BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7399_g1_i1 len=1263 path=[1165:0-448 1614:449-1130 2296:1131-1163
2296:1164-1196 2296:1197-1229 2296:1230-1262]

Length=1263
                                                                      Score     E

ref|XP_006365998.1|  PREDICTED: uncharacterized protein LOC102592106    358   5e-117   
ref|XP_004248146.1|  PREDICTED: uncharacterized protein LOC101257605    354   1e-115   
ref|XP_009630383.1|  PREDICTED: uncharacterized protein LOC104120343    347   8e-113   
ref|XP_011100341.1|  PREDICTED: uncharacterized protein LOC105178545    327   7e-105   
ref|XP_002274325.3|  PREDICTED: uncharacterized protein LOC100242621    320   3e-102   Vitis vinifera
emb|CDP14699.1|  unnamed protein product                                301   3e-96    
gb|KHG19911.1|  hypothetical protein F383_25029                         299   3e-94    
gb|KDP24190.1|  hypothetical protein JCGZ_25847                         291   2e-91    
ref|XP_009357100.1|  PREDICTED: uncharacterized protein LOC103947...    291   4e-91    
ref|XP_009357101.1|  PREDICTED: uncharacterized protein LOC103947...    289   2e-90    
gb|EYU24871.1|  hypothetical protein MIMGU_mgv1a011993mg                284   1e-89    
ref|XP_007043492.1|  Embryo defective 1923                              286   4e-89    
ref|XP_002517989.1|  conserved hypothetical protein                     285   6e-89    Ricinus communis
ref|XP_009350622.1|  PREDICTED: uncharacterized protein LOC103942134    285   8e-89    
ref|XP_007215629.1|  hypothetical protein PRUPE_ppa008067mg             285   1e-88    
emb|CBI28387.3|  unnamed protein product                                281   1e-88    
ref|XP_010531634.1|  PREDICTED: uncharacterized protein LOC104807893    281   2e-87    
ref|XP_002319380.1|  hypothetical protein POPTR_0013s14300g             281   3e-87    Populus trichocarpa [western balsam poplar]
ref|XP_010556170.1|  PREDICTED: uncharacterized protein LOC104825523    280   4e-87    
gb|KHN22899.1|  hypothetical protein glysoja_020829                     279   1e-86    
ref|XP_010095833.1|  hypothetical protein L484_022189                   279   1e-86    
ref|XP_011048458.1|  PREDICTED: uncharacterized protein LOC105142497    278   3e-86    
gb|ACU24077.1|  unknown                                                 277   6e-86    Glycine max [soybeans]
ref|XP_003539894.1|  PREDICTED: uncharacterized protein LOC100794085    277   6e-86    
ref|XP_003527457.1|  PREDICTED: uncharacterized protein LOC100819518    274   1e-84    
gb|KHN41158.1|  hypothetical protein glysoja_017202                     273   2e-84    
ref|XP_010052100.1|  PREDICTED: uncharacterized protein LOC104440818    273   3e-84    
ref|XP_010689490.1|  PREDICTED: uncharacterized protein LOC104903...    270   6e-83    
ref|XP_007132635.1|  hypothetical protein PHAVU_011G111800g             266   1e-81    
emb|CDY29890.1|  BnaA03g49110D                                          265   5e-81    
ref|XP_008437523.1|  PREDICTED: uncharacterized protein LOC103482911    264   1e-80    
ref|XP_009761591.1|  PREDICTED: uncharacterized protein LOC104213744    261   1e-79    
ref|XP_006285673.1|  hypothetical protein CARUB_v10007130mg             260   3e-79    
ref|XP_009137769.1|  PREDICTED: uncharacterized protein LOC103861815    259   7e-79    
ref|XP_006412983.1|  hypothetical protein EUTSA_v10025608mg             257   5e-78    
ref|XP_010448015.1|  PREDICTED: uncharacterized protein LOC104730532    255   3e-77    
ref|XP_002869515.1|  EMB1923                                            254   1e-76    
ref|XP_010438494.1|  PREDICTED: uncharacterized protein LOC104722085    254   1e-76    
gb|AAM61436.1|  unknown                                                 253   2e-76    Arabidopsis thaliana [mouse-ear cress]
ref|NP_567800.1|  embryo defective 1923 protein                         253   3e-76    Arabidopsis thaliana [mouse-ear cress]
emb|CDY58723.1|  BnaC07g50640D                                          252   4e-76    
ref|XP_006447378.1|  hypothetical protein CICLE_v10015637mg             253   6e-76    
ref|XP_004145896.1|  PREDICTED: uncharacterized protein LOC101214502    249   4e-75    
emb|CDX89194.1|  BnaA01g16990D                                          249   8e-75    
ref|XP_004507220.1|  PREDICTED: uncharacterized protein LOC101507951    248   1e-74    
gb|KFK29347.1|  hypothetical protein AALP_AA7G121900                    247   1e-74    
ref|XP_010433249.1|  PREDICTED: uncharacterized protein LOC104717391    246   8e-74    
ref|XP_008230221.1|  PREDICTED: uncharacterized protein LOC103329522    245   1e-73    
ref|XP_009144250.1|  PREDICTED: uncharacterized protein LOC103867909    245   2e-73    
ref|XP_008812229.1|  PREDICTED: uncharacterized protein LOC103723174    244   7e-73    
ref|XP_003636630.1|  hypothetical protein MTR_050s0011                  239   2e-71    
ref|XP_010277928.1|  PREDICTED: uncharacterized protein LOC104612270    239   3e-71    
ref|XP_009402583.1|  PREDICTED: uncharacterized protein LOC103986330    234   5e-69    
ref|XP_004304109.1|  PREDICTED: uncharacterized protein LOC101308695    233   1e-68    
ref|XP_010939724.1|  PREDICTED: uncharacterized protein LOC105058474    233   2e-68    
emb|CDY18995.1|  BnaC01g20730D                                          224   3e-65    
ref|XP_008379901.1|  PREDICTED: uncharacterized protein LOC103442887    218   2e-64    
gb|EPS63563.1|  hypothetical protein M569_11222                         211   2e-61    
ref|XP_010689492.1|  PREDICTED: uncharacterized protein LOC104903...    173   5e-48    
ref|XP_006841820.1|  hypothetical protein AMTR_s00003p00269770          168   3e-45    
gb|ADN33768.1|  hypothetical protein                                    134   2e-32    
gb|KDO40827.1|  hypothetical protein CISIN_1g037948mg                 94.4    4e-20    
ref|XP_011045513.1|  PREDICTED: uncharacterized protein LOC105140401  68.2    5e-10    
ref|XP_006841818.1|  hypothetical protein AMTR_s00003p00269740        65.9    2e-09    



>ref|XP_006365998.1| PREDICTED: uncharacterized protein LOC102592106 [Solanum tuberosum]
Length=355

 Score =   358 bits (918),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 201/356 (56%), Positives = 252/356 (71%), Gaps = 1/356 (0%)
 Frame = +1

Query  85    MSITLSTFRSPNIFFKNPIKLSSHPPLFNRPHHSNQAPFDSFQPRTSILRLRNAHKFPGL  264
             MSITLS   S     K   K+SS+ P  N   H     F S   R    +L   HK  G+
Sbjct  1     MSITLSFLSSSIPTLKKTHKISSNFPS-NAFSHYQILDFPSSVARIKPFKLELKHKCSGI  59

Query  265   LSTNLGLSVTKNHGFLAKAENGGEGTQNVANEVEIESRGESSMPERFRSLTKEAPDKPVR  444
              ++N G  + + +GF+AKAE+ G    N  ++ EI+ RGES+MP+RFR LTKEAPDKPVR
Sbjct  60    FTSNCGFQLRRKNGFIAKAESSGVDYGNSVDKAEIDVRGESTMPDRFRYLTKEAPDKPVR  119

Query  445   WPFLIVLAFLLYAWRAVLWELSIWKGIVMGFFRFIGTMMKFALANVLYYILHPVTASLRF  624
             WP+ I LAF+LYAWR VLWEL  WK  V   FRF+G + K ALA V Y+I   +TA ++F
Sbjct  120   WPWFIALAFILYAWRTVLWELDNWKKAVGAVFRFLGYISKLALAVVYYFIGDQITAVIKF  179

Query  625   VETILHIIRTFYSGVIKQAPIQELTKMiilaslilaiaeaTVPDSVNSQPYLLTVAGFIG  804
             +E+ ++ IR FYS ++  AP+QELT +IILAS +LAI EA VPDSVNSQPYLLT AG +G
Sbjct  180   IESSIYSIRAFYSSIVAYAPVQELTTIIILASCVLAIGEAAVPDSVNSQPYLLTAAGIMG  239

Query  805   FVAAKGYISELFFWTVLLGLFSFGRWVKKRDYvssalpvaavlaavGEPWIQALVMISYT  984
             F A +GYISELFFW +LLGLF F R++KKRDYVSSA+P AA LAAVGEPW++ +VM+SY 
Sbjct  240   FAAVRGYISELFFWFILLGLFFFARFIKKRDYVSSAMPAAAALAAVGEPWVRLVVMVSYA  299

Query  985   SLAIVQHSREPADGKEVEATNEVIRAPFPLLCVALAIGMRLAASWAGYRHLTWMIV  1152
             +LAI+QHS+ P +  E E T  V + P PL+C ALAIG+RLAA WAGY+HLTWMIV
Sbjct  300   ALAILQHSKTPLNKSEGETTGAVRKVPVPLICAALAIGVRLAAKWAGYQHLTWMIV  355



>ref|XP_004248146.1| PREDICTED: uncharacterized protein LOC101257605 [Solanum lycopersicum]
Length=355

 Score =   354 bits (909),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 201/356 (56%), Positives = 251/356 (71%), Gaps = 1/356 (0%)
 Frame = +1

Query  85    MSITLSTFRSPNIFFKNPIKLSSHPPLFNRPHHSNQAPFDSFQPRTSILRLRNAHKFPGL  264
             MSITLS F S     K   K+SS+ P  N   H+    F S   R   L+L   HK  G+
Sbjct  1     MSITLSFFSSSIPTIKKTHKISSNFPS-NAFSHNQILDFPSSVARIKPLKLELKHKCCGI  59

Query  265   LSTNLGLSVTKNHGFLAKAENGGEGTQNVANEVEIESRGESSMPERFRSLTKEAPDKPVR  444
              +++ G  + + +GF+ +AE+ G    N  ++ EI+ RGES+MP+RFR LTKEAPDKPVR
Sbjct  60    FTSDCGFQLRRKNGFIVEAESSGVDYGNSVDKAEIDVRGESTMPDRFRYLTKEAPDKPVR  119

Query  445   WPFLIVLAFLLYAWRAVLWELSIWKGIVMGFFRFIGTMMKFALANVLYYILHPVTASLRF  624
             WP+ I LAFLLYAWR VLWEL  WK  V   FRF+G + K A A V Y+I   +TA +RF
Sbjct  120   WPWFIALAFLLYAWRTVLWELGNWKKAVDAVFRFLGYISKLAFAVVYYFIGDQITAVIRF  179

Query  625   VETILHIIRTFYSGVIKQAPIQELTKMiilaslilaiaeaTVPDSVNSQPYLLTVAGFIG  804
             +E+ ++ IR FYS VI  AP+QELT +IILAS +LAI EA  PDSVNSQPYLLT AG +G
Sbjct  180   IESSIYSIRAFYSSVIAYAPVQELTTIIILASCVLAIGEAAAPDSVNSQPYLLTAAGIMG  239

Query  805   FVAAKGYISELFFWTVLLGLFSFGRWVKKRDYvssalpvaavlaavGEPWIQALVMISYT  984
             F A +GYISELFFW +LLGLF F R++KKRDYVSSA+P AA LAAVGEPW++ +VM+SY 
Sbjct  240   FAAVRGYISELFFWFILLGLFFFARFIKKRDYVSSAMPAAAALAAVGEPWVRLVVMVSYA  299

Query  985   SLAIVQHSREPADGKEVEATNEVIRAPFPLLCVALAIGMRLAASWAGYRHLTWMIV  1152
             +LAI+Q+S+ P +  E E    V + P PL+C ALAIG+RLAA WAGYRHLTWMIV
Sbjct  300   ALAILQYSKTPFNKSEGETIGAVRKVPVPLICAALAIGVRLAAKWAGYRHLTWMIV  355



>ref|XP_009630383.1| PREDICTED: uncharacterized protein LOC104120343 [Nicotiana tomentosiformis]
Length=352

 Score =   347 bits (889),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 207/361 (57%), Positives = 254/361 (70%), Gaps = 14/361 (4%)
 Frame = +1

Query  85    MSITLSTFRSP----NIFFKNPIKLSSHPPLFNRPHHSNQA-PFDSFQPRTSILRLRNAH  249
             MSITLS   S     N F K     SSH PL   P + N   P    + +   L L    
Sbjct  1     MSITLSALSSSIPSLNKFHKIS---SSHFPLNACPRNQNIIFPLSITRIKPFKLELTQ-K  56

Query  250   KFPGLLSTNLGLSVTKNHGFLAKAENGGEGTQNVANEVEIESRGESSMPERFRSLTKEAP  429
             ++ GL  +N G S+ K +GF+ KAENG         + E E+RGES+MP+RFR LTKEAP
Sbjct  57    RYSGLFGSNCGFSLIKKNGFIVKAENGKS-----VEKAENEARGESTMPDRFRYLTKEAP  111

Query  430   DKPVRWPFLIVLAFLLYAWRAVLWELSIWKGIVMGFFRFIGTMMKFALANVLYYILHPVT  609
             D PVRWP+ I LAFLLYAWR VLWELS WK  V   FRF+G + K AL+ + Y+I   +T
Sbjct  112   DNPVRWPWFIALAFLLYAWRTVLWELSNWKKAVGAIFRFLGYIPKLALSFIYYFIGDQIT  171

Query  610   ASLRFVETILHIIRTFYSGVIKQAPIQELTKMiilaslilaiaeaTVPDSVNSQPYLLTV  789
             A +RF+E+ ++ IR FYSGV+  AP+QELT +IILAS +LAIAEA VPDSVNSQPYLLT 
Sbjct  172   AVIRFIESTIYSIRAFYSGVVAYAPLQELTTIIILASCVLAIAEAAVPDSVNSQPYLLTA  231

Query  790   AGFIGFVAAKGYISELFFWTVLLGLFSFGRWVKKRDYvssalpvaavlaavGEPWIQALV  969
             AG +GF A +GYISELFFW +L+GLF F R+++KRDYVSSALP AAVLAAVGEPWI+ +V
Sbjct  232   AGIMGFAAVRGYISELFFWFLLVGLFVFARFIRKRDYVSSALPAAAVLAAVGEPWIRMVV  291

Query  970   MISYTSLAIVQHSREPADGKEVEATNEVIRAPFPLLCVALAIGMRLAASWAGYRHLTWMI  1149
             M+SY +LA++QHS+ P +  E E T  V + P PL+C ALAIG+RLAA WAGYRHLTWMI
Sbjct  292   MVSYAALAVIQHSKMPLNKSEGETTGAVKKVPIPLICAALAIGVRLAAKWAGYRHLTWMI  351

Query  1150  V  1152
             V
Sbjct  352   V  352



>ref|XP_011100341.1| PREDICTED: uncharacterized protein LOC105178545 [Sesamum indicum]
Length=353

 Score =   327 bits (837),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 204/360 (57%), Positives = 244/360 (68%), Gaps = 11/360 (3%)
 Frame = +1

Query  85    MSITLSTFRSPNIFFKNPIKLSSHPPLFNRPHHSNQA-PFDSFQPRTS---ILRLRNAHK  252
             MS+ LST        K  IK  S P    R H  N + PF S    T+   + +LR  H 
Sbjct  1     MSMVLSTLHQ-----KTCIKFFS-PKSSPRIHQINYSFPFGSSSLTTNAKPLNKLRITHN  54

Query  253   FPGLLSTNLGLSVTKNHGFLAKAENGGEGTQNVANEVEIESRGESSMPERFRSLTKEAPD  432
             F G  +  L     K+ GF   A+NGG+   N   E E E+RGESSMPERFR+LTKEAPD
Sbjct  55    FYGPFNKTLNGFPVKSRGFTVNAQNGGDFIHNRQQE-ETEARGESSMPERFRNLTKEAPD  113

Query  433   KPVRWPFLIVLAFLLYAWRAVLWELSIWKGIVMGFFRFIGTMMKFALANVLYYILHPVTA  612
             KPVRWP+LIVLAF+LYAWR VLWELS W+  V    R +  + KFALA + ++I  PVT+
Sbjct  114   KPVRWPWLIVLAFMLYAWRTVLWELSNWRAAVAAVGRLLTYISKFALALIFHFIGAPVTS  173

Query  613   SLRFVETILHIIRTFYSGVIKQAPIQELTKMiilaslilaiaeaTVPDSVNSQPYLLTVA  792
              +R VETI + IR FYSG++  API ELT +I+L S +LA+AEA  PD+VNSQP+LLTVA
Sbjct  174   LIRGVETIFYTIRAFYSGIVASAPIPELTLIIMLVSAVLAVAEAASPDTVNSQPHLLTVA  233

Query  793   GFIGFVAAKGYISELFFWTVLLGLFSFGRWVKKRDYvssalpvaavlaavGEPWIQALVM  972
             G IG  A   YISE  FWT+L+GLFSF R VKKRDYVSSALPVAAVLAAVGEPW++ +VM
Sbjct  234   GLIGLAAVTNYISEALFWTLLVGLFSFARLVKKRDYVSSALPVAAVLAAVGEPWVRVIVM  293

Query  973   ISYTSLAIVQHSREPADGKEVEATNEVIRAPFPLLCVALAIGMRLAASWAGYRHLTWMIV  1152
              SY +LAI  HS  P+  KE E    + R P PLLC ALAIG+ +AA WAGYRHLTWMIV
Sbjct  294   ASYLALAIFHHSNIPSHLKEDEDAGAINRVPVPLLCAALAIGIHVAAKWAGYRHLTWMIV  353



>ref|XP_002274325.3| PREDICTED: uncharacterized protein LOC100242621 [Vitis vinifera]
Length=361

 Score =   320 bits (820),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 201/364 (55%), Positives = 252/364 (69%), Gaps = 11/364 (3%)
 Frame = +1

Query  85    MSITLSTFRSPNIFFKNPIKLSSHPP---LFNRPHHSNQAPFDSFQPRTSILR--LRNAH  249
             MS T+S+   P +F K P      PP   LF R + SN   F S   R  + +  ++  H
Sbjct  1     MSTTMSSLSYPALFPKCPRLHLKFPPNALLFLR-NPSNTLAFCSSPTRIQLSKPQIQYTH  59

Query  250   KFPGLLSTNLGLSVTKNHGFLAKAENGGEGTQNVANEVEIESRGESSMPERFRSLTKEAP  429
                G    NLG+   +  GF A AENG E +     E   E+R +S+MPERFR LTKEAP
Sbjct  60    NLFGFAEKNLGVLRRRKLGFCANAENGEEKSNGSGFEGIEEARRQSTMPERFRHLTKEAP  119

Query  430   DKPVRWPFLIVLAFLLYAWRAVLWELSIWKGIVMGFFRFIGTMMKFALANVLYYILHPVT  609
             D P+RWP+ I L FL+YAWR VLWELS W+   +    F G ++K ALA + ++I +PVT
Sbjct  120   DPPLRWPWYIALVFLVYAWRTVLWELSNWRKAALAVVYFAGYLLKLALALIFHFIGNPVT  179

Query  610   ASLRFVETILHIIRTFYSGVIKQAPIQELTKMiilaslilaiaeaTVPDSVNSQPYLLTV  789
             + +R VET L+ IR FYS ++  AP+ ELT +IILAS +LAIAEATVPDSVNSQPYLLTV
Sbjct  180   SLIRCVETALYTIRAFYSSIVTYAPVPELTTIIILASAVLAIAEATVPDSVNSQPYLLTV  239

Query  790   AGFIGFVAAKGYISELFFWTVLLGLFSFGRWVKKRDYvssalpvaavlaavGEPWIQALV  969
             +G IGF A K +ISE FFWT+L+GLF+F + VKKRDYVSSALPVAAVLAAVG+PW++ +V
Sbjct  240   SGLIGFAAVKDFISEPFFWTLLVGLFAFAQLVKKRDYVSSALPVAAVLAAVGQPWLRVVV  299

Query  970   MISYTSLAIVQHSREPADGK---EVEATNEVIRAPFPLLCVALAIGMRLAASWAGYRHLT  1140
             + SYT+LAI  HS++ +DGK   EV AT+   R P PLLCV+LAIG+ LAA WAGYRHLT
Sbjct  300   IASYTALAISHHSKKISDGKEEGEVAATSR--RLPVPLLCVSLAIGIHLAAKWAGYRHLT  357

Query  1141  WMIV  1152
             WMIV
Sbjct  358   WMIV  361



>emb|CDP14699.1| unnamed protein product [Coffea canephora]
Length=254

 Score =   301 bits (770),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 169/253 (67%), Positives = 201/253 (79%), Gaps = 0/253 (0%)
 Frame = +1

Query  391   MPERFRSLTKEAPDKPVRWPFLIVLAFLLYAWRAVLWELSIWKGIVMGFFRFIGTMMKFA  570
             MP+RFR LTKEAPDKPVRWP+ I LAF LYAWR VLWELS WK  V   F+FIG ++K A
Sbjct  1     MPDRFRPLTKEAPDKPVRWPWFIALAFALYAWRTVLWELSNWKKAVAAIFQFIGYILKLA  60

Query  571   LANVLYYILHPVTASLRFVETILHIIRTFYSGVIKQAPIQELTKMiilaslilaiaeaTV  750
             LA V ++I  P+T+ +R +ET  + IR  YS VI  API +LT +I+L+S ILAI+EATV
Sbjct  61    LALVFHFIGDPITSLIRGIETTFYTIRASYSWVIAYAPIPDLTTVIVLSSAILAISEATV  120

Query  751   PDSVNSQPYLLTVAGFIGFVAAKGYISELFFWTVLLGLFSFGRWVKKRDYvssalpvaav  930
             PDSVNSQPY+LT+AG IG  A + YISELFFW +LLGLFSF R+VKKRDYVSSALP AAV
Sbjct  121   PDSVNSQPYMLTLAGLIGLAAVRSYISELFFWILLLGLFSFSRFVKKRDYVSSALPAAAV  180

Query  931   laavGEPWIQALVMISYTSLAIVQHSREPADGKEVEATNEVIRAPFPLLCVALAIGMRLA  1110
             LA VGEPWI+ +V+ SY +LAI+QHS++ +DGKE E T  V R P PLLC ALAIG+R+A
Sbjct  181   LAGVGEPWIRIIVLASYLALAIIQHSKQRSDGKENEVTGPVRRVPIPLLCAALAIGLRVA  240

Query  1111  ASWAGYRHLTWMI  1149
             A WAGYRHLTWMI
Sbjct  241   AKWAGYRHLTWMI  253



>gb|KHG19911.1| hypothetical protein F383_25029 [Gossypium arboreum]
Length=352

 Score =   299 bits (766),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 171/306 (56%), Positives = 223/306 (73%), Gaps = 3/306 (1%)
 Frame = +1

Query  238   RNAHKFPGLLSTNLGLSVTKNHGFLAKAENGGEGTQNVANEVEIESRGESSMPERFRSLT  417
             R A  F  L    LGLS+ +   F A A NGGE      +E E  +RGES+MPERFR LT
Sbjct  49    RPAPNFLLLSGKRLGLSLNRKSKFYANAGNGGE--DGGVDEAERLARGESTMPERFRYLT  106

Query  418   KEAPDKPVRWPFLIVLAFLLYAWRAVLWELSIWKGIVMGFFRFIGTMMKFALANVLYYIL  597
             KEAPD PVRWPF + +AFLLYAWRAVL ELS W+    G  RF+G ++K ALA + Y+I 
Sbjct  107   KEAPDPPVRWPFFVAVAFLLYAWRAVLLELSNWRNAAFGVVRFVGYILKLALALIFYFIG  166

Query  598   HPVTASLRFVETILHIIRTFYSGVIKQAPIQELTKMiilaslilaiaeaTVPDSVNSQPY  777
              P+T+ +R +ET+++ +R FYSG++  AP++ELT +I+LAS +LAIAEATVP+S++ QPY
Sbjct  167   DPITSMIRCIETLIYSVRAFYSGIVAYAPVKELTVIIVLASAVLAIAEATVPNSISCQPY  226

Query  778   LLTVAGFIGFVAAKGYISELFFWTVLLGLFSFGRWVKKRDYvssalpvaavlaavGEPWI  957
             +LT++G IG+ A  GYISE  +WT+LLGL+SF R +KKRD V+SALPVAAV+AA+GEPW+
Sbjct  227   MLTISGLIGYAAVTGYISEPLYWTLLLGLYSFSRVIKKRDDVTSALPVAAVMAAIGEPWV  286

Query  958   QALVMISYTSLAIVQHSREPADGKE-VEATNEVIRAPFPLLCVALAIGMRLAASWAGYRH  1134
             + LV+ SY +LAI  HS++ ++ +E  E      R P PLL  ALAIG+ LAA W GYRH
Sbjct  287   RILVITSYLALAIFNHSKKLSEVREQTEGIAMERRLPMPLLGAALAIGINLAAKWVGYRH  346

Query  1135  LTWMIV  1152
             LTWMIV
Sbjct  347   LTWMIV  352



>gb|KDP24190.1| hypothetical protein JCGZ_25847 [Jatropha curcas]
Length=346

 Score =   291 bits (746),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 164/302 (54%), Positives = 220/302 (73%), Gaps = 4/302 (1%)
 Frame = +1

Query  256   PGLLSTNLGLSVTKNHGFLAKAENGGE--GTQNVANE-VEIESRGESSMPERFRSLTKEA  426
             P L     GL  T+  GF   A + GE     +V ++  E  +RGES+MP+RFR LTKEA
Sbjct  44    PKLTQKRFGLLYTRKLGFCLNAADNGEVESKSSVDDDGAEKMARGESTMPDRFRYLTKEA  103

Query  427   PDKPVRWPFLIVLAFLLYAWRAVLWELSIWKGIVMGFFRFIGTMMKFALANVLYYILHPV  606
             PD PVRWP+ + L FL+YAWRAVL EL+ WK  V     F+G ++K  LA + ++I  P+
Sbjct  104   PDPPVRWPWFVALGFLVYAWRAVLLELANWKKSVQAVISFVGYLLKLLLAVIFHFIGDPI  163

Query  607   TASLRFVETILHIIRTFYSGVIKQAPIQELTKMiilaslilaiaeaTVPDSVNSQPYLLT  786
             T+ ++ +ET+++ IR +YSG++  AP+ ELT +I+LAS + AIAEA VP+S+ SQPYLLT
Sbjct  164   TSLIKCIETLVYAIRAYYSGIVAYAPVPELTMIIVLASAVFAIAEAAVPNSITSQPYLLT  223

Query  787   VAGFIGFVAAKGYISELFFWTVLLGLFSFGRWVKKRDYvssalpvaavlaavGEPWIQAL  966
             ++G IG+ A K YISE FFWT+L+GL++F R +KKRD+V+SALP AAVLAA+GEPW++ L
Sbjct  224   LSGLIGYAAVKNYISEPFFWTLLVGLYAFSRLIKKRDHVTSALPAAAVLAAIGEPWVRVL  283

Query  967   VMISYTSLAIVQHSREPADGK-EVEATNEVIRAPFPLLCVALAIGMRLAASWAGYRHLTW  1143
             V++SY +LAI  +SR+ +DGK EVE      R P PLLC ALAIG+RLAA WAGYRHLTW
Sbjct  284   VILSYLALAISHNSRKISDGKEEVETMATGQRVPVPLLCAALAIGIRLAAKWAGYRHLTW  343

Query  1144  MI  1149
             M+
Sbjct  344   MV  345



>ref|XP_009357100.1| PREDICTED: uncharacterized protein LOC103947859 isoform X1 [Pyrus 
x bretschneideri]
Length=346

 Score =   291 bits (745),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 179/361 (50%), Positives = 235/361 (65%), Gaps = 20/361 (6%)
 Frame = +1

Query  85    MSITLSTFRSPNIFFKNPIKLSSHPPLFNRPH-----HSNQAPFDSFQPRTSILRLRNAH  249
             MS ++ T  +P       +K++S  P   RPH       N   F    P         A 
Sbjct  1     MSTSIPTISAPTPSILR-LKVASFSPPRIRPHIQTISFRNSLKFQCLNPI-------QAQ  52

Query  250   KFPGLLSTNLGLSVTKNHGFLAKAENGGEGTQNVANEVEIESRGESSMPERFRSLTKEAP  429
             KFPG      G    +     A A+N G       +  E ES+GES+MPERFR LTKEAP
Sbjct  53    KFPGFSGNTNGFLFDRKLRVCASAKNEG------VDAAEDESKGESTMPERFRYLTKEAP  106

Query  430   DKPVRWPFLIVLAFLLYAWRAVLWELSIWKGIVMGFFRFIGTMMKFALANVLYYILHPVT  609
             D PVRWP+L+ L FL+YAWRAVL EL+ WK   +G  RF+G ++K  LA + ++I  P+T
Sbjct  107   DPPVRWPWLVALVFLIYAWRAVLLELANWKKAAVGVVRFVGYLLKLILALIFHFIGDPIT  166

Query  610   ASLRFVETILHIIRTFYSGVIKQAPIQELTKMiilaslilaiaeaTVPDSVNSQPYLLTV  789
             + +RF+ET L+ IR+FYSG++  API ELT +IILAS++LAIAEA VP++VN QP+LLT 
Sbjct  167   SVIRFIETTLYAIRSFYSGIVAYAPIPELTTVIILASIVLAIAEAVVPNAVNCQPFLLTA  226

Query  790   AGFIGFVAAKGYISELFFWTVLLGLFSFGRWVKKRDYvssalpvaavlaavGEPWIQALV  969
             +G +G+ A  GYISE FFWT+L+G + + R VKKRD V+SALP AAV+AA+GEPW++ LV
Sbjct  227   SGVVGYAAVAGYISEPFFWTILVGFYGYSRLVKKRDDVTSALPAAAVMAAIGEPWVRVLV  286

Query  970   MISYTSLAIVQHSREPADGKEVEATNEVIRAPFPLLCVALAIGMRLAASWAGYRHLTWMI  1149
             + SY +LAI  HS++ ++ KE E      + P PLL   LAIG+RLAA WAGYRHLTWMI
Sbjct  287   IASYLALAIFHHSKKVSEKKE-EIVVTDRKLPMPLLGAGLAIGIRLAAKWAGYRHLTWMI  345

Query  1150  V  1152
             V
Sbjct  346   V  346



>ref|XP_009357101.1| PREDICTED: uncharacterized protein LOC103947859 isoform X2 [Pyrus 
x bretschneideri]
Length=346

 Score =   289 bits (740),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 178/361 (49%), Positives = 234/361 (65%), Gaps = 20/361 (6%)
 Frame = +1

Query  85    MSITLSTFRSPNIFFKNPIKLSSHPPLFNRPH-----HSNQAPFDSFQPRTSILRLRNAH  249
             MS ++ T  +P       +K++S  P   RPH       N   F    P         A 
Sbjct  1     MSTSIPTISAPTPSILR-LKVASFSPPRIRPHIQTISFRNSLKFQCLNPI-------QAQ  52

Query  250   KFPGLLSTNLGLSVTKNHGFLAKAENGGEGTQNVANEVEIESRGESSMPERFRSLTKEAP  429
             KFPG      G    +     A A+N G       +  E ES+GES+MPERFR LTKEAP
Sbjct  53    KFPGFSGNTNGFLFDRKLRVCASAKNEG------VDAAEDESKGESTMPERFRYLTKEAP  106

Query  430   DKPVRWPFLIVLAFLLYAWRAVLWELSIWKGIVMGFFRFIGTMMKFALANVLYYILHPVT  609
             D PVRWP+ + L FL+YAWRAVL EL+ WK   +G  RF+G ++K  LA + ++I  P+T
Sbjct  107   DPPVRWPWFVALVFLIYAWRAVLLELANWKKAAVGVVRFVGYLLKLILALIFHFIGDPIT  166

Query  610   ASLRFVETILHIIRTFYSGVIKQAPIQELTKMiilaslilaiaeaTVPDSVNSQPYLLTV  789
             + +RF+ET L+ IR+FYSG++  API ELT +IILAS++LAIAEA VP++VN QP+LLT 
Sbjct  167   SVIRFIETTLYAIRSFYSGIVAYAPIPELTTVIILASIVLAIAEAVVPNAVNCQPFLLTA  226

Query  790   AGFIGFVAAKGYISELFFWTVLLGLFSFGRWVKKRDYvssalpvaavlaavGEPWIQALV  969
             +G +G+ A  GYISE FFWT+L+G + + R VKKRD V+SALP AAV+AA+GEPW++ LV
Sbjct  227   SGVVGYAAVAGYISEPFFWTILVGFYGYSRLVKKRDDVTSALPAAAVMAAIGEPWVRVLV  286

Query  970   MISYTSLAIVQHSREPADGKEVEATNEVIRAPFPLLCVALAIGMRLAASWAGYRHLTWMI  1149
             + SY +LAI  HS++ ++ KE E      + P PLL   LAIG+RLAA WAGYRHLTWMI
Sbjct  287   IASYLALAIFHHSKKVSEKKE-EIVVTDRKLPMPLLGAGLAIGIRLAAKWAGYRHLTWMI  345

Query  1150  V  1152
             V
Sbjct  346   V  346



>gb|EYU24871.1| hypothetical protein MIMGU_mgv1a011993mg [Erythranthe guttata]
Length=264

 Score =   284 bits (727),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 161/263 (61%), Positives = 203/263 (77%), Gaps = 2/263 (1%)
 Frame = +1

Query  367   IESRGESSMPERFRSLTKEAPDKPVRWPFLIVLAFLLYAWRAVLWELSIWKGIVMGFFRF  546
             + +RG+SSMPERFR L+KEAPDK VRWP+LIVL F+LYAWR VLWELS W+  +    RF
Sbjct  1     MAARGQSSMPERFRYLSKEAPDKSVRWPWLIVLGFMLYAWRTVLWELSNWRKSIFAIGRF  60

Query  547   IGTMMKFALANVLYYILHPVTASLRFVETILHIIRTFYSGVIKQAPIQELTKMiilasli  726
             +  + KFALA + ++I +P+T+ +  +ET L+ IR+FYSG+I  API +LT +I+L S +
Sbjct  61    LQYLSKFALALLFHFIGNPLTSLIHAIETTLYTIRSFYSGLIAYAPISDLTLIIMLTSAV  120

Query  727   laiaeaTVPDSVNSQPYLLTVAGFIGFVAAKGYISELFFWTVLLGLFSFGRWVKKRDYvs  906
             LAI+EA  PDSVN QPY+LTVAG IGF A K YI+ELFFWT+L+GLF +G  VKKRDYVS
Sbjct  121   LAISEAAAPDSVNRQPYILTVAGLIGFCAVKNYITELFFWTLLVGLFGYGSLVKKRDYVS  180

Query  907   salpvaavlaavGEPWIQALVMISYTSLAIVQHSREP-ADGKEVEATNEVI-RAPFPLLC  1080
             S+LPVA VLAAVGEPW++ + M S+  LAI  +SR+   D KE E  N V+ R P PL+C
Sbjct  181   SSLPVATVLAAVGEPWVRVISMGSFLGLAIFHYSRKKIVDSKEGEENNGVVNRVPIPLIC  240

Query  1081  VALAIGMRLAASWAGYRHLTWMI  1149
              ALAIG+R+AA WAGYRHLTWMI
Sbjct  241   AALAIGVRVAAKWAGYRHLTWMI  263



>ref|XP_007043492.1| Embryo defective 1923 [Theobroma cacao]
 gb|EOX99323.1| Embryo defective 1923 [Theobroma cacao]
Length=352

 Score =   286 bits (732),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 168/324 (52%), Positives = 221/324 (68%), Gaps = 3/324 (1%)
 Frame = +1

Query  184   SNQAPFDSFQPRTSILRLRNAHKFPGLLSTNLGLSVTKNHGFLAKAENGGEGTQNVANEV  363
             S      SF  R      + A  F  L    LG S      F   A NGGE      +E 
Sbjct  31    SRHQSLRSFPSRIPAFTPKPALNFLLLSDKRLGFSRNAKSEFYVSARNGGE--DGGVDEA  88

Query  364   EIESRGESSMPERFRSLTKEAPDKPVRWPFLIVLAFLLYAWRAVLWELSIWKGIVMGFFR  543
             E  +RGES+MPERFR LTKEAPD PVRWPF + LAFLLYAWRAVL+ELS W+    G  R
Sbjct  89    ERLARGESTMPERFRYLTKEAPDPPVRWPFFVALAFLLYAWRAVLFELSKWRQAAFGIVR  148

Query  544   FIGTMMKFALANVLYYILHPVTASLRFVETILHIIRTFYSGVIKQAPIQELTKMiilasl  723
             F+  ++K A+A + ++I  P T+ +R +ET+++ IR FYSG++  AP+ ELT +I+LAS 
Sbjct  149   FVRYLLKLAVAFIFHFIGDPTTSLIRCIETVIYNIRAFYSGIVAYAPVHELTVIIVLASA  208

Query  724   ilaiaeaTVPDSVNSQPYLLTVAGFIGFVAAKGYISELFFWTVLLGLFSFGRWVKKRDYv  903
             +L+IAEATVP+S++ QPY+LT++G IG+ A  GYISE  +WT+LLG++ F R +KKRD V
Sbjct  209   VLSIAEATVPNSISCQPYMLTISGLIGYAAVIGYISEPLYWTLLLGIYGFSRLIKKRDDV  268

Query  904   ssalpvaavlaavGEPWIQALVMISYTSLAIVQHSREPADGKE-VEATNEVIRAPFPLLC  1080
             +SALPVAAV+AA+GEPW++ LV+ SY +LAI  HS++ ++ +E +E      R P PLL 
Sbjct  269   TSALPVAAVMAAIGEPWVRILVITSYLALAIFHHSKKLSEVEEPIEGVAAERRLPMPLLG  328

Query  1081  VALAIGMRLAASWAGYRHLTWMIV  1152
              ALAIG+ LAA WAG RHLTWMIV
Sbjct  329   AALAIGVHLAAKWAGNRHLTWMIV  352



>ref|XP_002517989.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44507.1| conserved hypothetical protein [Ricinus communis]
Length=350

 Score =   285 bits (730),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 175/364 (48%), Positives = 242/364 (66%), Gaps = 22/364 (6%)
 Frame = +1

Query  85    MSITLSTFRSPNIFFKNPIKLSSHPPLFNRPHHSNQAPFDSFQPRTSILRLRNAHKFPGL  264
             M++ ++T  S +  FK P    S   L  R H    +PF S   +T +   +  H+    
Sbjct  1     MAMPIATLSSSSSTFKIP----SFSSLTLRNHKQPISPF-SLPIQTQLSNSKFTHE----  51

Query  265   LSTNLGLSVTKNHGFLAKAENGGEGTQNVA-----NEVEIESRGESSMPERFRSLTKEAP  429
                  GL V  N+  L    N G+G ++ +     ++ EI +RGES+MPERFR LTKEAP
Sbjct  52    ---RFGLFVYSNNKNLGLCLNAGKGERSNSVVDDNDDAEILARGESTMPERFRYLTKEAP  108

Query  430   DKPVRWPFLIVLAFLLYAWRAVLWELSIWKGIVMGFFRFIGTMMKFALANVLYYILHPVT  609
             D PVRWP+ I L FL+YAWRAVL+EL+ WK   +    F+  ++K  LA + ++I  PVT
Sbjct  109   DPPVRWPWFIALGFLVYAWRAVLFELANWKNGALAVVSFVSYLLKLLLAVIFHFIGDPVT  168

Query  610   ASLRFVETILHIIRTFYSGVIKQAPIQELTKMiilaslilaiaeaTVPDSVNSQPYLLTV  789
             + +RF+ET+++++R +YSG++  AP+ ELT +I+L+S +LAIAEA  P+S+ SQPYLLT+
Sbjct  169   SLIRFLETLIYMVRAYYSGIVSYAPVPELTTIIVLSSAVLAIAEAAAPNSITSQPYLLTI  228

Query  790   AGFIGFVAAKGYISELFFWTVLLGLFSFGRWVKKRDYvssalpvaavlaavGEPWIQALV  969
             +G IG+ A + YISE  FWT+LLGL+ F    K+RD+V+SALP AAVLAA+GEPW++ LV
Sbjct  229   SGLIGYAAVRNYISEPLFWTLLLGLYGFSLLFKRRDHVTSALPSAAVLAAIGEPWVRVLV  288

Query  970   MISYTSLAIVQHSREPADGKE---VEATNEVIRAPFPLLCVALAIGMRLAASWAGYRHLT  1140
             M +Y +LAI  HSR+  +GKE   V AT    + P PL C ALAIG+RLAA WAGYRHLT
Sbjct  289   MFAYLALAISHHSRKLIEGKEEVNVVATGR--KVPVPLFCAALAIGIRLAAKWAGYRHLT  346

Query  1141  WMIV  1152
             WM+V
Sbjct  347   WMVV  350



>ref|XP_009350622.1| PREDICTED: uncharacterized protein LOC103942134 [Pyrus x bretschneideri]
Length=346

 Score =   285 bits (729),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 170/338 (50%), Positives = 227/338 (67%), Gaps = 9/338 (3%)
 Frame = +1

Query  139   IKLSSHPPLFNRPHHSNQAPFDSFQPRTSILRLRNAHKFPGLLSTNLGLSVTKNHGFLAK  318
             +K++S  P   +PH + + PF S  P+   L    A  FPG      G    +     A 
Sbjct  18    LKVTSFTPPRIQPH-TQRIPFRSL-PKFQCLNRIQAQNFPGFSWKTNGFLFERKLRVRAS  75

Query  319   AENGGEGTQNVANEVEIESRGESSMPERFRSLTKEAPDKPVRWPFLIVLAFLLYAWRAVL  498
              +N G       +  E ESRGES+MPER R LTKEAPD PVRWP+L+ L FL+YAWRAVL
Sbjct  76    VKNEG------VDAAEEESRGESTMPERSRYLTKEAPDPPVRWPWLVALVFLIYAWRAVL  129

Query  499   WELSIWKGIVMGFFRFIGTMMKFALANVLYYILHPVTASLRFVETILHIIRTFYSGVIKQ  678
              EL+ W+    G  RF+G ++K  LA + ++I  P+T+ +RF+ET L+ IR+FYSG++  
Sbjct  130   LELANWRKAAEGVVRFVGYLLKLILALIFHFIGDPITSVIRFIETTLYAIRSFYSGIVAY  189

Query  679   APIQELTKMiilaslilaiaeaTVPDSVNSQPYLLTVAGFIGFVAAKGYISELFFWTVLL  858
             API ELT +IILAS +LAIAEA VP++VN QP+LLT +G +G+ A  GYISE  FWT+L+
Sbjct  190   APIPELTTVIILASTVLAIAEAVVPNAVNCQPFLLTASGVVGYAAVAGYISEPLFWTILV  249

Query  859   GLFSFGRWVKKRDYvssalpvaavlaavGEPWIQALVMISYTSLAIVQHSREPADGKEVE  1038
             G + + R VKKRD ++SALP AAV++A+GEPW++ LV+ SY +LAI  HS++ +D +E E
Sbjct  250   GFYGYSRLVKKRDDITSALPAAAVMSAIGEPWVRVLVIASYLALAIFHHSKKVSDTEE-E  308

Query  1039  ATNEVIRAPFPLLCVALAIGMRLAASWAGYRHLTWMIV  1152
                   + P PLL   LAIG+RLAA WAGYRHLTWMIV
Sbjct  309   IVVANRKLPMPLLGAGLAIGIRLAAKWAGYRHLTWMIV  346



>ref|XP_007215629.1| hypothetical protein PRUPE_ppa008067mg [Prunus persica]
 gb|EMJ16828.1| hypothetical protein PRUPE_ppa008067mg [Prunus persica]
Length=346

 Score =   285 bits (728),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 172/339 (51%), Positives = 232/339 (68%), Gaps = 11/339 (3%)
 Frame = +1

Query  139   IKLSSHPPLFNRPHHSNQAPFDSFQPRTSILRLRNAHKFPGLLSTNLGLSVTKNHGFLAK  318
             +K++S  PL  RP       F S   +  IL    AH FPG     +G    +       
Sbjct  18    LKITSFSPLSIRPRKQT-IQFRS-STKVQILNPIQAHNFPGFSGKAIGFLFERRLRVRVS  75

Query  319   AENGGEGTQNVANEVEIESRGESSMPERFRSLTKEAPDKPVRWPFLIVLAFLLYAWRAVL  498
             A++ G       +E E E+ GES+MPERFR LTKEAPD PVRWP+ + L FL+YAWRAVL
Sbjct  76    AKSDG------VDEAEEETGGESTMPERFRYLTKEAPDPPVRWPWFVALVFLIYAWRAVL  129

Query  499   WELSIWKGIVMGFFRFIGTMMKFALANVLYYILHPVTASLRFVETILHIIRTFYSGVIKQ  678
              EL+ W+   +   RF+G ++K  LA + +++  P+T  +RF+ET ++ +R+FYSG++  
Sbjct  130   LELANWRKAALAVVRFVGYLLKLILALIFHFLGDPITFIIRFIETTIYTLRSFYSGIVAY  189

Query  679   APIQELTKMiilaslilaiaeaTVPDSVNSQPYLLTVAGFIGFVAAKGYISELFFWTVLL  858
             API ELT +I+LAS +LAIAEA VP+S+N QP+LLT +G +G+ A  GYISE FFWT+L+
Sbjct  190   APIPELTTVIMLASTVLAIAEAVVPNSINCQPFLLTASGVVGYAAVTGYISEPFFWTILM  249

Query  859   GLFSFGRWVKKRDYvssalpvaavlaavGEPWIQALVMISYTSLAIVQHSREPADGK-EV  1035
             GL+ + R+VKKRD V+SALP AAVLAAVGEP+I+ LV+ SY +LAI+ HS++ ++ K E+
Sbjct  250   GLYGYSRFVKKRDDVTSALPAAAVLAAVGEPYIRVLVISSYLALAILHHSKKLSERKEEI  309

Query  1036  EATNEVIRAPFPLLCVALAIGMRLAASWAGYRHLTWMIV  1152
               TN   + P PLL VALAIG+ LAA WAGYRHLTWMIV
Sbjct  310   VVTNR--KLPMPLLGVALAIGIHLAAKWAGYRHLTWMIV  346



>emb|CBI28387.3| unnamed protein product [Vitis vinifera]
Length=255

 Score =   281 bits (719),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 166/257 (65%), Positives = 203/257 (79%), Gaps = 5/257 (2%)
 Frame = +1

Query  391   MPERFRSLTKEAPDKPVRWPFLIVLAFLLYAWRAVLWELSIWKGIVMGFFRFIGTMMKFA  570
             MPERFR LTKEAPD P+RWP+ I L FL+YAWR VLWELS W+   +    F G ++K A
Sbjct  1     MPERFRHLTKEAPDPPLRWPWYIALVFLVYAWRTVLWELSNWRKAALAVVYFAGYLLKLA  60

Query  571   LANVLYYILHPVTASLRFVETILHIIRTFYSGVIKQAPIQELTKMiilaslilaiaeaTV  750
             LA + ++I +PVT+ +R VET L+ IR FYS ++  AP+ ELT +IILAS +LAIAEATV
Sbjct  61    LALIFHFIGNPVTSLIRCVETALYTIRAFYSSIVTYAPVPELTTIIILASAVLAIAEATV  120

Query  751   PDSVNSQPYLLTVAGFIGFVAAKGYISELFFWTVLLGLFSFGRWVKKRDYvssalpvaav  930
             PDSVNSQPYLLTV+G IGF A K +ISE FFWT+L+GLF+F + VKKRDYVSSALPVAAV
Sbjct  121   PDSVNSQPYLLTVSGLIGFAAVKDFISEPFFWTLLVGLFAFAQLVKKRDYVSSALPVAAV  180

Query  931   laavGEPWIQALVMISYTSLAIVQHSREPADGK---EVEATNEVIRAPFPLLCVALAIGM  1101
             LAAVG+PW++ +V+ SYT+LAI  HS++ +DGK   EV AT+   R P PLLCV+LAIG+
Sbjct  181   LAAVGQPWLRVVVIASYTALAISHHSKKISDGKEEGEVAATSR--RLPVPLLCVSLAIGI  238

Query  1102  RLAASWAGYRHLTWMIV  1152
              LAA WAGYRHLTWMIV
Sbjct  239   HLAAKWAGYRHLTWMIV  255



>ref|XP_010531634.1| PREDICTED: uncharacterized protein LOC104807893 [Tarenaya hassleriana]
Length=352

 Score =   281 bits (720),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 161/310 (52%), Positives = 216/310 (70%), Gaps = 3/310 (1%)
 Frame = +1

Query  232   RLRNAHKFPGLLSTNLGLSVTKNHGFLAK--AENGGEGTQNVANEVEIESRGESSMPERF  405
             RLR     P    +  G++  +  G   K  AE G   +  VA E E  +RGES+MP+RF
Sbjct  43    RLRVQQALPSSSFSLNGVAKVRRLGLCGKLCAEKGDGRSDGVAEETERLARGESTMPDRF  102

Query  406   RSLTKEAPDKPVRWPFLIVLAFLLYAWRAVLWELSIWKGIVMGFFRFIGTMMKFALANVL  585
             R LTKEAPD  VRWP+ + LAFL+Y+WRAVL+ELS W+   +   R +G ++K  LA V 
Sbjct  103   RYLTKEAPDPTVRWPWFVALAFLVYSWRAVLFELSNWRKAALTILRILGDLLKLGLALVF  162

Query  586   YYILHPVTASLRFVETILHIIRTFYSGVIKQAPIQELTKMiilaslilaiaeaTVPDSVN  765
             ++I  P+T+ + F+ET ++ IR FYSG++   PI+ELT +++LAS +LA+ EA  P+S++
Sbjct  163   HFIGDPITSLISFIETAMYSIRAFYSGIVAYTPIRELTTVVLLASSVLAVGEAIAPNSIS  222

Query  766   SQPYLLTVAGFIGFVAAKGYISELFFWTVLLGLFSFGRWVKKRDYvssalpvaavlaavG  945
             SQPY+LTVAG IG+ A + YISE FFWT+LLGL+ F R +KKR +V+SALP AAVLAAVG
Sbjct  223   SQPYVLTVAGLIGYAAVQSYISEPFFWTLLLGLYGFSRLIKKRGHVTSALPSAAVLAAVG  282

Query  946   EPWIQALVMISYTSLAIVQHSREPADGK-EVEATNEVIRAPFPLLCVALAIGMRLAASWA  1122
             EPW++ + M  Y +LA+  +SR P+D K E E +      P PLL VALA+G+RLAA WA
Sbjct  283   EPWVRVMAMAGYLALAMYHNSRRPSDRKLESEGSKTGRSVPVPLLAVALAMGVRLAAKWA  342

Query  1123  GYRHLTWMIV  1152
             GYRHLTWMIV
Sbjct  343   GYRHLTWMIV  352



>ref|XP_002319380.1| hypothetical protein POPTR_0013s14300g [Populus trichocarpa]
 gb|EEE95303.1| hypothetical protein POPTR_0013s14300g [Populus trichocarpa]
Length=349

 Score =   281 bits (719),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 161/292 (55%), Positives = 210/292 (72%), Gaps = 4/292 (1%)
 Frame = +1

Query  286   SVTKNHGFLAKAENGGEGTQNVANEVEIESRGESSMPERFRSLTKEAPDKPVRWPFLIVL  465
             S  +  GF   AENG EG        +   RGES+MPERFR LTKEAPD PVRWP+ + L
Sbjct  59    SRDRKLGFRVNAENG-EGESERDGVFDDGERGESTMPERFRYLTKEAPDPPVRWPWFVAL  117

Query  466   AFLLYAWRAVLWELSIWKGIVMGFFRFIGTMMKFALANVLYYILHPVTASLRFVETILHI  645
              FL+YAWRAVL+EL  WK  V+    F+G ++K  LA V ++I  P+T+ +R +ET ++ 
Sbjct  118   GFLIYAWRAVLFELGNWKRGVIAIIGFVGYLLKLLLAVVFHFIGDPITSLIRCIETAIYT  177

Query  646   IRTFYSGVIKQAPIQELTKMiilaslilaiaeaTVPDSVNSQPYLLTVAGFIGFVAAKGY  825
              + FYSG+++ AP+ ELT +I+LAS +LAI EA  P+SV+ QPYLLTV+G IG+ A + Y
Sbjct  178   FQAFYSGIVRSAPVPELTLIIMLASAVLAIGEAAAPNSVSRQPYLLTVSGLIGYAAVRNY  237

Query  826   ISELFFWTVLLGLFSFGRWVKKRDYvssalpvaavlaavGEPWIQALVMISYTSLAIVQH  1005
             ISE  FWT+LLGL++F R++KKRD V+SALP AAVLAA+GEPW++ LVM+SY +LAI  H
Sbjct  238   ISEPLFWTLLLGLYAFSRFIKKRDDVTSALPAAAVLAAIGEPWVRVLVMVSYLALAISYH  297

Query  1006  SREPADGK---EVEATNEVIRAPFPLLCVALAIGMRLAASWAGYRHLTWMIV  1152
             S++ A GK   EV   +   R P PLLC ALAIG+ +AA WAGYRHLTWM+V
Sbjct  298   SKQLAKGKEEVEVVTADTGSRVPVPLLCAALAIGIHVAAKWAGYRHLTWMLV  349



>ref|XP_010556170.1| PREDICTED: uncharacterized protein LOC104825523 [Tarenaya hassleriana]
Length=343

 Score =   280 bits (717),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 155/280 (55%), Positives = 207/280 (74%), Gaps = 1/280 (0%)
 Frame = +1

Query  316   KAENGGEGTQNVANEVEIESRGESSMPERFRSLTKEAPDKPVRWPFLIVLAFLLYAWRAV  495
             +AE G E ++ +  E E  +RGES+MP+RFR LTKEAPD PVRWP+ + LAFL+Y+WRAV
Sbjct  64    RAEKGDERSEGITEEAERLARGESTMPDRFRYLTKEAPDPPVRWPWFVALAFLVYSWRAV  123

Query  496   LWELSIWKGIVMGFFRFIGTMMKFALANVLYYILHPVTASLRFVETILHIIRTFYSGVIK  675
             L+ELS W+   +   RF+G ++K  LA V ++I  P+T+ + FVET ++ IR FYSG++ 
Sbjct  124   LFELSNWRKASLAILRFLGDILKLGLALVFHFIGDPITSLIYFVETAIYSIRAFYSGIVA  183

Query  676   QAPIQELTKMiilaslilaiaeaTVPDSVNSQPYLLTVAGFIGFVAAKGYISELFFWTVL  855
               PI+ELT +I+LAS +LAI EA  P+S++SQPY+LT+AG IG+ A + YISE FFWT+L
Sbjct  184   YTPIRELTTVILLASSVLAIGEAVAPNSISSQPYVLTLAGLIGYAAVQSYISEPFFWTLL  243

Query  856   LGLFSFGRWVKKRDYvssalpvaavlaavGEPWIQALVMISYTSLAIVQHSREPADGK-E  1032
             L L+ F R +KKR+ V+SALP  AVLAAVGEPW++A+ M  Y +LA+  +S+   DGK E
Sbjct  244   LALYGFSRLIKKRNNVTSALPSVAVLAAVGEPWVRAIAMTGYLALAMYHNSKRLLDGKRE  303

Query  1033  VEATNEVIRAPFPLLCVALAIGMRLAASWAGYRHLTWMIV  1152
              E +      P PLL  ALAIG+RLAA+WAGYRHLTWMIV
Sbjct  304   KEGSTSGRNVPVPLLAAALAIGIRLAANWAGYRHLTWMIV  343



>gb|KHN22899.1| hypothetical protein glysoja_020829 [Glycine soja]
Length=334

 Score =   279 bits (713),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 158/278 (57%), Positives = 211/278 (76%), Gaps = 2/278 (1%)
 Frame = +1

Query  316   KAENGGEGTQNVANEVEIESRGESSMPERFRSLTKEAPDKPVRWPFLIVLAFLLYAWRAV  495
             K  N G+    + +E E E+RG S+MPERFR L KE P  PVRWP+L+VLAFL+YAWRAV
Sbjct  56    KESNNGDVLTGL-DEAEKEARGNSTMPERFRYLAKEVPSPPVRWPWLVVLAFLVYAWRAV  114

Query  496   LWELSIWKGIVMGFFRFIGTMMKFALANVLYYILHPVTASLRFVETILHIIRTFYSGVIK  675
             L+ELS WK       RF+G ++K+A A V  +I  P+T S+R +E + +I+R  YS +I 
Sbjct  115   LFELSNWKNGAFAIIRFVGYVLKYAFAVVYQFIGSPITFSIRCMEDLFYIVRACYSWIIH  174

Query  676   QAPIQELTKMiilaslilaiaeaTVPDSVNSQPYLLTVAGFIGFVAAKGYISELFFWTVL  855
              AP+ +LT +I+LAS++LAIAEATVP+S+N Q  +LTV+G IG+ A +GYISELFFWT+L
Sbjct  175   NAPVTDLTTIIVLASIVLAIAEATVPNSINDQHNVLTVSGLIGYAAVRGYISELFFWTLL  234

Query  856   LGLFSFGRWVKKRDYvssalpvaavlaavGEPWIQALVMISYTSLAIVQHSREPADGKEV  1035
             +G+++F ++VKKRD VS+A+PVAAVLA VGEPW++ALV+ISYT+LAI Q+S+ P +GK+V
Sbjct  235   VGVYAFSKFVKKRDDVSAAMPVAAVLAGVGEPWVRALVIISYTALAIYQYSKTPPEGKKV  294

Query  1036  -EATNEVIRAPFPLLCVALAIGMRLAASWAGYRHLTWM  1146
              E     +R P PLL  A AIG+R+AA W GYRHLTWM
Sbjct  295   GEVETRQMRLPIPLLLAAFAIGLRVAAKWVGYRHLTWM  332



>ref|XP_010095833.1| hypothetical protein L484_022189 [Morus notabilis]
 gb|EXB62301.1| hypothetical protein L484_022189 [Morus notabilis]
Length=352

 Score =   279 bits (714),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 175/356 (49%), Positives = 239/356 (67%), Gaps = 4/356 (1%)
 Frame = +1

Query  85    MSITLSTFRSPNIFFKNPIKLSSHPPLFNRPHHSNQAPFDSFQPRTSILRLRNAHKFPGL  264
             MS+T+ T  SPN    N +K +   P+  R   S    F S   +       +A    G 
Sbjct  1     MSMTVHTLSSPNPSLLN-LKFTCRSPITTR-FRSRFVTFSSSPTKLQSFNPLSADNLDGF  58

Query  265   LSTNLGLSVTKNHGFLAKAENGGEGTQNVANEVEIESRGESSMPERFRSLTKEAPDKPVR  444
                   L   +       A+N  +G + +  E E E+RGES++PERFR LT+EAPD P+R
Sbjct  59    SGKRPELLFGRKFWVCLAAKNDDKGDE-IDEEGEKEARGESTLPERFRYLTEEAPDLPLR  117

Query  445   WPFLIVLAFLLYAWRAVLWELSIWKGIVMGFFRFIGTMMKFALANVLYYILHPVTASLRF  624
             WP+ + +AFL+YAWR VL+EL  WK   +   RF G ++K  LA ++++I  P+T+ +R 
Sbjct  118   WPWFVAVAFLIYAWRTVLFELYNWKKAAIAIVRFAGYLLKLLLALMIHFIGDPITSLIRC  177

Query  625   VETILHIIRTFYSGVIKQAPIQELTKMiilaslilaiaeaTVPDSVNSQPYLLTVAGFIG  804
             VET L+ +R +YSG++  AP+ ELT +IIL+S +LAIAEATVPDSV+SQP++LT++G IG
Sbjct  178   VETALYTVRAYYSGIVAYAPVPELTTIIILSSAVLAIAEATVPDSVSSQPHILTISGLIG  237

Query  805   FVAAKGYISELFFWTVLLGLFSFGRWVKKRDYvssalpvaavlaavGEPWIQALVMISYT  984
             + A +GYISE FFWT+L+GL++F R VKKRD VS+ALPVAAVLAA+GEPW++ L M SY 
Sbjct  238   YAAVRGYISEPFFWTLLVGLYTFSRLVKKRDDVSAALPVAAVLAAIGEPWVRVLAMASYL  297

Query  985   SLAIVQHSREPADGKEVEATNEVIRAPFPLLCVALAIGMRLAASWAGYRHLTWMIV  1152
             +LAI  HS++  +GKE E      + P PLL VALAIG+R+AA WAGYRHLTWM+V
Sbjct  298   ALAISHHSKKLREGKEKEVV-AARKLPLPLLGVALAIGIRIAAKWAGYRHLTWMVV  352



>ref|XP_011048458.1| PREDICTED: uncharacterized protein LOC105142497 [Populus euphratica]
Length=349

 Score =   278 bits (712),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 158/289 (55%), Positives = 209/289 (72%), Gaps = 4/289 (1%)
 Frame = +1

Query  295   KNHGFLAKAENGGEGTQNVANEVEIESRGESSMPERFRSLTKEAPDKPVRWPFLIVLAFL  474
             +  GF   AENG EG        +   RGES+MPERFR LTKEAPD PVRWP+ + L FL
Sbjct  62    RKLGFRFNAENG-EGESKRDGVFDDGERGESTMPERFRYLTKEAPDPPVRWPWFVALGFL  120

Query  475   LYAWRAVLWELSIWKGIVMGFFRFIGTMMKFALANVLYYILHPVTASLRFVETILHIIRT  654
             +YAWRAVL+EL  WK  V+    F+G ++K  LA V ++I  P+T+ +R +ET ++  + 
Sbjct  121   IYAWRAVLFELGNWKRGVIAIIGFVGYLLKLLLAVVFHFIGDPITSLIRCIETAIYTFQA  180

Query  655   FYSGVIKQAPIQELTKMiilaslilaiaeaTVPDSVNSQPYLLTVAGFIGFVAAKGYISE  834
             FYSG+++ AP+ ELT +I+LAS +LAI EA  P+SV+ QPYLLT++G IG+ A + YISE
Sbjct  181   FYSGIVRSAPVPELTLIIMLASAVLAIGEAAAPNSVSRQPYLLTISGLIGYAAVRNYISE  240

Query  835   LFFWTVLLGLFSFGRWVKKRDYvssalpvaavlaavGEPWIQALVMISYTSLAIVQHSRE  1014
               FWT+LLGL++F R++KKRD V+SALP AAVLAA+GEPW++ L+M+SY +LAI  HS++
Sbjct  241   PLFWTLLLGLYAFSRFIKKRDDVTSALPAAAVLAAIGEPWVRVLLMVSYLALAISYHSKQ  300

Query  1015  PADGK---EVEATNEVIRAPFPLLCVALAIGMRLAASWAGYRHLTWMIV  1152
              A GK   EV   +   R P PLLC ALAIG+ +AA WAGYRHLTWM+V
Sbjct  301   LAKGKEEVEVVTADTSSRVPVPLLCAALAIGIHVAAKWAGYRHLTWMLV  349



>gb|ACU24077.1| unknown [Glycine max]
Length=334

 Score =   277 bits (709),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 157/278 (56%), Positives = 211/278 (76%), Gaps = 2/278 (1%)
 Frame = +1

Query  316   KAENGGEGTQNVANEVEIESRGESSMPERFRSLTKEAPDKPVRWPFLIVLAFLLYAWRAV  495
             K  N G+    + +E E E+RG S+MPERFR L KE P  PVRWP+L+VLAFL+YAWRAV
Sbjct  56    KESNNGDVLTGL-DEAEKEARGNSTMPERFRYLAKEVPSPPVRWPWLVVLAFLVYAWRAV  114

Query  496   LWELSIWKGIVMGFFRFIGTMMKFALANVLYYILHPVTASLRFVETILHIIRTFYSGVIK  675
             L+ELS WK       RF+G ++K+A A V  +I  P+T S+R +E + +I+R  YS +I 
Sbjct  115   LFELSNWKNGAFAIIRFVGYVLKYAFAVVYQFIGSPITFSIRCMEDLFYIVRACYSWIIH  174

Query  676   QAPIQELTKMiilaslilaiaeaTVPDSVNSQPYLLTVAGFIGFVAAKGYISELFFWTVL  855
              AP+ +LT +I+LAS++LAIAEATVP+S+N Q  +LTV+G IG+ A +GYISELFFWT+L
Sbjct  175   NAPVTDLTTIIVLASIVLAIAEATVPNSINDQHNVLTVSGLIGYAAVRGYISELFFWTLL  234

Query  856   LGLFSFGRWVKKRDYvssalpvaavlaavGEPWIQALVMISYTSLAIVQHSREPADGKEV  1035
             +G+++F ++VKKRD V++A+PVAAVLA VGEPW++ALV+ISYT+LAI Q+S+ P +GK+V
Sbjct  235   VGVYAFSKFVKKRDDVAAAMPVAAVLAGVGEPWVRALVIISYTALAIYQYSKTPPEGKKV  294

Query  1036  -EATNEVIRAPFPLLCVALAIGMRLAASWAGYRHLTWM  1146
              E     +R P PLL  A AIG+R+AA W GYRHLTWM
Sbjct  295   GEVETRQMRLPIPLLLAAFAIGLRVAAKWVGYRHLTWM  332



>ref|XP_003539894.1| PREDICTED: uncharacterized protein LOC100794085 [Glycine max]
Length=334

 Score =   277 bits (708),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 157/278 (56%), Positives = 211/278 (76%), Gaps = 2/278 (1%)
 Frame = +1

Query  316   KAENGGEGTQNVANEVEIESRGESSMPERFRSLTKEAPDKPVRWPFLIVLAFLLYAWRAV  495
             K  N G+    + +E E E+RG S+MPERFR L KE P  PVRWP+L+VLAFL+YAWRAV
Sbjct  56    KESNNGDVLTGL-DEAEKEARGNSTMPERFRYLAKEVPSPPVRWPWLVVLAFLVYAWRAV  114

Query  496   LWELSIWKGIVMGFFRFIGTMMKFALANVLYYILHPVTASLRFVETILHIIRTFYSGVIK  675
             L+ELS WK       RF+G ++K+A A V  +I  P+T S+R +E + +I+R  YS +I 
Sbjct  115   LFELSNWKNGAFAIIRFVGYVLKYAFAVVYQFIGSPITFSIRCMEDLFYIVRACYSWIIH  174

Query  676   QAPIQELTKMiilaslilaiaeaTVPDSVNSQPYLLTVAGFIGFVAAKGYISELFFWTVL  855
              AP+ +LT +I+LAS++LAIAEATVP+S+N Q  +LTV+G IG+ A +GYISELFFWT+L
Sbjct  175   NAPVTDLTTIIVLASIVLAIAEATVPNSINDQHNVLTVSGLIGYAAVRGYISELFFWTLL  234

Query  856   LGLFSFGRWVKKRDYvssalpvaavlaavGEPWIQALVMISYTSLAIVQHSREPADGKEV  1035
             +G+++F ++VKKRD V++A+PVAAVLA VGEPW++ALV+ISYT+LAI Q+S+ P +GK+V
Sbjct  235   VGVYAFSKFVKKRDDVAAAMPVAAVLAGVGEPWVRALVIISYTALAIYQYSKTPPEGKKV  294

Query  1036  -EATNEVIRAPFPLLCVALAIGMRLAASWAGYRHLTWM  1146
              E     +R P PLL  A AIG+R+AA W GYRHLTWM
Sbjct  295   GEVETRQMRLPIPLLLAAFAIGLRVAAKWVGYRHLTWM  332



>ref|XP_003527457.1| PREDICTED: uncharacterized protein LOC100819518 [Glycine max]
Length=339

 Score =   274 bits (701),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 157/278 (56%), Positives = 209/278 (75%), Gaps = 3/278 (1%)
 Frame = +1

Query  316   KAENGGEGTQNVANEVEIESRGESSMPERFRSLTKEAPDKPVRWPFLIVLAFLLYAWRAV  495
             +++NG   T    +EVE E+RG S+MPERFR L KE P  PVRWP+L+VLAFL+YAWRAV
Sbjct  62    ESDNGDVLTG--LDEVEKEARGNSTMPERFRYLAKEVPSLPVRWPWLVVLAFLVYAWRAV  119

Query  496   LWELSIWKGIVMGFFRFIGTMMKFALANVLYYILHPVTASLRFVETILHIIRTFYSGVIK  675
             L+ELS WK       RF+G ++K+A A V  +I  P+T S+R +E + + +R  YS +I 
Sbjct  120   LFELSNWKNGAFAIVRFLGYLLKYAFAVVYQFIGSPITFSIRCIEDLFYTVRASYSWIIH  179

Query  676   QAPIQELTKMiilaslilaiaeaTVPDSVNSQPYLLTVAGFIGFVAAKGYISELFFWTVL  855
              AP+ +LT +I+LAS++LAI EATVP+S+N Q  +LTV+G IG+ A +GYISELFFWT+L
Sbjct  180   NAPVPDLTIIIMLASIVLAIGEATVPNSINDQHNVLTVSGLIGYAAVRGYISELFFWTIL  239

Query  856   LGLFSFGRWVKKRDYvssalpvaavlaavGEPWIQALVMISYTSLAIVQHSREPADGKEV  1035
             LG+++F ++VKKRD VS+A+PVAAVLA VGEPW++ALV+ISYT+LAI Q+S+    GKEV
Sbjct  240   LGVYAFSKFVKKRDDVSAAMPVAAVLAGVGEPWVRALVIISYTALAIYQYSKTSTGGKEV  299

Query  1036  -EATNEVIRAPFPLLCVALAIGMRLAASWAGYRHLTWM  1146
              E     +R P PLL  + AIG+R+AA W GYRHLTWM
Sbjct  300   GEVETRQMRLPIPLLLASFAIGLRVAAKWVGYRHLTWM  337



>gb|KHN41158.1| hypothetical protein glysoja_017202 [Glycine soja]
Length=339

 Score =   273 bits (699),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 156/278 (56%), Positives = 209/278 (75%), Gaps = 3/278 (1%)
 Frame = +1

Query  316   KAENGGEGTQNVANEVEIESRGESSMPERFRSLTKEAPDKPVRWPFLIVLAFLLYAWRAV  495
             +++NG   T    +EVE E+RG S+MPERFR L KE P  PVRWP+L+VLAF++YAWRAV
Sbjct  62    ESDNGDVLTG--LDEVEKEARGNSTMPERFRYLAKEVPSLPVRWPWLVVLAFMVYAWRAV  119

Query  496   LWELSIWKGIVMGFFRFIGTMMKFALANVLYYILHPVTASLRFVETILHIIRTFYSGVIK  675
             L+ELS WK       RF+G ++K+A A V  +I  P+T S+R +E + + +R  YS +I 
Sbjct  120   LFELSNWKNGAFAIVRFLGYLLKYAFAVVYQFIGSPITFSIRCIEDLFYTVRASYSWIIH  179

Query  676   QAPIQELTKMiilaslilaiaeaTVPDSVNSQPYLLTVAGFIGFVAAKGYISELFFWTVL  855
              AP+ +LT +I+LAS++LAI EATVP+S+N Q  +LTV+G IG+ A +GYISELFFWT+L
Sbjct  180   NAPVPDLTIIIMLASIVLAIGEATVPNSINDQHNVLTVSGLIGYAAVRGYISELFFWTIL  239

Query  856   LGLFSFGRWVKKRDYvssalpvaavlaavGEPWIQALVMISYTSLAIVQHSREPADGKEV  1035
             LG+++F ++VKKRD VS+A+PVAAVLA VGEPW++ALV+ISYT+LAI Q+S+    GKEV
Sbjct  240   LGVYAFSKFVKKRDDVSAAMPVAAVLAGVGEPWVRALVIISYTALAIYQYSKTSTGGKEV  299

Query  1036  -EATNEVIRAPFPLLCVALAIGMRLAASWAGYRHLTWM  1146
              E     +R P PLL  + AIG+R+AA W GYRHLTWM
Sbjct  300   GEVETRQMRLPIPLLLASFAIGLRVAAKWVGYRHLTWM  337



>ref|XP_010052100.1| PREDICTED: uncharacterized protein LOC104440818 [Eucalyptus grandis]
 gb|KCW75965.1| hypothetical protein EUGRSUZ_D00334 [Eucalyptus grandis]
Length=364

 Score =   273 bits (699),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 148/266 (56%), Positives = 197/266 (74%), Gaps = 0/266 (0%)
 Frame = +1

Query  355   NEVEIESRGESSMPERFRSLTKEAPDKPVRWPFLIVLAFLLYAWRAVLWELSIWKGIVMG  534
             +E E  +RGES+MPERFR L +EAPD P+RWP+ + LAFL+YAWRAVL+ELS WK   + 
Sbjct  99    DEAERAARGESTMPERFRYLNREAPDPPIRWPWFVALAFLVYAWRAVLFELSNWKKAALA  158

Query  535   FFRFIGTMMKFALANVLYYILHPVTASLRFVETILHIIRTFYSGVIKQAPIQELTKMiil  714
                F+G + K  LA + ++I  P+T+++R +ET ++ +R FYSG++  AP+ ELT +I+L
Sbjct  159   IVGFVGYLSKLVLALIFHFIGDPITSTIRCIETAIYSVRAFYSGIVAYAPVPELTVIIML  218

Query  715   aslilaiaeaTVPDSVNSQPYLLTVAGFIGFVAAKGYISELFFWTVLLGLFSFGRWVKKR  894
             AS + AI EA VP+ V+SQPY LTVAG IG+ A +GYISE   WT+L+GL+ F R +KKR
Sbjct  219   ASAVAAIGEAVVPNCVSSQPYSLTVAGLIGYAAVRGYISEPLLWTLLVGLYGFSRIIKKR  278

Query  895   DYvssalpvaavlaavGEPWIQALVMISYTSLAIVQHSREPADGKEVEATNEVIRAPFPL  1074
             D VSS LP AAV+AA+GEPW++ +V+ SY +LAI  HSR+ ++GKEVE      R P PL
Sbjct  279   DDVSSLLPAAAVMAAIGEPWVRLVVIASYLALAISHHSRKLSEGKEVEEVVTNRRLPMPL  338

Query  1075  LCVALAIGMRLAASWAGYRHLTWMIV  1152
                ALAIG+R+AA W GYRHLTWMIV
Sbjct  339   FVAALAIGIRVAAKWVGYRHLTWMIV  364



>ref|XP_010689490.1| PREDICTED: uncharacterized protein LOC104903192 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=350

 Score =   270 bits (690),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 173/367 (47%), Positives = 234/367 (64%), Gaps = 28/367 (8%)
 Frame = +1

Query  85    MSITLSTFRSPNIFFKNPIKLSSHPPL-----FNRPHHSNQA-PFDSFQPRTSILRLRNA  246
             MSI++     PN+F     +   HPPL          ++NQ   F+S  P +S       
Sbjct  1     MSISI-----PNLFSPPKCRNYPHPPLKITTLLGGNRNTNQTLQFNSSTPNSSF-----T  50

Query  247   HKFPGLLSTNLGLSVTKNHGFLAKAENGGEGTQNVANEVEI----ESRGESSMPERFRSL  414
              +F G   +   L      GF  +A+N G   +++  E E     E RG+S+MP+RF+ L
Sbjct  51    QRF-GFCHSRAKL------GFCVRAQNVGGERKSIEQEKEDKALEELRGKSTMPDRFKYL  103

Query  415   TKEAPDKPVRWPFLIVLAFLLYAWRAVLWELSIWKGIVMGFFRFIGTMMKFALANVLYYI  594
             TKE P  P+RWP+LI L FL+YAWR VLWELS W+ +  G F F+G ++K  LA +  +I
Sbjct  104   TKEVPSPPLRWPWLIALPFLIYAWRLVLWELSNWRNLFFGIFPFVGYILKLILALIYRFI  163

Query  595   LHPVTASLRFVETILHIIRTFYSGVIKQAPIQELTKMiilaslilaiaeaTVPDSVNSQP  774
               P+T ++ +VET +H  R+ YS ++  API ELT +I+L+  +LAI EA  P+S+  QP
Sbjct  164   GDPITYTVLYVETAVHATRSLYSSIVTSAPIPELTFIIMLSLTVLAIGEAASPNSIKCQP  223

Query  775   YLLTVAGFIGFVAAKGYISELFFWTVLLGLFSFGRWVKKRDYvssalpvaavlaavGEPW  954
             YLLT AG IG+ A +G I E  FW +L+GLFSF R+ KKRDYVSSALP+A VLA+VGEPW
Sbjct  224   YLLTAAGLIGYGAVRGVIIEPLFWLMLVGLFSFSRFFKKRDYVSSALPIATVLASVGEPW  283

Query  955   IQALVMISYTSLAIVQHSREPADGK-EVEATNEVIRAPFPLLCVALAIGMRLAASWAGYR  1131
             ++ L +IS+T+LAI  HS+E A+G  + E T+     P PLL VALAIG+R+AA WAGYR
Sbjct  284   VRVLAIISFTALAIHHHSKELAEGNAKGEVTSSSGNIPLPLLGVALAIGIRVAAKWAGYR  343

Query  1132  HLTWMIV  1152
             HLTWMIV
Sbjct  344   HLTWMIV  350



>ref|XP_007132635.1| hypothetical protein PHAVU_011G111800g [Phaseolus vulgaris]
 gb|ESW04629.1| hypothetical protein PHAVU_011G111800g [Phaseolus vulgaris]
Length=333

 Score =   266 bits (680),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 172/358 (48%), Positives = 240/358 (67%), Gaps = 27/358 (8%)
 Frame = +1

Query  85    MSITLSTFRSPNIFFKNPIKLSSHPPLFNRPHHSNQA-PFDSFQPRTSILRLRNAHKFPG  261
             M+ T+ T  SP + FK  I  +   P   RP    ++  F +  P  ++ RL        
Sbjct  1     MATTIPTLLSPTLSFKPSIPSTQFQPF--RPQFRRKSIAFSAKSPTFTLGRLFA------  52

Query  262   LLSTNLGLSVTKNHGFLAKAENGGEGTQNVANEVEIESRGESSMPERFRSLTKEAPDKPV  441
                             L+  ++ G+    + +E E E+RG S+MPERFR LTKE P  PV
Sbjct  53    ----------------LSDKDSNGDVLTGL-DEAEKEARGNSTMPERFRYLTKEVPSPPV  95

Query  442   RWPFLIVLAFLLYAWRAVLWELSIWKGIVMGFFRFIGTMMKFALANVLYYILHPVTASLR  621
             RWP+ +V+AFL+YAWRAVL+ELS WK   +   RFIG ++K+A A V ++I  P+T S+R
Sbjct  96    RWPWFVVMAFLIYAWRAVLFELSNWKNAAIAIGRFIGYVLKYAFAVVYHFIGSPITFSIR  155

Query  622   FVETILHIIRTFYSGVIKQAPIQELTKMiilaslilaiaeaTVPDSVNSQPYLLTVAGFI  801
              +E + + +R  YS +I  AP+ +LT +I+L+S++LAI EATVP+ +NSQPY+LTV+G I
Sbjct  156   CMEDLFYTVRACYSWIIGNAPVPDLTLIIVLSSIVLAIGEATVPNCINSQPYVLTVSGLI  215

Query  802   GFVAAKGYISELFFWTVLLGLFSFGRWVKKRDYvssalpvaavlaavGEPWIQALVMISY  981
             G+ A +GYISE  FWT+LLG+++F +++KKRD VS+A+PVAAVLA VGEPW++ LV+ISY
Sbjct  216   GYAAVRGYISEPLFWTLLLGVYAFSKFLKKRDDVSAAMPVAAVLAGVGEPWVRVLVIISY  275

Query  982   TSLAIVQHSREPADGKEV-EATNEVIRAPFPLLCVALAIGMRLAASWAGYRHLTWMIV  1152
             T+LAI Q+S+ P++GKE  E     +R P PLL  ALAIG+R+AA WAGYRHLTWMIV
Sbjct  276   TTLAIYQYSKLPSEGKEAGEVETREMRLPIPLLLAALAIGLRVAAKWAGYRHLTWMIV  333



>emb|CDY29890.1| BnaA03g49110D [Brassica napus]
Length=345

 Score =   265 bits (676),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 153/296 (52%), Positives = 207/296 (70%), Gaps = 7/296 (2%)
 Frame = +1

Query  280   GLSVTK---NHGFLAKAENGGEGTQNVANEVEIESRGESSMPERFRSLTKEAPDKPVRWP  450
             GLSV     N     + E          +E E  +R ES+MP+RFR LTKEAPD PVRWP
Sbjct  52    GLSVPGKFPNAKLRVRCEKEDTIKGETEDEAERFARRESTMPDRFRHLTKEAPDTPVRWP  111

Query  451   FLIVLAFLLYAWRAVLWELSIWKGIVMGFFRFIGTMMKFALANVLYYILHPVTASLRFVE  630
             + I LAFL+YAWRAVL+ELS W+  V    RF+G + KFALA V ++I  P+T+ +  VE
Sbjct  112   WFIALAFLVYAWRAVLFELSNWRNAVFAIVRFLGDLSKFALALVFHFIGDPITSLIALVE  171

Query  631   TILHIIRTFYSGVIKQAPIQELTKMiilaslilaiaeaTVPDSVNSQPYLLTVAGFIGFV  810
             T ++ +R FYSG++   P++ELT +I+LAS +LAI EA  P+S++ QPY++T+AG +G+ 
Sbjct  172   TAIYSVRAFYSGIVAYTPVRELTTVILLASSVLAIGEAVAPNSISKQPYVVTLAGLVGYA  231

Query  811   AAKGYISELFFWTVLLGLFSFGRWVKKRDYvssalpvaavlaavGEPWIQALVMISYTSL  990
             A +GYISE FFWTVL+G++ + R VKKRD V+SALP AAVLA VGEPW++ + +  Y +L
Sbjct  232   AVQGYISEPFFWTVLVGMYGYSRLVKKRDDVTSALPSAAVLAGVGEPWVRVVAIAGYLAL  291

Query  991   AIVQHSREPADGKEVEATNEVIRA--PFPLLCVALAIGMRLAASWAGYRHLTWMIV  1152
             A+  +S + +  +E E   +++R   P PLL  ALAIG+RLAA WAGYRHLTWMIV
Sbjct  292   AMYHNSTKKSSSEEEE--GQIVRKAPPVPLLAAALAIGVRLAAKWAGYRHLTWMIV  345



>ref|XP_008437523.1| PREDICTED: uncharacterized protein LOC103482911 [Cucumis melo]
Length=349

 Score =   264 bits (675),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 151/269 (56%), Positives = 200/269 (74%), Gaps = 3/269 (1%)
 Frame = +1

Query  355   NEVEIESRGESSMPERFRSLTKEAPDKPVRWPFLIVLAFLLYAWRAVLWELSIWKGIVMG  534
             +E + + R ES++PERFR LTKEAPD PVRWPF + L FLLYAWRAVL+EL  W+ IV+ 
Sbjct  81    SEAQSDDREESTLPERFRYLTKEAPDPPVRWPFFVALPFLLYAWRAVLFELGNWRKIVVS  140

Query  535   FFRFIGTMMKFALANVLYYILHPVTASLRFVETILHIIRTFYSGVIKQAPIQELTKMiil  714
              F F+ +++K ALA +LY I  P+T+ +R +ET  + IR+FYS ++  API ELT +I+L
Sbjct  141   LFSFVASILKGALALILYVIGDPITSMIRGIETAFYTIRSFYSSIVAYAPIPELTTIIVL  200

Query  715   aslilaiaeaTVPDSVNSQPYLLTVAGFIGFVAAKGYISELFFWTVLLGLFSFGRWVKKR  894
             AS +LAI+EA+ PDSV+SQPYLLT++G  G++A +GYISE FFWT+LL ++ +  +VKKR
Sbjct  201   ASAMLAISEASAPDSVSSQPYLLTLSGLAGYLAVRGYISEPFFWTILLCVYGYSSFVKKR  260

Query  895   DYvssalpvaavlaavGEPWIQALVMISYTSLAIVQHSREPADG-KEVEATNEVIR--AP  1065
             + V+SALP A V AA+GEPW++ L M S+ +LAI  H ++ + G KE E    V R   P
Sbjct  261   NDVTSALPAAVVFAAIGEPWVRILAMGSFLALAITHHWKKLSQGKKEDEDEKGVYRWDVP  320

Query  1066  FPLLCVALAIGMRLAASWAGYRHLTWMIV  1152
              PLL VALAIG+  AA WAGYRHLTWMIV
Sbjct  321   LPLLGVALAIGIHAAAKWAGYRHLTWMIV  349



>ref|XP_009761591.1| PREDICTED: uncharacterized protein LOC104213744 [Nicotiana sylvestris]
Length=341

 Score =   261 bits (667),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 150/230 (65%), Positives = 182/230 (79%), Gaps = 0/230 (0%)
 Frame = +1

Query  463   LAFLLYAWRAVLWELSIWKGIVMGFFRFIGTMMKFALANVLYYILHPVTASLRFVETILH  642
             LAFLLYAWR VLWELS WK  V   FRF+G + K AL+ + Y+I   +TA +RF+E+ ++
Sbjct  112   LAFLLYAWRTVLWELSNWKKAVGAIFRFLGYIPKLALSFIYYFIGDQITAVIRFIESTIY  171

Query  643   IIRTFYSGVIKQAPIQELTKMiilaslilaiaeaTVPDSVNSQPYLLTVAGFIGFVAAKG  822
              IR FYSGV+  AP+QELT +IILAS +LAIAEA VPDSVNSQPYLLT AG +GF A +G
Sbjct  172   SIRAFYSGVVAYAPLQELTTIIILASCVLAIAEAAVPDSVNSQPYLLTAAGIMGFAAVRG  231

Query  823   YISELFFWTVLLGLFSFGRWVKKRDYvssalpvaavlaavGEPWIQALVMISYTSLAIVQ  1002
             YISELFFW +L+GLF F R+++KRDYVSSALP AAVLAAVGEPWI+ +VM+SY +LA++Q
Sbjct  232   YISELFFWFLLVGLFVFARFIRKRDYVSSALPAAAVLAAVGEPWIRMVVMVSYAALAVMQ  291

Query  1003  HSREPADGKEVEATNEVIRAPFPLLCVALAIGMRLAASWAGYRHLTWMIV  1152
             HS  P +  E E T  V + P PL+C ALAIG+RLAA WAGYRHLTWMIV
Sbjct  292   HSTMPLNKSEGETTGAVRKVPLPLICAALAIGVRLAAKWAGYRHLTWMIV  341



>ref|XP_006285673.1| hypothetical protein CARUB_v10007130mg [Capsella rubella]
 gb|EOA18571.1| hypothetical protein CARUB_v10007130mg [Capsella rubella]
Length=349

 Score =   260 bits (665),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 146/279 (52%), Positives = 196/279 (70%), Gaps = 2/279 (1%)
 Frame = +1

Query  316   KAENGGEGTQNVANEVEIESRGESSMPERFRSLTKEAPDKPVRWPFLIVLAFLLYAWRAV  495
             K E G      + +E E  +R ES+MP+RFR LTKEAPD PV WP+ + L FL+YAWRAV
Sbjct  73    KCEKGNAQNGGIEDEAERFARRESTMPDRFRYLTKEAPDSPVTWPWFVALGFLMYAWRAV  132

Query  496   LWELSIWKGIVMGFFRFIGTMMKFALANVLYYILHPVTASLRFVETILHIIRTFYSGVIK  675
             L+ELS W+        F+G ++KFALA V ++I  P+T+ +  VET ++ IR FYSG++ 
Sbjct  133   LFELSNWRKAAFAILGFVGDLLKFALALVFHFIGDPITSLISLVETAMYSIRAFYSGIVA  192

Query  676   QAPIQELTKMiilaslilaiaeaTVPDSVNSQPYLLTVAGFIGFVAAKGYISELFFWTVL  855
               P++ELT +I+LAS +LAI EA  P+S++ QPY++T+AG +G+ A + YISE FFWTVL
Sbjct  193   YTPVRELTTVILLASSVLAIGEAVAPNSISKQPYVVTIAGLVGYAAVQSYISEPFFWTVL  252

Query  856   LGLFSFGRWVKKRDYvssalpvaavlaavGEPWIQALVMISYTSLAIVQHSREPADGKEV  1035
             LGL+ + R +KKRD V+SALP AAVLA VGEPW++ + +  Y +LA+  +S + +   E 
Sbjct  253   LGLYGYSRLIKKRDDVTSALPSAAVLAGVGEPWVRVVAITGYLALAMYHNSTKTSS--EE  310

Query  1036  EATNEVIRAPFPLLCVALAIGMRLAASWAGYRHLTWMIV  1152
             E  N     P PLL  ALAIG+RLAA WAGYRHLTWMIV
Sbjct  311   ERQNLRRAPPMPLLAAALAIGVRLAAKWAGYRHLTWMIV  349



>ref|XP_009137769.1| PREDICTED: uncharacterized protein LOC103861815 [Brassica rapa]
Length=349

 Score =   259 bits (662),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 163/370 (44%), Positives = 224/370 (61%), Gaps = 36/370 (10%)
 Frame = +1

Query  49    ARPPRTPGLSEAMSITLSTFRSPNIFFKNPIKLSSHPPLFNRPHHSNQAPFDSFQPRTSI  228
              R  R P +S +     S  R P++   N + LS  PP F                  S+
Sbjct  14    CRNSRIPAISSS-----SLSRIPHLNVSNKLTLS--PPQF-------------LNAGVSL  53

Query  229   LRLRNAHKFPGLLSTNLGLSVTKNHGFLAKAENGGEGTQNVANEVEIESRGESSMPERFR  408
               L    KFP +                 K E          +E E  +R ES+MP+RFR
Sbjct  54    CGLSVPGKFPSV------------RALRVKCEKEDTIKGETEDEAERFARRESTMPDRFR  101

Query  409   SLTKEAPDKPVRWPFLIVLAFLLYAWRAVLWELSIWKGIVMGFFRFIGTMMKFALANVLY  588
              LTKEAPD PVRWP+ I LAFL+YAWRAVL+ELS W+       RF+G + KFALA V +
Sbjct  102   HLTKEAPDTPVRWPWFIALAFLVYAWRAVLFELSNWRNTAFAIVRFLGDLSKFALALVFH  161

Query  589   YILHPVTASLRFVETILHIIRTFYSGVIKQAPIQELTKMiilaslilaiaeaTVPDSVNS  768
             +I  P+T+ +  VET ++ +R FYSG++   P++ELT +I+LAS +LAI EA  P+S++ 
Sbjct  162   FIGDPITSLIALVETAIYSVRAFYSGIVAYTPVRELTTVILLASSVLAIGEAVAPNSISK  221

Query  769   QPYLLTVAGFIGFVAAKGYISELFFWTVLLGLFSFGRWVKKRDYvssalpvaavlaavGE  948
             QPY++T+AG +G+ A +GYISE  FWTVL+G++ + R  +KRD V+SALP AAVLA VGE
Sbjct  222   QPYVVTLAGLVGYAAVQGYISEPLFWTVLVGMYGYSRLARKRDDVTSALPSAAVLAGVGE  281

Query  949   PWIQALVMISYTSLAIVQHSREPADGKEVEATNEVIRA--PFPLLCVALAIGMRLAASWA  1122
             PW++ + +  Y +LA+  +S + +  +E E   +++R   P PLL  ALAIG+RLAA WA
Sbjct  282   PWVRVVAIAGYLALAMYHNSTKKSSSEEEE--GQIVRKAPPVPLLAAALAIGVRLAAKWA  339

Query  1123  GYRHLTWMIV  1152
             GYRHLTWMIV
Sbjct  340   GYRHLTWMIV  349



>ref|XP_006412983.1| hypothetical protein EUTSA_v10025608mg [Eutrema salsugineum]
 gb|ESQ54436.1| hypothetical protein EUTSA_v10025608mg [Eutrema salsugineum]
Length=349

 Score =   257 bits (657),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 161/348 (46%), Positives = 226/348 (65%), Gaps = 18/348 (5%)
 Frame = +1

Query  109   RSPNIFFKNPIKLSSHPPLFNRPHHSNQAPFDSFQPRTSILRLRNAHKFPGLLSTNLGLS  288
             R P+I F +P+   SHP ++ +P  + Q  F+S     S+       KFP   S  L +S
Sbjct  20    RIPSIRF-SPVSRVSHPNVY-KPTFAPQKCFNS---GASLHGFGVPGKFP---SVRLRVS  71

Query  289   VTKNHGFLAKAENGGEGTQNVANEVEIESRGESSMPERFRSLTKEAPDKPVRWPFLIVLA  468
                       A+NG      + +E E+ +R ES+MP+RFR LTKEAPD P+RWP+   L 
Sbjct  72    TRCEK---EDAQNG-----EIEDEAELFARRESTMPDRFRHLTKEAPDSPIRWPWFFALG  123

Query  469   FLLYAWRAVLWELSIWKGIVMGFFRFIGTMMKFALANVLYYILHPVTASLRFVETILHII  648
             FL+YAWRAVL+ELS W+        F+G + KFALA V ++I  P+T+ +  +ET  + I
Sbjct  124   FLVYAWRAVLFELSNWRKATFAIIGFLGDLSKFALALVFHFIGDPITSLIALIETATYSI  183

Query  649   RTFYSGVIKQAPIQELTKMiilaslilaiaeaTVPDSVNSQPYLLTVAGFIGFVAAKGYI  828
             R FYSG++   P++ELT +I+LAS +LAI EA  P+S+  QPY++T+AG +G+ A + YI
Sbjct  184   RAFYSGIVAYTPVRELTTVILLASSVLAIGEAVSPNSITKQPYVVTLAGLLGYAAVQSYI  243

Query  829   SELFFWTVLLGLFSFGRWVKKRDYvssalpvaavlaavGEPWIQALVMISYTSLAIVQHS  1008
             SE FFWTVL+GL+ + R +KKRD V+SALP AAVLA VGEPW++ + +  Y +LA+  +S
Sbjct  244   SEPFFWTVLVGLYGYSRLIKKRDDVTSALPSAAVLAGVGEPWVRVVAITGYLALAMYHNS  303

Query  1009  REPADGKEVEATNEVIRAPFPLLCVALAIGMRLAASWAGYRHLTWMIV  1152
              + ++ +E ++       P PLL  ALAIG+RLAA WAGYRHLTWMIV
Sbjct  304   TKTSEEEEGQSLRRA--PPIPLLAAALAIGVRLAAKWAGYRHLTWMIV  349



>ref|XP_010448015.1| PREDICTED: uncharacterized protein LOC104730532 [Camelina sativa]
Length=350

 Score =   255 bits (651),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 144/279 (52%), Positives = 197/279 (71%), Gaps = 7/279 (3%)
 Frame = +1

Query  316   KAENGGEGTQNVANEVEIESRGESSMPERFRSLTKEAPDKPVRWPFLIVLAFLLYAWRAV  495
              A NGG     + +E E  +R ES+MP+RFR LTKEAPD PV WP+ + L FL+YAWRAV
Sbjct  79    NAPNGG-----IEDEAERFARRESTMPDRFRYLTKEAPDSPVIWPWFVALGFLMYAWRAV  133

Query  496   LWELSIWKGIVMGFFRFIGTMMKFALANVLYYILHPVTASLRFVETILHIIRTFYSGVIK  675
             L+ELS W+        F+G + KFALA V ++I  P+T+ +  +ET ++ IR FYSG++ 
Sbjct  134   LFELSNWRKAAFAILGFVGDLSKFALALVFHFIGDPITSLISLIETAMYSIRAFYSGIVA  193

Query  676   QAPIQELTKMiilaslilaiaeaTVPDSVNSQPYLLTVAGFIGFVAAKGYISELFFWTVL  855
               P++ELT +I+LAS +LAI EA  P+S++ QPY++T+AG +G+ A + YISE FFWTVL
Sbjct  194   YTPVRELTTVILLASSVLAIGEAVAPNSISKQPYVVTIAGLVGYAAVQSYISEPFFWTVL  253

Query  856   LGLFSFGRWVKKRDYvssalpvaavlaavGEPWIQALVMISYTSLAIVQHSREPADGKEV  1035
             LGL+ + R +KKRD V+SALP AAVLA VGEPW++ + +  Y +LA+  +S + +  +E 
Sbjct  254   LGLYGYSRLIKKRDDVTSALPSAAVLAGVGEPWVRVVAITGYLALAMYHNSTKTSSEEET  313

Query  1036  EATNEVIRAPFPLLCVALAIGMRLAASWAGYRHLTWMIV  1152
             +   +    P PLL  ALAIG+RLAA WAGYRHLTWMIV
Sbjct  314   QNLRKA--PPIPLLAAALAIGVRLAAKWAGYRHLTWMIV  350



>ref|XP_002869515.1| EMB1923 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45774.1| EMB1923 [Arabidopsis lyrata subsp. lyrata]
Length=348

 Score =   254 bits (648),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 157/340 (46%), Positives = 216/340 (64%), Gaps = 16/340 (5%)
 Frame = +1

Query  136   PIKLSSHPPLFNRPHHSNQAPFDSFQPRTSILRLRNAHKFPGLLSTNLGLSVTKNHGFLA  315
             P    S     N  +    AP        S+ R R   KFP +    L     +N     
Sbjct  24    PFSPVSRLSCLNGDNELTIAPPQFLNAGESLRRFRVPGKFPSVRLRVLTRCEKEN-----  78

Query  316   KAENGGEGTQNVANEVEIESRGESSMPERFRSLTKEAPDKPVRWPFLIVLAFLLYAWRAV  495
              A NGG     + +E E  +R ES+MP+RFR LTKEAPD P+ WP+ + L FL+YAWRAV
Sbjct  79    -APNGG-----IEDEAERFARRESTMPDRFRYLTKEAPDSPIIWPWFVALGFLVYAWRAV  132

Query  496   LWELSIWKGIVMGFFRFIGTMMKFALANVLYYILHPVTASLRFVETILHIIRTFYSGVIK  675
             L+ELS W+        F+G + KFALA V ++I  P+T+ +  +ET ++ +R FYSG++ 
Sbjct  133   LFELSNWRKAAFAILGFVGDLSKFALALVFHFIGDPITSLISLLETAMYSVRAFYSGIVA  192

Query  676   QAPIQELTKMiilaslilaiaeaTVPDSVNSQPYLLTVAGFIGFVAAKGYISELFFWTVL  855
               P++ELT +I+LAS +LAI EA  P+S++ QPY++T+AG +G+ A + YISE FFWTVL
Sbjct  193   YTPVRELTTVILLASSVLAIGEAVEPNSISKQPYVVTIAGLVGYAAVQSYISEPFFWTVL  252

Query  856   LGLFSFGRWVKKRDYvssalpvaavlaavGEPWIQALVMISYTSLAIVQHSREPADGKEV  1035
             LGL+ + R +KKRD V+SALP AAVLA VGEPW++ + +  Y +LA+  +S + ++    
Sbjct  253   LGLYGYSRLIKKRDDVTSALPSAAVLAGVGEPWVRVVAITGYLALAMYHNSSKTSE----  308

Query  1036  EATNEVIRA-PFPLLCVALAIGMRLAASWAGYRHLTWMIV  1152
             E +  + RA P PLL  ALAIG+RLAA WAGYRHLTWMIV
Sbjct  309   EESQSLRRAPPMPLLAAALAIGVRLAAKWAGYRHLTWMIV  348



>ref|XP_010438494.1| PREDICTED: uncharacterized protein LOC104722085 [Camelina sativa]
Length=352

 Score =   254 bits (648),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 148/290 (51%), Positives = 199/290 (69%), Gaps = 4/290 (1%)
 Frame = +1

Query  283   LSVTKNHGFLAKAENGGEGTQNVANEVEIESRGESSMPERFRSLTKEAPDKPVRWPFLIV  462
             LSV        + EN  +G   + +E E  +R ES+MP+RFR LTKEAPD PV WP  + 
Sbjct  67    LSVRLRVSTRCEKENAPKG--EIEDEAERFARRESTMPDRFRYLTKEAPDSPVIWPCFVA  124

Query  463   LAFLLYAWRAVLWELSIWKGIVMGFFRFIGTMMKFALANVLYYILHPVTASLRFVETILH  642
             L FL+YAWR VL+ELS W+        F+G + KFALA V ++I  P+T+ +  VET ++
Sbjct  125   LGFLMYAWRVVLFELSNWRKAAFAILGFVGDLSKFALALVFHFIGDPITSLISLVETAMY  184

Query  643   IIRTFYSGVIKQAPIQELTKMiilaslilaiaeaTVPDSVNSQPYLLTVAGFIGFVAAKG  822
              IR FYSG++   P++ELT +I+LAS +LAI EA  P+S++ QPY++T+AG +G+ A + 
Sbjct  185   SIRAFYSGIVAYTPVRELTTVILLASSVLAIGEAVAPNSISKQPYVVTIAGLVGYAAVQS  244

Query  823   YISELFFWTVLLGLFSFGRWVKKRDYvssalpvaavlaavGEPWIQALVMISYTSLAIVQ  1002
             YISE FFWTVLLGL+ + R +KKRD V+SALP AAVLA VGEPW++ + +  Y +LA+  
Sbjct  245   YISEPFFWTVLLGLYGYSRLIKKRDDVTSALPSAAVLAGVGEPWVRVVAITGYLALAMYH  304

Query  1003  HSREPADGKEVEATNEVIRAPFPLLCVALAIGMRLAASWAGYRHLTWMIV  1152
             +S + +   E E+ N     P PLL  ALAIG+RLAA WAGYRHLTWMIV
Sbjct  305   NSTKTSS--EEESQNLRRAPPIPLLAAALAIGVRLAAKWAGYRHLTWMIV  352



>gb|AAM61436.1| unknown [Arabidopsis thaliana]
Length=348

 Score =   253 bits (646),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 141/283 (50%), Positives = 199/283 (70%), Gaps = 6/283 (2%)
 Frame = +1

Query  310   LAKAENGGEGTQNVANEVEIESRGESSMPERFRSLTKEAPDKPVRWPFLIVLAFLLYAWR  489
             L + E        + ++ E  +R ES+MP+RFR LTKEAPD P+ WP+ + L FL+YAWR
Sbjct  70    LTRCEKENAPKGGIEDDAERFARRESTMPDRFRYLTKEAPDSPIIWPWFVALGFLVYAWR  129

Query  490   AVLWELSIWKGIVMGFFRFIGTMMKFALANVLYYILHPVTASLRFVETILHIIRTFYSGV  669
             AV +ELS W+        F+G + KFALA V ++I  P+T+ +  VET ++ +R FYSG+
Sbjct  130   AVFFELSNWRKAAFAILAFVGDLSKFALALVFHFIGDPITSLISLVETAMYSVRAFYSGI  189

Query  670   IKQAPIQELTKMiilaslilaiaeaTVPDSVNSQPYLLTVAGFIGFVAAKGYISELFFWT  849
             +   P++ELT +I+LAS +LAI EA  P+S++ QPY++T+AG +G+ A + YISE FFWT
Sbjct  190   VAYTPVRELTTVILLASSVLAIGEAVAPESISKQPYVVTIAGLVGYAAVQSYISEPFFWT  249

Query  850   VLLGLFSFGRWVKKRDYvssalpvaavlaavGEPWIQALVMISYTSLAIVQHSREPADGK  1029
             VLLGL+ + R +KKRD V+SALP AAVLA VGEPW++ + +I Y +LA+  +S + +  +
Sbjct  250   VLLGLYGYSRLIKKRDDVTSALPSAAVLAGVGEPWVRVVAIIGYLALAMYHNSTKTSSEE  309

Query  1030  EVEATNEVIR--APFPLLCVALAIGMRLAASWAGYRHLTWMIV  1152
             E    ++++R   P PLL  ALAIG+RLAA WAGYRHLTWMIV
Sbjct  310   E----SQILRRAPPMPLLAAALAIGVRLAAKWAGYRHLTWMIV  348



>ref|NP_567800.1| embryo defective 1923 protein [Arabidopsis thaliana]
 emb|CAB79623.1| hypothetical protein [Arabidopsis thaliana]
 gb|ABF18989.1| At4g28210 [Arabidopsis thaliana]
 dbj|BAE98802.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE85454.1| embryo defective 1923 protein [Arabidopsis thaliana]
Length=348

 Score =   253 bits (645),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 141/283 (50%), Positives = 199/283 (70%), Gaps = 6/283 (2%)
 Frame = +1

Query  310   LAKAENGGEGTQNVANEVEIESRGESSMPERFRSLTKEAPDKPVRWPFLIVLAFLLYAWR  489
             L + E        + ++ E  +R ES+MP+RFR LTKEAPD P+ WP+ + L FL+YAWR
Sbjct  70    LTRCEKENAPKGGIEDDAERFARRESTMPDRFRYLTKEAPDSPIIWPWFVALGFLVYAWR  129

Query  490   AVLWELSIWKGIVMGFFRFIGTMMKFALANVLYYILHPVTASLRFVETILHIIRTFYSGV  669
             AVL+ELS W+        F+G + KFALA V ++I  P+T+ +  VET ++ +R FYSG+
Sbjct  130   AVLFELSNWRKAAFAILAFVGDLSKFALALVFHFIGDPITSLISLVETAMYSVRAFYSGI  189

Query  670   IKQAPIQELTKMiilaslilaiaeaTVPDSVNSQPYLLTVAGFIGFVAAKGYISELFFWT  849
             +   P++ELT +I+LAS +LAI EA  P+S++ QPY++T+AG +G+ A + YISE FFWT
Sbjct  190   VAYTPVRELTTVILLASSVLAIGEAVAPESISKQPYVVTIAGLVGYAAVQSYISEPFFWT  249

Query  850   VLLGLFSFGRWVKKRDYvssalpvaavlaavGEPWIQALVMISYTSLAIVQHSREPADGK  1029
             VLLGL+ + R +KKRD V+SALP AAVLA VGEPW++ + +  Y +LA+  +S + +  +
Sbjct  250   VLLGLYGYSRLIKKRDDVTSALPSAAVLAGVGEPWVRVVAITGYLALAMYHNSTKTSSEE  309

Query  1030  EVEATNEVIR--APFPLLCVALAIGMRLAASWAGYRHLTWMIV  1152
             E    ++++R   P PLL  ALAIG+RLAA WAGYRHLTWMIV
Sbjct  310   E----SQILRRAPPMPLLAAALAIGVRLAAKWAGYRHLTWMIV  348



>emb|CDY58723.1| BnaC07g50640D [Brassica napus]
Length=348

 Score =   252 bits (644),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 145/266 (55%), Positives = 195/266 (73%), Gaps = 0/266 (0%)
 Frame = +1

Query  355   NEVEIESRGESSMPERFRSLTKEAPDKPVRWPFLIVLAFLLYAWRAVLWELSIWKGIVMG  534
             +E E  +R ES+MP+RFR LTKEAPD PVRWP+ I LAFL+YAWRAVL+ELS W+     
Sbjct  83    DEAERFARRESTMPDRFRHLTKEAPDTPVRWPWFIALAFLVYAWRAVLFELSNWRNTAFA  142

Query  535   FFRFIGTMMKFALANVLYYILHPVTASLRFVETILHIIRTFYSGVIKQAPIQELTKMiil  714
               RF+G + KFALA V ++I  P+T+ +  VET ++ +R FYSG++   P++ELT +I+L
Sbjct  143   IVRFLGDLSKFALALVFHFIGDPITSLIALVETAIYSVRAFYSGIVAYTPVRELTTVILL  202

Query  715   aslilaiaeaTVPDSVNSQPYLLTVAGFIGFVAAKGYISELFFWTVLLGLFSFGRWVKKR  894
             AS +LAI EA  P+S++ QPY++T+AG +G+ A +GYISE  FWTVL+GL+ + R VKKR
Sbjct  203   ASSVLAIGEAVAPNSISKQPYVVTLAGLLGYAAVQGYISEPLFWTVLVGLYGYSRLVKKR  262

Query  895   DYvssalpvaavlaavGEPWIQALVMISYTSLAIVQHSREPADGKEVEATNEVIRAPFPL  1074
             D V+SALP AAVLA VGEPW++ + +  Y +LA+  +S + +  +E E  +     P PL
Sbjct  263   DDVTSALPSAAVLAGVGEPWVRVVAIAGYLALAMYHNSTKKSSSEEEEGQSLRKAPPVPL  322

Query  1075  LCVALAIGMRLAASWAGYRHLTWMIV  1152
             L  ALAIG+RLAA WAGYRHLTWMIV
Sbjct  323   LAAALAIGVRLAAKWAGYRHLTWMIV  348



>ref|XP_006447378.1| hypothetical protein CICLE_v10015637mg [Citrus clementina]
 ref|XP_006469844.1| PREDICTED: uncharacterized protein LOC102614991 [Citrus sinensis]
 gb|ESR60618.1| hypothetical protein CICLE_v10015637mg [Citrus clementina]
Length=375

 Score =   253 bits (645),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 167/362 (46%), Positives = 225/362 (62%), Gaps = 5/362 (1%)
 Frame = +1

Query  79    EAMSITLST-FRSPNIFFKNPIKLSSHPPLFNRPHHSNQAPFDSFQPRTSILRLRNAHKF  255
             +  S+ LST   SPNI  K  +         +R                S+  +R    F
Sbjct  13    QIQSMMLSTALSSPNITLKPQLDRHLKTYTLSRFWLQTHKKISPLSKTRSLEPIRTWSSF  72

Query  256   PGLLSTN-LGLSVTKNHGFLAKAENGG--EGTQNVANEVEIESRGESSMPERFRSLTKEA  426
              G       G S  K   F   A+NGG  E   +V +E E  +RGES+MPERFR LTKEA
Sbjct  73    LGFSGEERFGFSSIKILRFSVNADNGGGAETAHSVDDEAERLARGESTMPERFRHLTKEA  132

Query  427   PDKPVRWPFLIVLAFLLYAWRAVLWELSIWKGIVMGFFRFIGTMMKFALANVLYYILHPV  606
             PD PV+WP+ I LAFL+YAWR VL+ELS W+   +    F G ++K  LA + ++I  P+
Sbjct  133   PDVPVKWPWFIALAFLVYAWRTVLFELSNWRKGALTIVAFAGYLLKLILALIFHFIGDPL  192

Query  607   TASLRFVETILHIIRTFYSGVIKQAPIQELTKMiilaslilaiaeaTVPDSVNSQPYLLT  786
             T+ +  +ET ++ IR FYSG++   P+ ELT +I+LAS +L+I EATVP++++ QPYLLT
Sbjct  193   TSLIFCLETAIYSIRAFYSGIVAYTPVGELTFIIMLASAVLSIGEATVPNAISCQPYLLT  252

Query  787   VAGFIGFVAAKGYISELFFWTVLLGLFSFGRWVKKRDYvssalpvaavlaavGEPWIQAL  966
             ++G IG+    G ISE FFWT+LLG++ F R +KKRD V+SALP AA LAAVGEPW++ L
Sbjct  253   LSGLIGYAVVGGQISEPFFWTLLLGMYGFSRLIKKRDDVTSALPPAAALAAVGEPWVRVL  312

Query  967   VMISYTSLAIVQHSREPADGK-EVEATNEVIRAPFPLLCVALAIGMRLAASWAGYRHLTW  1143
              M +Y +LAI  HS++  +GK EV+      + P PL   ALAIG+R+ A WAGYRHLTW
Sbjct  313   AMAAYLALAIFHHSKKLGEGKEEVQVLATKRKVPLPLFGAALAIGIRVTAKWAGYRHLTW  372

Query  1144  MI  1149
             MI
Sbjct  373   MI  374



>ref|XP_004145896.1| PREDICTED: uncharacterized protein LOC101214502 [Cucumis sativus]
 ref|XP_004166534.1| PREDICTED: uncharacterized protein LOC101228806 [Cucumis sativus]
 gb|KGN49929.1| hypothetical protein Csa_5G141030 [Cucumis sativus]
Length=347

 Score =   249 bits (637),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 169/359 (47%), Positives = 223/359 (62%), Gaps = 15/359 (4%)
 Frame = +1

Query  85    MSITLSTFRSPNIFFKNPIKLSSHPPLFNRPHHSNQAPFDSFQPRTSILRLRNAHKFPGL  264
             M+ TL    S N+       +SS P  F R   +   PF +   +T  L   N  +   +
Sbjct  1     MATTLIASLSSNLKLPLLSAISSSPSTFRR--QTQTVPFSNSPIQTLWL---NPTRNCNV  55

Query  265   LSTNLGLSVTKNHGFLAKAENGGEGTQNVANEVEIESRGESSMPERFRSLTKEAPDKPVR  444
             +S N         GFL   +           E + + R ES+MPERFR L KE  D PVR
Sbjct  56    ISHN-------RSGFLISRKLESFTVFAADFEAQSDDREESTMPERFRYLAKEGSDPPVR  108

Query  445   WPFLIVLAFLLYAWRAVLWELSIWKGIVMGFFRFIGTMMKFALANVLYYILHPVTASLRF  624
             WPF + L FLLYAWRAVL+EL  W+ IV+    F+ +++K ALA +LY I  P+T+ +R 
Sbjct  109   WPFFVALPFLLYAWRAVLFELGNWRKIVVNLVGFVVSLLKGALALILYVIGDPITSVIRG  168

Query  625   VETILHIIRTFYSGVIKQAPIQELTKMiilaslilaiaeaTVPDSVNSQPYLLTVAGFIG  804
             +ET  + IR+F+S ++  AP+ ELT +IILAS +LAI+EA+ PDSV SQPYLLT++G  G
Sbjct  169   IETAFYTIRSFHSSIVAYAPVSELTTIIILASTVLAISEASAPDSVRSQPYLLTLSGLAG  228

Query  805   FVAAKGYISELFFWTVLLGLFSFGRWVKKRDYvssalpvaavlaavGEPWIQALVMISYT  984
             + A +GYISE FFWT+LL ++ +  +VKKR+ VSSALP AAV AA+GEPW++ L M S+ 
Sbjct  229   YAAVRGYISEPFFWTILLCVYGYSSFVKKRNDVSSALPAAAVFAAIGEPWVRILAMGSFL  288

Query  985   SLAIVQHSREPADG-KEVEATNEVIR--APFPLLCVALAIGMRLAASWAGYRHLTWMIV  1152
             +LAI  H +  + G KE E    V R   P PLL VALAIG+  AA WAGYRHLTWMIV
Sbjct  289   ALAITHHWKNLSQGKKEDEDEKGVYRWDIPLPLLGVALAIGIHGAAKWAGYRHLTWMIV  347



>emb|CDX89194.1| BnaA01g16990D [Brassica napus]
Length=341

 Score =   249 bits (635),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 139/279 (50%), Positives = 195/279 (70%), Gaps = 2/279 (1%)
 Frame = +1

Query  316   KAENGGEGTQNVANEVEIESRGESSMPERFRSLTKEAPDKPVRWPFLIVLAFLLYAWRAV  495
             + E        V +E E  +R ES+MP+RFR LTKEA D P+RWP+ + LAFL+YAWRAV
Sbjct  65    RCEKEDAQKGEVEDEAERFARRESTMPDRFRYLTKEAQDSPIRWPWFVALAFLVYAWRAV  124

Query  496   LWELSIWKGIVMGFFRFIGTMMKFALANVLYYILHPVTASLRFVETILHIIRTFYSGVIK  675
             L+ELS W+  V      +G + KFALA V ++I  P+T+ +  VET ++ +R FYSG++ 
Sbjct  125   LFELSNWRKAVFAIGGLLGDLSKFALALVFHFIGDPITSLISLVETAIYSVRGFYSGIVA  184

Query  676   QAPIQELTKMiilaslilaiaeaTVPDSVNSQPYLLTVAGFIGFVAAKGYISELFFWTVL  855
               P++ELT +I+LAS +LAI E   P+S++ QPYL+T+AG +G+ A  GYISE FFWTVL
Sbjct  185   YTPVRELTTVILLASSVLAIGETVAPNSISKQPYLVTLAGLLGYAAVHGYISEPFFWTVL  244

Query  856   LGLFSFGRWVKKRDYvssalpvaavlaavGEPWIQALVMISYTSLAIVQHSREPADGKEV  1035
             + L+ + R +KKRD+V+ ALP AAVLA VGEPW++ + +  Y +LA+  +S + +  ++ 
Sbjct  245   VCLYGYSRLLKKRDHVTLALPCAAVLAGVGEPWVRVVAITGYLALAMYHNSTKISSEEDR  304

Query  1036  EATNEVIRAPFPLLCVALAIGMRLAASWAGYRHLTWMIV  1152
             ++     + P PLL  ALAIG+RLAA WAGYRHLTWMIV
Sbjct  305   QSLGN--QPPVPLLAAALAIGVRLAAKWAGYRHLTWMIV  341



>ref|XP_004507220.1| PREDICTED: uncharacterized protein LOC101507951 [Cicer arietinum]
Length=340

 Score =   248 bits (633),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 143/279 (51%), Positives = 201/279 (72%), Gaps = 1/279 (0%)
 Frame = +1

Query  319   AENGGEGTQNVANEVEIESRGESSMPERFRSLTKEAPDKPVRWPFLIVLAFLLYAWRAVL  498
             A N  E      NE E E +  ++MP RF+   KEA + P +WP+ + LAFL+YAWRAVL
Sbjct  62    ATNDDESVVVGLNEAEKELQESNTMPGRFKIQFKEASEPPFKWPWFVALAFLVYAWRAVL  121

Query  499   WELSIWKGIVMGFFRFIGTMMKFALANVLYYILHPVTASLRFVETILHIIRTFYSGVIKQ  678
             +ELS WK    G  RF+G  +K+A A V  +I +P+T ++R +E  ++ ++ FYS +I  
Sbjct  122   FELSNWKNAAFGIVRFVGYALKYAFALVYQFIGNPITFTIRSIEDAIYSVQAFYSWIIAC  181

Query  679   APIQELTKMiilaslilaiaeaTVPDSVNSQPYLLTVAGFIGFVAAKGYISELFFWTVLL  858
             API +LT +I LAS++LA+AE TVP+ +++QPY+LT+ G IG+ A +G+ISE  FWT+L+
Sbjct  182   APIPDLTIIIFLASVVLAVAETTVPNCISNQPYVLTITGLIGYAAVRGFISEPLFWTLLV  241

Query  859   GLFSFGRWVKKRDYvssalpvaavlaavGEPWIQALVMISYTSLAIVQHSREPADGKEVE  1038
             G++ F +++K+RD VSSA+PVAAVLAAVGEPW++ +V+ SYT+LAI Q+S+  + GKEVE
Sbjct  242   GVYGFSKFIKRRDDVSSAMPVAAVLAAVGEPWVRLVVITSYTALAIYQYSKTLSKGKEVE  301

Query  1039  ATN-EVIRAPFPLLCVALAIGMRLAASWAGYRHLTWMIV  1152
                 +  R P PL   ALAIG+R+AA WAGYRHLTWMIV
Sbjct  302   EIEPQGKRLPVPLFLAALAIGLRVAAKWAGYRHLTWMIV  340



>gb|KFK29347.1| hypothetical protein AALP_AA7G121900 [Arabis alpina]
Length=320

 Score =   247 bits (631),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 139/263 (53%), Positives = 188/263 (71%), Gaps = 2/263 (1%)
 Frame = +1

Query  364   EIESRGESSMPERFRSLTKEAPDKPVRWPFLIVLAFLLYAWRAVLWELSIWKGIVMGFFR  543
             E  +R ES+MP+RFR LTKEAPD P+RWP  + L FL+YAWR VL+ELS W+        
Sbjct  60    EDSARRESTMPDRFRHLTKEAPDTPIRWPCFVALGFLVYAWRPVLFELSNWRKAAFAILG  119

Query  544   FIGTMMKFALANVLYYILHPVTASLRFVETILHIIRTFYSGVIKQAPIQELTKMiilasl  723
             F+G + KFALA V +++  P+T+ +  VET ++ +R FYSG++   P++ELT +I+LAS 
Sbjct  120   FLGDLSKFALALVFHFVGDPITSLIALVETAIYSVRAFYSGIVAYTPVRELTTVILLASS  179

Query  724   ilaiaeaTVPDSVNSQPYLLTVAGFIGFVAAKGYISELFFWTVLLGLFSFGRWVKKRDYv  903
             +LAI EA  P+S++ QPY++T+AG +G+ A + YISE FFWTVLLGL+ + R++KKRD V
Sbjct  180   VLAIGEAVAPNSISKQPYVVTLAGLLGYAAVQSYISEPFFWTVLLGLYGYSRFIKKRDDV  239

Query  904   ssalpvaavlaavGEPWIQALVMISYTSLAIVQHSREPADGKEVEATNEVIRAPFPLLCV  1083
             +SALP AAVLA VGEPW++ + +  Y +LA+  +S +     E E  N     P PLL  
Sbjct  240   TSALPSAAVLAGVGEPWVRVVAITGYLALAMYHNSTK--TSSEEERQNLRRAPPIPLLAA  297

Query  1084  ALAIGMRLAASWAGYRHLTWMIV  1152
             ALAIG+RLAA WAGYRHLTWMIV
Sbjct  298   ALAIGVRLAAKWAGYRHLTWMIV  320



>ref|XP_010433249.1| PREDICTED: uncharacterized protein LOC104717391 [Camelina sativa]
Length=353

 Score =   246 bits (629),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 144/279 (52%), Positives = 194/279 (70%), Gaps = 7/279 (3%)
 Frame = +1

Query  316   KAENGGEGTQNVANEVEIESRGESSMPERFRSLTKEAPDKPVRWPFLIVLAFLLYAWRAV  495
              A NGG     + +E E  +R ES+MP+RFR LT+EAPD PV WP+ + L FL+YAWRAV
Sbjct  82    NAPNGG-----IEDEAERFARRESTMPDRFRYLTREAPDSPVIWPWFVALGFLMYAWRAV  136

Query  496   LWELSIWKGIVMGFFRFIGTMMKFALANVLYYILHPVTASLRFVETILHIIRTFYSGVIK  675
             L+ELS W+        F+G + KFALA V ++I  P+T+ +  VET ++ IR FYSG++ 
Sbjct  137   LFELSNWRKAAFAILGFVGDLSKFALALVFHFIGDPITSLISLVETAMYSIRAFYSGIVA  196

Query  676   QAPIQELTKMiilaslilaiaeaTVPDSVNSQPYLLTVAGFIGFVAAKGYISELFFWTVL  855
               P++ELT +I+LAS +LAI EA   +S++ QPY++T+AG  G+ A + YISE FFWTVL
Sbjct  197   YTPVRELTTVILLASSVLAIGEAVALNSISKQPYVVTIAGLGGYAAVQSYISEPFFWTVL  256

Query  856   LGLFSFGRWVKKRDYvssalpvaavlaavGEPWIQALVMISYTSLAIVQHSREPADGKEV  1035
             LGL+ + R +KKRD V+SALP AAVLA VGEPW++ + +  Y +LA+  ++ +     E 
Sbjct  257   LGLYGYSRLIKKRDDVTSALPSAAVLAGVGEPWVRVVAITGYLALAMYHNTTKTTS--EE  314

Query  1036  EATNEVIRAPFPLLCVALAIGMRLAASWAGYRHLTWMIV  1152
             E+ N     P PLL  ALAIG+RLAA WAGYRHLTWMIV
Sbjct  315   ESQNLRRAPPIPLLAAALAIGVRLAAKWAGYRHLTWMIV  353



>ref|XP_008230221.1| PREDICTED: uncharacterized protein LOC103329522 [Prunus mume]
Length=325

 Score =   245 bits (625),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 161/341 (47%), Positives = 219/341 (64%), Gaps = 36/341 (11%)
 Frame = +1

Query  139   IKLSSHPPLFNRPHHSNQAPFDSFQPRTSILRLR--NAHKFPGLLSTNLGLSVTKNHGFL  312
             +K++S  PL  RPH         F+  T +  L     H FPG        S  K  GFL
Sbjct  18    LKITSFSPLIIRPHKQT----IQFRSSTKVQFLNPIQPHNFPG--------SSGKAVGFL  65

Query  313   AKAENGGEGTQNVANEVEIESRGESSMPERFRSLTKEAPDKPVRWPFLIVLAFLLYAWRA  492
              +        + +   V  +S G             EA + PVRWP+ + L FL+YAWRA
Sbjct  66    FE--------RRLRVRVSAKSDG-----------VDEAEEAPVRWPWFVALVFLIYAWRA  106

Query  493   VLWELSIWKGIVMGFFRFIGTMMKFALANVLYYILHPVTASLRFVETILHIIRTFYSGVI  672
             VL EL+ W+   +   RF+G ++K  LA + +++  P+T  +RF+ET ++ +R+FYSG++
Sbjct  107   VLLELANWRKAALAVVRFVGYLLKLILALIFHFLGDPITFIIRFIETTIYALRSFYSGIV  166

Query  673   KQAPIQELTKMiilaslilaiaeaTVPDSVNSQPYLLTVAGFIGFVAAKGYISELFFWTV  852
               API ELT +I+LAS +LAIAEA VP+S+N QP+LLT +G +G+ A  GYISE FFWT+
Sbjct  167   AYAPIPELTTVIMLASTVLAIAEAVVPNSINCQPFLLTASGVVGYAAVTGYISEPFFWTI  226

Query  853   LLGLFSFGRWVKKRDYvssalpvaavlaavGEPWIQALVMISYTSLAIVQHSREPADGK-  1029
             L+GL+ + R+VKKRD V+SALP AAVLAAVGEP+I+ LV+ SY SLAI+ HS++ ++ K 
Sbjct  227   LVGLYGYSRFVKKRDDVTSALPAAAVLAAVGEPYIRVLVISSYLSLAILHHSKKLSERKE  286

Query  1030  EVEATNEVIRAPFPLLCVALAIGMRLAASWAGYRHLTWMIV  1152
             E+  TN   + P PLL VALAIG+RLAA WAGYRHLTWMIV
Sbjct  287   EIVVTNR--KLPMPLLGVALAIGIRLAAKWAGYRHLTWMIV  325



>ref|XP_009144250.1| PREDICTED: uncharacterized protein LOC103867909 [Brassica rapa]
Length=341

 Score =   245 bits (625),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 138/279 (49%), Positives = 194/279 (70%), Gaps = 2/279 (1%)
 Frame = +1

Query  316   KAENGGEGTQNVANEVEIESRGESSMPERFRSLTKEAPDKPVRWPFLIVLAFLLYAWRAV  495
             + E        V +E E  +R ES+MP+RFR LTKEA D P+RW + + LAFL+YAWRAV
Sbjct  65    RCEKEDAKNGEVEDEAERFARRESTMPDRFRYLTKEAQDSPIRWHWFVALAFLVYAWRAV  124

Query  496   LWELSIWKGIVMGFFRFIGTMMKFALANVLYYILHPVTASLRFVETILHIIRTFYSGVIK  675
             L+ELS W+  V      +G + KFALA V ++I  P+T+ +  VET ++ +R FYSG++ 
Sbjct  125   LFELSNWRKAVFAIGGLLGDLSKFALALVFHFIGDPITSLISLVETAIYSVRGFYSGIVA  184

Query  676   QAPIQELTKMiilaslilaiaeaTVPDSVNSQPYLLTVAGFIGFVAAKGYISELFFWTVL  855
               P++ELT +I+LAS +LAI E   P+S++ QPYL+T+AG +G+ A  GYISE FFWTVL
Sbjct  185   YTPVRELTTVILLASSVLAIGETVAPNSISKQPYLVTLAGLLGYAAVHGYISEPFFWTVL  244

Query  856   LGLFSFGRWVKKRDYvssalpvaavlaavGEPWIQALVMISYTSLAIVQHSREPADGKEV  1035
             + L+ + R +KKRD+V+ ALP AAVLA VGEPW++ + +  Y +LA+  +S + +  ++ 
Sbjct  245   VCLYGYSRLLKKRDHVTLALPCAAVLAGVGEPWVRVVAITGYLALAMYHNSTKISSEEDR  304

Query  1036  EATNEVIRAPFPLLCVALAIGMRLAASWAGYRHLTWMIV  1152
             ++     + P PLL  ALAIG+RLAA WAGYRHLTWMIV
Sbjct  305   QSLGN--QPPVPLLAAALAIGVRLAAKWAGYRHLTWMIV  341



>ref|XP_008812229.1| PREDICTED: uncharacterized protein LOC103723174 [Phoenix dactylifera]
Length=355

 Score =   244 bits (622),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 173/363 (48%), Positives = 225/363 (62%), Gaps = 21/363 (6%)
 Frame = +1

Query  70    GLSEAMSITLSTFRSPNIFFKNPIKLSSHPPLFNRPHHSNQAPFDSFQP-RTSILRLRNA  246
              L+ A SI LST  SP +   NP K  S P L  RP  S       F P + S  R+R  
Sbjct  12    SLAMATSIRLST--SPLL---NP-KSRSFPHLL-RPFSSKTLALARFPPLKASPTRIR--  62

Query  247   HKFPGLLSTNLGLSVTKNHGFLAK-AENGGEGTQNVANEVEIESRGESSMPERFRSLTKE  423
                       LG S  +  GFL++ A+NGG   ++ A +    +RG+S+MPERFR LTKE
Sbjct  63    ----------LGASPRREPGFLSRVAKNGGGAPESAAEDEADSARGQSTMPERFRPLTKE  112

Query  424   APDKPVRWPFLIVLAFLLYAWRAVLWELSIWKGIVMGFFRFIGTMMKFALANVLYYILHP  603
             APD+PVRWP++I L FL+YAWR VLWEL+ WK  ++    F   + K  LA V ++I  P
Sbjct  113   APDRPVRWPWVIALVFLVYAWRTVLWELTNWKKAMLAIIGFFDYLFKLILAFVFHFIGEP  172

Query  604   VTASLRFVETILHIIRTFYSGVIKQAPIQELTKMiilaslilaiaeaTVPDSVNSQPYLL  783
             +T  +R +E  L+  R  YS V+  AP+ ELT++I   S I+AIAEATVPDSVNSQ +LL
Sbjct  173   ITVLIRCIEFALYSARYIYSSVVAFAPVPELTRIIFFTSTIMAIAEATVPDSVNSQQHLL  232

Query  784   TVAGFIGFVAAKGYISELFFWTVLLGLFSFGRWVKKRDYvssalpvaavlaavGEPWIQA  963
             T+AG IGF A  G++ EL FW +L G+F +  ++KKRD VS+ALP   VLAAVGEPWI+ 
Sbjct  233   TLAGIIGFGAVNGFVPELLFWLLLSGMFCYSHFIKKRDGVSAALPSTVVLAAVGEPWIRG  292

Query  964   LVMISYTSLAIVQHSREPADGKEVEATNEVIRAPFPLLCVALAIGMRLAASWAGYRHLTW  1143
             L + SY +LAIVQ+S+   +    +      R P PLL  AL+IG+ LAA W   RHLTW
Sbjct  293   LAIASYLALAIVQYSKLSEESVRTDTPVIGRRLPLPLLLAALSIGIHLAAKWVRRRHLTW  352

Query  1144  MIV  1152
             MIV
Sbjct  353   MIV  355



>ref|XP_003636630.1| hypothetical protein MTR_050s0011 [Medicago truncatula]
 gb|KEH29609.1| embryo defective 1923 protein, putative [Medicago truncatula]
Length=330

 Score =   239 bits (611),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 137/267 (51%), Positives = 197/267 (74%), Gaps = 2/267 (1%)
 Frame = +1

Query  355   NEVEIESRGESSMPERFRSLTKEAPDKPVRWPFLIVLAFLLYAWRAVLWELSIWKGIVMG  534
             N  E E +  S+MP RF+   K+AP+ P +WP  + LAFL+YAWRAVL+ELS WK    G
Sbjct  65    NNDEAE-KEPSTMPGRFKDYIKQAPESPFKWPMFVALAFLIYAWRAVLFELSNWKNAAFG  123

Query  535   FFRFIGTMMKFALANVLYYILHPVTASLRFVETILHIIRTFYSGVIKQAPIQELTKMiil  714
               RF+G ++K+A A V  +I +P+T ++  +E +++ ++ FYS +I  AP+ +LT +I+L
Sbjct  124   IVRFVGIVLKYAFALVYRFIGNPITFTIGSIEDLIYGVQAFYSWIITSAPVPDLTLVIVL  183

Query  715   aslilaiaeaTVPDSVNSQPYLLTVAGFIGFVAAKGYISELFFWTVLLGLFSFGRWVKKR  894
             AS++LA+AE   P+ ++ QPY+LTV G IG+ A +G ISE  FWT+L+G++ F +++K+R
Sbjct  184   ASVVLAVAETINPNCISDQPYVLTVTGLIGYAAVRGVISEPLFWTLLVGIYGFSKFMKRR  243

Query  895   DYvssalpvaavlaavGEPWIQALVMISYTSLAIVQHSREPADGKEVEATNEVIRA-PFP  1071
             D VSSA+PVAAVLAAVGEPW++ +V++SYT+LAI QHS+  ++GKEVE      R  P P
Sbjct  244   DDVSSAMPVAAVLAAVGEPWVRFVVIVSYTALAIYQHSKMISEGKEVEEIEPHRRKLPVP  303

Query  1072  LLCVALAIGMRLAASWAGYRHLTWMIV  1152
             L   ALAIG+R+AA+WAGYRHLTWM+V
Sbjct  304   LFLAALAIGLRVAANWAGYRHLTWMVV  330



>ref|XP_010277928.1| PREDICTED: uncharacterized protein LOC104612270 [Nelumbo nucifera]
Length=357

 Score =   239 bits (611),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 176/357 (49%), Positives = 232/357 (65%), Gaps = 3/357 (1%)
 Frame = +1

Query  85    MSITLSTFRSPNIFFKNPIKLSSHPPL--FNRPHHSNQAPFDSFQPRTSILRLRNAHKFP  258
             MS+  S   SPN+  K P+    + P   F   H  +     S   RT  ++  +  KF 
Sbjct  1     MSMATSIICSPNLTLKFPLLPHRNTPQTRFFSQHSDHIFKLRSSLSRTQPIKPNSTFKFL  60

Query  259   GLLSTNLGLSVTKNHGFLAKAENGGEGTQNVANEVEIESRGESSMPERFRSLTKEAPDKP  438
                    G     N GF A A++G      V +E E E+RG+S+MP RFR LTKEAPD+P
Sbjct  61    RFPLKPSGFPSRGNLGFSAAAKDGEREAVPVVDEAE-EARGQSTMPSRFRYLTKEAPDRP  119

Query  439   VRWPFLIVLAFLLYAWRAVLWELSIWKGIVMGFFRFIGTMMKFALANVLYYILHPVTASL  618
             VRWP+LI L FL+YAWRAVLWELS WK +V+   +F+  ++KF +A + ++I  P+T  +
Sbjct  120   VRWPWLIALPFLVYAWRAVLWELSNWKKVVLVIVQFVSYLLKFVMAFIFHFIGDPITGMI  179

Query  619   RFVETILHIIRTFYSGVIKQAPIQELTKMiilaslilaiaeaTVPDSVNSQPYLLTVAGF  798
             R +ET+L+ IR+ YSG++   P+ ELT +I+L S++LAIAEAT+PDS+N+Q + LT+AG 
Sbjct  180   RCIETVLYTIRSIYSGIVAATPVPELTVVIMLTSVVLAIAEATIPDSINNQMHFLTMAGI  239

Query  799   IGFVAAKGYISELFFWTVLLGLFSFGRWVKKRDYvssalpvaavlaavGEPWIQALVMIS  978
             IGF A +G I EL FW +LLGLFSF +++KKR+ VSSALPVAAVLAAVGEPW++ L + S
Sbjct  240   IGFAAVRGIIPELPFWLLLLGLFSFSKFIKKRNDVSSALPVAAVLAAVGEPWVRVLAIFS  299

Query  979   YTSLAIVQHSREPADGKEVEATNEVIRAPFPLLCVALAIGMRLAASWAGYRHLTWMI  1149
             Y  LAI  HS+      E E    V R P PLL  ALAIG+ LAA W  YRHLTWMI
Sbjct  300   YLGLAIYHHSKISKGHMETEEAVIVRRLPLPLLSAALAIGIHLAAKWLRYRHLTWMI  356



>ref|XP_009402583.1| PREDICTED: uncharacterized protein LOC103986330 [Musa acuminata 
subsp. malaccensis]
Length=355

 Score =   234 bits (597),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 164/358 (46%), Positives = 221/358 (62%), Gaps = 20/358 (6%)
 Frame = +1

Query  94    TLSTFRSPNIFFKNPIKLSSHPPL-FNRPHHSNQAPF-DSFQPRTSILRLRNAHKFPGLL  267
             +L+T  SP +    P    S   L  +RP+H     F  +  P+            P L 
Sbjct  11    SLATGSSPRLGAPPPFSAKSRSCLHLSRPNHGKDFTFVGASSPK------------PFLS  58

Query  268   STNLGLSVTKNHGFLAKAEN-GGEGTQNVAN-EVEIESRGESSMPERFRSLTKEAPDKPV  441
                +G S      FLA A   GG G    +  + + E RG+S+MPERFR LTKEAPD+PV
Sbjct  59    RARIGFSSRIERRFLAFAPRIGGSGNSETSRVDEDDEMRGQSTMPERFRHLTKEAPDRPV  118

Query  442   RWPFLIVLAFLLYAWRAVLWELSIWKGIVMGFFRFIGTMMKFALANVLYYILHPVTASLR  621
             RWP+++ L FL+YAWR VLWEL+ WK  ++    F+G + K  LA V +Y+   +T  +R
Sbjct  119   RWPWVVALLFLVYAWRTVLWELTNWKRTMLAVMHFLGYLGKLILAVVFHYVGDLITVLIR  178

Query  622   FVETILHIIRTFYSGVIKQAPIQELTKMiilaslilaiaeaTVPDSVNSQPYLLTVAGFI  801
              +E  L+  R  Y+ V+  AP+ ELT++I+ A+ +LAIAEATVPDSVNSQ +LLT+AGFI
Sbjct  179   CIEFCLNSARYAYASVVAFAPVPELTRVILFATAVLAIAEATVPDSVNSQSHLLTLAGFI  238

Query  802   GFVAAKGYISELFFWTVLLGLFSFGRWVKKRDYvssalpvaavlaavGEPWIQALVMISY  981
             GF   K ++ EL FW  L GL  + R++KK DY+S+ LP AAVLAAVGEPW++ LVM SY
Sbjct  239   GFGVVKDFVPELLFWLFLFGLSCYSRFIKKNDYISALLPSAAVLAAVGEPWVRGLVMGSY  298

Query  982   TSLAIVQHSREPAD--GKEVEATNEVIRAPFPLLCVALAIGMRLAASWAGYRHLTWMI  1149
              ++AI QHS+   +   +++ AT    R P PLL  A+AIG+ LAA W  YRHLTWMI
Sbjct  299   LAVAIFQHSKTSEELLSRKLPATGR--RLPEPLLLAAMAIGVHLAAKWIRYRHLTWMI  354



>ref|XP_004304109.1| PREDICTED: uncharacterized protein LOC101308695 [Fragaria vesca 
subsp. vesca]
Length=346

 Score =   233 bits (593),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 166/348 (48%), Positives = 233/348 (67%), Gaps = 14/348 (4%)
 Frame = +1

Query  145   LSSHPPLFNRPHHSN-QAPFDSFQPRTSILR-----LRNAHKFPGLLST---NLGLSVTK  297
             +++  P+ + P+ S  +  F SF P T+ L+      R+A K     +    NLG    K
Sbjct  1     MATTIPILSSPNPSILRTKFTSFSPVTARLQNQAIPFRSATKIQSWKTNQTHNLGGFPGK  60

Query  298   NHGFL--AKAENGGEGTQNVANEVEIESRGESSMPERFRSLTKEAPDKPVRWPFLIVLAF  471
               GF+   K        ++  +E E ESRGES+MPERFR L KEAPD PVRWP+ +  AF
Sbjct  61    GVGFVFERKLRARVSAKEDGGDEAEEESRGESTMPERFRYLNKEAPDPPVRWPWFLASAF  120

Query  472   LLYAWRAVLWELSIWKGIVMGFFRFIGTMMKFALANVLYYILHPVTASLRFVETILHIIR  651
             L+YAWRAVL ELS W+   +   +F+G ++K +LA + +++  P+T  +RFVETI + +R
Sbjct  121   LIYAWRAVLLELSNWRKGALAIVQFVGYLLKLSLAVIFHFVGDPITYMIRFVETIFYAVR  180

Query  652   TFYSGVIKQAPIQELTKMiilaslilaiaeaTVPDSVNSQPYLLTVAGFIGFVAAKGYIS  831
              +YS ++  API ELT +I+LAS +LAIAEA VP+SVN QP LLT++G +G+     YIS
Sbjct  181   AYYSEIVAYAPIPELTTVIMLASAVLAIAEAVVPNSVNCQPILLTLSGVVGYAVVFDYIS  240

Query  832   ELFFWTVLLGLFSFGRWVKKRDYvssalpvaavlaavGEPWIQALVMISYTSLAIVQHSR  1011
             E FF+T+L+GL+ + R+VK+RD V+SALP AAVLAAVGEPWI+ LV+  + +LAI  +S+
Sbjct  241   EPFFYTILVGLYGYSRFVKRRDDVTSALPAAAVLAAVGEPWIRVLVLPLFLALAIFIYSK  300

Query  1012  E-PADGKEVEATNEVIRAPFPLLCVALAIGMRLAASWAGYRHLTWMIV  1152
             + P   +++  TN   + P PLL  AL+IG+RLAA+WAGYRHLTW IV
Sbjct  301   KLPERKEDLVVTNR--KLPLPLLGAALSIGIRLAANWAGYRHLTWKIV  346



>ref|XP_010939724.1| PREDICTED: uncharacterized protein LOC105058474 [Elaeis guineensis]
Length=355

 Score =   233 bits (593),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 147/294 (50%), Positives = 198/294 (67%), Gaps = 2/294 (1%)
 Frame = +1

Query  277   LGLSVTKNHGFLAKA--ENGGEGTQNVANEVEIESRGESSMPERFRSLTKEAPDKPVRWP  450
             LG+S  +  GFL+      GGE  ++ A +    +RG+S+MPERFR LTKEAPD+PVRWP
Sbjct  62    LGVSPRREPGFLSCVGKNGGGESPESDAVDEADAARGQSTMPERFRPLTKEAPDRPVRWP  121

Query  451   FLIVLAFLLYAWRAVLWELSIWKGIVMGFFRFIGTMMKFALANVLYYILHPVTASLRFVE  630
             +++ L FL+YAWR VLWEL+ WK  ++    F   + K  LA V ++I  P+T  +R +E
Sbjct  122   WVVALVFLVYAWRTVLWELANWKKSMLAVIGFFSYLFKLILAFVFHFIGEPITVLIRCME  181

Query  631   TILHIIRTFYSGVIKQAPIQELTKMiilaslilaiaeaTVPDSVNSQPYLLTVAGFIGFV  810
               L+  R  YS ++  AP+ ELT++I+  S I+AIAEATVPDS NSQ +LLT+AG IGF 
Sbjct  182   FALYSARYIYSSIVAFAPVPELTRIILFTSTIVAIAEATVPDSANSQQHLLTLAGIIGFG  241

Query  811   AAKGYISELFFWTVLLGLFSFGRWVKKRDYvssalpvaavlaavGEPWIQALVMISYTSL  990
             A  G++ EL FW +L G+F +  ++KKRD VS+ALP  AVLAAVGEPW++ L + SY +L
Sbjct  242   AVNGFVPELLFWLLLSGMFCYSHFIKKRDGVSAALPSTAVLAAVGEPWVRGLAIASYLAL  301

Query  991   AIVQHSREPADGKEVEATNEVIRAPFPLLCVALAIGMRLAASWAGYRHLTWMIV  1152
             AIVQ+S+   +    +A     R P PLL  AL+IG+ LAA W   RHLTWMIV
Sbjct  302   AIVQYSKLSEESARTDAPVIGRRLPLPLLLAALSIGIHLAAKWVRRRHLTWMIV  355



>emb|CDY18995.1| BnaC01g20730D [Brassica napus]
Length=353

 Score =   224 bits (570),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 128/262 (49%), Positives = 181/262 (69%), Gaps = 4/262 (2%)
 Frame = +1

Query  313   AKAENGGEGTQNVANEVEIESRGESSMPERFRSLTKEAPDKPVRWPFLIVLAFLLYAWRA  492
              + EN   G   V +E E  +R ES+MP+RFR LTKEA D P RWP+ + LAFL+YAWRA
Sbjct  68    CEKENAKNG--EVDDEAERFARRESTMPDRFRYLTKEAQDSPTRWPWFVALAFLVYAWRA  125

Query  493   VLWELSIWKGIVMGFFRFIGTMMKFALANVLYYILHPVTASLRFVETILHIIRTFYSGVI  672
             VL+ELS W+       R +G + KFALA V ++I  P+T+ + FVET ++ IR+FYSG++
Sbjct  126   VLFELSNWRNAAFAILRLLGDLSKFALALVFHFIGDPITSLIAFVETTIYSIRSFYSGIV  185

Query  673   KQAPIQELTKMiilaslilaiaeaTVPDSVNSQPYLLTVAGFIGFVAAKGYISELFFWTV  852
                P++ELT +I+LAS +LAI E   P+S++ QPYL+T+AG +G+     YISE FFWTV
Sbjct  186   AYTPVRELTTVILLASSVLAIGETVAPNSISKQPYLVTLAGLLGYAVVHSYISEPFFWTV  245

Query  853   LLGLFSFGRWVKKRDYvssalpvaavlaavGEPWIQALVMISYTSLAIVQHSREPADGKE  1032
             L+GL+ + R +KKRD+V+SALP AAVLA VGEPW++ + +  Y +LA+  HS + +  ++
Sbjct  246   LVGLYGYSRLIKKRDHVTSALPCAAVLAGVGEPWVRVVAITGYLALAMYHHSTKTSSEED  305

Query  1033  VEATNEVIRAPFPLLCVALAIG  1098
              ++  +    P PLL  ALAIG
Sbjct  306   RQSLGKA--PPVPLLAAALAIG  325



>ref|XP_008379901.1| PREDICTED: uncharacterized protein LOC103442887, partial [Malus 
domestica]
Length=236

 Score =   218 bits (555),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 131/231 (57%), Positives = 173/231 (75%), Gaps = 3/231 (1%)
 Frame = +1

Query  463   LAFLLYAWRAVLWELSIWKGIVMGFFRFIGTMMKFALANVLYYILHPVTASLRFVETILH  642
             L FL+YAWRAVL EL+ W+   +G   F+G ++K  LA + ++I  P+T+ +RFVET L+
Sbjct  8     LVFLIYAWRAVLLELANWRKAAVGVVSFVGYLLKLILALIFHFIGDPITSVIRFVETTLY  67

Query  643   IIRTFYSGVIKQAPIQELTKMiilaslilaiaeaTVPDSVNSQPYLLTVAGFIGFVAAKG  822
              IR FYSG++  API ELT +IILAS++LAIAEA VP++VN QP+LLT +G + + A  G
Sbjct  68    AIRAFYSGIVAYAPIPELTTVIILASIVLAIAEAVVPNAVNCQPFLLTASGIVAYAAVAG  127

Query  823   YISELFFWTVLLGLFSFGRWVKKRDYvssalpvaavlaavGEPWIQALVMISYTSLAIVQ  1002
             YISE FFWT+LLG + + R VKKRD V+SALP AAV+AA+GEPW++ LV+ SY +LAI  
Sbjct  128   YISEPFFWTILLGFYGYSRLVKKRDDVTSALPAAAVMAAIGEPWVRVLVIASYLALAIFH  187

Query  1003  HSREPADGK-EVEATNEVIRAPFPLLCVALAIGMRLAASWAGYRHLTWMIV  1152
             HS++ ++ K E+  TN   + P PLL   LAIG+RLAA WAGYRHLTWMIV
Sbjct  188   HSKKVSEKKEEIVVTNR--KLPMPLLGAGLAIGIRLAAKWAGYRHLTWMIV  236



>gb|EPS63563.1| hypothetical protein M569_11222, partial [Genlisea aurea]
Length=257

 Score =   211 bits (537),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 150/258 (58%), Positives = 185/258 (72%), Gaps = 2/258 (1%)
 Frame = +1

Query  376   RGESSMPERFRSLTKEAPDKPVRWPFLIVLAFLLYAWRAVLWELSIWKGIVMGFFRFIGT  555
             RG SSMPERFR LTKEAPDKPVRWP+LI + F+LYAWR+VLWELS W   V     F+  
Sbjct  1     RGPSSMPERFRYLTKEAPDKPVRWPWLIAVGFMLYAWRSVLWELSNWSEAVKSIGGFLIY  60

Query  556   MMKFALANVLYYILHPVTASLRFVETILHIIRTFYSGVIKQAPIQELTKMiilaslilai  735
             + K  LA + +++  P+T+ +  +ET  +  R+ YS VI  APIQELT +++L S +LA+
Sbjct  61    VGKLGLAFIFHFVGDPITSFIWLLETAFYRFRSIYSAVIAYAPIQELTLIVVLTSFVLAV  120

Query  736   aeaTVPDSVNSQPYLLTVAGFIGFVAAKGYISELFFWTVLLGLFSFGRWVKKRDYvssal  915
             AEA VPDSV+ QP LLT+AG   F A    ISEL FWT+LLGLF F + VK RDYVSSAL
Sbjct  121   AEAAVPDSVDGQPRLLTLAGAASFAAVANLISELLFWTLLLGLFGFAKAVKGRDYVSSAL  180

Query  916   pvaavlaavGEPWIQALVMISYTSLAIVQHSREPADGKEVEATNEVIRAPFPLLCVALAI  1095
             PVAA LAAVGEPWI+A  + SY  LA+V   R    G++ E    + R PFPLLC ALA+
Sbjct  181   PVAAALAAVGEPWIRAAAVASYVGLAVV--CRRGKVGEDGEGGGGIDRVPFPLLCTALAV  238

Query  1096  GMRLAASWAGYRHLTWMI  1149
             G+RLAA+WAGYRHLTWM+
Sbjct  239   GVRLAANWAGYRHLTWMV  256



>ref|XP_010689492.1| PREDICTED: uncharacterized protein LOC104903192 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=190

 Score =   173 bits (439),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 138/185 (75%), Gaps = 1/185 (1%)
 Frame = +1

Query  601   PVTASLRFVETILHIIRTFYSGVIKQAPIQELTKMiilaslilaiaeaTVPDSVNSQPYL  780
             P+T ++ +VET +H  R+ YS ++  API ELT +I+L+  +LAI EA  P+S+  QPYL
Sbjct  6     PITYTVLYVETAVHATRSLYSSIVTSAPIPELTFIIMLSLTVLAIGEAASPNSIKCQPYL  65

Query  781   LTVAGFIGFVAAKGYISELFFWTVLLGLFSFGRWVKKRDYvssalpvaavlaavGEPWIQ  960
             LT AG IG+ A +G I E  FW +L+GLFSF R+ KKRDYVSSALP+A VLA+VGEPW++
Sbjct  66    LTAAGLIGYGAVRGVIIEPLFWLMLVGLFSFSRFFKKRDYVSSALPIATVLASVGEPWVR  125

Query  961   ALVMISYTSLAIVQHSREPADGK-EVEATNEVIRAPFPLLCVALAIGMRLAASWAGYRHL  1137
              L +IS+T+LAI  HS+E A+G  + E T+     P PLL VALAIG+R+AA WAGYRHL
Sbjct  126   VLAIISFTALAIHHHSKELAEGNAKGEVTSSSGNIPLPLLGVALAIGIRVAAKWAGYRHL  185

Query  1138  TWMIV  1152
             TWMIV
Sbjct  186   TWMIV  190



>ref|XP_006841820.1| hypothetical protein AMTR_s00003p00269770 [Amborella trichopoda]
 gb|ERN03495.1| hypothetical protein AMTR_s00003p00269770 [Amborella trichopoda]
Length=241

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 107/235 (46%), Positives = 157/235 (67%), Gaps = 3/235 (1%)
 Frame = +1

Query  451   FLIVLAFLLYAWRAVLWELSIWKGIVMGFFRFIGTMMKFALANVLYYILHPVTASLRFVE  630
             +L V  FL+Y W+ VLWELS WK  V+   +F   + KF LA + ++    +T  +R VE
Sbjct  7     YLAVSIFLIYCWQTVLWELSNWKKAVLAIAQFFMYLSKFILAFIYHFAGDFITGLIRNVE  66

Query  631   TILHIIRTFYSGVIKQAPIQELTKMiilaslilaiaeaTVPDSVNSQPYLLTVAGFIGFV  810
             T+L+I R+ YS ++  AP+ EL  +I+L S + AIAE+  P SV +QP++LT++GFIGF+
Sbjct  67    TVLYISRSIYSSIVASAPVGELLVIIMLTSAVFAIAESVEPGSVKNQPFILTLSGFIGFL  126

Query  811   AAKGYISELFFWTVLLGLFSFGRWVKKRDYvssalpvaavlaavGEPWIQALVMISYTSL  990
             A    + E FFW + LG+F F R+VKKRD VS+ LPVA+VL  VGEPW++ L + SY +L
Sbjct  127   AVTDLLLEPFFWLLALGIFCFSRFVKKRDGVSAVLPVASVLVGVGEPWVRVLAITSYLAL  186

Query  991   AIVQHSREPAD--GKEVEATNEVIRAPFPLLCVALAIGMRLAASWAGYRHLTWMI  1149
             A++Q+S+ P +  G E+ ++    + PF L  ++L IG+ + A W  YRHLTWMI
Sbjct  187   AMIQYSKMPEEKRGGEIRSSFG-WKPPFVLWVLSLVIGINVGAKWIRYRHLTWMI  240



>gb|ADN33768.1| hypothetical protein [Cucumis melo subsp. melo]
Length=279

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 101/138 (73%), Gaps = 3/138 (2%)
 Frame = +1

Query  745   TVPDSVNSQPYLLTVAGFIGFVAAKGYISELFFWTVLLGLFSFGRWVKKRDYvssalpva  924
             + PDSV+SQPYLLT++G  G++A +GYISE FFWT+LL ++ +  +VKKR+ V+SALP A
Sbjct  142   SAPDSVSSQPYLLTLSGLAGYLAVRGYISEPFFWTILLCVYGYSSFVKKRNDVTSALPAA  201

Query  925   avlaavGEPWIQALVMISYTSLAIVQHSREPADG-KEVEATNEVIR--APFPLLCVALAI  1095
              V AA+GEPW++ L M S+ +LAI  H ++ + G KE E    V R   P PLL VALAI
Sbjct  202   VVFAAIGEPWVRILAMGSFLALAITHHWKKLSQGKKEDEDEKGVYRWDVPLPLLGVALAI  261

Query  1096  GMRLAASWAGYRHLTWMI  1149
             G+  AA WAGYRHLTWMI
Sbjct  262   GIHAAAKWAGYRHLTWMI  279


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +1

Query  355  NEVEIESRGESSMPERFRSLTKEAPDKPVRWPFLIVLAFLLYAWRAVLWELS  510
            +E + + R ES++PERFR LTKEAPD PVRWPF + L FLLYAWRAVL+EL+
Sbjct  81   SEAQSDDREESTLPERFRYLTKEAPDPPVRWPFFVALPFLLYAWRAVLFELA  132



>gb|KDO40827.1| hypothetical protein CISIN_1g037948mg, partial [Citrus sinensis]
Length=85

 Score = 94.4 bits (233),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 59/84 (70%), Gaps = 2/84 (2%)
 Frame = +1

Query  322  ENGG--EGTQNVANEVEIESRGESSMPERFRSLTKEAPDKPVRWPFLIVLAFLLYAWRAV  495
            +NGG  E   +V +E E  +RGES+MPERFR LTKEAPD PV+WP+ I LAFL+YAWR V
Sbjct  2    DNGGGAETAHSVDDEAERLARGESTMPERFRHLTKEAPDVPVKWPWFIALAFLVYAWRTV  61

Query  496  LWELSIWKGIVMGFFRFIGTMMKF  567
            L+ELS W+   +    F G ++K 
Sbjct  62   LFELSNWRKGALTIVAFAGYLLKL  85



>ref|XP_011045513.1| PREDICTED: uncharacterized protein LOC105140401 [Populus euphratica]
Length=179

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 43/71 (61%), Gaps = 6/71 (8%)
 Frame = +1

Query  949   PWIQALVMISYTSLAIVQHSREPADGKE---VEATNEVIRAPFPLLCVALAIGMRLAASW  1119
             PW    V I  +   I  HS++ A GKE   V   +   R P PLLC ALAIG+ +AA W
Sbjct  112   PW---FVGIKRSEQTISYHSKQLAKGKEEVEVVTADTSSRVPVPLLCAALAIGIHVAAKW  168

Query  1120  AGYRHLTWMIV  1152
             AGYRHLTWM+V
Sbjct  169   AGYRHLTWMLV  179


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 32/52 (62%), Gaps = 1/52 (2%)
 Frame = +1

Query  304  GFLAKAENGGEGTQNVANEVEIESRGESSMPERFRSLTKEAPDKPVRWPFLI  459
            GF    ENG EG        +   RGES+MPERFR LTKEAPD PV WP+ +
Sbjct  65   GFRFNVENG-EGESKRDGVFDDGERGESTMPERFRYLTKEAPDPPVWWPWFV  115



>ref|XP_006841818.1| hypothetical protein AMTR_s00003p00269740 [Amborella trichopoda]
 gb|ERN03493.1| hypothetical protein AMTR_s00003p00269740 [Amborella trichopoda]
Length=134

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 67/132 (51%), Gaps = 16/132 (12%)
 Frame = +1

Query  85   MSITLSTFRSPNIFFKNPIKLSSHPPL-FNRPHHSNQAPFDSFQPRTSILRLRNAHKFPG  261
            MSI+ S    PN    +P    S   L  NR        F +F  R   LRL+  H+   
Sbjct  1    MSISCSLAAHPNPKHGSPCTRHSTVQLRANR--------FLNFDSRDCSLRLQMGHQLCK  52

Query  262  LLS--TNLGL----SVTKNHGFLAKAENGGEGTQNVANEVEIESRGESSMPERFRSLTKE  423
             L    N GL    SV     F  ++ENG +  + V +E E E+RG+S++P RFR LTKE
Sbjct  53   SLGFYANSGLFKGFSVPGKVAFEVRSENGEDDQKTVIDEAE-EARGKSTLPSRFRYLTKE  111

Query  424  APDKPVRWPFLI  459
            APD PVRW +L+
Sbjct  112  APDLPVRWSWLL  123



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3213648280796