRMVFEGYGVQYSYDTQQERTNYLFRMMKYRAPTEG  179

Query  618   DENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQ-FPPSSFIVMAGEAIKGWS  794
              E+++    HTDK F+TVL+Q N+VSGLEVQ ++G+W+  +   PSSFIVMA +A+  WS
Sbjct  180   -ESDLGCDVHTDKGFITVLHQ-NEVSGLEVQTKDGQWVCFEPSSPSSFIVMAADALLAWS  237

Query  795   NSRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMI  974
             N R+ A  H+V M   G + RYSVG+FS+LK     EVPEEL+D+EHPLQFKPF +  ++
Sbjct  238   NGRIHAAFHRVVM--RGSKARYSVGLFSYLKG--ITEVPEELIDEEHPLQFKPFDNFGLL  293

Query  975   KFFDSDKGRRSKNLLKDFCG  1034
              +F +++GR  ++ +K +CG
Sbjct  294   HYFYTEEGREKESTVKAYCG  313



>ref|XP_007145554.1| hypothetical protein PHAVU_007G248400g [Phaseolus vulgaris]
 gb|ESW17548.1| hypothetical protein PHAVU_007G248400g [Phaseolus vulgaris]
Length=309

 Score =   296 bits (757),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 150/319 (47%), Positives = 214/319 (67%), Gaps = 15/319 (5%)
 Frame = +3

Query  84    GSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFH  263
             GS E   +L V+DF+ E+LKPGS SW   C+ +R A E+HGCF+ + DKV  +L N +F 
Sbjct  3     GSEEQHPRLPVLDFSTEELKPGSDSWLERCRSVRKAFEEHGCFVAVYDKVCDELRNDVFC  62

Query  264   ASQQLFDLPFEKKILNTNE-KPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
             + ++LFDL  E K  NT E  P  GYVGQ P IP H++ GID  TT+EG+QSF++ MW  
Sbjct  63    SMKELFDLSVETKRRNTYEGAPLKGYVGQHPKIPLHQSMGIDQGTTLEGIQSFAHKMWPK  122

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN  F +    ++K+  EL+ KV RM+FESYG+ ++Y+SY+ ST+YLLR +K+  P E  
Sbjct  123   GNDQFCKHIIEYAKVAEELDGKVARMIFESYGLSEYYESYIGSTSYLLRLLKHTAPEEV-  181

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPS-SFIVMAGEAIKGWSN  797
             E  + F  HTDK+F T+L+Q N V+ L V+ RNG WI   F  + SF+VMAG+A+  WSN
Sbjct  182   EPQLGFLAHTDKSFTTILHQ-NHVNALMVETRNGVWIDVDFSSTNSFVVMAGDALMAWSN  240

Query  798   SRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIK  977
              R+ +P HKV M  NG++ RYS+G+F+F K    ++VPEEL+D+EHP+ +KPF HL ++ 
Sbjct  241   DRIQSPNHKVVM-KNGEDTRYSLGLFAFYKG--IMKVPEELIDEEHPVHYKPFDHLGLLN  297

Query  978   FFDSDKGRRSKNLLKDFCG  1034
             F+ ++        +K +CG
Sbjct  298   FYSAN--------MKAYCG  308



>emb|CDY26055.1| BnaC06g05690D [Brassica napus]
Length=310

 Score =   295 bits (756),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 150/313 (48%), Positives = 220/313 (70%), Gaps = 8/313 (3%)
 Frame = +3

Query  102   TKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIV-LCDKVSPQLHNSIFHASQQL  278
             +K+  +DF+ EDLKPG+  W    K+IR ALE++GCFI+ L DK    L + +F +  QL
Sbjct  3     SKIPTLDFSREDLKPGTKYWKSTSKNIRQALEEYGCFIIDLQDKTPLDLLDQVFGSLVQL  62

Query  279   FDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHsfs  458
             FDLP + K+ N  +KP +GYVGQIP +P HE+ GID+AT++E  +SF+ LMW  GN  FS
Sbjct  63    FDLPTQTKMKNKYDKPLNGYVGQIPALPLHESLGIDNATSLEATRSFTGLMWPQGNKHFS  122

Query  459   essqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNVVF  638
             E    +++  A+L++ V RM+FESY VEKHY  Y+EST YLLR +K   P  +D+ N+ F
Sbjct  123   ECVHKYAEFAAKLDQMVTRMVFESYNVEKHYKPYIESTTYLLRVLKNSAP-NNDKPNLGF  181

Query  639   PCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQF-PPSSFIVMAGEAIKGWSNSRVLAP  815
               HTDK+F T+L+Q NQV+GLE++ R GE I+     PS F+++AG+A+  WSN RV +P
Sbjct  182   VTHTDKSFTTILHQ-NQVNGLEMETREGEKININLSSPSLFMIVAGDALMAWSNDRVWSP  240

Query  816   IHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSDK  995
              H+V +  +G+  RYS+G+FSF  N+ T++VPEEL+D +HPL +KPF H+ +++F+ +D 
Sbjct  241   RHQVLV--SGETDRYSLGMFSF--NNGTLQVPEELIDHQHPLMYKPFDHIGLLRFYRTDI  296

Query  996   GRRSKNLLKDFCG  1034
             G +S+  +K +CG
Sbjct  297   GYKSECPIKAYCG  309



>emb|CDY68239.1| BnaA06g37440D [Brassica napus]
Length=310

 Score =   295 bits (755),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 149/313 (48%), Positives = 220/313 (70%), Gaps = 8/313 (3%)
 Frame = +3

Query  102   TKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIV-LCDKVSPQLHNSIFHASQQL  278
             +K+  +DF+ EDLKPG+  W    K+IR ALE++GCFI+ L DK    L + +F +  +L
Sbjct  3     SKIPTLDFSREDLKPGTKYWKSTSKNIRQALEEYGCFIIDLQDKTPLDLLDQVFGSLVEL  62

Query  279   FDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHsfs  458
             FDLP + K+ N  +KP +GYVGQIP +P HE+ GID+AT++E  +SF+ LMW  GN  FS
Sbjct  63    FDLPTQTKMKNKYDKPLNGYVGQIPALPLHESLGIDNATSLEATRSFTGLMWPQGNKHFS  122

Query  459   essqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNVVF  638
             E    +++  A+L++ V RM+FESY VEKHY  Y+EST YLLR +K   P  +D++N+ F
Sbjct  123   ECVHKYAEFAAKLDQMVTRMVFESYNVEKHYKPYIESTTYLLRVLKNSAP-NNDKSNLGF  181

Query  639   PCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQF-PPSSFIVMAGEAIKGWSNSRVLAP  815
               HTDK+F T+L+Q NQV+GLE++ R GE I+     PS F+++AG+A+  WSN RV +P
Sbjct  182   VTHTDKSFTTILHQ-NQVNGLEMETREGERININLSSPSLFMIVAGDALMAWSNDRVWSP  240

Query  816   IHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSDK  995
              H+V +  +G   RYS+G+FSF  N+ T++VPEEL+D +HPL +KPF H+ +++F+ +D 
Sbjct  241   RHQVLV--SGDTDRYSLGMFSF--NNGTLQVPEELIDHQHPLMYKPFDHIGLLRFYRTDI  296

Query  996   GRRSKNLLKDFCG  1034
             G +S+  +K +CG
Sbjct  297   GYKSECPIKAYCG  309



>ref|XP_009339601.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Pyrus x bretschneideri]
Length=312

 Score =   295 bits (754),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 147/318 (46%), Positives = 219/318 (69%), Gaps = 7/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS ET  KL V+D ++E+LKP + +W  ACK+I+ ALE++GCF  +  KV  +LHNSIF
Sbjct  1     MGS-ETQPKLPVIDLSDENLKPDTDAWLLACKEIKDALEEYGCFEAIYHKVPLELHNSIF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              A + LF LP E K+  T+++PYH Y+GQ  F+P +E+  +D+ TT++G Q F+N+MW  
Sbjct  60    SAMEDLFGLPLETKMQKTSDRPYHSYIGQYSFLPLYESLAVDNPTTVDGSQGFTNIMWPQ  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN  F E+  S SK+VAEL + V RM+F+ YGV++ Y+S++EST Y LR +KY  P E++
Sbjct  120   GNDHFCETVHSISKLVAELSQMVTRMVFDVYGVQRLYNSHMESTTYQLRCLKYRTPEENE  179

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
              N  + P HTDKTF++++ Q NQV+GL+++ ++G+WI     PSSF+++AG+A   WSN 
Sbjct  180   TNMGLQP-HTDKTFISIVNQ-NQVNGLQIRTKDGQWIDVNPSPSSFLILAGDAFMAWSND  237

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             RV +  H++ M  N  + RYS+G+FSF   S  I+VPEEL+D++HPL +KPF H   + F
Sbjct  238   RVPSCEHQIIMKEN--KTRYSLGLFSF--KSGIIQVPEELIDEKHPLLYKPFDHFSFLDF  293

Query  981   FDSDKGRRSKNLLKDFCG  1034
               + + R     +K +CG
Sbjct  294   GRTPEARNLLRTIKAYCG  311



>ref|XP_003533058.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1-like 
[Glycine max]
 gb|KHN47794.1| Gibberellin 20 oxidase 2 [Glycine soja]
Length=319

 Score =   295 bits (755),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 145/319 (45%), Positives = 213/319 (67%), Gaps = 8/319 (3%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS +T  ++ +VDF +E+LKPG+  WA AC  IR+ALEDHGCF  LCDKV   L+NS+F
Sbjct  1     MGS-QTACQVPIVDFTDEELKPGTAKWASACLVIRSALEDHGCFYALCDKVPMDLYNSVF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
                ++LF LP E K+   ++KPYHGY GQ   +P +E+ GI+   T+EGVQ+F+ LMW  
Sbjct  60    ALMEELFYLPLETKLQKMSDKPYHGYYGQFTHLPLYESLGINDPLTMEGVQNFTKLMWPA  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGV-EKHYDSYVESTAYLLRYMKYEVPAES  617
             G   F E+   ++K++ EL+    RM+F+ YG+ ++H DS +EST Y+LR  KY +P + 
Sbjct  120   GYDHFCETLSLYAKLLVELDHMAKRMVFDGYGLDQRHCDSLLESTNYMLRSFKYRLP-QK  178

Query  618   DENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSN  797
             DENN+    HTD +F T+L+Q N V+GL+V+ +NGEW+     P   +++AG+A K WSN
Sbjct  179   DENNLGLHAHTDTSFFTILHQ-NNVNGLQVKLKNGEWVDIDLSPFMLLILAGDAFKVWSN  237

Query  798   SRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIK  977
              R+    H+V +   GK+ RYS+G+FS     K +E PEELVD++HP ++KPF H + ++
Sbjct  238   DRIHCCEHRVII--KGKKDRYSMGLFSL--GGKMVETPEELVDEDHPRRYKPFDHYEYLR  293

Query  978   FFDSDKGRRSKNLLKDFCG  1034
             F+ + K   S+  +K FCG
Sbjct  294   FYATKKALESECRIKAFCG  312



>ref|XP_009147661.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP3 isoform 
X1 [Brassica rapa]
Length=310

 Score =   294 bits (753),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 149/313 (48%), Positives = 219/313 (70%), Gaps = 8/313 (3%)
 Frame = +3

Query  102   TKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIV-LCDKVSPQLHNSIFHASQQL  278
             +K+  +DF+ EDLKPG+  W    K+IR ALE++GCFI+ L DK    L + +F +  +L
Sbjct  3     SKIPTLDFSREDLKPGTKYWKSTSKNIRQALEEYGCFIIDLQDKTPLDLLDQVFGSLVEL  62

Query  279   FDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHsfs  458
             FDLP + K+ N  +KP +GYVGQIP +P HE+ GID+AT++E  +SF+ LMW  GN  FS
Sbjct  63    FDLPTQTKMRNKYDKPLNGYVGQIPALPLHESLGIDNATSLEATRSFTGLMWPQGNKHFS  122

Query  459   essqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNVVF  638
             E    +++  A+L++ V RM+FESY VEKHY  Y+EST YLLR +K   P  +D++N+ F
Sbjct  123   ECVHKYAEFAAKLDQMVTRMVFESYNVEKHYKPYIESTTYLLRVLKNSAP-NNDKSNLGF  181

Query  639   PCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQF-PPSSFIVMAGEAIKGWSNSRVLAP  815
               HTDK+F T+L+Q NQV+GLE++ R GE I+     PS F+++AG+A+  WSN RV +P
Sbjct  182   VTHTDKSFTTILHQ-NQVNGLEMETREGERININLSSPSLFMIVAGDALMAWSNDRVWSP  240

Query  816   IHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSDK  995
              H+V +  +G   RYS+G+FSF  N+ T++VPEEL+D +HPL +KPF H+ +++F+ +D 
Sbjct  241   RHQVLV--SGDTDRYSLGMFSF--NNGTLQVPEELIDHQHPLMYKPFDHIGLLRFYRTDI  296

Query  996   GRRSKNLLKDFCG  1034
             G +S   +K +CG
Sbjct  297   GYKSVCPIKAYCG  309



>ref|XP_010665883.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Beta vulgaris subsp. vulgaris]
Length=319

 Score =   294 bits (753),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 151/320 (47%), Positives = 213/320 (67%), Gaps = 10/320 (3%)
 Frame = +3

Query  75    KNMGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNS  254
             K +  L+ PT    ++   E+  PG++SW   C +I+ ALE++GCFI + DK S  LHN 
Sbjct  4     KTLAKLQLPT----INLGGENTNPGTSSWTSTCNNIKQALEEYGCFIAVYDKFSLDLHNK  59

Query  255   IFHASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMW  434
                  Q +F+LP E K  N++  PYHGY      +P  E+ GI+ A     V+SF+NL+W
Sbjct  60    AIDVIQPMFELPTEVKARNSSNLPYHGYYKPGNPMPLLESLGIEDALMRNAVRSFTNLLW  119

Query  435   SGGNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAE  614
               GNH F E+   ++K VAELE+ VLRM+FESYGVEK+++S++ ST+YLLR  KY VP +
Sbjct  120   PSGNHQFCETIDQYAKKVAELEQLVLRMVFESYGVEKYHNSHLNSTSYLLRIAKYRVP-Q  178

Query  615   SDENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWS  794
              +E+N+    HTDK F+T+L++ N V+GLEVQ ++GEW+S    P SFIVMAGE    WS
Sbjct  179   KNEHNLGAVGHTDKNFITILHE-NDVNGLEVQTKDGEWLSIDSSPQSFIVMAGEPFLAWS  237

Query  795   NSRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMI  974
             N+R+ AP+H+V M   G + RYS  +FS  K+  TIE P+ELVDDEHPLQFKPF ++ ++
Sbjct  238   NNRIHAPLHRVIM--KGDKPRYSFALFSTTKD--TIETPKELVDDEHPLQFKPFDYMGLL  293

Query  975   KFFDSDKGRRSKNLLKDFCG  1034
             +F+  D  R +   +KD+CG
Sbjct  294   QFYTEDVSRMAVCTIKDYCG  313



>ref|XP_006465423.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1.2-like 
[Citrus sinensis]
Length=315

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 150/319 (47%), Positives = 218/319 (68%), Gaps = 6/319 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS ETP KL ++DF+  +LKPG+  W      +R ALED+GCF  L +KV  ++  ++F
Sbjct  1     MGS-ETPIKLPIIDFSKPNLKPGTPEWDSVKSHVRKALEDYGCFEALFNKVPEEILKAVF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              A ++LFDLP   K+ N ++KP+HGYVGQ P +P +E+ GID A   E V+S +N++W  
Sbjct  60    GALEELFDLPLRTKMRNISKKPFHGYVGQYPQVPLYESMGIDDANVKEKVESMTNILWPE  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN SF ++ QSFS+ V+EL++ + RM+ ES G+EK+ D ++ ST+YLLR MKY+ P E+ 
Sbjct  120   GNKSFCKTIQSFSEQVSELDQTIRRMILESLGLEKYMDEHMNSTSYLLRVMKYKGP-ETT  178

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQ-FPPSSFIVMAGEAIKGWSN  797
             E  +    HTDK  +T+LYQ NQV GLE+Q +NGEWI+ +   P SFI M G+++  W+N
Sbjct  179   EKKLGLNAHTDKNIVTILYQ-NQVEGLELQTKNGEWINVKPSSPHSFIAMIGDSLYAWTN  237

Query  798   SRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIK  977
              ++ +P H+V M   G E RYS G+FS  K    IE PEELVD+EHPL FK F H + ++
Sbjct  238   GQLYSPYHRVMM--TGIETRYSTGLFSIPKAGYKIEAPEELVDEEHPLLFKSFDHFEFLE  295

Query  978   FFDSDKGRRSKNLLKDFCG  1034
             F+ ++ G+R+++ LK +CG
Sbjct  296   FYYTEAGQRAESALKTYCG  314



>ref|XP_006392867.1| hypothetical protein EUTSA_v10011672mg [Eutrema salsugineum]
 gb|ESQ30153.1| hypothetical protein EUTSA_v10011672mg [Eutrema salsugineum]
Length=288

 Score =   291 bits (746),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 150/320 (47%), Positives = 215/320 (67%), Gaps = 35/320 (11%)
 Frame = +3

Query  81    MGSL-ETPTKLLVVDFNNE-DLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNS  254
             MGS+ ++ +K+ ++D  ++ DLKP +++W    K+   ALE+ GCF+V+ D V+ QL +S
Sbjct  1     MGSIVKSSSKVPILDLTSQQDLKPNTSTWRSISKEACEALEEFGCFVVVHDGVTQQLDDS  60

Query  255   IFHASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMW  434
             IF A+++LFDLP E K  N NEKPYHGYVGQ+P IP HE  GID+ T  E  Q F++LMW
Sbjct  61    IFAAAEELFDLPTETKRKNVNEKPYHGYVGQMPVIPLHEGLGIDYVTNKEYAQRFTHLMW  120

Query  435   SGGNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAE  614
               GNH F  +  +FS  VAE+++ V+RM+FE+YGVEKHYDS+                  
Sbjct  121   PQGNHQFCATVHAFSNAVAEIDQLVVRMIFENYGVEKHYDSH------------------  162

Query  615   SDENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWS  794
                       HTDKTF+++L+Q N V+GLEV++++GEWIS Q P  S++VMAG+   GWS
Sbjct  163   ----------HTDKTFLSILHQ-NDVNGLEVKSKDGEWISLQLPSKSYVVMAGDISMGWS  211

Query  795   NSRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMI  974
             N R+ +  H+VTMD  G + RYS G+FSF+  +  + VP+ELVDDEHPL +KPF ++ +I
Sbjct  212   NDRIRSCEHRVTMD--GGKTRYSFGLFSFV--TGMVSVPKELVDDEHPLMYKPFDNIALI  267

Query  975   KFFDSDKGRRSKNLLKDFCG  1034
              F+ + +GR +K+ LK +CG
Sbjct  268   NFYATKEGREAKSTLKAYCG  287



>ref|XP_010110313.1| Gibberellin 3-beta-dioxygenase 4 [Morus notabilis]
 gb|EXC25833.1| Gibberellin 3-beta-dioxygenase 4 [Morus notabilis]
Length=312

 Score =   292 bits (748),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 147/312 (47%), Positives = 227/312 (73%), Gaps = 10/312 (3%)
 Frame = +3

Query  105   KLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQQLFD  284
             K+  +DF+  +L PG++SW   C D+R ALE++GCF+ L DK+S QL  S+F   ++LFD
Sbjct  8     KIPTIDFSEGNLNPGTSSWFSVCNDVRRALEEYGCFVALYDKISQQLRTSMFSELKELFD  67

Query  285   LPFEKKILNTNEKPYHGYVGQIPFI-PYHEAFGIDHATTIEGVQSFSNLMW-SGGNHsfs  458
             LP E K+ N ++KPY GY+G  P I P HE+ GI++ATT+EG +SF+N++W  GGN+ F 
Sbjct  68    LPTEIKMKNVSDKPYFGYIGNHPSIPPLHESMGIENATTLEGGESFTNIIWPKGGNNHFC  127

Query  459   essqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNVVF  638
             E+  S+S++V+ELE+ V RM+F+SYGVEK+YDS++ ST +LL+ +KY VP E +E+++  
Sbjct  128   ETVVSYSRLVSELEKMVKRMVFQSYGVEKYYDSHLGSTTFLLKLIKYRVP-EMNESSIGC  186

Query  639   PCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRVLAPI  818
               HTDK+F+TVL+Q N+V+GLE++ R+G+WI  +  PSSF+V+AG+A   W+N R+ +  
Sbjct  187   APHTDKSFITVLHQ-NEVNGLEIETRDGDWIQFEPSPSSFLVLAGDAFLAWTNGRIHSAA  245

Query  819   HKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSDKG  998
             H+V M   G + RYS+G+FS+  ++ TIE+P+ELVD++HP QFK F H  ++  + +   
Sbjct  246   HRVVM--TGTKPRYSIGLFSY--HNGTIEIPDELVDEQHPQQFKSFDHYGLLHHYHA--A  299

Query  999   RRSKNLLKDFCG  1034
              + ++  KD+CG
Sbjct  300   PKIESTAKDYCG  311



>ref|XP_002284968.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Vitis vinifera]
 emb|CBI36202.3| unnamed protein product [Vitis vinifera]
Length=314

 Score =   292 bits (748),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 147/318 (46%), Positives = 217/318 (68%), Gaps = 5/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS ETP KL V+DF++ +LKPG+  W      ++ ALE++GCF    +KV   L  +IF
Sbjct  1     MGS-ETPLKLPVIDFSDPELKPGTLQWNLVKAQVQKALEEYGCFEAFFNKVPLDLRKAIF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              A ++LFDLP + K+ N+++KPYHGYVGQ P +P +E+ GID A   E  + F+ L+W  
Sbjct  60    GALEELFDLPLQTKLRNSSKKPYHGYVGQYPTVPLYESMGIDDALVQEKAEHFTKLLWPE  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN +F ++ QSFS+ ++EL+  + RM+ ES G+EK+ D +++ST YLLR MKY+ P ++ 
Sbjct  120   GNPNFCKTIQSFSEQLSELDHTIRRMVLESLGMEKYLDEHMDSTNYLLRVMKYKGP-QTT  178

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
             E  +    HTDK  +T+LYQ NQV GL VQ ++G+WI+ +  P SFI+M G++   W+N 
Sbjct  179   ETKLGLNAHTDKNIVTILYQ-NQVDGLGVQTKDGQWINIKCSPDSFIIMIGDSFLAWTNG  237

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+ +P H+V M   G E RYS G+FS  K    I+ PEELVD+EHPL FKPF HL+ ++F
Sbjct  238   RLHSPYHRVMM--TGNESRYSTGLFSIPKAGYVIKAPEELVDEEHPLLFKPFDHLEFLQF  295

Query  981   FDSDKGRRSKNLLKDFCG  1034
             + ++ G+R+++ LK +CG
Sbjct  296   YYTEAGQRAESALKTYCG  313



>ref|XP_002284985.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Vitis vinifera]
 emb|CBI36207.3| unnamed protein product [Vitis vinifera]
Length=316

 Score =   291 bits (746),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 149/319 (47%), Positives = 218/319 (68%), Gaps = 12/319 (4%)
 Frame = +3

Query  87    SLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHA  266
              LET  K+ +VDF+ E+LKPG+ SW  AC ++R ALE++GCF+ + D+V   +HN+IF A
Sbjct  6     GLETLPKIPMVDFSKENLKPGTDSWLPACNNVRHALEEYGCFMAVYDQVPLGVHNTIFGA  65

Query  267   SQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATT-IEGVQSFSNLMWSGG  443
              ++LFDLP E K  N +EKPY GY  + P  P H+  GID+ TT +E ++ F+ +MW  G
Sbjct  66    MRELFDLPIETKKQNISEKPYQGYTSESPAAPLHQGLGIDNVTTNLEEIRRFAKIMWPAG  125

Query  444   NHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDE  623
             N +F +S   +SK+VAEL+  V+RM+ ESYG+E    S++ES ++L+R +K  VP + +E
Sbjct  126   NENFCQSVHCYSKLVAELDRMVVRMVLESYGIEN--GSHIESASFLVRLLKSRVP-KMNE  182

Query  624   NNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPS--SFIVMAGEAIKGWSN  797
              N  FP H DK+F+++L+Q N+V+GLE+Q ++G+WIS + PPS   F+VMAGE +  WSN
Sbjct  183   TNKAFPSHCDKSFISILHQ-NKVNGLEIQTKDGKWISHE-PPSLQVFLVMAGEVLTAWSN  240

Query  798   SRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIK  977
              R+    H+V +  N  E RY++G+FS +     I+VPEELVDD HPLQFKPF H  ++ 
Sbjct  241   GRIHPARHRVVVKGN--EARYTLGLFSTING--MIKVPEELVDDHHPLQFKPFDHTGLLH  296

Query  978   FFDSDKGRRSKNLLKDFCG  1034
             F  + +GR  +  LK +CG
Sbjct  297   FLGTKEGRNPETALKAYCG  315



>ref|XP_009379331.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Pyrus x bretschneideri]
Length=313

 Score =   291 bits (746),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 152/319 (48%), Positives = 214/319 (67%), Gaps = 8/319 (3%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNN-EDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSI  257
             MGS E   KL VVD  N E+LKPG+ +W   CK ++ ALED GCF      V   LHN++
Sbjct  1     MGS-EGQAKLPVVDLTNAENLKPGTEAWRSTCKQVQQALEDCGCFEATYHGVPLDLHNAM  59

Query  258   FHASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWS  437
             F  S  LFDLP E K   T++KPYH Y+GQI  +P +E+ G+D+ATT EGV+ F+N+MW 
Sbjct  60    FSMSNGLFDLPVETKCQKTSDKPYHSYIGQISSLPLYESLGVDYATTPEGVEKFTNMMWP  119

Query  438   GGNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAES  617
              G+  F E   +FS +VAEL + V +M+F +YGV++ Y+S++ ST YLLR+ +Y    E 
Sbjct  120   AGSDEFREKVYNFSNLVAELTKLVTKMVFHNYGVQRLYESHMASTIYLLRWSQYREQKE-  178

Query  618   DENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSN  797
             +E NV  P HTDK F++VL+Q  +V+GLEVQ ++G+W  A+  P+SF+VMAG+A   WSN
Sbjct  179   NETNVGLPPHTDKAFISVLHQ-KEVNGLEVQTKDGQWFVAEPSPTSFVVMAGDAFMAWSN  237

Query  798   SRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIK  977
              RV +  H+V M  N  + R S+G+FS+L    T++VPEEL+DDEHPL +KPF H   + 
Sbjct  238   GRVPSCFHQVIMKQN--KTRLSIGLFSWLNG--TVQVPEELIDDEHPLSYKPFDHFSYLH  293

Query  978   FFDSDKGRRSKNLLKDFCG  1034
             F  + + ++SK  +K +CG
Sbjct  294   FSVTPEAKQSKCAIKTYCG  312



>ref|XP_002298129.1| 2-oxoglutarate-dependent dioxygenase-related family protein [Populus 
trichocarpa]
 gb|EEE82934.1| 2-oxoglutarate-dependent dioxygenase-related family protein [Populus 
trichocarpa]
Length=314

 Score =   291 bits (745),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 148/318 (47%), Positives = 212/318 (67%), Gaps = 5/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS ETP KL ++DF+N    PG+  W      +R ALE++GCF  L DK+  +   +IF
Sbjct  1     MGS-ETPLKLPIIDFSNLGQNPGAAEWDLVKLQVRKALEEYGCFEALFDKIPAESRKAIF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              A ++LFDLP + K+ N ++KPYHGYVGQ P +P  E+ GID A   E V+S + ++W  
Sbjct  60    GAVEELFDLPLQTKMRNASKKPYHGYVGQYPQVPLFESMGIDDANIAEEVESMTTILWPQ  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN SFS +  SFS+ V+EL++ V RM+ ES G+EK+ D ++ ST YLLR MKY+ P ++ 
Sbjct  120   GNQSFSNTVLSFSEQVSELDQIVRRMIVESLGLEKYLDEHMNSTNYLLRVMKYKGP-QTT  178

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
             E  +    HTDK  +T+LYQ NQV GLE+Q ++G WI  +  P SFIVM G+++  W+N 
Sbjct  179   ETKLGLTAHTDKNMVTILYQ-NQVDGLELQTKDGCWIDLKPTPDSFIVMIGDSLHAWANG  237

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+ +P H+V M   G E RYSVG+FS  K    ++ PEEL+D+EHPL FKPF H+  + F
Sbjct  238   RLHSPYHRVMM--RGNEARYSVGLFSVPKAGYIVKAPEELIDEEHPLLFKPFDHVKFLGF  295

Query  981   FDSDKGRRSKNLLKDFCG  1034
             + ++ G+R+++ LK +CG
Sbjct  296   YYTEAGQRAQSALKTYCG  313



>ref|XP_007024335.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein, 
putative [Theobroma cacao]
 gb|EOY26957.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein, 
putative [Theobroma cacao]
Length=642

 Score =   301 bits (770),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 148/311 (48%), Positives = 217/311 (70%), Gaps = 7/311 (2%)
 Frame = +3

Query  93    ETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQ  272
             ++  +L V+D  +E+  PG+ SW   CKD+R ALE++GCF+   DKVS QL + +F++ Q
Sbjct  4     QSAVRLPVIDLFDENSVPGTASWVSKCKDVRLALEEYGCFLTPYDKVSLQLQDQVFNSVQ  63

Query  273   QLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHs  452
             +LF LP EKK+ NT++KPY GY    P IP  E+ GID  T +EG QSF++LMW  GN  
Sbjct  64    ELFALPTEKKVQNTSDKPYFGYFKH-PLIPLSESMGIDGPTVLEGTQSFTDLMWPNGNKR  122

Query  453   fsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNV  632
             F ES  +++K+V++L+ +V  M+FESYGV K++DS+++ST+YLLR +KY +P E + NN 
Sbjct  123   FCESVHTYAKLVSQLDRRVKYMVFESYGVGKYFDSHIDSTSYLLRLIKYRLPKEEETNNC  182

Query  633   VFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRVLA  812
              FP HTDK+F+T+L+  NQV+GLE++ ++G WI  +   S FIVMAG+A   WSN RV +
Sbjct  183   GFP-HTDKSFLTILHD-NQVAGLEIKTKDGRWIGVEPSGSMFIVMAGDAFLAWSNGRVHS  240

Query  813   PIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSD  992
              +H+V    NGK++RYS+G FSF  + +TI  PEEL+D+ HPL FKPF ++D+++ +  D
Sbjct  241   ALHRVV--TNGKKERYSLGFFSF--SGETIRTPEELIDEAHPLLFKPFENIDLLRLYSLD  296

Query  993   KGRRSKNLLKD  1025
               R+      D
Sbjct  297   DVRKYSQKFND  307


 Score =   288 bits (738),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 148/330 (45%), Positives = 225/330 (68%), Gaps = 10/330 (3%)
 Frame = +3

Query  54    YIELRKKKN--MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCD  227
             Y + +  KN  + + ++  KL V+D  +++ +PG+ SW   C++++ A E++GCF+   D
Sbjct  319   YSQQKSSKNYMIMATQSAIKLPVIDLFDDESEPGTDSWISKCEEVQRAFEEYGCFLATYD  378

Query  228   KVSPQLHNSIFHASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEG  407
             KVS QL + +F + ++LF LP EKK+LNT++KPY GY    P IP  E+ GID+ T +EG
Sbjct  379   KVSLQLQDEVFDSVRELFHLPTEKKVLNTSDKPYFGYFKH-PSIPLSESMGIDNPTILEG  437

Query  408   VQSFSNLMWSGGNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLR  587
              QSF+NLMW  GN  F ES  +++K+V+EL+  V  M+FESYGV K+YDS+++ST YLLR
Sbjct  438   TQSFTNLMWPNGNQIFCESIYAYAKLVSELDRMVKTMVFESYGVRKYYDSHIQSTNYLLR  497

Query  588   YMKYEVPAESDENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVM  767
              +KY VP E DEN+     HTDK+FMT+L+  N ++GL+++A++G WI  +   S F+VM
Sbjct  498   LIKYRVPRE-DENDFDGCPHTDKSFMTILHD-NHIAGLQIKAKDGNWIGVEPSGSMFVVM  555

Query  768   AGEAIKGWSNSRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQF  947
             AG+A   WSN R+ +P H+V M A  K++RY + +FSF  + +TI  PEELVD+ HPL F
Sbjct  556   AGDAFLAWSNGRIQSPTHRVIMKA--KKERYCLALFSF--SGETIRTPEELVDEAHPLLF  611

Query  948   KPFVHLDMIKFFD-SDKGRRSKNLLKDFCG  1034
             KPF ++D+++ F   D  + +++  +  CG
Sbjct  612   KPFDNMDLLRLFSLDDVHQHARSFSQPKCG  641



>ref|XP_002517541.1| Gibberellin 20 oxidase, putative [Ricinus communis]
 gb|EEF44705.1| Gibberellin 20 oxidase, putative [Ricinus communis]
Length=314

 Score =   290 bits (743),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 146/318 (46%), Positives = 217/318 (68%), Gaps = 5/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS ETP KL  +DF+ E+LKPG+  W      +R ALE++GCF     +V   L   +F
Sbjct  1     MGS-ETPLKLPAIDFSTENLKPGTVEWELVKTQVRNALEEYGCFEAFFSRVHNDLKKGVF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              A ++LF+LP + K+ N + KP+HGYVGQ P  P +E+ GI+   T+E V+SF++++W  
Sbjct  60    GAIEELFELPLQTKLKNVSRKPFHGYVGQYPQAPLYESMGIEDPDTVEKVESFTSVLWPQ  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN +FS++ QSFS+ V++L++ V RM+ ES G+EK+ D ++ ST YLLR MKY+ P E+ 
Sbjct  120   GNLTFSKTVQSFSEQVSKLDKVVRRMIVESLGLEKYMDEHMNSTDYLLRVMKYKGP-ETS  178

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
             E  +    HTDK  +T+L+Q NQV GLEV+ +NGEWI+ +  P SF+VM G+++  W+N 
Sbjct  179   EAKLGLHPHTDKNIVTILFQ-NQVDGLEVKTKNGEWITVKLSPDSFVVMIGDSLLAWANG  237

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+ +P H+V M   G E RYS G+FS  K    ++ PEELVD+EHPL FKPF H++ + F
Sbjct  238   RLHSPYHRVMM--TGNEARYSCGLFSIPKAGYIVKAPEELVDEEHPLLFKPFDHVEFLGF  295

Query  981   FDSDKGRRSKNLLKDFCG  1034
             + ++ G+R+++ LK +CG
Sbjct  296   YYTEAGQRAQSALKAYCG  313



>ref|XP_004302943.1| PREDICTED: gibberellin 20 oxidase 1-like [Fragaria vesca subsp. 
vesca]
Length=313

 Score =   290 bits (742),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 148/319 (46%), Positives = 225/319 (71%), Gaps = 8/319 (3%)
 Frame = +3

Query  81    MGSLETPT-KLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSI  257
             MGS   P  K+ +VD + E++KPG+ +W  A K+I+ ALE++GCF  + +KV  +LHNS 
Sbjct  1     MGSHTQPAAKVPIVDLSKENVKPGTDAWLLASKEIKYALEEYGCFEAIYNKVPLELHNST  60

Query  258   FHASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWS  437
             F   Q LF+LP E K+ +T+++PYH Y GQ  F+P +E+ G+D+ T IEGVQ F+++MW 
Sbjct  61    FSVLQDLFNLPLETKMQSTSDRPYHSYFGQYSFLPLYESLGVDNPTKIEGVQRFTSIMWP  120

Query  438   GGNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAES  617
              GN  F ES+ S+SK+VAEL+E V +M+FE+YGVE+ Y+S++ ST YLLR   Y  P + 
Sbjct  121   EGNDKFCESAHSYSKLVAELDEMVTKMVFENYGVERLYESHMASTTYLLRCFYYREP-QL  179

Query  618   DENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSN  797
             DE ++    HTDKTF+++L+Q ++++GL+++++ G+WI  +  PSSFIVMAG+A   WSN
Sbjct  180   DETDMGLHPHTDKTFISILHQ-DEINGLQIKSKEGQWIDVEPSPSSFIVMAGDAFMAWSN  238

Query  798   SRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIK  977
              RV +  H+V M    K+ RYS+G+F+F   +  ++VP ELVD++HPL +KPF H+  + 
Sbjct  239   DRVRSCEHQVIMKE--KKTRYSIGLFAF---NGVLQVPAELVDEKHPLLYKPFDHIGFLL  293

Query  978   FFDSDKGRRSKNLLKDFCG  1034
             F  + +G +SK  +KD+CG
Sbjct  294   FNKTPEGMKSKCPIKDYCG  312



>emb|CAN80138.1| hypothetical protein VITISV_028512 [Vitis vinifera]
Length=314

 Score =   289 bits (740),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 146/318 (46%), Positives = 215/318 (68%), Gaps = 5/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS ETP KL  +DF++ +LKPG+  W      ++ ALE++GCF    +KV   L  +IF
Sbjct  1     MGS-ETPLKLPXIDFSDPELKPGTLQWNLVKAQVQKALEEYGCFEAFFNKVPLDLRKAIF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              A ++LFDLP + K+ N+++KPYHGYVGQ P +P +E+ GID A   E  + F+ L+W  
Sbjct  60    GALEELFDLPLQTKLRNSSKKPYHGYVGQYPTVPLYESMGIDDALVQEKAEHFTKLLWPE  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN +F ++ QSFS+ ++EL+  + RM+ ES G+EK+ D +++ST YLLR MKY+ P ++ 
Sbjct  120   GNPNFCKTIQSFSEQLSELDHTIRRMVLESLGMEKYLDEHMDSTNYLLRVMKYKGP-QTT  178

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
             E  +    HTDK  +T+LYQ NQV GL VQ ++G WI+ +  P SFI+M G++   W+N 
Sbjct  179   ETKLGLNAHTDKNIVTILYQ-NQVDGLGVQTKDGXWINIKCSPDSFIIMIGDSFLAWTNG  237

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+ +P H+V M   G E RYS G+FS  K    I+ PEELVD+EHPL FKPF HL+ ++F
Sbjct  238   RLHSPYHRVMM--TGNESRYSTGLFSIPKAGYVIKAPEELVDEEHPLLFKPFDHLEFLQF  295

Query  981   FDSDKGRRSKNLLKDFCG  1034
             + ++ G+R+++ LK +CG
Sbjct  296   YYTEAGQRAESALKTYCG  313



>ref|XP_003528366.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1.2-like 
[Glycine max]
Length=314

 Score =   289 bits (739),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 150/318 (47%), Positives = 214/318 (67%), Gaps = 5/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS E   KL V+DF N  L+  + +W      +  AL D+GCF  + +KV  +L  +IF
Sbjct  1     MGS-EATLKLPVIDFTNLKLEANNPNWEAIKSQVHKALVDYGCFEAIFEKVPLELRKAIF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              A Q+LFDLP + KILN ++KPYHGYVGQ P +P  E+ GID A   E V+S +N+MW  
Sbjct  60    AALQELFDLPLQTKILNVSKKPYHGYVGQYPMVPLFESMGIDDANVYENVESMTNIMWPH  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN SFS++ QSFS+ ++EL++ + +M+ ES GVEK+ + ++ ST YLLR MKY+ P  SD
Sbjct  120   GNPSFSKTIQSFSEQLSELDQIIRKMILESLGVEKYLEEHMNSTNYLLRVMKYKGPQTSD  179

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
                V    H+DK  +T+LYQ N+V GLEV  ++G+WIS +  P SF+VM G+++  WSN 
Sbjct  180   -TKVGLTTHSDKNIVTILYQ-NEVEGLEVMTKDGKWISYRPSPDSFVVMIGDSLHAWSNG  237

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+ +P H+V M  +G E RYS G+FS  K    I+ PEELVD+EHPL FKPF H++ +K+
Sbjct  238   RLHSPFHRVMM--SGNEARYSAGLFSIPKGGNIIKAPEELVDEEHPLLFKPFDHVEFLKY  295

Query  981   FDSDKGRRSKNLLKDFCG  1034
             + ++KG+R +  L+ +CG
Sbjct  296   YYTEKGQRDQFALRTYCG  313



>emb|CDP08458.1| unnamed protein product [Coffea canephora]
Length=313

 Score =   288 bits (737),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 146/318 (46%), Positives = 215/318 (68%), Gaps = 6/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS ET T L  +DF+N  LKPG+  W      +R ALE++GCF  L DK+  +L  S+F
Sbjct  1     MGS-ET-TSLPTIDFSNPGLKPGAPEWDLVKDQVRKALEEYGCFEALFDKIPLELQKSLF  58

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              A ++LFDLP + K+ N+++KP+HGYVGQ P +P +E+ GID AT  E V+SF++L+W  
Sbjct  59    DALEELFDLPLQTKVRNSSKKPFHGYVGQYPMVPLYESMGIDDATISEKVESFTDLLWPE  118

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN +F ++  S+S  +++L++ V RM+ ES G EK+ D +++ST YLLR MKY+ P ++ 
Sbjct  119   GNSNFCKTVHSYSDQLSDLDKIVRRMILESLGAEKYMDEHMDSTNYLLRVMKYKGP-QTT  177

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
             E  +    HTDK  +T+L Q NQV GLE+  ++G WI  +  P SFIVM G+++  W+N 
Sbjct  178   EPKLGLNAHTDKNIVTILSQ-NQVQGLELLTKDGHWIDVKPSPGSFIVMIGDSLLAWTNG  236

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+ +P H+V M   G E RYS G+FS  K    I+ PEELVD+EHPL FKPF H++ + F
Sbjct  237   RLHSPYHQVMM--TGNEARYSAGLFSIPKAGYIIKAPEELVDEEHPLLFKPFDHVEFLSF  294

Query  981   FDSDKGRRSKNLLKDFCG  1034
             + ++ G+R+++ LK +CG
Sbjct  295   YYTEAGQRAQSALKTYCG  312



>ref|XP_004302952.1| PREDICTED: leucoanthocyanidin dioxygenase-like [Fragaria vesca 
subsp. vesca]
Length=316

 Score =   288 bits (737),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 144/318 (45%), Positives = 217/318 (68%), Gaps = 5/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS ETP KL  +DF+  +LKPG+T W      +R ALE++GCF  L +KV   +  +IF
Sbjct  1     MGS-ETPIKLPTIDFSMPNLKPGTTEWDSVRAQVRFALEEYGCFEALFNKVPLDVQKAIF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              A+++LFDLP + K+ N ++KP+HGY+GQ P +P +E+ GID A     VQSF++ +W  
Sbjct  60    EATEELFDLPLQTKLRNVSQKPFHGYIGQYPMVPLYESVGIDEANVYGQVQSFTHTLWPQ  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
              N +FS++  SFS+ ++EL++ + RM+ ES G+EK+ + ++ ST YLLR MKY+ P +++
Sbjct  120   QNPNFSKTVHSFSEKLSELDQIIRRMVLESLGLEKYLEEHIGSTNYLLRLMKYKGP-QTN  178

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
             E  +    HTDK  +T+LYQ NQV GLE+Q ++G+WI+ +  P SFI M G+++  W+N 
Sbjct  179   ETKLGINSHTDKNIVTILYQ-NQVHGLEIQTKDGKWINVKPLPESFIAMIGDSLYAWTNG  237

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+ +P H+V M   G E RYS G+FS  K    I+ PEE+VD+EHPL FKPF H++ + F
Sbjct  238   RLHSPPHRVMM--TGNEDRYSTGLFSIPKAGYIIKAPEEVVDEEHPLLFKPFDHVEFLGF  295

Query  981   FDSDKGRRSKNLLKDFCG  1034
             + S+ G+R+ + LK +CG
Sbjct  296   YYSEAGQRAPSALKAYCG  313



>ref|NP_175688.1| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis 
thaliana]
 gb|AAG52288.1|AC019018_25 putative oxidoreductase; 32373-31266 [Arabidopsis thaliana]
 gb|AEE32852.1| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis 
thaliana]
Length=310

 Score =   287 bits (735),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 148/313 (47%), Positives = 219/313 (70%), Gaps = 10/313 (3%)
 Frame = +3

Query  105   KLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIV-LCDKVSPQLHNSIFHASQQLF  281
             K+  +DF+ EDLKPG+  W    ++IR ALE++GCFI+ L DK    L + +F +   LF
Sbjct  4     KIPTLDFSREDLKPGTKYWESTRENIRQALEEYGCFIIDLKDKTPLDLLDRVFGSLVDLF  63

Query  282   DLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHsfse  461
             DLP + K+ N  +KP +GYVGQIP +P HE+ GID+AT++E  +SF+ LMW  GN  FSE
Sbjct  64    DLPTQTKMKNKYDKPLNGYVGQIPALPLHESLGIDNATSLEATRSFTGLMWPQGNEHFSE  123

Query  462   ssqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNVV-F  638
                 +++  AEL++ V RM+F+SY VEK+YD Y+EST YLLR +K   P  ++EN  + F
Sbjct  124   CLYKYAEFAAELDQMVTRMVFQSYNVEKYYDPYIESTTYLLRVLKNRAP--NNENPTLGF  181

Query  639   PCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQF-PPSSFIVMAGEAIKGWSNSRVLAP  815
               HTDK+F T+L+Q +QV+GLE++ R GE I+     PS F+V+AG+A+  WSN RV +P
Sbjct  182   VTHTDKSFTTILHQ-DQVNGLEMETREGERININLSSPSLFMVVAGDALMAWSNDRVWSP  240

Query  816   IHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSDK  995
              H+V +  +G+  RYS+G+F+F  N+ T++VPEEL+D +HPL +KPF HL +++F+ +D 
Sbjct  241   RHQVLV--SGETDRYSLGMFAF--NNGTLQVPEELIDHQHPLMYKPFDHLGLLRFYRTDT  296

Query  996   GRRSKNLLKDFCG  1034
             G +S+  +K +CG
Sbjct  297   GYKSECPIKAYCG  309



>gb|KDO58204.1| hypothetical protein CISIN_1g038676mg, partial [Citrus sinensis]
Length=307

 Score =   286 bits (732),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 144/310 (46%), Positives = 211/310 (68%), Gaps = 5/310 (2%)
 Frame = +3

Query  108   LLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQQLFDL  287
             L ++DF+  +LKPG+  W      +R ALED+GCF  L +KV  ++  ++F A ++LFDL
Sbjct  1     LPIIDFSKPNLKPGTPEWDSVKSHVRKALEDYGCFEALFNKVPEEILKAVFGALEELFDL  60

Query  288   PFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHsfsess  467
             P   K+ N ++KP+HGYVGQ P +P +E+ GID A   E V+S +N++W  GN SF ++ 
Sbjct  61    PLRTKMRNISKKPFHGYVGQYPQVPLYESMGIDDANVKEKVESMTNILWPEGNKSFCKTI  120

Query  468   qsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNVVFPCH  647
             QSFS+ V+EL++ + RM+ ES G+EK+ D ++ ST+YLLR MKY+ P E+ E  +    H
Sbjct  121   QSFSEQVSELDQTIRRMILESLGLEKYMDEHMNSTSYLLRVMKYKGP-ETTEKKLGLNAH  179

Query  648   TDKTFMTVLYQLNQVSGLEVQARNGEWISAQ-FPPSSFIVMAGEAIKGWSNSRVLAPIHK  824
             TDK  +T+LYQ NQV GLE+Q +NGEWI+ +   P SFI M G+++  W+N ++ +P H+
Sbjct  180   TDKNIVTILYQ-NQVEGLELQTKNGEWINVKPSSPHSFIAMIGDSLYAWTNGQLYSPYHR  238

Query  825   VTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSDKGRR  1004
             V M   G E RYS G FS  K    IE PEELVD+EHPL FKPF H + ++F+ ++ G+R
Sbjct  239   VMM--TGIETRYSTGFFSIPKAGYKIEAPEELVDEEHPLLFKPFDHFEFLEFYYTEAGQR  296

Query  1005  SKNLLKDFCG  1034
             +++ LK +CG
Sbjct  297   AESALKTYCG  306



>ref|XP_008228620.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Prunus mume]
Length=321

 Score =   286 bits (733),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 147/318 (46%), Positives = 209/318 (66%), Gaps = 5/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS ETP +L V+DF+N+ L PG+T W      +  ALE++GCF  L  KV   +  SIF
Sbjct  1     MGS-ETPLRLPVIDFSNQSLTPGTTEWNTVRAQVHNALEEYGCFEALFTKVPSHIRKSIF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              + ++L DLP + K+   ++KP+ GY GQ P +P +E+  ID A   E VQS +N +W  
Sbjct  60    QSIEELLDLPLQTKLKIVSKKPFRGYAGQSPMMPLYESMPIDGANVYEQVQSLANTLWPQ  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN SF ++ QSF++ V+EL++ + RM+ ES G+EK+ + ++ ST YLLR MKY+VP +++
Sbjct  120   GNPSFCKTIQSFTEKVSELDQIIRRMILESLGLEKYLEEHLNSTNYLLRVMKYKVP-QTN  178

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
             E  +  P HTDK  +T+LYQ NQV GLEVQ ++G+WI+ +    SFIV+ GE++  W+N 
Sbjct  179   ETKLGIPPHTDKNIVTILYQ-NQVDGLEVQTKDGKWINVKPSSDSFIVLIGESLHAWTNG  237

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+ +PIH+V M  NG E RYS G+FS  K    I+ P E+VD+EHPL FKP+ H     F
Sbjct  238   RLYSPIHRVMM--NGNEARYSTGLFSAPKEGYIIKAPNEVVDEEHPLLFKPYEHAQFTAF  295

Query  981   FDSDKGRRSKNLLKDFCG  1034
              +S+ GRR    LK FCG
Sbjct  296   CNSEAGRRDLFPLKTFCG  313



>gb|KHN01361.1| Gibberellin 20 oxidase 1 [Glycine soja]
Length=314

 Score =   286 bits (733),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 149/318 (47%), Positives = 213/318 (67%), Gaps = 5/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS E   KL V+DF N  L+  + +W      +  AL D+GCF  + +KV  +L  +IF
Sbjct  1     MGS-EATLKLPVIDFTNLKLEANNPNWEAIKSQVHKALVDYGCFEAIFEKVPLELRKAIF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              A Q+LFDLP + KILN ++KPYHGYVGQ P +P  E+ GID A   E V+S +N+MW  
Sbjct  60    AALQELFDLPLQTKILNVSKKPYHGYVGQYPMVPLFESMGIDDANVYENVESMTNIMWPH  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN SFS++ QSFS+ ++EL++ + +M+ ES GVEK+ + ++ ST YLL  MKY+ P  SD
Sbjct  120   GNPSFSKTIQSFSEQLSELDQIIRKMILESLGVEKYLEEHMNSTNYLLEVMKYKGPQTSD  179

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
                V    H+DK  +T+LYQ N+V GLEV  ++G+WIS +  P SF+VM G+++  WSN 
Sbjct  180   -TKVGLTTHSDKNIVTILYQ-NEVEGLEVMTKDGKWISYRPSPDSFVVMIGDSLHAWSNG  237

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+ +P H+V M  +G E RYS G+FS  K    I+ PEELVD+EHPL FKPF H++ +K+
Sbjct  238   RLHSPFHRVMM--SGNEARYSAGLFSIPKGGNIIKAPEELVDEEHPLLFKPFDHVEFLKY  295

Query  981   FDSDKGRRSKNLLKDFCG  1034
             + ++KG+R +  L+ +CG
Sbjct  296   YYTEKGQRDQFALRTYCG  313



>ref|XP_007024009.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein [Theobroma cacao]
 gb|EOY26631.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein [Theobroma cacao]
Length=316

 Score =   286 bits (731),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 147/318 (46%), Positives = 212/318 (67%), Gaps = 5/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS ETP KL V+DF   DLKPG+T W      ++ AL+++GCF  L +++   +  +IF
Sbjct  1     MGS-ETPLKLPVIDFTKPDLKPGTTEWDLVKGQVQQALQEYGCFEALFNRIPLDVRETIF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              A ++LFDLP E KI N ++KPYHGYVGQ P  P +E+ GID A  IE V++ +  +W  
Sbjct  60    GALEELFDLPLETKICNVSKKPYHGYVGQYPQAPLYESLGIDDANIIEKVEAQTRALWPE  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN SFS   QSFSK +AEL++ + RM+ ESY ++K+ D +++ST YLLR MKY+ P ++ 
Sbjct  120   GNKSFSNIIQSFSKQLAELDQTIRRMILESYDLDKYMDEHLDSTKYLLRLMKYKGP-KTT  178

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
             E  +    HTDK  +T+LYQ N+V GLEVQ ++G+W   +    SFIVM GE++  W N 
Sbjct  179   ETKLGLQSHTDKNIVTILYQ-NEVEGLEVQTKDGKWFDVKPSKGSFIVMIGESLHAWLNG  237

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+ AP H+V M  +G   RYS+G+FS  K    I+ P+ELVD+ HPL FKPF H+  + F
Sbjct  238   RLHAPYHRVMM--SGDMARYSIGLFSIPKGGYMIKAPDELVDEAHPLLFKPFDHVQFLGF  295

Query  981   FDSDKGRRSKNLLKDFCG  1034
             + ++ G+++++ LK +CG
Sbjct  296   YYTEAGQKAESALKAYCG  313



>ref|XP_007216816.1| hypothetical protein PRUPE_ppa023108mg [Prunus persica]
 gb|EMJ18015.1| hypothetical protein PRUPE_ppa023108mg [Prunus persica]
Length=321

 Score =   286 bits (732),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 145/318 (46%), Positives = 208/318 (65%), Gaps = 5/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS ETP +L V+DF+N+ L PG+  W      +  ALE++GCF  L  KV   +  SIF
Sbjct  1     MGS-ETPLRLPVIDFSNQSLTPGTREWNTVRAQVHNALEEYGCFEALFTKVPSHIRKSIF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              + + L DLP + K+ N + KPY GY GQ+P +P +E+ GID A   E VQS +N +W  
Sbjct  60    QSIEDLLDLPLQTKLKNVSRKPYRGYAGQLPMMPLYESMGIDGANVYEQVQSLANTLWPQ  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN SF ++ QSF++ V+EL++ + RM+ ES G++++ + ++ ST YLLR MKY+ P +++
Sbjct  120   GNPSFCKTIQSFTEKVSELDQIIRRMILESLGLKEYLEEHLNSTDYLLRVMKYKAP-QTN  178

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
             E  +  P HTDK  +T+LYQ NQV GLEVQ ++G+WI+ +    SFI + GE++  W+N 
Sbjct  179   ETKLGLPPHTDKNIVTILYQ-NQVDGLEVQTKDGKWINVKPSSDSFIALIGESLHAWTNG  237

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+ +PIH+V M  NG E RYS G+FS  K    I+ P E+VD+EHPL FKP+ H   I F
Sbjct  238   RLHSPIHRVMM--NGNEIRYSTGLFSAPKEGYIIKAPNEVVDEEHPLLFKPYEHAQFIAF  295

Query  981   FDSDKGRRSKNLLKDFCG  1034
              +S+ G+R    LK FCG
Sbjct  296   CNSEAGQRGPFSLKTFCG  313



>ref|XP_006392870.1| hypothetical protein EUTSA_v10011669mg [Eutrema salsugineum]
 gb|ESQ30156.1| hypothetical protein EUTSA_v10011669mg [Eutrema salsugineum]
Length=316

 Score =   286 bits (731),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 147/312 (47%), Positives = 217/312 (70%), Gaps = 8/312 (3%)
 Frame = +3

Query  105   KLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIV-LCDKVSPQLHNSIFHASQQLF  281
             K+  +DF+ E LKPG+  W    K+IR ALE++GCFI+ L DK    L + +F +  +LF
Sbjct  4     KIPTLDFSREVLKPGTKYWESTSKNIRQALEEYGCFIIDLQDKTPLDLLDQVFGSLVELF  63

Query  282   DLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHsfse  461
             DLP + K+ N  +KP +GYVGQIP +P HE+ GID AT++   +SF+ LMW  GN  FS+
Sbjct  64    DLPTQTKMKNKYDKPLNGYVGQIPALPLHESLGIDDATSLVATRSFTGLMWPQGNERFSD  123

Query  462   ssqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNVVFP  641
             S   +++ VA+L++ V RM+FESY VEK Y+ Y+EST YLLR +K   P  S  +N+ F 
Sbjct  124   SVHKYAEFVAKLDQMVTRMVFESYNVEKDYNPYIESTTYLLRVLKTRAP-NSKNSNLGFI  182

Query  642   CHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQF-PPSSFIVMAGEAIKGWSNSRVLAPI  818
              HTDK+F T+L+Q NQV+GL ++ R GE I+     PS F+V+AG+A+  WSN RV +P 
Sbjct  183   THTDKSFTTILHQ-NQVNGLVMETREGERININLSSPSLFMVVAGDALMAWSNDRVWSPR  241

Query  819   HKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSDKG  998
             H+V +  +G+  RYS+G+FSF  N+ T++VPEEL+D +HPL++KPF H+ +++F+ +D G
Sbjct  242   HQVLV--SGETDRYSLGMFSF--NNGTLQVPEELIDHQHPLKYKPFDHIGLLRFYRTDTG  297

Query  999   RRSKNLLKDFCG  1034
              +S+  +K +CG
Sbjct  298   YKSECPIKAYCG  309



>ref|XP_009780364.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP3-like [Nicotiana 
sylvestris]
Length=315

 Score =   285 bits (730),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 145/306 (47%), Positives = 213/306 (70%), Gaps = 9/306 (3%)
 Frame = +3

Query  126   NNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQQLFDLPFEKKI  305
             +N  LKP +++W  AC ++R ALE+ GCF+ + D VSP+L++ IF A ++LFDLP E K+
Sbjct  15    SNHYLKPNTSNWFSACDEVRRALEECGCFLAVYDSVSPELNSDIFQAVEELFDLPTETKL  74

Query  306   LNTNEKPYHGYVGQIPFIPYHEAFGID--HATTIEGVQSFSNLMWSGGNHsfsessqsfs  479
              NT+EKP++GY G+IP  P  E+ GI+   A T EGVQ+F+NLMW  GN  FSE    ++
Sbjct  75    YNTSEKPFYGYYGKIPDFPLQESLGINIGDAITAEGVQNFTNLMWPSGNDHFSEIIHDYA  134

Query  480   KIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNVVFPCHTDKT  659
              IVA LE+ V +M+FESYGVEK YDS  EST YLLR +KY  P + DE+NV    HTDKT
Sbjct  135   NIVAGLEKMVKKMVFESYGVEKCYDSLEESTTYLLRLIKYRTP-KLDESNVGSQVHTDKT  193

Query  660   FMTVLYQLNQVSGLEVQARNGEWISAQFPPS-SFIVMAGEAIKGWSNSRVLAPIHKVTMD  836
             F+++L+Q NQV+GLE++ ++GEW++    P+ SF+VM GEA   WSN+R+  P+H+V + 
Sbjct  194   FLSILHQ-NQVNGLEIKTKDGEWMAVDMTPANSFLVMVGEAFSAWSNNRLHCPVHRVIVK  252

Query  837   ANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSDKGRRSKNL  1016
              N  + RY++  FS++     I+ PEELVD++HP++F+PF + +++ FF      + +  
Sbjct  253   EN--KPRYTIAHFSYING--MIQTPEELVDEKHPIKFQPFDNFELLDFFAKHINDQMEYT  308

Query  1017  LKDFCG  1034
             ++ FCG
Sbjct  309   VRAFCG  314



>gb|KDO58208.1| hypothetical protein CISIN_1g044747mg [Citrus sinensis]
Length=322

 Score =   285 bits (729),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 145/326 (44%), Positives = 214/326 (66%), Gaps = 13/326 (4%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS +T +K+ V+D + +DLK G+++W   CKD+R A E+ GCF  +  K+S +  + + 
Sbjct  1     MGS-QTKSKIPVIDLSKQDLKSGTSTWLSTCKDVRHAFEEFGCFEAIYQKISQEFRSEVL  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              ++++LFD+P E K+ NT+ KPY  Y GQ   IP +E+  ID+  T    QSF+NLMW  
Sbjct  60    ASTEELFDVPIEIKVKNTSTKPYFEYYGQYTIIPLYESLAIDYPDTRNATQSFTNLMWPA  119

Query  441   --------GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMK  596
                       +S  ESS S S++V EL++ V RMLFESYGVE +YDSY+ S  YLLRY K
Sbjct  120   EMIAFGMICPYSLLESSLSMSELVVELDKMVTRMLFESYGVEGYYDSYIGSVNYLLRYFK  179

Query  597   YEVPAESDENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGE  776
             Y  P E +E  +    HTDKT  ++++Q+N ++GL+VQA++GEWI  +  PSSFIVMAG+
Sbjct  180   YRAP-EPNETKMGLTPHTDKTMTSIIHQINHINGLQVQAKDGEWIDVEPSPSSFIVMAGD  238

Query  777   AIKGWSNSRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPF  956
             A+  W N R+    H+V MD N  E RYS+G+FSF  +S  +++P+EL D+  PL++KPF
Sbjct  239   ALMAWGNDRIRPCRHQVIMD-NASETRYSLGLFSF--SSGVVDIPKELGDETQPLKYKPF  295

Query  957   VHLDMIKFFDSDKGRRSKNLLKDFCG  1034
              H   + F  S++G++S + +K +CG
Sbjct  296   DHFGFLHFNQSEEGKKSASSIKAYCG  321



>gb|KFK35768.1| hypothetical protein AALP_AA4G033700 [Arabis alpina]
Length=310

 Score =   285 bits (728),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 144/313 (46%), Positives = 216/313 (69%), Gaps = 8/313 (3%)
 Frame = +3

Query  102   TKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIV-LCDKVSPQLHNSIFHASQQL  278
             +K+  +DF+ EDLK G+  W    K+I  ALE++GCFI+ L DK    L + +F +  +L
Sbjct  3     SKIPTLDFSREDLKQGTKYWESTSKNIIQALEEYGCFIIDLQDKTPLDLLDQVFGSLVEL  62

Query  279   FDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHsfs  458
             F+LP + K+ NT +KP +GYVGQIP +P HE+ GID+AT++E   SF+ LMW  GN  FS
Sbjct  63    FNLPTQTKMKNTYDKPLNGYVGQIPALPLHESLGIDNATSLEATSSFTGLMWPQGNKHFS  122

Query  459   essqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNVVF  638
             E    +++  AEL++ V RM+FESY V+K+YD Y++ST YLLR +K   P  ++   + F
Sbjct  123   ECMHKYAEFTAELDQMVTRMVFESYNVKKYYDQYIKSTTYLLRVLKNRAP-NNENKKLAF  181

Query  639   PCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQF-PPSSFIVMAGEAIKGWSNSRVLAP  815
               HTDK+F T+L+Q NQV+GLE++   GE I+     PS F+++AG+A+  WSN RV +P
Sbjct  182   VTHTDKSFTTILHQ-NQVNGLEMETTEGERININLSSPSLFMIVAGDALMAWSNDRVWSP  240

Query  816   IHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSDK  995
              H+V M  +G   RYS+G+FSF  N+ T++VPEEL+D +HPL++KPF H+ +++F+ +D 
Sbjct  241   RHQVLM--SGDTDRYSLGMFSF--NNGTLQVPEELIDHQHPLKYKPFDHIGLLRFYRTDT  296

Query  996   GRRSKNLLKDFCG  1034
             G +S+  +K +CG
Sbjct  297   GYKSECPIKAYCG  309



>emb|CDP21179.1| unnamed protein product [Coffea canephora]
 emb|CDP17333.1| unnamed protein product [Coffea canephora]
Length=315

 Score =   285 bits (728),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 141/318 (44%), Positives = 213/318 (67%), Gaps = 6/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             M + ++  KL +VD   ++LKPG++SW   C  +R ALE++GCF+V+ D VS Q    +F
Sbjct  1     MAASQSRCKLPIVDLKKDNLKPGTSSWTATCDSVRHALEEYGCFLVVQDHVSAQFEKEVF  60

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
                ++LFDLP E K  N+ +  + GYVGQ+P  P HE+  I +ATTI+GVQ+F++LMW  
Sbjct  61    DVVRELFDLPTETKSQNSLDM-FLGYVGQLPHAPLHESMEIPNATTIDGVQAFTDLMWPS  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN  F E+  +++K+VAE+E+ V +M+F SYG   H +S++ES+ Y+LR +KY  P   +
Sbjct  120   GNKRFCETMLTYAKLVAEVEQTVDKMVFASYGAMDHLESHIESSTYILRPLKYTPPEMHN  179

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
               +V    HTDK+F+T+L+Q NQV+ L+VQARN EWI   F P+SF+V+AG+A + WSN 
Sbjct  180   NVDVGADVHTDKSFITMLHQ-NQVNALKVQARNEEWIDVDFSPASFLVLAGDAYQAWSND  238

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+  P H+V M  N  ++RY + +F++  N   + VPE L+D++HPL FKPF + D+++F
Sbjct  239   RIHPPRHQVIMKEN--KERYCIALFAY--NYGMVNVPEILIDEKHPLAFKPFDNFDLLRF  294

Query  981   FDSDKGRRSKNLLKDFCG  1034
             F S     S +  K +CG
Sbjct  295   FLSRTTDMSSSTAKAYCG  312



>ref|XP_006427127.1| hypothetical protein CICLE_v10027219mg, partial [Citrus clementina]
 gb|ESR40367.1| hypothetical protein CICLE_v10027219mg, partial [Citrus clementina]
Length=307

 Score =   284 bits (727),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 143/310 (46%), Positives = 211/310 (68%), Gaps = 5/310 (2%)
 Frame = +3

Query  108   LLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQQLFDL  287
             L ++DF+  +LKPG+  W      +R ALE++GCF  L +KV  ++  ++F A ++LFDL
Sbjct  1     LPIIDFSKPNLKPGTPEWDSVKSHVRKALEEYGCFEALFNKVPEEILKAVFGALEELFDL  60

Query  288   PFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHsfsess  467
             P   K+ N ++KP+HGYVGQ P +P +E+ GID A   E V+S +N++W  GN SF ++ 
Sbjct  61    PLRTKMRNISKKPFHGYVGQYPQVPLYESMGIDDANVKEKVESMTNILWPEGNKSFCKTI  120

Query  468   qsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNVVFPCH  647
             QSFS+ V+EL++ + RM+ ES G+EK+ D ++ ST+YLLR MKY+ P E+ E  +    H
Sbjct  121   QSFSEQVSELDQTIRRMILESLGLEKYMDEHMNSTSYLLRVMKYKGP-ETTEKKLGLNSH  179

Query  648   TDKTFMTVLYQLNQVSGLEVQARNGEWISAQ-FPPSSFIVMAGEAIKGWSNSRVLAPIHK  824
             TDK  +T+LYQ NQV GLE+Q +NGEWI+ +   P SFI M G+++  W+N ++ +P H+
Sbjct  180   TDKNIVTILYQ-NQVEGLELQTKNGEWINIKPSSPHSFIAMIGDSLYAWTNGQLYSPYHR  238

Query  825   VTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSDKGRR  1004
             V M   G E RYS G FS  K    IE PEELVD+EHPL FKPF H + ++F+ ++ G+R
Sbjct  239   VMM--TGIETRYSTGFFSIPKAGYKIEAPEELVDEEHPLLFKPFDHFEFLEFYYTEAGQR  296

Query  1005  SKNLLKDFCG  1034
             +++ LK +CG
Sbjct  297   AESALKTYCG  306



>ref|XP_004151475.1| PREDICTED: gibberellin 20 oxidase 1-B-like [Cucumis sativus]
Length=335

 Score =   285 bits (729),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 148/326 (45%), Positives = 226/326 (69%), Gaps = 16/326 (5%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             M +  +  +L VV F +++LK G+  W    K +R ALE++GCF+ L D VS ++ +++F
Sbjct  1     MATNMSDEQLPVVKFCSQNLKSGTEEWVSTTKKVREALEEYGCFVALYDTVSAEVSSNMF  60

Query  261   HASQQLFD-LPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMW-  434
              + ++LFD +P E+K+ N +EKPYHGY GQ P +P HE+ GI+H      + SF+NLMW 
Sbjct  61    DSLKELFDEVPLERKLQNVSEKPYHGYFGQNPLMPIHESMGIEHPILPTNINSFTNLMWP  120

Query  435   SGGNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAE  614
             S GNHSF E+  +++ +V+EL+++V  M+FESYGV     S++EST YL+R +KY VP E
Sbjct  121   SRGNHSFRENVTAYANLVSELDKRVKSMVFESYGVGNALRSHMESTKYLMRMIKYRVPKE  180

Query  615   SDENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPP------SSFIVMAGE  776
              + N   FP HTDK+F+T+L+Q N+V+GL+++ R+ +WI  Q+ P      SSFIVMAG+
Sbjct  181   KEMNLGAFP-HTDKSFLTILHQ-NEVNGLQIKTRDNKWI--QYHPFSSSSTSSFIVMAGD  236

Query  777   AIKGWSNSRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPF  956
             A   WSN R+ +P H+V M  +G ++RYSVG+FSF  N+  +++P+ELVDD+HP  FKPF
Sbjct  237   AFFAWSNGRIYSPPHRVIM--SGNKERYSVGLFSF--NNGIVQIPKELVDDKHPQLFKPF  292

Query  957   VHLDMIKFFDSDKGRRSKNLLKDFCG  1034
              H D ++F+ +++G+ S   +K +CG
Sbjct  293   DHQDYLRFYSTERGQNSPCAIKAYCG  318



>ref|XP_002517690.1| Gibberellin 20 oxidase, putative [Ricinus communis]
 gb|EEF44854.1| Gibberellin 20 oxidase, putative [Ricinus communis]
Length=307

 Score =   283 bits (725),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 141/301 (47%), Positives = 209/301 (69%), Gaps = 6/301 (2%)
 Frame = +3

Query  90   LETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHAS  269
            +E   KL  +DF+ E LKPGS+ W  AC ++RTALE++GCF+V   K+S +L + +F   
Sbjct  3    VEAAPKLPALDFSQETLKPGSSCWLKACGEVRTALEEYGCFVVEYKKLSLELRDEVFAEL  62

Query  270  QQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNH  449
            ++LFDLP   K+ N  ++P   Y+GQ   IP HE+ GI+ A T E  Q+F+NLMW  GN 
Sbjct  63   KELFDLPTAVKMQNKCQRPLISYIGQNSRIPLHESMGIEDADTPEAAQNFTNLMWPNGND  122

Query  450  sfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENN  629
             FSE   ++ K+V EL++ V RM+FESYG+ K++DSYVEST Y++R +K   P E DE  
Sbjct  123  RFSECIHAYGKLVVELDKIVTRMIFESYGLGKYHDSYVESTCYVIRLLKTRAPKE-DETV  181

Query  630  VVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRVL  809
            +    HTD +F T+L+Q NQV+GLE+  ++G+ I+  F P+SF+VMAG+A+  WSN R+ 
Sbjct  182  LGLGAHTDTSFTTILHQ-NQVNGLEIDTKDGKKINVDFSPTSFVVMAGDALMAWSNDRIK  240

Query  810  APIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDS  989
            +P H+V M  NGK  RYS+G+F+F  N+  ++VPEELV+++HPL +KPF H++ + F+ +
Sbjct  241  SPRHQVIM--NGKVDRYSMGLFTF--NNGNLQVPEELVNEDHPLTYKPFNHIEFLHFYQN  296

Query  990  D  992
            +
Sbjct  297  N  297



>ref|XP_010110312.1| Gibberellin 3-beta-dioxygenase 4 [Morus notabilis]
 gb|EXC25832.1| Gibberellin 3-beta-dioxygenase 4 [Morus notabilis]
Length=315

 Score =   283 bits (725),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 146/319 (46%), Positives = 213/319 (67%), Gaps = 6/319 (2%)
 Frame = +3

Query  81    MGSLETPT-KLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSI  257
             MG+  +P+ KL V+DF+ + LKPG T W      +R ALE+ GCF  L  K+S     +I
Sbjct  1     MGTETSPSVKLPVIDFSIQPLKPG-TEWDLVRSQVRQALEEFGCFEALFGKISLDTRRAI  59

Query  258   FHASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWS  437
             F   Q+LFDLP + K+ N ++KP+HGYVGQ P +P  E+  ID A   E V+S +N++W 
Sbjct  60    FDTLQELFDLPLQTKLRNVSKKPFHGYVGQYPQMPLFESMAIDDANIHENVESLANILWP  119

Query  438   GGNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAES  617
              GN +F +  QS+S+ ++EL++ + RM+ ES GVEK+ + ++ S  YLLR MKY+ P ++
Sbjct  120   QGNPNFCKIIQSYSEQLSELDQIIRRMILESLGVEKYLEEHLGSANYLLRVMKYKGP-QT  178

Query  618   DENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSN  797
              E  +    HTDK  +T+LYQ NQV GLEVQ ++GEWIS +  P+SFIVM G+++  W+N
Sbjct  179   KETKMGLSAHTDKNIVTILYQ-NQVEGLEVQTKDGEWISVKPSPNSFIVMIGDSLYAWAN  237

Query  798   SRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIK  977
              R+ +P H+V M   G E RYS G+FS  K    ++ PEELVD+EHPL FKPF H++ ++
Sbjct  238   GRLHSPCHRVIM--TGSEARYSAGLFSIPKAGYIVKAPEELVDEEHPLLFKPFDHVEFLE  295

Query  978   FFDSDKGRRSKNLLKDFCG  1034
             FF  + G+R+++ LK +CG
Sbjct  296   FFYREAGQRAESALKTYCG  314



>ref|XP_009339603.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Pyrus x bretschneideri]
Length=322

 Score =   283 bits (725),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 142/315 (45%), Positives = 207/315 (66%), Gaps = 5/315 (2%)
 Frame = +3

Query  93    ETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQ  272
             ETP  + ++DF+  DL  G+  W      +R ALE++GCF  L DKV   +  S   + +
Sbjct  4     ETPLGIPIIDFSKPDLNQGTKEWDLVRAQVRNALEEYGCFEALFDKVPSDIRKSTIESIE  63

Query  273   QLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHs  452
             +LFDLP + K+ N ++KPYHGYVGQ P +P +E+ G D A   E V+S +N +W  GN  
Sbjct  64    ELFDLPLQTKLQNVSKKPYHGYVGQYPMVPLYESMGFDDANVYEQVESLTNTLWPQGNPR  123

Query  453   fsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNV  632
             F  + QSFS+ V+EL++ + RM+ ES G+EK+++ +VEST YLLR MKY+ P E+ E  +
Sbjct  124   FCTTIQSFSEQVSELDQIIRRMILESLGLEKYFEEHVESTNYLLRVMKYKGP-ETKETKL  182

Query  633   VFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFP-PSSFIVMAGEAIKGWSNSRVL  809
                 HTDK  +T+LYQ NQV GLEVQ + G+WI  +   P SFI M G+++  W+N R+ 
Sbjct  183   GINAHTDKNIVTILYQ-NQVDGLEVQTKAGKWIKVKPSLPHSFIAMIGDSLYAWTNGRLH  241

Query  810   APIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDS  989
             +P H+V M  +G E RYS G+FS  K    I+ PEE+VD+EHPL FKPF H++ + F+ +
Sbjct  242   SPYHRVMM--SGNEARYSTGLFSIPKEGYIIKAPEEVVDEEHPLLFKPFDHVEFLGFYYT  299

Query  990   DKGRRSKNLLKDFCG  1034
             + G+R+++ LK +CG
Sbjct  300   EAGQRAQSALKTYCG  314



>gb|KDP37168.1| hypothetical protein JCGZ_06224 [Jatropha curcas]
Length=314

 Score =   283 bits (724),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 142/318 (45%), Positives = 210/318 (66%), Gaps = 5/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS ETP +L V+DF+  +LKPG+  W      +  AL+++GCF    ++V   L   + 
Sbjct  1     MGS-ETPLRLPVIDFSEGNLKPGTEEWDSVRSQVFEALKEYGCFEAFYNRVPSDLKKGVV  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              A ++LF+LP E K+ N ++KP+HGYVGQ P  P  E+ GID A   E V S +N +W  
Sbjct  60    GAIEELFELPLETKLKNVSKKPFHGYVGQYPQAPLFESMGIDDADVPENVDSLTNTLWPQ  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN +FS++  S+S++V+EL++ V RM+ ES GVEK+ D ++ ST YLLR MKY+ P ++ 
Sbjct  120   GNPAFSKTVVSYSELVSELDQTVRRMILESLGVEKYLDEHMNSTNYLLRVMKYKGP-QTT  178

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
             E  +    HTDK  +T+LYQ NQV GLEV+ + GEWI+ +  P SF+VM G+++  W+N 
Sbjct  179   ETKLGLHPHTDKNIVTILYQ-NQVDGLEVKTKEGEWINVKLSPHSFVVMIGDSLYAWANG  237

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+ +P H+V M  N  E RYS G+FS  K    ++ PEELVD++HPL FKPF H+  + F
Sbjct  238   RLYSPYHRVMMSGN--EARYSAGLFSIPKAGYMVKAPEELVDEQHPLLFKPFDHVKFLGF  295

Query  981   FDSDKGRRSKNLLKDFCG  1034
             + ++ G++S++ LK +CG
Sbjct  296   YYTESGQKSESALKAYCG  313



>ref|XP_004136074.1| PREDICTED: gibberellin 20 oxidase 1-like [Cucumis sativus]
Length=317

 Score =   283 bits (724),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 149/322 (46%), Positives = 220/322 (68%), Gaps = 10/322 (3%)
 Frame = +3

Query  81    MGSLETP-TKLLVVDFNNEDLKP-GSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNS  254
             MGS  T   +L V++F++E +K  G   W    K++R A+E++GCFI   + VS +L   
Sbjct  1     MGSETTEEIRLPVINFSDEKVKAEGGVEWRRTSKNVREAMEEYGCFIAKYEGVSKELREE  60

Query  255   IFHASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMW  434
             +  A ++LF+LP E+K +N  EKP++GYVG++  +P HE+ GID AT    VQSFS+LMW
Sbjct  61    VLKAVKELFELPIERKKMNKYEKPFNGYVGELRTLPLHESLGIDDATNFNQVQSFSHLMW  120

Query  435   -SGGNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPA  611
                GNH FS +  SF+KI  EL++ V +M+FESYGVEK+Y+S+ +S  YLLR +K + P 
Sbjct  121   PPEGNHHFSATLHSFAKIAEELDKMVTKMIFESYGVEKYYNSHADSITYLLRVLKSKAP-  179

Query  612   ESDENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISA-QFPPSSFIVMAGEAIKG  788
             +S +  +    HTDK+F T++YQ + ++GLE++ +NG+WI      PSSF+V+AG+AIK 
Sbjct  180   QSPDPTLCLVDHTDKSFTTMVYQ-DHINGLELKTKNGQWIQVDNSSPSSFLVIAGDAIKA  238

Query  789   WSNSRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLD  968
             WSN R+ +P HKVT+   G E RYS+ +F F  ++  +EVP+ELVD  HPL++KPF H+ 
Sbjct  239   WSNDRIESPTHKVTI--RGNEDRYSLAMFGF--SNGIVEVPKELVDQNHPLRYKPFDHIG  294

Query  969   MIKFFDSDKGRRSKNLLKDFCG  1034
             ++ FF S +G  SK+ LKD+C 
Sbjct  295   LLHFFRSKEGFNSKSPLKDYCA  316



>emb|CAN66061.1| hypothetical protein VITISV_007808 [Vitis vinifera]
Length=330

 Score =   283 bits (725),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 148/333 (44%), Positives = 218/333 (65%), Gaps = 26/333 (8%)
 Frame = +3

Query  87    SLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHA  266
              LET  K+ +VDF+ E+LKPG+ SW  AC ++R ALE++GCF+ + D+V   +HN+IF A
Sbjct  6     GLETLPKIPMVDFSKENLKPGTDSWLPACNNVRHALEEYGCFMAVYDQVPLGVHNTIFGA  65

Query  267   SQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATT-IEGVQSFSNLMWSGG  443
              ++LFDLP E K  N +EKPY GY  + P  P H+  GID+ TT +E ++ F+ +MW  G
Sbjct  66    MRELFDLPIETKKQNISEKPYQGYTSESPAXPLHQGLGIDNVTTXLEEIRXFAKIMWPAG  125

Query  444   NH--------------sfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYL  581
             N                 S+S   +SK+VAEL+  V+RM+ ESYG+E    S+++S ++L
Sbjct  126   NENFCYSFISDIFSSXLISQSVHCYSKLVAELDRMVVRMVLESYGIEN--GSHIZSASFL  183

Query  582   LRYMKYEVPAESDENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPS--S  755
             +R +K  VP + +E N  FP H+DK+F+++L+Q N+V+GLE+Q ++G+WIS + PPS   
Sbjct  184   VRLLKSRVP-KMNETNKAFPSHSDKSFISILHQ-NKVNGLEIQTKDGKWISHE-PPSLQV  240

Query  756   FIVMAGEAIKGWSNSRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEH  935
             F+VMAGE +  WSN R+    H+V +  N  E RY++G+FS +     I+VPEELVDD H
Sbjct  241   FLVMAGEVLTAWSNGRIHPARHRVVVKGN--EARYALGLFSTING--MIKVPEELVDDHH  296

Query  936   PLQFKPFVHLDMIKFFDSDKGRRSKNLLKDFCG  1034
             PLQFKPF H  ++ F  + +GR  +  LK +CG
Sbjct  297   PLQFKPFDHTGLLHFLGTKEGRNPETALKAYCG  329



>ref|XP_010545796.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
isoform X2 [Tarenaya hassleriana]
Length=310

 Score =   282 bits (721),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 144/310 (46%), Positives = 216/310 (70%), Gaps = 10/310 (3%)
 Frame = +3

Query  114   VVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIV-LCDKVSPQLHNSIFHASQQLFDLP  290
              +DF+ EDLKPG++ W    K+IR ALE +GCFIV L +K    L   +F + +QLFDLP
Sbjct  7     TLDFSREDLKPGTSYWETTSKNIRQALEQYGCFIVDLHEKAPFDLLARVFDSLKQLFDLP  66

Query  291   FEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHsfsessq  470
                K+ N  +KP +GYVGQIP +P HE+ GID+AT+++  +SF++LMW  GN  F +   
Sbjct  67    TPTKMKNKYDKPMNGYVGQIPALPLHESLGIDNATSLQSTRSFTDLMWPRGNDRFCDCMH  126

Query  471   sfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENN-VVFPCH  647
              +++ VAE++  V RM+F SYGV K+Y+ Y++ST+YLLR +K   P   DEN  + F  H
Sbjct  127   RYAEFVAEMDRMVARMIFGSYGVAKYYEPYMKSTSYLLRLLKNRAP--KDENPYLAFVTH  184

Query  648   TDKTFMTVLYQLNQVSGLEVQARNGEWISAQF-PPSSFIVMAGEAIKGWSNSRVLAPIHK  824
             TDK+F T+L+Q +Q++GLE++ R GE I+     PS F+V+AG+A+  WSN R+L+P H+
Sbjct  185   TDKSFTTILHQ-DQINGLEMETRLGERINVDLSSPSLFMVIAGDALMAWSNDRILSPRHR  243

Query  825   VTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSDKGRR  1004
             V +  +G+  RYS+G F+F  ++ T++VPEELVD+EHPL +KPF H+ ++ F+ +D G R
Sbjct  244   VLV--SGETDRYSLGQFAF--SNGTLQVPEELVDNEHPLMYKPFDHIGLLHFYRTDIGYR  299

Query  1005  SKNLLKDFCG  1034
             ++  +K +CG
Sbjct  300   AECPIKAYCG  309



>ref|XP_009771248.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
isoform X1 [Nicotiana sylvestris]
Length=313

 Score =   281 bits (720),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 146/318 (46%), Positives = 212/318 (67%), Gaps = 6/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS ET  KL  +DF+NEDLKPGS  W      +  AL ++GCF    DK+   L  SIF
Sbjct  1     MGS-ET-IKLPNIDFSNEDLKPGSLVWNQVKNQVHKALVNYGCFEASFDKIPIHLRKSIF  58

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              + ++LFDLP + KI N + KP+HGYVGQ P +P +E+ GID A   +  + F+ ++W  
Sbjct  59    ESLKELFDLPLQTKIRNISTKPFHGYVGQYPAVPLYESMGIDDANISDKAERFTRILWPE  118

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN +F ++ QS+S+ ++EL++ V +M+ ES GVEK+ D ++ ST YLLR MKY+ P +S+
Sbjct  119   GNPNFCKTIQSYSEQLSELDQTVRKMILESLGVEKYMDEHMNSTNYLLRVMKYKGP-QSN  177

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
             +  +    HTDK  +T+LYQ NQV+GLEV  ++G+WI+ +  P +FIVM G+++  W+N 
Sbjct  178   DTKLGLNAHTDKNIVTILYQ-NQVNGLEVLTKDGQWINVEPTPDAFIVMIGDSLYAWANG  236

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             RV +P H+V M   G E RYSVG+FS  K    I+ PEEL D EHPL FKPF H++ + F
Sbjct  237   RVHSPYHRVMM--TGNEARYSVGLFSIPKAGYKIKAPEELADKEHPLLFKPFDHVEFLAF  294

Query  981   FDSDKGRRSKNLLKDFCG  1034
             + +++G+R  + LK +CG
Sbjct  295   YYTEEGQRCGSALKTYCG  312



>ref|XP_002517547.1| Gibberellin 20 oxidase, putative [Ricinus communis]
 gb|EEF44711.1| Gibberellin 20 oxidase, putative [Ricinus communis]
Length=314

 Score =   281 bits (720),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 145/323 (45%), Positives = 220/323 (68%), Gaps = 15/323 (5%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS ET  ++ +VD ++E L PGS+SW  AC DIR ALE +GCF V+ +  S + HN + 
Sbjct  1     MGS-ETVGQIPLVDLSSEHLNPGSSSWRSACNDIRKALEQYGCFEVVYNNPSIEFHNRVL  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
                ++LF LP E K+ N N KP HGY+G++   P HE  GI++A   +  Q F+NLMW  
Sbjct  60    ALLEKLFQLPQEIKMKNVNPKPAHGYMGKMSIFPIHEGMGIEYANDKDECQKFTNLMWPE  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN  F ++  S++K+V EL++ +++MLFESYG+EKH +S+++ST YLLR +KY       
Sbjct  120   GNDHFCDTVHSYAKMVTELQQLLVKMLFESYGIEKHSESHIKSTTYLLRLLKYR--RSQA  177

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPS---SFIVMAGEAIKGW  791
             E N+ F  HTDK+F+++L+Q N V GLE++ ++G W+S  + PS   SF+V+AG+    W
Sbjct  178   ETNLGFKGHTDKSFLSILHQ-NHVKGLEIRMKDGNWVS--YEPSSHTSFVVVAGDVGMAW  234

Query  792   SNSRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDM  971
             SN R+ +  H+VT+D  G+E RY++G+FSFL  +  ++VPEEL+D+EHPLQ+KPF H  +
Sbjct  235   SNDRIKSCYHRVTVD--GEEVRYALGLFSFL--TGLVKVPEELIDEEHPLQYKPFEHQGL  290

Query  972   IKFFDSD--KGRRSKNLLKDFCG  1034
             + F+ S+  + +   N++K +CG
Sbjct  291   LDFYQSNNSQNKGDSNMVKAYCG  313



>ref|XP_007135718.1| hypothetical protein PHAVU_010G152400g [Phaseolus vulgaris]
 gb|ESW07712.1| hypothetical protein PHAVU_010G152400g [Phaseolus vulgaris]
Length=320

 Score =   281 bits (720),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 143/319 (45%), Positives = 210/319 (66%), Gaps = 7/319 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             M   E   ++ VVDF +++LKPG+  W  AC+ IR ALEDHGCF  L D+V  +L+NS+F
Sbjct  1     MRDSEAVCEVPVVDFTDKELKPGTRKWGSACEVIRNALEDHGCFYALYDEVPMELYNSVF  60

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
                ++ FDLP E K+   ++KPYHGY GQ   +P +E+ GI+H  T+EG+Q+F+ LMW  
Sbjct  61    TLMEEQFDLPLETKMQKISDKPYHGYYGQHAHVPLYESLGINHPLTMEGIQNFTKLMWPA  120

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVE-KHYDSYVESTAYLLRYMKYEVPAES  617
             G   F ES   ++K++ EL+    RM+F+ YGVE +H DS +EST Y+LR  KY +P + 
Sbjct  121   GYDHFCESMSMYAKLLVELDHMTKRMVFDGYGVEQRHCDSLLESTNYMLRSFKYRLP-QK  179

Query  618   DENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSN  797
             DEN++    HTD +F T+L+Q N V+GL+V+ +NG+WI     P  F+++AG+A K WSN
Sbjct  180   DENDLGLHAHTDTSFFTILHQ-NNVNGLQVKFKNGDWIDIDPSPFMFLILAGDAFKVWSN  238

Query  798   SRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIK  977
              R+    H+V +  +GK++RYS+G+FS     K +E  EELVD+EHP  +KPF H + + 
Sbjct  239   DRIHCCEHRVII--SGKKERYSMGLFSL--GGKMVETQEELVDEEHPRCYKPFDHYEYLS  294

Query  978   FFDSDKGRRSKNLLKDFCG  1034
             F  + K  +S + +K FCG
Sbjct  295   FCATKKALQSHSRIKAFCG  313



>ref|XP_006367750.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1.2-like 
[Solanum tuberosum]
Length=187

 Score =   275 bits (704),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 125/185 (68%), Positives = 159/185 (86%), Gaps = 2/185 (1%)
 Frame = +3

Query  480   KIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNVVFPCHTDKT  659
             KIVAEL+ KV+RMLFESYG+ K+ +SY+EST YLLRY+KY  P ++ E ++VFP HTDKT
Sbjct  4     KIVAELDNKVVRMLFESYGIVKNCESYLESTTYLLRYLKYNTP-KTKETSMVFPPHTDKT  62

Query  660   FMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRVLAPIHKVTMDA  839
             F T+LYQ N +SGLEVQ R+ +WI+ +FPPSSF+VMAGEA++GWSN RVL PIHKV MD 
Sbjct  63    FTTILYQ-NHISGLEVQTRDLQWITLEFPPSSFVVMAGEALRGWSNDRVLTPIHKVIMDI  121

Query  840   NGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSDKGRRSKNLL  1019
             NG E RY++G+F+FLK+ K IEV EEL+D+EHPL+FKPFVHLD+IKFFD+ +GRRS+NL+
Sbjct  122   NGSETRYTMGLFTFLKDDKIIEVAEELIDEEHPLKFKPFVHLDLIKFFDTQRGRRSQNLV  181

Query  1020  KDFCG  1034
             +DFCG
Sbjct  182   EDFCG  186



>gb|KHG05406.1| 2'-deoxymugineic-acid 2'-dioxygenase [Gossypium arboreum]
Length=314

 Score =   280 bits (716),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 146/318 (46%), Positives = 211/318 (66%), Gaps = 5/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS +TP KL V+DF+  DLK GS  W      ++ AL+++GCF  L DK+   L  +IF
Sbjct  1     MGS-QTPLKLPVIDFSKPDLKAGSNEWDLVKGQVQQALQEYGCFEALFDKIPLHLREAIF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              + Q+LFDLP + KI N + KPYHGYVGQ P +P +E+ G+D A   E V++ +  +W  
Sbjct  60    GSLQELFDLPLQAKIRNVSNKPYHGYVGQYPQVPLYESMGVDDANITEKVEALTTTLWPQ  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN SFS + QSFS+ ++EL++ V RM+ ES+ +EK+ D ++ ST YLLR MKY+ P ++ 
Sbjct  120   GNSSFSNTIQSFSEQLSELDQIVRRMILESFDLEKYMDEHMGSTNYLLRVMKYKGP-KTT  178

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
             E  +    HTDK  +T+LYQ N+V GLEV ++ GEWI+ +    SF VM GE++  W N 
Sbjct  179   ETKLGLNSHTDKNIVTILYQ-NEVDGLEVLSKQGEWINVKPSKHSFTVMIGESLYAWLNG  237

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+ AP H+V M   G + RYS G+FS  K    I+ P+ELVD+ HPL FKPF H+D ++F
Sbjct  238   RLHAPYHRVMM--TGDKARYSAGLFSVPKAGYIIKAPDELVDEAHPLLFKPFDHVDFLRF  295

Query  981   FDSDKGRRSKNLLKDFCG  1034
             + ++ G+++++ LK FCG
Sbjct  296   YYTEAGQKAESALKVFCG  313



>ref|XP_003553391.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP3-like [Glycine 
max]
 gb|KHN14923.1| Gibberellin 20 oxidase 3 [Glycine soja]
Length=320

 Score =   280 bits (716),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 140/320 (44%), Positives = 219/320 (68%), Gaps = 7/320 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS +T ++L VVDF +E++KPG+ +W  AC  +RT LE++G F+   DKV  +L +S+ 
Sbjct  1     MGS-QTQSQLHVVDFTDENMKPGTDAWLSACSVVRTELENNGFFMARYDKVGKELCDSVV  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              A ++ F LP E K   T++KP+HGY+GQ+ ++P +E+ GID   T++G Q F+++MW  
Sbjct  60    FAVEEFFGLPVETKAQKTSDKPFHGYLGQVSWLPLYESVGIDDPLTLQGCQKFAHIMWPE  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVE-KHYDSYVESTAYLLRYMKYEVPAES  617
             GN  F ES   ++K++ EL+    RM+FESYGV+ +  DS++ES  YLLR MKY  P + 
Sbjct  120   GNGRFCESINEYAKLLGELDHMAKRMVFESYGVDMQRCDSFIESNDYLLRCMKYRTP-QM  178

Query  618   DENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSN  797
             DEN++    H+D T  ++++QLN ++GLE++ ++GEW      PS F+VMAG+A   WSN
Sbjct  179   DENDLGLQPHSDLTITSIVHQLNNLNGLEIKLKDGEWKEIDASPSLFVVMAGDAFNVWSN  238

Query  798   SRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKP-FVHLDMI  974
              R+    H+VTM  NGK+ RYS+G+FSF  N K + +P+ELV+D+HPL++KP F H + +
Sbjct  239   GRIRPCEHRVTM--NGKKSRYSMGLFSFGGN-KMMRIPDELVNDQHPLRYKPIFDHYEYL  295

Query  975   KFFDSDKGRRSKNLLKDFCG  1034
             +F+D +K +   + ++ +CG
Sbjct  296   RFYDKEKIKEPYSRIQAYCG  315



>ref|XP_009588351.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Nicotiana tomentosiformis]
Length=313

 Score =   279 bits (714),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 147/318 (46%), Positives = 210/318 (66%), Gaps = 6/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS ET  KL  +DF+N DLKPG+  W      +  AL ++GCF    DK+   L  SIF
Sbjct  1     MGS-ET-IKLPNIDFSNVDLKPGTLVWNQVKSQVHKALVNYGCFEASFDKIPIHLRKSIF  58

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              + ++LFDLP + KI N + KP+HGYVGQ P +P +E+ GID A   +  +SF+ ++W  
Sbjct  59    ESLKELFDLPLQTKIRNISTKPFHGYVGQYPAVPLYESMGIDDANIPDKAESFTRILWPE  118

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN +F ++ QS+S+ ++EL++ V RM+ ES GVE +   ++ ST YLLR MKY+ P +S 
Sbjct  119   GNPTFCKTIQSYSEQLSELDQTVRRMILESLGVENYMGEHMNSTNYLLRVMKYKGP-QSS  177

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
             E  V    HTDK  +T+LYQ NQV+GLEV   +G+WI+ +  P++FIVM G+++  W+N 
Sbjct  178   ETKVGLNAHTDKNIVTILYQ-NQVNGLEVLTEDGQWINVEPTPNAFIVMIGDSLYAWANG  236

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             RV +P H+V M   G E RYSVG+FS  K    I  PEELVD+EHPL FKPF H++ + F
Sbjct  237   RVHSPFHRVMM--RGNEARYSVGLFSIPKAGYKIMAPEELVDEEHPLLFKPFDHVEFLAF  294

Query  981   FDSDKGRRSKNLLKDFCG  1034
             + +++G+R  + LK +CG
Sbjct  295   YYTEEGQRCGSALKTYCG  312



>ref|XP_004171510.1| PREDICTED: LOW QUALITY PROTEIN: gibberellin 20 oxidase 1-like 
[Cucumis sativus]
Length=317

 Score =   280 bits (715),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 148/322 (46%), Positives = 218/322 (68%), Gaps = 10/322 (3%)
 Frame = +3

Query  81    MGSLETP-TKLLVVDFNNEDLKP-GSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNS  254
             MGS  T   +L V++F++E +K  G   W    K +R A+E++GCFI   + VS +L   
Sbjct  1     MGSETTEEIRLPVINFSDEKVKAEGGVEWRRTSKKVREAMEEYGCFIAKYEGVSKELREE  60

Query  255   IFHASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMW  434
             +  A ++LF+LP E+K +N  EKP++GYVG++  +P HE+ GID AT    VQSFS+LMW
Sbjct  61    VLKAVKELFELPIERKKMNKYEKPFNGYVGELRTLPLHESLGIDDATNFNQVQSFSHLMW  120

Query  435   -SGGNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPA  611
                GNH FS +  SF+KI  EL++ V +M+FESYGVEK+Y+S+ +S  YLLR +K + P 
Sbjct  121   PPEGNHHFSATLHSFAKIAEELDKMVTKMIFESYGVEKYYNSHADSITYLLRVLKSKAP-  179

Query  612   ESDENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISA-QFPPSSFIVMAGEAIKG  788
             +S +  +    HTDK+F T++YQ + ++GLE++ + G+WI      PSSF+V+AG+AIK 
Sbjct  180   QSPDPTLCLVDHTDKSFTTMVYQ-DHINGLELKTKXGQWIQVDNSSPSSFLVIAGDAIKA  238

Query  789   WSNSRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLD  968
             WSN R+ +P HKVT+   G E RYS+ +F F  ++  +EVP+ELVD  HPL++KPF H+ 
Sbjct  239   WSNDRIESPTHKVTI--RGNEDRYSLAMFGF--SNGIVEVPKELVDQNHPLRYKPFDHIG  294

Query  969   MIKFFDSDKGRRSKNLLKDFCG  1034
             ++ FF S +G  SK+ LKD+C 
Sbjct  295   LLHFFRSKEGFNSKSPLKDYCA  316



>ref|XP_008461058.1| PREDICTED: probable inactive 2-oxoglutarate-dependent dioxygenase 
AOP2 isoform X2 [Cucumis melo]
Length=316

 Score =   279 bits (714),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 145/320 (45%), Positives = 215/320 (67%), Gaps = 8/320 (3%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKP-GSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSI  257
             MGS     +L V++F++E +K  GS  W    K +R ALE++GCFI   + V  +L   +
Sbjct  1     MGSETMEERLPVINFSDEKVKAEGSVEWRRTSKKVREALEEYGCFIAKYEGVGKELREEV  60

Query  258   FHASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWS  437
               A ++LF+LP E+K +N  EKP++GYVG++  +P HE+ GID AT   GVQSFS+LMW 
Sbjct  61    LKAVKELFELPIERKKMNKYEKPFNGYVGELRTLPLHESLGIDDATNFNGVQSFSHLMWP  120

Query  438   GGNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAES  617
              GNH FS +  SF+K   EL++ V +M+FESYGVEK+Y+S+ +S  YLLR +K + P +S
Sbjct  121   EGNHHFSATLHSFAKRAEELDKMVTKMIFESYGVEKYYNSHADSITYLLRILKNKAP-QS  179

Query  618   DENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISA-QFPPSSFIVMAGEAIKGWS  794
              +  +    HTDK+F T++YQ + ++GLE++ +NG+WI      PSSF+V+AG+A K WS
Sbjct  180   PDPTLCLVDHTDKSFTTMIYQ-DHINGLELKTKNGQWIQVDNSSPSSFVVIAGDAFKAWS  238

Query  795   NSRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMI  974
             N R+ +  H+V M   G+E RYS+G+FSF KN  TIEVP+  VDD +PL++KPF H D +
Sbjct  239   NERIRSCRHRVIM--RGEETRYSIGMFSF-KNG-TIEVPQGFVDDANPLRYKPFNHYDFL  294

Query  975   KFFDSDKGRRSKNLLKDFCG  1034
              +  ++    + + +KD+CG
Sbjct  295   TYDKANASHNTISRIKDYCG  314



>gb|KEH28749.1| 2-oxoglutarate-dependent dioxygenase [Medicago truncatula]
Length=315

 Score =   279 bits (713),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 146/321 (45%), Positives = 213/321 (66%), Gaps = 10/321 (3%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MG+  TP KL ++DFNN +L+  S +W      +  AL ++GCF  + DKV   L  +IF
Sbjct  1     MGTEATP-KLPIIDFNNLNLEAKSPNWELVKSQVYKALVEYGCFEAVFDKVPLDLRKAIF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              + Q+LFDLP E K+LN ++KPYHGYVGQ P IP  E+ GID A  +E V S +N +W  
Sbjct  60    ASLQELFDLPLETKLLNVSKKPYHGYVGQYPMIPLFESMGIDDANILEKVDSMTNNLWPD  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN +FS++  SFS+ + EL++ + +M+ ES GVEK+ + ++ ST YLLR MKY+ P  SD
Sbjct  120   GNQNFSKTIHSFSEELTELDQIIRKMILESLGVEKYLEEHMNSTNYLLRVMKYKGPQTSD  179

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPS---SFIVMAGEAIKGW  791
                +    H+DK  +T+LYQ NQV GLEV  ++G+WIS  + PS   SF+ M G++I  W
Sbjct  180   -TKLGLSTHSDKNVVTILYQ-NQVEGLEVMTKDGQWIS--YKPSSSGSFVAMIGDSIHAW  235

Query  792   SNSRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDM  971
             SN R+ +P H+V M  +G E RYS G+FS  K    I+ PEELVD+EHPL F+P+ H++ 
Sbjct  236   SNGRLHSPFHRVMM--SGNEARYSTGLFSIPKGGYIIKAPEELVDEEHPLLFRPYDHVEF  293

Query  972   IKFFDSDKGRRSKNLLKDFCG  1034
             +K++ ++KG+R +  ++ +CG
Sbjct  294   LKYYYTEKGQRDQFAMRTYCG  314



>ref|XP_008377588.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Malus domestica]
Length=322

 Score =   278 bits (710),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 141/315 (45%), Positives = 206/315 (65%), Gaps = 5/315 (2%)
 Frame = +3

Query  93    ETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQ  272
             ETP  L ++DF+  DL  G+  W      +  ALE++GCF  L +KV   +  S   + +
Sbjct  4     ETPLGLPIIDFSKPDLNQGTKEWDLVRAQVHNALEEYGCFEALFNKVPSDIRKSTIESME  63

Query  273   QLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHs  452
             +LFDLP + K+ N ++KPYHGYVGQ P +P +E+ G D A   E V+S +N +W  GN  
Sbjct  64    ELFDLPLQTKLQNVSKKPYHGYVGQYPMVPLYESMGFDDANVYEQVESLTNTLWPQGNPR  123

Query  453   fsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNV  632
             F  S QSFS+ V+EL++ + RM+ ES G+EK+++ +VEST YLLR MKY+ P E+ E+ +
Sbjct  124   FCTSIQSFSEQVSELDQIIRRMILESLGLEKYFEEHVESTNYLLRVMKYKGP-ETKESKL  182

Query  633   VFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQ-FPPSSFIVMAGEAIKGWSNSRVL  809
                 HTDK  +T+LYQ NQV GLEVQ +  +WI  +   P SFI M G+++  W+N R+ 
Sbjct  183   GINAHTDKNIVTILYQ-NQVDGLEVQTKACKWIKVKPSSPHSFIAMIGDSLHAWTNGRLH  241

Query  810   APIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDS  989
             +P H+V M  +G E RYS G+FS  K    I+ PEE+VD+EHPL FKPF H++ + F+ +
Sbjct  242   SPYHRVMM--SGNEARYSTGLFSIPKAGYIIKAPEEVVDEEHPLLFKPFDHVEFLGFYYT  299

Query  990   DKGRRSKNLLKDFCG  1034
             + G+R+++ LK +CG
Sbjct  300   EAGQRAQSALKTYCG  314



>gb|ACU24369.1| unknown [Glycine max]
Length=307

 Score =   277 bits (708),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 148/320 (46%), Positives = 204/320 (64%), Gaps = 16/320 (5%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS   P  L V+DF  EDLKPG+ SW   C  +R A E++G F+ + DK S +L N +F
Sbjct  1     MGSEGKPM-LPVLDFTIEDLKPGTNSWLSTCTSVRQAFEENGYFVAVYDKASTELQNGVF  59

Query  261   HASQQLFDLPFEKKILNTNEK-PYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWS  437
              + ++LFDLP E K  N  E  P  GYVGQ P IP HE+ GID  TT+EG+QSF+  MW 
Sbjct  60    GSMKELFDLPTETKRRNIFEGMPLKGYVGQHPKIPLHESMGIDPGTTLEGIQSFAEKMWP  119

Query  438   GGNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAES  617
              GN  F +    ++K+   L   V+RM+FESYG+ +HYD+++ ST YLLR + ++   E 
Sbjct  120   HGNDQFCKYIFEYAKVAEVLNRMVVRMIFESYGLLEHYDTFIGSTNYLLRLLAHKA-LEQ  178

Query  618   DENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQF-PPSSFIVMAGEAIKGWS  794
             +E  + F  HTDK+F T+L+Q N V+ L V+  NG WI   F  P+SF+VMAG+A+  WS
Sbjct  179   NEPQLGFVAHTDKSFTTILHQ-NHVNALMVETTNGNWIDVDFSSPTSFVVMAGDALMAWS  237

Query  795   NSRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMI  974
             N R+ +P H V M  NG E RYS+G+F+F +    ++VPEEL+D+EHPLQ+KPF HL ++
Sbjct  238   NDRIKSPNHMVMM--NGNETRYSLGLFAFYRG--ILKVPEELIDEEHPLQYKPFDHLALL  293

Query  975   KFFDSDKGRRSKNLLKDFCG  1034
              F  S         +K +CG
Sbjct  294   NFTYSAN-------MKAYCG  306



>ref|XP_004165032.1| PREDICTED: gibberellin 20 oxidase 1-B-like [Cucumis sativus]
Length=321

 Score =   277 bits (709),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 144/316 (46%), Positives = 221/316 (70%), Gaps = 16/316 (5%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             M +  +  +L VV F +++LK G+  W    K +R ALE++GCF+ L D VS ++ +++F
Sbjct  1     MATNMSDEQLPVVKFCSQNLKSGTEEWVSTTKKVREALEEYGCFVALYDTVSAEVSSNMF  60

Query  261   HASQQLFD-LPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMW-  434
              + ++LFD +P E+K+ N +EKPYHGY GQ P +P HE+ GI+H      + SF+NLMW 
Sbjct  61    DSLKELFDEVPLERKLQNVSEKPYHGYFGQNPLMPIHESMGIEHPILPTNINSFTNLMWP  120

Query  435   SGGNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAE  614
             S GNHSF E+  +++ +V+EL+++V  M+FESYGV     S++EST YL+R +KY VP E
Sbjct  121   SRGNHSFRENVTAYANLVSELDKRVKSMVFESYGVGNALRSHMESTKYLMRMIKYRVPKE  180

Query  615   SDENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPP------SSFIVMAGE  776
              + N   FP HTDK+F+T+L+Q N+V+GL+++ R+ +WI  Q+ P      SSFIVMAG+
Sbjct  181   KEMNLGAFP-HTDKSFLTILHQ-NEVNGLQIKTRDNKWI--QYHPFSSSSTSSFIVMAGD  236

Query  777   AIKGWSNSRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPF  956
             A   WSN R+ +P H+V M  +G ++RYSVG+FSF  N+  +++P+ELVDD+HP  FKPF
Sbjct  237   AFFAWSNGRIYSPPHRVIM--SGNKERYSVGLFSF--NNGIVQIPKELVDDKHPQLFKPF  292

Query  957   VHLDMIKFFDSDKGRR  1004
              H D ++F+ +++G++
Sbjct  293   DHQDYLRFYSTERGQK  308



>ref|XP_004293154.1| PREDICTED: gibberellin 3-beta-dioxygenase 4-like [Fragaria vesca 
subsp. vesca]
Length=316

 Score =   277 bits (708),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 135/319 (42%), Positives = 212/319 (66%), Gaps = 7/319 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS+  P ++  ++F+ +DLKPGS+SW   CK +R ALE++GCF+ L  +VS +L ++IF
Sbjct  1     MGSMTLPKEIPTINFSLQDLKPGSSSWTSTCKQVRNALEEYGCFVALYPQVSQELMDNIF  60

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
               S+ LF++P E K+ NT+E+PY GY+G  P +P +E   ID+ T+ +  Q F +LMW  
Sbjct  61    GQSRDLFEVPLENKVKNTSEEPYRGYIGPNPLLPLYEGIAIDNVTSPQETQKFRDLMWPN  120

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVE-KHYDSYVESTAYLLRYMKYEVPAES  617
             G   F E +  F+K++ ELE  V +M+FESYG+  + Y++   S ++LLR++KY++P E 
Sbjct  121   GKTQFCEITDLFAKLLGELENTVEKMIFESYGIPLEQYETLASSNSHLLRFLKYKIPEER  180

Query  618   DENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSN  797
             D   + FP HTDK F T++ Q + V GLEVQ ++G+WIS +   S F+ MA + ++ WSN
Sbjct  181   DA-ALRFPSHTDKNFTTIIVQ-HDVGGLEVQTKDGDWISVESASSQFLFMACDELQVWSN  238

Query  798   SRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIK  977
              RV AP H+V     G + RYS+G+F+F  N+   EVP+ELVDD HPL +  F  L  ++
Sbjct  239   DRVKAPHHRV--KHCGDKTRYSLGMFTF--NNGVFEVPKELVDDSHPLLYNQFDSLGFVR  294

Query  978   FFDSDKGRRSKNLLKDFCG  1034
             F+ + + +++++ +K +CG
Sbjct  295   FYTTPEAKKAESPIKAYCG  313



>emb|CDY26044.1| BnaC06g05800D [Brassica napus]
Length=317

 Score =   277 bits (708),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 139/312 (45%), Positives = 208/312 (67%), Gaps = 4/312 (1%)
 Frame = +3

Query  99    PTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQQL  278
             P  L V+DF+N++LKPG   W     D++ AL+D+GCF    DKV  +L  SIF A ++L
Sbjct  9     PLHLPVIDFSNQNLKPGEPQWDLTKADVQKALQDYGCFEASFDKVPIELRKSIFKALEEL  68

Query  279   FDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHsfs  458
             FDLP + K+ N ++KP+HGYVGQ P +P +E+ GID +  ++ V++F+  +W  GN+SFS
Sbjct  69    FDLPLKTKLRNVSKKPFHGYVGQYPMVPLYESMGIDDSDVVDKVEAFTEKLWPQGNNSFS  128

Query  459   essqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNVVF  638
              +  SFSK ++EL+  + RM+ ES+G+ K+ D +++ST YLLR MKY  P +++E  +  
Sbjct  129   ATIHSFSKKLSELDITIRRMIMESFGLVKYIDEHLQSTNYLLRVMKYTGP-DTEETKLGL  187

Query  639   PCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRVLAPI  818
               HTDK  +T+LYQ N V GLEVQ ++  WI  +    SFIVM G+++    N R+ +P 
Sbjct  188   NAHTDKNIVTILYQ-NHVEGLEVQTKDKNWIKVKPSEDSFIVMIGDSLHALLNGRLHSPY  246

Query  819   HKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSDKG  998
             H+V M   G E RYS+G+FS  K    +  P+ELVD+EHP  FKPF H++ +KF+ ++ G
Sbjct  247   HRVMM--TGTETRYSLGLFSIPKAGHIVSSPDELVDEEHPRLFKPFDHVEFLKFYYTEAG  304

Query  999   RRSKNLLKDFCG  1034
             +RS++ LK +CG
Sbjct  305   QRSQSALKTYCG  316



>ref|XP_003535849.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1.2-like 
[Glycine max]
Length=307

 Score =   276 bits (707),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 148/320 (46%), Positives = 204/320 (64%), Gaps = 16/320 (5%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS   P  L V+DF  EDLKPG+ SW   C  +R A E++G F+ + DK S +L N +F
Sbjct  1     MGSEGKPM-LPVLDFTIEDLKPGTNSWLSTCTSVRQAFEENGYFVAVYDKASIELQNGVF  59

Query  261   HASQQLFDLPFEKKILNTNEK-PYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWS  437
              + ++LFDLP E K  N  E  P  GYVGQ P IP HE+ GID  TT+EG+QSF+  MW 
Sbjct  60    GSMKELFDLPTETKRRNIFEGMPLKGYVGQHPKIPLHESMGIDPGTTLEGIQSFAEKMWP  119

Query  438   GGNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAES  617
              GN  F +    ++K+   L   V+RM+FESYG+ +HYD+++ ST YLLR + ++   E 
Sbjct  120   HGNDQFCKYIFEYAKVAEVLNRMVVRMIFESYGLLEHYDTFIGSTNYLLRLLAHKA-LEQ  178

Query  618   DENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQF-PPSSFIVMAGEAIKGWS  794
             +E  + F  HTDK+F T+L+Q N V+ L V+  NG WI   F  P+SF+VMAG+A+  WS
Sbjct  179   NEPQLGFVAHTDKSFTTILHQ-NHVNALMVETTNGNWIDVDFSSPTSFVVMAGDALMAWS  237

Query  795   NSRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMI  974
             N R+ +P H V M  NG E RYS+G+F+F +    ++VPEEL+D+EHPLQ+KPF HL ++
Sbjct  238   NDRIKSPNHMVMM--NGNETRYSLGLFAFYRG--ILKVPEELIDEEHPLQYKPFDHLALL  293

Query  975   KFFDSDKGRRSKNLLKDFCG  1034
              F  S         +K +CG
Sbjct  294   NFTYSAN-------MKAYCG  306



>ref|XP_010032029.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Eucalyptus grandis]
 gb|KCW51414.1| hypothetical protein EUGRSUZ_J00951 [Eucalyptus grandis]
Length=313

 Score =   276 bits (707),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 142/313 (45%), Positives = 207/313 (66%), Gaps = 8/313 (3%)
 Frame = +3

Query  102   TKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQQLF  281
             +++ V+ F+ E  KPG++SW  ACK I  ALEDHGCFIV    V   LH+++F  ++ LF
Sbjct  3     SQIPVIVFSEECTKPGTSSWEKACKVIVQALEDHGCFIVDHPNVPLGLHDTVFSVAEDLF  62

Query  282   DLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHsfse  461
             DLP E KI NTN KP HGY+ ++P  P  E   ID A  +E  + F+++MW  GN  F +
Sbjct  63    DLPHETKIKNTNFKPSHGYIAKVPGTPLLEGMNIDGAEKLEECEKFTSIMWPSGNDHFCK  122

Query  462   ssqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNVVFP  641
             +   +SK +AE+E+ V RM+ ESYGVEK +D Y+ES  YLLR++KY+ PA+ D N  V P
Sbjct  123   TVHDYSKFIAEIEKVVFRMVCESYGVEKCFDPYIESCTYLLRFLKYKKPADLDAN--VNP  180

Query  642   -CHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRVLAPI  818
               HTDK+F++ L+Q N + GLEV+ ++GEW + +    +F+VMAG+A   WSN R+ A  
Sbjct  181   IAHTDKSFLSYLHQ-NNIRGLEVRTKDGEWFTFEPSALTFMVMAGDACVAWSNGRIKACY  239

Query  819   HKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSDKG  998
             H+V +     + RYS+G FS++  S  IE PEE +D  HP Q+KPF H+D + ++DS   
Sbjct  240   HRVAVREES-QVRYSLGTFSYI--SGMIETPEEFIDKAHPRQYKPFNHIDFLCYYDSSDN  296

Query  999   R-RSKNLLKDFCG  1034
             R ++++L+K +CG
Sbjct  297   RIKAESLIKTYCG  309



>ref|XP_006305421.1| hypothetical protein CARUB_v10009821mg [Capsella rubella]
 gb|EOA38319.1| hypothetical protein CARUB_v10009821mg [Capsella rubella]
Length=310

 Score =   276 bits (707),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 142/312 (46%), Positives = 215/312 (69%), Gaps = 8/312 (3%)
 Frame = +3

Query  105   KLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIV-LCDKVSPQLHNSIFHASQQLF  281
             K+  +DF+ EDLK G+  W    K+IR ALE++GCFI+ L +K    L + +F +   LF
Sbjct  4     KIPTLDFSREDLKQGTQYWETTSKNIRQALEEYGCFIIDLQNKTPLDLLDQVFGSLVDLF  63

Query  282   DLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHsfse  461
             DLP + K+ N  +KP  GYVGQIP +P HE+ GID+AT+++  +SF+ LMW  GN  FSE
Sbjct  64    DLPTQTKMKNKYDKPLSGYVGQIPALPLHESLGIDNATSLKETRSFTGLMWPQGNEHFSE  123

Query  462   ssqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNVVFP  641
                 +++  A+L++ V++M+FESY VEK+YD Y+EST YLLR +K   P  +++  + F 
Sbjct  124   CLHKYAEFAAKLDQMVVQMVFESYNVEKYYDPYIESTTYLLRVLKNCAP-NNEKPTLGFV  182

Query  642   CHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQF-PPSSFIVMAGEAIKGWSNSRVLAPI  818
              HTDK+F T+L+Q +QV+GLE++ R GE ++     PS F+V AG+A++ WSN RV +P 
Sbjct  183   THTDKSFTTILHQ-DQVNGLELETREGERVNINLSSPSLFMVFAGDALRAWSNDRVWSPR  241

Query  819   HKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSDKG  998
             H+V +  +GK  RYS+ +F+F  N+ T++VPEEL+D +HPL +KPF HL ++ F+ +D G
Sbjct  242   HQVLV--SGKTDRYSLAMFAF--NNGTLQVPEELIDHQHPLMYKPFDHLGLLSFYRTDTG  297

Query  999   RRSKNLLKDFCG  1034
              +S+  +K +CG
Sbjct  298   YKSECPIKAYCG  309



>ref|XP_010061957.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Eucalyptus grandis]
Length=321

 Score =   276 bits (707),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 142/320 (44%), Positives = 209/320 (65%), Gaps = 8/320 (3%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             M   +  +++ V+  + E +KPG++SW  ACK I  ALEDHGCFIV    V   LH+++F
Sbjct  1     MAGTKVASQIPVIVLSEECMKPGTSSWEKACKVIVQALEDHGCFIVDHPNVPLGLHDTVF  60

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
               ++ LFDLP E KI NTN KP HGY+ ++P  P  E   ID A  +E  + F++LMW  
Sbjct  61    SVTEDLFDLPHETKIKNTNFKPSHGYIPKVPGTPLLEGTNIDGAEKLEECEKFTSLMWPS  120

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN  F ++   + K +AE+E+ V RM+ ESYGVEK YD Y+ES  YLLR++KY+ PA+ D
Sbjct  121   GNDHFCKTVHDYGKFIAEIEKVVFRMVCESYGVEKCYDPYIESCTYLLRFLKYKKPADLD  180

Query  621   ENNVVFP-CHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSN  797
              +  V P  HTDK+F++ L+Q N + GLEV+ ++GEW + +   S+F+VMAG+A   WSN
Sbjct  181   AS--VNPIAHTDKSFLSYLHQ-NNIRGLEVRTKDGEWFTFEPSASTFMVMAGDACVAWSN  237

Query  798   SRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIK  977
              R+ A  H+V +     + RYS+G FS++  S  IE PEE ++  HP Q+KPF H+D + 
Sbjct  238   GRIKACYHRVAVREES-QVRYSLGTFSYV--SGMIETPEEFINKAHPRQYKPFNHIDFLC  294

Query  978   FFDSDKGR-RSKNLLKDFCG  1034
             ++DS   R ++++L+K +CG
Sbjct  295   YYDSSDNRIKAESLIKTYCG  314



>ref|XP_004241720.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Solanum lycopersicum]
Length=313

 Score =   276 bits (707),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 139/310 (45%), Positives = 206/310 (66%), Gaps = 4/310 (1%)
 Frame = +3

Query  105   KLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQQLFD  284
             KL  +DF++EDLKP +  W      +  AL ++GCF    DK+   L  SIF + Q+LFD
Sbjct  7     KLPKIDFSHEDLKPDTLVWNQVKSQVHKALVEYGCFEASFDKIPIHLRKSIFESLQELFD  66

Query  285   LPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHsfses  464
             LP + K+ N ++KP+HGYVGQ P +P +E+ GID A      + F+ ++W  GN +F ++
Sbjct  67    LPLQTKLKNISKKPFHGYVGQYPQVPLYESMGIDDANIPHKAEKFTQILWPQGNPTFCKT  126

Query  465   sqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNVVFPC  644
              QS+S+ ++EL++ + RM+ ES GVEK+ D ++ ST+YLLR MKY+ P +S E  V    
Sbjct  127   IQSYSEQLSELDQTIRRMIVESLGVEKYMDEHMNSTSYLLRVMKYKGP-QSSETKVGLNA  185

Query  645   HTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRVLAPIHK  824
             HTDK  +T+LYQ N+VSGLEV  ++G+WI+    P +F VM G+++  W+N R+ +P H+
Sbjct  186   HTDKNIVTILYQ-NEVSGLEVLTKDGKWINVDPTPDTFTVMIGDSLYAWANGRLHSPYHR  244

Query  825   VTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSDKGRR  1004
             V M   G E RYSVG+FS  K   TI+ PEELVD+EH L FKPF H++ + F+ +++G+R
Sbjct  245   VMM--RGNEARYSVGLFSIPKAGYTIKAPEELVDEEHSLLFKPFDHVEFLDFYYTEEGQR  302

Query  1005  SKNLLKDFCG  1034
               + LK +CG
Sbjct  303   CASALKTYCG  312



>ref|XP_004506877.1| PREDICTED: feruloyl CoA ortho-hydroxylase 1-like [Cicer arietinum]
Length=314

 Score =   275 bits (704),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 140/316 (44%), Positives = 212/316 (67%), Gaps = 4/316 (1%)
 Frame = +3

Query  87    SLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHA  266
             S ET  KL ++DFNN +L+  S +W      +  ALE++GCF  + DKV   L  +IF +
Sbjct  2     SSETIPKLPIIDFNNLNLEAKSPNWESVKSQVYKALEEYGCFEAILDKVPLDLRKTIFSS  61

Query  267   SQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGN  446
              ++LFDLP + K LN ++K +HGY+ Q P +P +E+ GID A   E V+S +N++W  GN
Sbjct  62    LEELFDLPLQTKQLNVSKKLHHGYLSQYPMLPLYESIGIDDANIFENVESLTNILWPDGN  121

Query  447   HsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDEN  626
              SFS++  +FS+ + EL++ + +M+ ES GVEK+ + ++ ST+YLLR+MKY+ P  SD  
Sbjct  122   QSFSKTVHTFSEELLELDQIIRKMILESLGVEKYLEEHMNSTSYLLRFMKYKGPQTSD-T  180

Query  627   NVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRV  806
              V    HTDK  +T+LYQ NQV GLEV  ++G+WIS +    SF+V+ GE++  WSN R+
Sbjct  181   KVGLKAHTDKNTVTILYQ-NQVEGLEVMNKDGKWISYKPSLDSFVVLVGESLHAWSNGRL  239

Query  807   LAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFD  986
              +P+H+V M  +G E RYS+ + S  K    I+ P+ELVDDEHPL FKP+V+ + +K+F 
Sbjct  240   HSPLHRVMM--SGNEARYSIALGSIPKEECIIKAPDELVDDEHPLLFKPYVYDEFLKYFF  297

Query  987   SDKGRRSKNLLKDFCG  1034
             S+KG+R +  ++ +CG
Sbjct  298   SEKGQRDQFAMRTYCG  313



>ref|XP_011045369.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Populus euphratica]
Length=314

 Score =   275 bits (704),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 142/318 (45%), Positives = 206/318 (65%), Gaps = 5/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS ET  KL ++DF+N    PG+  W      +R ALE++GCF  L DK+  +   +IF
Sbjct  1     MGS-ETALKLPIIDFSNLGQNPGAAEWDLVKLQVRKALEEYGCFEALFDKIPAESRKAIF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              A ++LFDLP + K+ N + KPYHGYVGQ P +P  E+ GID A   E V+  + ++W  
Sbjct  60    GAVEELFDLPLQTKMRNASRKPYHGYVGQYPQVPLFESMGIDDANIAEEVERTTAILWPQ  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN SFS +  SFSK V+EL++ V RM+ ES G+EK+ D ++ ST YLLR MKY+VP ++ 
Sbjct  120   GNQSFSNTVLSFSKQVSELDQIVRRMIVESLGLEKYLDEHMNSTNYLLRVMKYKVP-QTT  178

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
             E  +    HTDK  +T+L Q NQV GLE+Q ++G W   +  P SFIVM G+++  W+N 
Sbjct  179   ETKLGLSSHTDKNMVTILCQ-NQVDGLELQTKDGCWTDLKPNPDSFIVMIGDSLYAWANG  237

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+ +P H+V M   G E RYS+G+F+  K    ++ PEEL+D+EHPL FKPF H + + +
Sbjct  238   RLHSPYHRVMM--RGNEVRYSLGLFAVPKAGYIVKAPEELIDEEHPLLFKPFDHFEFLGY  295

Query  981   FDSDKGRRSKNLLKDFCG  1034
             + ++ G+  ++ LK +CG
Sbjct  296   YYTEAGQTDQSALKTYCG  313



>gb|KHN31409.1| Gibberellin 20 oxidase 1 [Glycine soja]
Length=307

 Score =   275 bits (703),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 147/320 (46%), Positives = 204/320 (64%), Gaps = 16/320 (5%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS   P  L V+DF  EDLKPG+ SW   C  +R A E++G F+ + DK S +L N +F
Sbjct  1     MGSEGKPM-LPVLDFTIEDLKPGTNSWLSTCTSVRQAFEENGYFVAVYDKASIELQNGVF  59

Query  261   HASQQLFDLPFEKKILNTNEK-PYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWS  437
              + ++LFDLP E K  N  E  P  GYVGQ P IP HE+ GID  TT+EG+QSF+  +W 
Sbjct  60    GSMKELFDLPTETKRRNIFEGMPLKGYVGQHPKIPLHESMGIDPGTTLEGIQSFAEKLWP  119

Query  438   GGNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAES  617
              GN  F +    ++K+   L   V+RM+FESYG+ +HYD+++ ST YLLR + ++   E 
Sbjct  120   HGNDQFCKYIFEYAKVAEVLNRMVVRMIFESYGLLEHYDTFIGSTNYLLRLLAHKA-LEQ  178

Query  618   DENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQF-PPSSFIVMAGEAIKGWS  794
             +E  + F  HTDK+F T+L+Q N V+ L V+  NG WI   F  P+SF+VMAG+A+  WS
Sbjct  179   NEPQLGFVAHTDKSFTTILHQ-NHVNALMVETTNGNWIDVDFSSPTSFVVMAGDALMAWS  237

Query  795   NSRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMI  974
             N R+ +P H V M  NG E RYS+G+F+F +    ++VPEEL+D+EHPLQ+KPF HL ++
Sbjct  238   NDRIKSPNHMVMM--NGNETRYSLGLFAFYRG--ILKVPEELIDEEHPLQYKPFDHLALL  293

Query  975   KFFDSDKGRRSKNLLKDFCG  1034
              F  S         +K +CG
Sbjct  294   NFTYSAN-------MKAYCG  306



>ref|XP_008454372.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Cucumis melo]
Length=314

 Score =   275 bits (704),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 135/314 (43%), Positives = 210/314 (67%), Gaps = 5/314 (2%)
 Frame = +3

Query  93    ETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQ  272
             E+  KL ++DF+N  L+ G   W  A   ++ ALE+ GCF    DKV  ++   +F A +
Sbjct  4     ESSLKLPLIDFSN--LESGGPKWELAKAQVKEALEEFGCFEASFDKVPIEVRKGLFEALE  61

Query  273   QLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHs  452
             +LF+LP E K+ N ++KP+HGYVGQ P  P  E+ G+D +T  + VQ F+N++W  GN +
Sbjct  62    ELFNLPLETKLRNVSQKPFHGYVGQYPMAPLFESMGVDDSTIPQKVQDFTNILWPQGNPT  121

Query  453   fsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNV  632
             FS+  +++S+ ++EL+E V RM+ ES GVEK+ + ++EST YLLR MKY+   +S+E  +
Sbjct  122   FSKVIETYSQQLSELDEMVRRMVLESLGVEKYMEEHLESTNYLLRVMKYKGTDQSNETKI  181

Query  633   VFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRVLA  812
                 HTDK  +T+LYQ N V GL+VQ ++G+WI+ Q  P SF+ M G++   W+N R+ +
Sbjct  182   GLHSHTDKNIVTILYQ-NHVEGLQVQTKDGKWINFQPSPHSFVAMIGDSFHAWTNGRLHS  240

Query  813   PIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSD  992
             P H+V M  +G+E RYS G+FS  K    ++ PEELVD++HPL F PF H+  ++F+ ++
Sbjct  241   PYHRVMM--SGEEVRYSAGLFSIPKAGYIVKAPEELVDEQHPLLFNPFDHVQFLQFYYTE  298

Query  993   KGRRSKNLLKDFCG  1034
              G+++++ LK FCG
Sbjct  299   AGQKAQSALKTFCG  312



>gb|AFK40822.1| unknown [Medicago truncatula]
Length=315

 Score =   275 bits (704),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 145/321 (45%), Positives = 212/321 (66%), Gaps = 10/321 (3%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MG+  TP KL ++DFNN +L+  S +W      +  AL ++GCF  + DKV   L  +IF
Sbjct  1     MGTEATP-KLPIIDFNNLNLEAKSPNWELVKSQVYKALVEYGCFEAVFDKVPLDLRKAIF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              + Q+LF LP E K+LN ++KPYHGYVGQ P IP  E+ GID A  +E V S +N +W  
Sbjct  60    ASLQELFYLPLETKLLNVSKKPYHGYVGQYPMIPLFESMGIDDANILEKVDSMTNNLWPD  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN +FS++  SFS+ + EL++ + +M+ ES GVEK+ + ++ ST YLLR MKY+ P  SD
Sbjct  120   GNQNFSKTIHSFSEELTELDQIIRKMILESLGVEKYLEEHMNSTNYLLRVMKYKGPQTSD  179

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPS---SFIVMAGEAIKGW  791
                +    H+DK  +T+LYQ NQV GLEV  ++G+WIS  + PS   SF+ M G++I  W
Sbjct  180   -TKLGLSTHSDKNVVTILYQ-NQVEGLEVMTKDGQWIS--YKPSSSGSFVAMIGDSIHAW  235

Query  792   SNSRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDM  971
             SN R+ +P H+V M  +G E RYS G+FS  K    I+ PEELVD+EHPL F+P+ H++ 
Sbjct  236   SNGRLHSPFHRVMM--SGNEARYSTGLFSIPKGGYIIKAPEELVDEEHPLLFRPYDHVEF  293

Query  972   IKFFDSDKGRRSKNLLKDFCG  1034
             +K++ ++KG+R +  ++ +CG
Sbjct  294   LKYYYTEKGQRDQFAMRTYCG  314



>ref|XP_009347560.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP2-like [Pyrus 
x bretschneideri]
Length=317

 Score =   275 bits (704),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 138/320 (43%), Positives = 213/320 (67%), Gaps = 6/320 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             M S   P  + VVD ++E+LKPG+ +W  ACK ++ ALE++ CF  + +K + ++HNSIF
Sbjct  1     MISKTQPKVVPVVDLSDENLKPGTDAWLLACKQVQHALEEYSCFEAVYNKATLEIHNSIF  60

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              A + L DLP E K+   N++P+H Y GQ+P  P +E  GI    ++EG Q F+N+MW  
Sbjct  61    SAIKDLCDLPLETKMQKANDRPFHNYFGQLPLNPRYETLGIQDPASLEGAQRFTNIMWPA  120

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN  F ES  SFSK+V EL++ V RM+F++YGV + YDSY  ST Y LR + Y+    ++
Sbjct  121   GNDHFRESVHSFSKVVVELDQMVKRMVFDAYGVGRLYDSYKASTTYQLRCINYKSQLTNE  180

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWI-SAQFPPSSFIVMAGEAIKGWSN  797
               ++    HTDK F ++L+Q N V GL+++ ++GEWI +A   PSSF+V+A +    WSN
Sbjct  181   TTDLGLIPHTDKNFTSILHQ-NDVGGLQIKTKDGEWIEAAPSSPSSFLVLASDLFMAWSN  239

Query  798   SRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIK  977
              R+ A  H+V +    K+ RYS+ +FS++ +   ++VPEE VD++HPL++KPF H D ++
Sbjct  240   DRISACEHQVVLKE--KKARYSLALFSYIGDG-VVQVPEEFVDEKHPLKYKPFGHFDYLR  296

Query  978   FFDSD-KGRRSKNLLKDFCG  1034
             F+++D + R+SKN +K +CG
Sbjct  297   FYETDEEARKSKNPIKAYCG  316



>ref|XP_009147658.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Brassica rapa]
Length=317

 Score =   275 bits (703),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 138/312 (44%), Positives = 207/312 (66%), Gaps = 4/312 (1%)
 Frame = +3

Query  99    PTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQQL  278
             P  L V+DF+N++LKPG   W     D++ AL+D+GCF    DKV  +L  SIF A ++L
Sbjct  9     PLHLPVIDFSNQNLKPGEPQWDLTKADVQKALQDYGCFEASFDKVPIELRKSIFKALEEL  68

Query  279   FDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHsfs  458
             FDLP + K+ N ++KP+HGYVGQ P +P +E+ GID +  ++ V++F+  +W  GN SFS
Sbjct  69    FDLPLQTKLRNVSKKPFHGYVGQYPMVPLYESMGIDDSDVVDKVEAFTEKLWPQGNTSFS  128

Query  459   essqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNVVF  638
              +  SFSK ++EL+  + RM+ ES+G+ K+ D +++ST YL R MKY  P +++E  +  
Sbjct  129   ATIHSFSKKLSELDITIRRMIMESFGLVKYIDEHLQSTNYLFRVMKYTGP-DTEETKLGL  187

Query  639   PCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRVLAPI  818
               HTDK  +T+LYQ N V GLEVQ ++  WI+ +    SFIVM G+++    N R+ +P 
Sbjct  188   NAHTDKNIVTILYQ-NHVEGLEVQTKDKNWINVKPSEDSFIVMIGDSLHALLNGRLHSPY  246

Query  819   HKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSDKG  998
             H+V M   G E RYS+G+FS  K    +  P+ELVD+EHP  FKPF H++ +KF+ ++ G
Sbjct  247   HRVMM--TGTETRYSLGLFSIPKAGHIVSSPDELVDEEHPRLFKPFDHVEFLKFYYTEAG  304

Query  999   RRSKNLLKDFCG  1034
             +RS++ LK +CG
Sbjct  305   QRSQSALKTYCG  316



>gb|KDP37164.1| hypothetical protein JCGZ_06220 [Jatropha curcas]
Length=308

 Score =   275 bits (702),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 146/316 (46%), Positives = 214/316 (68%), Gaps = 15/316 (5%)
 Frame = +3

Query  102   TKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQQLF  281
             +K+ V+D  +E+LKPGS++W  AC DIR A E++GC  VL + ++ + HN +  A Q+LF
Sbjct  2     SKIPVIDLCSENLKPGSSAWLSACNDIRKAFEEYGCMEVLYN-INIEFHNQVLSALQELF  60

Query  282   DLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHsfse  461
              LP E K+ N N KP HGY+G+I   P HE  GI+ AT  +  Q F+NLMW  GN +F E
Sbjct  61    QLPQEIKMKNVNPKPAHGYMGKISTFPIHEGLGIEFATIKDECQKFTNLMWPDGNDNFCE  120

Query  462   ssqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNVVFP  641
             +  S++K+VAEL+E ++RML ESYG++KH +S  +ST YLLR +KY       E N+ F 
Sbjct  121   TVHSYAKLVAELQELLVRMLCESYGIDKHSESRNKSTTYLLRLLKYR--RSQAETNLGFK  178

Query  642   CHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPP---SSFIVMAGEAIKGWSNSRVLA  812
              HTDK+F+++L+Q N V GLE++ ++GEWIS  + P   SSF V+AG+A   WSN R+ +
Sbjct  179   GHTDKSFISILHQ-NHVKGLEIRTKDGEWIS--YEPSSFSSFAVVAGDACMAWSNDRIKS  235

Query  813   PIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFF--D  986
               H+VT+   G+E RY++G+FSFL  +  I  PEELVD+EHPL +KPF H  ++ F+  +
Sbjct  236   CYHRVTV--GGEEVRYALGLFSFL--TGLINPPEELVDEEHPLAYKPFEHQGLLDFYVAN  291

Query  987   SDKGRRSKNLLKDFCG  1034
             + + +   N++K +CG
Sbjct  292   NAQNKGESNMVKTYCG  307



>ref|XP_009375961.1| PREDICTED: probable inactive 2-oxoglutarate-dependent dioxygenase 
AOP2 [Pyrus x bretschneideri]
Length=318

 Score =   275 bits (702),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 139/318 (44%), Positives = 209/318 (66%), Gaps = 6/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGSL  P KL  ++F+ + LKPGS+SW    K +R ALE++GCF+   D+VS QL N+IF
Sbjct  1     MGSLTLP-KLPTINFSIDALKPGSSSWLSTSKQVRYALEEYGCFVAQYDQVSAQLLNNIF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
               ++ LF++P E K+ N +++PY GY+G    +P +E   ID+ T+ +  Q F NLMW  
Sbjct  60    GQAKDLFEVPLENKVKNVSDEPYRGYIGPNHLMPLYEGIAIDNVTSPQETQKFKNLMWPD  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             G  +F E++ SF+++++ELE KV +MLFESYG EK Y+S   + ++LLR++KY  P E+D
Sbjct  120   GKSNFCETTDSFAQLLSELERKVEQMLFESYGAEKQYESVASANSHLLRFLKYNKPEEAD  179

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
                + F  HTDK F T++ Q + V GLEV+ ++G+WI+ +  PS F+ MAG+ ++ W N 
Sbjct  180   RATLRFASHTDKNFTTIVVQ-HDVGGLEVKTKDGDWINIESAPSQFLFMAGDGLQVWRND  238

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+ A  H+V     G + RYS+G+F+F  N+  I+VPEELVD+ HPL + P V L+ ++F
Sbjct  239   RIKACHHRVKH--CGDKTRYSLGLFTF--NNGIIQVPEELVDERHPLLYNPLVSLEYMRF  294

Query  981   FDSDKGRRSKNLLKDFCG  1034
                 + R   + LK FCG
Sbjct  295   HSRGEARNLVSPLKTFCG  312



>ref|XP_010110314.1| Gibberellin 3-beta-dioxygenase 4 [Morus notabilis]
 gb|EXC25834.1| Gibberellin 3-beta-dioxygenase 4 [Morus notabilis]
Length=312

 Score =   274 bits (701),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 131/306 (43%), Positives = 207/306 (68%), Gaps = 6/306 (2%)
 Frame = +3

Query  81   MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
            MGS     K+ V+DF  ++LKPG+  W  ACK++R   E++GCF  + DK+   LHNS+F
Sbjct  1    MGSQSAEHKIPVIDFTKKNLKPGTDEWVLACKEVRNGFEEYGCFEAVYDKIPVDLHNSVF  60

Query  261  HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
             A++ LFDLP E K+  T+E+PYH Y GQ   +P +E+ G+D+ TT++G + F+NLMW  
Sbjct  61   AAAESLFDLPLETKMQKTSERPYHSYYGQFSVVPLYESLGVDNPTTLQGSRKFTNLMWPA  120

Query  441  GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
            GN +F E++QS SK++ EL E   RM+F+SYGV++ + S +  T+YLLR+ KY    + +
Sbjct  121  GNENFRETTQSMSKLLVELYELATRMVFDSYGVQRLHGSNMALTSYLLRFFKYRT-RQPN  179

Query  621  ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
            E +V   CH D+TFM+++ Q +Q+ GL+V++++G+WI  +   SSF+++AG+ +  WSN 
Sbjct  180  ETDVGLQCHKDRTFMSIVNQ-HQIEGLQVKSKDGQWIDVKPSASSFLIIAGDIVGAWSND  238

Query  801  RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
            RV    H+V M  N  + RYS+G+F+F+     I+VPE+LVD+++PL++KP  H   ++F
Sbjct  239  RVRPCEHQVIMKEN--KTRYSIGLFAFING--VIDVPEDLVDEKYPLKYKPIDHFGWLRF  294

Query  981  FDSDKG  998
             +  K 
Sbjct  295  QEQRKA  300



>emb|CDP19783.1| unnamed protein product [Coffea canephora]
Length=311

 Score =   274 bits (700),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 136/310 (44%), Positives = 200/310 (65%), Gaps = 7/310 (2%)
 Frame = +3

Query  105   KLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQQLFD  284
             +L V++   E L+ G  SW  A   +  A E++GCFI + DK   ++ +SIF   Q LF+
Sbjct  8     RLPVINLTEEILRSGKDSWTEARNTVTRAFEEYGCFIAVHDKYPSEVSDSIFSELQDLFN  67

Query  285   LPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHsfses  464
             LP E K+ NT++ P  GY G  P++P +E+  I+ A  +E VQ F+N MW   N+ F E 
Sbjct  68    LPLEIKVQNTSQTPLFGYYGPNPYLPLYESTSIEDAINLEAVQKFTNQMWPSKNNHFCEL  127

Query  465   sqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNVVFPC  644
                ++   AEL++ V +++FESYGVEK+++S+V S  Y++R+ KY VP +++ N  V P 
Sbjct  128   LHCYANQAAELDKMVSKLVFESYGVEKYHESHVGSVTYIVRFTKYRVPEQNETNVGVLP-  186

Query  645   HTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRVLAPIHK  824
             HTDK F+T+L Q +   GLEVQ +NG WI   FPPSS ++MAG+A   WSN RV +P H+
Sbjct  187   HTDKNFITILQQ-SDADGLEVQLKNGSWIPVDFPPSSVVIMAGDAFSVWSNGRVHSPFHR  245

Query  825   VTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSDKGRR  1004
             VTM   G   RYS+  F++ K  K ++ P ELVDDEHPL +KPF +   ++F  +D+GR+
Sbjct  246   VTMKGKG---RYSIAQFAYCK--KLVKTPTELVDDEHPLLYKPFDNFGFLRFTSTDEGRK  300

Query  1005  SKNLLKDFCG  1034
             ++N LK +CG
Sbjct  301   AQNPLKAYCG  310



>ref|XP_010479801.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP3-like [Camelina 
sativa]
Length=310

 Score =   273 bits (699),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 145/313 (46%), Positives = 213/313 (68%), Gaps = 10/313 (3%)
 Frame = +3

Query  105   KLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIV-LCDKVSPQLHNSIFHASQQLF  281
             K+L +DF+ EDLKPG+  W    K+I  ALE +GCFI+ L +K    L + +F +   LF
Sbjct  4     KILTLDFSREDLKPGTKYWESTSKNITQALEKYGCFIIDLQNKTPLDLLDQVFGSLVDLF  63

Query  282   DLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHsfse  461
             DLP   K+ N  +KP  GYVGQIP +  HE+ GID+AT++E  +SF+ LMW  GN  FSE
Sbjct  64    DLPTHTKMKNKYDKPLSGYVGQIPTLHLHESLGIDNATSLEATRSFTGLMWPQGNEHFSE  123

Query  462   ssqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNVV-F  638
                 +++  A+L++ V++M+FESY VEK+Y+ Y+EST YLLR +K   P  ++EN  + F
Sbjct  124   CLHKYAEFAAKLDQMVIQMVFESYNVEKYYNPYMESTTYLLRMLKNCAP--NNENPTLGF  181

Query  639   PCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQF-PPSSFIVMAGEAIKGWSNSRVLAP  815
               HTDK+F T+L+Q +QV+GLE++ R GE I      PS F+V AG+A K WSN RV +P
Sbjct  182   VTHTDKSFTTILHQ-DQVNGLEMETREGERIKINLSSPSLFMVFAGDAFKAWSNDRVWSP  240

Query  816   IHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSDK  995
              H+V +  +G+  RYS+ +F+F  N+ T++VPEEL+D +HPL +KPF HL +++F+ +D 
Sbjct  241   RHQVLV--SGETDRYSLAMFAF--NNGTLQVPEELIDHQHPLLYKPFDHLGLLRFYRTDT  296

Query  996   GRRSKNLLKDFCG  1034
             G +S+  +K +CG
Sbjct  297   GFKSECPIKAYCG  309



>ref|XP_010462133.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP3-like [Camelina 
sativa]
Length=310

 Score =   273 bits (699),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 142/312 (46%), Positives = 211/312 (68%), Gaps = 8/312 (3%)
 Frame = +3

Query  105   KLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIV-LCDKVSPQLHNSIFHASQQLF  281
             K+  +DF+ EDLKPG+  W    K+I  ALE++GCFI+ L DK    L + +F +   LF
Sbjct  4     KIPTLDFSREDLKPGTKYWESTRKNITQALEEYGCFIIDLQDKTPLNLLDQVFGSLVDLF  63

Query  282   DLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHsfse  461
             DLP + K+ N   KP  GYVGQIP +P HE+ GID+AT++E  +SF+ LMW  GN  FS 
Sbjct  64    DLPTQTKMKNKYNKPLSGYVGQIPTLPLHESLGIDNATSLEATRSFTGLMWPQGNEHFSA  123

Query  462   ssqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNVVFP  641
                ++++  A+L++ V++++FESY VEK+Y+ Y+EST YLLR +K   P   +   + F 
Sbjct  124   CLHNYAEFAAKLDQIVIQIVFESYNVEKYYNPYMESTTYLLRMLKNCAPNIKNP-TLGFV  182

Query  642   CHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQF-PPSSFIVMAGEAIKGWSNSRVLAPI  818
              HTDK+F T+L+Q +QV+GLE++ R GE I      PS F+V AG+A + WSN RV +P 
Sbjct  183   THTDKSFTTILHQ-DQVNGLEMETREGERIIINLSSPSLFMVFAGDAFRAWSNDRVWSPR  241

Query  819   HKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSDKG  998
             H+V +  +G+  RYS+ +F+F  NS T++VPEEL+D +HPL +KPF HL +++F+ +D G
Sbjct  242   HQVLV--SGETDRYSLAMFAF--NSGTLQVPEELIDHQHPLMYKPFDHLGLLRFYRTDTG  297

Query  999   RRSKNLLKDFCG  1034
              +S+  +K +CG
Sbjct  298   YKSECPIKAYCG  309



>gb|KDP37370.1| hypothetical protein JCGZ_06824 [Jatropha curcas]
Length=315

 Score =   274 bits (700),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 138/320 (43%), Positives = 214/320 (67%), Gaps = 8/320 (3%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKP-GSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSI  257
             MGSL   +KL V+DF++E+L+  G++ W   CKD+  ALE++GCF+ + DKV  QLH  +
Sbjct  1     MGSLSN-SKLPVIDFSSENLEAAGTSGWVSKCKDVLKALEEYGCFVAVYDKVPLQLHADL  59

Query  258   FHASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWS  437
             F+  Q+LFDLP E K  N ++ P+ G++  +P   + E+  I    T+EG+Q F+  MW 
Sbjct  60    FNVLQELFDLPLETKRKNVSDVPFTGFIEHVPHRSFIESMAITRTETLEGIQDFTKTMWP  119

Query  438   GGNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAES  617
              GN++F +   S++K V EL + V++M+F+ YG+EK+Y+S++EST Y  R++ Y VP E+
Sbjct  120   NGNNNFCKIVHSYTKTVEELHKMVVKMIFDGYGMEKYYESHMESTTYFSRFLNYIVPQEN  179

Query  618   D-ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWS  794
             + E       H DK+F+T+L+Q N VSGL+++ +NGEW+      S F+V+AGE I GWS
Sbjct  180   ENETKQGLHPHMDKSFLTMLHQ-NDVSGLQIKPKNGEWLDVHLASSDFLVLAGEGIMGWS  238

Query  795   NSRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMI  974
             N R+    H+VT+ +  KEKR+SVG+FSF K    ++VP+E VDD+HPL +KPF H+ ++
Sbjct  239   NDRIDGCDHRVTIKS--KEKRFSVGLFSFDKG--IMQVPKEFVDDDHPLMYKPFDHIGLL  294

Query  975   KFFDSDKGRRSKNLLKDFCG  1034
              FF + +G +  + LK + G
Sbjct  295   HFFGTPEGYKQHHSLKAYTG  314



>ref|XP_009371496.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Pyrus x bretschneideri]
Length=317

 Score =   273 bits (699),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 137/320 (43%), Positives = 211/320 (66%), Gaps = 6/320 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             M S   P  + VVD ++E+LKPG+ +W  ACK ++ ALE++ CF  + +K + ++HNSIF
Sbjct  1     MISKTQPKVVPVVDLSDENLKPGTDAWLLACKQVQHALEEYSCFEAVYNKATLEIHNSIF  60

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              A + L DLP E K+   + +P+H Y GQ+P  P +E  GI    ++EG Q F+N+MW  
Sbjct  61    SAIKDLCDLPLETKMQKASNRPFHNYFGQLPLNPRYETLGIQDPASLEGAQRFTNIMWPA  120

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN  F ES  SFSK+V EL++ V RM+F++YGV + YDSY  ST Y LR + Y+    ++
Sbjct  121   GNDRFRESVHSFSKVVVELDQMVKRMVFDAYGVGRLYDSYKASTTYQLRCINYKSQLTNE  180

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWI-SAQFPPSSFIVMAGEAIKGWSN  797
               ++    HTDK F ++L+Q N V GL+++ ++GEWI +A   PSSF+V+A +    WSN
Sbjct  181   TTDLGLIAHTDKNFTSILHQ-NDVGGLQIKTKDGEWIEAAPSSPSSFLVLASDLFMAWSN  239

Query  798   SRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIK  977
              R+ A  H+V +    K+ RYS+ +FS++ +   ++VPEE VD +HPL++KPF H D ++
Sbjct  240   DRISACEHQVVLKE--KKARYSLALFSYIGDG-VVQVPEEFVDGKHPLKYKPFGHFDYLR  296

Query  978   FFDSD-KGRRSKNLLKDFCG  1034
             F+++D + R+SKN +K +CG
Sbjct  297   FYETDEEARKSKNPIKAYCG  316



>ref|XP_009621185.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Nicotiana tomentosiformis]
Length=321

 Score =   273 bits (699),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 141/316 (45%), Positives = 208/316 (66%), Gaps = 7/316 (2%)
 Frame = +3

Query  93    ETPTKLLVVDFNN-EDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHAS  269
             +T  K  ++D N  E  K GS SW   C  +R ALEDHG FI L DKVS ++   IF   
Sbjct  3     QTLCKAPIIDLNKLEKSKRGSNSWLELCNGVRLALEDHGYFIALYDKVSSEVEKEIFDVM  62

Query  270   QQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNH  449
              +LFDLP E K  N+++  ++ +VGQ+   P HE+FGI + T I+ +QSF+ LMW  GN 
Sbjct  63    DELFDLPIETKKKNSSDFYFYRWVGQLEAAPLHESFGIVYPTHIQALQSFTTLMWPQGNQ  122

Query  450   sfsessqsfsKIVAELEEKVLRMLFESYGV-EKHYDSYVESTAYLLRYMKYEVPAESDEN  626
              FSE+  S+ K+ AELE+ V +M+FESYGV E+HY+S++ +T YLLR  KY  P  S+ N
Sbjct  123   RFSETVTSYVKVAAELEQLVDKMVFESYGVAERHYESHIAATTYLLRPTKYAAPPPSNIN  182

Query  627   NVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRV  806
             NV    HTDK+F T+L+Q NQ++GL+V++++G+WI+   PPS+F+ MAG+A + WSN R+
Sbjct  183   NVGANIHTDKSFSTLLFQ-NQINGLQVESKSGDWIAVNVPPSAFVFMAGDAYEAWSNGRI  241

Query  807   LAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFD  986
              AP H+V +    +++RY++ +F+F  N    ++PEELVD+ HPLQ+KPF +  +  ++ 
Sbjct  242   YAPRHQVLLKE--EKQRYTLALFTF--NKGITDIPEELVDETHPLQYKPFDNFGLAWYYL  297

Query  987   SDKGRRSKNLLKDFCG  1034
             S       +  K +CG
Sbjct  298   SGANSMIHSTAKAYCG  313



>ref|XP_004306704.1| PREDICTED: gibberellin 3-beta-dioxygenase 3-like [Fragaria vesca 
subsp. vesca]
Length=316

 Score =   273 bits (699),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 140/319 (44%), Positives = 212/319 (66%), Gaps = 7/319 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS+  P +L  ++F+ +DLKPGS+SWA  CK +R ALE++GCF+ L ++VSPQL N+IF
Sbjct  1     MGSMTLPKELPTINFSLQDLKPGSSSWASTCKQVRYALEEYGCFVALYEQVSPQLMNNIF  60

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
               S+ LF +P E K+ NT+E+PY GY+G  P +P +E   ID+ T+ +  Q F +LMW  
Sbjct  61    GQSKDLFQVPLENKVKNTSEEPYRGYIGPNPLMPLYEGLAIDNVTSPQETQKFRDLMWPN  120

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGV-EKHYDSYVESTAYLLRYMKYEVPAES  617
             G   F E +  F+K++ +LE+ V +MLFES+GV +  Y+S   S ++LLR++KY  P E 
Sbjct  121   GKTKFCEITDLFAKLLGDLEKTVEKMLFESFGVSQDQYESLSSSNSHLLRFLKYNTPEER  180

Query  618   DENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSN  797
             D   + FP HTDK F T++ Q + V GLEVQ ++G+WIS +  PS F+ MAG+ ++ WSN
Sbjct  181   DA-VIRFPSHTDKNFTTIVVQ-HDVGGLEVQTKDGDWISVESAPSQFLFMAGDGLQVWSN  238

Query  798   SRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIK  977
              RV A  H+V     G + RYS+G+F+F  N+   EVP+EL+D+ HPL +  F     I+
Sbjct  239   DRVQACHHRVKH--CGDKTRYSLGMFTF--NNGAFEVPKELIDESHPLVYNKFDSRGFIR  294

Query  978   FFDSDKGRRSKNLLKDFCG  1034
             F+ + + +++++  K +CG
Sbjct  295   FYTTPEAKKAESPTKAYCG  313



>ref|XP_011072273.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Sesamum indicum]
Length=315

 Score =   273 bits (698),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 145/319 (45%), Positives = 206/319 (65%), Gaps = 6/319 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS E+  KL V+DF+N      + +W      +R ALE++GCF  + D++ P L  S  
Sbjct  1     MGS-ESCMKLPVIDFSNLKQDSRTPTWESTKTQVRAALEEYGCFEAVFDQIPPTLRQSTI  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMW-S  437
                +QLFDLP + K+ N + KPYHGYVGQ P +P +E+ GI+ A +   V SFSNLMW  
Sbjct  60    DGIKQLFDLPLQTKLRNRSNKPYHGYVGQYPIVPLYESLGIEDALSPAKVDSFSNLMWPE  119

Query  438   GGNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAES  617
              GN +FS+S    S+  +EL++ V RM+ ES G+EK+ + ++EST YL+R  KY+ P +S
Sbjct  120   DGNPTFSKSIACLSEQFSELDKVVRRMVVESLGLEKYMNEHMESTDYLVRVQKYDGP-QS  178

Query  618   DENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSN  797
              E+ +    HTDK  +T+L+Q N+V GLEV  ++G+WI+A    +SFIVM GE+   W+N
Sbjct  179   AESKIGLTSHTDKNIVTILHQ-NEVKGLEVLTKDGQWIAADPSHNSFIVMIGESFYAWTN  237

Query  798   SRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIK  977
              R+  P H+V M   G E RYS+G+FS  K    I+ PEELVDDEHPL FKPF H++ + 
Sbjct  238   GRLHPPYHRVMM--RGDEARYSIGLFSVPKAGYIIKAPEELVDDEHPLLFKPFDHVEFLD  295

Query  978   FFDSDKGRRSKNLLKDFCG  1034
             F+ ++ G+RS   LK +CG
Sbjct  296   FYYTEAGQRSPAALKAYCG  314



>ref|XP_006356178.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1.2-like 
[Solanum tuberosum]
Length=313

 Score =   272 bits (695),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 138/311 (44%), Positives = 206/311 (66%), Gaps = 4/311 (1%)
 Frame = +3

Query  102   TKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQQLF  281
             TKL ++DF++EDLKP +  W      +  AL ++GCF    DK+   L  SIF + Q+LF
Sbjct  6     TKLPIIDFSHEDLKPDTLVWNQVKSQVHKALVEYGCFEASFDKIPIHLRKSIFESLQELF  65

Query  282   DLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHsfse  461
             DLP + K+ N ++KP+HGYVGQ P +P +E+ GID A      + F+ ++W  GN +F E
Sbjct  66    DLPLQTKLKNISKKPFHGYVGQYPQVPLYESMGIDDANIPHKTEKFTQILWPQGNPTFCE  125

Query  462   ssqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNVVFP  641
             + QS+S+ ++EL++ V +M+ ES GVEK+ D ++ ST YLLR MKY+ P +S E  +   
Sbjct  126   TIQSYSEHLSELDQTVRKMILESLGVEKYMDEHMNSTNYLLRVMKYKGP-QSSETKLGLN  184

Query  642   CHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRVLAPIH  821
              HTDK  +T+LYQ N+VSGLEV  ++G WI+    P +F VM G+++  W+N ++ +P H
Sbjct  185   AHTDKNIVTILYQ-NEVSGLEVLTKDGHWINVDPTPDTFTVMIGDSLYAWANGQLHSPNH  243

Query  822   KVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSDKGR  1001
             +V M   G E RYSVG+FS  K   TI+ P+ELVD+EH L FKPF H++ + F+ +++G+
Sbjct  244   RVMM--RGNEARYSVGLFSIPKAGYTIKAPKELVDEEHSLLFKPFDHVEFLDFYYTEEGQ  301

Query  1002  RSKNLLKDFCG  1034
             R  + LK +CG
Sbjct  302   RCASALKTYCG  312



>ref|XP_007135717.1| hypothetical protein PHAVU_010G152300g [Phaseolus vulgaris]
 gb|ESW07711.1| hypothetical protein PHAVU_010G152300g [Phaseolus vulgaris]
Length=314

 Score =   272 bits (695),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 142/318 (45%), Positives = 208/318 (65%), Gaps = 5/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS +TP KL V++F +  L+    +W      +  AL + GCF  + D+V  +L  +I 
Sbjct  1     MGSEDTP-KLPVINFTDLKLEAKDPNWEAVKSQVHRALVEFGCFEAVFDRVPLELRKAIL  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              + Q+LFDLP + K+LN ++K +HGYVGQ P +P  E+ GID A   E V+S +N MW  
Sbjct  60    GSLQELFDLPLQTKLLNVSKKLFHGYVGQYPMVPLFESMGIDDAVVYEEVESLTNTMWPN  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN +FS++ QSFS+ +AEL++ + +M+ ES GVEK+ + ++ ST YLLR MKY+ P  SD
Sbjct  120   GNPNFSKTIQSFSEELAELDQIIRKMVLESLGVEKYLEEHMNSTNYLLRVMKYQGPQTSD  179

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
                +    HTDK  +T+LYQ N+V GLEV  ++G WIS +  P SF+VM G++   W+N 
Sbjct  180   -TKLGLSAHTDKNIVTILYQ-NEVEGLEVLTKDGTWISYKPSPHSFVVMIGDSFNAWANG  237

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+ +P H+V M  +G E RYS G+FS  K    I+ PEELVD+EHPL FKPF H++ +K+
Sbjct  238   RLHSPFHRVMM--SGNETRYSAGLFSIPKGGSIIKAPEELVDEEHPLLFKPFDHMEFLKY  295

Query  981   FDSDKGRRSKNLLKDFCG  1034
             + ++KG+R +  L  +CG
Sbjct  296   YYTEKGQRDQFALLTYCG  313



>ref|XP_007024010.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein, putative [Theobroma cacao]
 gb|EOY26632.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein, putative [Theobroma cacao]
Length=319

 Score =   272 bits (695),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 141/317 (44%), Positives = 203/317 (64%), Gaps = 5/317 (2%)
 Frame = +3

Query  87    SLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHA  266
             S ETP  L ++DF+N+DLK G+  W      +R AL++ GCF  L D+V P+L  ++F A
Sbjct  6     SCETPLGLPIIDFSNKDLKQGTPEWDSVKIQVRKALQEFGCFEALVDEVPPELREAVFGA  65

Query  267   SQQLFDLPFEKKILNTNEKPYHGYVGQIP-FIPYHEAFGIDHATTIEGVQSFSNLMWSGG  443
              ++LFDLP E K+LN +EKPYHGY+G  P   P +E+FGI+    IE V+  SN++W  G
Sbjct  66    LKELFDLPLETKMLNVSEKPYHGYLGVHPERSPLYESFGIEDP-NIENVEGLSNILWPEG  124

Query  444   NHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDE  623
             N +FS+     ++ V  LE  V RM+ ES  +EK+ + +++S  YLLR MKY+ P E+ E
Sbjct  125   NLAFSKPIHYLAEQVLGLERMVRRMILESLSLEKYMEEHMDSNYYLLRLMKYKGP-ETTE  183

Query  624   NNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSR  803
               +    HTDK  MT+LYQ N V  L+V+A++GEWI  +  P SFIVM G+ +K W N  
Sbjct  184   AKLGLYGHTDKNIMTILYQNNDVHALQVRAKDGEWIHVKPSPRSFIVMIGDPLKAWLNGH  243

Query  804   VLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFF  983
             + +P H+V M  N  E R+S G+FS  K   TI+ PEELVD++HPL FKPF + + + F 
Sbjct  244   MHSPFHRVMMKGN--ETRFSTGLFSIPKAGYTIKAPEELVDEQHPLLFKPFTYDEFLGFL  301

Query  984   DSDKGRRSKNLLKDFCG  1034
              ++ G+ ++  L D+CG
Sbjct  302   YTEAGQTAECALTDYCG  318



>ref|XP_006392865.1| hypothetical protein EUTSA_v10011667mg [Eutrema salsugineum]
 gb|ESQ30151.1| hypothetical protein EUTSA_v10011667mg [Eutrema salsugineum]
Length=317

 Score =   271 bits (693),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 134/312 (43%), Positives = 205/312 (66%), Gaps = 4/312 (1%)
 Frame = +3

Query  99    PTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQQL  278
             P  L V++F+N++LKPG   W      ++ AL+D+GCF    D++  +L  SIF A ++L
Sbjct  9     PLNLPVINFSNKNLKPGEPEWDLTRAHVKKALQDYGCFEASFDRIPSELRKSIFGAMEEL  68

Query  279   FDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHsfs  458
             FDLP + K+ N ++KP+HGYVGQ P +P +E+ GID +     V +F+  +W  GN+S S
Sbjct  69    FDLPLQTKLRNVSKKPFHGYVGQYPMVPLYESMGIDDSDVAAKVDAFTEKLWPQGNNSLS  128

Query  459   essqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNVVF  638
              + QSFSK ++EL+  + RM+ ES+G+ K+ D +++ST YLLR MKY+ P +++E  +  
Sbjct  129   TTIQSFSKKLSELDVTIRRMIMESFGLVKYMDEHLQSTNYLLRVMKYKGP-DTEETELGL  187

Query  639   PCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRVLAPI  818
               HTDK  +T+LYQ N V GLEVQ ++  WI  +    SFIVM G+++    N R+ +P 
Sbjct  188   NAHTDKNIVTILYQ-NHVEGLEVQTKDNNWIKVKPSQDSFIVMIGDSLHALLNGRLYSPN  246

Query  819   HKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSDKG  998
             H+V M   G E RYS+G+FS  K    +  P+ELVD+EHP  FKPF H++ ++F+ ++ G
Sbjct  247   HRVMM--TGTETRYSLGLFSIPKAGYIVNAPDELVDEEHPRMFKPFDHVEFLQFYYTEAG  304

Query  999   RRSKNLLKDFCG  1034
             +RS++ LK +CG
Sbjct  305   QRSQSALKTYCG  316



>ref|XP_004152262.1| PREDICTED: gibberellin 20 oxidase 1-B-like [Cucumis sativus]
 ref|XP_004156846.1| PREDICTED: gibberellin 20 oxidase 1-B-like [Cucumis sativus]
Length=314

 Score =   271 bits (693),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 133/314 (42%), Positives = 208/314 (66%), Gaps = 5/314 (2%)
 Frame = +3

Query  93    ETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQ  272
             E+  KL ++DF+N  L+ G   W  A   ++ ALE+ GCF    DKV  ++   +F A +
Sbjct  4     ESSLKLPLIDFSN--LESGGPKWELAKAQVKEALEEFGCFEASFDKVPVEVRKGLFEALE  61

Query  273   QLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHs  452
             +LF+LP E K+ N ++KP+HGYVGQ P  P  E+ G+D +T  + VQ F+N++W  GN +
Sbjct  62    ELFNLPLETKLRNVSQKPFHGYVGQYPMAPLFESMGVDDSTIPQKVQDFTNILWPQGNPT  121

Query  453   fsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNV  632
             FS+  +++S+ +AEL+E V RM+ ES GVEK+ + ++EST YLLR MKY+    + E  +
Sbjct  122   FSKVMETYSQQLAELDEMVRRMVLESLGVEKYLEEHLESTNYLLRVMKYKGTESNYETKI  181

Query  633   VFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRVLA  812
                 HTDK  +T+LYQ N V GL+V+ ++G+WI+ Q  P SF+ M G++   W+N R+ +
Sbjct  182   GLHSHTDKNIVTILYQ-NHVQGLQVKTKDGKWINFQPSPDSFVAMIGDSFHAWTNGRLHS  240

Query  813   PIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSD  992
             P H+V M  +G+E RYS G+FS  K    ++ PEELVD++HPL F PF H+  ++F+ ++
Sbjct  241   PYHRVMM--SGEEVRYSAGLFSIPKAGYIVKAPEELVDEQHPLLFNPFDHVQFLQFYYTE  298

Query  993   KGRRSKNLLKDFCG  1034
              G+++++ LK +CG
Sbjct  299   AGQKAQSALKTYCG  312



>ref|XP_010110321.1| Gibberellin 20 oxidase 1 [Morus notabilis]
 gb|EXC25841.1| Gibberellin 20 oxidase 1 [Morus notabilis]
Length=313

 Score =   271 bits (693),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 142/319 (45%), Positives = 214/319 (67%), Gaps = 8/319 (3%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS +T  K+ V+DF +++LKPGS SW  ACK IR  LE++GCF  + DKV  +LH SIF
Sbjct  1     MGS-QTDHKIPVIDFTDKNLKPGSDSWVSACKLIRYGLEEYGCFEAVYDKVPTELHTSIF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              A+++LFDLP E K   T+++P   YVGQ PF+P +E+ G+D+ T+ E  +SF+  MW  
Sbjct  60    SAAKELFDLPIETKEQKTSDRPGANYVGQDPFVPLYESLGLDNPTSFEAAESFTKFMWPA  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN +F E  +SFSK  AEL    +R++F+SYG+ + Y S++ES  Y LR+ KY VP + +
Sbjct  120   GNDTFREIVRSFSKPAAELYGTAIRIVFDSYGLGRLYGSHIESAFYRLRFFKYSVP-KPN  178

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
             E+NV  P HTDKTF+T+L+Q +QV GL+++ ++ ++I  +  PSSF+ +AGE +  WSN 
Sbjct  179   ESNVGLPNHTDKTFVTILHQ-HQVEGLQIRTKDDQYIDVKAKPSSFLCIAGEGLMAWSND  237

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLD-MIK  977
             R+    H+V +  N  + RYS+G ++ +     I VPEE++D+E+PL +KP  +LD ++ 
Sbjct  238   RIRPCEHRVIIKEN--KGRYSLGFYTLVNG--VIHVPEEMIDEEYPLAYKPIDYLDFLLH  293

Query  978   FFDSDKGRRSKNLLKDFCG  1034
             FF +D  R +   +K F G
Sbjct  294   FFTNDIVRYAACPIKAFAG  312



>ref|XP_003521152.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1-like 
[Glycine max]
 gb|KHN30391.1| Gibberellin 20 oxidase 2 [Glycine soja]
Length=322

 Score =   271 bits (693),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 142/321 (44%), Positives = 212/321 (66%), Gaps = 7/321 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLK-PGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSI  257
             MGS     +L VVDF +E+ K PG+ +W  AC  +RTALED+G F+   DKV  +L +S+
Sbjct  1     MGSQTQSQELHVVDFTDENTKKPGTDAWLSACSVVRTALEDNGFFMARYDKVGKELCDSV  60

Query  258   FHASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWS  437
               A ++LFDLP E K   T+EK +HGY+GQ+ ++P +E+ GID   T+ G Q F ++MW 
Sbjct  61    VSAVEELFDLPVETKAQKTSEKLFHGYLGQVSWLPLYESVGIDDPLTLLGCQKFGHIMWP  120

Query  438   GGNHsfsessqsfsKIVAELEEKVLRMLFESYGVE-KHYDSYVESTAYLLRYMKYEVPAE  614
              GNH F ES   +SK++ EL+    RM+FESYGV+ +  DS++ES  YLLR M Y  P +
Sbjct  121   EGNHRFCESINEYSKLLGELDHMAKRMVFESYGVDMQRCDSFIESNDYLLRCMMYRTP-Q  179

Query  615   SDENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWS  794
             + E ++    H+D T  ++++QLN ++GLE++ ++GEW      PSSF+VMAG+A   WS
Sbjct  180   TGEIDLGLQPHSDLTITSIVHQLNNLNGLEIKLKDGEWKGIDASPSSFVVMAGDAFNVWS  239

Query  795   NSRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKP-FVHLDM  971
             N R+    H+VTM  N K+ RYS+G+FSF  N K + +PEELV+ +HPL++KP F H + 
Sbjct  240   NGRIRPCEHRVTM--NAKKTRYSMGLFSFGGN-KVMRIPEELVNKQHPLRYKPLFDHYEY  296

Query  972   IKFFDSDKGRRSKNLLKDFCG  1034
             ++F+D +K +   + ++  CG
Sbjct  297   LRFYDKEKIKEPYSRIQAHCG  317



>ref|XP_010061956.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Eucalyptus grandis]
 gb|KCW69002.1| hypothetical protein EUGRSUZ_F02562 [Eucalyptus grandis]
Length=313

 Score =   271 bits (692),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 137/312 (44%), Positives = 203/312 (65%), Gaps = 6/312 (2%)
 Frame = +3

Query  102   TKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQQLF  281
             +++ V+ F+ E  KPG++SW  ACK I  ALEDHGCFIV    V   LH+S F  ++ L 
Sbjct  3     SQIPVITFSEECTKPGTSSWEKACKVIVQALEDHGCFIVEHPNVPLGLHDSAFSVTEDLL  62

Query  282   DLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHsfse  461
             DLP E KI NTN KP HGY+ ++P  P  E   ID    +E  + F++LMW  GN  F +
Sbjct  63    DLPHETKIKNTNLKPSHGYIAKVPGTPLLEGMNIDGVEKLEECEKFTSLMWPSGNDHFCK  122

Query  462   ssqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNVVFP  641
             +   + K++ E+E+ V RM+ ESYGVEK YD Y++S  YLLR++KY+ PA+ D  +V   
Sbjct  123   TVHDYGKLMVEIEKVVFRMVCESYGVEKCYDPYIKSCTYLLRFLKYKKPADLD-TSVNPV  181

Query  642   CHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRVLAPIH  821
              HTDK+F++ L+Q N + GLEV+ ++GEW + +   S+F+VMAG+A   WSN R+ A  H
Sbjct  182   AHTDKSFLSYLHQ-NNIRGLEVRTKDGEWFAFEPSASTFMVMAGDACVAWSNGRIKACYH  240

Query  822   KVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSDKGR  1001
             +V +     + RY +G FS++     IE P+E +D+ HP Q+KPF H+D ++++DS  G 
Sbjct  241   RVLVREQN-QVRYCLGTFSYVPG--MIETPKEFIDEAHPQQYKPFNHIDFLRYYDSSNGP  297

Query  1002  -RSKNLLKDFCG  1034
              ++++L+K FCG
Sbjct  298   IKAESLIKTFCG  309



>ref|XP_010033902.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Eucalyptus grandis]
 gb|KCW53768.1| hypothetical protein EUGRSUZ_J03021 [Eucalyptus grandis]
Length=314

 Score =   270 bits (691),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 141/318 (44%), Positives = 207/318 (65%), Gaps = 5/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS+     L V+DF++  LKPG+  W     +++ ALE  GCF     KV   L  S+ 
Sbjct  1     MGSM-AELMLPVIDFSSLRLKPGTAEWTAVRDEVKQALETCGCFEARFKKVPVDLQESML  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              + Q+LFDLP + K+ N + KPYHGYVGQ P +P +E+ GID A   E V   + ++W  
Sbjct  60    GSVQELFDLPLQTKLRNVSRKPYHGYVGQYPMVPLYESMGIDDADVYEKVDGLTTILWPE  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             G+ +FS++ QSFS+ ++EL++ + RM+ ES GVEK+ D ++ ST YLLR M+Y  P  +D
Sbjct  120   GHPNFSKNIQSFSEKLSELDKMIRRMILESLGVEKYLDEHMNSTNYLLRVMRYAGPQTTD  179

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
                +    HTDK  +T+L Q N+V GLEVQ ++GEW SAQ  P+SFIVM G+++  W N 
Sbjct  180   -TKLGLNSHTDKNIVTILCQ-NEVDGLEVQTKDGEWFSAQPSPNSFIVMIGDSLYAWVNG  237

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+ +P H+V M  +G + RYSVG+FS  K    I+ P+ELVD+E PL FKPF H++ + F
Sbjct  238   RLHSPHHRVMM--SGNKARYSVGLFSIPKGGYMIKAPDELVDEERPLLFKPFDHVEFLGF  295

Query  981   FDSDKGRRSKNLLKDFCG  1034
             + ++ G+R+++ LK +CG
Sbjct  296   YYTEAGQRAESALKTYCG  313



>ref|XP_008366303.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP2-like [Malus 
domestica]
Length=317

 Score =   270 bits (690),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 136/320 (43%), Positives = 211/320 (66%), Gaps = 6/320 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             M S   P  + VVD ++E+LKPG+ +W  ACK ++ ALE++ CF  + +K + ++HNSIF
Sbjct  1     MVSKTQPKVVPVVDLSDENLKPGTDAWLLACKQVQHALEEYSCFEAVYNKXTLEIHNSIF  60

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              A ++L DLP E K+   +++P+H Y GQ+P  P +E  GI    ++EG Q F+++MW  
Sbjct  61    SAIKELCDLPLETKMQKASDRPFHHYFGQLPLNPRYETLGIQDPASLEGAQRFTSIMWPA  120

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN  F ES  SFSK+V EL++ V RM+F++YGV + YDSY  ST Y LR + Y+    ++
Sbjct  121   GNDRFXESVHSFSKVVVELDQMVKRMVFDAYGVGRLYDSYKASTTYQLRCINYKSXLTNE  180

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWI-SAQFPPSSFIVMAGEAIKGWSN  797
               +     HTDK F ++L+Q N V GL+++ ++GEWI +A   PSSF+V+A +    WSN
Sbjct  181   TTDXGLIPHTDKNFTSILHQ-NDVGGLQIKTKDGEWIEAAPSSPSSFLVLASDLFMAWSN  239

Query  798   SRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIK  977
              R+ A  H+V +    K+ RYS+ +FS++ +   ++VPEE VDD HPL++KPF H D ++
Sbjct  240   DRISACEHQVXL--KEKKARYSLALFSYIGDG-VVQVPEEFVDDXHPLKYKPFGHFDYLR  296

Query  978   FFDSD-KGRRSKNLLKDFCG  1034
             F+++D + R+ KN +K +CG
Sbjct  297   FYETDEEARKXKNPIKAYCG  316



>ref|XP_010545794.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
isoform X1 [Tarenaya hassleriana]
Length=330

 Score =   270 bits (690),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 145/330 (44%), Positives = 217/330 (66%), Gaps = 30/330 (9%)
 Frame = +3

Query  114   VVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIV-LCDKVSPQLHNSIFHASQQLFDLP  290
              +DF+ EDLKPG++ W    K+IR ALE +GCFIV L +K    L   +F + +QLFDLP
Sbjct  7     TLDFSREDLKPGTSYWETTSKNIRQALEQYGCFIVDLHEKAPFDLLARVFDSLKQLFDLP  66

Query  291   FEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHsf-----  455
                K+ N  +KP +GYVGQIP +P HE+ GID+AT+++  +SF++LMW  GN  F     
Sbjct  67    TPTKMKNKYDKPMNGYVGQIPALPLHESLGIDNATSLQSTRSFTDLMWPRGNDRFWYVLI  126

Query  456   ---------------sessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRY  590
                            S+    +++ VAE++  V RM+F SYGV K+Y+ Y++ST+YLLR 
Sbjct  127   IRILRYFPEYNVSFCSDCMHRYAEFVAEMDRMVARMIFGSYGVAKYYEPYMKSTSYLLRL  186

Query  591   MKYEVPAESDEN-NVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFP-PSSFIV  764
             +K   P   DEN  + F  HTDK+F T+L+Q +Q++GLE++ R GE I+     PS F+V
Sbjct  187   LKNRAP--KDENPYLAFVTHTDKSFTTILHQ-DQINGLEMETRLGERINVDLSSPSLFMV  243

Query  765   MAGEAIKGWSNSRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQ  944
             +AG+A+  WSN R+L+P H+V +  +G+  RYS+G F+F  ++ T++VPEELVD+EHPL 
Sbjct  244   IAGDALMAWSNDRILSPRHRVLV--SGETDRYSLGQFAF--SNGTLQVPEELVDNEHPLM  299

Query  945   FKPFVHLDMIKFFDSDKGRRSKNLLKDFCG  1034
             +KPF H+ ++ F+ +D G R++  +K +CG
Sbjct  300   YKPFDHIGLLHFYRTDIGYRAECPIKAYCG  329



>ref|XP_006305391.1| hypothetical protein CARUB_v10009783mg [Capsella rubella]
 gb|EOA38289.1| hypothetical protein CARUB_v10009783mg [Capsella rubella]
Length=317

 Score =   270 bits (689),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 134/312 (43%), Positives = 206/312 (66%), Gaps = 4/312 (1%)
 Frame = +3

Query  99    PTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQQL  278
             P +L V+DF+N++LKPG   W     D++ AL+D+GCF    D +  +L  S+F A ++L
Sbjct  9     PLRLPVIDFSNKNLKPGEPEWDLTRADVKKALQDYGCFEAAFDGIPVELRKSVFGALEEL  68

Query  279   FDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHsfs  458
             FDLP + K+ N ++KP+HGYVGQ P +P +E+ GI+ A   E V  F+  +W  GN+SFS
Sbjct  69    FDLPLQTKLRNVSKKPFHGYVGQYPMVPLYESMGIEDADVAEKVDDFTGKLWPQGNNSFS  128

Query  459   essqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNVVF  638
              +  SFS+ ++EL+  + RM+ ES+ ++K+ D ++ ST YL+R MKY+ P ++++  +  
Sbjct  129   TTIHSFSEKLSELDITIRRMIMESFRLDKYIDEHLHSTNYLMRVMKYKEP-DTEDTKLGL  187

Query  639   PCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRVLAPI  818
               HTDK  +T+LYQ N V GLEVQ ++  WI  +    SFIVM G+++ G  N R+ +P 
Sbjct  188   NAHTDKNIVTILYQ-NHVEGLEVQTKDNNWIKVKPSQDSFIVMIGDSLYGMLNGRLHSPY  246

Query  819   HKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSDKG  998
             H+V M   G E RYS+G+FS  K    I  P+ELVD+EHP  FKPF H++ ++F+ ++ G
Sbjct  247   HRVMM--TGTETRYSLGLFSIPKAGHIISSPDELVDEEHPRLFKPFDHVEFLQFYYTEAG  304

Query  999   RRSKNLLKDFCG  1034
             +RS++ LK +CG
Sbjct  305   QRSQSALKTYCG  316



>emb|CDO98088.1| unnamed protein product [Coffea canephora]
Length=315

 Score =   269 bits (688),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 141/321 (44%), Positives = 217/321 (68%), Gaps = 10/321 (3%)
 Frame = +3

Query  81    MGS-LETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSI  257
             MGS  +  +KL +++FN E+L PG+TSW      +R ALE  GCF+V   K+S +LH+ +
Sbjct  1     MGSESDAQSKLPIIEFNEENLTPGTTSWLSTSDLVRQALESCGCFLVKYKKLSQELHDKM  60

Query  258   FHASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWS  437
             F  S+QLF LP E K+ NT+     GY     F+P  E FGI++  T++  + F+NLMW 
Sbjct  61    FELSKQLFQLPTEIKVQNTSNILGFGYGTNFSFMPLVEYFGIENGATLKATEEFTNLMWP  120

Query  438   GGNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAES  617
              GN SF E++ S+SK+++EL+  V+RM+F SYGVEK+ D  ++S+ YL+R++KY  P ++
Sbjct  121   AGNSSFCETAFSYSKLLSELDHGVMRMVFGSYGVEKYLDPLIKSSFYLMRFLKYRAP-KT  179

Query  618   DENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQ--FPPSSFIVMAGEAIKGW  791
             DE N+    H DK F+ +L   NQV+GLE+Q ++GEWI+ +    PS+F+V+AGE  + W
Sbjct  180   DEINIGLHPHVDKGFLAIL-DTNQVTGLEIQLKHGEWITYEPSTSPSTFLVIAGEPFQAW  238

Query  792   SNSRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDM  971
             SN RV AP+HKV +   G E++Y++G+FSF++  + +++PEEL+D+++PLQFK F HLD 
Sbjct  239   SNGRVHAPLHKVVI--RGTEEKYTIGLFSFMR--EKVKIPEELIDEKNPLQFKDFNHLDF  294

Query  972   IKFFDSDKGRRSKNLLKDFCG  1034
             ++F    K    + ++  FCG
Sbjct  295   LEFLRGGKYTMERPIVA-FCG  314



>ref|XP_009375959.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP3-like [Pyrus 
x bretschneideri]
Length=318

 Score =   269 bits (688),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 139/318 (44%), Positives = 206/318 (65%), Gaps = 6/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGSL  P KL  ++F+ + LKPGS+SW    K +R ALE++GCF+   D+VS QL N+IF
Sbjct  1     MGSLTLP-KLPTINFSVDALKPGSSSWLSTSKQVRYALEEYGCFVAQYDQVSAQLLNNIF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
               ++ LF++P E K+ N +++PY GY+G    +P +E   ID  T+ +  Q F NLMW  
Sbjct  60    GQAKDLFEVPLENKVKNVSDEPYRGYIGPNHLMPLYEGIAIDKVTSPQETQKFKNLMWPD  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             G  +F E++ SF+++++ELE KV +MLFESYG EK Y+S   + ++LLR++KY  P E+D
Sbjct  120   GKSNFCETTDSFAQLLSELEHKVEQMLFESYGAEKQYESVASANSHLLRFLKYNKPEEAD  179

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
                + F  HTDK F T++ Q + V GLEV+ + G WI+ +  PS F+ MAG+ ++ WSN 
Sbjct  180   RAALRFASHTDKNFTTIVVQ-HDVGGLEVKTKYGNWINIESVPSQFLFMAGDGLQVWSND  238

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+ A  H+V     G + RYS+G+F+F  N+  I+VPEELVD+ HPL + P   L+ I+F
Sbjct  239   RIKACDHRVKH--CGDKTRYSLGLFTF--NNGKIQVPEELVDETHPLLYNPLDSLEYIRF  294

Query  981   FDSDKGRRSKNLLKDFCG  1034
                 + R   + +K FCG
Sbjct  295   HSRGEARNLVSPVKTFCG  312



>ref|XP_010033901.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Eucalyptus grandis]
 gb|KCW53767.1| hypothetical protein EUGRSUZ_J03020 [Eucalyptus grandis]
Length=314

 Score =   269 bits (687),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 136/318 (43%), Positives = 205/318 (64%), Gaps = 5/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS+    KL V+DF++  L+PG+  W     +++ ALE +GCF    +KV  +L  S+ 
Sbjct  1     MGSM-AELKLPVIDFSSPRLEPGTAEWTAVRDEVKQALETYGCFEAWFEKVPVELQKSML  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              + Q+LFDLP + K+ N + KPYHGYVGQ P +P +E+ GID A   E V   +  +W  
Sbjct  60    GSVQELFDLPLQTKLRNVSRKPYHGYVGQYPMVPLYESIGIDDADIYEKVDGLTTTLWPE  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN +FS++  SF++ ++EL++   RM+ ES+GVEK+ D ++ ST YL R MKY  P  +D
Sbjct  120   GNMNFSKTIHSFTEKLSELDKMSRRMILESFGVEKYLDEHMNSTNYLFRLMKYAGPQTTD  179

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
                 + P HTD+  +T+L Q N+V GL+VQ ++GEWIS +   +SF+VM GE++  W N 
Sbjct  180   PKLGLVP-HTDQNTVTILCQ-NEVDGLQVQTKHGEWISTRPSTNSFVVMIGESLNAWLNG  237

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+  P H+V M  +G   RYS G+F+  K    ++ P ELVD+EHPL FKPF H++ + F
Sbjct  238   RLHTPYHQVMM--SGNRARYSAGLFTVPKGGYIVKAPNELVDEEHPLLFKPFDHVEFLDF  295

Query  981   FDSDKGRRSKNLLKDFCG  1034
             + ++ G+R+K+ LK +CG
Sbjct  296   YYTETGQRAKSALKAYCG  313



>ref|XP_009603180.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP3-like [Nicotiana 
tomentosiformis]
Length=316

 Score =   269 bits (687),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 143/307 (47%), Positives = 207/307 (67%), Gaps = 10/307 (3%)
 Frame = +3

Query  126   NNEDLKPG-STSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQQLFDLPFEKK  302
             +N  LKP  ST+W  AC ++R ALE++GCF+ + D VSP+L+  IF A  +LFDLP E K
Sbjct  15    SNHYLKPNTSTNWFSACDEVRRALEEYGCFLAVYDSVSPELNIDIFQAVVELFDLPTESK  74

Query  303   ILNTNEKPYHGYVGQIPFIPYHEAFGID--HATTIEGVQSFSNLMWSGGNHsfsessqsf  476
             + NT+EKP++GY G I   P  E+ GI+   A T EGVQ+F++LMW  GN  FSE    +
Sbjct  75    LRNTSEKPFYGYYGNISDFPLQESLGINIGDAITAEGVQNFTSLMWPTGNDHFSEIIHDY  134

Query  477   sKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNVVFPCHTDK  656
             + IVA+LE+ V RM+ ESYGVE  YD   +ST YLLR +KY  P + DE+NV    HTDK
Sbjct  135   ANIVADLEKMVKRMVIESYGVENCYDFLDKSTTYLLRLIKYRTP-KLDESNVGSQVHTDK  193

Query  657   TFMTVLYQLNQVSGLEVQARNGEWISAQFPPS-SFIVMAGEAIKGWSNSRVLAPIHKVTM  833
             TF+++L+Q NQV+GLEV+ ++GEW++    P+ SF+VM GEA   WSN+R+  P+H+V +
Sbjct  194   TFLSILHQ-NQVNGLEVKTKDGEWMAIDMTPANSFLVMVGEAFSAWSNNRLHCPVHRVIV  252

Query  834   DANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSDKGRRSKN  1013
               N  + RY++  FS++     I+ PEELVD++HP +F+PF + +++ FF      + + 
Sbjct  253   KEN--KPRYTLAHFSYING--MIQTPEELVDEKHPKKFQPFDNFELLDFFAKHVNEQMEY  308

Query  1014  LLKDFCG  1034
              ++ FCG
Sbjct  309   TVRAFCG  315



>ref|XP_010061958.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Eucalyptus grandis]
Length=310

 Score =   268 bits (686),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 135/312 (43%), Positives = 205/312 (66%), Gaps = 6/312 (2%)
 Frame = +3

Query  102   TKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQQLF  281
             +++ V+ F+ E ++P + SW  AC +I  ALE HGCF+   +    +  + IF  +++LF
Sbjct  3     SEVPVIVFSQESMEPATKSWTRACDEIVQALEHHGCFVAEYEDFPGEFRDPIFGVAKELF  62

Query  282   DLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHsfse  461
             DLP E K+ + +    +GY+ + P  P  E   ID A  +E  + F+ LMW  GN  F +
Sbjct  63    DLPQETKVRSPSSAYSNGYIAKCPGTPLLEGLNIDGAEKLEAFEKFTALMWPSGNARFCK  122

Query  462   ssqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNVVFP  641
             ++ S++K +A++E+ V RM+FE YGV K+ +S+ EST YLLR +KY+ P E DE N+   
Sbjct  123   TAHSYAKEIAKVEKVVTRMVFEGYGVGKYCNSHFESTTYLLRILKYKKPGE-DEGNINPI  181

Query  642   CHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRVLAPIH  821
              HTDKTF+++LY  N V GLEV  ++GEW+  Q  PSSF+VMAG+A  GWSN R+ A  H
Sbjct  182   AHTDKTFLSILYP-NDVRGLEVMTKDGEWVVFQPSPSSFMVMAGDACMGWSNGRIKACYH  240

Query  822   KVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSDKGR  1001
             +  +  +G   RY++G+FS+  N+ TIE+P+EL+D +HP QFK F HLD ++F+D  +GR
Sbjct  241   RTNVREDGS-VRYALGVFSY--NTGTIEIPKELIDQDHPQQFKSFNHLDFLRFYDKSQGR  297

Query  1002  -RSKNLLKDFCG  1034
              +S+ L+K +CG
Sbjct  298   TKSQCLIKAYCG  309



>ref|NP_175691.1| putative 2-oxoglutarate-dependent dioxygenase [Arabidopsis thaliana]
 gb|AAG52269.1|AC019018_6 putative oxidoreductase; 38288-39393 [Arabidopsis thaliana]
 gb|AEE32855.1| putative 2-oxoglutarate-dependent dioxygenase [Arabidopsis thaliana]
Length=317

 Score =   268 bits (685),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 136/312 (44%), Positives = 206/312 (66%), Gaps = 4/312 (1%)
 Frame = +3

Query  99    PTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQQL  278
             P +L V+DF+N++LKPG   W     D++ AL+D+G F    D++  +L  S+F A ++L
Sbjct  9     PLRLPVIDFSNKNLKPGEPEWDLTRADVQKALQDYGYFEASFDRIPFELRKSVFGALEEL  68

Query  279   FDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHsfs  458
             FDLP + K+ N ++KP+HGYVGQ P +P +E+ GID +   E V +F+  +W  GN SFS
Sbjct  69    FDLPLQTKLRNVSKKPFHGYVGQYPMVPLYESMGIDDSDIAEKVDAFTEKLWPQGNISFS  128

Query  459   essqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNVVF  638
              + QSFSK ++EL+  + RM+ ES+G++K+ D ++ ST YLLR MKY+ P +++E  V  
Sbjct  129   TTIQSFSKKLSELDITIRRMIMESFGLDKYIDEHLHSTNYLLRVMKYKGP-DTEETKVGL  187

Query  639   PCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRVLAPI  818
               HTDK  +T+LYQ N V GLEVQ ++  WI  +    SF VM G+++    N R+ +P 
Sbjct  188   NAHTDKNIVTILYQ-NHVEGLEVQTKDKNWIKVKPTQDSFTVMIGDSLYALLNGRLHSPY  246

Query  819   HKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSDKG  998
             H+V M   G E RYS+G+FS  K    +  P+ELVD+EHP  FKPF H++ ++F+ ++ G
Sbjct  247   HRVMM--TGTETRYSLGLFSIPKAGHIVSSPDELVDEEHPRLFKPFDHVEFLQFYYTEAG  304

Query  999   RRSKNLLKDFCG  1034
             +RS++ LK +CG
Sbjct  305   QRSQSALKTYCG  316



>ref|XP_008384915.1| PREDICTED: probable inactive 2-oxoglutarate-dependent dioxygenase 
AOP2 [Malus domestica]
Length=318

 Score =   268 bits (685),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 137/318 (43%), Positives = 207/318 (65%), Gaps = 6/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGSL  P  L  ++F+ + LKPGS+SW    K +R ALE++GCF+   ++VS QL N+IF
Sbjct  1     MGSLTLPN-LPTINFSVDALKPGSSSWLSTSKQVRYALEEYGCFVAEYNQVSAQLLNNIF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
               ++ LF++P E K+ N + +PY GY+G    +P +E   ID+ T+ +  Q F NLMW  
Sbjct  60    GQAKDLFEVPLENKVKNVSNEPYRGYIGPNHLMPLYEGIAIDNVTSPQETQKFKNLMWPD  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             G  +F E++ SF+++++ELE KV +MLFESYG EK Y+S   + ++LLR++KY  P E+D
Sbjct  120   GKSNFCETTDSFAQLLSELEHKVEQMLFESYGSEKQYESVASANSHLLRFLKYNKPEEAD  179

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
                + F  HTDK F T++ Q + V GLEV+ ++G+WI+ +  PS F+ MAG+ ++ WSN 
Sbjct  180   RATLRFASHTDKNFTTIVVQ-HDVGGLEVKTKDGDWINIESAPSQFLFMAGDGLQVWSNE  238

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+ A  H+V     G + RYS+G+F+F  N+  I+VPEELVD+ HPL + P   L+ I+F
Sbjct  239   RIKACDHRVKH--CGDKTRYSLGLFTF--NNGKIQVPEELVDERHPLLYNPLDSLEYIRF  294

Query  981   FDSDKGRRSKNLLKDFCG  1034
                 + R   + +K FCG
Sbjct  295   HSRGEARNLVSPVKTFCG  312



>gb|KDP37380.1| hypothetical protein JCGZ_06834 [Jatropha curcas]
Length=316

 Score =   267 bits (683),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 142/321 (44%), Positives = 211/321 (66%), Gaps = 9/321 (3%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLK-PGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSI  257
             MGSL   +KL V+DF++E+L+  G++ W   CKDI  ALE++GCF+ + + V  QLH  +
Sbjct  1     MGSLSN-SKLPVIDFSSENLESAGTSGWVSKCKDILKALEEYGCFVAVYNNVPLQLHVDL  59

Query  258   FHASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWS  437
             F+  ++LFDLP E K  N ++ P+ GYV   P  P++E+ GI H   +EG + F+  MW 
Sbjct  60    FNVLEELFDLPLETKRKNVSDIPFTGYVEIEPTRPFYESMGISHVEMLEGNKDFTKTMWP  119

Query  438   GGNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPA-E  614
              GN +F +   SFSK V +L +  ++M+F+ YG+EK+Y S++E T Y  R + Y +P   
Sbjct  120   KGNDNFCKIVHSFSKAVEDLHKMAVKMIFDGYGMEKNYQSHMELTTYFSRLVNYIIPQLN  179

Query  615   SDENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSS-FIVMAGEAIKGW  791
              +E  +    HTDK+F+T+L+Q N V+GLE+Q +NGEW+      SS F+VMAGE I GW
Sbjct  180   ENETKLGLYPHTDKSFLTILHQ-NDVNGLEIQTKNGEWVDVDLSSSSNFLVMAGEGIMGW  238

Query  792   SNSRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDM  971
             SN+R+ A  H+VT+  N KEKR S+G+FS++K    I+VPEE VD+EHPL +KPF H+ +
Sbjct  239   SNNRIDACDHRVTI--NRKEKRLSIGLFSYVKG--IIKVPEEFVDEEHPLMYKPFDHIGL  294

Query  972   IKFFDSDKGRRSKNLLKDFCG  1034
             + FF + +G +    LK + G
Sbjct  295   VHFFGTPEGHKQHRTLKAYSG  315



>gb|AFK47428.1| unknown [Lotus japonicus]
Length=311

 Score =   267 bits (682),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 141/318 (44%), Positives = 206/318 (65%), Gaps = 8/318 (3%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS ET  KL V+DF + +      +W      +  AL ++GCF  + DKV   L   IF
Sbjct  1     MGS-ETTRKLPVIDFTDLN---SLANWEAVKSKVHEALVEYGCFEAIFDKVPLDLRKEIF  56

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              + ++LF+LP + K+LN ++KPYHGYVGQ P +P  E+ GID A   E V++ +N++W  
Sbjct  57    ASLEELFNLPLQTKLLNVSKKPYHGYVGQYPMVPLFESMGIDDANVSEKVEAMANILWPD  116

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN SFS++  SFS+ ++EL+  + +M+ ES GVEK+ D ++ ST YLLR MKY+ P  SD
Sbjct  117   GNPSFSKTINSFSEQLSELDHIIRKMVLESLGVEKYLDEHLHSTNYLLRVMKYKGPETSD  176

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
                +    H+DK  +T+LYQ NQV GLEV  ++G+WIS +     F+VM G+++  WSN 
Sbjct  177   -TKLGLTTHSDKNIVTILYQ-NQVEGLEVLTKDGKWISYKPSSEGFVVMIGDSLHAWSNG  234

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+ +P H+V M   G E RYS G+FS  K    I+ PEELVD+EHPL FKPF H++ +K+
Sbjct  235   RLHSPFHRVMM--TGNEARYSTGLFSIPKGEYIIKTPEELVDEEHPLLFKPFDHVEFLKY  292

Query  981   FDSDKGRRSKNLLKDFCG  1034
             + ++KG+R +  L+ +CG
Sbjct  293   YYTEKGQRDQFALRTYCG  310



>ref|XP_008390710.1| PREDICTED: probable inactive 2-oxoglutarate-dependent dioxygenase 
AOP2 [Malus domestica]
Length=316

 Score =   267 bits (682),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 136/318 (43%), Positives = 209/318 (66%), Gaps = 7/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGSL  P +L  ++F+ EDLKPGS+SW    K +R ALE++G F+   D++SP+LHN+IF
Sbjct  1     MGSL-APPQLPTINFSAEDLKPGSSSWLSTAKQVRCALEEYGSFVAXYDQISPELHNNIF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
               +  LF++P E K+ N  E+PYHGY+G  P IP +E+  ID+ T+ +    F NLMW  
Sbjct  60    GQAADLFEVPLENKVKNVGEQPYHGYMGPNPAIPLYESLCIDNVTSPQATHKFKNLMWPA  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             G  +FSE++ SF +++A+L+  V +M+F+S+GV   Y+S     ++LLR++KY+VP + D
Sbjct  120   GKKNFSETTDSFGQLLADLDRTVGQMIFDSFGVGNEYESVACCNSHLLRFIKYKVPEDPD  179

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
                + FP HTD  F T++ Q + VSGLEV+ + G+WI+ +  PS F+ MA E ++ WSN 
Sbjct  180   I-TLRFPMHTDNNFTTIVVQ-HDVSGLEVKTKEGDWINIESVPSHFLFMAAEGLQVWSND  237

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+ A  H+V     G + RYS+G+F+F  N+  I+VP+ELVDDEHPL + P       +F
Sbjct  238   RIKACQHRVKH--RGDKTRYSLGLFTF--NNGVIQVPKELVDDEHPLLYNPCDSRGYTRF  293

Query  981   FDSDKGRRSKNLLKDFCG  1034
               S + +++ + +K +CG
Sbjct  294   HASAESKKAASRIKAYCG  311



>ref|XP_010462134.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
isoform X1 [Camelina sativa]
Length=317

 Score =   267 bits (682),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 139/321 (43%), Positives = 206/321 (64%), Gaps = 8/321 (2%)
 Frame = +3

Query  81    MGSLETPTKLL---VVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHN  251
             MGS ETP   L   V+DF+NE LKPG   W     D++ AL+D+GCF    D++  +L  
Sbjct  1     MGS-ETPLLPLCLPVIDFSNEYLKPGEPEWDLTSADVQKALQDYGCFEASFDRIPIELRK  59

Query  252   SIFHASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLM  431
              +F   ++LFDLP + K+ N ++KP+HGYVGQ P +P +E+ GI+     E V +F+  +
Sbjct  60    LVFETLEELFDLPLQTKLRNVSKKPFHGYVGQYPMVPLYESMGIEDPDVAERVNAFTKPL  119

Query  432   WSGGNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPA  611
             W  GN+SFS    +FSK +++L+  + RM+ ES+G++K+ D +++ST YLLR MKY+ P 
Sbjct  120   WPQGNNSFSTRIHTFSKKLSDLDITIRRMIMESFGLDKYIDEHLQSTNYLLRVMKYKGP-  178

Query  612   ESDENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGW  791
             +++E  +    HTDK  +T+LYQ N V GLEVQ ++  WI  +    SFIVM G+++   
Sbjct  179   DTEETKLGLNAHTDKNIVTILYQ-NHVEGLEVQTKDNNWIKVKPSKDSFIVMIGDSLHAM  237

Query  792   SNSRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDM  971
              N R+ +P H+V M   G E RYS+G+FS  K    I  PEELVD EHP  FKPF H++ 
Sbjct  238   LNGRLHSPNHRVMM--TGTETRYSLGLFSIPKAGHIISSPEELVDQEHPRLFKPFDHVEF  295

Query  972   IKFFDSDKGRRSKNLLKDFCG  1034
             ++F+ +  G+RS++ LK +CG
Sbjct  296   LQFYYTQAGQRSQSALKTYCG  316



>ref|XP_008377590.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Malus domestica]
Length=291

 Score =   266 bits (679),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 137/291 (47%), Positives = 202/291 (69%), Gaps = 6/291 (2%)
 Frame = +3

Query  93   ETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQ  272
            ET  KL V+D ++E+LKPG+ +W  ACK+I+ ALE++GCF  +  KV  +LHNS+F A +
Sbjct  4    ETQPKLPVIDLSDENLKPGTDAWLLACKEIKDALEEYGCFEAIYHKVPLELHNSMFTAME  63

Query  273  QLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHs  452
             LF LP E K   T+++  H Y+GQ  FIP +E+  + + TT+EG Q F++ MW  GN  
Sbjct  64   DLFGLPLETKKQKTSDRHLHSYLGQYSFIPLYESLAMANPTTVEGAQGFTSTMWPQGNDH  123

Query  453  fsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNV  632
            F E++ SFSK+VAEL + V RM+F+ YGV++ YDS++E T Y LR+ KY    +++E NV
Sbjct  124  FCETAHSFSKLVAELSQMVTRMVFDMYGVQRLYDSHMELTTYQLRWYKYRT-QQANETNV  182

Query  633  VFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRVLA  812
                HTDK+F+++L Q +QV+GL++  ++ +WI  +  PSSF+++AG+A   WSN RV +
Sbjct  183  GMLPHTDKSFISILNQ-DQVNGLQIGTKDSQWIDVKPSPSSFLILAGDAFMAWSNDRVPS  241

Query  813  PIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHL  965
              H+VTM  N  + RYS+G+FSF   S  I+VPEEL+D++HPL +KPF H 
Sbjct  242  CEHQVTMREN--KTRYSLGLFSF--KSGIIQVPEELIDEKHPLLYKPFDHF  288



>ref|XP_008372275.1| PREDICTED: probable inactive 2-oxoglutarate-dependent dioxygenase 
AOP2 [Malus domestica]
Length=316

 Score =   266 bits (681),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 136/318 (43%), Positives = 209/318 (66%), Gaps = 7/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGSL  P +L  ++F+ EDLKPGS+SW    K +R ALE++G F+   D++SP+LHN+IF
Sbjct  1     MGSL-APPQLPTINFSAEDLKPGSSSWLSTAKQVRCALEEYGSFVAQYDQISPELHNNIF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
               +  LF++P E K+ N  E+PYHGY+G  P IP +E+  ID+ T+ +    F NLMW  
Sbjct  60    GQAADLFEVPLENKVKNVGEQPYHGYMGPNPAIPLYESLCIDNVTSPQATHKFKNLMWPA  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             G  +FSE++ SF +++A+L+  V +M+F+S+GV   Y+S     ++LLR++KY+VP + D
Sbjct  120   GKKNFSETTDSFGQLLADLDRTVGQMIFDSFGVGNEYESVACCNSHLLRFIKYKVPEDPD  179

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
                + FP HTD  F T++ Q + VSGLEV+ + G+WI+ +  PS F+ MA E ++ WSN 
Sbjct  180   I-TLRFPMHTDNNFTTIVVQ-HDVSGLEVKTKEGDWINIESVPSHFLFMAAEGLQVWSND  237

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+ A  H+V     G + RYS+G+F+F  N+  I+VP+ELVDDEHPL + P       +F
Sbjct  238   RIKACQHRVKH--RGDKTRYSLGLFTF--NNGVIQVPKELVDDEHPLLYNPCDSRGYTRF  293

Query  981   FDSDKGRRSKNLLKDFCG  1034
               S + +++ + +K +CG
Sbjct  294   HASAESKKAASRIKAYCG  311



>ref|XP_010500907.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
isoform X2 [Camelina sativa]
Length=317

 Score =   266 bits (681),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 139/321 (43%), Positives = 206/321 (64%), Gaps = 8/321 (2%)
 Frame = +3

Query  81    MGSLETPTKLL---VVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHN  251
             MGS ETP   L   V+DF+NE LKPG   W     D++ AL+D+GCF    D++  +L  
Sbjct  1     MGS-ETPLLPLCLPVIDFSNEYLKPGEPEWDLTSADVQKALQDYGCFEASFDRIPIELRK  59

Query  252   SIFHASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLM  431
              +F   ++LFDLP + K+ N ++KP+HGYVGQ P +P +E+ GI+     E V +F+  +
Sbjct  60    LVFETLEELFDLPLQTKLRNVSKKPFHGYVGQYPMVPLYESMGIEDPDVAERVNAFTKPL  119

Query  432   WSGGNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPA  611
             W  GN+SFS    +FSK +++L+  + RM+ ES+G++K+ D ++ ST YLLR MKY+ P 
Sbjct  120   WPQGNNSFSTRIHTFSKKLSDLDITIRRMIMESFGLDKYIDEHLHSTNYLLRVMKYKEP-  178

Query  612   ESDENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGW  791
             +++E  +    HTDK  +T+LYQ N V GLEVQ ++  WI  +    SFIVM G+++   
Sbjct  179   DTEETKLGLNAHTDKNIVTILYQ-NHVEGLEVQTKDNNWIKVKPSKDSFIVMIGDSLHAM  237

Query  792   SNSRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDM  971
              N R+ +P H+V M   G E RYS+G+FS  K    I  PEELVD+EHP  FKPF H++ 
Sbjct  238   LNGRLHSPNHRVMM--TGTETRYSLGLFSIPKAGHIISSPEELVDEEHPRLFKPFDHVEF  295

Query  972   IKFFDSDKGRRSKNLLKDFCG  1034
             ++F+ +  G+RS++ LK +CG
Sbjct  296   LQFYYTQAGQRSQSALKTYCG  316



>ref|XP_008386022.1| PREDICTED: probable inactive 2-oxoglutarate-dependent dioxygenase 
AOP2 [Malus domestica]
Length=318

 Score =   266 bits (681),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 137/318 (43%), Positives = 205/318 (64%), Gaps = 6/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGSL  P KL  +DF+ + LKPGS+SW    K +R ALE++G F+   D++S QL N IF
Sbjct  1     MGSLTLP-KLPTIDFSVDVLKPGSSSWLSTSKQVRYALEEYGGFVAQYDQISAQLLNDIF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
               ++ LF++P E K+ N + +PY GY+G    +P +E   ID+ T+ E  Q F NLMW  
Sbjct  60    GHAKDLFEVPLENKVKNVSNEPYRGYIGPNHLMPLYEGIAIDNVTSPEETQKFKNLMWPD  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             G  +F E++ SF+++++ELE KV +MLFESYG EK Y+S   + ++LLR++KY  P E+D
Sbjct  120   GKSNFCETTDSFAQLLSELEHKVEQMLFESYGAEKQYESVASANSHLLRFLKYNKPEEAD  179

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
                + F  HTDK F T++ Q + V GLEV+ ++G+WIS +  PS F+ +AG+ ++ WSN 
Sbjct  180   STTLRFASHTDKNFTTIVVQ-HDVGGLEVKTKDGDWISVESVPSQFVFLAGDGLQVWSND  238

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+ A  H+V     G + RYS+G+F+F  N+  I+VP+ELVD+ HPL + P   L+ I+F
Sbjct  239   RIKACHHRVKH--CGDKTRYSLGLFTF--NNGIIQVPQELVDERHPLLYNPLDSLEYIRF  294

Query  981   FDSDKGRRSKNLLKDFCG  1034
                 + R   + +  FCG
Sbjct  295   HSRGEARNLVSPVNTFCG  312



>emb|CDP08459.1| unnamed protein product [Coffea canephora]
Length=313

 Score =   266 bits (680),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 134/310 (43%), Positives = 199/310 (64%), Gaps = 4/310 (1%)
 Frame = +3

Query  105   KLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQQLFD  284
             KL  +DF+   LKPG+  W      +R ALE+ GCF  + DK+S +L  S F A ++LF+
Sbjct  7     KLPAIDFSQPGLKPGNPEWDSVKGQVRKALEEFGCFEAMYDKISLELQKSFFKALEELFN  66

Query  285   LPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHsfses  464
             LP + K  N ++K YHGY+GQ P  P +E+ G+D A  +E V+SF++L+W  GN +F ++
Sbjct  67    LPLQTKQRNASKKIYHGYIGQYPIFPLYESMGLDDANILEKVESFTDLLWPEGNSNFCKT  126

Query  465   sqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNVVFPC  644
               S+S+ ++EL++ V RM+ ES G+EK+ D ++E T YLLR MKYE P ++ E  V  P 
Sbjct  127   VHSYSEQISELDKIVRRMILESLGLEKYMDEHMELTNYLLRAMKYEGP-QTTETKVGLPA  185

Query  645   HTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRVLAPIHK  824
             HTDK  +++L Q +Q+ GL+V  ++G WI  +  P SF VM G+A+  W+N R+  P H+
Sbjct  186   HTDKNILSILCQ-DQIRGLQVLTKDGHWIDVEPSPGSFTVMIGDALFAWTNGRLHCPFHR  244

Query  825   VTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSDKGRR  1004
             V M   G   RYS GIFS  K    I+ PEELVD+EHPL FKPF +++ + F  ++ G+ 
Sbjct  245   VMM--TGNIARYSAGIFSMPKAGYIIKAPEELVDEEHPLLFKPFDNVEFLSFLRTEAGKG  302

Query  1005  SKNLLKDFCG  1034
             ++  LK + G
Sbjct  303   AQFALKTYSG  312



>ref|XP_009344329.1| PREDICTED: probable inactive 2-oxoglutarate-dependent dioxygenase 
AOP2 [Pyrus x bretschneideri]
Length=316

 Score =   265 bits (678),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 133/318 (42%), Positives = 208/318 (65%), Gaps = 7/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGSL  P KL  ++F+ + LKPGS+SW    K +R ALE++G F+   D++SP+L N+IF
Sbjct  1     MGSL-APPKLPTINFSAKGLKPGSSSWLPTAKQVRYALEEYGSFVAQYDQISPELQNNIF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
               +  LF++P E K+ N  E+PYHGY+G  PF+P +E+  ID+ T+ +    F NLMW  
Sbjct  60    GQAADLFEVPVENKVKNVGEQPYHGYIGPNPFMPLYESLCIDNVTSPQATHKFKNLMWPA  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             G  +F E++ SF +++ +LE  V +MLF+S+GV   Y+S     ++LLR++KYEVP ++D
Sbjct  120   GKKNFCETTDSFGQLLGDLERTVGQMLFDSFGVGNEYESVANCNSHLLRFIKYEVPEDTD  179

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
                + FP HTD +F T++ Q + VSGLEV+ + G+WI+ +  PS F+ MA + ++ WSN 
Sbjct  180   -TTLRFPMHTDNSFTTIVVQ-HDVSGLEVKTKEGDWINIESVPSQFLFMAADGLQMWSND  237

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+ A  H+V     G + RYS+G+F+F  N+  ++VP+ELVDDEHPL + P       +F
Sbjct  238   RIKACQHRVKH--CGDKTRYSLGLFTF--NNGVLQVPKELVDDEHPLLYNPCDSRGYTRF  293

Query  981   FDSDKGRRSKNLLKDFCG  1034
               S + +++ + +K +CG
Sbjct  294   HASAESKKAASRIKAYCG  311



>gb|KEH28750.1| 2-oxoglutarate-dependent dioxygenase [Medicago truncatula]
Length=314

 Score =   265 bits (676),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 139/318 (44%), Positives = 207/318 (65%), Gaps = 5/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS E   KL ++DFNN + +  + +W      +  AL ++GCF  + DKV   L  +IF
Sbjct  1     MGS-EHTQKLPLIDFNNLNFEAKNPNWELVKSQVYKALVEYGCFEAIFDKVPLDLRKAIF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              + ++LFDLP E K+LN + KPY GY+GQ P +P +E+  I+ A  +E V+S +N++W  
Sbjct  60    TSIEELFDLPLETKLLNVSNKPYDGYIGQYPVVPLYESMAIEDANILEKVKSMTNILWPD  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN +FSE+  SFS+ + EL++ + +M+ ES GVEK+ + ++ ST Y LR MKY+ P  SD
Sbjct  120   GNKNFSETIHSFSEELIELDQIIRKMILESLGVEKYLEEHMNSTNYRLRAMKYKGPQTSD  179

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
                 + P HTDK F+T+LYQ NQV GLE+  ++G+WIS +    SF+V+ G++I  WSN 
Sbjct  180   TKVGLTP-HTDKNFVTILYQ-NQVEGLEMMTKDGQWISYKPSSGSFVVVLGDSIHAWSNG  237

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+ +P H+V M  +G E RYS G+FS  K    I+ PEELVD+EHPL FKPF   + +K+
Sbjct  238   RLHSPFHRVMM--SGNEARYSAGLFSTPKGGYIIKAPEELVDEEHPLLFKPFDQAEFLKY  295

Query  981   FDSDKGRRSKNLLKDFCG  1034
             + S +G R +  ++ +CG
Sbjct  296   YHSREGARDRFAIRTYCG  313



>ref|XP_010542274.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Tarenaya hassleriana]
Length=314

 Score =   265 bits (676),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 144/319 (45%), Positives = 207/319 (65%), Gaps = 7/319 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS ET  +L V+DF+ ++LK GS  W     D+R ALE+ GCF    DK+   L   IF
Sbjct  1     MGS-ET-LQLPVIDFSGKNLKKGSKEWECTRSDVRKALEEFGCFEASFDKIPLHLRREIF  58

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
                ++LFDLP + K+ N ++KP+HGYVGQ P +P +E+ GID A   + V SF+  +W  
Sbjct  59    GCLEELFDLPLQTKLRNVSKKPFHGYVGQYPQVPLYESMGIDDADLPDQVLSFTQKLWPH  118

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GNH FS + QSF++ ++EL+  + RM  ES+G+EK+ D ++EST YLLR MKY+ P +++
Sbjct  119   GNHHFSNTIQSFAEQLSELDITIRRMTLESFGLEKYIDEHLESTNYLLRAMKYKGP-DTE  177

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
             E  +    HTDK  +T+LYQ N V GLEVQ ++ +WI  +    SFI M G+++    N 
Sbjct  178   ETKLGLNAHTDKNIVTILYQ-NHVEGLEVQTKDNKWIKVKPSKDSFIAMIGDSLYALLNG  236

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVD-DEHPLQFKPFVHLDMIK  977
             RV +P H+V M   GKE RYS G+FS  K    I  PEELVD DE+P  FKPF H++ ++
Sbjct  237   RVHSPYHRVMM--TGKEARYSAGLFSIPKAGHIIYAPEELVDGDEYPRLFKPFDHVEFLQ  294

Query  978   FFDSDKGRRSKNLLKDFCG  1034
             F+ ++ G+R+++ LK +CG
Sbjct  295   FYYTEAGQRAQSALKTYCG  313



>ref|XP_009354842.1| PREDICTED: probable inactive 2-oxoglutarate-dependent dioxygenase 
AOP2 [Pyrus x bretschneideri]
Length=316

 Score =   265 bits (676),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 134/318 (42%), Positives = 210/318 (66%), Gaps = 7/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGSL  P +L  ++F+ EDLKPGS+SW    K +R ALE++G F+   D++SP+LHN+IF
Sbjct  1     MGSL-APPQLPTINFSAEDLKPGSSSWLSTAKQVRCALEEYGSFVAQYDQISPELHNNIF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
               +  LF++P E K+ N  ++PYHGY+G  P IP +E+  ID+ T+ +    F NLMW  
Sbjct  60    GQAADLFEVPLENKVKNVGDQPYHGYMGPNPGIPLYESLCIDNVTSPQATHKFKNLMWPA  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             G  +FSE++ SF +++A+LE  V +M+F+S GV   Y+S     ++LLR++KY+VP +++
Sbjct  120   GKKNFSETTDSFGQLLADLERTVGQMIFDSLGVGNEYESVACCNSHLLRFIKYKVPEDTN  179

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
                + FP HTD +F T++ Q + VSGLEV+ + G+WI+ +  PS F+ MA + ++ WSN 
Sbjct  180   -TTLRFPMHTDNSFTTIVVQ-HDVSGLEVKTKEGDWINIESVPSHFLFMAADGLQVWSND  237

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+ A  H+V     G + RYS+G+F+F  N+  I+VP+ELVDDEHPL + P       +F
Sbjct  238   RIKACQHRVKH--RGDKTRYSLGLFTF--NNGVIQVPKELVDDEHPLLYNPCDSRGYTRF  293

Query  981   FDSDKGRRSKNLLKDFCG  1034
               S + +++ + +K +CG
Sbjct  294   HASAESKKAASRIKAYCG  311



>ref|XP_007162137.1| hypothetical protein PHAVU_001G127200g [Phaseolus vulgaris]
 gb|ESW34131.1| hypothetical protein PHAVU_001G127200g [Phaseolus vulgaris]
Length=319

 Score =   264 bits (675),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 133/320 (42%), Positives = 213/320 (67%), Gaps = 8/320 (3%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS ET ++L VVDF +E +KPG+ +W  AC  +RTALED+GCF+     +   L +S+ 
Sbjct  1     MGS-ETQSQLHVVDFTDEAMKPGTDAWLSACILVRTALEDNGCFLARYHGIGKDLCDSVV  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              A   LF LP E K   T++KP+H Y+GQ+ ++P +E+ GID+  T++G Q F+++M   
Sbjct  60    SAMGDLFSLPVETKAQKTSDKPFHSYLGQVSWLPLYESLGIDNPLTLQGCQKFTHIMGLQ  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVE-KHYDSYVESTAYLLRYMKYEVPAES  617
             GNH F ES   ++K++ EL+    RM+FESYGV+ +  +  +ES+ YLLR MKY   AE+
Sbjct  120   GNHRFCESVNEYAKLLGELDHMAKRMVFESYGVDMEGRECMIESSDYLLRCMKYRT-AET  178

Query  618   DENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSN  797
             DEN++    HTD T +++++QLN ++GLE++ ++GEWI      S F+VMAG+A+  WSN
Sbjct  179   DENDLGLQSHTDLTIVSIVHQLNNLNGLEIKLKDGEWIGVDASSSLFVVMAGDALNVWSN  238

Query  798   SRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKP-FVHLDMI  974
              R+    H+V M  N  + RYS+G+FSF  + + +++P+ELV +EHPL++K  F H + +
Sbjct  239   GRIRPCEHRVIM--NATKTRYSMGLFSF--SGEILQIPDELVSEEHPLRYKSIFDHYEYL  294

Query  975   KFFDSDKGRRSKNLLKDFCG  1034
             ++ + +  + S + ++ +CG
Sbjct  295   RYHEKENNKDSYSRIEAYCG  314



>gb|KDP24591.1| hypothetical protein JCGZ_25507 [Jatropha curcas]
Length=314

 Score =   264 bits (675),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 137/321 (43%), Positives = 212/321 (66%), Gaps = 11/321 (3%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTS-WAHACKDIRTALEDHGCFIVLCDKVSPQLHNSI  257
             MGSL   +KL V+DF+  +L+   TS W   CKD+  ALE++GCF+ + D V  QLH  +
Sbjct  1     MGSLSN-SKLPVIDFSRANLEAAGTSGWVSKCKDVLKALEEYGCFVAVYDNVPLQLHEDL  59

Query  258   FHASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWS  437
             F+  ++LFDLP E K  N ++ P++GY+  +P  P+ E+ GI  A T+E  Q F+  MW 
Sbjct  60    FNVLEELFDLPPETKRKNVSDIPFNGYIEYVPDRPFFESMGITRAETLEDTQDFTKTMWP  119

Query  438   GGNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAES  617
              GN +F ++  S+SK V EL + V++M+   YG+EK+Y+ ++EST Y LR++ Y  P E+
Sbjct  120   NGNDNFCQNVHSYSKAVEELYQMVMKMILNGYGIEKYYEPHMESTTYSLRFINYN-PEEN  178

Query  618   DENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSN  797
             + N  + P H DK+F+T+L+Q N ++GLE++ +NG+WI+    PS+FIV+AGE I GWSN
Sbjct  179   ETNMFMVP-HKDKSFLTILHQ-NDINGLEIKPKNGQWINVDLAPSNFIVIAGEGIMGWSN  236

Query  798   SRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIK  977
              R+ A  H+V M++  +EKR +VG+FS++K      VP+E VDD+HPL +KPF H+ ++ 
Sbjct  237   DRIDACEHRVRMES--REKRRTVGLFSYIKG--ITHVPQEFVDDDHPLMYKPFDHIGLLY  292

Query  978   FFDSDKGRRS--KNLLKDFCG  1034
             F  S +G  +   + +K + G
Sbjct  293   FLASPEGHSTSLSHTMKAYAG  313



>ref|XP_004301787.1| PREDICTED: gibberellin 3-beta-dioxygenase 4-like [Fragaria vesca 
subsp. vesca]
Length=344

 Score =   265 bits (677),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 132/288 (46%), Positives = 195/288 (68%), Gaps = 7/288 (2%)
 Frame = +3

Query  81   MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
            MGS+  P +L  +DF+ +DLKPGS+SW   CK +R ALE++GCF+ L  +VSPQL ++IF
Sbjct  1    MGSMTLPKELPTIDFSLQDLKPGSSSWTKTCKQVRYALEEYGCFVALYQQVSPQLIDNIF  60

Query  261  HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              S+ LF+LP E K+ NT+++PY GY+G IP +P++E  GI++ T+ +  Q F +LMW  
Sbjct  61   GHSKDLFELPLETKVKNTSKEPYRGYIGPIPLMPHYEGMGIENVTSPQATQKFKDLMWPN  120

Query  441  GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEK-HYDSYVESTAYLLRYMKYEVPAES  617
            G   F E++  F+K+V +LE  V +M+FES+G+ K  Y+S   S ++L+R++KY  P E 
Sbjct  121  GKTEFCETTDLFAKLVGDLEHTVEKMMFESFGIPKGQYESLASSNSHLIRFLKYMTPEER  180

Query  618  DENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSN  797
            D     FP HTDK F T++ Q + V GLEVQ ++G+WIS +  PS F+ MAG+ ++ WSN
Sbjct  181  DAVE-RFPSHTDKNFTTIVAQ-HDVGGLEVQTKDGDWISVESAPSQFLFMAGDGLQVWSN  238

Query  798  SRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPL  941
             RV A  H+V    +  + RYS+ +F+F  N+   +VP+ELVDD HPL
Sbjct  239  GRVKASHHRVKHCED--KTRYSLAMFTF--NNGVFQVPKELVDDSHPL  282



>ref|XP_004506878.1| PREDICTED: S-norcoclaurine synthase 1-like [Cicer arietinum]
Length=314

 Score =   263 bits (672),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 136/316 (43%), Positives = 208/316 (66%), Gaps = 4/316 (1%)
 Frame = +3

Query  87    SLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHA  266
             S +T  KL  +DF + +L+  S +W      +  AL ++GCF  + D++  +L  +IF +
Sbjct  2     SSKTTLKLPQIDFTSLNLEAKSPNWELVKSQVYEALLEYGCFEAIFDEIPIELRKAIFAS  61

Query  267   SQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGN  446
              ++LFDLP E K LN ++KPYHGYVGQ P IP +E+ GID A   + V+S +N  W  GN
Sbjct  62    LEELFDLPLETKQLNVSKKPYHGYVGQYPMIPLYESMGIDDANIFDKVESMTNNFWPDGN  121

Query  447   HsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDEN  626
              SFS++  SFS  + +L++ + +M+ ES GVEK+ + ++ S+ YLLR MKY+ P  SD  
Sbjct  122   QSFSKTIHSFSDELTKLDQIIRKMILESLGVEKYLEEHLNSSNYLLRVMKYKGPETSD-T  180

Query  627   NVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRV  806
              +    HTD+  +T+LYQ N+V GLEV  ++G+WIS +   +SF+VM G+++  WSN R+
Sbjct  181   KLGLSSHTDRNIVTILYQ-NEVEGLEVMTKDGKWISYKPSLNSFVVMIGDSLHAWSNGRL  239

Query  807   LAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFD  986
              +P H+V M  +G E RYS G+FS  K    I+ P+ELVD+EHPL FKP+ H++ +K++ 
Sbjct  240   HSPFHQVMM--SGNEARYSTGLFSIPKGGYLIKAPKELVDEEHPLLFKPYDHVEFLKYYY  297

Query  987   SDKGRRSKNLLKDFCG  1034
             S+KG+R +  ++ FCG
Sbjct  298   SEKGQRDQFPMRTFCG  313



>ref|XP_009364342.1| PREDICTED: probable inactive 2-oxoglutarate-dependent dioxygenase 
AOP2 [Pyrus x bretschneideri]
Length=318

 Score =   263 bits (672),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 135/318 (42%), Positives = 206/318 (65%), Gaps = 6/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             M SL  P KL ++DF+ + LKPGS+SW    K +R ALE++G F+   D++S QL N IF
Sbjct  1     MDSLTLP-KLPIIDFSVDVLKPGSSSWLSTSKKVRYALEEYGGFVAQYDQISEQLLNDIF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
               ++ LF++P E K+ + +++PY GY+G    +P +E   ID+ T+ E  Q F NLMW  
Sbjct  60    GQAKDLFEVPLENKVKSVSKEPYRGYIGPNHLMPLYEGIAIDNVTSPEETQKFKNLMWPD  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             G  +F E++ SF+++++ELE KV +MLFESYG EK Y+S   + ++LLR++KY  P E+D
Sbjct  120   GKSNFCETTDSFAQLLSELEHKVEQMLFESYGAEKQYESVASANSHLLRFLKYNKPEEAD  179

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
                + F  HTDK F T++ Q + V GLEV+ ++G+WIS +  PS F+ +AG+ ++ WSN 
Sbjct  180   RTTLRFASHTDKNFTTIVVQ-HDVGGLEVKTKDGDWISIESVPSQFVFLAGDGLQVWSND  238

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+ A  H+V     G + RYS+G+F+F  N+  I+VP+ELVD+ HPL + P   L+ I+F
Sbjct  239   RIKACHHRVKH--CGDKTRYSLGLFTF--NNGIIQVPQELVDERHPLLYNPLDSLEYIRF  294

Query  981   FDSDKGRRSKNLLKDFCG  1034
                 + R   + +  FCG
Sbjct  295   HSRGEARNLVSPVNTFCG  312



>ref|XP_010500906.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
isoform X1 [Camelina sativa]
Length=318

 Score =   262 bits (670),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 138/322 (43%), Positives = 205/322 (64%), Gaps = 9/322 (3%)
 Frame = +3

Query  81    MGSLETPTKLL---VVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHN  251
             MGS ETP   L   V+DF+NE LKPG   W     D++ AL+D+GCF    D++  +L  
Sbjct  1     MGS-ETPLLPLCLPVIDFSNEYLKPGEPEWDLTSADVQKALQDYGCFEASFDRIPIELRK  59

Query  252   SIFHASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLM  431
              +F   ++LFDLP + K+ N ++KP+HGYVGQ P +P +E+ GI+     E V +F+  +
Sbjct  60    LVFETLEELFDLPLQTKLRNVSKKPFHGYVGQYPMVPLYESMGIEDPDVAERVNAFTKPL  119

Query  432   WSGGNHs-fsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVP  608
             W  GN+S  S    +FSK +++L+  + RM+ ES+G++K+ D ++ ST YLLR MKY+ P
Sbjct  120   WPQGNNSFSSTRIHTFSKKLSDLDITIRRMIMESFGLDKYIDEHLHSTNYLLRVMKYKEP  179

Query  609   AESDENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKG  788
              +++E  +    HTDK  +T+LYQ N V GLEVQ ++  WI  +    SFIVM G+++  
Sbjct  180   -DTEETKLGLNAHTDKNIVTILYQ-NHVEGLEVQTKDNNWIKVKPSKDSFIVMIGDSLHA  237

Query  789   WSNSRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLD  968
               N R+ +P H+V M   G E RYS+G+FS  K    I  PEELVD+EHP  FKPF H++
Sbjct  238   MLNGRLHSPNHRVMM--TGTETRYSLGLFSIPKAGHIISSPEELVDEEHPRLFKPFDHVE  295

Query  969   MIKFFDSDKGRRSKNLLKDFCG  1034
              ++F+ +  G+RS++ LK +CG
Sbjct  296   FLQFYYTQAGQRSQSALKTYCG  317



>emb|CDP14980.1| unnamed protein product [Coffea canephora]
Length=321

 Score =   262 bits (669),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 140/325 (43%), Positives = 206/325 (63%), Gaps = 15/325 (5%)
 Frame = +3

Query  87    SLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHA  266
             S E P KL  +DF+N++LKPG   W      +R ALE++GCF    D++  QL  SIF A
Sbjct  2     SSEGP-KLPFIDFSNQELKPGFPLWNSLKIQVREALEEYGCFEASYDRIPIQLRKSIFDA  60

Query  267   SQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGN  446
               +LFDLP + K+ N+N KPYHGY+GQ P  P +E  GID A  +E  +SFS  MW  GN
Sbjct  61    VTELFDLPLQVKVKNSNGKPYHGYIGQSPLFPLYEGMGIDEANVLEHAESFSKDMWPEGN  120

Query  447   HsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDEN  626
               FS++ Q++++ ++EL++ V +M+ E  GVE++ D ++EST YLLR +KY+ P +++E 
Sbjct  121   SEFSKTIQNYAEQLSELDQMVRKMVLEGLGVEQYIDEHLESTHYLLRVIKYKGP-QTNET  179

Query  627   NVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAI--------  782
              +  P H D   +T+L+Q NQV GLE+Q ++G+WI  +  P+SF+VM GE+         
Sbjct  180   KLGLPSHRDANLVTILHQ-NQVQGLELQKKDGQWIDFKPSPNSFVVMIGESFHASLFNKF  238

Query  783   -KGWSNSRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFV  959
                W+N R+  P H+V M   G E RYSVG+FSF K+   ++ P+ELVD+ HPL FKPF 
Sbjct  239   CSAWTNGRLHPPNHRVLM--TGNEARYSVGLFSFPKDGYMVKAPKELVDETHPLLFKPFN  296

Query  960   HLDMIKFFDSDKGRRSKNLLKDFCG  1034
               D + +    +G++  + LK +CG
Sbjct  297   CPDYLAYI-YKRGKKVDSSLKTYCG  320



>ref|XP_008344774.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP3-like [Malus 
domestica]
Length=317

 Score =   261 bits (667),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 139/321 (43%), Positives = 213/321 (66%), Gaps = 8/321 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS   P  + VVD ++E++KPG+ +W  ACK ++ ALE+ GCF  +  K + +  NSIF
Sbjct  1     MGSETQPPVVPVVDLSSENMKPGTDAWLLACKKVQHALEEFGCFEAVYKKDTLETQNSIF  60

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              A +   DLP E K+  T++KP H Y G+ P  P+  + GI++  T+EG Q F+++MW  
Sbjct  61    SAIKDFCDLPLETKMQKTSDKPLHSYFGRNPLFPHDFSTGIENPETVEGXQKFTSIMWPA  120

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPA--E  614
             GN  F ES  SFS+++ EL++ V RM+F+ YGV++ YDS+  ST Y LR ++Y++ A  +
Sbjct  121   GNXRFRESVHSFSRMLVELDQMVTRMVFDIYGVZRLYDSHKASTTYQLRCIEYQIQAIQQ  180

Query  615   SDENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWIS-AQFPPSSFIVMAGEAIKGW  791
             +D+++V    HTDK F T+L+Q N+V+GL+++ R G+ I  A   PSSFIV A + +  W
Sbjct  181   TDKSDVRLFPHTDKGFTTILHQ-NEVNGLQIKTRAGQRIDYAPSSPSSFIVFAADVLMAW  239

Query  792   SNSRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDM  971
             SN RV A  H+V M    ++ RYSV +FS+ KN   ++VPEELVDD+HPL++KPF   D 
Sbjct  240   SNDRVYASEHQVIM--KEEKTRYSVALFSY-KNG-IVQVPEELVDDKHPLRYKPFDQFDY  295

Query  972   IKFFDSDKGRRSKNLLKDFCG  1034
             ++FF +++  + K+ +K +CG
Sbjct  296   LRFFQTEEAXKIKHPIKAYCG  316



>ref|XP_007145555.1| hypothetical protein PHAVU_007G248500g [Phaseolus vulgaris]
 gb|ESW17549.1| hypothetical protein PHAVU_007G248500g [Phaseolus vulgaris]
Length=309

 Score =   261 bits (666),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 134/310 (43%), Positives = 203/310 (65%), Gaps = 9/310 (3%)
 Frame = +3

Query  108   LLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQQLFDL  287
             L VVDF+ E++KPG+ +W  AC+ +R   EDHGCF+   +KV+P+L NS+F A +QLF L
Sbjct  7     LPVVDFSTENMKPGTDTWLAACQMVRRGFEDHGCFLANFNKVTPKLLNSLFSAMEQLFGL  66

Query  288   PFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHsfsess  467
             P E K   T++KP HGY GQ+P  P  E+F I + + I+  Q FS +MW  GNH   ES 
Sbjct  67    PVETKRRKTSDKPNHGYTGQVPTSPLFESFAIHNPSNIQDCQKFSRVMWPTGNHQLCESV  126

Query  468   qsfsKIVAELEEKVLRMLFESYGVEK-HYDSYVESTAYLLRYMKYEVPAESDENNVVFPC  644
               ++K++ EL++ V RM+F+SYG++K   + ++EST Y  R  KY++PA  DE+NV    
Sbjct  127   NEYAKLLQELDQSVKRMVFDSYGLDKVKCEMFLESTDYSFRSYKYKIPA-VDESNVGVNS  185

Query  645   HTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRVLAPIHK  824
             HTD TF+T+L+Q  +V GLEVQ ++GEW      P  F V+AG+A   WS+ R+ A  H+
Sbjct  186   HTDSTFITILHQ--RVDGLEVQLKDGEWFGIDASP-LFCVIAGDAFMVWSSERIRACEHR  242

Query  825   VTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSDKGRR  1004
             V +  N K  RYS+G+ S+  ++K ++  E+LVD+EHP+++KPF H   + F  +++  +
Sbjct  243   VIL--NSKVTRYSLGLLSY--STKMVQTLEDLVDEEHPIRYKPFDHYSYVGFRFTEEAVK  298

Query  1005  SKNLLKDFCG  1034
               + +K +CG
Sbjct  299   CTSRIKAYCG  308



>ref|XP_011045370.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Populus euphratica]
 ref|XP_011013043.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Populus euphratica]
Length=312

 Score =   261 bits (666),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 145/323 (45%), Positives = 209/323 (65%), Gaps = 17/323 (5%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS ET +K+ VV  + E+ +PGS+SW  AC DIR ALE++  F V+  + S + +  I 
Sbjct  1     MGS-ETASKIHVVHLSKENFEPGSSSWLAACSDIRRALEEYSFFEVVYSEPSMEFYREII  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
                ++LF+LP E K  NT+ K  HGY+G+I   P  E  GI++AT  +  Q+F++LMW  
Sbjct  60    SVLEELFNLPHETKNRNTHPKLGHGYMGKISGFP--EGLGIEYATKKDECQNFTSLMWPD  117

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN  F +   SF+KI +EL + V+RMLFESYG++K Y+ ++ ST YLLR +KY       
Sbjct  118   GNERFCDVIHSFTKIASELNQMVVRMLFESYGIKKDYEPFINSTNYLLRLLKY--GRSQG  175

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPS---SFIVMAGEAIKGW  791
             E NV F  H DKTF+T+LYQ N V GLE++ + GEWI+  + PS   SF V+AG+    W
Sbjct  176   ETNVGFKAHMDKTFLTLLYQ-NPVKGLEIRTKEGEWIT--YEPSSTTSFAVIAGDVCMAW  232

Query  792   SNSRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDM  971
             SN R+ +  H+V + +  +E RY++G+F+FL     ++ PEELVDDEHPLQ+KPF H  +
Sbjct  233   SNDRIKSSYHRVVVTS--EEDRYALGLFTFLDG--VVQPPEELVDDEHPLQYKPFDHQKL  288

Query  972   IKFFDS--DKGRRSKNLLKDFCG  1034
             + F+ S  D  +R  N++K +CG
Sbjct  289   LDFYQSYNDPNKRDCNIMKTYCG  311



>emb|CDP19495.1| unnamed protein product [Coffea canephora]
Length=311

 Score =   260 bits (665),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 136/310 (44%), Positives = 195/310 (63%), Gaps = 7/310 (2%)
 Frame = +3

Query  105   KLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQQLFD  284
             +L V++   E L+ G  SW  A   +  A E++GCFI + DK   ++ +SIF   Q LF+
Sbjct  8     RLPVINLTEEILRSGKDSWTEARNIVTRAFEEYGCFIAVHDKYPSEVRDSIFSELQDLFN  67

Query  285   LPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHsfses  464
             LP E K+ NT++ P  GY    P +  +E+  I+ AT +E V+ F+N MW   N+ F E 
Sbjct  68    LPLEIKVRNTSQTPLIGYARPRPNVDLYESMSIEDATNLEAVEKFANQMWPSKNNHFCEL  127

Query  465   sqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNVVFPC  644
                ++  VAEL++ V +++FESYGVEK+++S+V S  Y +R ++Y VP E +E NV  P 
Sbjct  128   FHWYANQVAELDKMVSKLVFESYGVEKYHESHVGSVTYTVRLIRYRVP-EQNEMNVGVPP  186

Query  645   HTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRVLAPIHK  824
             HTDK F+T+L Q N+  GLEVQ +NG WI   FPPSS ++MAG+    WSN RV +P H+
Sbjct  187   HTDKNFITILQQ-NEADGLEVQLKNGSWIPIDFPPSSVVIMAGDVFSAWSNGRVHSPFHR  245

Query  825   VTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSDKGRR  1004
             VTM  NGKE R+S+  F++ K  K +E P ELVDDEHPL +KP  +   ++F  +D    
Sbjct  246   VTM--NGKE-RHSIAQFAYCK--KLVETPTELVDDEHPLLYKPLDNFGYLRFLSTDDNFN  300

Query  1005  SKNLLKDFCG  1034
             + N LK +CG
Sbjct  301   TPNPLKAYCG  310



>ref|XP_008382989.1| PREDICTED: probable inactive 2-oxoglutarate-dependent dioxygenase 
AOP2 [Malus domestica]
Length=316

 Score =   260 bits (665),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 130/318 (41%), Positives = 206/318 (65%), Gaps = 7/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGSL  P KL  ++F+ + LKPGS+SW    K +R ALE++G F+   D++SP+L N+IF
Sbjct  1     MGSL-APPKLPTINFSAQGLKPGSSSWLSTAKQVRYALEEYGSFVAQYDQISPELQNNIF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
               +  LF++P E K+ N  E+PY GY+G  PF+P +E+  ID+ T+ +    F NLMW  
Sbjct  60    GQAADLFEVPVENKVKNVGEQPYRGYIGPNPFMPLYESLCIDNVTSPQATHKFKNLMWPA  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             G  +F E++ SF +++ +LE  V +MLF+S+GV   Y+      ++LLR++KY+VP ++D
Sbjct  120   GKKNFCETTDSFGQLLGDLERTVGQMLFDSFGVGNEYECVANCNSHLLRFIKYKVPEDTD  179

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
                + FP HTD +F T++ Q + VSGLEV+ + G+WI+ +  PS F+ MA + ++ WSN 
Sbjct  180   -TTLRFPMHTDNSFTTIVVQ-HDVSGLEVKTKEGDWINIESVPSQFLFMAADGLQMWSND  237

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+ A  H+V     G + RYS+G+F+F  N+  ++VP+ELVDDEHPL + P       +F
Sbjct  238   RIKACQHRVKH--CGNKTRYSLGLFTF--NNGVLQVPKELVDDEHPLLYNPCDGRGYTRF  293

Query  981   FDSDKGRRSKNLLKDFCG  1034
               S + +++ + +K +CG
Sbjct  294   HASAESKKAASRIKAYCG  311



>ref|XP_004148019.1| PREDICTED: gibberellin 3-beta-dioxygenase 3-like [Cucumis sativus]
 ref|XP_004171217.1| PREDICTED: gibberellin 3-beta-dioxygenase 3-like [Cucumis sativus]
Length=338

 Score =   261 bits (666),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 140/337 (42%), Positives = 213/337 (63%), Gaps = 24/337 (7%)
 Frame = +3

Query  81    MGSLETPT-KLLVVDFNNEDLKPGSTS-WAHACKDIRTALEDHGCFIVLCD---------  227
             +  LE P  KL  VD  ++D  P S   W    K +R ALE++GCF+   D         
Sbjct  6     LAKLEVPIIKLSNVDKKDDDSDPESRKLWLERSKQVRDALEEYGCFLGEYDDDESSCSCN  65

Query  228   -----KVSPQLHNSIFHASQQLFDLPFEKKILNTNEKPYHGYVG-QIPFI-PYHEAFGID  386
                  K++   +  IF   ++LFDLP E KI N ++KPYHG++  + PF+ P H++ GI+
Sbjct  66    SSSSPKLNSNNYEEIFKGLKELFDLPLETKIKNVSDKPYHGFLDCRTPFVLPLHQSLGIE  125

Query  387   HATTIEGVQSFSNLMWSGGNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVE  566
             +A++ E VQ F NL+W  GNH F E   ++SK ++E+E+ V RM+FESYGV K+YDS++ 
Sbjct  126   NASSYEAVQFFVNLLWPSGNHHFCEKLFAYSKKISEMEQLVKRMVFESYGVGKYYDSHIA  185

Query  567   STAYLLRYMKYEVPAESDENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARN-GEWISAQF  743
             ST YLLR MKY +P   +E N+    HTDK+F T+L+Q + V+GL+++ +N  +W+  QF
Sbjct  186   STTYLLRTMKYRIPKMGEE-NIGAEAHTDKSFFTILHQFDGVNGLQIKPKNYDQWLGVQF  244

Query  744   PPSSFIVMAGEAIKGWSNSRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELV  923
              P+SF+VMAG+A   WSN R+ +  H+V ++ N  ++RYS G+FS+ K    IE+P+ELV
Sbjct  245   SPNSFLVMAGDACLAWSNGRIHSATHRVIIEGN--KERYSTGLFSYHKG--IIEIPQELV  300

Query  924   DDEHPLQFKPFVHLDMIKFFDSDKGRRSKNLLKDFCG  1034
             D++HPL+F PF H  ++ +F +D   +  +    +CG
Sbjct  301   DEKHPLRFNPFNHYGLLGYFSTDDCDKIPSTANAYCG  337



>ref|XP_008784635.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Phoenix dactylifera]
Length=314

 Score =   259 bits (662),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 142/311 (46%), Positives = 193/311 (62%), Gaps = 6/311 (2%)
 Frame = +3

Query  105   KLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQQLFD  284
             KL  +D ++E L+PGS SW      +R ALE  GCF  +  KV  +L  +IF A  +LF 
Sbjct  8     KLPRLDLSDEGLQPGSESWGLVRAQVRQALETFGCFEAVFPKVPEELRRAIFPALDELFS  67

Query  285   LPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG-GNHsfse  461
             LP E K+ N ++KP HGYVGQ P +P  E+ GI+ A   E  Q F+ LMW   GN SFSE
Sbjct  68    LPTEAKLRNISDKPSHGYVGQYPHLPLFESMGIEDAEIPEEAQKFTALMWPPHGNQSFSE  127

Query  462   ssqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNVVFP  641
             +  SFSK V EL++ V RM+ ES GVEK+ DS+++ T Y+LR MKY+ P ++ E  +   
Sbjct  128   TICSFSKHVGELDQMVRRMVLESLGVEKYLDSHMQLTRYVLRVMKYKGP-DTAEATMGLG  186

Query  642   CHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRVLAPIH  821
              H+D   +T+LYQ NQ  GLE+Q ++G WI     P SF+VM G++   WSN RV AP H
Sbjct  187   AHSDSNIVTILYQ-NQ-DGLEIQTKDGRWIPVSTSPDSFVVMTGDSFTAWSNGRVHAPEH  244

Query  822   KVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSDKGR  1001
             +V M   G E RYS G+F+  K    +  P+ELVD+EHPL +KPF H+D ++F  +   +
Sbjct  245   RVMM--TGSEVRYSAGLFAMPKAGHLVRAPDELVDEEHPLLYKPFDHMDFLRFHRTRLNQ  302

Query  1002  RSKNLLKDFCG  1034
               K  L +FCG
Sbjct  303   TVKAALNEFCG  313



>ref|XP_004136073.1| PREDICTED: gibberellin 2-beta-dioxygenase 8-like [Cucumis sativus]
 ref|XP_004171509.1| PREDICTED: gibberellin 2-beta-dioxygenase 8-like [Cucumis sativus]
Length=316

 Score =   258 bits (660),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 141/319 (44%), Positives = 210/319 (66%), Gaps = 12/319 (4%)
 Frame = +3

Query  93    ETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQ  272
             E  +K+++   +   L+ G+  W  AC+++R  LE  GCF V+ DKVS +LHNSIF A++
Sbjct  4     EAKSKVVIPIIDLSKLEEGTKEWGLACREMRFGLEQFGCFSVVYDKVSLELHNSIFEATK  63

Query  273   QLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMW-SGGNH  449
             +LF LP E ++ NT+EKPYHGY G   F+P +E+  ID+   ++  QSF+NLMW +  N+
Sbjct  64    ELFHLPIETRMKNTSEKPYHGYFGGYSFLPLYESMAIDNPIQLQPTQSFANLMWPTTENN  123

Query  450   sfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDS--YVESTAYLLRYMKYEVPAESDE  623
              F  + + FS +VA+LE  V +M+ ESYGV     S   +EST YLLR  KY V AE DE
Sbjct  124   HFCVAVERFSTLVAKLEHMVTKMVLESYGVSNKVVSEPIMESTNYLLRLFKYRV-AEKDE  182

Query  624   NNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPS--SFIVMAGEAIKGWSN  797
             N+V    HTD TF+++++Q + +SGL++Q  + +W+    P S  SF VMAG+A+  WSN
Sbjct  183   NDVGLHSHTDLTFLSIIHQ-HLISGLQIQLLDDQWLEVH-PSSHCSFTVMAGDALMAWSN  240

Query  798   SRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIK  977
              R+ +  H+V M   G+E RYS+G+FSF KN + IEVP+E VDD +PL++KPF H D + 
Sbjct  241   ERIRSCRHRVIM--RGEETRYSIGMFSF-KNGR-IEVPQEFVDDANPLRYKPFHHYDFLT  296

Query  978   FFDSDKGRRSKNLLKDFCG  1034
             +  ++   ++ + +KD+CG
Sbjct  297   YDKANASHKTISRIKDYCG  315



>ref|XP_010110319.1| Protein SRG1 [Morus notabilis]
 gb|EXC25839.1| Protein SRG1 [Morus notabilis]
Length=313

 Score =   258 bits (659),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 137/320 (43%), Positives = 213/320 (67%), Gaps = 10/320 (3%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGSL    K+ V++F  E LKPGS SW  A K +R   E++GC  ++CD+   +LHNSIF
Sbjct  1     MGSL-AEQKIPVINFKEEHLKPGSDSWISALKQVRYGFEEYGCLEIVCDQFPFELHNSIF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYH-GYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWS  437
              A++ +F+LP E K+  T+ +P   GY+  +P +P +E+  +D ATT+E V+ F+N+MW 
Sbjct  60    DAAEDVFNLPKETKMQKTSTRPGKIGYIAGLPELPLYESIALDSATTLEEVEYFTNIMWP  119

Query  438   GGNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAES  617
              GN+SF +S  SFSK +  L E V RM+FE+YGVE  ++S+ E   Y+ R+ KY+ P ++
Sbjct  120   AGNNSFRDSVHSFSKRIEVLHEMVTRMVFENYGVEGLFNSFWEKRFYVCRFFKYKAPHQT  179

Query  618   DENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSN  797
             +E+ V    HTD TF+++L+Q +QV GL+++ ++G+WI  +  PSS  V+AG+ +K WSN
Sbjct  180   NESEVGIGAHTDSTFLSILHQ-HQVKGLQIKTKDGQWIDVKPKPSSLFVIAGDVLKVWSN  238

Query  798   SRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIK  977
              RV +  H+V +  +  + RYS G+F+F+K    ++VPEEL+DDE+PL++KPF H +  +
Sbjct  239   DRVRSCEHQVMVSED--KIRYSAGLFTFIKG--VMQVPEELIDDEYPLRYKPFDHAEYNR  294

Query  978   FFDSDKGRRSKNL-LKDFCG  1034
             +  S+   R KN  +  FCG
Sbjct  295   YLLSED--RDKNCPINAFCG  312



>ref|XP_010479810.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Camelina sativa]
Length=317

 Score =   258 bits (659),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 130/312 (42%), Positives = 198/312 (63%), Gaps = 4/312 (1%)
 Frame = +3

Query  99    PTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQQL  278
             P  L V+DF+NE LKPG   W     D++ AL+D+GCF     ++  +L   +F   ++L
Sbjct  9     PLCLPVIDFSNEYLKPGEPEWDLTRADVQKALQDYGCFEASFKRIPTELRKLVFETLEEL  68

Query  279   FDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHsfs  458
             FDLP + K+ N ++KP+HGYVGQ P +P +E+ GI+     E V +F+  +W  GN+SFS
Sbjct  69    FDLPLQTKLRNVSKKPFHGYVGQYPMVPLYESMGIEDPDVAERVNAFTKPLWPQGNNSFS  128

Query  459   essqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNVVF  638
                 +F+K +++L+  + RM+ ES+G++K+ + ++ ST YLLR MKY+ P ++ E  +  
Sbjct  129   TRIHTFAKKLSDLDITIRRMIMESFGLDKYIEEHLHSTNYLLRVMKYKGP-DTKETKLGL  187

Query  639   PCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRVLAPI  818
               HTDK  +T+LYQ N V GLEVQ ++  WI  +    SFIVM G+++    N R+ +P 
Sbjct  188   NAHTDKNIVTILYQ-NHVEGLEVQTKDNNWIKVKPSKDSFIVMIGDSLHAMLNGRLHSPN  246

Query  819   HKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSDKG  998
             H+V M   G E RYS+G+FS  K    I  PEELV +EHP  FKPF H++ ++F+ +  G
Sbjct  247   HRVMM--TGTETRYSLGLFSIPKAEHIISSPEELVGEEHPRLFKPFDHVEFLQFYYTQAG  304

Query  999   RRSKNLLKDFCG  1034
             +RS++ LK +CG
Sbjct  305   QRSQSALKTYCG  316



>ref|XP_004241719.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Solanum lycopersicum]
Length=314

 Score =   257 bits (656),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 128/310 (41%), Positives = 199/310 (64%), Gaps = 3/310 (1%)
 Frame = +3

Query  105   KLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQQLFD  284
             KL  +DF++EDLKPG+  W      +  AL ++GCF     K+   L  SIF + Q++FD
Sbjct  7     KLPKIDFSHEDLKPGTLVWNQVKSQVHKALVEYGCFEASFYKIPIHLKKSIFESLQEIFD  66

Query  285   LPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHsfses  464
             LP + K+ N + KP+HGYVGQ P +P  E+ GID A        F+ ++W  GN SF ++
Sbjct  67    LPLQTKLENISTKPFHGYVGQFPSLPLFESMGIDDANIPRKADEFAQILWPQGNPSFCKT  126

Query  465   sqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNVVFPC  644
              QS+S+ ++EL++ V RM+ ES G+EK+ D ++ ST ++L+ MKY  P  + E  +    
Sbjct  127   IQSYSEQLSELDQTVRRMVLESLGLEKYMDEHMNSTNFVLQLMKYNTPQSNTETEIGVSA  186

Query  645   HTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRVLAPIHK  824
             HTDK+  T+LYQ NQ++GL+V  +NG+WI+ +    +F VM G+++  W+N R+ AP H+
Sbjct  187   HTDKSIATILYQ-NQINGLQVMNKNGQWINVEPTQDTFTVMIGDSLHAWTNGRMHAPYHR  245

Query  825   VTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSDKGRR  1004
             V M   G + RYSVG+FS  K   TI+ P+E+VD+E+PL +KPF    ++ F ++++G R
Sbjct  246   VMM--RGNKARYSVGLFSVPKGDYTIKAPKEMVDEENPLLYKPFDLHGLLAFTNTEEGMR  303

Query  1005  SKNLLKDFCG  1034
              ++ LK +CG
Sbjct  304   CESALKTYCG  313



>ref|XP_009785369.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Nicotiana sylvestris]
Length=323

 Score =   257 bits (657),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 134/302 (44%), Positives = 196/302 (65%), Gaps = 12/302 (4%)
 Frame = +3

Query  150   STSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQQLFDLPFEKKILNTNEKPY  329
             S SW   C D+R ALEDHG FI L DKVS +L N IF    +LFDLP E K  N+++  +
Sbjct  19    SNSWLELCNDVRHALEDHGYFISLYDKVSSELENEIFDVMDELFDLPIETKKKNSSDFYF  78

Query  330   HGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHsfsessqsfsKIVAELEEKV  509
             + +VGQ+   P HE+FGI   T I+ +Q+F+ LMW   N  FSE+  S+ K  AELE+ V
Sbjct  79    YRWVGQLEAAPLHESFGIVCPTDIQALQTFTTLMWRQSNERFSETVTSYVKAAAELEQLV  138

Query  510   LRMLFESYGV-EKHYDSYVESTAYLLRYMKYEVPAESDE------NNVVFPCHTDKTFMT  668
              +M+F+SYGV E+HY+S++ +T YLLR  KY  P  S +      NN+    HTDK+F T
Sbjct  139   DKMVFQSYGVAERHYESHIAATTYLLRPTKYATPPPSADDDGANINNIGANIHTDKSFST  198

Query  669   VLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRVLAPIHKVTMDANGK  848
             +L+Q NQ++GL+V++++G+WI    PPS+FI MAG+A + WSN R+ AP H+V +    +
Sbjct  199   LLFQ-NQINGLQVESKSGDWIVVDVPPSAFIFMAGDAYEAWSNGRIYAPRHQVLLKE--E  255

Query  849   EKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSDKGRRSKNLLKDF  1028
             ++RY++ +F+F  N    ++PEELVD+ HPLQ+KPF +  +  ++ S       +  K +
Sbjct  256   KQRYTLALFTF--NKGITDIPEELVDETHPLQYKPFDNFGLAWYYLSGANSMIHSTAKAY  313

Query  1029  CG  1034
             CG
Sbjct  314   CG  315



>ref|XP_004241718.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Solanum lycopersicum]
Length=314

 Score =   256 bits (655),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 130/307 (42%), Positives = 201/307 (65%), Gaps = 5/307 (2%)
 Frame = +3

Query  117   VDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQQLFDLPFE  296
             +DF++++LKP +  W      +  AL ++GCF    DK    L  SIF +SQ+LFDLP +
Sbjct  11    IDFSHKELKPHTLVWNQVKSQVHKALVEYGCFEASFDKFPISLQKSIFESSQELFDLPSQ  70

Query  297   KKILNTNEKPYHGYVGQI-PFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHsfsessqs  473
              K+ +   KP++GYVG   P IP +E+ GID A      + F+ ++W  GN +F ++ QS
Sbjct  71    TKLKSIRTKPFNGYVGFYHPSIPLYESMGIDDANIPHKAEKFTQILWPQGNTTFCKTIQS  130

Query  474   fsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNVVFPCHTD  653
             +S+ ++EL++ + RM+ ES GVE + D ++ ST YLLR MKY+ P +S EN +    HTD
Sbjct  131   YSEQLSELDQMIRRMILESLGVENYMDEHMNSTNYLLRLMKYKTP-QSSENEMGLSSHTD  189

Query  654   KTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRVLAPIHKVTM  833
             K+ +T+LYQ NQV+GL+V  ++G+WI+    P +FIV+ G+++  W+N R+ AP H+V M
Sbjct  190   KSNITILYQ-NQVNGLQVLTKDGQWINVDPTPDTFIVLIGDSLHAWTNGRMHAPFHRVMM  248

Query  834   DANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSDKGRRSKN  1013
               N  E RYS+G+F+  K    I+ P+ELVD+EHPL +KPF HL+ I F  +++G + ++
Sbjct  249   KGN--EARYSIGLFTIPKTGYMIKAPKELVDEEHPLLYKPFTHLEFITFSYTEEGMQCES  306

Query  1014  LLKDFCG  1034
              LK +CG
Sbjct  307   ALKTYCG  313



>ref|XP_003625060.1| Gibberellin 20 oxidase [Medicago truncatula]
 gb|ABD33293.1| Immunoglobulin/major histocompatibility complex; 2OG-Fe(II) oxygenase 
[Medicago truncatula]
 gb|AES81278.1| 2-oxoglutarate-dependent dioxygenase [Medicago truncatula]
 gb|AFK39209.1| unknown [Medicago truncatula]
Length=321

 Score =   256 bits (655),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 128/320 (40%), Positives = 208/320 (65%), Gaps = 7/320 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS      + VVD +++++KPG+ +W  AC  ++T+LED+GCF+   DK+  +L +++ 
Sbjct  1     MGSETVSQIIPVVDLSDQNMKPGTDTWVSACNVVKTSLEDYGCFVAHYDKIGKELCDNVI  60

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
                ++ F LP E K    +++P+HGY GQ+  +P +E+  I    T+ G Q F+ ++W  
Sbjct  61    FGIEEFFKLPLETKAQKISDRPFHGYSGQLLTLPLYESLDIQDPLTMLGCQIFTQIIWPQ  120

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVE-KHYDSYVESTAYLLRYMKYEVPAES  617
             GN+ F ES   +SK++ EL+    RM+FESYGV+ K  +S +ES+ YL+R +KY    E 
Sbjct  121   GNNRFCESFNEYSKLLGELDHIAKRMVFESYGVDTKICESLIESSNYLIRCLKYRT-REM  179

Query  618   DENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSN  797
             DEN++    H+D T ++V++QLN ++GL+++ +NGEW   +  PSSF+V+AG+A   WSN
Sbjct  180   DENDLGLTPHSDLTIISVVHQLNNLNGLQIKLKNGEWTEVEASPSSFVVLAGDAFTIWSN  239

Query  798   SRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKP-FVHLDMI  974
              R+ A  H+V M  N  + RY+  +FSF   SK +E+PEELV++EHPL++KP F H D +
Sbjct  240   GRIRACEHRVIM--NATKTRYAAALFSFA--SKIMEIPEELVNEEHPLRYKPTFDHYDYL  295

Query  975   KFFDSDKGRRSKNLLKDFCG  1034
             +FF  +K +   + ++ +CG
Sbjct  296   RFFQKEKMKEPISRMEVYCG  315



>gb|KDP32296.1| hypothetical protein JCGZ_13221 [Jatropha curcas]
Length=309

 Score =   256 bits (653),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 127/292 (43%), Positives = 180/292 (62%), Gaps = 3/292 (1%)
 Frame = +3

Query  114  VVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQQLFDLPF  293
            ++DF+ E L+ GS  W   CK +R A E HGCFI++ D +S +L   +F     LFDLP 
Sbjct  8    ILDFSKEALEIGSEKWGTVCKQVREACERHGCFILMYDNLSAKLREDLFMGMNSLFDLPQ  67

Query  294  EKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHsfsessqs  473
            E K    N KPY  Y G  P +P+ E+FG+D A  ++ V SF+NLMW  GN +F ES  +
Sbjct  68   EVKAKYINPKPYRSYSGMSPIVPFSESFGLDDAHNLDTVHSFTNLMWPQGNPTFCESLHT  127

Query  474  fsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNVVFPCHTD  653
             S  + EL   VL+M+FES+G+  HYD +V+ +  L R MKY  P   D++ +    HTD
Sbjct  128  MSSEMLELNLAVLKMIFESFGMANHYDLHVQDSTSLFRVMKYIAPRNGDDSVIALRSHTD  187

Query  654  KTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRVLAPIHKVTM  833
            K  +T+L Q N+V GL+VQ ++G W+ A  P  +F V+ GEA+K WSN R+ A  H+V +
Sbjct  188  KNAITILCQ-NEVQGLQVQTKDGNWVCAMVPQDAFFVIIGEALKVWSNGRLEAARHRVVV  246

Query  834  DANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDS  989
              +G+E R+S G+F+  K    IEVP E VD +HPL ++PF+  D I +F S
Sbjct  247  --SGEEDRFSCGLFTMPKEEAKIEVPREFVDKDHPLLYRPFIFADYISYFVS  296



>ref|XP_003553825.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1.2-like 
[Glycine max]
Length=313

 Score =   255 bits (652),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 133/315 (42%), Positives = 207/315 (66%), Gaps = 11/315 (3%)
 Frame = +3

Query  93    ETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQ  272
             E+P  L VVDF NE++KPG+ +W  AC+ +R   ED+GCF+    KV P+L NS+++A +
Sbjct  8     ESP--LPVVDFINENMKPGTDTWLGACQLVRRGFEDYGCFLARFSKVGPELLNSVYYAME  65

Query  273   QLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHs  452
             +LF LP E K   T++KP HGY GQ+P  P  E+F ID+ ++IE  Q F+ +MW  GN  
Sbjct  66    ELFSLPLETKRRKTSDKPNHGYTGQVPTSPLFESFAIDNPSSIEDCQKFARIMWPTGNDH  125

Query  453   fsessqsfsKIVAELEEKVLRMLFESYGVEK-HYDSYVESTAYLLRYMKYEVPAESDENN  629
               ES   ++K++ EL++ V RM+F+SYG++K   +S++EST Y  R  KY++PA +DE++
Sbjct  126   LCESVNEYTKMLKELDQTVKRMVFDSYGLDKLKCESFLESTNYAFRSYKYKIPA-TDESS  184

Query  630   VVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRVL  809
             V    HTD TF+T+L+Q  +V GLEV+ ++GEW      P  F VMAG+A   WS+ R+ 
Sbjct  185   VGVNSHTDSTFITILHQ--RVDGLEVKLKDGEWFGVDASP-LFCVMAGDAFMVWSSERIR  241

Query  810   APIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDS  989
             A  H+V + +  K  RYS+G+ S+  +SK ++  E+LVD+EHP+++KPF H   + F  +
Sbjct  242   ACEHRVILKS--KVTRYSLGLLSY--SSKMVQTLEDLVDEEHPIRYKPFDHYAYVGFRFT  297

Query  990   DKGRRSKNLLKDFCG  1034
             ++  +  + +K + G
Sbjct  298   EEAVKYTSRIKTYSG  312



>ref|XP_010462135.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
isoform X2 [Camelina sativa]
Length=299

 Score =   255 bits (651),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 134/321 (42%), Positives = 195/321 (61%), Gaps = 26/321 (8%)
 Frame = +3

Query  81    MGSLETPTKLL---VVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHN  251
             MGS ETP   L   V+DF+NE LKPG   W     D++ AL+D+GCF    D++  +L  
Sbjct  1     MGS-ETPLLPLCLPVIDFSNEYLKPGEPEWDLTSADVQKALQDYGCFEASFDRIPIELRK  59

Query  252   SIFHASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLM  431
              +F   ++LFDLP + K+ N ++KP+HGYVGQ P +P +E+ GI+     E V +F+  +
Sbjct  60    LVFETLEELFDLPLQTKLRNVSKKPFHGYVGQYPMVPLYESMGIEDPDVAERVNAFTKPL  119

Query  432   WSGGNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPA  611
             W  GN+SF                   RM+ ES+G++K+ D +++ST YLLR MKY+ P 
Sbjct  120   WPQGNNSFR------------------RMIMESFGLDKYIDEHLQSTNYLLRVMKYKGP-  160

Query  612   ESDENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGW  791
             +++E  +    HTDK  +T+LYQ N V GLEVQ ++  WI  +    SFIVM G+++   
Sbjct  161   DTEETKLGLNAHTDKNIVTILYQ-NHVEGLEVQTKDNNWIKVKPSKDSFIVMIGDSLHAM  219

Query  792   SNSRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDM  971
              N R+ +P H+V M   G E RYS+G+FS  K    I  PEELVD EHP  FKPF H++ 
Sbjct  220   LNGRLHSPNHRVMM--TGTETRYSLGLFSIPKAGHIISSPEELVDQEHPRLFKPFDHVEF  277

Query  972   IKFFDSDKGRRSKNLLKDFCG  1034
             ++F+ +  G+RS++ LK +CG
Sbjct  278   LQFYYTQAGQRSQSALKTYCG  298



>gb|KHN06108.1| Gibberellin 3-beta-dioxygenase 3 [Glycine soja]
Length=313

 Score =   255 bits (652),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 133/315 (42%), Positives = 207/315 (66%), Gaps = 11/315 (3%)
 Frame = +3

Query  93    ETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQ  272
             E+P  L VVDF NE++KPG+ +W  AC+ +R   ED+GCF+    KV P+L NS+++A +
Sbjct  8     ESP--LPVVDFINENMKPGTDTWLGACQLVRRGFEDYGCFLARFSKVGPELLNSVYYAME  65

Query  273   QLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHs  452
             +LF LP E K   T++KP HGY GQ+P  P  E+F ID+ ++IE  Q F+ +MW  GN  
Sbjct  66    ELFSLPLETKRRKTSDKPNHGYTGQVPTSPLFESFAIDNPSSIEDCQKFARIMWPTGNDH  125

Query  453   fsessqsfsKIVAELEEKVLRMLFESYGVEK-HYDSYVESTAYLLRYMKYEVPAESDENN  629
               ES   ++K++ EL++ V RM+F+SYG++K   +S++EST Y  R  KY++PA +DE++
Sbjct  126   LCESVNEYTKMLKELDQTVKRMVFDSYGLDKLKCESFLESTNYAFRSYKYKIPA-TDESS  184

Query  630   VVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRVL  809
             V    HTD TF+T+L+Q  +V GLEV+ ++GEW      P  F VMAG+A   WS+ R+ 
Sbjct  185   VGVNSHTDSTFITILHQ--RVDGLEVKLKDGEWFGVDASP-LFCVMAGDAFMVWSSERIR  241

Query  810   APIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDS  989
             A  H+V + A  K  RYS+G+ S+  +SK ++  E+LVD++HP+++KPF H   + F  +
Sbjct  242   ACEHRVILKA--KVTRYSLGLLSY--SSKMVQTLEDLVDEDHPIRYKPFDHYAYVGFRFT  297

Query  990   DKGRRSKNLLKDFCG  1034
             ++  +  + +K + G
Sbjct  298   EEAVKYTSRIKTYSG  312



>ref|XP_010500908.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
isoform X3 [Camelina sativa]
Length=299

 Score =   254 bits (650),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 134/321 (42%), Positives = 195/321 (61%), Gaps = 26/321 (8%)
 Frame = +3

Query  81    MGSLETPTKLL---VVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHN  251
             MGS ETP   L   V+DF+NE LKPG   W     D++ AL+D+GCF    D++  +L  
Sbjct  1     MGS-ETPLLPLCLPVIDFSNEYLKPGEPEWDLTSADVQKALQDYGCFEASFDRIPIELRK  59

Query  252   SIFHASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLM  431
              +F   ++LFDLP + K+ N ++KP+HGYVGQ P +P +E+ GI+     E V +F+  +
Sbjct  60    LVFETLEELFDLPLQTKLRNVSKKPFHGYVGQYPMVPLYESMGIEDPDVAERVNAFTKPL  119

Query  432   WSGGNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPA  611
             W  GN+SF                   RM+ ES+G++K+ D ++ ST YLLR MKY+ P 
Sbjct  120   WPQGNNSFR------------------RMIMESFGLDKYIDEHLHSTNYLLRVMKYKEP-  160

Query  612   ESDENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGW  791
             +++E  +    HTDK  +T+LYQ N V GLEVQ ++  WI  +    SFIVM G+++   
Sbjct  161   DTEETKLGLNAHTDKNIVTILYQ-NHVEGLEVQTKDNNWIKVKPSKDSFIVMIGDSLHAM  219

Query  792   SNSRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDM  971
              N R+ +P H+V M   G E RYS+G+FS  K    I  PEELVD+EHP  FKPF H++ 
Sbjct  220   LNGRLHSPNHRVMM--TGTETRYSLGLFSIPKAGHIISSPEELVDEEHPRLFKPFDHVEF  277

Query  972   IKFFDSDKGRRSKNLLKDFCG  1034
             ++F+ +  G+RS++ LK +CG
Sbjct  278   LQFYYTQAGQRSQSALKTYCG  298



>ref|XP_011019740.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Populus euphratica]
Length=364

 Score =   256 bits (655),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 140/339 (41%), Positives = 203/339 (60%), Gaps = 15/339 (4%)
 Frame = +3

Query  33    TLVTVNIYIELRKKKNM--GSLETPTKLLVVDFNNE---DLKPGSTSWAHACKDIRTALE  197
             T  T N  IE  ++++M    +E P     +DF+ E    L+  S  W   C  +R A E
Sbjct  35    TCTTANNSIERVRERDMTVSKVEIP----FLDFSEEALTGLEVKSEKWKELCNQVREACE  90

Query  198   DHGCFIVLCDKVSPQLHNSIFHASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAF  377
              HG F ++ DK+   L   +F A + LFDLP E K  + N KPY  Y+G+ P +P+HE+F
Sbjct  91    AHGVFFLVYDKIPSSLREEMFGAMKALFDLPEETKNRHVNPKPYRSYLGKCPVVPFHESF  150

Query  378   GIDHATTIEGVQSFSNLMWSGGNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDS  557
             G+D A T++  Q+F+NLMW  GN SF E+  S S  + EL   V++M++ES+G+EK YDS
Sbjct  151   GVDDAPTLDASQAFTNLMWPEGNPSFCETIHSMSSKMQELNFLVMKMIYESFGIEKLYDS  210

Query  558   YVESTAYLLRYMKYEVPAESDENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISA  737
             ++E T  +L+ MKY+VP    E+ +    HTDK  +T+L Q N+V GLEVQA+NG+W   
Sbjct  211   FLEETTSILKVMKYKVPPSDTESAIGLVAHTDKNAITILCQ-NEVQGLEVQAKNGDWAQV  269

Query  738   QFPPSSFIVMAGEAIKGWSNSRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEE  917
               P ++F  + G+ +K WSN R+ A  H+V +  +G   RYS G+FS  K    IEVP E
Sbjct  270   MVPENAFTAIVGDTVKAWSNGRLHAARHRVVI--SGDRDRYSCGLFSTPKEEAVIEVPNE  327

Query  918   LVDDEHPLQFKPFVHLDMIKFFDSDKGRRSKNLLKDFCG  1034
             LVD EHPLQ++PF   D + +F S   + S + L+ + G
Sbjct  328   LVDKEHPLQYRPFNFSDYLSYFVS---KLSDDALEIYAG  363



>ref|XP_008461057.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
isoform X1 [Cucumis melo]
Length=317

 Score =   254 bits (649),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 142/319 (45%), Positives = 210/319 (66%), Gaps = 12/319 (4%)
 Frame = +3

Query  93    ETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQ  272
             E  +K+++   +   L+ G+  W  ACK++R  LE+ GCF V+ DKVS +LHNSI  A++
Sbjct  4     EAKSKVVIPTIDLSKLEVGTKEWGLACKEMRFGLEEFGCFSVVYDKVSLELHNSIVEATK  63

Query  273   QLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMW-SGGNH  449
             +LF LP E ++ NT+EKPYHGY G   F+P +E+  ID+   ++  QSF+NLMW +  N+
Sbjct  64    ELFHLPIETRMKNTSEKPYHGYFGGYSFLPLYESMAIDNPIQLKSTQSFANLMWPTRDNN  123

Query  450   sfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDS-YVESTAYLLRYMKYEVPAESDEN  626
              F  + + FS +VA+LE+ V +M+ ESYGV K  +   +EST YLLR  KY V AE DE 
Sbjct  124   HFCVTVERFSTLVAKLEKMVTKMVLESYGVSKVVNEPIMESTNYLLRLFKYRV-AEKDET  182

Query  627   NVVFPCHTDKTFMTVLYQLNQVSGLEVQARN-GEWISAQFPPS--SFIVMAGEAIKGWSN  797
             +V    HTD TF ++++Q + +SGL++Q+ N  +W+    P S  SFIVMAG+A+  WSN
Sbjct  183   DVGLHSHTDLTFFSIIHQ-HLISGLQIQSLNDDQWLDVH-PSSHCSFIVMAGDALMAWSN  240

Query  798   SRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIK  977
              R+ +  H+V M   G+E RYS+G+FSF KN  TIEVP+  VDD +PL++KPF H D + 
Sbjct  241   ERIRSCRHRVIM--RGEETRYSIGMFSF-KNG-TIEVPQGFVDDANPLRYKPFNHYDFLT  296

Query  978   FFDSDKGRRSKNLLKDFCG  1034
             +  ++    + + +KD+CG
Sbjct  297   YDKANASHNTISRIKDYCG  315



>emb|CDO98087.1| unnamed protein product [Coffea canephora]
Length=314

 Score =   254 bits (649),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 132/320 (41%), Positives = 210/320 (66%), Gaps = 10/320 (3%)
 Frame = +3

Query  81    MGSLETPTKLL-VVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSI  257
             MGS +T  K L ++ FN+E+L PGS+SW    + +R ALE +GCF+ +   +SP+LH+ +
Sbjct  2     MGSDQTLEKALPIIHFNSENLTPGSSSWLSTSEIVRKALESYGCFVAVYKNISPELHDKM  61

Query  258   FHASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWS  437
              + S++LFD+P E K+ NT++    GY G    +P  E  GI +A T+E  + F+NL+W 
Sbjct  62    LNLSKELFDVPVEIKVQNTSDYLGFGYGGNYSVMPLIEYLGITNAATLEATKDFTNLIWP  121

Query  438   GGNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAES  617
              GN SF E++ S++K + EL+  +++M+ E+YGVEKHY+  V S  +L+R++KY  P  +
Sbjct  122   DGNDSFCETAFSYAKQLLELKNLMMQMVLENYGVEKHYELLVRSAFHLMRFIKYRTPKTN  181

Query  618   DENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSN  797
             + N  + P H DKTF++VL   N V GL+++ ++GEWI     PS+F+V+AGE    WSN
Sbjct  182   EINTGLRP-HVDKTFLSVLAG-NHVKGLQIETKDGEWIDFAPTPSAFLVIAGEGFTAWSN  239

Query  798   SRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELV-DDEHPLQFKPFVHLDMI  974
              +V AP+H+V +   G E++Y++G+FSF+    T+++P EL  DD++PLQFKPF ++  +
Sbjct  240   GKVYAPLHRVII--GGAEEKYTIGLFSFMHG--TLQIPVELADDDQNPLQFKPFNNVAFL  295

Query  975   KFFDSDKGRRSKNLLKDFCG  1034
              +   D    +   +KDFCG
Sbjct  296   DYCSGD--NITARAIKDFCG  313



>emb|CDP20247.1| unnamed protein product [Coffea canephora]
Length=312

 Score =   254 bits (648),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 132/310 (43%), Positives = 193/310 (62%), Gaps = 6/310 (2%)
 Frame = +3

Query  105   KLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQQLFD  284
             +L V++   E L+ G  SW  A   +  A E++GCFI + DK   ++ +S+F   Q LF+
Sbjct  8     RLPVINLTEEILRSGKDSWTEARNIVTRAFEEYGCFIAVHDKYPSEVSDSLFSELQDLFN  67

Query  285   LPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHsfses  464
             LP E K+ NT++ P  GY    P +  +E+  I+ AT +E V+ F+N MW   N+ F E 
Sbjct  68    LPLEIKVQNTSQTPLSGYARPRPNVNLYESMCIEDATNLEAVEKFANQMWPSKNNHFCEL  127

Query  465   sqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNVVFPC  644
                ++  VAEL++ V +++FESYGVEK+++S+V S  Y +R+++Y VP E +E NV    
Sbjct  128   FHCYANQVAELDKMVSKLVFESYGVEKYHESHVGSVTYNVRFIRYRVP-EQNEMNVGVAP  186

Query  645   HTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRVLAPIHK  824
             HTDK F+T+L Q N+  GLEVQ +NG WI   FPPSS ++MAG+    WSN RV +P H+
Sbjct  187   HTDKNFITILQQ-NETDGLEVQLKNGSWIPIDFPPSSVVIMAGDVFSAWSNGRVHSPFHR  245

Query  825   VTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSDKGRR  1004
             VTM   G+  RYS+  FS+ K  K ++ P ELVDDEHPL +KPF     ++F  +++   
Sbjct  246   VTM--KGRGTRYSIAQFSYCK--KLVKTPTELVDDEHPLLYKPFDCFGYLRFLSTNEDWN  301

Query  1005  SKNLLKDFCG  1034
               N LK +CG
Sbjct  302   IPNSLKVYCG  311



>ref|XP_002298128.2| hypothetical protein POPTR_0001s17630g [Populus trichocarpa]
 gb|EEE82933.2| hypothetical protein POPTR_0001s17630g [Populus trichocarpa]
Length=311

 Score =   253 bits (647),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 146/323 (45%), Positives = 205/323 (63%), Gaps = 18/323 (6%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS ET +K+ VV  + E+ +PGS+SW  AC DIR ALE +  F V+  + S + +  I 
Sbjct  1     MGS-ETVSKIPVVHLSKENFEPGSSSWLAACNDIRRALEKYSFFEVVYSEPSMEFYREII  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
                ++LF+LP E K  NT+ K  HGY+G+IP  P  E  GI++AT  +  Q F++LMW  
Sbjct  60    SVLEELFNLPHETKNRNTHPKLGHGYMGKIPGFP--EGLGIEYATKKDECQKFTSLMWPD  117

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN  F +   SF+KI +EL + V+RMLFESYG++K  +  V ST YLLR +KY       
Sbjct  118   GNERFCDVIHSFTKIASELNQMVVRMLFESYGIKKD-EPLVNSTNYLLRLLKY--GRSQG  174

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPS---SFIVMAGEAIKGW  791
             E NV F  H DKTF T+LYQ N V GLE++ + GEWI+  + PS   SF V+AG+    W
Sbjct  175   ETNVGFKAHMDKTFFTLLYQ-NPVKGLEIRTKEGEWIT--YEPSSTTSFAVIAGDVCMAW  231

Query  792   SNSRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDM  971
             SN R+ +  H+V + +  +E RY++G+F+FL     ++ PEELVDDEHPLQ+KPF H  +
Sbjct  232   SNDRIKSSYHRVVVSS--EEDRYALGLFTFLDG--VVQPPEELVDDEHPLQYKPFEHQKL  287

Query  972   IKFFDS--DKGRRSKNLLKDFCG  1034
             + F+ S  D  +R  N++K +CG
Sbjct  288   LDFYQSYNDPNKRDCNIMKAYCG  310



>ref|XP_004252327.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP3 [Solanum 
lycopersicum]
Length=313

 Score =   252 bits (644),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 134/320 (42%), Positives = 204/320 (64%), Gaps = 13/320 (4%)
 Frame = +3

Query  87    SLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHA  266
             + +   KL +++F NE L+ G+TSW    ++IR ALE++GCF  +  KV P+L  ++F  
Sbjct  2     AFQVEPKLPIIEFTNETLRSGTTSWLSTSREIRCALEEYGCFAAVYKKVMPELREAMFDH  61

Query  267   SQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGN  446
              ++LF LP E K+ N ++    GY G+   +P  E FGI +  TI+  + F+N MW   N
Sbjct  62    CKELFKLPLETKLKNNSDIYGFGYSGKFSTMPLAEFFGIVNGETIDATKDFANKMWPNDN  121

Query  447   -HsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDE  623
              H + E S S+SK++ EL++ ++RM+ E YG+EKHY++   S  YL+R +KY  P ++DE
Sbjct  122   VHKYCEESISYSKLIVELDDTIIRMILECYGIEKHYEALKNSCMYLMRLIKYRSP-KNDE  180

Query  624   NNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSF---IVMAGEAIKGWS  794
              ++    H DK+FM ++   NQV GLE+Q R+G WI+  F PSS+   +++AGE    WS
Sbjct  181   KSIGHLPHRDKSFMGII-DTNQVGGLEMQTRDGRWIT--FHPSSYKTLVIIAGEPFTAWS  237

Query  795   NSRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMI  974
             N RV APIH+V M   G E +YS+ +FSF++   T+EVPEEL+D+E+P QFK F +   +
Sbjct  238   NGRVYAPIHRVIM--KGDEDKYSLALFSFMRG--TLEVPEELIDEENPKQFKSFNNFQYL  293

Query  975   KFFDSDKGRRSKNLLKDFCG  1034
             K+  +  G + K+ LK FCG
Sbjct  294   KYCGT-HGYKEKDPLKAFCG  312



>emb|CBI36205.3| unnamed protein product [Vitis vinifera]
Length=270

 Score =   250 bits (639),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 133/275 (48%), Positives = 190/275 (69%), Gaps = 8/275 (3%)
 Frame = +3

Query  81   MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
            MGS ET  KL  ++F+ ++L PG+ SW   C +++ ALE++G F+ + D+V+ ++HN+IF
Sbjct  1    MGS-ETLPKLPTINFSEQNLSPGTNSWFSTCIEVQHALEEYGRFVAVFDEVTLEIHNAIF  59

Query  261  HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
               ++LFDLP E KI NT+ KPYHGYVGQ+PFIP HE+ GI+++TT +GVQSF+ +MW  
Sbjct  60   RTLKELFDLPTETKIQNTSHKPYHGYVGQLPFIPLHESLGINNSTT-QGVQSFTKIMWPA  118

Query  441  GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
            GN  F ES  S+S ++AEL+E V+RM+ ESYG++   DS++ ST + L  MK +VP E  
Sbjct  119  GNQHFYESVDSYSMLLAELQEIVMRMVLESYGIKDGCDSHIGSTTHPLLVMKNQVP-EMP  177

Query  621  ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
             NNV FPCHTDK+F T+L Q  QV GLE++ ++G WI+ + P     V+AG+A   WSN 
Sbjct  178  VNNVTFPCHTDKSFTTILPQ-KQVGGLEIETKDGNWIAFEPPSPLPCVIAGDAFMAWSNG  236

Query  801  RVLAPIHKVTMDANGKEKRYSVG--IFSFLKNSKT  899
            R+ +P H+V   A G E+RYS+G   F  + N  T
Sbjct  237  RIHSPNHQVV--ARGNEERYSLGAAFFQQMDNKNT  269



>ref|XP_011026516.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Populus euphratica]
Length=335

 Score =   252 bits (643),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 130/320 (41%), Positives = 195/320 (61%), Gaps = 9/320 (3%)
 Frame = +3

Query  84    GSLETPTKLLVVDFNNE---DLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNS  254
             G +    ++  +D + E    L+  S  W   C  +R A E HG F ++ DK+   L   
Sbjct  21    GEMAAKVEIPFLDISGEALAGLEVKSEKWKELCNQVREACETHGIFFLVYDKIPTSLREE  80

Query  255   IFHASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMW  434
             +F A + LFDLP E K  + N KPY  Y+G  P IP+HE+FG+D A T++  Q+F+NLMW
Sbjct  81    MFVALKALFDLPEETKNKHVNPKPYRSYLGNCPVIPFHESFGVDDAPTLDASQAFTNLMW  140

Query  435   SGGNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAE  614
               GN SF E+    S  + EL   V++M++ES+ +EK YDS+VE T  + R MKY+VP  
Sbjct  141   PEGNPSFCETIHGMSSKMQELNFLVMKMIYESFDIEKLYDSFVEETTSIFRIMKYKVPPS  200

Query  615   SDENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWS  794
             + ++++    HTDK  +T+L Q N+V GLE+Q +NG+W     P ++F  + G+A+K WS
Sbjct  201   ATDSSIGLVAHTDKNAITILCQ-NEVQGLEIQTKNGDWAQVMVPENAFTAVVGDALKAWS  259

Query  795   NSRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMI  974
             N R+ A  H+V +  +G++ RYS G+FS  K    +EVP+ELVD EHPLQ++PF + D I
Sbjct  260   NGRLHAARHRVVI--SGEKDRYSCGLFSMPKEEAVVEVPDELVDKEHPLQYRPFNYSDYI  317

Query  975   KFFDSDKGRRSKNLLKDFCG  1034
              +F S   + S + L+ + G
Sbjct  318   SYFVS---KLSDDALEIYAG  334



>gb|AFK38656.1| unknown [Lotus japonicus]
Length=317

 Score =   251 bits (641),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 143/323 (44%), Positives = 208/323 (64%), Gaps = 12/323 (4%)
 Frame = +3

Query  81    MGS-LETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSI  257
             MGS  E+   L V+DF++E LKPG+  W   C+ +R+A+EDHG F+ L DKV P L++S+
Sbjct  1     MGSQTESQVPLPVIDFSDEHLKPGTHKWVSTCQAVRSAMEDHGGFLALYDKVDPLLYDSV  60

Query  258   FHASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWS  437
             F A ++LFDLP E K   T +KP   Y  Q P IP +E+  ID+A +    Q ++ +MW 
Sbjct  61    FSAMKRLFDLPSETKGQKTTDKPIFSYAAQCPNIPLYESIAIDNAVSAGDCQKYTTIMWP  120

Query  438   GGNHsfsessqsfsKIVAELEEKVLRMLFESYGVE-KHYDSYVESTAYLLRYMKYEVPAE  614
              GN  FSES  S++K VAEL+  V +M+FESYGV+ + ++S   ST Y+LR  KY  P  
Sbjct  121   QGNDHFSESVNSYAKKVAELDYIVKKMVFESYGVDNQKHESMHASTDYVLRCYKYRTPLV  180

Query  615   SDENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWS  794
              + N  V P HTD  F+T+L Q  +++GLE++ ++G+W   +  PS F V+AGEA+  WS
Sbjct  181   GETNIGVLP-HTDSGFLTILNQ--RLNGLEIKLQDGKWFPVEASPSMFAVLAGEALTVWS  237

Query  795   NSRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMI  974
             N R+ A +H+V M  N K  RYS+G+ S+    K +E  EELVD+EHPL++KPF H    
Sbjct  238   NDRISACLHRVFM--NEKVDRYSLGLLSYA--GKLMEPQEELVDEEHPLRYKPFDHYGYP  293

Query  975   KFFDSDKGRRS-KN--LLKDFCG  1034
             +F+ S++G ++ KN   +K +CG
Sbjct  294   RFYVSEEGVKAFKNGTRIKTYCG  316



>emb|CDP08608.1| unnamed protein product [Coffea canephora]
Length=339

 Score =   251 bits (641),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 136/309 (44%), Positives = 195/309 (63%), Gaps = 10/309 (3%)
 Frame = +3

Query  114   VVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQQLFDLPF  293
             V+ F  E+L PG+ SW   CK +  ALE+  CF+ + DKV P+  +  F + ++LF+LP 
Sbjct  20    VIYFTAENLNPGTGSWFSTCKAVSEALEEFSCFVAVYDKVEPEFISDAFASFKELFNLPM  79

Query  294   EKKILNT-NEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHsfsessq  470
             E K+LNT  ++P  GY+   P  P HE  GI+ +TTI  VQSF+N++W  GN  F E+  
Sbjct  80    ETKLLNTIPDRPAFGYIRPRPETPVHETVGIEDSTTIGAVQSFANVIWPSGNDHFCETIH  139

Query  471   sfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNVVFPCHT  650
             S++K V+E+   V RM+FESYGV K+ DS++EST+YLLR   Y VP E + N  + P HT
Sbjct  140   SYTKQVSEVNRLVSRMIFESYGVGKYSDSHIESTSYLLRANAYRVPHEKEPNLGIIP-HT  198

Query  651   DKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRVLAPIHKVT  830
             D +F++V+ Q + V GL+VQ ++G WI    P SSF VMAG+A+  WSN RV    H+V 
Sbjct  199   DTSFVSVVKQ-DSVQGLQVQLKDGTWIPVHLPQSSFAVMAGDAMLAWSNGRVHPCFHRVI  257

Query  831   MDANGKEK-RYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSDKGRRS  1007
             M    KEK R+S+ +FSF K    ++VP+EL DD +PL+FK F H  ++ F   +     
Sbjct  258   M----KEKARFSIALFSFHKG--VVQVPKELADDNYPLRFKSFDHFGLLNFRLKNPALSC  311

Query  1008  KNLLKDFCG  1034
             +  +K +CG
Sbjct  312   QERVKAYCG  320



>ref|XP_002309592.1| hypothetical protein POPTR_0006s26410g [Populus trichocarpa]
 gb|EEE93115.1| hypothetical protein POPTR_0006s26410g [Populus trichocarpa]
Length=314

 Score =   250 bits (639),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 129/295 (44%), Positives = 182/295 (62%), Gaps = 6/295 (2%)
 Frame = +3

Query  114  VVDFNNE---DLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQQLFD  284
            V+DF+ E    L+  S  W   C  +R A E HG F ++ DK+   L   +F A + LFD
Sbjct  10   VLDFSEEALTGLEVKSEKWKELCNQVREACETHGVFFLVYDKIPGSLREEMFGAMKALFD  69

Query  285  LPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHsfses  464
            LP E K  + N KPY  Y+G+ P IP+HE+FG+D A T++  Q+F+ LMW  GN SF E+
Sbjct  70   LPEETKNRHVNPKPYRSYLGKCPVIPFHESFGVDDAPTLDASQAFTTLMWPEGNPSFCET  129

Query  465  sqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNVVFPC  644
              S S  + EL   V++M++ES+G+EK YDS++E T  +L+ MKY+VP    E+ +    
Sbjct  130  IHSMSSKMQELNFLVMKMIYESFGIEKLYDSFLEETTSILKVMKYKVPPSDTESAIGLVA  189

Query  645  HTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRVLAPIHK  824
            HTDK  +T+L Q N+V GLEVQ +NG+W     P ++F  + G+ +K WSN R+ A  H+
Sbjct  190  HTDKNAITILCQ-NEVQGLEVQTKNGDWAQVMVPENAFTAIVGDTVKAWSNGRLHAARHR  248

Query  825  VTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDS  989
            V +  +G   RYS G+FS  K    IEVP ELVD EHPLQ++PF   D + +F S
Sbjct  249  VVI--SGDRDRYSCGLFSTPKEEAVIEVPNELVDKEHPLQYRPFNFSDYLSYFVS  301



>gb|AFK44600.1| unknown [Lotus japonicus]
Length=336

 Score =   251 bits (640),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 141/323 (44%), Positives = 208/323 (64%), Gaps = 12/323 (4%)
 Frame = +3

Query  81    MGS-LETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSI  257
             MGS  E+   L  +DF++E LKPG+  W   C+ +R+A+EDHG F+ L DKV P L++S+
Sbjct  20    MGSQTESQVPLPAIDFSDEHLKPGTHKWVSTCQAVRSAMEDHGGFLALYDKVDPLLYDSV  79

Query  258   FHASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWS  437
             F A ++LFDLP E K   T +KP   Y  Q P IP +E+  ID+A +    Q ++ +MW 
Sbjct  80    FSAMKRLFDLPSETKGQKTTDKPIFSYAAQCPNIPLYESIAIDNAVSAGDCQKYTTIMWP  139

Query  438   GGNHsfsessqsfsKIVAELEEKVLRMLFESYGVE-KHYDSYVESTAYLLRYMKYEVPAE  614
              GN  FSES  S++K VAEL+  V +M+FESYGV+ + ++S   ST Y+LR  KY  P  
Sbjct  140   QGNDHFSESVNSYAKKVAELDYIVKKMVFESYGVDNQKHESMHASTDYVLRCYKYRTPLV  199

Query  615   SDENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWS  794
              + N  V P HTD  F+T++ Q  +++GLE++ ++G+W   +  PS F V+AGEA+  WS
Sbjct  200   GETNIGVLP-HTDSGFLTIINQ--RLNGLEIKLQDGKWFPVEASPSMFAVLAGEALTVWS  256

Query  795   NSRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMI  974
             N R+ A +H+V M  N K  RYS+G+ S+    K +E  EELVD+EHPL++KPF H   +
Sbjct  257   NDRISACLHRVFM--NEKVDRYSLGLLSYA--GKLMEPQEELVDEEHPLRYKPFDHYGYL  312

Query  975   KFFDSDKGRRS-KN--LLKDFCG  1034
             +F+ S++G ++ KN   +K +CG
Sbjct  313   RFYVSEEGVKAFKNGTRIKTYCG  335



>ref|XP_002324836.1| hypothetical protein POPTR_0018s01190g [Populus trichocarpa]
 gb|EEF03401.1| hypothetical protein POPTR_0018s01190g [Populus trichocarpa]
Length=313

 Score =   249 bits (636),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 126/295 (43%), Positives = 184/295 (62%), Gaps = 6/295 (2%)
 Frame = +3

Query  150   STSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQQLFDLPFEKKILNTNEKPY  329
             S  W   C  +R A E HG F ++ DK+   L   +F A + LFDLP E K  + N KPY
Sbjct  24    SEKWKELCNQVREACETHGIFFLVYDKIPTSLREEMFVALKALFDLPEETKNKHVNPKPY  83

Query  330   HGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHsfsessqsfsKIVAELEEKV  509
               Y+G  P IP+HE+FG+D A T++  Q+F+NLMW  GN SF E+    S  + EL   V
Sbjct  84    RSYLGNCPVIPFHESFGVDDAPTLDASQAFTNLMWPEGNPSFCETIHGMSSKMQELNFLV  143

Query  510   LRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNVVFPCHTDKTFMTVLYQLNQ  689
             ++M++ES+ +EK YDS+VE T  + R MKY+VP  + ++++    HTDK  +T+L Q N+
Sbjct  144   MKMIYESFDIEKLYDSFVEETTSIFRIMKYKVPPSATDSSIGLVAHTDKNAITILCQ-NE  202

Query  690   VSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRVLAPIHKVTMDANGKEKRYSVG  869
             V GLE+Q +NG W     P ++F  + G+A+K WSN R+ A  H+V +  +G++ RYS G
Sbjct  203   VQGLEIQTKNGYWAQVMVPENAFTAVVGDALKAWSNGRLHAARHRVVI--SGEKDRYSCG  260

Query  870   IFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSDKGRRSKNLLKDFCG  1034
             +FS  K    +EVP+ELVD EHPLQ++PF + D I +F S   + S + L+ + G
Sbjct  261   LFSMPKEEAVVEVPDELVDKEHPLQYRPFNYSDYISYFVS---KLSDDALEIYAG  312



>ref|XP_004229768.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP2-like [Solanum 
lycopersicum]
Length=315

 Score =   249 bits (635),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 127/299 (42%), Positives = 191/299 (64%), Gaps = 9/299 (3%)
 Frame = +3

Query  150   STSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQQLFDLPFEKKILNTNEKPY  329
             S SW   C ++R ALE+HG FI L +  + ++   IF   ++LFDLP E K  NT++  +
Sbjct  18    SNSWVPLCNEVRHALEEHGYFIALYEDANNKISKEIFDVMEELFDLPIETKRKNTSDVYF  77

Query  330   HGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHsfsessqsfsKIVAELEEKV  509
             + Y GQ+   P HE+FGI H T +E +QSF+ LMW  GN  F E+  S+ K+ AE+E+ V
Sbjct  78    YRYKGQLLTAPLHESFGIPHPTDVEALQSFTTLMWPQGNQRFCETMTSYIKVGAEIEQLV  137

Query  510   LRMLFESYGV-EKHYDSYVESTAYLLRYMKYEVP---AESDENNVVFPCHTDKTFMTVLY  677
              +M+FESYG+ EKHY+S+V +T YLLR  KY      AE    NV    HTDK F  VL+
Sbjct  138   DKMVFESYGLPEKHYESHVAATTYLLRPTKYRAAPAGAEDGIGNVGSNIHTDKGFSAVLF  197

Query  678   QLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRVLAPIHKVTMDANGKEKR  857
             Q NQ++ L+++ ++GEWI    PPS+F+ +AG+A + WSN R+ +P H+V M  +  ++R
Sbjct  198   Q-NQINALQIETKSGEWIPIDVPPSAFVFVAGDAYEAWSNGRIYSPRHQVLMKED--KQR  254

Query  858   YSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSDKGRRSKNLLKDFCG  1034
             Y++ +F+F  N    ++PEELVD+ HPLQ+KPF + D++ ++ +     +    K +CG
Sbjct  255   YTLALFTF--NKGITDIPEELVDETHPLQYKPFDNFDLVMYYSTGASPMAYGTAKPYCG  311



>ref|XP_006348005.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP2-like [Solanum 
tuberosum]
Length=315

 Score =   248 bits (634),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 127/299 (42%), Positives = 190/299 (64%), Gaps = 9/299 (3%)
 Frame = +3

Query  150   STSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQQLFDLPFEKKILNTNEKPY  329
             S SW   C ++R ALE+HG FI L +  + ++   IF   ++LFDLP E K  NT++  +
Sbjct  18    SNSWVPLCNEVRHALEEHGYFIALYEDANNKISKEIFDVMEELFDLPIETKKKNTSDIYF  77

Query  330   HGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHsfsessqsfsKIVAELEEKV  509
             + Y GQ+   P HE+FGI H   IE +QSF+ LMW  GN  F E+  S+ K+ AE+E+ V
Sbjct  78    YRYKGQLVTAPLHESFGIPHPNDIEALQSFTTLMWPQGNQRFCETMTSYIKVGAEIEQLV  137

Query  510   LRMLFESYGV-EKHYDSYVESTAYLLRYMKYEVP---AESDENNVVFPCHTDKTFMTVLY  677
              +M+FESYG+ E+HY+S+V +T YLLR  KY      AE    NV    HTDK F  VL+
Sbjct  138   DKMVFESYGLPERHYESHVAATTYLLRPTKYRAAPAGAEDGIGNVGSNIHTDKGFSAVLF  197

Query  678   QLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRVLAPIHKVTMDANGKEKR  857
             Q NQ++ L+++ ++GEWI    PPS+F+ +AG+A + WSN R+ +P HKV M  +  ++R
Sbjct  198   Q-NQINALQIETKSGEWIPIDVPPSAFVYVAGDAYEAWSNGRIYSPRHKVLMKED--KER  254

Query  858   YSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSDKGRRSKNLLKDFCG  1034
             Y++ +F+F  N    ++PEELVD+ HPLQ+KPF + D++ ++ +     +    K +CG
Sbjct  255   YTLALFTF--NKGITDIPEELVDETHPLQYKPFDNFDLVMYYSTGASSMAHGTAKPYCG  311



>ref|XP_007145557.1| hypothetical protein PHAVU_007G248700g [Phaseolus vulgaris]
 gb|ESW17551.1| hypothetical protein PHAVU_007G248700g [Phaseolus vulgaris]
Length=312

 Score =   248 bits (634),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 135/319 (42%), Positives = 204/319 (64%), Gaps = 9/319 (3%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS ET ++L VVDF N++LK G+ +W   C+ +R+ALEDHG F+ L D +S Q ++SI+
Sbjct  1     MGS-ETQSQLQVVDFTNQNLKEGTETWVSTCQVVRSALEDHGAFLALYDNISLQTYDSIY  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
                 +LFDL  E K   T EKP   Y GQ P IP +E+ GI +  + +  Q ++++MW  
Sbjct  60    SEMSKLFDLSTETKRRKTTEKPIFSYSGQRPSIPLYESAGIINPLSFQDCQKYTHVMWPQ  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVE-KHYDSYVESTAYLLRYMKYEVPAES  617
             GNH F +S  S++K + EL+  V RM+FESYGVE K  +S +EST Y+LR  KY  P E 
Sbjct  120   GNHHFCKSVNSYAKNLVELDHIVKRMMFESYGVERKKLESLLESTEYVLRGYKYRKP-EV  178

Query  618   DENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSN  797
              E+N+  P H+D   +T+L Q  +V GL V+ + GEW      PS ++VM G+A+  WSN
Sbjct  179   GESNLGVPPHSDTALLTILNQ--KVEGLGVKLKGGEWFEVGVSPSLYLVMGGDALMVWSN  236

Query  798   SRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIK  977
              R+ A  H+V + +  K++RYS+G+ S++  +K +E  E LVD+EHPL++KP  H   ++
Sbjct  237   GRIPACEHRVLVKS--KKERYSMGLLSYV--NKIMEPEEGLVDEEHPLRYKPLDHYGYLR  292

Query  978   FFDSDKGRRSKNLLKDFCG  1034
             FF +++  +S + +  +CG
Sbjct  293   FFITEEALKSDSRINAYCG  311



>ref|XP_008227259.1| PREDICTED: probable inactive 2-oxoglutarate-dependent dioxygenase 
AOP2 [Prunus mume]
Length=315

 Score =   248 bits (633),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 133/319 (42%), Positives = 202/319 (63%), Gaps = 8/319 (3%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS   PT L  ++F+ EDLKPGS SW    K +R ALE++GCF+   +++S +L NSIF
Sbjct  1     MGSQTKPT-LPAINFSIEDLKPGSASWLSTAKQVRFALEEYGCFVAQYEQISGELLNSIF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
               ++ LF++P E K+ N  E+PY G++G  P +P +E+  ID+ T+ +  Q F NLMW  
Sbjct  60    GQAKDLFEVPKENKVKNVGEEPYRGHMGPNPLLPLYESLCIDNVTSPQETQKFKNLMWPE  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             G  +F E++ SF +++A+LE  V +++FE YG+ K Y+S   S  +LLR++KY VP + D
Sbjct  120   GKTNFCETTDSFGQLLADLERTVEQLIFEGYGIGKQYESVGNSNGHLLRFIKYTVPEDKD  179

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
                V FP HTD  F T++ Q +++ GLEV+ + G+WI  +  PS F+ MAG+  + WSN 
Sbjct  180   A-TVRFPSHTDINFTTIVVQ-HEIPGLEVKTKEGDWIDVECAPSQFVFMAGDGFQVWSND  237

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMI-K  977
             RV A  H+V    N  + RYS+G+F+F  N+   +VPEELVD+ HPL + PF     I K
Sbjct  238   RVKACHHRVKHCGN--KTRYSIGLFTF--NNGIFQVPEELVDESHPLLYNPFDSRAFIRK  293

Query  978   FFDSDKGRRSKNLLKDFCG  1034
             +  + + ++  + +K F G
Sbjct  294   YATTPELKKEPSPIKAFAG  312



>ref|XP_006365982.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1.2-like 
[Solanum tuberosum]
Length=314

 Score =   248 bits (633),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 133/315 (42%), Positives = 198/315 (63%), Gaps = 9/315 (3%)
 Frame = +3

Query  105   KLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQQLFD  284
             KL  +DF +EDLK G+  W      +  AL ++GCF    DK+S  L  SIF  SQ+LFD
Sbjct  3     KLPEIDFFHEDLKSGTLVWNQVKSQVHKALVEYGCFEASFDKISIHLKKSIFEVSQELFD  62

Query  285   LPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHsfses  464
             LP + K+ N + +P HGY+G  P IP +E+  I+ A      + F+  +W  G  SF ++
Sbjct  63    LPLQTKLKNISTRPLHGYIGPCPQIPLYESLCIEDANIHNKAEKFTQTLWPQGKSSFCKT  122

Query  465   sqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNVVFPC  644
              QS+S+ ++EL++ V RM+ ES G+EK+ D ++ ST YLLR MKY+ P +S E  +    
Sbjct  123   IQSYSEKLSELDQIVNRMILESLGMEKYMDEHMNSTNYLLRLMKYKAP-QSSETEMGMNV  181

Query  645   HTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRVLAPIHK  824
             HTD + +T+LYQ NQV+GL++  ++G+WI+A   P +FIVM G+ +  W+N R+ AP H+
Sbjct  182   HTDTSNLTILYQ-NQVNGLQILTKDGQWINADPTPDTFIVMIGDPLHAWTNGRLHAPYHR  240

Query  825   VTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFF-----DS  989
             V M   GKE RYS+G FS  K    I+ P+ELVD++HPL FKPFVH + + F      ++
Sbjct  241   VIM--RGKEARYSIGFFSRPKAGHIIKTPKELVDEDHPLLFKPFVHAEYLDFCYRAFNNT  298

Query  990   DKGRRSKNLLKDFCG  1034
              +G   +++LK + G
Sbjct  299   KEGMGCESILKTYYG  313



>ref|XP_006348004.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1-like 
[Solanum tuberosum]
Length=316

 Score =   248 bits (632),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 128/300 (43%), Positives = 192/300 (64%), Gaps = 10/300 (3%)
 Frame = +3

Query  150   STSWAHACKDIRTALEDHGCFIVLCDK-VSPQLHNSIFHASQQLFDLPFEKKILNTNEKP  326
             S SW   C ++R ALE+HG FI L D   + ++   IF   ++LFDLP E K  NT++  
Sbjct  18    SNSWVPLCNEVRHALEEHGYFIALYDDDNNNKISKEIFEVVEELFDLPIETKKKNTSDFL  77

Query  327   YHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHsfsessqsfsKIVAELEEK  506
             ++ + GQ+   P HE+FGI H T +E +QSF+ LMW  GN  F E+  S+ K+ AE+E+ 
Sbjct  78    FYQWNGQLKAAPLHESFGIPHPTDVEALQSFTTLMWPQGNQKFCETVASYVKVAAEVEQL  137

Query  507   VLRMLFESYGV-EKHYDSYVESTAYLLRYMKYEVP---AESDENNVVFPCHTDKTFMTVL  674
             V +M+FESYGV E HY+S+V +T YLLR +KY  P   AE   +N+    HTDK+F T+L
Sbjct  138   VDKMVFESYGVAETHYESHVAATTYLLRPIKYRAPLQGAEDGTSNIGSNIHTDKSFSTLL  197

Query  675   YQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRVLAPIHKVTMDANGKEK  854
             +Q NQ++ L+V+ +NGEW+    PPS+F+ MAG+A + WSN R+ A  H+V M  +  ++
Sbjct  198   FQ-NQINALQVETKNGEWVDVDVPPSAFVFMAGDAYEAWSNGRIYAARHQVLMKED--KQ  254

Query  855   RYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSDKGRRSKNLLKDFCG  1034
             RY++ +F+F  N    ++PEELVD+ HP+Q+KPF +  +  ++ S     +    K +CG
Sbjct  255   RYTLALFTF--NKGITDIPEELVDETHPIQYKPFDNFGLAWYYLSGASSMTHGTAKPYCG  312



>ref|XP_009802367.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP3-like [Nicotiana 
sylvestris]
Length=313

 Score =   246 bits (629),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 130/314 (41%), Positives = 204/314 (65%), Gaps = 13/314 (4%)
 Frame = +3

Query  105   KLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQQLFD  284
             KL +++F +E+L  G+TSW    ++IR ALE++GCF  +  KVSP+L  ++F+  ++LF 
Sbjct  8     KLPIIEFTDENLSSGTTSWISTSQEIRRALEEYGCFAAVYKKVSPELREAMFNHCKELFQ  67

Query  285   LPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGN-Hsfse  461
             LP E K+ NT++    GY G  P +P  E FGI++  T+   ++F+  MW  GN   F E
Sbjct  68    LPLEAKLQNTSDVLGFGYGGNFPNMPLAEYFGIENGGTLGSTKNFAKQMWPNGNVDKFCE  127

Query  462   ssqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNVVFP  641
              + S+SK++ EL++ V++M+  SYG+EK+YD    S  YL+R++KY  P + DE N+   
Sbjct  128   ETISYSKLIVELDDAVIQMILGSYGLEKYYDPLKNSYMYLMRFIKYRSP-KIDEINIGHL  186

Query  642   CHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSF---IVMAGEAIKGWSNSRVLA  812
              H DK+FM ++   NQV GLE+Q R+G W++  F PSS+   + +AGE    WSN RV A
Sbjct  187   PHRDKSFMGII-DTNQVGGLEMQTRDGNWMT--FNPSSYKTVVFIAGEPFTAWSNGRVYA  243

Query  813   PIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSD  992
             P+H+V M   G + +YS+ +FSF++   T+++PEEL+D+E+P  FK F H + +K+  +D
Sbjct  244   PMHRVIM--KGTDDKYSLALFSFMRG--TVKIPEELIDEENPQYFKSFDHFEYLKYCATD  299

Query  993   KGRRSKNLLKDFCG  1034
              G + KN +K +CG
Sbjct  300   -GWKEKNPIKAYCG  312



>ref|XP_010047771.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Eucalyptus grandis]
 gb|KCW79750.1| hypothetical protein EUGRSUZ_C01096 [Eucalyptus grandis]
Length=313

 Score =   246 bits (629),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 131/319 (41%), Positives = 199/319 (62%), Gaps = 8/319 (3%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MG+L +P KL ++DF   D+KPGS  W    +++  ALE++GCF    DK+S +LH+ +F
Sbjct  1     MGAL-SPPKLPLIDFCKNDMKPGSADWDSVQREVVKALEEYGCFEARYDKISVELHDEVF  59

Query  261   HASQQLFDLPFEKKILNTN-EKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWS  437
                + LF+LP + K L  +  KPY GY+  +P +  +EA GI       G+Q  +NLMW 
Sbjct  60    RQVEDLFNLPAKTKRLFVDPRKPYDGYITNLPNLSLYEAIGISGMLDSGGIQKLANLMWP  119

Query  438   GGNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAES  617
              GN  F E+  S++  ++ELE  + RM+F+S GVEK+ DS+ +S  + +R M+Y+ P  +
Sbjct  120   QGNPKFCETLTSYAMRLSELESLITRMVFQSLGVEKYLDSHTKSLNHSIRAMRYKSPM-T  178

Query  618   DENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSN  797
              E  V    H DK F+T+L Q N V+GLEVQ ++G W       S+ +VM GE++ GWSN
Sbjct  179   QEPQVGASSHCDKNFLTILQQ-NHVNGLEVQTKDGRWSPVAPSASTLVVMVGESLLGWSN  237

Query  798   SRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIK  977
              R+  P H+V M  +G E RYS+G FS ++    IE P ELVD++HPL FKPF  + +++
Sbjct  238   GRLHCPRHQVMM--SGNETRYSIGSFSAIRG--VIECPCELVDEQHPLLFKPFDEVGLLR  293

Query  978   FFDSDKGRRSKNLLKDFCG  1034
             F  +++G  +++ LK +CG
Sbjct  294   FSLTEQGHEAESTLKAYCG  312



>ref|XP_009608401.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP3-like [Nicotiana 
tomentosiformis]
Length=313

 Score =   246 bits (628),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 130/314 (41%), Positives = 202/314 (64%), Gaps = 13/314 (4%)
 Frame = +3

Query  105   KLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQQLFD  284
             KL +++F +E+L  G++ W    ++IR ALE++GCF  +  KVSP+L  ++F+  ++LF 
Sbjct  8     KLPIIEFTDENLSSGTSCWISTSQEIRRALEEYGCFAAVYKKVSPELREAMFNHCKELFQ  67

Query  285   LPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGN-Hsfse  461
             LP E K+ NT++    GY G  P +P  E FGI++  T+    +F+  MW   N   F E
Sbjct  68    LPLEVKLQNTSDVLGFGYGGNFPNMPLAEYFGIENGGTLNSTNNFAKQMWPNANVDKFCE  127

Query  462   ssqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNVVFP  641
              + S+SK++AEL++ V+RM+ ESY +EK+Y+    S  YL+R++KY  P + +E N+   
Sbjct  128   ETLSYSKLIAELDDAVIRMMLESYSLEKYYEPVKNSCMYLMRFIKYRSP-KMNEINIGHL  186

Query  642   CHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSF---IVMAGEAIKGWSNSRVLA  812
              H DK+FM ++   NQV GLE+Q R+G WI+  F PSS+   + +AGE    WSN RV A
Sbjct  187   PHRDKSFMGII-DTNQVGGLEMQTRDGNWIT--FNPSSYKTVVFIAGEPFTAWSNGRVYA  243

Query  813   PIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSD  992
             PIH+V M   G E +YS+ +FSF++   T+++PEEL+D+E+P  FK F H + +K+  +D
Sbjct  244   PIHRVIM--KGSEDKYSLALFSFMRG--TVKIPEELIDEENPQHFKSFDHFEYLKYCATD  299

Query  993   KGRRSKNLLKDFCG  1034
              G + KN +K +CG
Sbjct  300   -GWKEKNPIKSYCG  312



>ref|XP_003555065.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP3-like [Glycine 
max]
 gb|KHN05760.1| Gibberellin 20 oxidase 1 [Glycine soja]
Length=312

 Score =   246 bits (627),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 131/314 (42%), Positives = 202/314 (64%), Gaps = 8/314 (3%)
 Frame = +3

Query  96    TPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQQ  275
             T ++L +VDF NE+LKPG+ +W  A + +R+ALEDHG F+ L DKVS + ++S++     
Sbjct  5     TQSQLPIVDFTNENLKPGTDAWVSASQVVRSALEDHGGFLALYDKVSLETYDSVYSEMMN  64

Query  276   LFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHsf  455
              FDL  + K   T EKP   Y GQ+P IP +E+ GI +  + +  Q ++++MW  GN  F
Sbjct  65    FFDLSIKTKRRKTTEKPIFSYSGQLPGIPLYESVGIMNPLSFQDCQKYTHVMWPQGNDHF  124

Query  456   sessqsfsKIVAELEEKVLRMLFESYGVE-KHYDSYVESTAYLLRYMKYEVPAESDENNV  632
              ES  S++K + EL+  V RM+FE+YG+E K +D+ +EST Y+LR  KY +P   + N  
Sbjct  125   CESVNSYAKKLVELDHIVKRMVFENYGIETKKFDTLLESTEYVLRAYKYRIPQVGESNLG  184

Query  633   VFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRVLA  812
             V P H+D  F+T+L Q  +V GL V+ ++G+W      PS ++VM G+A+  WSN R+ A
Sbjct  185   VAP-HSDTAFITILNQ--KVEGLGVKLKDGKWFEVGASPSLYLVMGGDALMVWSNDRIPA  241

Query  813   PIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSD  992
               H+V +  N K  RYS+G+ S+   +K +E  EELVD+EHPL++KPF H   ++FF ++
Sbjct  242   CEHRVLI--NSKIDRYSMGLLSY--AAKIMEPQEELVDEEHPLRYKPFDHYGYLRFFLTE  297

Query  993   KGRRSKNLLKDFCG  1034
             +  +S + +K +CG
Sbjct  298   EAIKSDSRIKAYCG  311



>ref|XP_003547720.1| PREDICTED: probable inactive 2-oxoglutarate-dependent dioxygenase 
AOP2-like [Glycine max]
Length=312

 Score =   245 bits (626),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 133/315 (42%), Positives = 202/315 (64%), Gaps = 8/315 (3%)
 Frame = +3

Query  93    ETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQ  272
             +T ++L VVDF N++LKPG+ +W  A + +R ALEDHG F+ L DKVS + ++S++    
Sbjct  4     QTQSELPVVDFTNKNLKPGTDAWVSASQVVRGALEDHGGFLALYDKVSLETYDSVYSEMM  63

Query  273   QLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHs  452
               FDL  E K   T EKP   Y GQ P IP +E+ GI +  + +  Q ++++MW   NH 
Sbjct  64    NFFDLSIETKRRKTTEKPIFSYSGQRPGIPLYESVGIMNPLSFQDCQKYTHVMWPQENHH  123

Query  453   fsessqsfsKIVAELEEKVLRMLFESYGVE-KHYDSYVESTAYLLRYMKYEVPAESDENN  629
             F ES  S++K + EL+  V RM+FESYG+E K +++ +EST Y+LR  KY +P E + N 
Sbjct  124   FCESVNSYAKQLVELDHIVKRMVFESYGLETKKFETLLESTEYVLRGYKYRIPREGESNL  183

Query  630   VVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRVL  809
              V P H D  F+T+L Q  +V GL V+ ++G+W+     PS ++VM G+A+  WSN R+ 
Sbjct  184   GVAP-HCDTAFLTILNQ--KVEGLGVKLKDGKWLEVGASPSLYLVMGGDALMVWSNDRIP  240

Query  810   APIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDS  989
             A  H+V M  N K  RYS+G+ S+   +K +E  EELVD+E+PL++KPF H   ++FF +
Sbjct  241   ACEHRVLM--NSKIDRYSMGLLSY--AAKIMEPQEELVDEEYPLRYKPFDHYGYLRFFLT  296

Query  990   DKGRRSKNLLKDFCG  1034
             ++  +S + +K +CG
Sbjct  297   EEAIKSDSRIKAYCG  311



>gb|KDO58205.1| hypothetical protein CISIN_1g045288mg [Citrus sinensis]
Length=236

 Score =   243 bits (619),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 124/235 (53%), Positives = 177/235 (75%), Gaps = 5/235 (2%)
 Frame = +3

Query  81   MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
            MGSL  P KL VV+ + E+LKPG++SW    + +R ALE+ GCF+ L D+VS +LHN+IF
Sbjct  1    MGSLSVP-KLPVVNLSKENLKPGASSWLGTSRKVREALEEFGCFVALYDEVSLELHNAIF  59

Query  261  HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIP-YHEAFGIDHATTIEGVQSFSNLMWS  437
             A+++LF+LP E K  N +EKPY+GY+G  P +P  +E  G+D+A TIEG Q+F+NL+W 
Sbjct  60   SAAEELFNLPIEIKEKNVSEKPYYGYLGNNPLVPAIYEGMGVDYANTIEGTQNFTNLIWP  119

Query  438  GGNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAES  617
             GN +F ++  S+S++V+ELE+ V RM+FESYGV+K+YDS +ES+ YLLR MKY  P E+
Sbjct  120  EGNENFCKTVVSYSRLVSELEQMVKRMVFESYGVDKYYDSVLESSTYLLRIMKYRCP-ET  178

Query  618  DENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFP-PSSFIVMAGEA  779
            +E N+    HTDK+F+TVL+Q N+V+GLE++ ++G WI    P PSSFIV+AG+A
Sbjct  179  NEKNLGCDVHTDKSFITVLHQ-NEVNGLEIRTKDGCWIGFDDPTPSSFIVLAGDA  232



>ref|XP_002515914.1| Flavonol synthase/flavanone 3-hydroxylase, putative [Ricinus 
communis]
 gb|EEF46334.1| Flavonol synthase/flavanone 3-hydroxylase, putative [Ricinus 
communis]
Length=314

 Score =   245 bits (625),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 128/318 (40%), Positives = 200/318 (63%), Gaps = 5/318 (2%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS ET  KL  +DF++ +LKPG+  W      +R A E++GCF  L   +S +L  ++ 
Sbjct  1     MGS-ETTFKLPAIDFSSTELKPGNPLWETVKSQVRKAAEEYGCFEALFQDISQELRKAMD  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              A +++F LP E K LN +++P+HGY+G    +  +E+ G D       V+SF+N+MW  
Sbjct  60    GALEEIFALPLEIKKLNVSDRPFHGYIGSSSPLSLYESIGFDDPDNFHKVESFTNIMWPQ  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             GN +FS +  SFSK + EL++ + +M+ ES+G+EK+ D ++ S   + R  KY  P  +D
Sbjct  120   GNINFSTTVHSFSKTLTELDQMIRKMIVESFGMEKYLDEHMNSAYNIFRVTKYAAPETTD  179

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
             +   +   HTDK   ++LYQ NQ+ GLE+Q ++GEWI+ +F P SFIV+ GE++  W+N 
Sbjct  180   KKTGL-RAHTDKNTTSILYQ-NQIDGLEIQTKDGEWINVEFSPYSFIVIIGESLNAWTNG  237

Query  801   RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKF  980
             R+ +P H+V M  +G + RYS  +F+  K    I+  EELVDDEHPLQFKPF +L+ +K 
Sbjct  238   RLHSPCHRVMM--SGSKTRYSAVLFTVPKEGYVIKAVEELVDDEHPLQFKPFEYLEYLKL  295

Query  981   FDSDKGRRSKNLLKDFCG  1034
               ++ G+  ++ LK + G
Sbjct  296   RYAEVGKNFESPLKAYFG  313



>ref|XP_007214111.1| hypothetical protein PRUPE_ppa017120mg [Prunus persica]
 gb|EMJ15310.1| hypothetical protein PRUPE_ppa017120mg [Prunus persica]
Length=296

 Score =   244 bits (623),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 126/292 (43%), Positives = 191/292 (65%), Gaps = 7/292 (2%)
 Frame = +3

Query  81   MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
            MGS   PT L  ++F+ EDLKPGS SW    K +R  LE++GCF+   +++S +L NSIF
Sbjct  1    MGSQTKPT-LPTINFSIEDLKPGSASWLSTAKQVRFGLEEYGCFVAQYEQISGELLNSIF  59

Query  261  HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
              ++ LF++P E K+ N  E+PY G++G  P +P +E+  ID+ T+ +  Q F NLMW  
Sbjct  60   GQAKDLFEVPKENKVKNVGEEPYRGHMGPNPLLPLYESLCIDNVTSPQETQKFKNLMWPE  119

Query  441  GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
            G  +F E++ SF +++A+LE  V +++FESYG+ K Y+S   S  +LLR++KY VP ++D
Sbjct  120  GKTNFCETTDSFGQLLADLERTVEQLIFESYGIGKQYESVGSSNGHLLRFIKYTVPEDND  179

Query  621  ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNS  800
               + FP HTD  F T++ Q + + GLEV+ + G+WI  +  PS F+ MAG+ ++ WSN 
Sbjct  180  -TTLRFPSHTDINFTTIVVQ-HDIPGLEVKTKEGDWIDVECAPSQFVFMAGDGLQVWSND  237

Query  801  RVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPF  956
            RV A  H+V    N  + RYS+G+F+F  N+   +VP+ELVD+ HPL + PF
Sbjct  238  RVKACHHRVKHCGN--KTRYSIGLFTF--NNGIFQVPQELVDESHPLLYNPF  285



>ref|XP_007024016.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein, putative [Theobroma cacao]
 gb|EOY26638.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein, putative [Theobroma cacao]
Length=319

 Score =   245 bits (625),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 138/325 (42%), Positives = 207/325 (64%), Gaps = 10/325 (3%)
 Frame = +3

Query  63    LRKKKNMGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQ  242
             + K   M S ETP +L V+D + +DLKPGS  W      +R AL+++GCF  L DKV  +
Sbjct  1     MTKSAEMSS-ETPVRLPVIDSSKQDLKPGSADWELVKVQVRQALQEYGCFEALFDKVL-E  58

Query  243   LHNSIFHASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGV-QSF  419
             L   +  A ++LFDLP + K    +EK + GY G  P  P HE+  ID A   E V Q  
Sbjct  59    LGKPLIGALEELFDLPLQTKTRYVSEKVFRGYYG--PKAPLHESMVIDEANVAENVEQRL  116

Query  420   SNLMWSGGNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKY  599
             +N++W  GN SFSE+  SFS + + LE+ + RM+ ES+G+EK+ D ++EST Y+LR MKY
Sbjct  117   TNILWPQGNSSFSETLLSFSSLASGLEKTIRRMILESFGLEKYMDKHMESTNYILRVMKY  176

Query  600   EVPAESDENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEA  779
             E P  S E  +    H+D+  +T+L+Q N+V+GLE+Q ++GEWI+ +  P+SFIVM GE+
Sbjct  177   EGPHTS-EPTIGARAHSDQNMVTLLHQ-NEVNGLEIQTKDGEWINVKPSPASFIVMIGES  234

Query  780   IKGWSNSRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFV  959
             +  W N R+ +P H+V +   G + RYS G+F+  K    ++VPEELVD+E+PL FKPF 
Sbjct  235   LSVWLNGRLPSPYHRVMI--TGNKARYSSGLFATTKGGYKVKVPEELVDEENPLLFKPFD  292

Query  960   HLDMIKFFDSDKGRRS-KNLLKDFC  1031
             + + ++F+ ++  R +  + LK +C
Sbjct  293   YEEFLEFYSTEAARGALGSGLKAYC  317



>emb|CDP21546.1| unnamed protein product [Coffea canephora]
Length=325

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 128/308 (42%), Positives = 191/308 (62%), Gaps = 8/308 (3%)
 Frame = +3

Query  114   VVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQQLFDLPF  293
             V+ F  E+LK G++SW   CK +R ALED GCFI + DK   +    +F + ++ F+LP 
Sbjct  21    VIYFTTENLKLGTSSWLSTCKAVREALEDFGCFIAVYDKAESECKIDVFASLKEFFNLPM  80

Query  294   EKKILNTN-EKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHsfsessq  470
             E K+LN + +K   GY G  P  P  EA  I+ +TTIE VQSF+NL W  GN  F E+  
Sbjct  81    ETKLLNVHPDKDAFGYFGPKPNFPLLEAISIEDSTTIEAVQSFANLAWPSGNDHFCETIC  140

Query  471   sfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNVVFPCHT  650
             + ++ ++E+   V +M+FESYGV ++ DS++EST+YL R   Y V  E + N  + P HT
Sbjct  141   ACTRQLSEVNRMVSKMIFESYGVGRYSDSHIESTSYLFRANAYRVSQEKEPNLGISP-HT  199

Query  651   DKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRVLAPIHKVT  830
             D +F++VL Q + V GL++Q+++G WI   FPPSS  +MAG+A+  WSN RV    H+V 
Sbjct  200   DTSFVSVLKQ-DSVQGLQIQSKDGTWIPVDFPPSSVAIMAGDAMLAWSNGRVRPCFHRVM  258

Query  831   MDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSDKGRRSK  1010
             +    ++ R S+G+FSF  ++  ++VP+EL DD +P QF  F H  ++KF   +    S 
Sbjct  259   VT---EKARTSIGLFSF--HTGIVQVPKELADDNYPSQFTSFDHWGLLKFRSKNPALSSN  313

Query  1011  NLLKDFCG  1034
               +K +CG
Sbjct  314   ERVKAYCG  321



>emb|CDP10138.1| unnamed protein product [Coffea canephora]
Length=314

 Score =   244 bits (623),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 139/320 (43%), Positives = 196/320 (61%), Gaps = 9/320 (3%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGS ++   L +V F  E LKPG+ SW   CK +R ALE H CF+   +++  +L ++IF
Sbjct  1     MGS-QSQANLPIVYFTRETLKPGTGSWLSTCKKVRDALEKHSCFLAQYERIPSELISAIF  59

Query  261   HASQQLFDLPFEKKILN-TNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWS  437
                 +LFDLP E K+ N T      GY GQ P  P +E  GI+     E V  F+NLMW 
Sbjct  60    LQLGELFDLPTETKVQNITTTDGLFGYFGQQPTNPTYEGMGIEDVNNPEAVLKFTNLMWP  119

Query  438   GGNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAES  617
              GN SF E  +S+   V++LE+ V+R +FES+GVEK Y S+ ES   +LR+ K+  P + 
Sbjct  120   SGNDSFCELMESYKNHVSDLEKLVMRTIFESFGVEKLYSSHDESCNRMLRFNKHR-PPQM  178

Query  618   DENNVVFPCHTDKTFMTVLYQLNQVSGLEVQAR-NGEWISAQFPPSSFIVMAGEAIKGWS  794
              EN    P HTD TF+T++ Q NQ S LEV+++ +G WI+  FPPSSF+VMAG+ +  WS
Sbjct  179   SENLGGVPEHTDPTFVTII-QRNQYSSLEVKSKEDGSWIAVDFPPSSFLVMAGDCLVAWS  237

Query  795   NSRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMI  974
             N RV + +H++ M     E R+S  +FS+  +S  + VPEELVDDEHPLQFKPF  +   
Sbjct  238   NGRVHSTVHRIRMRPG--ETRFSTALFSY--HSGMVHVPEELVDDEHPLQFKPFDQMGFF  293

Query  975   KFFDSDKGRRSKNLLKDFCG  1034
             +F  +      ++ +K +CG
Sbjct  294   RFTFAYYPLSDESKIKAYCG  313



>gb|KHN27538.1| Gibberellin 20 oxidase 1 [Glycine soja]
Length=312

 Score =   243 bits (621),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 133/315 (42%), Positives = 201/315 (64%), Gaps = 8/315 (3%)
 Frame = +3

Query  93    ETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQ  272
             +T ++L VVDF N++LKPG+ +W  A + +R ALEDHG F+ L DKVS + ++S +    
Sbjct  4     QTQSELPVVDFTNKNLKPGTDAWVSASQVVRGALEDHGGFLALYDKVSLETYDSAYSEMM  63

Query  273   QLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHs  452
               FDL  E K   T EKP   Y GQ P IP +E+ GI +  + +  Q ++++MW   NH 
Sbjct  64    NFFDLSIETKRRKTTEKPIFSYSGQRPGIPLYESVGIMNPLSFQDCQKYTHVMWPQENHH  123

Query  453   fsessqsfsKIVAELEEKVLRMLFESYGVE-KHYDSYVESTAYLLRYMKYEVPAESDENN  629
             F ES  S++K + EL+  V RM+FESYG+E K +++ +EST Y+LR  KY +P E + N 
Sbjct  124   FCESVNSYAKQLVELDHIVKRMVFESYGLETKKFETLLESTEYVLRGYKYRIPREGESNL  183

Query  630   VVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRVL  809
              V P H D  F+T+L Q  +V GL V+ ++G+W+     PS ++VM G+A+  WSN R+ 
Sbjct  184   GVAP-HCDTAFLTILNQ--KVEGLGVKLKDGKWLEVGASPSLYLVMGGDALMVWSNDRIP  240

Query  810   APIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDS  989
             A  H+V M  N K  RYS+G+ S+   +K +E  EELVD+E+PL++KPF H   ++FF +
Sbjct  241   ACEHRVLM--NSKIDRYSMGLLSY--AAKIMEPQEELVDEEYPLRYKPFDHYGYLRFFLT  296

Query  990   DKGRRSKNLLKDFCG  1034
             ++  +S + +K +CG
Sbjct  297   EEAIKSDSRIKAYCG  311



>emb|CDP21180.1| unnamed protein product [Coffea canephora]
Length=316

 Score =   243 bits (620),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 136/314 (43%), Positives = 200/314 (64%), Gaps = 10/314 (3%)
 Frame = +3

Query  105   KLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQQLFD  284
             KL V++F  E L+ G+  W+ A  ++R ALE+ GCF+ + D VS +L +S+F A ++LFD
Sbjct  8     KLPVINFGKEKLQHGTNGWSFARNEVRHALEECGCFLAVYDAVSFKLRDSVFSALEKLFD  67

Query  285   LPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHsf-se  461
             LP E K  NT+++   GY         HE+ GI+++T IE V+  S L+W  GN    S 
Sbjct  68    LPVETKKKNTSDRDLFGYFSIDGDSSNHESMGIENSTDIEEVKKLSKLVWPQGNDDNFSG  127

Query  462   ssqsfsKIVAELEEKVLRMLFESYGVEK-HYDSYVESTAYLLRYMKYEVPAESDENNVVF  638
                  + +++ELEE V+RM++ESYGVEK   DS+++S  +LLR+ +Y +    DE  V  
Sbjct  128   IIHECANLMSELEEVVIRMVYESYGVEKLKCDSHLDSNMHLLRFNRY-ISHGVDEKTVSS  186

Query  639   PCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRVLAPI  818
               HTDKTF+T+L + N+ +GLEV+ ++G+WI   F PSSF+VMAGEA   WSNSR+    
Sbjct  187   NAHTDKTFITILTE-NRENGLEVKLKDGQWIPVDFLPSSFVVMAGEAAMAWSNSRIQPCF  245

Query  819   HKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSDK-  995
             H+V  +AN   KR S+G+FSF  N   I +P+EL+DDEHP +FK F +L ++ FF  +K 
Sbjct  246   HRVLTNANA--KRLSLGLFSF--NKGVIHIPQELIDDEHPQRFKSFDNLALLDFFLEEKR  301

Query  996   -GRRSKNLLKDFCG  1034
              G  + +  K +CG
Sbjct  302   MGLPTDSTTKKYCG  315



>gb|KHN45675.1| Gibberellin 20 oxidase 1, partial [Glycine soja]
Length=263

 Score =   241 bits (615),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 129/270 (48%), Positives = 183/270 (68%), Gaps = 9/270 (3%)
 Frame = +3

Query  225   DKVSPQLHNSIFHASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIE  404
             +KV  +L  +IF A Q+LFDLP + KILN ++KPYHGYVGQ P +P  E+ GID A   E
Sbjct  2     EKVPLELRKAIFAALQELFDLPLQTKILNVSKKPYHGYVGQYPMVPLFESMGIDDANVYE  61

Query  405   GVQSFSNLMWSGGNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLL  584
              V+S +N+MW  GN SFS++ QSFS+ ++EL++ + +M+ ES GVEK+ + ++ ST YLL
Sbjct  62    NVESMTNIMWPHGNPSFSKTIQSFSEQLSELDQIIRKMILESLGVEKYLEEHMNSTNYLL  121

Query  585   RYMKYEVPAESDENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIV  764
               MKY+ P  SD   V    H+DK  +T+LYQ N+V GLEV  ++G+WIS +  P SF+V
Sbjct  122   GVMKYKGPQTSD-TKVGLTTHSDKNIVTILYQ-NEVEGLEVMTKDGKWISYRPSPDSFVV  179

Query  765   MAGEAIKGWSNSRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQ  944
             M        SN R+ +P H+V M  +G E RYS G+FS  K    I+ PEELVD+EHPL 
Sbjct  180   MI-----ACSNRRLHSPFHRVMM--SGNEARYSAGLFSIPKGGNIIKAPEELVDEEHPLL  232

Query  945   FKPFVHLDMIKFFDSDKGRRSKNLLKDFCG  1034
             FKPF H++ +K++ ++KG+R +  L+ +CG
Sbjct  233   FKPFDHVEFLKYYYTEKGQRDQFALRTYCG  262



>ref|XP_009621187.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1.2 
[Nicotiana tomentosiformis]
Length=278

 Score =   241 bits (616),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 123/273 (45%), Positives = 181/273 (66%), Gaps = 5/273 (2%)
 Frame = +3

Query  90   LETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHAS  269
            +E+   + V+ F+ E++ P S+ W   C+D++ A E +GCF+ + +++S +    +F   
Sbjct  1    MESQRVIPVIRFSQENMSPSSSCWISTCQDVKKAFEIYGCFLAIYEEISMEQCKELFREL  60

Query  270  QQLFDLPFEKKILNTNEKPYHGYVGQIPFI-PYHEAFGIDHATTIEGVQSFSNLMWSGGN  446
            ++LFDLP E K  NT++ PY GY+G   +  P +E+ GI++AT +E VQSF+NLMW  GN
Sbjct  61   EKLFDLPVETKAKNTSKTPYFGYIGPESYTRPLYESMGIENATNLESVQSFTNLMWPSGN  120

Query  447  HsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDEN  626
              F       +K + EL+  V R +F SYGV+K++ S V+S   L+R MKY VP +SDE 
Sbjct  121  THFCGLLHYHAKQMLELDNMVTRTMFASYGVDKYHKSCVKSKGNLVRVMKYGVP-KSDEP  179

Query  627  NVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRV  806
            NV  P H+DK F T+L+Q NQV+GLE++ ++G WIS +FPPSSFIV+AG+A+K WSN R+
Sbjct  180  NVGLPPHSDKGFTTILHQ-NQVNGLEIETKDGHWISVEFPPSSFIVIAGDALKEWSNDRI  238

Query  807  LAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIE  905
             A  H+VTM  N  E RYS+G FS  +   T+E
Sbjct  239  HAVTHRVTMSGN--ESRYSLGQFSHPQKIGTLE  269



>ref|XP_010026428.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP3-like [Eucalyptus 
grandis]
 gb|KCW59346.1| hypothetical protein EUGRSUZ_H02034 [Eucalyptus grandis]
Length=290

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 129/291 (44%), Positives = 188/291 (65%), Gaps = 5/291 (2%)
 Frame = +3

Query  102  TKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQQLF  281
            +K+ V+ F+ E  KPG++SWA AC+ +  ALEDHGCFIV    V   LH+S+   ++ LF
Sbjct  3    SKVPVIVFSEECTKPGTSSWAEACEVMAQALEDHGCFIVDHPGVPLGLHDSVLSVTENLF  62

Query  282  DLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHsfse  461
            DLP E KI NTN KP  G V   P  P  EA  ID    ++  + ++ LMW  GN  F +
Sbjct  63   DLPPETKIKNTNFKPPLGSVDTAPGSPLVEALTIDGIEKLQECEKYTFLMWPSGNGHFCK  122

Query  462  ssqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNVVFP  641
            +   + K +AE+E+ V RM+ ESYGVEK+YD Y++S+ YLLR++KY+   E  E +V   
Sbjct  123  AVHDYGKFIAEMEKVVFRMVCESYGVEKYYDPYIDSSTYLLRFLKYK-KLEGVEGSVNST  181

Query  642  CHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRVLAPIH  821
             HTDK+F++ L+Q N + GLEV+ ++GEW +     S+F+VMAGEA   WSN R+ A  H
Sbjct  182  EHTDKSFLSYLHQ-NNIRGLEVRTKDGEWFTFDPSASNFMVMAGEACVAWSNGRIKACDH  240

Query  822  KVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMI  974
            +V +     + RYS+G FS++  + TIE P+E +++ HP Q+KPF H+D++
Sbjct  241  RVAVKEE-SQVRYSLGTFSYV--TGTIETPKEFINEAHPQQYKPFNHIDLL  288



>gb|KFK30901.1| hypothetical protein AALP_AA6G040900 [Arabis alpina]
Length=321

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 136/314 (43%), Positives = 195/314 (62%), Gaps = 16/314 (5%)
 Frame = +3

Query  114   VVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQQLFDLPF  293
             V+DF+++ LKPGS+ W     D+R ALED+GCF    DKVS +L  SIF A Q+LF+LP 
Sbjct  16    VIDFSDQTLKPGSSKWDQVKSDVRKALEDYGCFEASFDKVSMELKKSIFEAMQELFELPI  75

Query  294   EKKILNTNEKP-YHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG-GNHsfsess  467
             E K  N + KP Y+GY+        +++ GID A  +E V  F+  +W   GN S SE+ 
Sbjct  76    ETKQRNVSPKPFYYGYLNH----NLYQSLGIDDANVLEKVNEFAQQIWPDHGNKSISETI  131

Query  468   qsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDENNVV----  635
               FS+ ++EL+  V RM+ ES+G+EK+ D ++ ST YLLR MKY  P ++D N+V     
Sbjct  132   HKFSEQLSELDVMVRRMIMESFGIEKYIDEHLNSTNYLLRIMKYTSPLDADNNDVEEAKL  191

Query  636   -FPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRVLA  812
                 HTDK  +T+L+Q  QV GLEV+ ++ +WI  +    SFIVM G+++    N R+ +
Sbjct  192   GLRSHTDKNIITILHQY-QVGGLEVKTKDEKWIKVKPSHDSFIVMIGDSLCALLNGRLSS  250

Query  813   PIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDSD  992
             P H+V M     + RYS  +FS      TI+ PEELVD+EHP  FKPF + D +KFF ++
Sbjct  251   PYHRVMM----TKTRYSTALFSVPNPEVTIDSPEELVDEEHPRIFKPFEYNDFVKFFRTE  306

Query  993   KGRRSKNLLKDFCG  1034
              GR +++ L+DFC 
Sbjct  307   AGRGAQSTLQDFCA  320



>ref|XP_006346585.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP3-like [Solanum 
tuberosum]
Length=315

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 132/320 (41%), Positives = 201/320 (63%), Gaps = 13/320 (4%)
 Frame = +3

Query  87    SLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHA  266
             + +   KL +++F +E L+ G+TSW    ++IR ALE++GCF  +  KV P+L  ++F  
Sbjct  4     AFQVEPKLPIIEFTDETLRGGTTSWLSTSREIRCALEEYGCFGAVYKKVMPELREAMFDH  63

Query  267   SQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGN  446
              ++LF LP E K+ N ++    GY G    +P  E FGI    TI+  + F+N MW   N
Sbjct  64    CKELFKLPLETKLKNNSDILGFGYGGNFGTMPLAEFFGIVDGETIDATKDFANKMWPNDN  123

Query  447   -HsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESDE  623
                + E S S+SK++AEL++ ++RM  ESYG+EKHY++   S  YL+R +KY  P  +++
Sbjct  124   VRKYCEESISYSKLIAELDDTIIRMTLESYGIEKHYEALKHSCMYLMRLIKYRSPKNNEK  183

Query  624   NNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSF---IVMAGEAIKGWS  794
             +    P H DK+FM ++   NQV  LE+Q R+G+WI+  F PSS+   +++AGE    WS
Sbjct  184   SIGHLP-HRDKSFMGII-DTNQVGRLEMQTRDGKWIT--FHPSSYKTLVIIAGEPFTAWS  239

Query  795   NSRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMI  974
             N RV APIH+V M   G E +YS+ +FSF++   TIEVPEEL+D+E+P QFK F +   +
Sbjct  240   NGRVYAPIHRVIM--KGVEDKYSLALFSFMRG--TIEVPEELIDEENPKQFKSFNNFQYL  295

Query  975   KFFDSDKGRRSKNLLKDFCG  1034
             K+  +  G + K+ LK +CG
Sbjct  296   KYCGT-HGSKEKDPLKAYCG  314



>ref|XP_006301978.1| hypothetical protein CARUB_v10022458mg [Capsella rubella]
 gb|EOA34876.1| hypothetical protein CARUB_v10022458mg [Capsella rubella]
Length=320

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 129/315 (41%), Positives = 200/315 (63%), Gaps = 12/315 (4%)
 Frame = +3

Query  108   LLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIFHASQQLFDL  287
             L ++DF+ + L PG++ W     ++R A+E+ G F+   D V+  L +S+F   ++++DL
Sbjct  9     LPILDFSRDKLMPGTSHWITTRDNVRKAMEEQGWFVAEFDGVTSDLRDSLFTGMKEMYDL  68

Query  288   PFEKKILNTNEKPYHGYVGQ-IPFIPYHEAFGIDHATTIEGVQSFSNLMWSGGNHsfses  464
             P+E KI N N K  HGY+   +     HE+ GID+AT ++  + FS L+W  GN  FS+S
Sbjct  69    PYEIKIKNENHKVSHGYMSMVVDDYRIHESLGIDYATELQACKDFSKLLWPQGNDPFSQS  128

Query  465   sqsfsKIVAELEEKVLRMLFESYGVE--KHYDSYVESTAYLLRYMKYEVPAESDENNVVF  638
             +  ++  +AE+E+KV+RML+ESYG++  KH  S+ EST YLLR + Y     + E N  F
Sbjct  129   THVYATALAEIEQKVMRMLYESYGMDEKKHSASHSESTRYLLRMLSYR-RQRNGEANTGF  187

Query  639   PCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEAIKGWSNSRVLAPI  818
               HTDK+FM++L+Q N V GL ++    +W+  +  P+ F+V++G  +  WSN R+ A  
Sbjct  188   VSHTDKSFMSILHQ-NHVGGLHLKTMTDQWVGFKPSPTRFVVLSGMGLTAWSNDRIKACY  246

Query  819   HKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMIKFFDS---  989
             HKV M A+  E RYS+G FSF K   TI  PEELVDD+HPL++ PF H  +++F++S   
Sbjct  247   HKVVMSAD--EVRYSLGFFSFHKG--TIRTPEELVDDQHPLRYNPFDHDGLLRFYESYLN  302

Query  990   DKGRRSKNLLKDFCG  1034
                + S++LL+ +CG
Sbjct  303   SLKKSSEDLLQVYCG  317



>ref|XP_008227273.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 
[Prunus mume]
Length=317

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 132/321 (41%), Positives = 206/321 (64%), Gaps = 10/321 (3%)
 Frame = +3

Query  81    MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCDKVSPQLHNSIF  260
             MGSL +P KL  ++F+ EDLKPGS SW    K +R ALE++G F+   +++S +L N++F
Sbjct  1     MGSLTSP-KLPTINFSVEDLKPGSASWLSTAKQVRFALEEYGSFVAQYEQISAKLLNNMF  59

Query  261   HASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMWSG  440
               ++ LF++P E K+ N  E+PY G++G  P +P +E+  ID+ T+ +  Q F NLMW  
Sbjct  60    GQAKDLFEVPKENKVKNVGEEPYRGHMGPNPGMPLYESLCIDNVTSPQETQKFKNLMWPE  119

Query  441   GNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVPAESD  620
             G  +F E++ SF ++++ LE  V ++LFESYG+ K Y+S   S  +LLR+++Y VP + D
Sbjct  120   GKSNFCETTDSFGQLLSNLERTVEQLLFESYGIGKQYESVGSSNGHLLRFIRYTVPEDKD  179

Query  621   ENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPS--SFIVMAGEAIKGWS  794
                V FP HTD  F T++ Q + V+GLEV+ + G+WI+ +  PS   F+ MAG+ ++ WS
Sbjct  180   A-TVRFPSHTDINFTTIVVQ-HDVAGLEVRTKEGDWINVECKPSQVQFVFMAGDGLQVWS  237

Query  795   NSRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFVHLDMI  974
             N RV A  H+V    N  + RYS+G+F+F  N+  ++VPEELVD+ HPL + PF     I
Sbjct  238   NDRVKACHHRVKHCGN--KTRYSIGLFTF--NNGIVQVPEELVDESHPLLYNPFDSRAFI  293

Query  975   -KFFDSDKGRRSKNLLKDFCG  1034
              K+  + + ++  + +K F G
Sbjct  294   RKYAATPELKKEPSPIKAFAG  314



>ref|XP_002515597.1| Gibberellin 2-beta-dioxygenase, putative [Ricinus communis]
 gb|EEF47046.1| Gibberellin 2-beta-dioxygenase, putative [Ricinus communis]
Length=316

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 129/310 (42%), Positives = 184/310 (59%), Gaps = 14/310 (5%)
 Frame = +3

Query  81   MGSLETPTKLLVVDFNNEDLKPGSTSWAHACKDIRTALEDHGCFIVLCD--KVSPQLHNS  254
            M   E PT    + F+ E L  GS S    C  +R A E HGCF+++ D   +  +L  +
Sbjct  1    MAKAEIPT----LYFSGEALSSGSESRRELCNRVRKACESHGCFLLMYDHGNIPAKLRQN  56

Query  255  IFHASQQLFDLPFEKKILNTNEKPYHGYVGQIPFIPYHEAFGIDHATTIEGVQSFSNLMW  434
            +F + + LFDLP + K    N KPY  Y G+ P IP++E+FG+D A  +  VQ F+NLMW
Sbjct  57   LFVSMKALFDLPEDTKTKYVNPKPYRSYTGRSPVIPFYESFGLDDAHKLGQVQDFTNLMW  116

Query  435  SGGNHsfsessqsfsKIVAELEEKVLRMLFESYGVEKHYDSYVESTAYLLRYMKYEVP--  608
              GN SF E     S  + E+   VL+M+FES+G+EKHYDS+++ +  L + MKY  P  
Sbjct  117  PQGNTSFCEILHVMSSKMLEMNLMVLKMIFESFGMEKHYDSHIQDSTSLFKVMKYIAPPS  176

Query  609  ---AESDENNVVFPCHTDKTFMTVLYQLNQVSGLEVQARNGEWISAQFPPSSFIVMAGEA  779
                  +++ +    H DK  +T+L Q N+V GLEV++++GEW     P  +F+V+ GEA
Sbjct  177  NGRGSGEDSAIALRAHRDKNAITILCQ-NEVQGLEVESKDGEWARVMVPQDAFVVIVGEA  235

Query  780  IKGWSNSRVLAPIHKVTMDANGKEKRYSVGIFSFLKNSKTIEVPEELVDDEHPLQFKPFV  959
            +K WSN R+ A  H+V +  NGKE RYS  +FS  K    IEVP ELVD +HPL ++PF+
Sbjct  236  LKVWSNGRLEAARHRVVI--NGKEDRYSCALFSMPKEESKIEVPCELVDKDHPLLYRPFI  293

Query  960  HLDMIKFFDS  989
              D I +F S
Sbjct  294  FSDYISYFVS  303



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2531029472560