BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7368_g1_i1 len=1046 path=[1:0-1045]

Length=1046
                                                                      Score     E

ref|XP_009768743.1|  PREDICTED: protein DCL, chloroplastic-like         223   4e-67   
ref|XP_009587068.1|  PREDICTED: protein DCL, chloroplastic-like         220   4e-66   
ref|XP_006354776.1|  PREDICTED: protein DCL, chloroplastic-like         216   7e-65   
ref|XP_004241584.1|  PREDICTED: protein DCL, chloroplastic-like         212   5e-63   
ref|XP_008239940.1|  PREDICTED: protein DCL, chloroplastic              203   1e-59   
ref|XP_007209564.1|  hypothetical protein PRUPE_ppa011021mg             203   1e-59   
ref|XP_007138179.1|  hypothetical protein PHAVU_009G187000g             199   6e-58   
ref|XP_004299358.1|  PREDICTED: uncharacterized protein LOC101304576    197   1e-57   
ref|XP_009339285.1|  PREDICTED: protein DCL, chloroplastic-like         197   1e-57   
ref|XP_008351848.1|  PREDICTED: protein DCL, chloroplastic-like         196   1e-56   
ref|XP_010257491.1|  PREDICTED: protein DCL, chloroplastic-like         196   1e-56   
ref|XP_008393164.1|  PREDICTED: protein DCL, chloroplastic-like         195   1e-56   
ref|XP_006477458.1|  PREDICTED: protein DCL, chloroplastic-like         194   2e-56   
ref|XP_006440602.1|  hypothetical protein CICLE_v10022133mg             194   3e-56   
ref|XP_002284935.1|  PREDICTED: uncharacterized protein LOC100255290    194   3e-56   Vitis vinifera
emb|CDP12303.1|  unnamed protein product                                194   3e-56   
ref|XP_008453205.1|  PREDICTED: protein DCL, chloroplastic              192   2e-55   
gb|EYU24371.1|  hypothetical protein MIMGU_mgv1a013650mg                191   3e-55   
ref|XP_002514753.1|  conserved hypothetical protein                     189   2e-54   Ricinus communis
ref|XP_006364595.1|  PREDICTED: protein DCL, chloroplastic-like         188   3e-54   
ref|XP_007037355.1|  Uncharacterized protein TCM_014003                 189   3e-54   
ref|XP_004499475.1|  PREDICTED: protein DCL, chloroplastic-like         188   5e-54   
ref|XP_011036794.1|  PREDICTED: protein DCL, chloroplastic-like i...    188   6e-54   
ref|XP_004154974.1|  PREDICTED: uncharacterized protein LOC101228008    188   6e-54   
ref|XP_009614786.1|  PREDICTED: protein DCL, chloroplastic-like         186   4e-53   
gb|KDP31255.1|  hypothetical protein JCGZ_11631                         186   5e-53   
ref|XP_009778685.1|  PREDICTED: protein DCL, chloroplastic-like i...    185   7e-53   
ref|XP_009778678.1|  PREDICTED: protein DCL, chloroplastic-like i...    185   1e-52   
gb|EPS64007.1|  hypothetical protein M569_10774                         181   9e-52   
ref|XP_008374549.1|  PREDICTED: protein DCL, chloroplastic-like         181   4e-51   
ref|XP_003523019.1|  PREDICTED: zinc finger CCCH domain-containin...    181   5e-51   
ref|XP_011071644.1|  PREDICTED: protein DCL, chloroplastic              179   6e-51   
ref|XP_011036792.1|  PREDICTED: protein DCL, chloroplastic-like i...    181   9e-51   
ref|XP_011087245.1|  PREDICTED: protein DCL, chloroplastic-like         179   2e-50   
ref|XP_006440603.1|  hypothetical protein CICLE_v10022133mg             178   2e-50   
ref|XP_004236037.1|  PREDICTED: protein DCL, chloroplastic-like         177   4e-50   
ref|XP_009369291.1|  PREDICTED: protein DCL, chloroplastic-like         177   8e-50   
gb|KHG12161.1|  Protein DCL, chloroplastic                              177   9e-50   
ref|XP_010091522.1|  hypothetical protein L484_015949                   177   9e-50   
ref|XP_004508733.1|  PREDICTED: protein DCL, chloroplastic-like         176   1e-49   
ref|XP_006842642.1|  hypothetical protein AMTR_s00077p00189420          179   3e-49   
ref|XP_010678517.1|  PREDICTED: protein DCL, chloroplastic              176   3e-49   
ref|XP_006649525.1|  PREDICTED: cyclic nucleotide-gated cation ch...    176   3e-49   
ref|XP_003527083.1|  PREDICTED: nucleolin-like                          176   4e-49   
ref|XP_010916681.1|  PREDICTED: uncharacterized protein LOC105041409    176   8e-49   
ref|XP_003558636.1|  PREDICTED: protein DCL, chloroplastic              175   9e-49   
ref|XP_008782334.1|  PREDICTED: DNA-directed RNA polymerase V sub...    177   2e-48   
ref|XP_006382598.1|  hypothetical protein POPTR_0005s03610g             174   3e-48   
ref|NP_001236280.1|  uncharacterized protein LOC100305757               172   3e-48   
ref|XP_011023607.1|  PREDICTED: protein DCL, chloroplastic-like         173   4e-48   
gb|ABR25889.1|  unknown                                                 170   5e-48   Oryza sativa Indica Group [Indian rice]
ref|NP_201050.2|  uncharacterized protein                               172   6e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007155309.1|  hypothetical protein PHAVU_003G190000g             172   9e-48   
emb|CDY65200.1|  BnaCnng45980D                                          171   1e-47   
ref|XP_010483956.1|  PREDICTED: uncharacterized protein LOC104762379    171   1e-47   
ref|NP_001049206.1|  Os03g0187000                                       172   1e-47   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002866491.1|  hypothetical protein ARALYDRAFT_496421             170   3e-47   
ref|XP_006281035.1|  hypothetical protein CARUB_v10027052mg             171   3e-47   
ref|XP_010444092.1|  PREDICTED: uncharacterized protein LOC104726842    169   9e-47   
ref|XP_004985426.1|  PREDICTED: protein DCL, chloroplastic-like         169   1e-46   
emb|CDY00287.1|  BnaA06g21880D                                          168   1e-46   
gb|KHN18554.1|  hypothetical protein glysoja_006967                     168   2e-46   
ref|XP_003550782.1|  PREDICTED: protein DCL, chloroplastic-like         168   2e-46   
ref|XP_002468368.1|  hypothetical protein SORBIDRAFT_01g044760          169   2e-46   Sorghum bicolor [broomcorn]
gb|EMS51361.1|  hypothetical protein TRIUR3_16777                       167   2e-46   
ref|XP_009151366.1|  PREDICTED: protein DCL, chloroplastic              167   2e-46   
ref|XP_009413463.1|  PREDICTED: high mobility group nucleosome-bi...    172   2e-46   
ref|XP_009403245.1|  PREDICTED: uncharacterized protein LOC103986852    168   3e-46   
ref|XP_009401349.1|  PREDICTED: protein DCL, chloroplastic-like         167   4e-46   
ref|NP_001144806.1|  uncharacterized protein LOC100277882               168   5e-46   Zea mays [maize]
ref|XP_010458929.1|  PREDICTED: uncharacterized protein LOC104740096    167   5e-46   
gb|KEH33322.1|  DUF3223 family protein                                  167   6e-46   
ref|XP_010258340.1|  PREDICTED: uncharacterized protein LOC104598124    167   1e-45   
gb|KFK27971.1|  hypothetical protein AALP_AA8G455200                    165   2e-45   
ref|XP_010550601.1|  PREDICTED: protein DCL, chloroplastic              165   4e-45   
ref|XP_010029845.1|  PREDICTED: zinc finger CCCH domain-containin...    164   1e-44   
ref|XP_009130215.1|  PREDICTED: uncharacterized protein LOC103855007    161   4e-44   
emb|CDY67519.1|  BnaAnng24490D                                          160   7e-44   
ref|NP_001145212.1|  uncharacterized protein LOC100278469               159   2e-42   Zea mays [maize]
ref|XP_002319542.1|  hypothetical protein POPTR_0013s02340g             155   2e-41   Populus trichocarpa [western balsam poplar]
gb|KHG30734.1|  DNA-directed RNA polymerase D subunit 1 -like pro...    154   3e-41   
gb|ABF94367.1|  expressed protein                                       150   2e-40   Oryza sativa Japonica Group [Japonica rice]
gb|KHN32529.1|  Protein DCL, chloroplastic                              149   3e-40   
gb|KHN26248.1|  DNA-directed RNA polymerase E subunit 1                 149   3e-40   
emb|CBI15220.3|  unnamed protein product                                149   4e-40   
gb|KHG30737.1|  DNA-directed RNA polymerase D subunit 1 -like pro...    149   1e-39   
gb|KHN48689.1|  DNA-directed RNA polymerase E subunit 1                 145   1e-38   
ref|XP_002319012.2|  hypothetical protein POPTR_0013s02280g             145   3e-38   Populus trichocarpa [western balsam poplar]
ref|XP_008795182.1|  PREDICTED: protein DCL, chloroplastic-like         140   2e-37   
ref|XP_002977413.1|  hypothetical protein SELMODRAFT_417447             144   8e-37   
ref|XP_002974996.1|  hypothetical protein SELMODRAFT_442719             144   1e-36   
ref|XP_001753803.1|  predicted protein                                  137   2e-35   
ref|XP_001753605.1|  predicted protein                                  131   6e-33   
ref|XP_004497728.1|  PREDICTED: uncharacterized protein LOC101504695    127   8e-32   
ref|XP_004492623.1|  PREDICTED: uncharacterized protein LOC101492280    127   1e-31   
ref|XP_003609061.1|  hypothetical protein MTR_4g108450                  120   1e-28   
emb|CAN70579.1|  hypothetical protein VITISV_004014                     115   8e-28   Vitis vinifera
dbj|BAB11494.1|  unnamed protein product                                112   8e-27   Arabidopsis thaliana [mouse-ear cress]
emb|CEF98737.1|  Copper amine oxidase, N2/N3-terminal                   112   2e-25   
ref|XP_009615031.1|  PREDICTED: protein DCL, chloroplastic-like         107   6e-25   
ref|XP_002500133.1|  predicted protein                                  110   1e-24   Micromonas commoda
ref|XP_007514553.1|  predicted protein                                93.2    1e-18   
ref|XP_003057804.1|  predicted protein                                90.9    1e-18   
ref|XP_005646811.1|  hypothetical protein COCSUDRAFT_47805            91.3    2e-17   
ref|XP_001418710.1|  predicted protein                                89.0    2e-17   Ostreococcus lucimarinus CCE9901
ref|XP_002957335.1|  tRNA pseudouridine synthase mitochondrial pr...  88.6    6e-16   
ref|XP_001774741.1|  predicted protein                                76.6    3e-14   
ref|XP_003597253.1|  hypothetical protein MTR_2g094530                78.6    3e-14   
gb|KFM25263.1|  Guanine nucleotide-binding protein subunit beta-l...  81.6    1e-13   
ref|XP_005848324.1|  hypothetical protein CHLNCDRAFT_145004           73.2    1e-11   
ref|XP_004348505.1|  RNA binding motif protein                        72.8    4e-11   
emb|CDY16774.1|  BnaA09g06080D                                        64.7    7e-10   
emb|CDX87249.1|  BnaC09g05640D                                        64.3    1e-09   
ref|XP_001755235.1|  predicted protein                                68.9    2e-09   
gb|KDD73790.1|  hypothetical protein H632_c1835p1                     64.7    5e-09   
ref|WP_018827610.1|  hypothetical protein                             64.3    1e-08   
ref|XP_006382591.1|  hypothetical protein POPTR_0005s03530g           62.8    1e-08   
ref|WP_011805632.1|  hypothetical protein                             61.6    2e-08   
ref|WP_018586305.1|  hypothetical protein                             63.2    3e-08   
ref|WP_018791465.1|  hypothetical protein                             63.2    3e-08   
ref|WP_011388568.1|  hypothetical protein                             58.9    2e-07   
ref|XP_002504634.1|  predicted protein                                63.2    2e-07   Micromonas commoda
ref|WP_028184335.1|  hypothetical protein                             60.8    2e-07   
pdb|2K0M|A  Chain A, Solution Nmr Structure Of The Uncharacterize...  58.5    3e-07   
ref|WP_011388268.1|  hypothetical protein                             55.8    2e-06   
dbj|BAB11495.1|  unnamed protein product                              55.8    3e-06   Arabidopsis thaliana [mouse-ear cress]
gb|KDP38331.1|  hypothetical protein JCGZ_04256                       56.6    4e-06   
ref|XP_002459901.1|  hypothetical protein SORBIDRAFT_02g014000        56.6    4e-06   Sorghum bicolor [broomcorn]
ref|XP_007160882.1|  hypothetical protein PHAVU_001G024800g           56.2    5e-06   
tpg|DAA43777.1|  TPA: hypothetical protein ZEAMMB73_746378            55.5    6e-06   
emb|CDY60335.1|  BnaC03g72290D                                        58.2    7e-06   
ref|NP_001062578.1|  Os09g0112400                                     55.1    8e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002991942.1|  hypothetical protein SELMODRAFT_448611           57.0    8e-06   
ref|NP_001148729.1|  LOC100282345                                     55.5    8e-06   Zea mays [maize]
ref|XP_006434757.1|  hypothetical protein CICLE_v10002377mg           55.8    1e-05   
ref|WP_002714803.1|  hypothetical protein                             55.5    1e-05   
ref|XP_008351988.1|  PREDICTED: protein DCL, chloroplastic-like i...  55.1    1e-05   
ref|XP_006473317.1|  PREDICTED: protein DCL, chloroplastic-like       55.5    1e-05   
ref|XP_008803255.1|  PREDICTED: DNA-directed RNA polymerase IV su...  57.0    2e-05   
gb|EPS63154.1|  hypothetical protein M569_11634                       53.5    2e-05   
ref|XP_002989419.1|  hypothetical protein SELMODRAFT_29281            52.8    2e-05   
dbj|BAJ90438.1|  predicted protein                                    54.3    2e-05   
ref|XP_010919205.1|  PREDICTED: DNA-directed RNA polymerase IV su...  57.0    2e-05   
ref|XP_004140346.1|  PREDICTED: LOW QUALITY PROTEIN: DNA-directed...  56.6    2e-05   
gb|KHN22486.1|  DNA-directed RNA polymerase E subunit 1               53.5    2e-05   
ref|WP_036359675.1|  hypothetical protein                             55.1    2e-05   
ref|XP_004155767.1|  PREDICTED: DNA-directed RNA polymerase E sub...  56.6    2e-05   
ref|WP_038069582.1|  hypothetical protein                             52.8    2e-05   
ref|XP_008465860.1|  PREDICTED: DNA-directed RNA polymerase V sub...  56.6    2e-05   
gb|KGN51090.1|  hypothetical protein Csa_5G435050                     56.6    2e-05   
ref|XP_009133402.1|  PREDICTED: DNA-directed RNA polymerase V sub...  56.6    2e-05   
ref|XP_008351987.1|  PREDICTED: protein DCL, chloroplastic-like i...  54.3    3e-05   
ref|XP_006855235.1|  hypothetical protein AMTR_s00051p00224060        54.3    3e-05   
ref|WP_007120620.1|  MULTISPECIES: hypothetical protein               52.8    3e-05   
ref|XP_002962468.1|  hypothetical protein SELMODRAFT_404272           53.9    3e-05   
ref|WP_027516036.1|  hypothetical protein                             52.8    3e-05   
ref|XP_003603048.1|  Protein DCL                                      54.3    3e-05   
ref|XP_008348940.1|  PREDICTED: DNA-directed RNA polymerase V sub...  56.2    3e-05   
ref|WP_023752066.1|  MULTISPECIES: hypothetical protein               52.4    3e-05   
ref|XP_003550320.1|  PREDICTED: DNA-directed RNA polymerase V sub...  53.5    3e-05   
ref|WP_011084973.1|  MULTISPECIES: hypothetical protein               52.4    3e-05   
ref|WP_011975386.1|  hypothetical protein                             52.4    3e-05   
ref|XP_011074428.1|  PREDICTED: protein DCL, chloroplastic            54.3    3e-05   
ref|XP_006411250.1|  hypothetical protein EUTSA_v10016128mg           55.8    4e-05   
ref|XP_007136687.1|  hypothetical protein PHAVU_009G065400g           53.9    4e-05   
ref|WP_018646984.1|  MULTISPECIES: hypothetical protein               52.4    4e-05   
ref|NP_001148429.1|  DCL protein                                      53.5    4e-05   Zea mays [maize]
gb|EMT14856.1|  hypothetical protein F775_12212                       53.5    4e-05   
ref|XP_010479096.1|  PREDICTED: protein DCL, chloroplastic-like       53.9    4e-05   
ref|WP_023735767.1|  MULTISPECIES: hypothetical protein               52.0    4e-05   
ref|XP_010500205.1|  PREDICTED: protein DCL, chloroplastic            53.9    4e-05   
ref|XP_009360061.1|  PREDICTED: protein DCL, chloroplastic-like       53.5    4e-05   
ref|XP_007225808.1|  hypothetical protein PRUPE_ppa011355mg           53.5    4e-05   
ref|XP_006304196.1|  hypothetical protein CARUB_v10010275mg           53.5    4e-05   
ref|XP_006595984.1|  PREDICTED: DNA-directed RNA polymerase V sub...  53.1    4e-05   
ref|XP_011083836.1|  PREDICTED: protein DCL, chloroplastic-like       53.9    4e-05   
gb|AFK49399.1|  unknown                                               53.9    5e-05   
ref|WP_008891939.1|  hypothetical protein                             52.0    5e-05   
ref|NP_001031151.1|  uncharacterized protein                          53.5    5e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010943194.1|  PREDICTED: protein DCL, chloroplastic            53.1    5e-05   
ref|XP_001758330.1|  predicted protein                                52.0    5e-05   
ref|XP_010461498.1|  PREDICTED: protein DCL, chloroplastic-like       53.5    5e-05   
gb|AAB95289.1|  unknown protein                                       55.5    5e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003573687.1|  PREDICTED: protein DCL, chloroplastic-like       52.8    5e-05   
gb|KDP41687.1|  hypothetical protein JCGZ_16094                       53.1    6e-05   
gb|KHN04477.1|  Protein DCL, chloroplastic                            52.8    6e-05   
ref|XP_003063587.1|  predicted protein                                55.1    6e-05   
ref|XP_011029320.1|  PREDICTED: protein DCL, chloroplastic-like       52.8    7e-05   
ref|WP_008134936.1|  hypothetical protein                             51.2    8e-05   
gb|KDP25521.1|  hypothetical protein JCGZ_20677                       54.7    8e-05   
ref|XP_010552513.1|  PREDICTED: protein DCL, chloroplastic-like       53.1    8e-05   
ref|XP_008378000.1|  PREDICTED: protein DCL, chloroplastic-like       52.8    8e-05   
ref|NP_683398.1|  uncharacterized protein                             53.1    8e-05   Arabidopsis thaliana [mouse-ear cress]
ref|WP_008120591.1|  hypothetical protein                             51.2    8e-05   
ref|XP_010512942.1|  PREDICTED: DNA-directed RNA polymerase V sub...  54.7    8e-05   
gb|KDO53583.1|  hypothetical protein CISIN_1g0002912mg                54.7    9e-05   
gb|EMT19779.1|  hypothetical protein F775_42610                       52.0    9e-05   
ref|XP_007226523.1|  hypothetical protein PRUPE_ppa024709mg           51.6    9e-05   
ref|XP_002894020.1|  hypothetical protein ARALYDRAFT_473852           52.8    9e-05   
emb|CBI21428.3|  unnamed protein product                              51.2    1e-04   
ref|XP_004963608.1|  PREDICTED: DNA-directed RNA polymerase E sub...  52.4    1e-04   
ref|XP_006393639.1|  hypothetical protein EUTSA_v10011763mg           52.8    1e-04   
gb|ABK26866.1|  unknown                                               53.1    1e-04   Picea sitchensis
ref|XP_009361958.1|  PREDICTED: DNA-directed RNA polymerase V sub...  54.7    1e-04   
ref|NP_001048223.1|  Os02g0766000                                     51.2    1e-04   Oryza sativa Japonica Group [Japonica rice]
gb|ESY14377.1|  hypothetical protein X751_26805                       50.4    1e-04   
ref|XP_007133762.1|  hypothetical protein PHAVU_011G206900g           54.7    1e-04   
ref|XP_010412959.1|  PREDICTED: DNA-directed RNA polymerase V sub...  54.7    1e-04   
ref|XP_009107447.1|  PREDICTED: protein DCL, chloroplastic            52.4    1e-04   
emb|CDY17057.1|  BnaA08g04210D                                        52.4    1e-04   
ref|XP_002510162.1|  conserved hypothetical protein                   52.8    1e-04   Ricinus communis
dbj|BAD17127.1|  DCL protein-like                                     50.8    1e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004308588.1|  PREDICTED: DNA-directed RNA polymerase E sub...  54.3    1e-04   
gb|KFK36162.1|  hypothetical protein AALP_AA4G086100                  52.4    1e-04   
ref|XP_009354163.1|  PREDICTED: protein DCL, chloroplastic-like       52.4    1e-04   
ref|XP_006649071.1|  PREDICTED: protein DCL, chloroplastic-like       51.6    1e-04   
ref|XP_008231662.1|  PREDICTED: DNA-directed RNA polymerase V sub...  54.3    1e-04   
ref|XP_004501564.1|  PREDICTED: protein DCL, chloroplastic-like       52.4    1e-04   
ref|XP_010509007.1|  PREDICTED: LOW QUALITY PROTEIN: DNA-directed...  54.3    1e-04   
ref|XP_002879839.1|  NRPD1b                                           54.3    1e-04   
gb|AFK33859.1|  unknown                                               52.4    1e-04   
ref|XP_007218881.1|  hypothetical protein PRUPE_ppa000088mg           54.3    1e-04   
emb|CAD12248.1|  DCL protein                                          52.4    1e-04   Coffea arabica [arabica coffee]
ref|XP_003523609.1|  PREDICTED: protein DCL, chloroplastic-like       52.0    1e-04   
ref|XP_008352141.1|  PREDICTED: protein DCL, chloroplastic-like       52.0    1e-04   
gb|EMS54113.1|  Protein DCL, chloroplastic                            50.8    1e-04   
ref|XP_004511611.1|  PREDICTED: DNA-directed RNA polymerase D sub...  53.9    1e-04   
ref|XP_004511607.1|  PREDICTED: DNA-directed RNA polymerase D sub...  53.9    1e-04   
emb|CDY43215.1|  BnaC08g04880D                                        52.0    2e-04   
emb|CDP01368.1|  unnamed protein product                              52.4    2e-04   
gb|AAY89362.1|  RNA polymerase IV largest subunit                     53.9    2e-04   Arabidopsis thaliana [mouse-ear cress]
ref|NP_181532.2|  nuclear RNA polymerase D1B                          53.9    2e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002466454.1|  hypothetical protein SORBIDRAFT_01g008000        51.6    2e-04   Sorghum bicolor [broomcorn]
ref|XP_002282478.1|  PREDICTED: protein DCL, chloroplastic            52.0    2e-04   Vitis vinifera
ref|XP_009354160.1|  PREDICTED: protein DCL, chloroplastic-like       52.0    2e-04   
ref|XP_006838071.1|  hypothetical protein AMTR_s00091p00171300        50.4    2e-04   
ref|XP_008375320.1|  PREDICTED: DNA-directed RNA polymerase V sub...  53.5    2e-04   
ref|XP_008220273.1|  PREDICTED: protein DCL, chloroplastic            51.6    2e-04   
gb|AES94122.2|  DNA-directed RNA polymerase                           53.5    2e-04   
ref|XP_010094661.1|  hypothetical protein L484_008893                 52.0    2e-04   
gb|KHG04572.1|  Protein DCL, chloroplastic                            52.0    2e-04   
ref|XP_006420718.1|  hypothetical protein CICLE_v10004129mg           53.5    2e-04   
ref|XP_008452556.1|  PREDICTED: protein DCL, chloroplastic            52.0    2e-04   
ref|XP_007158453.1|  hypothetical protein PHAVU_002G153700g           53.5    2e-04   
ref|XP_008378172.1|  PREDICTED: uncharacterized protein LOC103441252  52.4    2e-04   
ref|XP_002284778.1|  PREDICTED: protein DCL, chloroplastic            51.6    2e-04   Vitis vinifera
ref|XP_007158454.1|  hypothetical protein PHAVU_002G153700g           53.5    2e-04   
ref|XP_003611164.1|  DNA-directed RNA polymerase subunit beta         53.5    2e-04   
ref|XP_006470866.1|  PREDICTED: DNA-directed RNA polymerase V sub...  53.5    2e-04   
ref|XP_002454603.1|  hypothetical protein SORBIDRAFT_04g034170        52.0    2e-04   Sorghum bicolor [broomcorn]
ref|XP_004141259.1|  PREDICTED: protein DCL, chloroplastic-like       51.6    2e-04   
ref|XP_007017220.1|  Uncharacterized protein isoform 6                51.6    2e-04   
gb|EYU36304.1|  hypothetical protein MIMGU_mgv1a013445mg              51.6    2e-04   
ref|XP_006659296.1|  PREDICTED: protein DCL, chloroplastic-like       50.8    2e-04   
gb|KHN37673.1|  DNA-directed RNA polymerase E subunit 1               53.5    2e-04   
ref|XP_008367666.1|  PREDICTED: protein DCL, chloroplastic-like       51.6    2e-04   
ref|XP_003541591.1|  PREDICTED: DNA-directed RNA polymerase V sub...  53.5    3e-04   
ref|XP_010269801.1|  PREDICTED: protein DCL, chloroplastic-like       51.6    3e-04   
ref|XP_009393664.1|  PREDICTED: protein DCL, chloroplastic isofor...  51.6    3e-04   
ref|XP_007017144.1|  Uncharacterized protein TCM_033766               51.2    3e-04   
ref|XP_008452601.1|  PREDICTED: protein DCL, chloroplastic            51.2    3e-04   
ref|XP_008378043.1|  PREDICTED: protein DCL, chloroplastic            51.2    3e-04   
gb|KHN27337.1|  DNA-directed RNA polymerase E subunit 1               53.1    3e-04   
ref|XP_006598109.1|  PREDICTED: DNA-directed RNA polymerase V sub...  53.1    3e-04   
gb|AAQ56405.1|  putative defective chloroplasts and leaves (DCL) ...  50.8    3e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009359615.1|  PREDICTED: protein DCL, chloroplastic            51.2    3e-04   
ref|XP_010263539.1|  PREDICTED: protein DCL, chloroplastic            51.6    3e-04   
ref|XP_007017215.1|  Uncharacterized protein isoform 1                51.2    3e-04   
emb|CDP01288.1|  unnamed protein product                              50.8    3e-04   
ref|XP_004141276.1|  PREDICTED: protein DCL, chloroplastic-like       50.8    3e-04   
ref|NP_001235676.1|  uncharacterized protein LOC100527410             50.8    4e-04   
gb|KGN55233.1|  hypothetical protein Csa_4G641650                     50.8    4e-04   
gb|KHG15662.1|  Protein DCL, chloroplastic                            51.2    4e-04   
ref|XP_010534197.1|  PREDICTED: DNA-directed RNA polymerase V sub...  52.8    4e-04   
gb|EAZ24730.1|  hypothetical protein OsJ_08502                        52.0    4e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011029161.1|  PREDICTED: DNA-directed RNA polymerase IV su...  52.8    4e-04   
gb|EYU38999.1|  hypothetical protein MIMGU_mgv1a000239mg              52.8    4e-04   
ref|XP_006354844.1|  PREDICTED: protein DCL, chloroplastic-like       50.4    4e-04   
ref|XP_011014513.1|  PREDICTED: DNA-directed RNA polymerase IV su...  52.8    4e-04   
gb|KCW68702.1|  hypothetical protein EUGRSUZ_F02303                   50.8    4e-04   
ref|XP_004238128.1|  PREDICTED: protein DCL, chloroplastic            50.4    4e-04   
gb|EMT07000.1|  hypothetical protein F775_07046                       50.8    4e-04   
gb|EYU25468.1|  hypothetical protein MIMGU_mgv1a014101mg              50.4    4e-04   
dbj|BAJ93491.1|  predicted protein                                    50.8    4e-04   
gb|EEE68454.1|  hypothetical protein OsJ_26844                        51.6    5e-04   
ref|XP_006434703.1|  hypothetical protein CICLE_v10002565mg           50.4    5e-04   
ref|XP_004954026.1|  PREDICTED: protein DCL, chloroplastic-like       51.2    5e-04   
ref|XP_004956292.1|  PREDICTED: protein DCL, chloroplastic-like       50.1    5e-04   
ref|XP_011029329.1|  PREDICTED: protein DCL, chloroplastic-like i...  50.8    5e-04   
ref|XP_004138301.1|  PREDICTED: malate dehydrogenase, chloroplast...  52.0    5e-04   
ref|XP_007010999.1|  DNA-directed RNA polymerase E subunit 1, put...  52.4    5e-04   
gb|KDP40529.1|  hypothetical protein JCGZ_24528                       52.4    5e-04   
gb|KHG12122.1|  Protein DCL, chloroplastic                            50.1    6e-04   
emb|CAN63470.1|  hypothetical protein VITISV_024603                   52.0    6e-04   
ref|WP_012647889.1|  hypothetical protein                             50.4    6e-04   
gb|KDO84069.1|  hypothetical protein CISIN_1g047760mg                 50.1    6e-04   
gb|KEH35753.1|  DCL protein                                           50.1    6e-04   
ref|XP_008813811.1|  PREDICTED: protein DCL, chloroplastic            50.1    6e-04   
ref|XP_006473271.1|  PREDICTED: protein DCL, chloroplastic-like       50.1    6e-04   
ref|XP_004291069.1|  PREDICTED: protein DCL, chloroplastic-like       50.1    6e-04   
ref|XP_004291102.1|  PREDICTED: protein DCL, chloroplastic-like       50.1    7e-04   
ref|XP_010514986.1|  PREDICTED: protein DCL, chloroplastic-like       50.1    7e-04   
ref|NP_001235407.1|  uncharacterized protein LOC100306718             50.1    7e-04   
gb|ABC47855.1|  defective chloroplast and leaves protein              50.1    7e-04   
ref|XP_002265533.1|  PREDICTED: DNA-directed RNA polymerase V sub...  52.0    7e-04   
emb|CDX93859.1|  BnaC04g20180D                                        51.6    8e-04   
emb|CBI40152.3|  unnamed protein product                              51.6    8e-04   
ref|XP_009150243.1|  PREDICTED: protein DCL, chloroplastic-like       49.7    8e-04   
ref|XP_002971839.1|  hypothetical protein SELMODRAFT_441655           51.6    8e-04   
emb|CDY21779.1|  BnaA06g20480D                                        49.7    8e-04   
ref|XP_011069724.1|  PREDICTED: protein DCL, chloroplastic            49.7    8e-04   
ref|XP_011020393.1|  PREDICTED: DNA-directed RNA polymerase V sub...  51.6    8e-04   
ref|XP_004511031.1|  PREDICTED: DNA-directed RNA polymerase E sub...  51.6    8e-04   
emb|CDY38070.1|  BnaC03g75090D                                        49.7    0.001   
ref|XP_002283006.1|  PREDICTED: protein DCL, chloroplastic isofor...  49.3    0.001   
ref|XP_010270909.1|  PREDICTED: protein DCL, chloroplastic            49.7    0.001   
ref|XP_010426102.1|  PREDICTED: protein DCL, chloroplastic-like       49.7    0.001   
ref|WP_019361330.1|  hypothetical protein                             48.1    0.001   



>ref|XP_009768743.1| PREDICTED: protein DCL, chloroplastic-like [Nicotiana sylvestris]
Length=235

 Score =   223 bits (567),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 127/147 (86%), Gaps = 1/147 (1%)
 Frame = -1

Query  830  SKKVRVDKSVEEQRLEILEGSQVG-EGKKDDKSGPVTLGPKSFGSSVEMFEYCYKLLHHW  654
            SKK++VDKSVEEQRLE L+GS+   + +K + SGP ++GPK+FGSSVEMF+Y YKLLH W
Sbjct  63   SKKLKVDKSVEEQRLENLDGSETAVDEEKKNGSGPASVGPKNFGSSVEMFDYFYKLLHSW  122

Query  653  APNLDINEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADD  474
            +PNL++N+YEH+VLL+L+KKGH +P +KIG GI AFQ+R HP FKSRCFF++R DGS DD
Sbjct  123  SPNLNLNKYEHLVLLDLLKKGHLEPDRKIGTGIRAFQIRFHPQFKSRCFFVIREDGSVDD  182

Query  473  FSFRKCVDRILPLPESMQIKHNANKAL  393
            FSFRKCVD ILPLPE+MQ+KH ANKAL
Sbjct  183  FSFRKCVDHILPLPENMQVKHEANKAL  209



>ref|XP_009587068.1| PREDICTED: protein DCL, chloroplastic-like [Nicotiana tomentosiformis]
Length=229

 Score =   220 bits (560),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 149/186 (80%), Gaps = 4/186 (2%)
 Frame = -1

Query  947  SEDMDIESNVAEDSGTENggakrpreeggepengdngdASKKVRVDKSVEEQRLEILEGS  768
            ++DMD+E+  A+D+  ENG +KRPREE       ++   +KK++VDKSVEEQRLE L+GS
Sbjct  27   AQDMDVEAQTADDAA-ENGSSKRPREEEKNEPENEDA--TKKLKVDKSVEEQRLENLDGS  83

Query  767  QVG-EGKKDDKSGPVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKG  591
            +   + +K + SGP ++G K+F SSVEMF+Y YKLLH W+PNL++N+YEH+VLL+L+KKG
Sbjct  84   ETAVDEEKKNGSGPASVGSKNFWSSVEMFDYFYKLLHSWSPNLNLNKYEHLVLLDLLKKG  143

Query  590  HADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVDRILPLPESMQIKH  411
            H +P +KIG GI AFQ+R HP FKSRCFF++R DGS DDFSFRKCVD ILPLPE+MQ+KH
Sbjct  144  HLEPDRKIGTGIRAFQIRFHPQFKSRCFFVIREDGSVDDFSFRKCVDHILPLPENMQVKH  203

Query  410  NANKAL  393
             ANKAL
Sbjct  204  EANKAL  209



>ref|XP_006354776.1| PREDICTED: protein DCL, chloroplastic-like [Solanum tuberosum]
Length=226

 Score =   216 bits (551),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 151/185 (82%), Gaps = 4/185 (2%)
 Frame = -1

Query  947  SEDMDIESNVAEDSGTENggakrpreeggepengdngdASKKVRVDKSVEEQRLEILEGS  768
            ++DMD+E+  A+D+  ENGG+KRPREE  E EN D    +KK++VDKSVEE+R E L+GS
Sbjct  27   AQDMDVEAQAADDT-EENGGSKRPREEENEVENEDV---TKKLKVDKSVEEERFENLDGS  82

Query  767  QVGEGKKDDKSGPVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGH  588
            +  E +K  +SGPV++GPK+FGSSVEMF+Y YKLLH W+PNL++N+YEH+VLL+L+KKGH
Sbjct  83   KTVEEEKKYESGPVSVGPKNFGSSVEMFDYFYKLLHSWSPNLNLNKYEHIVLLDLLKKGH  142

Query  587  ADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVDRILPLPESMQIKHN  408
             +P +KIG G+ AFQ+R HP FKSRCFF++R D S DDFSFRKCVD I PLPE+MQ+KH 
Sbjct  143  LEPDRKIGTGVRAFQIRFHPQFKSRCFFVIREDDSVDDFSFRKCVDHISPLPENMQVKHE  202

Query  407  ANKAL  393
            AN+ L
Sbjct  203  ANRDL  207



>ref|XP_004241584.1| PREDICTED: protein DCL, chloroplastic-like [Solanum lycopersicum]
Length=227

 Score =   212 bits (539),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 149/185 (81%), Gaps = 4/185 (2%)
 Frame = -1

Query  947  SEDMDIESNVAEDSGTENggakrpreeggepengdngdASKKVRVDKSVEEQRLEILEGS  768
            ++DMD+E+  A+D+  ENGG+KRPREE  E E  D    +KK++VDKSVEE+R E L+GS
Sbjct  28   AQDMDVEAQAADDT-EENGGSKRPREEENEVEKEDA---TKKLKVDKSVEEERFENLDGS  83

Query  767  QVGEGKKDDKSGPVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGH  588
            +  + +K D SGP+++GPK+FGSSVE+F Y YKLLH W+PNL++N+YE++VLL+L+KKGH
Sbjct  84   KTVDEEKKDVSGPISVGPKNFGSSVEVFNYFYKLLHSWSPNLNLNKYEYIVLLDLLKKGH  143

Query  587  ADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVDRILPLPESMQIKHN  408
             +P +KIG G+ AFQ+R HP +KSRCFFI+R D S DDFSFRKC+D I PLPE+MQ+KH 
Sbjct  144  LEPDRKIGTGVRAFQIRFHPQYKSRCFFIIREDDSVDDFSFRKCIDHISPLPENMQVKHE  203

Query  407  ANKAL  393
            AN+ L
Sbjct  204  ANRDL  208



>ref|XP_008239940.1| PREDICTED: protein DCL, chloroplastic [Prunus mume]
Length=226

 Score =   203 bits (517),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 108/202 (53%), Positives = 145/202 (72%), Gaps = 14/202 (7%)
 Frame = -1

Query  983  MSESAPEVAKPLSEDMDIESN---VAE--DSGTENggakrpreeggepengdngdASKKV  819
            ++E+  E A   +EDM++E++    AE  D GT        +    E  +  N   +KK 
Sbjct  9    LAETNSETAA-AAEDMELEASEPAPAEKPDEGTNGEAEANAKRLRDEEGSEGNDAVAKKT  67

Query  818  RVDKSVEEQRLEILEGSQVGEGKKDDKSGPVTLGPKSFGSSVEMFEYCYKLLHHWAPNLD  639
            +V+KS EE+RLE     ++GEGK+   SG V+LGPKSFGSSVEMF+Y YKLLH+W  +L 
Sbjct  68   KVEKSPEEERLE-----KLGEGKE---SGRVSLGPKSFGSSVEMFDYFYKLLHYWPTDLS  119

Query  638  INEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRK  459
            +N+YEH+VLL+L+KKGHA+P KKIG G+ AFQVR HP++KSRCFF++R D + DDFSFRK
Sbjct  120  VNKYEHLVLLDLLKKGHAEPDKKIGGGVHAFQVRTHPLYKSRCFFLIREDEAVDDFSFRK  179

Query  458  CVDRILPLPESMQIKHNANKAL  393
            CVD+ILPLPE+M+   +ANKAL
Sbjct  180  CVDQILPLPENMKAHSDANKAL  201



>ref|XP_007209564.1| hypothetical protein PRUPE_ppa011021mg [Prunus persica]
 gb|EMJ10763.1| hypothetical protein PRUPE_ppa011021mg [Prunus persica]
Length=226

 Score =   203 bits (516),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 107/202 (53%), Positives = 145/202 (72%), Gaps = 14/202 (7%)
 Frame = -1

Query  983  MSESAPEVAKPLSEDMDIESN---VAE--DSGTENggakrpreeggepengdngdASKKV  819
            ++E+  E A   +EDM++E++    AE  D GT        +    E  +  N   +KK 
Sbjct  9    LAETNSETAA-AAEDMELEASEPAPAEKPDEGTNGEAEANAKRLRDEEGSEGNDAVAKKT  67

Query  818  RVDKSVEEQRLEILEGSQVGEGKKDDKSGPVTLGPKSFGSSVEMFEYCYKLLHHWAPNLD  639
            +V+KS EE+RLE     ++GEGK+   SG V+LGPKSFGSSVEMF+Y Y+LLH+W  +L 
Sbjct  68   KVEKSPEEERLE-----KLGEGKE---SGRVSLGPKSFGSSVEMFDYFYRLLHYWPTDLS  119

Query  638  INEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRK  459
            +N+YEH+VLL+L+KKGHA+P KKIG G+ AFQVR HP++KSRCFF++R D + DDFSFRK
Sbjct  120  VNKYEHLVLLDLLKKGHAEPDKKIGGGVQAFQVRTHPLYKSRCFFLIREDETVDDFSFRK  179

Query  458  CVDRILPLPESMQIKHNANKAL  393
            CVD+ILPLPE+M+   +ANKAL
Sbjct  180  CVDQILPLPENMKAHSDANKAL  201



>ref|XP_007138179.1| hypothetical protein PHAVU_009G187000g [Phaseolus vulgaris]
 gb|ESW10173.1| hypothetical protein PHAVU_009G187000g [Phaseolus vulgaris]
Length=248

 Score =   199 bits (507),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 113/210 (54%), Positives = 141/210 (67%), Gaps = 21/210 (10%)
 Frame = -1

Query  974  SAPEVAKP---LSEDMDIESNVAEDSGTENggakrpreeggepengdngdASKKVRVD--  810
            +APEVA P    + DMD+E  VA+D+GT++   +   +E   P++      SKK +VD  
Sbjct  5    AAPEVADPNTVAAVDMDVEKVVADDNGTDSNQKRAREDEEPLPDDV-----SKKQKVDEE  59

Query  809  KSVEEQRLEILEGSQVGEG-----------KKDDKSGPVTLGPKSFGSSVEMFEYCYKLL  663
            KSVEEQRLE   G +  E            +K+D S  V LGPKSFGSS EMF Y Y  L
Sbjct  60   KSVEEQRLEKSNGQEEKEKEAEEDKNAEAEEKEDASVSVKLGPKSFGSSSEMFHYFYNFL  119

Query  662  HHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGS  483
            H+W   L++N+YEH +LLEL+K GHA+P KKIG G+ AFQVR HP +KSRCFF++R D S
Sbjct  120  HNWPQYLNVNKYEHAMLLELLKNGHAEPDKKIGGGVRAFQVRKHPTYKSRCFFLIREDDS  179

Query  482  ADDFSFRKCVDRILPLPESMQIKHNANKAL  393
            ADDFSFRKCVD ILPLPE M +K +ANKAL
Sbjct  180  ADDFSFRKCVDHILPLPEDMHLKSDANKAL  209



>ref|XP_004299358.1| PREDICTED: uncharacterized protein LOC101304576 [Fragaria vesca 
subsp. vesca]
Length=218

 Score =   197 bits (502),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 140/190 (74%), Gaps = 10/190 (5%)
 Frame = -1

Query  953  PLSEDMDIESNVAE--DSGTENggakrpreeggepengdngdASKKVRVD-KSVEEQRLE  783
            P +EDMD+E+  A+  D         +   E  E E      A+KK +V+ KS EEQRLE
Sbjct  14   PAAEDMDLETAPAQNIDEAQNGDATAKRAREEEEAEESGGDGAAKKAKVEEKSAEEQRLE  73

Query  782  ILEGSQVGEGKKDDKSGPVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLEL  603
                 ++GEG  ++ +G V+LGPKSFGS+VEMF+Y YKLLH+W  +L+IN+YE++VLL+L
Sbjct  74   -----KLGEG--ENGAGRVSLGPKSFGSAVEMFDYFYKLLHYWPTDLNINKYEYLVLLDL  126

Query  602  IKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVDRILPLPESM  423
            +KKGH++P KKIG GI AFQVR HP+++SRC+F+VR DG++DDFSFRKCVD ILPLPE+M
Sbjct  127  LKKGHSEPDKKIGGGIQAFQVRFHPLYRSRCYFLVREDGASDDFSFRKCVDHILPLPENM  186

Query  422  QIKHNANKAL  393
            +   +ANKAL
Sbjct  187  KAHGDANKAL  196



>ref|XP_009339285.1| PREDICTED: protein DCL, chloroplastic-like [Pyrus x bretschneideri]
Length=225

 Score =   197 bits (502),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 119/146 (82%), Gaps = 7/146 (5%)
 Frame = -1

Query  830  SKKVRVDKSVEEQRLEILEGSQVGEGKKDDKSGPVTLGPKSFGSSVEMFEYCYKLLHHWA  651
            +KK +VDKS EE+RLE     ++GEG   +KSG V LGPKSFGSSVEMF+Y YK LH+W 
Sbjct  61   AKKTKVDKSPEEERLE----EKLGEG---EKSGRVGLGPKSFGSSVEMFDYFYKFLHYWP  113

Query  650  PNLDINEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDF  471
             +L++N+YE++VLL+L+KKGHA+P KKIG G+ AFQVR HP++KSRCFF++R D   DDF
Sbjct  114  TDLNVNKYEYLVLLDLLKKGHAEPDKKIGGGVKAFQVRTHPLYKSRCFFLIREDEVVDDF  173

Query  470  SFRKCVDRILPLPESMQIKHNANKAL  393
            SFRKCVD+ILPLPE+M+   +ANKAL
Sbjct  174  SFRKCVDQILPLPENMKANADANKAL  199



>ref|XP_008351848.1| PREDICTED: protein DCL, chloroplastic-like [Malus domestica]
Length=230

 Score =   196 bits (497),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 119/146 (82%), Gaps = 7/146 (5%)
 Frame = -1

Query  830  SKKVRVDKSVEEQRLEILEGSQVGEGKKDDKSGPVTLGPKSFGSSVEMFEYCYKLLHHWA  651
            +KK +V+KS EE+RLE     ++GEG   + SG V+LGPKSFGSSVEMF+Y YK LH+W 
Sbjct  64   AKKTKVEKSPEEERLE----EKLGEG---ENSGRVSLGPKSFGSSVEMFDYFYKFLHYWP  116

Query  650  PNLDINEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDF  471
             +L++N+YEH+VLL+L+KKGHA+P KKIG G+ AFQVR HP++KSRCFF++R D   DDF
Sbjct  117  TDLNVNKYEHLVLLDLLKKGHAEPDKKIGGGVKAFQVRIHPLYKSRCFFLIREDEVVDDF  176

Query  470  SFRKCVDRILPLPESMQIKHNANKAL  393
            SFRKCVD+ILPLPE+M+   +ANKAL
Sbjct  177  SFRKCVDQILPLPENMKANADANKAL  202



>ref|XP_010257491.1| PREDICTED: protein DCL, chloroplastic-like [Nelumbo nucifera]
Length=265

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 122/160 (76%), Gaps = 14/160 (9%)
 Frame = -1

Query  830  SKKVRVDKSVEEQRLEILEGSQVGEGKKDD--------------KSGPVTLGPKSFGSSV  693
            SKK +++KSVEE+RLE L+ S+  +  K+D              K  PV+LGPK F SS 
Sbjct  79   SKKQKIEKSVEEERLEKLQQSEEDDEVKEDGKEKDEEQEKEEEKKEDPVSLGPKKFSSSE  138

Query  692  EMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSR  513
            +MF Y YKLLH+W PN+++NEYEHMVLL+L+KKGHA+ +KK+G G+GAFQVR HP++KSR
Sbjct  139  DMFNYFYKLLHYWPPNINVNEYEHMVLLDLLKKGHAEAEKKLGGGVGAFQVRYHPMWKSR  198

Query  512  CFFIVRVDGSADDFSFRKCVDRILPLPESMQIKHNANKAL  393
            CFF++R D S DDFSFRKCVD ILPLPE+M++K + NKAL
Sbjct  199  CFFLIRHDESVDDFSFRKCVDHILPLPENMKVKSDVNKAL  238



>ref|XP_008393164.1| PREDICTED: protein DCL, chloroplastic-like [Malus domestica]
Length=230

 Score =   195 bits (496),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 119/146 (82%), Gaps = 7/146 (5%)
 Frame = -1

Query  830  SKKVRVDKSVEEQRLEILEGSQVGEGKKDDKSGPVTLGPKSFGSSVEMFEYCYKLLHHWA  651
            +KK +V+KS EE+RLE     ++GEG   + SG V+LGPKSFGSSVEMF+Y YK LH+W 
Sbjct  64   AKKTKVEKSPEEERLE----EKLGEG---ENSGRVSLGPKSFGSSVEMFDYFYKFLHYWP  116

Query  650  PNLDINEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDF  471
             +L++N+YEH+VLL+L+KKGHA+P KKIG G+ AFQVR HP++KSRCFF++R D   DDF
Sbjct  117  TDLNVNKYEHLVLLDLLKKGHAEPDKKIGGGVKAFQVRIHPLYKSRCFFLIREDEVVDDF  176

Query  470  SFRKCVDRILPLPESMQIKHNANKAL  393
            SFRKCVD+ILPLPE+M+   +ANKAL
Sbjct  177  SFRKCVDQILPLPENMKANADANKAL  202



>ref|XP_006477458.1| PREDICTED: protein DCL, chloroplastic-like [Citrus sinensis]
Length=223

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 112/200 (56%), Positives = 137/200 (69%), Gaps = 21/200 (11%)
 Frame = -1

Query  971  APEVAKPLSE------DMDIESNVAEDSGTENggakrpreeggepengdngdASKKVRVD  810
            A E AK L+E      DMD+E    E+ G  N    R  ++GGE         SKK ++D
Sbjct  2    AEEAAKELTESNAAAEDMDLEG--GENGGDANAKRARDDDDGGEGNGDV----SKKQKID  55

Query  809  -KSVEEQRLEILEGSQVGEGKKDDKSGPVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDIN  633
             KSVEE+RLE     +V  G     SG V LGPK FGSS+EMF+Y YK LH W PNL++N
Sbjct  56   EKSVEEERLE---KKEVVNG-----SGRVKLGPKEFGSSIEMFDYFYKFLHFWPPNLNVN  107

Query  632  EYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCV  453
            +YEHMVLL+L+KKGH +P KKIG GI AFQVR HP +KSRCFF++R D +ADDFSFRKCV
Sbjct  108  KYEHMVLLDLLKKGHPEPDKKIGGGIQAFQVRYHPTYKSRCFFLIREDETADDFSFRKCV  167

Query  452  DRILPLPESMQIKHNANKAL  393
            D +LPLPE M++K +ANKAL
Sbjct  168  DHMLPLPEDMKVKSDANKAL  187



>ref|XP_006440602.1| hypothetical protein CICLE_v10022133mg [Citrus clementina]
 gb|ESR53842.1| hypothetical protein CICLE_v10022133mg [Citrus clementina]
 gb|KDO55563.1| hypothetical protein CISIN_1g027552mg [Citrus sinensis]
Length=222

 Score =   194 bits (493),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 112/202 (55%), Positives = 137/202 (68%), Gaps = 23/202 (11%)
 Frame = -1

Query  971  APEVAKPLSE------DMDIESNVAEDSGTENggakrpreeggepengdngdASKKVRVD  810
            A E AK L+E      DMD+E    E+ G  N    R  ++GGE         SKK ++D
Sbjct  2    AEEAAKELTESNAAAEDMDLEG--GENGGDANAKRARDDDDGGEGNGDV----SKKQKID  55

Query  809  ---KSVEEQRLEILEGSQVGEGKKDDKSGPVTLGPKSFGSSVEMFEYCYKLLHHWAPNLD  639
               KSVEE+RLE     +V  G     SG V LGPK FGSS+EMF+Y YK LH W PNL+
Sbjct  56   EDEKSVEEERLE---KKEVVNG-----SGRVKLGPKEFGSSIEMFDYFYKFLHFWPPNLN  107

Query  638  INEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRK  459
            +N+YEHMVLL+L+KKGH +P KKIG GI AFQVR HP +KSRCFF++R D +ADDFSFRK
Sbjct  108  VNKYEHMVLLDLLKKGHPEPDKKIGGGIQAFQVRYHPTYKSRCFFLIREDETADDFSFRK  167

Query  458  CVDRILPLPESMQIKHNANKAL  393
            CVD +LPLPE M++K +ANKAL
Sbjct  168  CVDHMLPLPEDMKVKSDANKAL  189



>ref|XP_002284935.1| PREDICTED: uncharacterized protein LOC100255290 [Vitis vinifera]
Length=235

 Score =   194 bits (494),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 114/146 (78%), Gaps = 7/146 (5%)
 Frame = -1

Query  830  SKKVRVDKSVEEQRLEILEGSQVGEGKKDDKSGPVTLGPKSFGSSVEMFEYCYKLLHHWA  651
            +KK +V+KSVEE+RLE LE   V       ++G  +LGPK+FGSSVEMF++ +K LH+W 
Sbjct  68   TKKQKVEKSVEEERLEKLEAEVV-------ETGRFSLGPKTFGSSVEMFDHFFKFLHYWP  120

Query  650  PNLDINEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDF  471
             NLD+N+YEHM+LL+L+KKGH +P KKIG GI AFQVR HP+FKSRCFF++R D S DDF
Sbjct  121  ANLDVNKYEHMMLLDLLKKGHTEPDKKIGGGIHAFQVRYHPVFKSRCFFVIRDDESVDDF  180

Query  470  SFRKCVDRILPLPESMQIKHNANKAL  393
            SFRKCVD I PLPE+M+ K   NKAL
Sbjct  181  SFRKCVDHISPLPENMKAKSEVNKAL  206



>emb|CDP12303.1| unnamed protein product [Coffea canephora]
Length=246

 Score =   194 bits (494),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 111/151 (74%), Gaps = 11/151 (7%)
 Frame = -1

Query  812  DKSVEEQRLEILEGSQVGEGKKDD-----------KSGPVTLGPKSFGSSVEMFEYCYKL  666
            DKSVEE+RLE    ++     + +           KSGPV LGPKSF SSVEMF+Y YK 
Sbjct  68   DKSVEEERLEKTADAEPKSCSEPEPEPKSGSTPELKSGPVELGPKSFESSVEMFDYFYKF  127

Query  665  LHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDG  486
            LH W PN+++N+YEH++LLELIKKGH +P KKIG GI AFQVR HP FKSRCFF+ R D 
Sbjct  128  LHFWTPNVNVNKYEHVMLLELIKKGHLEPDKKIGNGIRAFQVRYHPKFKSRCFFLTREDD  187

Query  485  SADDFSFRKCVDRILPLPESMQIKHNANKAL  393
            S DDFSFRKCVD ILPLPE+MQ+KH+ NK L
Sbjct  188  SVDDFSFRKCVDHILPLPENMQVKHDVNKVL  218



>ref|XP_008453205.1| PREDICTED: protein DCL, chloroplastic [Cucumis melo]
Length=232

 Score =   192 bits (488),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 141/200 (71%), Gaps = 12/200 (6%)
 Frame = -1

Query  968  PEVAKPLSEDMDIESNVAEDSGTENggakrpreeggepengdngdAS--------KKVRV  813
            PEV    +EDM++E+ V + S   +   +      G+  +    + S        KK ++
Sbjct  11   PEVTNSGTEDMELETTVPKGSSDASEATEAAPVINGDANSKREREESADDGVGDGKKQKI  70

Query  812  DKSVEEQRLEILEGSQVGEGKKDDKSGPVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDIN  633
            +KSVEE+R+E L G    +GK +++  PV+LGPKSF SSVE+F+Y YK+LH+W  NL++N
Sbjct  71   EKSVEEERVEKLGG----DGKCEEEPVPVSLGPKSFRSSVELFDYFYKILHNWPINLNVN  126

Query  632  EYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCV  453
            +YE MVL++L+KKGH +P+KKIG GI AFQ+R HP++KS+CFF++R D SADDFSFRKCV
Sbjct  127  QYEQMVLVDLLKKGHLEPEKKIGCGIQAFQIRFHPVWKSKCFFLIREDESADDFSFRKCV  186

Query  452  DRILPLPESMQIKHNANKAL  393
            D ILPLPE+ + K +AN+AL
Sbjct  187  DHILPLPENFKAKSDANRAL  206



>gb|EYU24371.1| hypothetical protein MIMGU_mgv1a013650mg [Erythranthe guttata]
Length=214

 Score =   191 bits (485),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -1

Query  824  KVRVDKSVEEQRLEILEGSQVGEGKKDDKSGPVTLGPKSFGSSVEMFEYCYKLLHHWAPN  645
            K+  +KS EE+RLE   G      ++ +  G  T+GPK+FGSSVEMF+Y YKLLH W PN
Sbjct  53   KIEDEKSSEERRLESSGGGDDKMVEEKESGGAATIGPKTFGSSVEMFDYFYKLLHAWTPN  112

Query  644  LDINEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDFSF  465
            L+IN+YEHM++LEL+KKGH +  +KIG+GI AFQVR HP F SRCFF+ R D + DDFSF
Sbjct  113  LNINKYEHMMVLELLKKGHLEADRKIGKGIKAFQVRFHPKFHSRCFFLTREDDTTDDFSF  172

Query  464  RKCVDRILPLPESMQIKHNANKAL  393
            RKCVD+ILPLPE+MQ+K++ NKAL
Sbjct  173  RKCVDQILPLPENMQVKNDVNKAL  196



>ref|XP_002514753.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47859.1| conserved hypothetical protein [Ricinus communis]
Length=224

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 120/143 (84%), Gaps = 2/143 (1%)
 Frame = -1

Query  830  SKKVRVDKSVEEQRLEILEGSQVGEGKKDDKSGPVTLGPKSFGSSVEMFEYCYKLLHHWA  651
            SKK +VDKSVEE+RLE LE  +  E K+  +S PV+LGPKSFGSSVEMF+Y Y LLH+W 
Sbjct  51   SKKQKVDKSVEEERLEKLEEGEGEEDKE--ESVPVSLGPKSFGSSVEMFDYFYNLLHYWP  108

Query  650  PNLDINEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDF  471
            PNL +N+YEHMVLLEL+KKGH+DP+KKIG GI AFQVR HP++KSRCFF++R D + DDF
Sbjct  109  PNLTVNKYEHMVLLELLKKGHSDPEKKIGGGIQAFQVRYHPMWKSRCFFLIRDDDTMDDF  168

Query  470  SFRKCVDRILPLPESMQIKHNAN  402
            SFRKCVD+ILPLPE M+IK + N
Sbjct  169  SFRKCVDKILPLPEDMKIKSDGN  191



>ref|XP_006364595.1| PREDICTED: protein DCL, chloroplastic-like [Solanum tuberosum]
Length=205

 Score =   188 bits (478),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 112/143 (78%), Gaps = 14/143 (10%)
 Frame = -1

Query  830  SKKVRVDKSVEEQRLEILEGSQVGEGKKDDKSGPVTLGPKSFGSSVEMFEYCYKLLHHWA  651
            +KK RVD+SVEE+              K D S PV++G KSF SSVEMF+Y YKLLH W+
Sbjct  58   TKKPRVDQSVEEE--------------KKDVSVPVSVGSKSFVSSVEMFDYFYKLLHSWS  103

Query  650  PNLDINEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDF  471
             NL++N+YEHMVLL+L+KKGH++P++KIG G+GAFQ+R HP FKSRCFF+VR D + DDF
Sbjct  104  VNLNLNKYEHMVLLDLLKKGHSEPERKIGTGVGAFQIRFHPHFKSRCFFVVREDDTVDDF  163

Query  470  SFRKCVDRILPLPESMQIKHNAN  402
            SFRKCVD+I PLPE+MQ KH+AN
Sbjct  164  SFRKCVDQIQPLPENMQTKHHAN  186



>ref|XP_007037355.1| Uncharacterized protein TCM_014003 [Theobroma cacao]
 gb|EOY21856.1| Uncharacterized protein TCM_014003 [Theobroma cacao]
Length=225

 Score =   189 bits (479),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/146 (60%), Positives = 114/146 (78%), Gaps = 8/146 (5%)
 Frame = -1

Query  830  SKKVRVDKSVEEQRLEILEGSQVGEGKKDDKSGPVTLGPKSFGSSVEMFEYCYKLLHHWA  651
            SKK +V+KSVEE+R+E        +  +  +S P  LGPK FGSS+EMF+Y Y LLH+W 
Sbjct  63   SKKQKVEKSVEEERME--------KESRSSESCPAHLGPKEFGSSMEMFDYFYNLLHYWP  114

Query  650  PNLDINEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDF  471
              L++N+YEHMVLL+L+KKGH +P KKIG GI AFQ+RNHP++KS+CFF++R D + DDF
Sbjct  115  TQLNLNKYEHMVLLDLLKKGHLEPGKKIGSGIRAFQIRNHPMWKSKCFFVIRDDETIDDF  174

Query  470  SFRKCVDRILPLPESMQIKHNANKAL  393
            SFRKCVD ILPLPE M+IK +AN+AL
Sbjct  175  SFRKCVDHILPLPEEMKIKLDANRAL  200



>ref|XP_004499475.1| PREDICTED: protein DCL, chloroplastic-like [Cicer arietinum]
Length=228

 Score =   188 bits (478),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 113/147 (77%), Gaps = 4/147 (3%)
 Frame = -1

Query  827  KKVRVD--KSVEEQRLEILEGSQ--VGEGKKDDKSGPVTLGPKSFGSSVEMFEYCYKLLH  660
            KK++VD  KSVEEQRLE LE  Q    E ++ + SG + LGPK F SS+EMF Y +  LH
Sbjct  48   KKIKVDEEKSVEEQRLEKLEKQQDKTVEEEEKEPSGAINLGPKHFCSSLEMFHYFHNFLH  107

Query  659  HWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSA  480
             W  NL++N+YEHM+LLEL+K GHA+P +KIG GI AFQVR+HP FKSRC+F++R D S 
Sbjct  108  AWPQNLNVNKYEHMMLLELLKNGHAEPDRKIGGGICAFQVRDHPHFKSRCYFLIREDDSV  167

Query  479  DDFSFRKCVDRILPLPESMQIKHNANK  399
            DDFSFRKCVD ILPLPE MQ+K+ ANK
Sbjct  168  DDFSFRKCVDHILPLPEEMQLKNEANK  194



>ref|XP_011036794.1| PREDICTED: protein DCL, chloroplastic-like isoform X3 [Populus 
euphratica]
 ref|XP_011036795.1| PREDICTED: protein DCL, chloroplastic-like isoform X4 [Populus 
euphratica]
Length=228

 Score =   188 bits (478),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 115/142 (81%), Gaps = 3/142 (2%)
 Frame = -1

Query  830  SKKVRVDKSVEEQRLEILEGSQVGEGKKDD---KSGPVTLGPKSFGSSVEMFEYCYKLLH  660
            +KK +VDKSVEE+RLE LEG   GEG++      SGPV+LGPKSF S+VEMF+Y Y LLH
Sbjct  50   AKKQKVDKSVEEERLEKLEGEGTGEGEEKKEKENSGPVSLGPKSFASAVEMFDYFYNLLH  109

Query  659  HWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSA  480
            +W PNL++N+YE MVLLEL+K+GH +P KKIG GI  FQVR HP+FKSRCFF++R D S 
Sbjct  110  YWPPNLNVNKYEQMVLLELLKRGHTEPDKKIGGGIQTFQVRFHPMFKSRCFFLIRDDESV  169

Query  479  DDFSFRKCVDRILPLPESMQIK  414
            DDFSFRKCVD ILPLPE M+IK
Sbjct  170  DDFSFRKCVDHILPLPEDMKIK  191



>ref|XP_004154974.1| PREDICTED: uncharacterized protein LOC101228008 [Cucumis sativus]
 gb|KGN63669.1| hypothetical protein Csa_1G009730 [Cucumis sativus]
Length=232

 Score =   188 bits (478),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 138/200 (69%), Gaps = 12/200 (6%)
 Frame = -1

Query  968  PEVAKPLSEDMDIESN---VAEDSGTENgga-----krpreeggepengdngdASKKVRV  813
            PEV    +EDM++E+     + D+   N  A         +   E    D     KK ++
Sbjct  11   PEVTNSGTEDMELETTEPKASTDASEANEAAPVINGDATSKREREESADDGVADGKKQKI  70

Query  812  DKSVEEQRLEILEGSQVGEGKKDDKSGPVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDIN  633
            +KSVEE+RLE L     G+GK +++  PV+LGPKSF SSVE+F+Y YK+LHHW  NL++N
Sbjct  71   EKSVEEERLEKL----GGDGKCEEEPVPVSLGPKSFRSSVELFDYFYKILHHWPVNLNVN  126

Query  632  EYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCV  453
            +YE MVL++L+KKGH +P+KKIG GI +FQ+R HP +KS+CFF++R D SADDFSFRKCV
Sbjct  127  QYEQMVLVDLLKKGHLEPEKKIGCGIHSFQIRFHPEWKSKCFFLIREDESADDFSFRKCV  186

Query  452  DRILPLPESMQIKHNANKAL  393
            D ILPLPE+ + K +AN+AL
Sbjct  187  DHILPLPENFKGKFDANRAL  206



>ref|XP_009614786.1| PREDICTED: protein DCL, chloroplastic-like [Nicotiana tomentosiformis]
Length=215

 Score =   186 bits (471),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 108/143 (76%), Gaps = 14/143 (10%)
 Frame = -1

Query  830  SKKVRVDKSVEEQRLEILEGSQVGEGKKDDKSGPVTLGPKSFGSSVEMFEYCYKLLHHWA  651
            +KK +VD  VEE              KK D S PVT+GPKSFGSSVEMF+Y YKLLH W 
Sbjct  61   TKKPKVDNFVEE--------------KKKDGSDPVTVGPKSFGSSVEMFDYFYKLLHSWT  106

Query  650  PNLDINEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDF  471
             NL++N+YE +VLL+L+KKGH++P+KKIG G+ AFQ+R HP FKSRCFF+VR D S DDF
Sbjct  107  LNLNLNKYEQVVLLDLLKKGHSEPEKKIGTGVRAFQIRFHPQFKSRCFFVVREDDSVDDF  166

Query  470  SFRKCVDRILPLPESMQIKHNAN  402
            SFRKCVD+I PLP +MQ+KH AN
Sbjct  167  SFRKCVDQIQPLPANMQVKHYAN  189



>gb|KDP31255.1| hypothetical protein JCGZ_11631 [Jatropha curcas]
Length=235

 Score =   186 bits (472),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 116/148 (78%), Gaps = 8/148 (5%)
 Frame = -1

Query  827  KKVRVDKSVEEQRLEILEGSQVGEGKKDDKS--------GPVTLGPKSFGSSVEMFEYCY  672
            KK +VDKSVEE+RLE +EG    EG + ++         GPV+LGPK+FGSSVEMF+Y Y
Sbjct  55   KKQKVDKSVEEERLEKVEGEGEEEGNEGEEEGEEAKQELGPVSLGPKTFGSSVEMFDYFY  114

Query  671  KLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRV  492
              LH W PNL++N+YE MVLL+L+KKGH +P+KKIG GI AFQVR HP++KSRC F++R 
Sbjct  115  NFLHFWPPNLNVNKYEQMVLLDLLKKGHTEPEKKIGVGIRAFQVRYHPMWKSRCLFLIRD  174

Query  491  DGSADDFSFRKCVDRILPLPESMQIKHN  408
            + + DDFSFRKCVD+ILPLPE M+IKH+
Sbjct  175  NDTVDDFSFRKCVDKILPLPEDMKIKHD  202



>ref|XP_009778685.1| PREDICTED: protein DCL, chloroplastic-like isoform X2 [Nicotiana 
sylvestris]
Length=216

 Score =   185 bits (470),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 109/143 (76%), Gaps = 14/143 (10%)
 Frame = -1

Query  830  SKKVRVDKSVEEQRLEILEGSQVGEGKKDDKSGPVTLGPKSFGSSVEMFEYCYKLLHHWA  651
            +KK +V+ SV+E+              K D S PV++G KSFGSSVEMF+Y YKLLH W 
Sbjct  61   TKKPKVENSVQEE--------------KKDGSDPVSVGSKSFGSSVEMFDYFYKLLHSWT  106

Query  650  PNLDINEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDF  471
             NLD+N+YEHM+LL+L+KKGH++P+KKIG G+ +FQ+R HP FKSRCFF+VR D S DDF
Sbjct  107  LNLDLNKYEHMLLLDLLKKGHSEPEKKIGTGVRSFQIRFHPQFKSRCFFVVREDDSVDDF  166

Query  470  SFRKCVDRILPLPESMQIKHNAN  402
            SFRKCVD+I PLP +MQ+KH AN
Sbjct  167  SFRKCVDQIQPLPANMQVKHYAN  189



>ref|XP_009778678.1| PREDICTED: protein DCL, chloroplastic-like isoform X1 [Nicotiana 
sylvestris]
Length=234

 Score =   185 bits (469),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 109/143 (76%), Gaps = 14/143 (10%)
 Frame = -1

Query  830  SKKVRVDKSVEEQRLEILEGSQVGEGKKDDKSGPVTLGPKSFGSSVEMFEYCYKLLHHWA  651
            +KK +V+ SV+E+              K D S PV++G KSFGSSVEMF+Y YKLLH W 
Sbjct  79   TKKPKVENSVQEE--------------KKDGSDPVSVGSKSFGSSVEMFDYFYKLLHSWT  124

Query  650  PNLDINEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDF  471
             NLD+N+YEHM+LL+L+KKGH++P+KKIG G+ +FQ+R HP FKSRCFF+VR D S DDF
Sbjct  125  LNLDLNKYEHMLLLDLLKKGHSEPEKKIGTGVRSFQIRFHPQFKSRCFFVVREDDSVDDF  184

Query  470  SFRKCVDRILPLPESMQIKHNAN  402
            SFRKCVD+I PLP +MQ+KH AN
Sbjct  185  SFRKCVDQIQPLPANMQVKHYAN  207



>gb|EPS64007.1| hypothetical protein M569_10774 [Genlisea aurea]
Length=198

 Score =   181 bits (460),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -1

Query  731  PVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIG  552
            PV++GPK+F SSV MF+Y YKLLH W P +D+N+YEHM+LLEL+KKGH++P KKIG G+ 
Sbjct  66   PVSVGPKTFTSSVAMFDYFYKLLHTWPPKVDLNKYEHMMLLELVKKGHSEPDKKIGSGVK  125

Query  551  AFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVDRILPLPESMQIKHNANKALR  390
             FQVR HP +KSRCFF+VR D SADDFSFRKCVDR++PLPE+MQ++ +AN+AL+
Sbjct  126  VFQVRFHPQYKSRCFFLVREDESADDFSFRKCVDRLIPLPENMQVQQDANRALQ  179



>ref|XP_008374549.1| PREDICTED: protein DCL, chloroplastic-like [Malus domestica]
Length=228

 Score =   181 bits (459),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = -1

Query  743  DKSGPVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIG  564
            +KSGPV+LGPKSFGSSVEMF+Y YK LH+W  +L++N+YE++VLL+L+KKGHA+P KKIG
Sbjct  85   EKSGPVSLGPKSFGSSVEMFDYFYKFLHYWPTDLNVNKYEYLVLLDLLKKGHAEPDKKIG  144

Query  563  QGIGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVDRILPLPESMQIKHNANKAL  393
             G+ AFQVR HP++KSRCFF++R D   DDFSFRKCVD ILPLPE+M+    ANK L
Sbjct  145  GGVQAFQVRIHPLYKSRCFFLIREDEVVDDFSFRKCVDHILPLPENMKANAEANKVL  201



>ref|XP_003523019.1| PREDICTED: zinc finger CCCH domain-containing protein 4-like 
[Glycine max]
Length=252

 Score =   181 bits (460),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 114/160 (71%), Gaps = 14/160 (9%)
 Frame = -1

Query  830  SKKVRVD----KSVEEQRLEILEGSQVGEGKKDDK----------SGPVTLGPKSFGSSV  693
            SKK RVD    KSVEEQRLE  +  +  +G++ +           SG V LG KSFGSS+
Sbjct  56   SKKQRVDEENEKSVEEQRLEKRDEQEEEKGEEKEAEKEEEEEKEASGSVNLGFKSFGSSL  115

Query  692  EMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSR  513
            EMF Y Y  LH W   L++N+YEH++LLEL+K GHA+P KKIG G+ AFQVR HP FKSR
Sbjct  116  EMFHYFYNFLHTWPQYLNVNKYEHLMLLELLKNGHAEPDKKIGGGVRAFQVRKHPTFKSR  175

Query  512  CFFIVRVDGSADDFSFRKCVDRILPLPESMQIKHNANKAL  393
            CFF++R D SADDFSFRKCVD ILPLPE M +K +ANKAL
Sbjct  176  CFFLIREDDSADDFSFRKCVDHILPLPEEMHLKSDANKAL  215



>ref|XP_011071644.1| PREDICTED: protein DCL, chloroplastic [Sesamum indicum]
Length=182

 Score =   179 bits (453),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = -1

Query  734  GPVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGI  555
            G  T+GPK+FGSSVEMF+Y YK+LH W  NLD+N+YEH +LLEL+KKGH +  +KIG+G+
Sbjct  51   GRATVGPKTFGSSVEMFDYFYKILHSWPTNLDLNKYEHTMLLELLKKGHLEADRKIGKGV  110

Query  554  GAFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVDRILPLPESMQIKHNANKAL  393
             AFQ+R HP FKSRCFF++R D S DDFSFRKC+D ILPLPE+MQIKH+ NKA 
Sbjct  111  KAFQIRFHPQFKSRCFFLIREDNSVDDFSFRKCIDHILPLPENMQIKHDVNKAF  164



>ref|XP_011036792.1| PREDICTED: protein DCL, chloroplastic-like isoform X1 [Populus 
euphratica]
 ref|XP_011036793.1| PREDICTED: protein DCL, chloroplastic-like isoform X2 [Populus 
euphratica]
Length=248

 Score =   181 bits (458),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 96/162 (59%), Positives = 115/162 (71%), Gaps = 23/162 (14%)
 Frame = -1

Query  830  SKKVRVDKSVEEQRLEILEGSQVGEGKKDD-----------------------KSGPVTL  720
            +KK +VDKSVEE+RLE LEG   GEG++                          SGPV+L
Sbjct  50   AKKQKVDKSVEEERLEKLEGEGTGEGEEKKEEEQPEKLEGEGTGEGEEKKEKENSGPVSL  109

Query  719  GPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIGAFQV  540
            GPKSF S+VEMF+Y Y LLH+W PNL++N+YE MVLLEL+K+GH +P KKIG GI  FQV
Sbjct  110  GPKSFASAVEMFDYFYNLLHYWPPNLNVNKYEQMVLLELLKRGHTEPDKKIGGGIQTFQV  169

Query  539  RNHPIFKSRCFFIVRVDGSADDFSFRKCVDRILPLPESMQIK  414
            R HP+FKSRCFF++R D S DDFSFRKCVD ILPLPE M+IK
Sbjct  170  RFHPMFKSRCFFLIRDDESVDDFSFRKCVDHILPLPEDMKIK  211



>ref|XP_011087245.1| PREDICTED: protein DCL, chloroplastic-like [Sesamum indicum]
Length=221

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = -1

Query  725  TLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIGAF  546
            T+GPK+FGSSVEMF+Y YKLLH W  NL++N+YEH+VLLEL+KKGH + ++KIG+G+ +F
Sbjct  93   TIGPKTFGSSVEMFDYFYKLLHAWPANLNLNKYEHIVLLELLKKGHLEAERKIGKGVKSF  152

Query  545  QVRNHPIFKSRCFFIVRVDGSADDFSFRKCVDRILPLPESMQIKHNANKAL  393
            QVR HP FKSRCFF++R D S DDFSFRKCV+ ILPLPE+MQ+KH+ NKAL
Sbjct  153  QVRFHPQFKSRCFFLIREDESVDDFSFRKCVNHILPLPENMQVKHDVNKAL  203



>ref|XP_006440603.1| hypothetical protein CICLE_v10022133mg [Citrus clementina]
 gb|ESR53843.1| hypothetical protein CICLE_v10022133mg [Citrus clementina]
Length=208

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 104/202 (51%), Positives = 128/202 (63%), Gaps = 37/202 (18%)
 Frame = -1

Query  971  APEVAKPLSE------DMDIESNVAEDSGTENggakrpreeggepengdngdASKKVRVD  810
            A E AK L+E      DMD+E    E+ G  N    R  ++GGE         SKK ++D
Sbjct  2    AEEAAKELTESNAAAEDMDLEG--GENGGDANAKRARDDDDGGEGNGDV----SKKQKID  55

Query  809  ---KSVEEQRLEILEGSQVGEGKKDDKSGPVTLGPKSFGSSVEMFEYCYKLLHHWAPNLD  639
               KSVEE+RLE                       K FGSS+EMF+Y YK LH W PNL+
Sbjct  56   EDEKSVEEERLE----------------------KKEFGSSIEMFDYFYKFLHFWPPNLN  93

Query  638  INEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRK  459
            +N+YEHMVLL+L+KKGH +P KKIG GI AFQVR HP +KSRCFF++R D +ADDFSFRK
Sbjct  94   VNKYEHMVLLDLLKKGHPEPDKKIGGGIQAFQVRYHPTYKSRCFFLIREDETADDFSFRK  153

Query  458  CVDRILPLPESMQIKHNANKAL  393
            CVD +LPLPE M++K +ANKAL
Sbjct  154  CVDHMLPLPEDMKVKSDANKAL  175



>ref|XP_004236037.1| PREDICTED: protein DCL, chloroplastic-like [Solanum lycopersicum]
Length=206

 Score =   177 bits (450),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 108/143 (76%), Gaps = 14/143 (10%)
 Frame = -1

Query  830  SKKVRVDKSVEEQRLEILEGSQVGEGKKDDKSGPVTLGPKSFGSSVEMFEYCYKLLHHWA  651
            +KK RVD+SVEE+              K D S PV++G KSF SSVEMF Y YKLLH W+
Sbjct  58   TKKPRVDQSVEEE--------------KKDVSVPVSVGSKSFVSSVEMFNYFYKLLHSWS  103

Query  650  PNLDINEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDF  471
             NL++N+YEHM+LL+L+KKGH++ ++KIG G+ AFQ+R HP +KSRCFF+VR D + DDF
Sbjct  104  VNLNLNKYEHMILLDLLKKGHSESERKIGSGVRAFQIRFHPQYKSRCFFLVREDDTVDDF  163

Query  470  SFRKCVDRILPLPESMQIKHNAN  402
            SFRKCVD+I PLP +MQ KH+AN
Sbjct  164  SFRKCVDQIQPLPANMQTKHHAN  186



>ref|XP_009369291.1| PREDICTED: protein DCL, chloroplastic-like [Pyrus x bretschneideri]
Length=225

 Score =   177 bits (449),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 98/117 (84%), Gaps = 0/117 (0%)
 Frame = -1

Query  743  DKSGPVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIG  564
            +KSG V+LGPKSFGSSVEMF+Y YK LH+W  +L++N+YE++VLL+L+KKGHA+P KKIG
Sbjct  85   EKSGRVSLGPKSFGSSVEMFDYFYKFLHYWPTDLNVNKYEYLVLLDLLKKGHAEPDKKIG  144

Query  563  QGIGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVDRILPLPESMQIKHNANKAL  393
             G+ AFQVR HP++KSRCFF++R D   DDFSFRKCVD ILPLPE+M+    ANK L
Sbjct  145  GGVKAFQVRIHPLYKSRCFFLIREDEVVDDFSFRKCVDHILPLPENMKANAEANKVL  201



>gb|KHG12161.1| Protein DCL, chloroplastic [Gossypium arboreum]
Length=223

 Score =   177 bits (449),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 99/206 (48%), Positives = 136/206 (66%), Gaps = 18/206 (9%)
 Frame = -1

Query  989  VAMSESAPEVAK--PLSEDMDIE---SNVAEDSGTENggakrpreeggepengdngdASK  825
            +A  E +PE A+  P SEDMD+E   S+    +  ++       + G E +  +  D SK
Sbjct  1    MADKEPSPEPAEANPPSEDMDLENLDSSAQNPNAGDDANGDSKSKRGREEDGEETEDVSK  60

Query  824  KVRVDKSVEEQRLEILEGSQVGEGKKDDKS---GPVTLGPKSFGSSVEMFEYCYKLLHHW  654
            K +++KSVEE+RLE          KK D+S   G V LGPK FGSS EM +Y   LLHHW
Sbjct  61   KQKLEKSVEEERLE----------KKSDESPESGRVRLGPKEFGSSSEMLDYFCYLLHHW  110

Query  653  APNLDINEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADD  474
               L+ N+YEHMVLL+L+KKGH +P++KIG G+ AFQ+R HP +KS+CFF++R D + DD
Sbjct  111  GTQLNFNKYEHMVLLDLLKKGHLEPERKIGGGVKAFQIRIHPQWKSKCFFVIRDDETMDD  170

Query  473  FSFRKCVDRILPLPESMQIKHNANKA  396
            FSFRKC+D ILPLPE ++ K ++N+A
Sbjct  171  FSFRKCIDHILPLPEDLKGKSDSNRA  196



>ref|XP_010091522.1| hypothetical protein L484_015949 [Morus notabilis]
 gb|EXB44692.1| hypothetical protein L484_015949 [Morus notabilis]
Length=227

 Score =   177 bits (449),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 102/207 (49%), Positives = 135/207 (65%), Gaps = 25/207 (12%)
 Frame = -1

Query  983  MSESAPEVAKPLSEDMDIESNV----AEDSGTENggakrp----reeggepengdngdAS  828
            +SE+  E    ++EDM++E+      + D+G  N    R       E  +  + +N   S
Sbjct  9    LSEANSEQQNAVTEDMELEATEPVQESNDNGETNSKRAREEGDGSSEENDVSSEENEGVS  68

Query  827  KKVRV--DKSVEEQRLEILEGSQVGEGKKDDKSGPVTLGPKSFGSSVEMFEYCYKLLHHW  654
            KK +V  +KSVEE+RLE        +   D++SG V+LGPKSFGSSVEMF+Y YK LH+W
Sbjct  69   KKQKVGDEKSVEEERLE--------KKLADEESGRVSLGPKSFGSSVEMFDYFYKFLHYW  120

Query  653  APNLDINEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADD  474
             PNL++N++       L    HA+P KKIG GI AFQVR HP+FKSRCFF++R D S DD
Sbjct  121  PPNLNVNKF-------LFFARHAEPDKKIGGGIRAFQVRYHPMFKSRCFFLIRNDESYDD  173

Query  473  FSFRKCVDRILPLPESMQIKHNANKAL  393
            FSFRKCVDRILPLPE M++K +AN+AL
Sbjct  174  FSFRKCVDRILPLPEDMKVKSDANRAL  200



>ref|XP_004508733.1| PREDICTED: protein DCL, chloroplastic-like [Cicer arietinum]
Length=214

 Score =   176 bits (447),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 97/115 (84%), Gaps = 0/115 (0%)
 Frame = -1

Query  737  SGPVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQG  558
            SGPV LG K+FG+S+E+F+Y    LH WAPNL++N+YEH +LLELI KGH +P KKIG  
Sbjct  74   SGPVKLGHKTFGNSLELFDYFNSFLHDWAPNLNVNKYEHKMLLELIMKGHPEPDKKIGGE  133

Query  557  IGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVDRILPLPESMQIKHNANKAL  393
            I AFQVR HP++KS+CFF++R D SADDFSFRKCVD ILPLPE+MQ+KH+AN+AL
Sbjct  134  ICAFQVRRHPMWKSKCFFLIREDESADDFSFRKCVDHILPLPEAMQVKHDANRAL  188



>ref|XP_006842642.1| hypothetical protein AMTR_s00077p00189420 [Amborella trichopoda]
 gb|ERN04317.1| hypothetical protein AMTR_s00077p00189420 [Amborella trichopoda]
Length=342

 Score =   179 bits (455),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 98/117 (84%), Gaps = 0/117 (0%)
 Frame = -1

Query  737  SGPVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQG  558
            SGPV+LGPK F +SVEMF+Y YK +  W P++D N+YEHMVL++LIK+GH DP KKIG G
Sbjct  196  SGPVSLGPKGFSTSVEMFDYFYKFITFWPPHVDFNKYEHMVLMDLIKRGHPDPDKKIGNG  255

Query  557  IGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVDRILPLPESMQIKHNANKALRE  387
            I AFQVR HP++KS+C+FIVR DG ADDFS+RKCVD+ILPLPE+M+ K + ++AL E
Sbjct  256  IRAFQVRYHPLWKSKCYFIVRDDGLADDFSYRKCVDKILPLPENMKAKTDIDRALEE  312



>ref|XP_010678517.1| PREDICTED: protein DCL, chloroplastic [Beta vulgaris subsp. vulgaris]
Length=228

 Score =   176 bits (446),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 110/151 (73%), Gaps = 5/151 (3%)
 Frame = -1

Query  830  SKKVRVD--KSVEEQRLEILE---GSQVGEGKKDDKSGPVTLGPKSFGSSVEMFEYCYKL  666
            SKK ++D  KSVEE R+E L+   G    E K++    PV +GPK+FGSS+EMF Y YKL
Sbjct  47   SKKQKLDDEKSVEETRMEKLQENSGEVEEEKKEEKIVDPVKIGPKTFGSSLEMFNYFYKL  106

Query  665  LHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDG  486
            LH W   LD+N+YEHMVLLELIKKGH +  KKIG G+ AF+VR H ++KSRCFF VR D 
Sbjct  107  LHSWPLFLDLNKYEHMVLLELIKKGHPEADKKIGSGVEAFEVREHSVYKSRCFFAVRTDK  166

Query  485  SADDFSFRKCVDRILPLPESMQIKHNANKAL  393
            SA+DFSFRKCV+ ILPLPE+MQ   + N  L
Sbjct  167  SAEDFSFRKCVNNILPLPENMQGNSDVNNVL  197



>ref|XP_006649525.1| PREDICTED: cyclic nucleotide-gated cation channel beta-1-like 
[Oryza brachyantha]
Length=229

 Score =   176 bits (446),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 99/123 (80%), Gaps = 2/123 (2%)
 Frame = -1

Query  758  EGKKDDKSGPVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADP  579
            E  K+++  PV LGPK F +SVEMF+Y + LLH WAP LDIN+YEHMVL +L+KKGHA+ 
Sbjct  80   ENAKEEEGKPVKLGPKEFATSVEMFDYFFALLHSWAPQLDINKYEHMVLEDLLKKGHAES  139

Query  578  QKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVDRILPLPESMQI--KHNA  405
             +KIG G+ AF++RNHP+++SRCFF+ RVDGS+DDFSFRKCVD ILPLPE M+I  K N 
Sbjct  140  DRKIGPGVEAFEIRNHPVWQSRCFFVRRVDGSSDDFSFRKCVDNILPLPEDMKIGGKSNG  199

Query  404  NKA  396
             KA
Sbjct  200  KKA  202



>ref|XP_003527083.1| PREDICTED: nucleolin-like [Glycine max]
Length=252

 Score =   176 bits (447),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 105/209 (50%), Positives = 130/209 (62%), Gaps = 14/209 (7%)
 Frame = -1

Query  977  ESAPEVAKPLSE---------DMDIESNVAEDSGTE-NggakrpreeggepengdngdAS  828
            E+AP+V  P +          DMD+E+  A D+G E N    R  EE    ++       
Sbjct  4    EAAPKVVDPNTVVAAAAAAAVDMDVENIEAGDNGAEPNQKRAREEEEPLGDDDDVLKKQK  63

Query  827  KKVRVDKSVEEQRLE----ILEGSQVGEGKKDDKSGPVTLGPKSFGSSVEMFEYCYKLLH  660
                 ++SVEEQRLE      E     E ++ + SG V LG KSF SS EMF Y Y  LH
Sbjct  64   VAEEKEQSVEEQRLEKRDEKEEKEAEKEEEEKEASGSVNLGFKSFVSSSEMFHYFYNFLH  123

Query  659  HWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSA  480
             W   L++N+YEH++LLEL+K GHA+P KKIG G+ AFQVR HP FKSRCFF++R D SA
Sbjct  124  TWPQYLNVNKYEHLMLLELLKNGHAEPDKKIGGGVRAFQVRKHPTFKSRCFFLIREDDSA  183

Query  479  DDFSFRKCVDRILPLPESMQIKHNANKAL  393
            DDFSFRKCVD ILPLPE M +K +ANKAL
Sbjct  184  DDFSFRKCVDHILPLPEEMHLKFDANKAL  212



>ref|XP_010916681.1| PREDICTED: uncharacterized protein LOC105041409 [Elaeis guineensis]
Length=273

 Score =   176 bits (447),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 114/166 (69%), Gaps = 21/166 (13%)
 Frame = -1

Query  830  SKKVRVDKSVEEQRLEILEGSQVGEGKKDDK-----------------SGPVTLGPKSFG  702
            S K  V++S+EE+ L+ +E  +  EG +D                   S  V LGPK+F 
Sbjct  82   SNKRMVERSLEEKSLDKMEDKK--EGGEDSNADEKEEEEGGGGEEEKKSMKVCLGPKAFD  139

Query  701  SSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIF  522
            SS EMF+Y +KLL  W+PNLDINEYEHMVLL+L++KGH +P+KKIG+GI AFQVR  P +
Sbjct  140  SSKEMFDYFFKLLRQWSPNLDINEYEHMVLLDLLQKGHPEPEKKIGEGIQAFQVRYQPAW  199

Query  521  KSRCFFIVRVDGSADDFSFRKCVDRILPLPESM--QIKHNANKALR  390
            KSRCFFIVRVDG+ DDFSFRKC+D+ILPLPE M  Q   N NK  R
Sbjct  200  KSRCFFIVRVDGTDDDFSFRKCIDQILPLPEHMKAQSASNGNKVGR  245



>ref|XP_003558636.1| PREDICTED: protein DCL, chloroplastic [Brachypodium distachyon]
Length=236

 Score =   175 bits (443),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 107/142 (75%), Gaps = 7/142 (5%)
 Frame = -1

Query  827  KKVRVD---KSVEEQRLE----ILEGSQVGEGKKDDKSGPVTLGPKSFGSSVEMFEYCYK  669
            KK R++   K VEE+ +E     +EG    EG K +   PV LGPK F SSV+MF+Y + 
Sbjct  50   KKPRLEEEAKDVEEKGVEEGAKDVEGKGEEEGAKGEDGKPVKLGPKEFASSVDMFDYFFA  109

Query  668  LLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVD  489
            LLH W P L+IN+YEHMVL +L+KKGHA+P KKIG G+ AF++RNHP+++SRCFF+ RVD
Sbjct  110  LLHSWTPQLEINKYEHMVLEDLVKKGHAEPSKKIGAGVEAFEIRNHPVWQSRCFFVRRVD  169

Query  488  GSADDFSFRKCVDRILPLPESM  423
            GS+DDFSFRKCVD ILPLPE +
Sbjct  170  GSSDDFSFRKCVDNILPLPEDL  191



>ref|XP_008782334.1| PREDICTED: DNA-directed RNA polymerase V subunit 1-like [Phoenix 
dactylifera]
Length=353

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 93/109 (85%), Gaps = 0/109 (0%)
 Frame = -1

Query  728  VTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIGA  549
             +LGP  F SSVEMF+Y +KLLHHW+PNLDIN+YEHMVLL L++KGH +P KKIG+GI A
Sbjct  133  ASLGPNVFTSSVEMFDYFFKLLHHWSPNLDINKYEHMVLLNLLQKGHPEPDKKIGEGIQA  192

Query  548  FQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVDRILPLPESMQIKHNAN  402
            FQVR HP +KSRCFFIVRVDG+ DDFSFRKC+DRILPLP+ M++   +N
Sbjct  193  FQVRYHPTWKSRCFFIVRVDGTDDDFSFRKCIDRILPLPDQMKVPSASN  241



>ref|XP_006382598.1| hypothetical protein POPTR_0005s03610g [Populus trichocarpa]
 gb|ERP60395.1| hypothetical protein POPTR_0005s03610g [Populus trichocarpa]
Length=250

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = -1

Query  737  SGPVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQG  558
            SGPV LG KSFGS+VEMF+Y Y  LH+W PNL++N+YE MVLL+L+K+GH +P KKIG G
Sbjct  104  SGPVRLGLKSFGSAVEMFDYFYNFLHYWPPNLNVNKYEQMVLLDLLKRGHTEPDKKIGGG  163

Query  557  IGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVDRILPLPESMQIKHN  408
            I  FQVR HP+FKSRCFF++R D S DDFSFRKCVD ILPLPE M+IK +
Sbjct  164  IQTFQVRFHPMFKSRCFFLIRDDESVDDFSFRKCVDHILPLPEDMKIKSD  213



>ref|NP_001236280.1| uncharacterized protein LOC100305757 [Glycine max]
 gb|ACU13611.1| unknown [Glycine max]
Length=206

 Score =   172 bits (437),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 92/115 (80%), Gaps = 0/115 (0%)
 Frame = -1

Query  737  SGPVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQG  558
            SGPV LG KSF SSVEMF+Y Y LLH W   L++N+YEHM+LLEL+K GH +P  KIG G
Sbjct  63   SGPVKLGFKSFASSVEMFDYFYNLLHAWPAYLNLNQYEHMMLLELLKNGHTEPDTKIGGG  122

Query  557  IGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVDRILPLPESMQIKHNANKAL  393
            I  FQVR HP++KSRCFF+VR D S DDFSFRKCVD ILPLP+ MQ++ +AN+AL
Sbjct  123  IRVFQVRKHPMWKSRCFFLVRDDESVDDFSFRKCVDHILPLPQEMQVRPDANRAL  177



>ref|XP_011023607.1| PREDICTED: protein DCL, chloroplastic-like [Populus euphratica]
 ref|XP_011023608.1| PREDICTED: protein DCL, chloroplastic-like [Populus euphratica]
Length=236

 Score =   173 bits (439),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 98/199 (49%), Positives = 128/199 (64%), Gaps = 21/199 (11%)
 Frame = -1

Query  977  ESAPEVAKPLSEDMDIESNVAEDSGTENggakrpreeggepengdngdASKKVRVDKSVE  798
            E+  E A   +EDMD+  +VAE+                E E  +N D  KK +VDK+ E
Sbjct  11   EANLERADSATEDMDMVEDVAENGAKR----------AREGEEEENEDVLKKQKVDKAGE  60

Query  797  EQRLEILEGSQVGEGKKDDKSG-----------PVTLGPKSFGSSVEMFEYCYKLLHHWA  651
            E RLE +E     EG+   +             PV+LGPKSFGS+VEMF+Y Y  LH W 
Sbjct  61   EGRLEKIEEEGKAEGEGGREEKEEKKEEEEKSGPVSLGPKSFGSAVEMFDYFYNFLHQWP  120

Query  650  PNLDINEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDF  471
            PN+ +N+YEHM+L++L+K GH++P KKIG GI AFQVR HP FKSRCFF++R D + DDF
Sbjct  121  PNIKVNKYEHMMLVDLLKTGHSEPDKKIGSGIQAFQVRFHPRFKSRCFFLIRDDDTVDDF  180

Query  470  SFRKCVDRILPLPESMQIK  414
            SFRKCVD ILPLPE++++K
Sbjct  181  SFRKCVDHILPLPENLKVK  199



>gb|ABR25889.1| unknown [Oryza sativa Indica Group]
Length=150

 Score =   170 bits (431),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = -1

Query  743  DKSGPVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIG  564
            +++ PV LGPK F + VEMF+Y + LLH WAP L+IN+YEHMVL +L+KKGHA+  +KIG
Sbjct  1    EEAKPVKLGPKEFATGVEMFDYFFALLHSWAPQLEINKYEHMVLEDLLKKGHAESDRKIG  60

Query  563  QGIGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVDRILPLPESMQIKHNAN  402
             GI AF++RNHP+F+SRCFF+ RVDGS+DDFSFRKCVD ILPLPE M+I + +N
Sbjct  61   AGIEAFEIRNHPVFQSRCFFVRRVDGSSDDFSFRKCVDSILPLPEDMKIGNKSN  114



>ref|NP_201050.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAM21312.1|AF371327_1 EMB514 [Arabidopsis thaliana]
 gb|AAM65405.1| unknown [Arabidopsis thaliana]
 gb|AAP40395.1| unknown protein [Arabidopsis thaliana]
 gb|AAP40494.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43068.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAF01556.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED97608.1| uncharacterized protein AT5G62440 [Arabidopsis thaliana]
Length=202

 Score =   172 bits (435),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 97/116 (84%), Gaps = 3/116 (3%)
 Frame = -1

Query  767  QVGEGKKDDKSGPVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGH  588
            +VGE   ++KSGPV LGPK F +SV MF+Y  K LH W  +LD+N+YEHMVLL+LIKKGH
Sbjct  57   KVGE---EEKSGPVKLGPKEFVTSVAMFDYFVKFLHFWPTDLDVNKYEHMVLLDLIKKGH  113

Query  587  ADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVDRILPLPESMQ  420
            ++P+KKIG GI  FQVR HP++KSRCFF+VR D +ADDFSFRKCVD+ILPLPE+M+
Sbjct  114  SEPEKKIGGGIKTFQVRTHPMWKSRCFFLVREDDTADDFSFRKCVDQILPLPENMK  169



>ref|XP_007155309.1| hypothetical protein PHAVU_003G190000g [Phaseolus vulgaris]
 gb|ESW27303.1| hypothetical protein PHAVU_003G190000g [Phaseolus vulgaris]
Length=219

 Score =   172 bits (435),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 106/147 (72%), Gaps = 8/147 (5%)
 Frame = -1

Query  830  SKKVRVDKSVEEQRLEILEGSQVGEGKKDDK-SGPVTLGPKSFGSSVEMFEYCYKLLHHW  654
            SKK +V+   E + L        GE +K+ K SGPV LG  SF SSVEMF+Y   LLH W
Sbjct  53   SKKHKVEPEEEREPL-------TGEDEKEKKPSGPVKLGFLSFASSVEMFDYFNNLLHTW  105

Query  653  APNLDINEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADD  474
             P L++N+YEH +LLEL+K GH  P +KIG GI  FQVR HP++KSRCFF++R + S DD
Sbjct  106  PPYLNLNQYEHTMLLELLKNGHTGPDEKIGGGIRVFQVRKHPMWKSRCFFLIRDNESVDD  165

Query  473  FSFRKCVDRILPLPESMQIKHNANKAL  393
            FSFRKCVD ILPLPE MQ+KH+AN+AL
Sbjct  166  FSFRKCVDSILPLPEEMQVKHDANRAL  192



>emb|CDY65200.1| BnaCnng45980D [Brassica napus]
Length=203

 Score =   171 bits (433),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 101/134 (75%), Gaps = 3/134 (2%)
 Frame = -1

Query  812  DKSVEEQRLEILEGSQVGE---GKKDDKSGPVTLGPKSFGSSVEMFEYCYKLLHHWAPNL  642
            DK   EQ  E  +G +  +   G+++  +GPV LGPK F SSV MF+Y  K +H W   L
Sbjct  37   DKRGREQTEETEDGGETKKQKVGEEEKSNGPVKLGPKEFVSSVAMFDYFTKFMHFWPTGL  96

Query  641  DINEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDFSFR  462
            D+N+YE MVLL+LIKKGH++P KKIG GI AFQVR HP++KSRCFF+VR D SADDFSFR
Sbjct  97   DVNKYEQMVLLDLIKKGHSEPDKKIGGGIKAFQVRTHPMWKSRCFFLVREDDSADDFSFR  156

Query  461  KCVDRILPLPESMQ  420
            KCVD+ILPLPE+M+
Sbjct  157  KCVDQILPLPENMK  170



>ref|XP_010483956.1| PREDICTED: uncharacterized protein LOC104762379 [Camelina sativa]
Length=203

 Score =   171 bits (432),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 101/130 (78%), Gaps = 5/130 (4%)
 Frame = -1

Query  794  QRLEILEGSQVGEGKK-----DDKSGPVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINE  630
            +R E  E    GE KK     ++KSGPV LGPK F +SV MF+Y  K +H W  +LD+N+
Sbjct  40   EREETGEDENGGESKKQKVGDEEKSGPVKLGPKEFVTSVAMFDYFVKFMHFWPTDLDVNK  99

Query  629  YEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVD  450
            YE+MVLL+LIKKGH++P+KKIG G+  FQVR HP++KSRCFF+VR D +ADDFSFRKCVD
Sbjct  100  YEYMVLLDLIKKGHSEPEKKIGGGVKTFQVRTHPMWKSRCFFLVREDDTADDFSFRKCVD  159

Query  449  RILPLPESMQ  420
            +ILPLPE+M+
Sbjct  160  QILPLPENMK  169



>ref|NP_001049206.1| Os03g0187000 [Oryza sativa Japonica Group]
 gb|ABF94366.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF11120.1| Os03g0187000 [Oryza sativa Japonica Group]
 dbj|BAG87151.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74651.1| hypothetical protein OsI_10304 [Oryza sativa Indica Group]
 gb|EEE58461.1| hypothetical protein OsJ_09703 [Oryza sativa Japonica Group]
Length=232

 Score =   172 bits (435),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -1

Query  731  PVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIG  552
            PV LGPK F + VEMF+Y + LLH WAP L+IN+YEHMVL +L+KKGHA+  +KIG GI 
Sbjct  87   PVKLGPKEFATGVEMFDYFFALLHSWAPQLEINKYEHMVLEDLLKKGHAESDRKIGAGIE  146

Query  551  AFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVDRILPLPESMQIKHNAN  402
            AF++RNHP+F+SRCFF+ RVDGS+DDFSFRKCVD ILPLPE M+I + +N
Sbjct  147  AFEIRNHPVFQSRCFFVRRVDGSSDDFSFRKCVDSILPLPEDMKIGNKSN  196



>ref|XP_002866491.1| hypothetical protein ARALYDRAFT_496421 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42750.1| hypothetical protein ARALYDRAFT_496421 [Arabidopsis lyrata subsp. 
lyrata]
Length=203

 Score =   170 bits (430),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -1

Query  749  KDDKSGPVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKK  570
            +++KSGPV LGPK F +SV MF+Y  K LH W  +LD+N+YEHMVLL+LIKKGH++P+KK
Sbjct  60   EEEKSGPVKLGPKEFVTSVAMFDYFVKFLHFWPTDLDVNKYEHMVLLDLIKKGHSEPEKK  119

Query  569  IGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVDRILPLPESMQ  420
            IG GI  FQVR HP++KSRCFF+VR D +ADDFSFRKCVD ILPLPE+M+
Sbjct  120  IGGGIKTFQVRTHPMWKSRCFFLVREDDTADDFSFRKCVDHILPLPENMK  169



>ref|XP_006281035.1| hypothetical protein CARUB_v10027052mg, partial [Capsella rubella]
 gb|EOA13933.1| hypothetical protein CARUB_v10027052mg, partial [Capsella rubella]
Length=232

 Score =   171 bits (432),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 75/109 (69%), Positives = 93/109 (85%), Gaps = 0/109 (0%)
 Frame = -1

Query  746  DDKSGPVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKI  567
            ++KSGPV LGPK F +SV MF+Y  K LH W  +LD+N+YEHMVLL+LIKKGH++P+KKI
Sbjct  90   EEKSGPVKLGPKEFVTSVAMFDYFVKFLHFWPTDLDVNKYEHMVLLDLIKKGHSEPEKKI  149

Query  566  GQGIGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVDRILPLPESMQ  420
            G GI  FQVR HP++KSRCFF+VR D +ADDFSFRKCVD+ILPLPE+M+
Sbjct  150  GGGIKTFQVRTHPMWKSRCFFLVREDDTADDFSFRKCVDQILPLPENMK  198



>ref|XP_010444092.1| PREDICTED: uncharacterized protein LOC104726842 [Camelina sativa]
Length=203

 Score =   169 bits (427),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 100/131 (76%), Gaps = 5/131 (4%)
 Frame = -1

Query  794  QRLEILEGSQVGEGKK-----DDKSGPVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINE  630
            +R E  E    GE KK     ++KSGPV LGPK F +SV MF+Y  K +  W  +LD+N+
Sbjct  40   EREETGEDENGGESKKQKVGDEEKSGPVKLGPKEFVTSVAMFDYFVKFMQFWPTDLDVNK  99

Query  629  YEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVD  450
            YE+MVLL+LIKKGH++P+KKIG GI  FQVR HP++KSRCFF+VR D +ADDFSFRKCVD
Sbjct  100  YEYMVLLDLIKKGHSEPEKKIGGGIKTFQVRTHPMWKSRCFFLVREDDTADDFSFRKCVD  159

Query  449  RILPLPESMQI  417
            +ILPLPE+M+ 
Sbjct  160  QILPLPENMKT  170



>ref|XP_004985426.1| PREDICTED: protein DCL, chloroplastic-like [Setaria italica]
Length=231

 Score =   169 bits (429),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 94/115 (82%), Gaps = 1/115 (1%)
 Frame = -1

Query  758  EGKKDDKSG-PVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHAD  582
            EGK ++  G P  LGPK F ++VEMF+Y + LLH WAP L+ N+YE MVL +L+KKGHA+
Sbjct  77   EGKGEEAKGKPAKLGPKEFATAVEMFDYFFALLHSWAPQLEFNKYEQMVLEDLLKKGHAE  136

Query  581  PQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVDRILPLPESMQI  417
            P KKIG GI AF++RNHP+++SRCFF+ RVDGSADDFSFRKCVD ILPLPE M+I
Sbjct  137  PAKKIGPGIEAFEIRNHPVWQSRCFFVRRVDGSADDFSFRKCVDNILPLPEDMKI  191



>emb|CDY00287.1| BnaA06g21880D [Brassica napus]
Length=203

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 92/112 (82%), Gaps = 0/112 (0%)
 Frame = -1

Query  755  GKKDDKSGPVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQ  576
            G+++  +G V LGPK FGSSV MF+Y  K +H W   LD+N+YE MVLL+LIKKGH++P 
Sbjct  59   GEEEKSTGLVKLGPKEFGSSVAMFDYFTKFMHFWPTGLDVNKYEQMVLLDLIKKGHSEPD  118

Query  575  KKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVDRILPLPESMQ  420
            KKIG GI AFQVR HP++KSRCFF+VR D SADDFSFRKCVD+ILPLPE+M+
Sbjct  119  KKIGGGIKAFQVRTHPMWKSRCFFLVREDDSADDFSFRKCVDQILPLPENMK  170



>gb|KHN18554.1| hypothetical protein glysoja_006967 [Glycine soja]
Length=216

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/145 (59%), Positives = 104/145 (72%), Gaps = 3/145 (2%)
 Frame = -1

Query  827  KKVRVDKSVEEQRLEILEGSQVGEGKKDDKSGPVTLGPKSFGSSVEMFEYCYKLLHHWAP  648
            ++ RVD   EE    + +  +V E +K   SGPV LG KSF SS+EMF+Y Y LLH W P
Sbjct  32   ERTRVDSDDEEDG--VSKKRKVDEEEKK-PSGPVKLGFKSFASSLEMFDYFYNLLHAWPP  88

Query  647  NLDINEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDFS  468
              ++N+YEHM+LLEL+K GH +P  KIG GI  FQVR HP++KSRCFF+VR   S DDFS
Sbjct  89   FQNLNQYEHMMLLELLKNGHTEPDTKIGGGICVFQVRKHPMWKSRCFFLVREGESVDDFS  148

Query  467  FRKCVDRILPLPESMQIKHNANKAL  393
            FRKCVD ILPLPE MQ+K +AN AL
Sbjct  149  FRKCVDHILPLPEEMQVKPDANMAL  173



>ref|XP_003550782.1| PREDICTED: protein DCL, chloroplastic-like [Glycine max]
Length=208

 Score =   168 bits (425),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/145 (59%), Positives = 104/145 (72%), Gaps = 3/145 (2%)
 Frame = -1

Query  827  KKVRVDKSVEEQRLEILEGSQVGEGKKDDKSGPVTLGPKSFGSSVEMFEYCYKLLHHWAP  648
            K+ RVD   EE    + +  +V E +K+  SGPV LG KSF SS+EMF+Y Y LLH W P
Sbjct  32   KRTRVDSDDEEDG--VSKKRKVDEEEKE-PSGPVKLGFKSFASSLEMFDYFYNLLHAWPP  88

Query  647  NLDINEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDFS  468
              ++N+YEHM+LLEL+K GH +P  KIG GI  FQVR HP++KSRCFF+VR   S DDFS
Sbjct  89   FQNLNQYEHMMLLELLKNGHTEPDTKIGGGICVFQVRKHPMWKSRCFFLVREGESVDDFS  148

Query  467  FRKCVDRILPLPESMQIKHNANKAL  393
            F KCVD ILPLPE MQ+K +AN AL
Sbjct  149  FHKCVDHILPLPEEMQVKPDANMAL  173



>ref|XP_002468368.1| hypothetical protein SORBIDRAFT_01g044760 [Sorghum bicolor]
 gb|EER95366.1| hypothetical protein SORBIDRAFT_01g044760 [Sorghum bicolor]
Length=245

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 87/105 (83%), Gaps = 0/105 (0%)
 Frame = -1

Query  731  PVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIG  552
            PV LGPK F S+VEMF+Y + LLH W P L+ N+YE +VL +L+KKGHADP KKIG G+ 
Sbjct  99   PVKLGPKEFASAVEMFDYFFALLHSWTPQLEFNKYEQLVLEDLLKKGHADPAKKIGAGVE  158

Query  551  AFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVDRILPLPESMQI  417
            AF++RNHP+++SRCFF+ R DGSADDFSFRKCVD ILPLPE M+I
Sbjct  159  AFEIRNHPVWQSRCFFVRRTDGSADDFSFRKCVDNILPLPEDMKI  203



>gb|EMS51361.1| hypothetical protein TRIUR3_16777 [Triticum urartu]
Length=185

 Score =   167 bits (423),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = -1

Query  731  PVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIG  552
            PV LGPK F ++V+MF+Y + LLH W+PNL+ N+YE MVL +L+KKGHA+P KKIG G+ 
Sbjct  38   PVKLGPKEFATAVDMFDYFFALLHSWSPNLEFNKYEQMVLEDLVKKGHAEPAKKIGSGVE  97

Query  551  AFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVDRILPLPESMQ  420
            AF++RNHP+++SRCFFI RVDGSADDFSFRKCVD ILPLPE ++
Sbjct  98   AFEIRNHPVWQSRCFFIRRVDGSADDFSFRKCVDNILPLPEDLK  141



>ref|XP_009151366.1| PREDICTED: protein DCL, chloroplastic [Brassica rapa]
Length=203

 Score =   167 bits (424),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 92/112 (82%), Gaps = 0/112 (0%)
 Frame = -1

Query  755  GKKDDKSGPVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQ  576
            G+++  +G V LGPK FGSSV MF+Y  K +H W   LD+N+YE MVLL+LIKKGH++P 
Sbjct  59   GEEEKSTGLVKLGPKEFGSSVAMFDYFTKFMHFWPTGLDVNKYEQMVLLDLIKKGHSEPD  118

Query  575  KKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVDRILPLPESMQ  420
            KKIG GI AFQVR HP++KSRCFF+VR D SADDFSFRKCVD+ILPLPE+M+
Sbjct  119  KKIGGGIKAFQVRTHPMWKSRCFFLVREDDSADDFSFRKCVDQILPLPENMK  170



>ref|XP_009413463.1| PREDICTED: high mobility group nucleosome-binding domain-containing 
protein 5-like [Musa acuminata subsp. malaccensis]
Length=348

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 108/159 (68%), Gaps = 27/159 (17%)
 Frame = -1

Query  809  KSVEEQRLEILEGSQVG----EGKKDD-----------------------KSGPVTLGPK  711
            +SVEE+R+E +EG   G    EG  DD                       ++  V++GPK
Sbjct  141  RSVEEERMEKVEGKGEGAEDLEGGGDDEKEFKGEEEGGGDLEEGRGDVEKETSDVSVGPK  200

Query  710  SFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNH  531
             F SSVEMFEY +KLLH W+PNLD+N+YEHMVL +L+ KGH +P KKIG GI AFQVR H
Sbjct  201  VFTSSVEMFEYFFKLLHSWSPNLDLNKYEHMVLHDLLNKGHPEPTKKIGVGIQAFQVRYH  260

Query  530  PIFKSRCFFIVRVDGSADDFSFRKCVDRILPLPESMQIK  414
            P +KSRCFF+VRVD + DDFSFRKCVD ILPLP++M+ +
Sbjct  261  PAWKSRCFFVVRVDETIDDFSFRKCVDNILPLPDNMKAR  299



>ref|XP_009403245.1| PREDICTED: uncharacterized protein LOC103986852 [Musa acuminata 
subsp. malaccensis]
Length=226

 Score =   168 bits (426),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 108/151 (72%), Gaps = 7/151 (5%)
 Frame = -1

Query  827  KKVRVDKSVEEQRLEILEGSQVGEGKKD-------DKSGPVTLGPKSFGSSVEMFEYCYK  669
            K+ +V+   EE++ + ++G + G G  +        +S    +GPK F SSVEMFEY  K
Sbjct  46   KRQKVEGYWEEEKTDGVDGKREGGGDLEVGGCGDGRESEAANVGPKGFKSSVEMFEYFLK  105

Query  668  LLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVD  489
            LL  W+P+LDIN+YEHMVLL+L+KKGH DP KKIG GI AFQVRNHP FKSRCFF+VR D
Sbjct  106  LLRSWSPDLDINKYEHMVLLDLLKKGHPDPAKKIGAGIEAFQVRNHPTFKSRCFFLVRAD  165

Query  488  GSADDFSFRKCVDRILPLPESMQIKHNANKA  396
            G++DDFSF KCVD ILP+P+ ++ +  ++  
Sbjct  166  GTSDDFSFCKCVDMILPMPDHLKAQSTSDNG  196



>ref|XP_009401349.1| PREDICTED: protein DCL, chloroplastic-like [Musa acuminata subsp. 
malaccensis]
Length=226

 Score =   167 bits (424),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 92/109 (84%), Gaps = 0/109 (0%)
 Frame = -1

Query  728  VTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIGA  549
             ++GPK F SSVEMF+Y  KLL  W PNL+IN+YEHMVLL+L+KKGH +P KKIG+GI A
Sbjct  86   ASIGPKVFTSSVEMFDYFLKLLRSWLPNLNINKYEHMVLLDLLKKGHPEPAKKIGEGIEA  145

Query  548  FQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVDRILPLPESMQIKHNAN  402
            FQVR HP +KSRCFF++RVDG+ DDFSFRKCVD+ILPLP+ ++++  ++
Sbjct  146  FQVRYHPTYKSRCFFLIRVDGTTDDFSFRKCVDKILPLPDHLKVQSTSD  194



>ref|NP_001144806.1| uncharacterized protein LOC100277882 [Zea mays]
 gb|ACG43005.1| hypothetical protein [Zea mays]
 gb|ACG43097.1| hypothetical protein [Zea mays]
 gb|ACG44008.1| hypothetical protein [Zea mays]
 gb|ACN37012.1| unknown [Zea mays]
 gb|AFW89435.1| hypothetical protein ZEAMMB73_275111 [Zea mays]
Length=235

 Score =   168 bits (425),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 89/105 (85%), Gaps = 0/105 (0%)
 Frame = -1

Query  731  PVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIG  552
            PV LGPK F SSVEMF+Y + LLH+W P ++ N+YE MVL +L+KKGHA+P KKIG G+ 
Sbjct  91   PVKLGPKEFSSSVEMFDYFFGLLHYWTPQIEFNKYEQMVLEDLLKKGHAEPAKKIGAGVE  150

Query  551  AFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVDRILPLPESMQI  417
            AF++RNHP+++SRCFFI R+DGS+DDFSFRKCVD ILPLPE M++
Sbjct  151  AFEIRNHPVWQSRCFFIRRIDGSSDDFSFRKCVDNILPLPEDMKV  195



>ref|XP_010458929.1| PREDICTED: uncharacterized protein LOC104740096 [Camelina sativa]
Length=205

 Score =   167 bits (422),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 101/131 (77%), Gaps = 6/131 (5%)
 Frame = -1

Query  794  QRLEILEGSQVGEGKK------DDKSGPVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDIN  633
            +R E  E    GE KK      ++KSGPV LGPK F +SV MF+Y  K +H W  +LD+N
Sbjct  41   EREETGEDENGGESKKQKVGDEEEKSGPVKLGPKEFVTSVAMFDYFVKFMHFWPTDLDVN  100

Query  632  EYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCV  453
            +YE+MVLL+LIKKGH++ +KKIG G+ +FQVR HP++KSRCFF+VR D +ADDFSFRKCV
Sbjct  101  KYEYMVLLDLIKKGHSEHEKKIGGGVKSFQVRTHPMWKSRCFFLVREDDTADDFSFRKCV  160

Query  452  DRILPLPESMQ  420
            D+ILPLPE+M+
Sbjct  161  DQILPLPENMK  171



>gb|KEH33322.1| DUF3223 family protein [Medicago truncatula]
Length=235

 Score =   167 bits (424),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 111/148 (75%), Gaps = 2/148 (1%)
 Frame = -1

Query  830  SKKVRVD--KSVEEQRLEILEGSQVGEGKKDDKSGPVTLGPKSFGSSVEMFEYCYKLLHH  657
            SKK +VD  KSVEE+RLE LE ++     + + SG V LGPK+FGSS++MF Y +K LH 
Sbjct  52   SKKAKVDEEKSVEEERLEKLEKNEGDVKDEKEASGDVKLGPKTFGSSLDMFHYFHKFLHA  111

Query  656  WAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSAD  477
            W  NL++N+YEH +LLEL+K GHA+P +KIG GI AFQVR+HP + SRC+F++R D +AD
Sbjct  112  WPQNLNVNKYEHTMLLELLKNGHAEPDRKIGVGICAFQVRDHPRYNSRCYFLIREDDTAD  171

Query  476  DFSFRKCVDRILPLPESMQIKHNANKAL  393
            DFSFRKCVD I PLPE MQ+K   NK  
Sbjct  172  DFSFRKCVDHISPLPEEMQLKSEGNKKF  199



>ref|XP_010258340.1| PREDICTED: uncharacterized protein LOC104598124 [Nelumbo nucifera]
Length=239

 Score =   167 bits (422),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 112/151 (74%), Gaps = 6/151 (4%)
 Frame = -1

Query  827  KKVRVDKSVEEQRLEILEGSQVGEGKKDDKSG------PVTLGPKSFGSSVEMFEYCYKL  666
            KK +++K VEE+ L+ L+ ++  E  K+ +        PV++GPK+F SS E+F Y YK 
Sbjct  62   KKQKIEKLVEEECLDKLQQNEEEEEVKEAEKEEEKKTEPVSVGPKNFSSSEEIFNYFYKF  121

Query  665  LHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDG  486
            LH W PN+++N+YEHM+LL L++KGHAD ++K+G G+ AFQVR HP++K RCFF++R D 
Sbjct  122  LHCWPPNVNVNQYEHMMLLNLLEKGHADAERKLGGGVDAFQVRYHPLWKKRCFFLIRQDE  181

Query  485  SADDFSFRKCVDRILPLPESMQIKHNANKAL  393
            S DDFSFRKC+D ILPLPESM++  + NK L
Sbjct  182  SVDDFSFRKCIDHILPLPESMKVNSDVNKVL  212



>gb|KFK27971.1| hypothetical protein AALP_AA8G455200 [Arabis alpina]
Length=205

 Score =   165 bits (417),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = -1

Query  767  QVGEGKKDDKSGPVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGH  588
            +VGE +K + SGPV LGPK F +S+ MF+Y  K +  W  +LD+N+YE+MVLL+LIKKGH
Sbjct  58   KVGEEEKTNGSGPVKLGPKEFVTSIAMFDYFTKFMQFWPTDLDVNKYEYMVLLDLIKKGH  117

Query  587  ADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVDRILPLPESMQ  420
            A+P KKIG GI  FQ++ HP++KSRCFF+VR D SADDFSFRKCVD ILPLP++M+
Sbjct  118  AEPDKKIGGGIKTFQIKIHPMWKSRCFFLVREDDSADDFSFRKCVDHILPLPDNMK  173



>ref|XP_010550601.1| PREDICTED: protein DCL, chloroplastic [Tarenaya hassleriana]
Length=215

 Score =   165 bits (417),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 92/119 (77%), Gaps = 3/119 (3%)
 Frame = -1

Query  749  KDDK---SGPVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADP  579
            KDDK   SG   LGPK F SSVEMF+Y  K LH W  +LD+N+YEH VLL+L+KKGH +P
Sbjct  74   KDDKTNGSGGAKLGPKEFVSSVEMFDYFVKFLHFWPTDLDVNKYEHTVLLDLVKKGHPEP  133

Query  578  QKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVDRILPLPESMQIKHNAN  402
            ++KIG GI AFQ+RNHP++KSRCFF+VR D + DDFSFRKCVD ILPLPE+M+     N
Sbjct  134  ERKIGGGIKAFQIRNHPMWKSRCFFLVREDDTTDDFSFRKCVDHILPLPENMKAPKPGN  192



>ref|XP_010029845.1| PREDICTED: zinc finger CCCH domain-containing protein 4 [Eucalyptus 
grandis]
 gb|KCW83613.1| hypothetical protein EUGRSUZ_B00508 [Eucalyptus grandis]
Length=239

 Score =   164 bits (415),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 91/114 (80%), Gaps = 0/114 (0%)
 Frame = -1

Query  734  GPVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGI  555
            G   +GPK FGS+VEMF+Y +K LH W  N+++N+YE++ LLELIKKGH++P+KKIG GI
Sbjct  99   GRTKVGPKEFGSAVEMFDYFFKFLHFWPANVNVNKYEYLTLLELIKKGHSEPEKKIGAGI  158

Query  554  GAFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVDRILPLPESMQIKHNANKAL  393
             AFQVR HP FKS+CFF++R D S DDFSFRKCVD I+PLPE M+ K   ++AL
Sbjct  159  KAFQVRFHPTFKSKCFFLIREDDSMDDFSFRKCVDHIIPLPEEMKAKEGVSRAL  212



>ref|XP_009130215.1| PREDICTED: uncharacterized protein LOC103855007 [Brassica rapa]
Length=192

 Score =   161 bits (408),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = -1

Query  737  SGPVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQG  558
            S PV LGPK F +SV MF+Y  K +H W  +LD+N+YEHMVLL+LIKKGH +P  KIG G
Sbjct  55   SDPVKLGPKEFVTSVAMFDYFTKFMHFWPTDLDVNKYEHMVLLDLIKKGHTEPDNKIGGG  114

Query  557  IGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVDRILPLPESMQI  417
            I AFQVR HP++KSRCFF+VR D +ADDFS+RKCVD ILPLPE+M+ 
Sbjct  115  IKAFQVRTHPMWKSRCFFLVREDDTADDFSYRKCVDHILPLPENMKT  161



>emb|CDY67519.1| BnaAnng24490D [Brassica napus]
Length=195

 Score =   160 bits (406),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = -1

Query  737  SGPVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQG  558
            S PV LGPK F +SV MF+Y  K +H W  +LD+N+YEHMVLL+LIKKGH +P  KIG G
Sbjct  58   SDPVKLGPKEFVTSVAMFDYFTKFMHFWPTDLDVNKYEHMVLLDLIKKGHTEPDNKIGGG  117

Query  557  IGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVDRILPLPESMQ  420
            I AFQVR HP++KSRCFF+VR D +ADDFS+RKCVD ILPLPE+M+
Sbjct  118  IKAFQVRTHPMWKSRCFFLVREDDTADDFSYRKCVDHILPLPENMK  163



>ref|NP_001145212.1| uncharacterized protein LOC100278469 [Zea mays]
 gb|ACG45819.1| hypothetical protein [Zea mays]
Length=261

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -1

Query  731  PVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIG  552
            PV LGPK F S+++MF Y Y LLH W P L+ N+YE MVL +L++KGHA+P KKIG G+ 
Sbjct  117  PVKLGPKEFASAIDMFNYFYALLHSWTPQLEFNKYEQMVLEDLLRKGHAEPAKKIGAGVE  176

Query  551  AFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVDRILPLPESMQI  417
            AF++ NHP+++S CFF+ R DGS DDFSFRKCVD ILPLPE  +I
Sbjct  177  AFEIGNHPVWRSHCFFVRRTDGSVDDFSFRKCVDNILPLPEDFKI  221



>ref|XP_002319542.1| hypothetical protein POPTR_0013s02340g [Populus trichocarpa]
 gb|EEE95465.1| hypothetical protein POPTR_0013s02340g [Populus trichocarpa]
Length=232

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = -1

Query  737  SGPVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQG  558
            SGPV+LGPKSFGS+VEMF+Y Y  LH W PN+ +N+YEHMVL++L+K GH++P KKIG G
Sbjct  88   SGPVSLGPKSFGSAVEMFDYFYNFLHQWPPNIKVNKYEHMVLVDLLKTGHSEPDKKIGSG  147

Query  557  IGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVDRILPLPESMQIK  414
            I AFQVR HP FKSRC F++R D S DDFSFRKCVD ILPLPE +++K
Sbjct  148  IQAFQVRFHPRFKSRCLFLIRDDDSVDDFSFRKCVDHILPLPEDLKVK  195



>gb|KHG30734.1| DNA-directed RNA polymerase D subunit 1 -like protein [Gossypium 
arboreum]
Length=216

 Score =   154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 85/145 (59%), Positives = 111/145 (77%), Gaps = 9/145 (6%)
 Frame = -1

Query  830  SKKVRVDKSVEEQRLEILEGSQVGEGKKDDKSGPVTLGPKSFGSSVEMFEYCYKLLHHWA  651
            SKK + +KSV++   EI+E + V        S  V LGPK FGSSVEMF+Y Y LLH+WA
Sbjct  63   SKKQKAEKSVDD---EIIEKNSVPSV-----SSRVRLGPKEFGSSVEMFDYFYNLLHYWA  114

Query  650  PNLDINEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDF  471
             +L++N+YEHMVLLEL+KKGH +P KKIG+GI  FQVR HP++KS+CFF+++ D + DDF
Sbjct  115  THLNLNKYEHMVLLELLKKGHEEPDKKIGKGIKGFQVRIHPVWKSKCFFVIKDDDTFDDF  174

Query  470  SFRKCVDRILPLPESMQIKHNANKA  396
            SFRKCVD ILPLP+ M+ + +ANKA
Sbjct  175  SFRKCVDHILPLPDEMK-QPDANKA  198



>gb|ABF94367.1| expressed protein [Oryza sativa Japonica Group]
Length=132

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -1

Query  689  MFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRC  510
            MF+Y + LLH WAP L+IN+YEHMVL +L+KKGHA+  +KIG GI AF++RNHP+F+SRC
Sbjct  1    MFDYFFALLHSWAPQLEINKYEHMVLEDLLKKGHAESDRKIGAGIEAFEIRNHPVFQSRC  60

Query  509  FFIVRVDGSADDFSFRKCVDRILPLPESMQIKHNAN  402
            FF+ RVDGS+DDFSFRKCVD ILPLPE M+I + +N
Sbjct  61   FFVRRVDGSSDDFSFRKCVDSILPLPEDMKIGNKSN  96



>gb|KHN32529.1| Protein DCL, chloroplastic [Glycine soja]
Length=136

 Score =   149 bits (377),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = -1

Query  689  MFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRC  510
            MF Y Y  LH W   L++N+YEH++LLEL+K GHA+P KKIG G+ AFQVR HP FKSRC
Sbjct  1    MFHYFYNFLHTWPQYLNVNKYEHLMLLELLKNGHAEPDKKIGGGVRAFQVRKHPTFKSRC  60

Query  509  FFIVRVDGSADDFSFRKCVDRILPLPESMQIKHNANKAL  393
            FF++R D SADDFSFRKCVD ILPLPE M +K +ANKAL
Sbjct  61   FFLIREDDSADDFSFRKCVDHILPLPEEMHLKSDANKAL  99



>gb|KHN26248.1| DNA-directed RNA polymerase E subunit 1 [Glycine soja]
Length=139

 Score =   149 bits (377),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = -1

Query  689  MFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRC  510
            MF Y Y  LH W   L++N+YEH++LLEL+K GHA+P KKIG G+ AFQVR HP FKSRC
Sbjct  1    MFHYFYNFLHTWPQYLNVNKYEHLMLLELLKNGHAEPDKKIGGGVRAFQVRKHPTFKSRC  60

Query  509  FFIVRVDGSADDFSFRKCVDRILPLPESMQIKHNANKAL  393
            FF++R D SADDFSFRKCVD ILPLPE M +K +ANKAL
Sbjct  61   FFLIREDDSADDFSFRKCVDHILPLPEEMHLKFDANKAL  99



>emb|CBI15220.3| unnamed protein product [Vitis vinifera]
Length=128

 Score =   149 bits (376),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = -1

Query  689  MFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRC  510
            MF++ +K LH+W  NLD+N+YEHM+LL+L+KKGH +P KKIG GI AFQVR HP+FKSRC
Sbjct  1    MFDHFFKFLHYWPANLDVNKYEHMMLLDLLKKGHTEPDKKIGGGIHAFQVRYHPVFKSRC  60

Query  509  FFIVRVDGSADDFSFRKCVDRILPLPESMQIKHNANKAL  393
            FF++R D S DDFSFRKCVD I PLPE+M+ K   NKAL
Sbjct  61   FFVIRDDESVDDFSFRKCVDHISPLPENMKAKSEVNKAL  99



>gb|KHG30737.1| DNA-directed RNA polymerase D subunit 1 -like protein [Gossypium 
arboreum]
Length=197

 Score =   149 bits (377),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 108/145 (74%), Gaps = 9/145 (6%)
 Frame = -1

Query  830  SKKVRVDKSVEEQRLEILEGSQVGEGKKDDKSGPVTLGPKSFGSSVEMFEYCYKLLHHWA  651
            SKK + + SV++   EI+E + V        S  V LGPK FGSSVEMF+Y Y LLH+WA
Sbjct  44   SKKQKAETSVDD---EIIEKNSV-----PSVSNRVRLGPKEFGSSVEMFDYFYNLLHYWA  95

Query  650  PNLDINEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDF  471
             +L++N+YEHMVLLEL+KKGH +P KKIG+GI  FQVR HP++KS+CFF++  D + DDF
Sbjct  96   THLNLNKYEHMVLLELLKKGHEEPDKKIGKGIKGFQVRIHPVWKSKCFFVINDDDTFDDF  155

Query  470  SFRKCVDRILPLPESMQIKHNANKA  396
            SFRKCVD ILPLP+ M+ + + NKA
Sbjct  156  SFRKCVDHILPLPDEMK-QPDTNKA  179



>gb|KHN48689.1| DNA-directed RNA polymerase E subunit 1 [Glycine soja]
Length=128

 Score =   145 bits (365),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = -1

Query  689  MFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRC  510
            MF+Y Y LLH W   L++N+YEHM+LLEL+K GH +P  KIG GI  FQVR HP++KSRC
Sbjct  1    MFDYFYNLLHAWPAYLNLNQYEHMMLLELLKNGHTEPDTKIGGGIRVFQVRKHPMWKSRC  60

Query  509  FFIVRVDGSADDFSFRKCVDRILPLPESMQIKHNANKAL  393
            FF+VR D S DDFSFRKCVD ILPLP+ MQ++ +AN+AL
Sbjct  61   FFLVRDDESVDDFSFRKCVDHILPLPQEMQVRPDANRAL  99



>ref|XP_002319012.2| hypothetical protein POPTR_0013s02280g [Populus trichocarpa]
 gb|EEE94935.2| hypothetical protein POPTR_0013s02280g [Populus trichocarpa]
Length=152

 Score =   145 bits (365),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 89/117 (76%), Gaps = 0/117 (0%)
 Frame = -1

Query  752  KKDDKSGPVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQK  573
            KK ++ GPV LGPK+F S+VEMF++ Y  LH W PNL++N++EHMVL+EL+ + H +P+K
Sbjct  13   KKQEEVGPVRLGPKTFVSAVEMFDFFYNFLHFWPPNLNVNKFEHMVLVELLMQDHLEPEK  72

Query  572  KIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVDRILPLPESMQIKHNAN  402
            KIG GI AFQ+R  P++K+RC F++  D   DDFSF K  D ILPLPE M+IK +A+
Sbjct  73   KIGCGIQAFQLRFRPMWKTRCIFLIWDDEFVDDFSFWKRTDNILPLPEDMRIKSDAS  129



>ref|XP_008795182.1| PREDICTED: protein DCL, chloroplastic-like [Phoenix dactylifera]
Length=100

 Score =   140 bits (354),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = -1

Query  728  VTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIGA  549
            V+LGPK F SS EMF+Y + LL HW+ NLDINEYEHMVLL+++++GH +P KKIG+GI A
Sbjct  3    VSLGPKVFDSSKEMFDYYFNLLRHWSLNLDINEYEHMVLLDILQRGHPEPDKKIGEGIRA  62

Query  548  FQVRNHPIFKSRCFFIVRVDGSADDFSFRKCV  453
            FQVR  P +KSRCFFIV VDG+ DDFSFRKC+
Sbjct  63   FQVRYRPAWKSRCFFIVWVDGADDDFSFRKCI  94



>ref|XP_002977413.1| hypothetical protein SELMODRAFT_417447 [Selaginella moellendorffii]
 gb|EFJ21417.1| hypothetical protein SELMODRAFT_417447 [Selaginella moellendorffii]
Length=248

 Score =   144 bits (362),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 82/103 (80%), Gaps = 1/103 (1%)
 Frame = -1

Query  728  VTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIG-  552
            V LGP +F S  EMF Y Y+LLH WA + D+NEYEHMVLL+L+ KGH DP+ K+G G   
Sbjct  94   VKLGPMTFSSGKEMFMYFYELLHGWAADYDMNEYEHMVLLDLLNKGHNDPEAKMGPGGAK  153

Query  551  AFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVDRILPLPESM  423
            AFQ+R HP+++SRC+++VR DG+A DFS+RKCVD+++PLP+ +
Sbjct  154  AFQIRVHPVWRSRCYYLVRADGTAVDFSYRKCVDKLMPLPQEI  196



>ref|XP_002974996.1| hypothetical protein SELMODRAFT_442719 [Selaginella moellendorffii]
 gb|EFJ23781.1| hypothetical protein SELMODRAFT_442719 [Selaginella moellendorffii]
Length=249

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 82/103 (80%), Gaps = 1/103 (1%)
 Frame = -1

Query  728  VTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIG-  552
            V LGP +F S  EMF Y Y+LLH WA + D+NEYEHMVLL+L+ KGH DP+ K+G G   
Sbjct  95   VKLGPMTFSSGKEMFMYFYELLHGWAADYDMNEYEHMVLLDLLNKGHNDPEAKMGPGGAK  154

Query  551  AFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVDRILPLPESM  423
            AFQ+R HP+++SRC+++VR DG+A DFS+RKCVD+++PLP+ +
Sbjct  155  AFQIRVHPVWRSRCYYLVRADGTAVDFSYRKCVDKLMPLPQEI  197



>ref|XP_001753803.1| predicted protein [Physcomitrella patens]
 gb|EDQ81555.1| predicted protein [Physcomitrella patens]
Length=141

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 83/110 (75%), Gaps = 3/110 (3%)
 Frame = -1

Query  752  KKDDKSGPVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQK  573
            ++D    P  LGPK F ++VEMF Y Y LLH W  NL +N+YE+MVL EL+ +G  +PQK
Sbjct  2    QEDQSVEPKKLGPKVFNTAVEMFIYFYDLLHEWTLNLSVNKYEYMVLSELVAQG--NPQK  59

Query  572  KIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVDRILPLPESM  423
             IG GI AFQ+RNHP +KSRC++++R DGS +DFS+RKCVD ++PLP S+
Sbjct  60   -IGDGIAAFQIRNHPQWKSRCYYLIRKDGSEEDFSYRKCVDALMPLPASI  108



>ref|XP_001753605.1| predicted protein [Physcomitrella patens]
 gb|EDQ81828.1| predicted protein, partial [Physcomitrella patens]
Length=171

 Score =   131 bits (329),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 86/116 (74%), Gaps = 6/116 (5%)
 Frame = -1

Query  761  GEGKKDDKSGPV---TLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKG  591
             +G   D+S PV    LGPK F + V+MF Y Y LLH W  N+++N+YE++VL EL+ +G
Sbjct  23   ADGTVGDESKPVEAKKLGPKVFETPVKMFSYFYNLLHDWQFNVNVNKYEYLVLSELVAQG  82

Query  590  HADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVDRILPLPESM  423
              +PQK +G GI AFQ+RNHP +KSRC++++R DGS +DFS+RKCVD ++PLP ++
Sbjct  83   --NPQK-VGDGIAAFQIRNHPEWKSRCYYLIRKDGSEEDFSYRKCVDALMPLPANL  135



>ref|XP_004497728.1| PREDICTED: uncharacterized protein LOC101504695 [Cicer arietinum]
Length=125

 Score =   127 bits (318),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = -1

Query  638  INEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRK  459
            + +YEH +LLELI KGH +P KKIG  I AFQVR HP++KS+CFF++R D SADDFSFRK
Sbjct  18   VWQYEHKMLLELIMKGHPEPHKKIGGEICAFQVRRHPMWKSKCFFLIREDESADDFSFRK  77

Query  458  CVDRILPLPESMQIKHNANKAL  393
            CVD ILPLPE+MQ+KH+AN+AL
Sbjct  78   CVDHILPLPEAMQVKHDANRAL  99



>ref|XP_004492623.1| PREDICTED: uncharacterized protein LOC101492280 [Cicer arietinum]
Length=161

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = -1

Query  629  YEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVD  450
            YEH +LLELI KGH +P KKIG  I AFQVR HP++KS+CFF++R D SADDFSFRKCVD
Sbjct  57   YEHKMLLELIMKGHPEPHKKIGGEICAFQVRMHPMWKSKCFFLIREDESADDFSFRKCVD  116

Query  449  RILPLPESMQIKHNANKAL  393
             ILPLPE+MQ+KH+AN+AL
Sbjct  117  HILPLPEAMQVKHDANRAL  135



>ref|XP_003609061.1| hypothetical protein MTR_4g108450 [Medicago truncatula]
 gb|KEH16585.1| DUF3223 family protein [Medicago truncatula]
Length=195

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 70/99 (71%), Gaps = 13/99 (13%)
 Frame = -1

Query  689  MFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRC  510
            +F+Y    LH W PNL++N+YEH +LLEL+ KGH +P +KIG  I AFQVR         
Sbjct  82   LFDYFNSFLHAWGPNLNVNKYEHTMLLELLMKGHPEPDQKIGGKIRAFQVR---------  132

Query  509  FFIVRVDGSADDFSFRKCVDRILPLPESMQIKHNANKAL  393
                + D SADDFSFRKCVD ILPLPE+MQ+KH+AN+AL
Sbjct  133  ----KEDESADDFSFRKCVDHILPLPEAMQVKHDANRAL  167



>emb|CAN70579.1| hypothetical protein VITISV_004014 [Vitis vinifera]
Length=101

 Score =   115 bits (287),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -1

Query  620  MVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVDRIL  441
            M+LL+L+KKGH +P KKIG GI AFQVR HP+FKSRCFF++R D S DDFSFRKCVD I 
Sbjct  1    MMLLDLLKKGHTEPDKKIGGGIHAFQVRYHPVFKSRCFFVIRDDESVDDFSFRKCVDHIS  60

Query  440  PLPESMQIKHNANKAL  393
            PLPE+M+ K   NKAL
Sbjct  61   PLPENMKAKSEVNKAL  76



>dbj|BAB11494.1| unnamed protein product [Arabidopsis thaliana]
Length=100

 Score =   112 bits (280),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = -1

Query  620  MVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVDRIL  441
            MVLL+LIKKGH++P+KKIG GI  FQVR HP++KSRCFF+VR D +ADDFSFRKCVD+IL
Sbjct  1    MVLLDLIKKGHSEPEKKIGGGIKTFQVRTHPMWKSRCFFLVREDDTADDFSFRKCVDQIL  60

Query  440  PLPESMQ  420
            PLPE+M+
Sbjct  61   PLPENMK  67



>emb|CEF98737.1| Copper amine oxidase, N2/N3-terminal, partial [Ostreococcus tauri]
Length=218

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 68/103 (66%), Gaps = 0/103 (0%)
 Frame = -1

Query  746  DDKSGPVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKI  567
            D    PVTLGPK+F S  ++ +Y  KL +    + ++NEYE  V   L++ GHA+ +KK 
Sbjct  50   DATPAPVTLGPKTFTSGDDLMKYFGKLRNELTLDQNMNEYEQSVTEALLRLGHAEAEKKF  109

Query  566  GQGIGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVDRILP  438
            G G+ +FQVRNHP   SRCF IVRVD + +DFS+RKC  R+ P
Sbjct  110  GAGLRSFQVRNHPTHGSRCFMIVRVDNTVEDFSYRKCAGRLFP  152



>ref|XP_009615031.1| PREDICTED: protein DCL, chloroplastic-like [Nicotiana tomentosiformis]
Length=96

 Score =   107 bits (266),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = -1

Query  620  MVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVDRIL  441
            MVLL+L+KKGH++P+KKI  G+ AFQ+R  P FKS CFF+VR D S DDFSFRKC+D+I 
Sbjct  1    MVLLDLLKKGHSEPEKKIRTGVRAFQIRFQPQFKSCCFFVVREDDSVDDFSFRKCLDQIQ  60

Query  440  PLPESMQIKHNAN  402
            PLP +MQ+KH AN
Sbjct  61   PLPANMQVKHYAN  73



>ref|XP_002500133.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO61391.1| predicted protein [Micromonas sp. RCC299]
Length=218

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 67/98 (68%), Gaps = 0/98 (0%)
 Frame = -1

Query  731  PVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIG  552
            PV LGPK+F S  EM +Y   LL+    N D+N+YE MV+   ++  H + +KKIG GI 
Sbjct  53   PVKLGPKTFNSPDEMIKYFSWLLNAMTMNQDMNDYERMVVEACLRDAHPEAEKKIGCGIK  112

Query  551  AFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVDRILP  438
            +FQ+R HP   SRC+ +VR DG+ +DFS+RKCV+++ P
Sbjct  113  SFQIRTHPEHDSRCYMVVRTDGTCEDFSYRKCVEKLFP  150



>ref|XP_007514553.1| predicted protein [Bathycoccus prasinos]
 emb|CCO14793.1| predicted protein [Bathycoccus prasinos]
Length=240

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 74/116 (64%), Gaps = 2/116 (2%)
 Frame = -1

Query  782  ILEGSQVGEGKKDDKSGPVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLEL  603
            + E ++V E KK     PV LGPK+F +  +  +Y   LL+    + D+N+YE +V+  +
Sbjct  84   MAEEAEVAE-KKSPTWTPVKLGPKTFDTPEDAIKYISWLLNTVTMHQDLNDYERLVVEGM  142

Query  602  IKKGHADPQKKIGQ-GIGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVDRILP  438
            +++GH D +KKIG+ GI + QV+ H    S+C+++VR DGS  DFS+RKCV+   P
Sbjct  143  LRRGHEDAEKKIGESGIKSIQVKVHQEHDSKCYYVVRNDGSRSDFSYRKCVEGCFP  198



>ref|XP_003057804.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH57755.1| predicted protein [Micromonas pusilla CCMP1545]
Length=156

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = -1

Query  689  MFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRC  510
            M +Y   +L++   N D+N+YE MV+   ++  H D +KKIG GI AFQ+R HP  ++RC
Sbjct  1    MVKYFSWILNNMTINQDMNDYERMVVEPCLRTAHPDAEKKIGSGIKAFQIRTHPEHETRC  60

Query  509  FFIVRVDGSADDFSFRKCVDRILP  438
            + ++R DG+ +DFS+RKCV+ + P
Sbjct  61   YTVIRTDGTTEDFSYRKCVEVLFP  84



>ref|XP_005646811.1| hypothetical protein COCSUDRAFT_47805 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE22267.1| hypothetical protein COCSUDRAFT_47805 [Coccomyxa subellipsoidea 
C-169]
Length=350

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 58/98 (59%), Gaps = 0/98 (0%)
 Frame = -1

Query  731  PVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIG  552
            P  +G K F    E   Y   LL+       +NEYE  ++LEL+K GH +P+KK+G G+ 
Sbjct  133  PKKIGYKLFKDGKEAATYFRTLLNALTQRQPLNEYEFHMVLELLKNGHPEPEKKMGSGVK  192

Query  551  AFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVDRILP  438
            A  VR H    S CFF++R DGS DDFS  KC++R+ P
Sbjct  193  AIIVRKHQTEDSNCFFLLRTDGSMDDFSVFKCINRLFP  230



>ref|XP_001418710.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97003.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=200

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 47/68 (69%), Gaps = 0/68 (0%)
 Frame = -1

Query  641  DINEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDFSFR  462
            ++NEYE      L++ GH D  KK G G+ AFQVRNHP+  +RCF IVR DG+ +DFS+R
Sbjct  16   NMNEYEAATTEALLRLGHEDAAKKFGSGLRAFQVRNHPVHNTRCFMIVRTDGTMEDFSYR  75

Query  461  KCVDRILP  438
            KC  R+ P
Sbjct  76   KCAARLFP  83



>ref|XP_002957335.1| tRNA pseudouridine synthase mitochondrial precursor [Volvox carteri 
f. nagariensis]
 gb|EFJ41544.1| tRNA pseudouridine synthase mitochondrial precursor [Volvox carteri 
f. nagariensis]
Length=642

 Score = 88.6 bits (218),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 72/116 (62%), Gaps = 2/116 (2%)
 Frame = -1

Query  761  GEGKK-DDKSGPVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHA  585
            G GK+     GP+TLG +SF +     +Y   LL     + D+NEYE+ VLL+LI+KGH 
Sbjct  502  GAGKRRKGHVGPLTLGYRSFETGKACADYLKALLSTSPLDTDMNEYEYRVLLDLIQKGHP  561

Query  584  DPQKKIGQGIGAFQVRNHPI-FKSRCFFIVRVDGSADDFSFRKCVDRILPLPESMQ  420
                KIG G+ AFQVR++    ++R FF +R DG+ +DFS+ KC+ ++ P   ++Q
Sbjct  562  SAASKIGCGLRAFQVRHYNADGEARAFFAIRKDGTREDFSYVKCLGQLYPGEITLQ  617



>ref|XP_001774741.1| predicted protein [Physcomitrella patens]
 gb|EDQ60412.1| predicted protein [Physcomitrella patens]
Length=50

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 31/50 (62%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -1

Query  572  KIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVDRILPLPESM  423
            K+  GI AFQVR HP ++SRC+F++R DGS DDFSFRKCV+ ++PLPE++
Sbjct  1    KVAGGIVAFQVRIHPDWQSRCYFLIRKDGSDDDFSFRKCVNTLMPLPENL  50



>ref|XP_003597253.1| hypothetical protein MTR_2g094530 [Medicago truncatula]
 gb|AES67504.1| hypothetical protein MTR_2g094530 [Medicago truncatula]
Length=144

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 63/82 (77%), Gaps = 2/82 (2%)
 Frame = -1

Query  830  SKKVRVD--KSVEEQRLEILEGSQVGEGKKDDKSGPVTLGPKSFGSSVEMFEYCYKLLHH  657
            SKK +VD  KSVEE+RLE LE ++  E ++ + SG V LGPK+FGSS++MF Y +K LH 
Sbjct  55   SKKAKVDDEKSVEEERLERLEKNEGDEKEEKEASGGVNLGPKTFGSSLDMFYYFHKFLHA  114

Query  656  WAPNLDINEYEHMVLLELIKKG  591
            W  NL++N+YEHM+LLEL+K G
Sbjct  115  WLQNLNVNKYEHMMLLELLKNG  136



>gb|KFM25263.1| Guanine nucleotide-binding protein subunit beta-like protein 
1-like protein [Auxenochlorella protothecoides]
Length=465

 Score = 81.6 bits (200),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/147 (33%), Positives = 80/147 (54%), Gaps = 7/147 (5%)
 Frame = -1

Query  830  SKKVRVDKSVEEQRLEILEGSQVGEGKKDDKSGPVTLGPKSFGSSVEMFEYCYKLLHHWA  651
            +KK R D+  +       EGS   E +    S PVT+G ++F +   + EY   L     
Sbjct  24   AKKQRTDEGNDAD-----EGSDAMEVEPPSTSQPVTVGYRTFENGAALHEYYQGLHSKLR  78

Query  650  PNLDINEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRN--HPIFKSRCFFIVRVDGSAD  477
               ++N+YE  ++LELIKKGH D ++K+  G+ A Q++N  +   ++ CF ++R DGS +
Sbjct  79   SYQNLNDYEFHMVLELIKKGHPDAERKVPGGVAAIQLQNKEYDGRQTSCFHLIRPDGSVE  138

Query  476  DFSFRKCVDRILPLPESMQIKHNANKA  396
            D S+RKC+  +     ++  K +  KA
Sbjct  139  DVSYRKCIASLDATVATLLAKEDGKKA  165



>ref|XP_005848324.1| hypothetical protein CHLNCDRAFT_145004 [Chlorella variabilis]
 gb|EFN56222.1| hypothetical protein CHLNCDRAFT_145004 [Chlorella variabilis]
Length=230

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 63/107 (59%), Gaps = 6/107 (6%)
 Frame = -1

Query  761  GEGKKDDKSGPVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHAD  582
            GE        PVT+G ++F +  + ++Y + L+       ++N+YE  ++ +LIKKGH +
Sbjct  68   GEAAAKAPQEPVTIGYRTFATGKQCYDYFHSLMTKLRKYQNLNDYEFHMVHDLIKKGHPE  127

Query  581  PQKKIGQGIGAFQVRN----HPIFKSRCFFIVRVDGSADDFSFRKCV  453
              +K+  G+ A Q+R+    H +  S CFF++  DGS +D S+RKC+
Sbjct  128  AARKLEGGVRAIQLRDVDMGHAV--SSCFFLIHEDGSDEDVSYRKCL  172



>ref|XP_004348505.1| RNA binding motif protein [Acanthamoeba castellanii str. Neff]
 gb|ELR22047.1| RNA binding motif protein [Acanthamoeba castellanii str. Neff]
Length=308

 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 62/102 (61%), Gaps = 3/102 (3%)
 Frame = -1

Query  728  VTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIGA  549
            VTLG K++  S  +      +L +   N  + + E  ++L+L+++GHA   +KIG G+  
Sbjct  7    VTLGGKTYNRSDTLARAVKDILFNL--NAKLKQEEENLVLDLLRQGHAKADEKIGSGVKH  64

Query  548  FQVRNHPIF-KSRCFFIVRVDGSADDFSFRKCVDRILPLPES  426
             +V +HP + +SRCF +VR D +  DFS+RKCV+ +  + +S
Sbjct  65   IKVGSHPEYPESRCFHVVRTDDTTADFSYRKCVETLFGVEKS  106



>emb|CDY16774.1| BnaA09g06080D [Brassica napus]
Length=62

 Score = 64.7 bits (156),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  527  IFKSRCFFIVRVDGSADDFSFRKCVDRILPLPESM  423
            ++KSRCFF+VR D SADDFS+RKCVD ILPLPE+M
Sbjct  1    MWKSRCFFLVREDDSADDFSYRKCVDHILPLPENM  35



>emb|CDX87249.1| BnaC09g05640D [Brassica napus]
Length=64

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  527  IFKSRCFFIVRVDGSADDFSFRKCVDRILPLPESMQ  420
            ++KSRCFF+VR D SADDFS+RKCVD ILPLPE+M+
Sbjct  1    MWKSRCFFLVREDDSADDFSYRKCVDHILPLPENMK  36



>ref|XP_001755235.1| predicted protein [Physcomitrella patens]
 gb|EDQ80179.1| predicted protein [Physcomitrella patens]
Length=527

 Score = 68.9 bits (167),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 46/67 (69%), Gaps = 3/67 (4%)
 Frame = -1

Query  638  INEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRK  459
            I  YE+MVL+ELI +  ++   K+  GI AFQV  +P  +SRCF ++R DGS ++FSF+K
Sbjct  408  IQNYEYMVLIELIAQSDSN---KVAGGITAFQVHINPNCQSRCFILIREDGSKEEFSFKK  464

Query  458  CVDRILP  438
             V  ++P
Sbjct  465  YVKTLMP  471



>gb|KDD73790.1| hypothetical protein H632_c1835p1, partial [Helicosporidium sp. 
ATCC 50920]
Length=177

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 52/90 (58%), Gaps = 3/90 (3%)
 Frame = -1

Query  728  VTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIGA  549
            VT+G K+  S  +   Y   LL +      +NEYEH ++ EL+K GH D ++K+  G+ A
Sbjct  89   VTIGYKTM-SGAQTQAYFQDLLSNLRRYQSLNEYEHHMVCELVKLGHPDAERKLAGGVRA  147

Query  548  FQVRN--HPIFKSRCFFIVRVDGSADDFSF  465
             QVR+  H    S+CFF++  DG  +D S+
Sbjct  148  VQVRDTEHEGATSKCFFLIHEDGKVEDVSY  177



>ref|WP_018827610.1| hypothetical protein [Salinispora pacifica]
Length=232

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 54/94 (57%), Gaps = 1/94 (1%)
 Frame = -1

Query  731  PVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIG  552
            P+T+G + F +     E C  +L+ +     + + +H   L+ +   H DP  KIG GI 
Sbjct  4    PLTIGARHFKTKKAAEEACRSILYGYPQGGIVTDPDHRQFLDDLLLRHHDPVGKIGCGIL  63

Query  551  AFQVRNHPIFKSRC-FFIVRVDGSADDFSFRKCV  453
             ++VR +P + S+  F++VRVDG+  DFSF +C+
Sbjct  64   RYEVRQNPAYPSQTSFYLVRVDGTETDFSFIRCI  97



>ref|XP_006382591.1| hypothetical protein POPTR_0005s03530g [Populus trichocarpa]
 gb|ERP60388.1| hypothetical protein POPTR_0005s03530g [Populus trichocarpa]
Length=140

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 49/145 (34%), Positives = 67/145 (46%), Gaps = 37/145 (26%)
 Frame = -1

Query  827  KKVRVDKSVEEQRLEILEGSQVGEGKKDDKSGPVTLGPKSFGSSVEMFEYCYKLLHHWAP  648
            KK +V K +EE++LE L+G   GE K+ + SG V L  K F  S   F +    L  W P
Sbjct  13   KKQKVVKFMEEKQLEKLKGE--GEKKEQEGSGRVRLVQKDFCFSSGDFYFFNYFLQFWPP  70

Query  647  NLDINEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDFS  468
            NL++ ++E+M+LL                               R F      G  DD S
Sbjct  71   NLNVKKFEYMMLL------------------------------WRFF-----QGFVDDPS  95

Query  467  FRKCVDRILPLPESMQIKHNANKAL  393
            F K VD ILPLP+ M+I  +A+  L
Sbjct  96   FLKSVDNILPLPKDMKINSDASTYL  120



>ref|WP_011805632.1| hypothetical protein [Acidovorax sp. JS42]
 ref|YP_986664.1| hypothetical protein Ajs_2427 [Acidovorax sp. JS42]
 gb|ABM42588.1| conserved hypothetical protein [Acidovorax sp. JS42]
Length=99

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 54/96 (56%), Gaps = 2/96 (2%)
 Frame = -1

Query  740  KSGPVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQ  561
            K+ PV LG  +F S      +   +L  +AP   +++ E  VLLE +   H +   KIG+
Sbjct  3    KAKPVVLGDVTFKSESAARTFFKAMLRKYAPGDRVSD-EDAVLLERLLGRHPEVHGKIGE  61

Query  560  GIGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCV  453
            GI  F+V +H  F S+CF + R DGS +DFS+  C+
Sbjct  62   GIDHFEVMSH-TFNSQCFAVHRTDGSFEDFSYTWCI  96



>ref|WP_018586305.1| hypothetical protein [Salinispora arenicola]
Length=232

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 54/94 (57%), Gaps = 1/94 (1%)
 Frame = -1

Query  731  PVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIG  552
            P+T+G + F +     + C  +L+ +     + + +H   L+ +   H DP  KIG GI 
Sbjct  4    PLTIGARHFKTKKAAEDACRSILYGYPQGGIVTDPDHRQFLDDLLLRHHDPVGKIGCGIL  63

Query  551  AFQVRNHPIFKSRC-FFIVRVDGSADDFSFRKCV  453
             ++VR +P + S+  F++VRVDG+  DFSF +C+
Sbjct  64   RYEVRQNPAYPSQTSFYLVRVDGTETDFSFIRCI  97



>ref|WP_018791465.1| hypothetical protein [Salinispora arenicola]
Length=232

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 54/94 (57%), Gaps = 1/94 (1%)
 Frame = -1

Query  731  PVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIG  552
            P+T+G + F +     + C  +L+ +     + + +H   L+ +   H DP  KIG GI 
Sbjct  4    PLTIGARHFKTKKAAEDACRSILYGYPQGGIVTDPDHRQFLDDLLLRHHDPVGKIGCGIL  63

Query  551  AFQVRNHPIFKSRC-FFIVRVDGSADDFSFRKCV  453
             ++VR +P + S+  F++VRVDG+  DFSF +C+
Sbjct  64   RYEVRQNPAYPSQTSFYLVRVDGTETDFSFIRCI  97



>ref|WP_011388568.1| hypothetical protein [Rhodospirillum rubrum]
 ref|YP_425901.1| hypothetical protein Rru_A0810 [Rhodospirillum rubrum ATCC 11170]
 ref|YP_006047102.1| hypothetical protein F11_04175 [Rhodospirillum rubrum F11]
 gb|ABC21614.1| conserved hypothetical protein [Rhodospirillum rubrum ATCC 11170]
 gb|AEO47305.1| hypothetical protein F11_04175 [Rhodospirillum rubrum F11]
Length=96

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 29/96 (30%), Positives = 54/96 (56%), Gaps = 2/96 (2%)
 Frame = -1

Query  740  KSGPVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQ  561
            K+ P+ +    F    +   +   +L+ + P   ++  +   L+E +K+ H D   KIG 
Sbjct  3    KAQPIEIAGHEFARKADALAFMKVMLNRYRPGDIVSTVDGAFLVEALKR-HPDATSKIGP  61

Query  560  GIGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCV  453
            G+  F+VR+   + ++CF+I+R DGS + FS++KCV
Sbjct  62   GVRNFEVRSAD-YGTQCFWILRTDGSEERFSYKKCV  96



>ref|XP_002504634.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO65892.1| predicted protein [Micromonas sp. RCC299]
Length=861

 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 54/101 (53%), Gaps = 7/101 (7%)
 Frame = -1

Query  728  VTLG--PKSFGSSVEMFEYCYKLLHHWAP---NLDINEYEHMVLLELIKKGHADPQKKIG  564
            VTLG    +FGS  +   +  +LL   +P   +  +    H VLL+ + + H D + K+G
Sbjct  76   VTLGDGAVTFGSPDDAMRFFNRLLET-SPVDEDWPVAGETHAVLLDALGR-HPDARDKMG  133

Query  563  QGIGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVDRIL  441
             G+  F+V  HP    R F   RVDG+A DFS RKCVD + 
Sbjct  134  DGVATFRVSLHPTEGYRSFVATRVDGTAVDFSLRKCVDAMF  174



>ref|WP_028184335.1| hypothetical protein [Salinispora arenicola]
Length=232

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/94 (32%), Positives = 53/94 (56%), Gaps = 1/94 (1%)
 Frame = -1

Query  731  PVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIG  552
            P+ +G + F +     + C  +L+ +     + + +H   L+ +   H DP  KIG GI 
Sbjct  4    PLIIGARHFKTKKAAEDACRSILYGYPQGGIVTDPDHRQFLDDLLLRHHDPVGKIGCGIL  63

Query  551  AFQVRNHPIFKSRC-FFIVRVDGSADDFSFRKCV  453
             ++VR +P + S+  F++VRVDG+  DFSF +C+
Sbjct  64   RYEVRQNPAYPSQTSFYLVRVDGTETDFSFIRCI  97



>pdb|2K0M|A Chain A, Solution Nmr Structure Of The Uncharacterized Protein 
From Rhodospirillum Rubrum Gene Locus Rru_a0810. Northeast 
Structural Genomics Target Rrr43
Length=104

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 29/96 (30%), Positives = 54/96 (56%), Gaps = 2/96 (2%)
 Frame = -1

Query  740  KSGPVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQ  561
            K+ P+ +    F    +   +   +L+ + P   ++  +   L+E +K+ H D   KIG 
Sbjct  3    KAQPIEIAGHEFARKADALAFMKVMLNRYRPGDIVSTVDGAFLVEALKR-HPDATSKIGP  61

Query  560  GIGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCV  453
            G+  F+VR+   + ++CF+I+R DGS + FS++KCV
Sbjct  62   GVRNFEVRSAD-YGTQCFWILRTDGSEERFSYKKCV  96



>ref|WP_011388268.1| hypothetical protein [Rhodospirillum rubrum]
 ref|YP_425601.1| hypothetical protein Rru_A0510 [Rhodospirillum rubrum ATCC 11170]
 ref|YP_006046790.1| hypothetical protein F11_02615 [Rhodospirillum rubrum F11]
 gb|ABC21314.1| conserved hypothetical protein [Rhodospirillum rubrum ATCC 11170]
 gb|AEO46993.1| hypothetical protein F11_02615 [Rhodospirillum rubrum F11]
Length=98

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 29/93 (31%), Positives = 50/93 (54%), Gaps = 2/93 (2%)
 Frame = -1

Query  731  PVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIG  552
            P+ LGP  F    +   Y +K+LH +     +++ + ++L   +   H D + K+G GI 
Sbjct  5    PIDLGPMHFEKKEDAVAYLHKMLHRYDLGDKVSDDDAIILRAALAH-HRDAEVKVGCGIT  63

Query  551  AFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCV  453
             F VR    F +RCF++ R DG+ + FS + C+
Sbjct  64   YFSVRTAD-FGTRCFWLNRNDGTTEKFSHKTCI  95



>dbj|BAB11495.1| unnamed protein product [Arabidopsis thaliana]
Length=135

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 35/50 (70%), Gaps = 3/50 (6%)
 Frame = -1

Query  767  QVGEGKKDDKSGPVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHM  618
            +VGE   ++KSGPV LGPK F +SV MF+Y  K LH W  +LD+N+  H+
Sbjct  57   KVGE---EEKSGPVKLGPKEFVTSVAMFDYFVKFLHFWPTDLDVNKVIHI  103



>gb|KDP38331.1| hypothetical protein JCGZ_04256 [Jatropha curcas]
Length=208

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = -1

Query  617  VLLELIKKGHADPQKKIGQGIGAFQVRNHPIF-KSRCFFIVRVDGSADDFSFRKCV  453
             ++E +   H + +KKIG GI    VRNHP F +SRC FIVR DG   DFS+ KC+
Sbjct  127  TIVEKLLPYHPEYEKKIGCGIDYITVRNHPDFERSRCLFIVRKDGELVDFSYWKCI  182



>ref|XP_002459901.1| hypothetical protein SORBIDRAFT_02g014000 [Sorghum bicolor]
 gb|EER96422.1| hypothetical protein SORBIDRAFT_02g014000 [Sorghum bicolor]
Length=195

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = -1

Query  617  VLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVDRIL  441
            V+ E +   H   ++KIG G+    V  HP FKSRC F VR +G  +DFS+RKC+   L
Sbjct  94   VVTEKLLSHHPRAEEKIGCGLDGIMVDRHPEFKSRCLFAVRTNGDLEDFSYRKCLRAYL  152



>ref|XP_007160882.1| hypothetical protein PHAVU_001G024800g [Phaseolus vulgaris]
 gb|ESW32876.1| hypothetical protein PHAVU_001G024800g [Phaseolus vulgaris]
Length=187

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 33/51 (65%), Gaps = 1/51 (2%)
 Frame = -1

Query  590  HADPQKKIGQGIGAFQVRNHPIFK-SRCFFIVRVDGSADDFSFRKCVDRIL  441
            H D + KIG G+GA  V  HP++   RC F+VR DGS  DFS+R C++  +
Sbjct  111  HPDYEDKIGSGLGAIMVDQHPLYLFPRCLFVVRTDGSWIDFSYRVCLEEYI  161



>tpg|DAA43777.1| TPA: hypothetical protein ZEAMMB73_746378 [Zea mays]
Length=169

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = -1

Query  731  PVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKK  594
            PV LGPK F S+++MF Y Y LLH W P L+ N+    V++ + KK
Sbjct  117  PVKLGPKEFASAIDMFNYFYALLHSWTPQLEFNKVRVRVVILVAKK  162



>emb|CDY60335.1| BnaC03g72290D [Brassica napus]
Length=1869

 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 39/67 (58%), Gaps = 1/67 (1%)
 Frame = -1

Query  638   INEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIF-KSRCFFIVRVDGSADDFSFR  462
             I++ +   +LE I   H D   K+G G+    V  H  F +SRCFF+V  DG+  DFS+R
Sbjct  1715  ISDEDKTYVLEQILNYHPDKDAKLGPGLDFITVDKHTTFTESRCFFVVSTDGTKQDFSYR  1774

Query  461   KCVDRIL  441
             KC++  L
Sbjct  1775  KCINNYL  1781



>ref|NP_001062578.1| Os09g0112400 [Oryza sativa Japonica Group]
 dbj|BAD17553.1| putative DCL protein [Oryza sativa Japonica Group]
 dbj|BAF24492.1| Os09g0112400 [Oryza sativa Japonica Group]
 dbj|BAG98628.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC84087.1| hypothetical protein OsI_30385 [Oryza sativa Indica Group]
 gb|EEE69194.1| hypothetical protein OsJ_28381 [Oryza sativa Japonica Group]
Length=159

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = -1

Query  614  LLELIKKGHADPQKKIGQGIGAFQVRNHPIF-KSRCFFIVRVDGSADDFSFRKCV  453
            ++E +   H   + KIG G+ A  V  HP F KSRC FIVR +G  +DFS+RKC+
Sbjct  76   VVEKVLVHHPTSEDKIGCGVDAIMVGKHPDFRKSRCLFIVRTNGETEDFSYRKCI  130



>ref|XP_002991942.1| hypothetical protein SELMODRAFT_448611 [Selaginella moellendorffii]
 gb|EFJ07053.1| hypothetical protein SELMODRAFT_448611 [Selaginella moellendorffii]
Length=312

 Score = 57.0 bits (136),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -1

Query  626  EHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCV  453
            + ++LLE     H + + K+G GI   +V  HP F SRCFFIVR D S  DFS+RKC+
Sbjct  176  DELILLEEAIPYHPEREIKVGCGISYIKVDVHPEFGSRCFFIVRQDQSEIDFSYRKCM  233



>ref|NP_001148729.1| LOC100282345 [Zea mays]
 gb|ACG32671.1| DCL protein [Zea mays]
 tpg|DAA60612.1| TPA: DCL protein [Zea mays]
Length=191

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = -1

Query  617  VLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVDRIL  441
            V+ E +   H   ++KIG G+    V  HP FKSRC F+VR +G  +DFS+ KC+   L
Sbjct  94   VVREKLLSHHPRAEEKIGCGLDGIMVDRHPEFKSRCLFVVRTNGDWEDFSYHKCLRAYL  152



>ref|XP_006434757.1| hypothetical protein CICLE_v10002377mg [Citrus clementina]
 gb|ESR47997.1| hypothetical protein CICLE_v10002377mg [Citrus clementina]
Length=227

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 55/109 (50%), Gaps = 3/109 (3%)
 Frame = -1

Query  770  SQVGEGKKDDKSGPVTLGPKSFGSSVEMFEYCYKLLH--HWAPNLDINEYEHMVLLELIK  597
            S+  EG+ +D  G +    K    +V +  +   +LH   +   + ++      +LE + 
Sbjct  88   SEKDEGESEDDEGWIDWEDKILEDTVPLVGFVRMILHSGRYESGVRLSPEHERTILERLL  147

Query  596  KGHADPQKKIGQGIGAFQVRNHPIFKS-RCFFIVRVDGSADDFSFRKCV  453
              H + +KKIG GI    +  HP F+S RC FIVR DG   DFS+ KC+
Sbjct  148  PYHPEFEKKIGCGIDYITIGYHPDFESSRCLFIVRKDGELVDFSYWKCI  196



>ref|WP_002714803.1| hypothetical protein [Afipia clevelandensis]
 gb|EKS32130.1| hypothetical protein HMPREF9696_03933 [Afipia clevelandensis 
ATCC 49720]
Length=216

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/98 (32%), Positives = 53/98 (54%), Gaps = 2/98 (2%)
 Frame = -1

Query  731  PVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIG  552
            P+ +G  SF    +  E+  ++L    P + ++E +   +  L+++ H +   KIG G+ 
Sbjct  5    PLDIGDLSFARKGDAQEHFRQILRRHDPGVALSEPDATQVYWLLER-HPEAAVKIGAGVK  63

Query  551  AFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVDRILP  438
             F  R+  +F +RCF I R+DGS  DFS + C+D   P
Sbjct  64   EFSTRS-AMFDTRCFEIRRIDGSTTDFSVKPCLDGKAP  100



>ref|XP_008351988.1| PREDICTED: protein DCL, chloroplastic-like isoform X2 [Malus 
domestica]
Length=196

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 38/63 (60%), Gaps = 1/63 (2%)
 Frame = -1

Query  638  INEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFK-SRCFFIVRVDGSADDFSFR  462
            + E +  V++E +   H   + KIG GI +  V  HP FK SRC F++R DG   DFS++
Sbjct  124  LTEEDEKVVVERLLAHHPQSKDKIGCGIDSIMVDRHPQFKHSRCLFVIRTDGVWIDFSYQ  183

Query  461  KCV  453
            KC+
Sbjct  184  KCL  186



>ref|XP_006473317.1| PREDICTED: protein DCL, chloroplastic-like [Citrus sinensis]
 gb|KDO84151.1| hypothetical protein CISIN_1g027145mg [Citrus sinensis]
Length=227

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 55/109 (50%), Gaps = 3/109 (3%)
 Frame = -1

Query  770  SQVGEGKKDDKSGPVTLGPKSFGSSVEMFEYCYKLLH--HWAPNLDINEYEHMVLLELIK  597
            S+  EG+ +D  G +    K    +V +  +   +LH   +   + ++      +LE + 
Sbjct  88   SEKDEGESEDDEGWIDWEDKILEDTVPLVGFVRMILHSGRYESGVRLSPEHERTILERLL  147

Query  596  KGHADPQKKIGQGIGAFQVRNHPIFKS-RCFFIVRVDGSADDFSFRKCV  453
              H + +KKIG GI    +  HP F+S RC FIVR DG   DFS+ KC+
Sbjct  148  PYHPEFKKKIGCGIDYITIGYHPDFESSRCLFIVRKDGELVDFSYWKCI  196



>ref|XP_008803255.1| PREDICTED: DNA-directed RNA polymerase IV subunit 1 [Phoenix 
dactylifera]
Length=1567

 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 50/91 (55%), Gaps = 5/91 (5%)
 Frame = -1

Query  713   KSFGSSVEMFEYCYKL---LHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIGAFQ  543
             +S GS   + + C  L   LH +  N  +NE +   L+E +   H     K+G GI   +
Sbjct  1455  RSAGSWANIVDMCSNLRTILHEYPINGYLNETDKSCLMEALSY-HPKRDAKMGTGIQGIK  1513

Query  542   VRNHPIFK-SRCFFIVRVDGSADDFSFRKCV  453
             + + P+   SRCF +VR DG+ +DFS+RKC+
Sbjct  1514  IGHSPLHPGSRCFVLVRNDGTTEDFSYRKCI  1544



>gb|EPS63154.1| hypothetical protein M569_11634, partial [Genlisea aurea]
Length=125

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 46/80 (58%), Gaps = 7/80 (9%)
 Frame = -1

Query  620  MVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKS-RCFFIVRVDGSADDFSFRKCVDRI  444
            M+L +L+   H   + KIG G+  F V  HP F+S +C FIVR DG   DFS+ KC+  +
Sbjct  47   MILNKLLPY-HPHYESKIGSGVDHFVVGYHPTFESSKCLFIVRRDGEVVDFSYWKCIKGL  105

Query  443  L----PL-PESMQIKHNANK  399
            +    PL  ES  I+H  N+
Sbjct  106  IRKEYPLYAESFIIRHFRNR  125



>ref|XP_002989419.1| hypothetical protein SELMODRAFT_29281, partial [Selaginella moellendorffii]
 gb|EFJ09510.1| hypothetical protein SELMODRAFT_29281, partial [Selaginella moellendorffii]
Length=70

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/63 (38%), Positives = 40/63 (63%), Gaps = 1/63 (2%)
 Frame = -1

Query  638  INEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIF-KSRCFFIVRVDGSADDFSFR  462
            ++EY+  ++ E + + H    +KIG G+ +  +  HP + +SRCF I R+D S  DFS+R
Sbjct  8    LDEYDAKLIQEEVLRFHPRAAEKIGCGVASIMINYHPDYNRSRCFMINRLDESVCDFSYR  67

Query  461  KCV  453
            KC+
Sbjct  68   KCM  70



>dbj|BAJ90438.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93598.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=183

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 39/63 (62%), Gaps = 1/63 (2%)
 Frame = -1

Query  638  INEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFK-SRCFFIVRVDGSADDFSFR  462
            +N  +  V++E +   H   + KIG G+ A  V  HP FK SRC ++VR +G+  DFS+R
Sbjct  87   LNPEDEKVVVEKVLAHHPRSEDKIGCGLHAIMVNKHPDFKMSRCLYVVRTNGAWADFSYR  146

Query  461  KCV  453
            KC+
Sbjct  147  KCL  149



>ref|XP_010919205.1| PREDICTED: DNA-directed RNA polymerase IV subunit 1 [Elaeis guineensis]
Length=1569

 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 50/87 (57%), Gaps = 2/87 (2%)
 Frame = -1

Query  710   SFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNH  531
             S+ + V+M      +LH +  N  +NE +   L+E +   H   + K+G G+   ++ + 
Sbjct  1461  SWANIVDMCSNLRTILHEYPINGYLNETDKSCLMEALSY-HPKREAKMGTGVQGIKIGHS  1519

Query  530   PIFK-SRCFFIVRVDGSADDFSFRKCV  453
             P+   SRCF +VR DG+ +DFS+RKC+
Sbjct  1520  PLHPGSRCFVLVRNDGTTEDFSYRKCI  1546



>ref|XP_004140346.1| PREDICTED: LOW QUALITY PROTEIN: DNA-directed RNA polymerase E 
subunit 1-like [Cucumis sativus]
Length=2019

 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 36/59 (61%), Gaps = 1/59 (2%)
 Frame = -1

Query  614   LLELIKKGHADPQKKIGQGIGAFQVRNHPIFK-SRCFFIVRVDGSADDFSFRKCVDRIL  441
             +L+ +   H D   K+G GI  F V  H  F+ SRCF++V  DG  +DFS+RKC+D  +
Sbjct  1905  VLQSVFNFHPDKAAKMGAGIDHFMVSRHSSFQESRCFYVVTTDGHKEDFSYRKCLDNFI  1963



>gb|KHN22486.1| DNA-directed RNA polymerase E subunit 1 [Glycine soja]
Length=147

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 35/56 (63%), Gaps = 1/56 (2%)
 Frame = -1

Query  614  LLELIKKGHADPQKKIGQGIGAFQVRNHPIFK-SRCFFIVRVDGSADDFSFRKCVD  450
            ++E I   H D + KIG G+ +  V  HP++   RC F+VR DGS  DFS+R C++
Sbjct  63   VVENILIYHPDYEDKIGSGLNSIMVDQHPLYLFPRCLFVVRTDGSWIDFSYRVCIE  118



>ref|WP_036359675.1| hypothetical protein [Microvirga lupini]
Length=236

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 62/117 (53%), Gaps = 3/117 (3%)
 Frame = -1

Query  740  KSGPVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQ  561
            +S PV L  +SF +  +   +   +L+ + P   +++ + + L  L+++ H +   K+G 
Sbjct  3    RSKPVDLATRSFETQGDAKIFFKGMLNRYQPGQRVSDEDSLDLAALLER-HTEYANKVGC  61

Query  560  GIGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVDRILPLPESMQIKHNANKALR  390
            G+  F+V       ++CF I+RVDGS  DFS+  C+ +  P     ++ H   +A+R
Sbjct  62   GVSHFEVMMTE-HGTQCFRIIRVDGSGTDFSYGHCIAQRAP-SRKQEVSHAFRRAVR  116



>ref|XP_004155767.1| PREDICTED: DNA-directed RNA polymerase E subunit 1-like [Cucumis 
sativus]
Length=1959

 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 36/59 (61%), Gaps = 1/59 (2%)
 Frame = -1

Query  614   LLELIKKGHADPQKKIGQGIGAFQVRNHPIFK-SRCFFIVRVDGSADDFSFRKCVDRIL  441
             +L+ +   H D   K+G GI  F V  H  F+ SRCF++V  DG  +DFS+RKC+D  +
Sbjct  1845  VLQSVFNFHPDKAAKMGAGIDHFMVSRHSSFQESRCFYVVTTDGHKEDFSYRKCLDNFI  1903



>ref|WP_038069582.1| hypothetical protein [Thioclava dalianensis]
 gb|KEP68039.1| hypothetical protein DL1_15285 [Thioclava dalianensis]
Length=95

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 29/92 (32%), Positives = 49/92 (53%), Gaps = 2/92 (2%)
 Frame = -1

Query  731  PVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIG  552
            PV +G  SF    +  ++   +L+ +     +   +  +L  L+   H +  +KIG GI 
Sbjct  5    PVEIGSLSFARKGDANDFFRDMLYKYELGDKVTSKDAEILTHLMHM-HPEATEKIGPGIE  63

Query  551  AFQVRNHPIFKSRCFFIVRVDGSADDFSFRKC  456
            +F VR    + +RCF++ RVDG+ + FSFR C
Sbjct  64   SFSVRTAD-YGTRCFWVNRVDGTTEKFSFRAC  94



>ref|XP_008465860.1| PREDICTED: DNA-directed RNA polymerase V subunit 1 [Cucumis melo]
 ref|XP_008465867.1| PREDICTED: DNA-directed RNA polymerase V subunit 1 [Cucumis melo]
 ref|XP_008465874.1| PREDICTED: DNA-directed RNA polymerase V subunit 1 [Cucumis melo]
Length=1964

 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 36/59 (61%), Gaps = 1/59 (2%)
 Frame = -1

Query  614   LLELIKKGHADPQKKIGQGIGAFQVRNHPIFK-SRCFFIVRVDGSADDFSFRKCVDRIL  441
             +L+ +   H D   K+G GI  F V  H  F+ SRCF++V  DG  +DFS+RKC+D  +
Sbjct  1849  VLQSVFNFHPDKAAKMGAGIDHFMVSRHSSFQESRCFYVVTTDGHKEDFSYRKCLDNFI  1907



>gb|KGN51090.1| hypothetical protein Csa_5G435050 [Cucumis sativus]
Length=1963

 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 36/59 (61%), Gaps = 1/59 (2%)
 Frame = -1

Query  614   LLELIKKGHADPQKKIGQGIGAFQVRNHPIFK-SRCFFIVRVDGSADDFSFRKCVDRIL  441
             +L+ +   H D   K+G GI  F V  H  F+ SRCF++V  DG  +DFS+RKC+D  +
Sbjct  1849  VLQSVFNFHPDKAAKMGAGIDHFMVSRHSSFQESRCFYVVTTDGHKEDFSYRKCLDNFI  1907



>ref|XP_009133402.1| PREDICTED: DNA-directed RNA polymerase V subunit 1 [Brassica 
rapa]
Length=2059

 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 39/67 (58%), Gaps = 1/67 (1%)
 Frame = -1

Query  638   INEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIF-KSRCFFIVRVDGSADDFSFR  462
             I++ +   +LE I   H +   K+G G+    V  H  F +SRCFF+V  DG+  DFS+R
Sbjct  1887  ISDEDKTYVLEQILNYHPEKDAKLGPGLDFITVDKHTTFTESRCFFVVSTDGTKQDFSYR  1946

Query  461   KCVDRIL  441
             KC++  L
Sbjct  1947  KCINNYL  1953



>ref|XP_008351987.1| PREDICTED: protein DCL, chloroplastic-like isoform X1 [Malus 
domestica]
Length=211

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 38/63 (60%), Gaps = 1/63 (2%)
 Frame = -1

Query  638  INEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFK-SRCFFIVRVDGSADDFSFR  462
            + E +  V++E +   H   + KIG GI +  V  HP FK SRC F++R DG   DFS++
Sbjct  124  LTEEDEKVVVERLLAHHPQSKDKIGCGIDSIMVDRHPQFKHSRCLFVIRTDGVWIDFSYQ  183

Query  461  KCV  453
            KC+
Sbjct  184  KCL  186



>ref|XP_006855235.1| hypothetical protein AMTR_s00051p00224060 [Amborella trichopoda]
 gb|ERN16702.1| hypothetical protein AMTR_s00051p00224060 [Amborella trichopoda]
Length=204

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 35/56 (63%), Gaps = 1/56 (2%)
 Frame = -1

Query  617  VLLELIKKGHADPQKKIGQGIGAFQVRNHPIFK-SRCFFIVRVDGSADDFSFRKCV  453
            V++E +   H   Q KIG G+ A  V  HP F+ SRC F+VR DG   DFS++KC+
Sbjct  125  VVVEKLLAYHPHSQDKIGCGLDAIMVDRHPQFRNSRCLFVVRTDGGWIDFSYQKCL  180



>ref|WP_007120620.1| MULTISPECIES: hypothetical protein [Rhodobacteraceae]
 gb|EDQ03861.1| hypothetical protein OIHEL45_17746 [Oceanibulbus indolifex HEL-45]
 gb|KGB80891.1| hypothetical protein JT55_16175 [Rhodovulum sp. NI22]
Length=95

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 29/92 (32%), Positives = 49/92 (53%), Gaps = 2/92 (2%)
 Frame = -1

Query  731  PVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIG  552
            PV +G  SF    +  ++   +L+ +     +   +  +L  L+   H +  +KIG GI 
Sbjct  5    PVEIGSLSFARKGDANDFFRDMLYKYELGDKVTNEDAEILTHLMHM-HPEAAEKIGPGIE  63

Query  551  AFQVRNHPIFKSRCFFIVRVDGSADDFSFRKC  456
            +F VR    + +RCF++ RVDG+ + FSFR C
Sbjct  64   SFSVRTAD-YGTRCFWVNRVDGTTEKFSFRAC  94



>ref|XP_002962468.1| hypothetical protein SELMODRAFT_404272 [Selaginella moellendorffii]
 gb|EFJ35931.1| hypothetical protein SELMODRAFT_404272 [Selaginella moellendorffii]
Length=188

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 40/63 (63%), Gaps = 1/63 (2%)
 Frame = -1

Query  638  INEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIF-KSRCFFIVRVDGSADDFSFR  462
            ++EY+  ++ E + + H    +KIG G+ +  V  HP + +SRCF I R+D S  DFS+R
Sbjct  93   LDEYDAKLIQEEVLRFHPRAAEKIGCGVASIMVNYHPDYNRSRCFMINRLDESVCDFSYR  152

Query  461  KCV  453
            KC+
Sbjct  153  KCM  155



>ref|WP_027516036.1| hypothetical protein [Bradyrhizobium sp. WSM1417]
Length=98

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 30/96 (31%), Positives = 47/96 (49%), Gaps = 8/96 (8%)
 Frame = -1

Query  731  PVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEY---EHMVLLELIKKGHADPQKKIGQ  561
            P+ LGP  F    +   Y   +LH +    D+ +    +  V+L    + H D + K G 
Sbjct  5    PIDLGPLHFAKRGDAVAYLNDMLHRY----DVGDRVGADDTVILRTALEHHPDAEAKKGC  60

Query  560  GIGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCV  453
            GI  F VR    F ++CF++ R DG+ + FS R C+
Sbjct  61   GITHFSVRTAD-FGTKCFWLNRTDGTTEKFSHRACI  95



>ref|XP_003603048.1| Protein DCL [Medicago truncatula]
 gb|AES73299.1| DCL protein [Medicago truncatula]
Length=224

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 46/80 (58%), Gaps = 6/80 (8%)
 Frame = -1

Query  617  VLLELIKKGHADPQKKIGQGIGAFQVRNHPIF-KSRCFFIVRVDGSADDFSFRKCVDRIL  441
             ++E +   H + QKKIG GI    V  HP F +SRC FIVR DG   DFS+ KC+  ++
Sbjct  142  TIVEKLLPFHPESQKKIGCGIDYITVGYHPNFDRSRCMFIVRQDGELVDFSYWKCIKGLI  201

Query  440  ----PL-PESMQIKHNANKA  396
                PL  +S  ++H  N++
Sbjct  202  RKNYPLYADSFILRHFRNRS  221



>ref|XP_008348940.1| PREDICTED: DNA-directed RNA polymerase V subunit 1-like [Malus 
domestica]
Length=904

 Score = 56.2 bits (134),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 37/63 (59%), Gaps = 1/63 (2%)
 Frame = -1

Query  626  EHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFK-SRCFFIVRVDGSADDFSFRKCVD  450
            +   +L+ +   H D   K+G GIG   V  H  F+ SRCFF+V  DG  +DFS+RKC++
Sbjct  768  DQSFILDNVLNYHPDKAVKMGSGIGHLTVDRHGSFQDSRCFFVVTTDGHKEDFSYRKCLE  827

Query  449  RIL  441
              +
Sbjct  828  NYI  830



>ref|WP_023752066.1| MULTISPECIES: hypothetical protein [Mesorhizobium]
 gb|ESY47590.1| hypothetical protein X746_12680 [Mesorhizobium sp. LNJC380A00]
Length=96

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 26/93 (28%), Positives = 51/93 (55%), Gaps = 2/93 (2%)
 Frame = -1

Query  731  PVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIG  552
            P+ +    F    +   +   +L+ + P   ++  +   L E +K+ H + + KIG GI 
Sbjct  6    PLEIAGYQFERKTDALAFMKIMLNRYRPGDAVSAADVAFLAEALKR-HPEARTKIGSGIR  64

Query  551  AFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCV  453
            +F VR+   + ++CF+++R DGS + FS++ CV
Sbjct  65   SFDVRSAD-YGTKCFWVLRTDGSEERFSYKSCV  96



>ref|XP_003550320.1| PREDICTED: DNA-directed RNA polymerase V subunit 1-like isoform 
X1 [Glycine max]
 gb|KHN12815.1| DNA-directed RNA polymerase E subunit 1 [Glycine soja]
Length=176

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 35/56 (63%), Gaps = 1/56 (2%)
 Frame = -1

Query  614  LLELIKKGHADPQKKIGQGIGAFQVRNHPIFK-SRCFFIVRVDGSADDFSFRKCVD  450
            ++E I   H D + KIG G+ +  V  HP++   RC F+VR DGS  DFS+R C++
Sbjct  92   VVENILIYHPDYEDKIGSGLNSIMVDQHPLYLFPRCLFVVRTDGSWIDFSYRVCIE  147



>ref|WP_011084973.1| MULTISPECIES: hypothetical protein [Bradyrhizobium]
 ref|NP_768823.1| hypothetical protein bsl2183 [Bradyrhizobium diazoefficiens USDA 
110]
 ref|YP_005612502.1| hypothetical protein BJ6T_76690 [Bradyrhizobium japonicum USDA 
6]
 dbj|BAC47448.1| bsl2183 [Bradyrhizobium diazoefficiens USDA 110]
 dbj|BAL12914.1| hypothetical protein BJ6T_76690 [Bradyrhizobium japonicum USDA 
6]
 gb|AHY48789.1| hypothetical protein BJS_07507 [Bradyrhizobium japonicum SEMIA 
5079]
 gb|KGT73128.1| hypothetical protein MA20_46270 [Bradyrhizobium japonicum]
 gb|AJA65305.1| hypothetical protein RN69_37225 [Bradyrhizobium japonicum]
Length=98

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 28/93 (30%), Positives = 46/93 (49%), Gaps = 2/93 (2%)
 Frame = -1

Query  731  PVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIG  552
            P+ LGP  F    +   Y   +LH +     +   + ++L   ++  H D + K G GI 
Sbjct  5    PIDLGPLHFAKRGDAVAYLNDMLHRYDVGDRVGANDTVILRAALEH-HPDAEAKKGCGIT  63

Query  551  AFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCV  453
             F VR    F ++CF++ R DG+ + FS R C+
Sbjct  64   HFNVRTAD-FGTKCFWLNRTDGTTEKFSHRACI  95



>ref|WP_011975386.1| hypothetical protein [Sinorhizobium medicae]
 ref|YP_001326903.1| hypothetical protein Smed_1218 [Sinorhizobium medicae WSM419]
 gb|ABR60068.1| conserved hypothetical protein [Sinorhizobium medicae WSM419]
Length=96

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 54/96 (56%), Gaps = 2/96 (2%)
 Frame = -1

Query  740  KSGPVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQ  561
            K+  V +    F    +   +   +L+ + P   ++  + + LL+ +K+ H +   KIG 
Sbjct  3    KAQSVEIAGHQFPRKTDALAFLKVMLNRYRPGDIVHAEDEVFLLDALKR-HPEAAIKIGS  61

Query  560  GIGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCV  453
            G+  F+VR+   + ++CF+I+RVDG+ + FS++ C+
Sbjct  62   GVRGFEVRSAD-YGTQCFWILRVDGTDERFSYKSCI  96



>ref|XP_011074428.1| PREDICTED: protein DCL, chloroplastic [Sesamum indicum]
 ref|XP_011074429.1| PREDICTED: protein DCL, chloroplastic [Sesamum indicum]
Length=225

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 40/65 (62%), Gaps = 2/65 (3%)
 Frame = -1

Query  632  EYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKS-RCFFIVRVDGSADDFSFRKC  456
            E+E M+L  L+   H + +KKIG G+    +  HP F+S RC FIVR DG   DFS+ KC
Sbjct  139  EHERMILERLLPY-HPESEKKIGCGVDYITIGYHPNFESSRCLFIVRKDGELVDFSYWKC  197

Query  455  VDRIL  441
            +  ++
Sbjct  198  IKGLI  202



>ref|XP_006411250.1| hypothetical protein EUTSA_v10016128mg [Eutrema salsugineum]
 gb|ESQ52703.1| hypothetical protein EUTSA_v10016128mg [Eutrema salsugineum]
Length=1874

 Score = 55.8 bits (133),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 37/63 (59%), Gaps = 1/63 (2%)
 Frame = -1

Query  638   INEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIF-KSRCFFIVRVDGSADDFSFR  462
             I++ +   +LE +   H D   K+G G+    V  H  F +SRCFF+V  DG+  DFS+R
Sbjct  1726  ISDADKSYVLEHVLNFHPDKDSKLGSGVDFITVDKHTTFTESRCFFVVSTDGAKQDFSYR  1785

Query  461   KCV  453
             KC+
Sbjct  1786  KCI  1788



>ref|XP_007136687.1| hypothetical protein PHAVU_009G065400g [Phaseolus vulgaris]
 gb|ESW08681.1| hypothetical protein PHAVU_009G065400g [Phaseolus vulgaris]
Length=217

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 59/124 (48%), Gaps = 7/124 (6%)
 Frame = -1

Query  809  KSVEEQRLEILE--GSQVGEGKKDDKSGPVTLGPKSFGSSVEMFEYCYKLLH--HWAPNL  642
            K +   R  ILE  GS   E   DDK   +    +    +V +  +   +LH   +    
Sbjct  69   KPLVSHRRGILEEHGSHASEEDDDDKW--IDWEDQILEDTVPLVGFVRMILHSGQYESGD  126

Query  641  DINEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIF-KSRCFFIVRVDGSADDFSF  465
             ++E     ++E +   H + +KKIG G+    +  HP F +SRC FIVR DG   DFS+
Sbjct  127  RLSEEHEKTIIEKLLPFHPESEKKIGCGVDYITIGYHPDFERSRCLFIVRQDGQVVDFSY  186

Query  464  RKCV  453
             KC+
Sbjct  187  WKCI  190



>ref|WP_018646984.1| MULTISPECIES: hypothetical protein [Bradyrhizobium]
 gb|KGJ67387.1| hypothetical protein BJA5080_07751 [Bradyrhizobium diazoefficiens 
SEMIA 5080]
Length=98

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 28/93 (30%), Positives = 46/93 (49%), Gaps = 2/93 (2%)
 Frame = -1

Query  731  PVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIG  552
            P+ LGP  F    +   Y   +LH +     +   + ++L   ++  H D + K G GI 
Sbjct  5    PIDLGPLHFAKRGDAVAYLNDMLHRYDVGDRVGANDTVILRAALEH-HPDAEAKKGCGIT  63

Query  551  AFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCV  453
             F VR    F ++CF++ R DG+ + FS R C+
Sbjct  64   HFNVRTAD-FGTKCFWLNRTDGATEKFSHRACI  95



>ref|NP_001148429.1| DCL protein [Zea mays]
 gb|ACG31443.1| DCL protein [Zea mays]
 tpg|DAA51372.1| TPA: DCL protein [Zea mays]
Length=188

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 1/56 (2%)
 Frame = -1

Query  617  VLLELIKKGHADPQKKIGQGIGAFQVRNHPIF-KSRCFFIVRVDGSADDFSFRKCV  453
            V++E +   H   Q KIG G+ A  V  HP F KSRC F+VR DG   DFS++KC+
Sbjct  110  VVVEKLLSYHPRAQDKIGCGLDAIMVDRHPEFRKSRCLFVVRTDGVWIDFSYQKCL  165



>gb|EMT14856.1| hypothetical protein F775_12212 [Aegilops tauschii]
Length=197

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 35/56 (63%), Gaps = 1/56 (2%)
 Frame = -1

Query  617  VLLELIKKGHADPQKKIGQGIGAFQVRNHPIFK-SRCFFIVRVDGSADDFSFRKCV  453
            V++E +   H   + KIG G+ A  V  HP FK SRC ++VR +G   DFS+RKC+
Sbjct  108  VVVEKVLAHHPRSEDKIGCGLDAIMVNKHPDFKMSRCLYVVRTNGDWADFSYRKCL  163



>ref|XP_010479096.1| PREDICTED: protein DCL, chloroplastic-like [Camelina sativa]
Length=220

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 40/61 (66%), Gaps = 2/61 (3%)
 Frame = -1

Query  632  EYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKS-RCFFIVRVDGSADDFSFRKC  456
            E+E M++ E++   H + +KKIG GI    V +HP F+S RC FIVR DG   DFS+ KC
Sbjct  134  EHERMIV-EMLLPYHPEFEKKIGCGIDYIMVGHHPDFESSRCMFIVRRDGEVVDFSYWKC  192

Query  455  V  453
            +
Sbjct  193  I  193



>ref|WP_023735767.1| MULTISPECIES: hypothetical protein [Mesorhizobium]
 gb|ESY06595.1| hypothetical protein X753_13705 [Mesorhizobium sp. LNJC399B00]
 gb|ESY66161.1| hypothetical protein X742_19430 [Mesorhizobium sp. LNHC232B00]
Length=96

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 50/96 (52%), Gaps = 2/96 (2%)
 Frame = -1

Query  740  KSGPVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQ  561
            K+ P+ L  + F    +   +    L  + P   + + +  +L  L+ + H D   K G 
Sbjct  3    KAIPLQLAGRDFAKKGDALLHVRARLQRYPPGQRVADEDEALLRALLAR-HPDSASKTGS  61

Query  560  GIGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCV  453
            G+  F VR+   + ++CF++VR DGS + FS+++C+
Sbjct  62   GVDHFMVRSAD-YGTKCFWVVRTDGSTERFSYKECL  96



>ref|XP_010500205.1| PREDICTED: protein DCL, chloroplastic [Camelina sativa]
Length=221

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 40/61 (66%), Gaps = 2/61 (3%)
 Frame = -1

Query  632  EYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKS-RCFFIVRVDGSADDFSFRKC  456
            E+E M++ E++   H + +KKIG GI    V +HP F+S RC FIVR DG   DFS+ KC
Sbjct  135  EHERMIV-EMLLPYHPEFEKKIGCGIDYIMVGHHPDFESSRCMFIVRRDGEVVDFSYWKC  193

Query  455  V  453
            +
Sbjct  194  I  194



>ref|XP_009360061.1| PREDICTED: protein DCL, chloroplastic-like [Pyrus x bretschneideri]
Length=213

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 38/63 (60%), Gaps = 1/63 (2%)
 Frame = -1

Query  638  INEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFK-SRCFFIVRVDGSADDFSFR  462
            + E +  V++E +   H   + KIG GI +  V  HP FK SRC F++R DG   DFS++
Sbjct  126  LTEEDEKVVVERLLVHHPQSKDKIGCGIDSIMVDRHPQFKHSRCLFVIRTDGVWIDFSYQ  185

Query  461  KCV  453
            KC+
Sbjct  186  KCL  188



>ref|XP_007225808.1| hypothetical protein PRUPE_ppa011355mg [Prunus persica]
 ref|XP_008220232.1| PREDICTED: protein DCL, chloroplastic [Prunus mume]
 gb|EMJ27007.1| hypothetical protein PRUPE_ppa011355mg [Prunus persica]
Length=214

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 40/65 (62%), Gaps = 2/65 (3%)
 Frame = -1

Query  632  EYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKS-RCFFIVRVDGSADDFSFRKC  456
            E+E  VL  L+   H + QKKIG GI    V  HP F+S RC FIV+ DG+  DFS+ KC
Sbjct  128  EHEKTVLERLLPF-HPEAQKKIGSGIDYITVGYHPDFESSRCLFIVQKDGTLVDFSYWKC  186

Query  455  VDRIL  441
            +  ++
Sbjct  187  IKGLI  191



>ref|XP_006304196.1| hypothetical protein CARUB_v10010275mg [Capsella rubella]
 gb|EOA37094.1| hypothetical protein CARUB_v10010275mg [Capsella rubella]
Length=216

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 40/61 (66%), Gaps = 2/61 (3%)
 Frame = -1

Query  632  EYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKS-RCFFIVRVDGSADDFSFRKC  456
            E+E M++ E++   H + +KKIG GI    V +HP F+S RC FIVR DG   DFS+ KC
Sbjct  130  EHERMIV-EMLLPYHPEFEKKIGCGIDYIMVGHHPDFESSRCMFIVRRDGEVVDFSYWKC  188

Query  455  V  453
            +
Sbjct  189  I  189



>ref|XP_006595984.1| PREDICTED: DNA-directed RNA polymerase V subunit 1-like [Glycine 
max]
Length=189

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 35/56 (63%), Gaps = 1/56 (2%)
 Frame = -1

Query  614  LLELIKKGHADPQKKIGQGIGAFQVRNHPIFK-SRCFFIVRVDGSADDFSFRKCVD  450
            ++E I   H D + KIG G+ +  V  HP++   RC F+VR DGS  DFS+R C++
Sbjct  105  VVENILIYHPDYEDKIGSGLNSIMVDQHPLYLFPRCLFVVRTDGSWIDFSYRVCIE  160



>ref|XP_011083836.1| PREDICTED: protein DCL, chloroplastic-like [Sesamum indicum]
Length=225

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 54/114 (47%), Gaps = 3/114 (3%)
 Frame = -1

Query  773  GSQVGEGKKDDKSGPVTLGPKSFGSSVEMFEYCYKLLH--HWAPNLDINEYEHMVLLELI  600
            G +  E K  D    V    +  G +V +  +   +LH   +     ++      +LE +
Sbjct  89   GGEGSEPKGGDGGTWVDWEDQILGDTVPLVGFVRMILHSGEYESGDRLSPEHERTILERL  148

Query  599  KKGHADPQKKIGQGIGAFQVRNHPIFK-SRCFFIVRVDGSADDFSFRKCVDRIL  441
               H D +KKIG G+    +  HP F  SRC FIVR DG   DFS+ KC++ ++
Sbjct  149  LPYHPDCEKKIGSGVDYITIGYHPNFNNSRCLFIVREDGELVDFSYWKCMEGLI  202



>gb|AFK49399.1| unknown [Medicago truncatula]
Length=224

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 45/80 (56%), Gaps = 6/80 (8%)
 Frame = -1

Query  617  VLLELIKKGHADPQKKIGQGIGAFQVRNHPIF-KSRCFFIVRVDGSADDFSFRKCVDRIL  441
             ++E +   H + QKKIG GI    V  HP F +SRC FIVR DG   DFS+ KC+  ++
Sbjct  142  TIVEKLLPFHPESQKKIGCGIDYITVGYHPNFDRSRCMFIVRQDGELVDFSYWKCIKGLI  201

Query  440  ----PL-PESMQIKHNANKA  396
                PL  +S   +H  N++
Sbjct  202  RKNYPLYADSFIFRHFRNRS  221



>ref|WP_008891939.1| hypothetical protein [Thalassospira profundimaris]
 gb|EKF06792.1| hypothetical protein TH2_18219 [Thalassospira profundimaris WP0211]
Length=96

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 29/96 (30%), Positives = 50/96 (52%), Gaps = 2/96 (2%)
 Frame = -1

Query  740  KSGPVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQ  561
            K+ PV +G   F    +  EY   +L+ +A    ++  +   L + +K  H D   K G 
Sbjct  3    KATPVKIGEVDFAKKGDALEYLRVMLNSYALEERVSRDDENFLRDALKN-HPDANDKFGD  61

Query  560  GIGAFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCV  453
            G+  F VR    + +RCF++ R+DG+ + FS++ CV
Sbjct  62   GVDHFFVRRAD-YGTRCFWVRRLDGTEERFSYKSCV  96



>ref|NP_001031151.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE32114.1| uncharacterized protein AT1G45230 [Arabidopsis thaliana]
Length=219

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = -1

Query  617  VLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKS-RCFFIVRVDGSADDFSFRKCV  453
             ++E++   H + +KKIG GI    V +HP F+S RC FIVR DG   DFS+ KC+
Sbjct  137  TIIEMLLPYHPECEKKIGCGIDYIMVWHHPDFESSRCMFIVRKDGEVVDFSYWKCI  192



>ref|XP_010943194.1| PREDICTED: protein DCL, chloroplastic [Elaeis guineensis]
Length=200

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 39/63 (62%), Gaps = 1/63 (2%)
 Frame = -1

Query  638  INEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFK-SRCFFIVRVDGSADDFSFR  462
            +N+ +  V++E +   H   + KIG G+ +  V  HP F+ SRC F+VR DG   DFS++
Sbjct  115  LNDEDEKVVVEKLLAYHPHSEDKIGCGLDSIMVDRHPQFRNSRCLFVVRTDGVWIDFSYQ  174

Query  461  KCV  453
            KC+
Sbjct  175  KCL  177



>ref|XP_001758330.1| predicted protein [Physcomitrella patens]
 gb|EDQ76732.1| predicted protein [Physcomitrella patens]
Length=96

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 40/69 (58%), Gaps = 2/69 (3%)
 Frame = -1

Query  656  WAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIF-KSRCFFIVRVDGSA  480
            +  N  ++E +   +  L++  H   ++KIG GI   ++  H  F K RCF+IVR DG+ 
Sbjct  2    YEDNARVSEEDEKTMRRLLQH-HPKSEEKIGCGIDYIKINRHSTFNKVRCFWIVRTDGTE  60

Query  479  DDFSFRKCV  453
             DFS+ KCV
Sbjct  61   TDFSYHKCV  69



>ref|XP_010461498.1| PREDICTED: protein DCL, chloroplastic-like [Camelina sativa]
Length=222

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 40/61 (66%), Gaps = 2/61 (3%)
 Frame = -1

Query  632  EYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKS-RCFFIVRVDGSADDFSFRKC  456
            E+E M++ E++   H + +KKIG GI    V +HP F+S RC FIVR DG   DFS+ KC
Sbjct  136  EHERMIV-EMLLPYHPEFEKKIGCGIDYIMVGHHPDFESSRCMFIVRRDGEVVDFSYWKC  194

Query  455  V  453
            +
Sbjct  195  I  195



>gb|AAB95289.1| unknown protein [Arabidopsis thaliana]
Length=839

 Score = 55.5 bits (132),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 46/80 (58%), Gaps = 3/80 (4%)
 Frame = -1

Query  671  KLLHHWA-PNLD-INEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFK-SRCFFI  501
            K++H  A P+ D I++ +   +LE I   H   + K+G G+    V  H IF  SRCFF+
Sbjct  615  KIMHPSAYPDGDPISDDDKTFVLEKILNFHPQKETKLGSGVDFITVDKHTIFSDSRCFFV  674

Query  500  VRVDGSADDFSFRKCVDRIL  441
            V  DG+  DFS+RK ++  L
Sbjct  675  VSTDGAKQDFSYRKSLNNYL  694



>ref|XP_003573687.1| PREDICTED: protein DCL, chloroplastic-like [Brachypodium distachyon]
Length=185

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 35/56 (63%), Gaps = 1/56 (2%)
 Frame = -1

Query  617  VLLELIKKGHADPQKKIGQGIGAFQVRNHPIF-KSRCFFIVRVDGSADDFSFRKCV  453
            +++E +   H   + KIG G+ A  V  HP F KSRC F+VR DG   DFS++KC+
Sbjct  107  IIVEKLLTYHPRAEDKIGCGLDAIMVDRHPQFRKSRCLFVVRTDGVWIDFSYQKCL  162



>gb|KDP41687.1| hypothetical protein JCGZ_16094 [Jatropha curcas]
Length=196

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = -1

Query  617  VLLELIKKGHADPQKKIGQGIGAFQVRNHPIFK-SRCFFIVRVDGSADDFSFRKCV  453
            +++E +   H + + KIG G+ +  V  HP F+ SRC F+VR DG   DFS++KC+
Sbjct  116  LVVEKLLTYHPNSEDKIGSGLDSIMVDRHPQFRHSRCLFVVRTDGGWIDFSYQKCL  171



>gb|KHN04477.1| Protein DCL, chloroplastic [Glycine soja]
Length=171

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 38/63 (60%), Gaps = 1/63 (2%)
 Frame = -1

Query  638  INEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFK-SRCFFIVRVDGSADDFSFR  462
            +NE +   ++E +   H   + KIG G+ +  V  HP ++ SRC F+VR DG   DFS++
Sbjct  84   LNEEDEKAIVEKLLAYHPHSEDKIGCGLESIMVDRHPQYRQSRCLFVVRTDGGWIDFSYQ  143

Query  461  KCV  453
            KC+
Sbjct  144  KCL  146



>ref|XP_003063587.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH51960.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=628

 Score = 55.1 bits (131),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 59/124 (48%), Gaps = 14/124 (11%)
 Frame = -1

Query  734  GPVTLGPK----SFGSSVEMFEYCYKLLHHWAPNLDINEY---EHMVLLELIKKGHADPQ  576
             PVT+ P+    +F +  EM  Y   +L     +  +  Y   E    +  + + H D  
Sbjct  83   APVTIPPRDGGATFATPHEMMGYFSGVLK----DAKLCRYLDGEARDAVASVLRAHPDAS  138

Query  575  KKIGQGIG-AFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCVDRILPLPESMQIKHNANK  399
            +K+G+G    FQVR  P    R F ++R DG+A+DFS RK VD +   P    +K   N+
Sbjct  139  RKMGRGAPRGFQVRQDPEKGYRYFVVIREDGTAEDFSVRKGVDAL--FPGFANVKRKGNQ  196

Query  398  ALRE  387
              RE
Sbjct  197  TRRE  200



>ref|XP_011029320.1| PREDICTED: protein DCL, chloroplastic-like [Populus euphratica]
Length=195

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 34/56 (61%), Gaps = 1/56 (2%)
 Frame = -1

Query  617  VLLELIKKGHADPQKKIGQGIGAFQVRNHPIFK-SRCFFIVRVDGSADDFSFRKCV  453
            V+ E +   H +   KIG G+ +  V  HP FK SRC F+VR DG   DFS++KC+
Sbjct  116  VVAERLLAYHPNSDDKIGCGLDSIMVDRHPQFKNSRCLFVVRTDGGWIDFSYQKCL  171



>ref|WP_008134936.1| hypothetical protein [Bradyrhizobium sp. YR681]
 gb|EJN13544.1| Protein of unknown function (DUF3223) [Bradyrhizobium sp. YR681]
Length=97

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 31/93 (33%), Positives = 50/93 (54%), Gaps = 2/93 (2%)
 Frame = -1

Query  731  PVTLGPKSFGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIG  552
            PVT+GP  F    +   +   +LH +     ++  +  VLL      H +   K+G GI 
Sbjct  5    PVTIGPLHFSKKGDAAAFLKAMLHKYDVGDKVSTGDAEVLLA-ALALHPNATAKMGLGIT  63

Query  551  AFQVRNHPIFKSRCFFIVRVDGSADDFSFRKCV  453
             F VR+   F S+CF++ RVDGS++ FS++ C+
Sbjct  64   HFSVRSAN-FGSKCFWVNRVDGSSEKFSYKACI  95



>gb|KDP25521.1| hypothetical protein JCGZ_20677 [Jatropha curcas]
Length=942

 Score = 54.7 bits (130),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 45/74 (61%), Gaps = 2/74 (3%)
 Frame = -1

Query  671  KLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFK-SRCFFIVR  495
            K+L+ +  +  +NE +   L+  +   H    +KIG G    +V NHP ++ SRCF +VR
Sbjct  845  KILNKYPVDQQLNEADKCTLMSALY-FHPRRDEKIGSGAQDIKVVNHPEYQGSRCFSVVR  903

Query  494  VDGSADDFSFRKCV  453
             DG+ +DFS+RKCV
Sbjct  904  TDGTIEDFSYRKCV  917



>ref|XP_010552513.1| PREDICTED: protein DCL, chloroplastic-like [Tarenaya hassleriana]
Length=222

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 49/86 (57%), Gaps = 7/86 (8%)
 Frame = -1

Query  632  EYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIF-KSRCFFIVRVDGSADDFSFRKC  456
            E+E MV+  L+   H + +KKIG GI    V +HP F +SRC FI R DG   DFS+ KC
Sbjct  136  EHERMVVERLLPY-HPEYEKKIGPGIDHIMVGHHPDFERSRCLFIARKDGEIVDFSYWKC  194

Query  455  VDRIL----PL-PESMQIKHNANKAL  393
            +  ++    PL  +S  ++H   + L
Sbjct  195  IKGLIRKNYPLYADSFILRHFRKRRL  220



>ref|XP_008378000.1| PREDICTED: protein DCL, chloroplastic-like [Malus domestica]
Length=207

 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 38/63 (60%), Gaps = 1/63 (2%)
 Frame = -1

Query  638  INEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFK-SRCFFIVRVDGSADDFSFR  462
            + E +  V++E +   H   + KIG GI +  V  HP F+ SRC F++R DG   DFS++
Sbjct  120  LTEEDEKVVVERLLAHHPHSEDKIGCGIDSVMVDRHPQFRHSRCLFVIRTDGVWIDFSYQ  179

Query  461  KCV  453
            KC+
Sbjct  180  KCL  182



>ref|NP_683398.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAG50632.1|AC083835_17 defective chloroplasts and leaves (DCL) protein, putative [Arabidopsis 
thaliana]
 gb|AAM91086.1| At1g45261/F2G19.1 [Arabidopsis thaliana]
 gb|AAT41860.1| At1g45261 [Arabidopsis thaliana]
 dbj|BAD95026.1| defective chloroplasts and leaves (DCL) protein [Arabidopsis 
thaliana]
 gb|AEE32113.1| uncharacterized protein AT1G45230 [Arabidopsis thaliana]
Length=219

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = -1

Query  617  VLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKS-RCFFIVRVDGSADDFSFRKCV  453
             ++E++   H + +KKIG GI    V +HP F+S RC FIVR DG   DFS+ KC+
Sbjct  137  TIIEMLLPYHPECEKKIGCGIDYIMVGHHPDFESSRCMFIVRKDGEVVDFSYWKCI  192



>ref|WP_008120591.1| hypothetical protein [Phyllobacterium sp. YR531]
 gb|EJN06800.1| Protein of unknown function (DUF3223) [Phyllobacterium sp. YR531]
Length=103

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 27/84 (32%), Positives = 47/84 (56%), Gaps = 2/84 (2%)
 Frame = -1

Query  707  FGSSVEMFEYCYKLLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHP  528
            F + VE  E    +L+ +     I+  +   +   +++ H +   KIG GI +F+VR   
Sbjct  15   FTTQVEARERFRSILYKYRIGETIDAADSQFMTSALQR-HPEAATKIGFGIQSFEVRAAD  73

Query  527  IFKSRCFFIVRVDGSADDFSFRKC  456
             + +RCF+++RVDG+A+ FSF  C
Sbjct  74   -YGTRCFWVIRVDGTAEKFSFNAC  96



>ref|XP_010512942.1| PREDICTED: DNA-directed RNA polymerase V subunit 1-like [Camelina 
sativa]
Length=1429

 Score = 54.7 bits (130),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 39/67 (58%), Gaps = 1/67 (1%)
 Frame = -1

Query  638   INEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFK-SRCFFIVRVDGSADDFSFR  462
             I++ +   +LE I   H + +KK+G G+    V  H  F  SRCFF+V  DG+  DFS+R
Sbjct  1289  ISDDDKTFVLEKILNFHPEKEKKLGSGVDFITVDKHTTFSDSRCFFVVSTDGTKQDFSYR  1348

Query  461   KCVDRIL  441
             K ++  L
Sbjct  1349  KSLNNYL  1355



>gb|KDO53583.1| hypothetical protein CISIN_1g0002912mg, partial [Citrus sinensis]
Length=734

 Score = 54.7 bits (130),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (63%), Gaps = 1/51 (2%)
 Frame = -1

Query  590  HADPQKKIGQGIGAFQVRNHPIFK-SRCFFIVRVDGSADDFSFRKCVDRIL  441
            H D   K+G GI  F+V  H  F+ SRC F+V  DGS  DFS+RKC++  +
Sbjct  643  HPDKAMKMGAGIDHFKVDKHGSFQDSRCLFVVSTDGSQQDFSYRKCLESFI  693



>gb|EMT19779.1| hypothetical protein F775_42610 [Aegilops tauschii]
Length=164

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 36/63 (57%), Gaps = 1/63 (2%)
 Frame = -1

Query  638  INEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIF-KSRCFFIVRVDGSADDFSFR  462
            +   + +V+ E I   H   + KIG G+    V  HP F KSRC F+VR DG   DFS++
Sbjct  93   LGPADEIVVAEKILAYHPRAEDKIGCGLDGIMVDRHPQFRKSRCLFVVRTDGVWIDFSYQ  152

Query  461  KCV  453
            KC+
Sbjct  153  KCL  155



>ref|XP_007226523.1| hypothetical protein PRUPE_ppa024709mg, partial [Prunus persica]
 gb|EMJ27722.1| hypothetical protein PRUPE_ppa024709mg, partial [Prunus persica]
Length=146

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 35/56 (63%), Gaps = 1/56 (2%)
 Frame = -1

Query  617  VLLELIKKGHADPQKKIGQGIGAFQVRNHPIFK-SRCFFIVRVDGSADDFSFRKCV  453
            V++E +   H   + KIG GI +  V  HP F+ SRC F++R DG   DFS++KC+
Sbjct  66   VVVERLLAHHPHSEDKIGCGIDSIMVDRHPQFRHSRCLFVIRTDGIWIDFSYQKCL  121



>ref|XP_002894020.1| hypothetical protein ARALYDRAFT_473852 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70279.1| hypothetical protein ARALYDRAFT_473852 [Arabidopsis lyrata subsp. 
lyrata]
Length=218

 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = -1

Query  617  VLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKS-RCFFIVRVDGSADDFSFRKCV  453
             ++E++   H + +KKIG GI    V +HP F+S RC FIVR DG   DFS+ KC+
Sbjct  136  TIVEMLLPYHPEFEKKIGCGIDYIMVWHHPDFESSRCMFIVRKDGEVVDFSYWKCI  191



>emb|CBI21428.3| unnamed protein product [Vitis vinifera]
Length=103

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 34/56 (61%), Gaps = 1/56 (2%)
 Frame = -1

Query  617  VLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKS-RCFFIVRVDGSADDFSFRKCV  453
            ++LE +   H   ++KIG GI    V  HP F+S RC FIVR DG   DFS+ KC+
Sbjct  21   IILERLLPYHPGYERKIGSGIDYITVGYHPEFESSRCLFIVRKDGELVDFSYWKCI  76



>ref|XP_004963608.1| PREDICTED: DNA-directed RNA polymerase E subunit 1-like [Setaria 
italica]
Length=189

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 35/56 (63%), Gaps = 1/56 (2%)
 Frame = -1

Query  617  VLLELIKKGHADPQKKIGQGIGAFQVRNHPIF-KSRCFFIVRVDGSADDFSFRKCV  453
            V+++ +   H   Q KIG G+ A  V  HP F KSRC F+VR DG   DFS++KC+
Sbjct  111  VVVQKLLAFHPRAQDKIGCGLDAIMVDRHPEFRKSRCLFVVRTDGVWIDFSYQKCL  166



>ref|XP_006393639.1| hypothetical protein EUTSA_v10011763mg [Eutrema salsugineum]
 gb|ESQ30925.1| hypothetical protein EUTSA_v10011763mg [Eutrema salsugineum]
Length=221

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = -1

Query  617  VLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKS-RCFFIVRVDGSADDFSFRKCV  453
             ++E++   H + +KKIG GI    V +HP F+S RC FIVR DG   DFS+ KC+
Sbjct  139  TIIEMLLPYHPEVEKKIGCGIDYIMVGHHPEFESSRCMFIVRKDGEVVDFSYWKCI  194



>gb|ABK26866.1| unknown [Picea sitchensis]
Length=255

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 40/63 (63%), Gaps = 2/63 (3%)
 Frame = -1

Query  638  INEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIF-KSRCFFIVRVDGSADDFSFR  462
            I E+E  +L +L+   H + ++KIG G+    V NHP F  SRC FI+R DG + DFS+ 
Sbjct  169  IPEHETTILEKLLPY-HPELEEKIGCGVDFITVDNHPDFGDSRCLFIIRKDGESIDFSYW  227

Query  461  KCV  453
            KC+
Sbjct  228  KCL  230



>ref|XP_009361958.1| PREDICTED: DNA-directed RNA polymerase V subunit 1 [Pyrus x bretschneideri]
 ref|XP_009361959.1| PREDICTED: DNA-directed RNA polymerase V subunit 1 [Pyrus x bretschneideri]
Length=1960

 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (63%), Gaps = 1/51 (2%)
 Frame = -1

Query  590   HADPQKKIGQGIGAFQVRNHPIFK-SRCFFIVRVDGSADDFSFRKCVDRIL  441
             H D   K+G GIG   V  H  F+ SRCFF+V  DG  +DFS+RKC++  +
Sbjct  1846  HPDKAVKMGSGIGHLTVDRHGSFQDSRCFFVVTTDGHKEDFSYRKCLENYI  1896



>ref|NP_001048223.1| Os02g0766000 [Oryza sativa Japonica Group]
 dbj|BAF10137.1| Os02g0766000, partial [Oryza sativa Japonica Group]
Length=139

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 33/56 (59%), Gaps = 1/56 (2%)
 Frame = -1

Query  617  VLLELIKKGHADPQKKIGQGIGAFQVRNHPIFK-SRCFFIVRVDGSADDFSFRKCV  453
             +LE +   H   +KKIG GI    V  HP F+ SRC FIVR DG   DFSF KC+
Sbjct  53   AILERLLPYHPQYEKKIGCGIDYLTVGLHPEFENSRCLFIVRKDGEQVDFSFWKCI  108



>gb|ESY14377.1| hypothetical protein X751_26805 [Mesorhizobium sp. LNJC395A00]
Length=73

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 45/72 (63%), Gaps = 2/72 (3%)
 Frame = -1

Query  668  LLHHWAPNLDINEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKSRCFFIVRVD  489
            +L+ + P   ++  +   L E +K+ H + + KIG GI +F VR+   + ++CF+++R D
Sbjct  4    MLNRYRPGDAVSAADVAFLAEALKR-HPEARTKIGSGIRSFDVRSAD-YGTKCFWVLRTD  61

Query  488  GSADDFSFRKCV  453
            GS + FS++ CV
Sbjct  62   GSEERFSYKSCV  73



>ref|XP_007133762.1| hypothetical protein PHAVU_011G206900g [Phaseolus vulgaris]
 gb|ESW05756.1| hypothetical protein PHAVU_011G206900g [Phaseolus vulgaris]
Length=2052

 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 38/63 (60%), Gaps = 1/63 (2%)
 Frame = -1

Query  626   EHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFK-SRCFFIVRVDGSADDFSFRKCVD  450
             + + +LE + + H D   K+G GI    V  H  F+ SRCF++V  DG  +DFS+RKC+D
Sbjct  1931  DQLFVLENVFEHHPDKDTKMGAGIDYVMVNKHSSFQDSRCFYVVLKDGRREDFSYRKCLD  1990

Query  449   RIL  441
               +
Sbjct  1991  NWI  1993



>ref|XP_010412959.1| PREDICTED: DNA-directed RNA polymerase V subunit 1-like [Camelina 
sativa]
Length=1920

 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 39/67 (58%), Gaps = 1/67 (1%)
 Frame = -1

Query  638   INEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFK-SRCFFIVRVDGSADDFSFR  462
             I++ +   +LE I   H + +KK+G G+    V  H  F  SRCFF+V  DG+  DFS+R
Sbjct  1720  ISDDDKTFVLEKILNFHPEKEKKLGSGVDFITVDKHTTFSDSRCFFVVSTDGTKQDFSYR  1779

Query  461   KCVDRIL  441
             K ++  L
Sbjct  1780  KSLNNYL  1786



>ref|XP_009107447.1| PREDICTED: protein DCL, chloroplastic [Brassica rapa]
Length=210

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 35/56 (63%), Gaps = 1/56 (2%)
 Frame = -1

Query  617  VLLELIKKGHADPQKKIGQGIGAFQVRNHPIF-KSRCFFIVRVDGSADDFSFRKCV  453
             ++E++   H +  KKIG GI    V +HP F +SRC FIVR DG   DFS+ KC+
Sbjct  128  TIVEMLLPYHPEVDKKIGCGIDFIMVGHHPEFERSRCLFIVRKDGEVVDFSYWKCI  183



>emb|CDY17057.1| BnaA08g04210D [Brassica napus]
Length=210

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 35/56 (63%), Gaps = 1/56 (2%)
 Frame = -1

Query  617  VLLELIKKGHADPQKKIGQGIGAFQVRNHPIF-KSRCFFIVRVDGSADDFSFRKCV  453
             ++E++   H +  KKIG GI    V +HP F +SRC FIVR DG   DFS+ KC+
Sbjct  128  TIVEMLLPYHPEVDKKIGCGIDFIMVGHHPEFERSRCLFIVRKDGEVVDFSYWKCI  183



>ref|XP_002510162.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52349.1| conserved hypothetical protein [Ricinus communis]
Length=234

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = -1

Query  617  VLLELIKKGHADPQKKIGQGIGAFQVRNHPIFK-SRCFFIVRVDGSADDFSFRKCV  453
             ++E +   H + + KIG G+ +  V  HP F+ SRC F+VR+DG   DFS++KC+
Sbjct  155  AIVEKLLAHHPNSEDKIGCGLDSIMVDRHPQFRHSRCLFVVRIDGGWIDFSYQKCL  210



>dbj|BAD17127.1| DCL protein-like [Oryza sativa Japonica Group]
 dbj|BAD17315.1| DCL protein-like [Oryza sativa Japonica Group]
Length=107

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 33/56 (59%), Gaps = 1/56 (2%)
 Frame = -1

Query  617  VLLELIKKGHADPQKKIGQGIGAFQVRNHPIFK-SRCFFIVRVDGSADDFSFRKCV  453
             +LE +   H   +KKIG GI    V  HP F+ SRC FIVR DG   DFSF KC+
Sbjct  21   AILERLLPYHPQYEKKIGCGIDYLTVGLHPEFENSRCLFIVRKDGEQVDFSFWKCI  76



>ref|XP_004308588.1| PREDICTED: DNA-directed RNA polymerase E subunit 1-like [Fragaria 
vesca subsp. vesca]
Length=1991

 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 38/63 (60%), Gaps = 1/63 (2%)
 Frame = -1

Query  626   EHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFK-SRCFFIVRVDGSADDFSFRKCVD  450
             +H  +L+ +   H + + K+G GI  F V  H  F+ SRC F++  DG  +DFS+RKC+ 
Sbjct  1890  DHSFILDKVFNFHPEKEAKMGSGIDYFTVDRHGSFQESRCLFVISTDGRKEDFSYRKCLQ  1949

Query  449   RIL  441
              ++
Sbjct  1950  NMI  1952



>gb|KFK36162.1| hypothetical protein AALP_AA4G086100 [Arabis alpina]
Length=220

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = -1

Query  617  VLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKS-RCFFIVRVDGSADDFSFRKCV  453
             ++E++   H + +KKIG GI    V +HP F+S RC FIVR DG   DFS+ KC+
Sbjct  138  TIVEMLLPYHPEFEKKIGCGIDYIMVGHHPEFESSRCLFIVRRDGEVVDFSYWKCI  193



>ref|XP_009354163.1| PREDICTED: protein DCL, chloroplastic-like [Pyrus x bretschneideri]
Length=207

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 37/63 (59%), Gaps = 1/63 (2%)
 Frame = -1

Query  638  INEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFK-SRCFFIVRVDGSADDFSFR  462
            + E +  V++E +   H   + KIG  I +  V  HP FK SRC F++R DG   DFS++
Sbjct  120  LTEEDEKVVVERLLAHHPHSEDKIGCAIDSIMVDQHPQFKRSRCLFVIRTDGVWIDFSYQ  179

Query  461  KCV  453
            KC+
Sbjct  180  KCL  182



>ref|XP_006649071.1| PREDICTED: protein DCL, chloroplastic-like [Oryza brachyantha]
Length=161

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 33/56 (59%), Gaps = 1/56 (2%)
 Frame = -1

Query  617  VLLELIKKGHADPQKKIGQGIGAFQVRNHPIFK-SRCFFIVRVDGSADDFSFRKCV  453
             +LE +   H   +KKIG GI    V  HP F+ SRC FIVR DG   DFSF KC+
Sbjct  75   AILERLLPYHPQYEKKIGCGIDYITVGLHPEFENSRCLFIVRKDGEQVDFSFWKCI  130



>ref|XP_008231662.1| PREDICTED: DNA-directed RNA polymerase V subunit 1 [Prunus mume]
Length=1855

 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 35/59 (59%), Gaps = 1/59 (2%)
 Frame = -1

Query  614   LLELIKKGHADPQKKIGQGIGAFQVRNHPIFK-SRCFFIVRVDGSADDFSFRKCVDRIL  441
             +L+ +   H D   K+G GI    V  H  F+ SRCFF+V  DG  +DFS+RKC+D  +
Sbjct  1748  VLDNVFNYHPDKAAKMGCGIDHLTVNRHGSFQDSRCFFVVSTDGRTEDFSYRKCLDNYI  1806



>ref|XP_004501564.1| PREDICTED: protein DCL, chloroplastic-like [Cicer arietinum]
Length=211

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 34/56 (61%), Gaps = 1/56 (2%)
 Frame = -1

Query  617  VLLELIKKGHADPQKKIGQGIGAFQVRNHPIF-KSRCFFIVRVDGSADDFSFRKCV  453
             +LE +   H + QKKIG GI    +  HP F +SRC FIVR DG   DFS+ KCV
Sbjct  129  TILEKLLPFHPEFQKKIGCGIDYITIGYHPDFDRSRCMFIVRQDGEHVDFSYWKCV  184



>ref|XP_010509007.1| PREDICTED: LOW QUALITY PROTEIN: DNA-directed RNA polymerase V 
subunit 1-like [Camelina sativa]
Length=1834

 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 39/67 (58%), Gaps = 1/67 (1%)
 Frame = -1

Query  638   INEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFK-SRCFFIVRVDGSADDFSFR  462
             I++ +   +LE I   H + +KK+G G+    V  H  F  SRCFF+V  DG+  DFS+R
Sbjct  1694  ISDDDKTFVLEKILNFHPEKEKKLGSGVDFITVDKHTTFSDSRCFFVVSTDGTKQDFSYR  1753

Query  461   KCVDRIL  441
             K ++  L
Sbjct  1754  KSLNNYL  1760



>ref|XP_002879839.1| NRPD1b [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56098.1| NRPD1b [Arabidopsis lyrata subsp. lyrata]
Length=1947

 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 46/80 (58%), Gaps = 3/80 (4%)
 Frame = -1

Query  671   KLLHHWA-PNLD-INEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFK-SRCFFI  501
             K++H  A P+ D I++ +   +LE I   H   + K+G G+    V  H IF  SRCFF+
Sbjct  1752  KIMHPSAYPDGDPISDDDKTFVLEKILNFHPQKETKLGSGVDFITVDKHTIFSDSRCFFV  1811

Query  500   VRVDGSADDFSFRKCVDRIL  441
             V  DG+  DFS+RK ++  L
Sbjct  1812  VSTDGAKQDFSYRKSLNNYL  1831



>gb|AFK33859.1| unknown [Lotus japonicus]
Length=224

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 34/56 (61%), Gaps = 1/56 (2%)
 Frame = -1

Query  617  VLLELIKKGHADPQKKIGQGIGAFQVRNHPIF-KSRCFFIVRVDGSADDFSFRKCV  453
             +LE +   H + +KKIG GI    +  HP F +SRC FIVR DG   DFS+ KC+
Sbjct  142  TILEKLLPFHPESEKKIGCGIDYITIGYHPQFDRSRCLFIVRKDGELVDFSYWKCI  197



>ref|XP_007218881.1| hypothetical protein PRUPE_ppa000088mg [Prunus persica]
 gb|EMJ20080.1| hypothetical protein PRUPE_ppa000088mg [Prunus persica]
Length=1855

 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 35/59 (59%), Gaps = 1/59 (2%)
 Frame = -1

Query  614   LLELIKKGHADPQKKIGQGIGAFQVRNHPIFK-SRCFFIVRVDGSADDFSFRKCVDRIL  441
             +L+ +   H D   K+G GI    V  H  F+ SRCFF+V  DG  +DFS+RKC+D  +
Sbjct  1748  VLDNVFNYHPDKAAKMGCGIDHLTVNRHGSFQDSRCFFVVSTDGRTEDFSYRKCLDNYI  1806



>emb|CAD12248.1| DCL protein [Coffea arabica]
Length=224

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 33/56 (59%), Gaps = 1/56 (2%)
 Frame = -1

Query  617  VLLELIKKGHADPQKKIGQGIGAFQVRNHPIF-KSRCFFIVRVDGSADDFSFRKCV  453
             +LE +   H   +KKIG G+    +  HP F +SRC FIVR DG   DFS+ KC+
Sbjct  142  TILERVLPYHPQCEKKIGSGVDYITIGYHPDFDRSRCLFIVRKDGELVDFSYWKCI  197



>ref|XP_003523609.1| PREDICTED: protein DCL, chloroplastic-like [Glycine max]
Length=203

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 38/63 (60%), Gaps = 1/63 (2%)
 Frame = -1

Query  638  INEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFK-SRCFFIVRVDGSADDFSFR  462
            +NE +   ++E +   H   + KIG G+ +  V  HP ++ SRC F+VR DG   DFS++
Sbjct  116  LNEEDEKAIVEKLLAYHPHSEDKIGCGLESIMVDRHPQYRQSRCLFVVRTDGGWIDFSYQ  175

Query  461  KCV  453
            KC+
Sbjct  176  KCL  178



>ref|XP_008352141.1| PREDICTED: protein DCL, chloroplastic-like [Malus domestica]
Length=209

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 39/65 (60%), Gaps = 2/65 (3%)
 Frame = -1

Query  632  EYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKS-RCFFIVRVDGSADDFSFRKC  456
            E++  VL  L+   H D +KKIG GI    V  HP F+S RC FIV  DG+  DFS+ KC
Sbjct  123  EHQKTVLQRLLPF-HPDAKKKIGSGIDYITVGYHPDFESSRCLFIVXKDGTLVDFSYWKC  181

Query  455  VDRIL  441
            +  ++
Sbjct  182  IKGLI  186



>gb|EMS54113.1| Protein DCL, chloroplastic [Triticum urartu]
Length=134

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 35/60 (58%), Gaps = 1/60 (2%)
 Frame = -1

Query  617  VLLELIKKGHADPQKKIGQGIGAFQVRNHPIFK-SRCFFIVRVDGSADDFSFRKCVDRIL  441
             +LE +   H   +KKIG GI    +  HP F+ SRC FIVR DG   DFSF KC+  ++
Sbjct  53   AILERLLPYHPQYKKKIGCGIDYITLGLHPEFENSRCLFIVRTDGEQVDFSFWKCIKGLI  112



>ref|XP_004511611.1| PREDICTED: DNA-directed RNA polymerase D subunit 1-like isoform 
X5 [Cicer arietinum]
Length=1474

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 3/56 (5%)
 Frame = -1

Query  611   LELIKKGHADPQK--KIGQGIGAFQVRNHPIFK-SRCFFIVRVDGSADDFSFRKCV  453
             L ++K  H  P++  K+G G    +V  HP F  SRCFFI+R DG+ +DFS+RKC+
Sbjct  1385  LTIMKVLHFHPRRNEKLGSGPQHIKVGWHPKFTDSRCFFIIRTDGTVEDFSYRKCI  1440



>ref|XP_004511607.1| PREDICTED: DNA-directed RNA polymerase D subunit 1-like isoform 
X1 [Cicer arietinum]
 ref|XP_004511608.1| PREDICTED: DNA-directed RNA polymerase D subunit 1-like isoform 
X2 [Cicer arietinum]
 ref|XP_004511609.1| PREDICTED: DNA-directed RNA polymerase D subunit 1-like isoform 
X3 [Cicer arietinum]
 ref|XP_004511610.1| PREDICTED: DNA-directed RNA polymerase D subunit 1-like isoform 
X4 [Cicer arietinum]
Length=1475

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 3/56 (5%)
 Frame = -1

Query  611   LELIKKGHADPQK--KIGQGIGAFQVRNHPIFK-SRCFFIVRVDGSADDFSFRKCV  453
             L ++K  H  P++  K+G G    +V  HP F  SRCFFI+R DG+ +DFS+RKC+
Sbjct  1386  LTIMKVLHFHPRRNEKLGSGPQHIKVGWHPKFTDSRCFFIIRTDGTVEDFSYRKCI  1441



>emb|CDY43215.1| BnaC08g04880D [Brassica napus]
Length=209

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = -1

Query  617  VLLELIKKGHADPQKKIGQGIGAFQVRNHPIF-KSRCFFIVRVDGSADDFSFRKCV  453
             +++++   H + +KKIG GI    V +HP F +SRC FIVR DG   DFS+ KC+
Sbjct  127  TIVQMLLPYHPEVEKKIGCGIDFIMVGHHPEFERSRCLFIVRKDGEVVDFSYWKCI  182



>emb|CDP01368.1| unnamed protein product [Coffea canephora]
Length=224

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 35/60 (58%), Gaps = 1/60 (2%)
 Frame = -1

Query  617  VLLELIKKGHADPQKKIGQGIGAFQVRNHPIF-KSRCFFIVRVDGSADDFSFRKCVDRIL  441
             +LE +   H   +KKIG G+    +  HP F +SRC FIVR DG   DFS+ KC+  ++
Sbjct  142  TILERVLPYHPQCEKKIGSGVDYITIGYHPDFDRSRCLFIVRKDGELVDFSYWKCIKGLI  201



>gb|AAY89362.1| RNA polymerase IV largest subunit [Arabidopsis thaliana]
Length=1976

 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 46/80 (58%), Gaps = 3/80 (4%)
 Frame = -1

Query  671   KLLHHWA-PNLD-INEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFK-SRCFFI  501
             K++H  A P+ D I++ +   +LE I   H   + K+G G+    V  H IF  SRCFF+
Sbjct  1752  KIMHPSAYPDGDPISDDDKTFVLEKILNFHPQKETKLGSGVDFITVDKHTIFSDSRCFFV  1811

Query  500   VRVDGSADDFSFRKCVDRIL  441
             V  DG+  DFS+RK ++  L
Sbjct  1812  VSTDGAKQDFSYRKSLNNYL  1831



>ref|NP_181532.2| nuclear RNA polymerase D1B [Arabidopsis thaliana]
 sp|Q5D869.1|NRPE1_ARATH RecName: Full=DNA-directed RNA polymerase V subunit 1; AltName: 
Full=DNA-directed RNA polymerase D subunit 1b; Short=AtNRPD1b; 
Short=Nuclear RNA polymerase D 1b; AltName: Full=DNA-directed 
RNA polymerase E subunit 1; Short=Nuclear RNA polymerase 
E 1; AltName: Full=Protein DEFECTIVE IN MERISTEM SILENCING 
5; AltName: Full=Protein DEFECTIVE IN RNA-DIRECTED DNA METHYLATION 
3; AltName: Full=Protein RNA-DIRECTED DNA METHYLATION 
DEFECTIVE 1; AltName: Full=RNA polymerase IV subunit 1; 
Short=POL IV 1 [Arabidopsis thaliana]
 gb|AAX12373.1| DNA-directed RNA polymerase alpha subunit [Arabidopsis thaliana]
 gb|AAY15198.1| DNA-dependent RNA polymerase large subunit [Arabidopsis thaliana]
 gb|AEC09767.1| nuclear RNA polymerase D1B [Arabidopsis thaliana]
Length=1976

 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 46/80 (58%), Gaps = 3/80 (4%)
 Frame = -1

Query  671   KLLHHWA-PNLD-INEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFK-SRCFFI  501
             K++H  A P+ D I++ +   +LE I   H   + K+G G+    V  H IF  SRCFF+
Sbjct  1752  KIMHPSAYPDGDPISDDDKTFVLEKILNFHPQKETKLGSGVDFITVDKHTIFSDSRCFFV  1811

Query  500   VRVDGSADDFSFRKCVDRIL  441
             V  DG+  DFS+RK ++  L
Sbjct  1812  VSTDGAKQDFSYRKSLNNYL  1831



>ref|XP_002466454.1| hypothetical protein SORBIDRAFT_01g008000 [Sorghum bicolor]
 gb|EER93452.1| hypothetical protein SORBIDRAFT_01g008000 [Sorghum bicolor]
Length=188

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 34/56 (61%), Gaps = 1/56 (2%)
 Frame = -1

Query  617  VLLELIKKGHADPQKKIGQGIGAFQVRNHPIF-KSRCFFIVRVDGSADDFSFRKCV  453
            V++E +   H     KIG G+ A  V  HP F KSRC F+VR DG   DFS++KC+
Sbjct  110  VVVEKLLSYHPRAHDKIGCGLDAIMVDRHPEFRKSRCLFVVRTDGVWIDFSYQKCL  165



>ref|XP_002282478.1| PREDICTED: protein DCL, chloroplastic [Vitis vinifera]
 emb|CAN69898.1| hypothetical protein VITISV_032063 [Vitis vinifera]
Length=205

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 34/56 (61%), Gaps = 1/56 (2%)
 Frame = -1

Query  617  VLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKS-RCFFIVRVDGSADDFSFRKCV  453
            ++LE +   H   ++KIG GI    V  HP F+S RC FIVR DG   DFS+ KC+
Sbjct  123  IILERLLPYHPGYERKIGSGIDYITVGYHPEFESSRCLFIVRKDGELVDFSYWKCI  178



>ref|XP_009354160.1| PREDICTED: protein DCL, chloroplastic-like [Pyrus x bretschneideri]
Length=212

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 37/63 (59%), Gaps = 1/63 (2%)
 Frame = -1

Query  638  INEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFK-SRCFFIVRVDGSADDFSFR  462
            + E +  V++E +   H   + KIG  I +     HP FK SRC F++R DG+  DFS++
Sbjct  125  LTEEDEKVVVERLLAHHPHSEDKIGCAIDSIMADRHPQFKHSRCLFVIRTDGAWIDFSYQ  184

Query  461  KCV  453
            KC+
Sbjct  185  KCL  187



>ref|XP_006838071.1| hypothetical protein AMTR_s00091p00171300 [Amborella trichopoda]
 gb|ERN00640.1| hypothetical protein AMTR_s00091p00171300 [Amborella trichopoda]
Length=108

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = -1

Query  617  VLLELIKKGHADPQKKIGQGIGAFQVRNHPIFK-SRCFFIVRVDGSADDFSFRKCVDRIL  441
            ++LE +   H +  KKIG G+    +  HP F+ SRC F++R DG+  DFSF KC+  ++
Sbjct  26   IILEKLLPYHPEADKKIGPGVEFITIDYHPDFENSRCLFLMRKDGTEVDFSFWKCIKGLI  85



>ref|XP_008375320.1| PREDICTED: DNA-directed RNA polymerase V subunit 1-like [Malus 
domestica]
Length=945

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 32/51 (63%), Gaps = 1/51 (2%)
 Frame = -1

Query  590  HADPQKKIGQGIGAFQVRNHPIFK-SRCFFIVRVDGSADDFSFRKCVDRIL  441
            H D   K+G GIG   V  H  F+ SRCFF+V  +G  +DFS+RKC++  +
Sbjct  831  HPDKAVKMGSGIGHLTVDRHGSFQDSRCFFVVTTEGHKEDFSYRKCLENYI  881



>ref|XP_008220273.1| PREDICTED: protein DCL, chloroplastic [Prunus mume]
Length=207

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 35/56 (63%), Gaps = 1/56 (2%)
 Frame = -1

Query  617  VLLELIKKGHADPQKKIGQGIGAFQVRNHPIFK-SRCFFIVRVDGSADDFSFRKCV  453
            V++E +   H   + KIG GI +  V  HP F+ SRC F++R DG   DFS++KC+
Sbjct  127  VVVERLLAHHPHSEDKIGCGIDSIMVDRHPQFRHSRCLFVIRTDGIWIDFSYQKCL  182



>gb|AES94122.2| DNA-directed RNA polymerase [Medicago truncatula]
Length=1519

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 44/73 (60%), Gaps = 5/73 (7%)
 Frame = -1

Query  611   LELIKKGHADPQK--KIGQGIGAFQVRNHPIFK-SRCFFIVRVDGSADDFSFRKCVDRIL  441
             L ++K  H  P++  K G G    +V  HP F  SRCFFI+R DGS +DFS+RKC+   L
Sbjct  1390  LTIMKVLHFHPRRDEKFGSGPQNIKVGWHPEFTDSRCFFIIRKDGSVEDFSYRKCILGAL  1449

Query  440   PL--PESMQIKHN  408
              +  P+  +I+ N
Sbjct  1450  DIIDPKKSKIQRN  1462



>ref|XP_010094661.1| hypothetical protein L484_008893 [Morus notabilis]
 gb|EXB56512.1| hypothetical protein L484_008893 [Morus notabilis]
Length=230

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 36/60 (60%), Gaps = 1/60 (2%)
 Frame = -1

Query  617  VLLELIKKGHADPQKKIGQGIGAFQVRNHPIFK-SRCFFIVRVDGSADDFSFRKCVDRIL  441
             ++E +   H   + KIG G+ +  V  HP F+ SRC FI+R DG+  DFS++KC+   L
Sbjct  151  AVVEKLLAYHPRSEDKIGCGLDSIMVDRHPQFRNSRCLFIIRTDGAWIDFSYQKCLRHYL  210



>gb|KHG04572.1| Protein DCL, chloroplastic [Gossypium arboreum]
Length=217

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 38/65 (58%), Gaps = 2/65 (3%)
 Frame = -1

Query  632  EYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIF-KSRCFFIVRVDGSADDFSFRKC  456
            E+E  +L  L+   H + +KKIG GI    V  HP F  SRC FIVR DG   DFS+ KC
Sbjct  131  EHEKTILERLLPY-HPESEKKIGCGIDYITVGYHPEFVGSRCLFIVRKDGELVDFSYWKC  189

Query  455  VDRIL  441
            +  ++
Sbjct  190  IKGLI  194



>ref|XP_006420718.1| hypothetical protein CICLE_v10004129mg [Citrus clementina]
 gb|ESR33958.1| hypothetical protein CICLE_v10004129mg [Citrus clementina]
Length=1867

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (63%), Gaps = 1/51 (2%)
 Frame = -1

Query  590   HADPQKKIGQGIGAFQVRNHPIFK-SRCFFIVRVDGSADDFSFRKCVDRIL  441
             H D   K+G GI  F+V  H  F+ SRC F+V  DGS  DFS+RKC++  +
Sbjct  1776  HPDKAMKMGAGIDHFKVDKHGSFQDSRCLFVVSTDGSQQDFSYRKCLESFI  1826



>ref|XP_008452556.1| PREDICTED: protein DCL, chloroplastic [Cucumis melo]
Length=225

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 36/60 (60%), Gaps = 1/60 (2%)
 Frame = -1

Query  617  VLLELIKKGHADPQKKIGQGIGAFQVRNHPIFKS-RCFFIVRVDGSADDFSFRKCVDRIL  441
             +LE +   H + +KKIG G+    V  HP F+S RC FIVR DG   DFS+ KC+  ++
Sbjct  141  TILERLLPYHPESEKKIGCGVDYITVGYHPDFESSRCLFIVRKDGELVDFSYWKCIKGLI  200



>ref|XP_007158453.1| hypothetical protein PHAVU_002G153700g [Phaseolus vulgaris]
 gb|ESW30447.1| hypothetical protein PHAVU_002G153700g [Phaseolus vulgaris]
Length=1463

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 42/67 (63%), Gaps = 2/67 (3%)
 Frame = -1

Query  638   INEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFK-SRCFFIVRVDGSADDFSFR  462
             ++E++   +L ++   H    +K+G G    +V  HP FK SRCF IVR DG+ +DFS+R
Sbjct  1367  LSEFDRSTILRVLN-FHPRRSEKLGIGPQDIKVGWHPKFKDSRCFHIVRTDGTVEDFSYR  1425

Query  461   KCVDRIL  441
             KC+ R L
Sbjct  1426  KCILRAL  1432



>ref|XP_008378172.1| PREDICTED: uncharacterized protein LOC103441252 [Malus domestica]
Length=283

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 37/63 (59%), Gaps = 1/63 (2%)
 Frame = -1

Query  638  INEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFK-SRCFFIVRVDGSADDFSFR  462
            + E +  V++E +   H   + KIG GI +  V  HP FK  RC F++R DG   DFS++
Sbjct  196  LTEEDEKVVVERLLAHHPHSEDKIGCGIDSIMVDRHPQFKHXRCLFVIRTDGVWXDFSYQ  255

Query  461  KCV  453
            KC+
Sbjct  256  KCL  258



>ref|XP_002284778.1| PREDICTED: protein DCL, chloroplastic [Vitis vinifera]
Length=215

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 40/65 (62%), Gaps = 2/65 (3%)
 Frame = -1

Query  632  EYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFK-SRCFFIVRVDGSADDFSFRKC  456
            E+E  VL +L+   H + +KKIG GI    V  HP F+ SRC FIVR DG   DFS+ KC
Sbjct  131  EHEKFVLEKLLAY-HPECEKKIGCGIDYITVGYHPDFEGSRCLFIVRNDGELVDFSYWKC  189

Query  455  VDRIL  441
            +  ++
Sbjct  190  IKGLI  194



>ref|XP_007158454.1| hypothetical protein PHAVU_002G153700g [Phaseolus vulgaris]
 gb|ESW30448.1| hypothetical protein PHAVU_002G153700g [Phaseolus vulgaris]
Length=1464

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 42/67 (63%), Gaps = 2/67 (3%)
 Frame = -1

Query  638   INEYEHMVLLELIKKGHADPQKKIGQGIGAFQVRNHPIFK-SRCFFIVRVDGSADDFSFR  462
             ++E++   +L ++   H    +K+G G    +V  HP FK SRCF IVR DG+ +DFS+R
Sbjct  1368  LSEFDRSTILRVLN-FHPRRSEKLGIGPQDIKVGWHPKFKDSRCFHIVRTDGTVEDFSYR  1426

Query  461   KCVDRIL  441
             KC+ R L
Sbjct  1427  KCILRAL  1433



>ref|XP_003611164.1| DNA-directed RNA polymerase subunit beta [Medicago truncatula]
Length=1687

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 44/73 (60%), Gaps = 5/73 (7%)
 Frame = -1

Query  611   LELIKKGHADPQK--KIGQGIGAFQVRNHPIFK-SRCFFIVRVDGSADDFSFRKCVDRIL  441
             L ++K  H  P++  K G G    +V  HP F  SRCFFI+R DGS +DFS+RKC+   L
Sbjct  1558  LTIMKVLHFHPRRDEKFGSGPQNIKVGWHPEFTDSRCFFIIRKDGSVEDFSYRKCILGAL  1617

Query  440   PL--PESMQIKHN  408
              +  P+  +I+ N
Sbjct  1618  DIIDPKKSKIQRN  1630



>ref|XP_006470866.1| PREDICTED: DNA-directed RNA polymerase V subunit 1-like [Citrus 
sinensis]
Length=1865

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (63%), Gaps = 1/51 (2%)
 Frame = -1

Query  590   HADPQKKIGQGIGAFQVRNHPIFK-SRCFFIVRVDGSADDFSFRKCVDRIL  441
             H D   K+G GI  F+V  H  F+ SRC F+V  DGS  DFS+RKC++  +
Sbjct  1774  HPDKAMKMGAGIDHFKVDKHGSFQDSRCLFVVSTDGSQQDFSYRKCLESFI  1824



>ref|XP_002454603.1| hypothetical protein SORBIDRAFT_04g034170 [Sorghum bicolor]
 gb|EES07579.1| hypothetical protein SORBIDRAFT_04g034170 [Sorghum bicolor]
Length=236

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 33/56 (59%), Gaps = 1/56 (2%)
 Frame = -1

Query  617  VLLELIKKGHADPQKKIGQGIGAFQVRNHPIFK-SRCFFIVRVDGSADDFSFRKCV  453
             +LE +   H +  KKIG GI    V  HP F+ SRC FIVR DG   DFSF KCV
Sbjct  155  AILERLLPYHPEYDKKIGCGIDYITVGLHPEFENSRCLFIVRKDGEQVDFSFWKCV  210



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2388345296832