BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7362_g1_i1 len=980 path=[803:0-732 1536:733-801 1536:802-870
1617:871-979]

Length=980
                                                                      Score     E

ref|XP_004245571.1|  PREDICTED: protein SPIRAL1-like 5                81.6    8e-16   
ref|XP_009768724.1|  PREDICTED: protein SPIRAL1-like 5                80.5    2e-15   
ref|XP_009604284.1|  PREDICTED: protein SPIRAL1-like 5                79.7    5e-15   
ref|XP_002278988.1|  PREDICTED: protein SPIRAL1-like 5                75.1    2e-13   Vitis vinifera
gb|ABK93358.1|  unknown                                               72.4    2e-12   Populus trichocarpa [western balsam poplar]
ref|XP_011022628.1|  PREDICTED: protein SPIRAL1-like 5                72.0    3e-12   
ref|XP_010448700.1|  PREDICTED: protein SPIRAL1-like 5                71.6    5e-12   
ref|XP_006439489.1|  hypothetical protein CICLE_v10023365mg           70.9    8e-12   
ref|XP_002299512.1|  hypothetical protein POPTR_0001s09780g           70.9    8e-12   Populus trichocarpa [western balsam poplar]
ref|XP_002303604.1|  hypothetical protein POPTR_0003s13150g           70.5    1e-11   Populus trichocarpa [western balsam poplar]
ref|XP_002509849.1|  SP1L, putative                                   70.5    1e-11   Ricinus communis
ref|XP_010439167.1|  PREDICTED: protein SPIRAL1-like 5                70.1    1e-11   
ref|XP_010433899.1|  PREDICTED: protein SPIRAL1-like 5                69.7    2e-11   
ref|XP_011029345.1|  PREDICTED: protein SPIRAL1-like 5                68.9    4e-11   
gb|KDP25393.1|  hypothetical protein JCGZ_20549                       68.2    9e-11   
ref|XP_007040334.1|  Uncharacterized protein TCM_016326               67.4    1e-10   
gb|KHG30592.1|  3-isopropylmalate dehydratase large subunit           67.4    2e-10   
ref|XP_009345127.1|  PREDICTED: protein SPIRAL1-like 5                67.4    2e-10   
ref|XP_008452039.1|  PREDICTED: protein SPIRAL1-like 5                65.9    5e-10   
ref|XP_004298827.1|  PREDICTED: protein SPIRAL1-like 5-like           65.9    5e-10   
ref|XP_004146520.1|  PREDICTED: protein SPIRAL1-like 5-like           65.5    8e-10   
gb|EYU23461.1|  hypothetical protein MIMGU_mgv1a020916mg              65.5    1e-09   
ref|XP_009363401.1|  PREDICTED: protein SPIRAL1-like 5                64.7    1e-09   
ref|XP_008392950.1|  PREDICTED: protein SPIRAL1-like 5                64.3    2e-09   
ref|XP_010541163.1|  PREDICTED: protein SPIRAL1-like 5                64.3    2e-09   
ref|XP_010676425.1|  PREDICTED: protein SPIRAL1-like 5                64.3    2e-09   
ref|XP_009108605.1|  PREDICTED: protein SPIRAL1-like 5                63.5    3e-09   
ref|XP_010053222.1|  PREDICTED: protein SPIRAL1-like 5                63.9    3e-09   
emb|CDY65232.1|  BnaCnng46230D                                        63.5    4e-09   
ref|XP_006284828.1|  hypothetical protein CARUB_v10006108mg           62.4    1e-08   
ref|XP_002867704.1|  hypothetical protein ARALYDRAFT_492521           62.0    1e-08   
ref|XP_011074179.1|  PREDICTED: protein SPIRAL1-like 5                61.6    2e-08   
ref|XP_006422032.1|  hypothetical protein CICLE_v10006293mg           61.6    2e-08   
ref|XP_006413549.1|  hypothetical protein EUTSA_v10027042mg           61.2    2e-08   
ref|NP_567685.1|  protein SPIRAL1-like5                               61.2    3e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009137067.1|  PREDICTED: protein SPIRAL1-like 5                60.5    5e-08   
ref|XP_007038807.1|  Glycerol dehydrogenase large subunit, putative   60.1    6e-08   
ref|XP_007208852.1|  hypothetical protein PRUPE_ppa025762mg           60.1    7e-08   
ref|XP_010529620.1|  PREDICTED: protein SPIRAL1-like 5 isoform X1     59.3    1e-07   
ref|XP_008805554.1|  PREDICTED: protein SPIRAL1-like 5                59.3    1e-07   
ref|XP_010919118.1|  PREDICTED: protein SPIRAL1-like 5 isoform X2     59.3    1e-07   
ref|XP_010933980.1|  PREDICTED: protein SPIRAL1-like 5                59.3    1e-07   
emb|CDP12063.1|  unnamed protein product                              58.9    2e-07   
ref|XP_008377589.1|  PREDICTED: protein SPIRAL1-like 5                58.9    2e-07   
ref|XP_008810118.1|  PREDICTED: protein SPIRAL1-like 5                58.9    2e-07   
ref|XP_010089057.1|  hypothetical protein L484_024230                 58.5    2e-07   
emb|CDY63421.1|  BnaCnng42090D                                        58.5    2e-07   
ref|XP_007158524.1|  hypothetical protein PHAVU_002G159400g           58.2    3e-07   
ref|XP_010919117.1|  PREDICTED: protein SPIRAL1-like 5 isoform X1     58.9    3e-07   
ref|XP_008238945.1|  PREDICTED: protein SPIRAL1-like 5                58.2    4e-07   
ref|XP_007210726.1|  hypothetical protein PRUPE_ppa022393mg           57.8    4e-07   
ref|XP_006829075.1|  hypothetical protein AMTR_s00001p00259880        56.6    9e-07   
gb|ABR17819.1|  unknown                                               56.2    1e-06   Picea sitchensis
gb|ACC91277.1|  unknown                                               55.8    2e-06   Capsella rubella
ref|XP_009382259.1|  PREDICTED: protein SPIRAL1-like 5                55.5    3e-06   
ref|XP_010460317.1|  PREDICTED: protein SPIRAL1-like 1                55.5    3e-06   
ref|XP_002977573.1|  hypothetical protein SELMODRAFT_443554           55.1    5e-06   
ref|XP_006856449.1|  hypothetical protein AMTR_s00047p00230680        53.5    5e-06   
ref|XP_010477864.1|  PREDICTED: protein SPIRAL1-like 1                54.3    8e-06   
ref|XP_006338353.1|  PREDICTED: protein SPIRAL1-like 1-like           53.9    9e-06   
ref|XP_007216070.1|  hypothetical protein PRUPE_ppa017965mg           54.3    9e-06   
ref|XP_004232154.1|  PREDICTED: protein SPIRAL1-like 1                53.9    9e-06   
ref|XP_008230904.1|  PREDICTED: protein SPIRAL1-like 2                54.3    1e-05   
emb|CDY34708.1|  BnaA01g33170D                                        53.5    1e-05   
ref|XP_003525379.1|  PREDICTED: protein SPIRAL1-like 5-like           53.5    1e-05   
ref|XP_003581695.1|  PREDICTED: protein SPIRAL1-like 1                53.5    1e-05   
gb|KHN25680.1|  hypothetical protein glysoja_018254                   53.1    1e-05   
gb|ABK23093.1|  unknown                                               53.1    1e-05   Picea sitchensis
ref|XP_010255226.1|  PREDICTED: protein SPIRAL1-like 5                53.1    2e-05   
ref|NP_001237130.1|  uncharacterized protein LOC100306586             53.1    2e-05   
ref|XP_011070925.1|  PREDICTED: protein SPIRAL1-like 1                53.1    2e-05   
ref|NP_001150321.1|  nitrilase-associated protein                     53.1    2e-05   Zea mays [maize]
gb|ACG30822.1|  nitrilase-associated protein                          53.1    2e-05   Zea mays [maize]
ref|XP_011070923.1|  PREDICTED: protein SPIRAL1-like 1                53.1    2e-05   
ref|XP_010258011.1|  PREDICTED: protein SPIRAL1-like 2                53.1    2e-05   
ref|XP_009400057.1|  PREDICTED: protein SPIRAL1-like 3                52.8    2e-05   
ref|XP_010680669.1|  PREDICTED: protein SPIRAL1-like 1                53.1    2e-05   
ref|XP_009117803.1|  PREDICTED: protein SPIRAL1-like 3                53.1    2e-05   
ref|XP_004304219.1|  PREDICTED: protein SPIRAL1-like 1-like           53.5    2e-05   
ref|XP_008810744.1|  PREDICTED: protein SPIRAL1-like 3 isoform X2     52.8    2e-05   
gb|ACA58349.1|  putative nitrilase-associated protein                 52.8    2e-05   Sandersonia aurantiaca [Chinese-lantern lily]
gb|AIG20404.1|  At3g02200-like protein                                54.7    2e-05   
ref|XP_010663458.1|  PREDICTED: protein SPIRAL1-like 1 isoform X2     53.1    2e-05   
ref|XP_009406308.1|  PREDICTED: protein SPIRAL1-like 3                52.8    2e-05   
emb|CDP02330.1|  unnamed protein product                              52.8    2e-05   
ref|XP_007160098.1|  hypothetical protein PHAVU_002G292200g           52.4    3e-05   
ref|XP_010936457.1|  PREDICTED: protein SPIRAL1-like 3                52.4    3e-05   
ref|XP_001758605.1|  predicted protein                                52.8    3e-05   
ref|XP_009126059.1|  PREDICTED: protein SPIRAL1-like 4                52.4    3e-05   
emb|CDX85544.1|  BnaA02g02690D                                        52.8    3e-05   
ref|NP_001236360.1|  uncharacterized protein LOC100526947             52.4    3e-05   
ref|XP_011018777.1|  PREDICTED: protein SPIRAL1-like 1                52.4    3e-05   
emb|CBI15321.3|  unnamed protein product                              52.8    3e-05   
ref|XP_010663457.1|  PREDICTED: protein SPIRAL1-like 1 isoform X1     52.8    3e-05   
gb|EPS62977.1|  hypothetical protein M569_11815                       52.0    3e-05   
ref|XP_009767263.1|  PREDICTED: protein SPIRAL1-like 1                52.4    4e-05   
ref|XP_009416560.1|  PREDICTED: protein SPIRAL1-like 3                52.0    4e-05   
ref|XP_011085678.1|  PREDICTED: protein SPIRAL1-like 2                52.0    4e-05   
ref|XP_002533540.1|  SP1L, putative                                   52.0    4e-05   Ricinus communis
gb|EYU23621.1|  hypothetical protein MIMGU_mgv1a016534mg              52.4    4e-05   
ref|XP_004236061.1|  PREDICTED: protein SPIRAL1-like 1                52.0    4e-05   
ref|XP_004297225.1|  PREDICTED: protein SPIRAL1-like 1-like isofo...  52.4    4e-05   
ref|XP_002975167.1|  hypothetical protein SELMODRAFT_415236           55.1    4e-05   
ref|XP_009596273.1|  PREDICTED: protein SPIRAL1-like 1                52.0    4e-05   
ref|XP_010937691.1|  PREDICTED: protein SPIRAL1-like 1                52.0    4e-05   
ref|XP_006345113.1|  PREDICTED: protein SPIRAL1-like 1-like           52.0    4e-05   
gb|AFW88103.1|  hypothetical protein ZEAMMB73_001069                  51.2    4e-05   
ref|XP_001754081.1|  predicted protein                                52.4    5e-05   
emb|CDX90984.1|  BnaC02g06130D                                        52.0    5e-05   
dbj|BAK01594.1|  predicted protein                                    51.6    5e-05   
ref|XP_006437905.1|  hypothetical protein CICLE_v10033140mg           52.0    5e-05   
gb|AAU05601.1|  hypothetical protein                                  52.4    5e-05   Acrostichum aureum
ref|XP_006484225.1|  PREDICTED: protein SPIRAL1-like 1-like isofo...  51.6    5e-05   
ref|XP_008810743.1|  PREDICTED: protein SPIRAL1-like 3 isoform X1     52.0    5e-05   
gb|EEC68488.1|  hypothetical protein OsI_36745                        52.0    6e-05   Oryza sativa Indica Group [Indian rice]
gb|KDO70333.1|  hypothetical protein CISIN_1g034005mg                 51.6    6e-05   
gb|EMS45081.1|  hypothetical protein TRIUR3_32047                     51.6    6e-05   
ref|NP_001068314.1|  Os11g0629400                                     51.6    6e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009800170.1|  PREDICTED: protein SPIRAL1-like 1                51.6    6e-05   
ref|XP_008805159.1|  PREDICTED: protein SPIRAL1-like 1                51.6    6e-05   
ref|XP_001769047.1|  predicted protein                                51.6    6e-05   
ref|NP_001132152.1|  uncharacterized protein LOC100193571             51.6    6e-05   Zea mays [maize]
emb|CDP18053.1|  unnamed protein product                              51.6    6e-05   
emb|CDY26443.1|  BnaC09g42250D                                        51.6    7e-05   
ref|XP_009593870.1|  PREDICTED: protein SPIRAL1-like 1                51.6    7e-05   
ref|XP_008339794.1|  PREDICTED: protein SPIRAL1-like 1                51.6    7e-05   
ref|XP_004297224.1|  PREDICTED: protein SPIRAL1-like 1-like isofo...  52.0    7e-05   
ref|XP_009121557.1|  PREDICTED: protein SPIRAL1-like 4                51.6    7e-05   
gb|ACF74272.1|  putative nitrilase-associated protein                 51.2    8e-05   Arachis hypogaea [goober]
ref|XP_009402969.1|  PREDICTED: protein SPIRAL1-like 3                51.2    8e-05   
ref|XP_002465124.1|  hypothetical protein SORBIDRAFT_01g032430        51.2    8e-05   Sorghum bicolor [broomcorn]
ref|XP_011014914.1|  PREDICTED: protein SPIRAL1-like 1                51.2    8e-05   
ref|XP_008360088.1|  PREDICTED: protein SPIRAL1-like 1                51.2    9e-05   
ref|XP_011011852.1|  PREDICTED: protein SPIRAL1-like 1                51.2    9e-05   
ref|XP_009356421.1|  PREDICTED: protein SPIRAL1-like 1                51.2    9e-05   
ref|XP_006650199.1|  PREDICTED: protein SPIRAL1-like 1-like           51.2    9e-05   
gb|ABK26309.1|  unknown                                               51.2    1e-04   Picea sitchensis
ref|XP_001770348.1|  predicted protein                                50.8    1e-04   
ref|XP_006482790.1|  PREDICTED: protein SPIRAL1-like 2-like           51.2    1e-04   
gb|AAM64577.1|  putative nitrilase-associated protein                 50.8    1e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007045838.1|  T1K7.26 protein                                  51.2    1e-04   
ref|XP_006400083.1|  hypothetical protein EUTSA_v10015075mg           50.8    1e-04   
sp|Q7Y1L9.1|SP1L1_ORYSJ  RecName: Full=Protein SPIRAL1-like 1         50.8    1e-04   Oryza sativa Japonica Group [Japonica rice]
gb|ABK94106.1|  unknown                                               50.8    1e-04   Populus trichocarpa [western balsam poplar]
ref|XP_002285501.1|  PREDICTED: protein SPIRAL1-like 1                50.8    1e-04   Vitis vinifera
ref|NP_001150100.1|  LOC100283729                                     50.8    1e-04   Zea mays [maize]
gb|KDP27263.1|  hypothetical protein JCGZ_19962                       50.8    1e-04   
ref|XP_008341789.1|  PREDICTED: protein SPIRAL1-like 2                50.8    1e-04   
ref|XP_002316083.1|  hypothetical protein POPTR_0010s16510g           50.8    1e-04   Populus trichocarpa [western balsam poplar]
ref|XP_002512065.1|  SP1L, putative                                   50.8    1e-04   Ricinus communis
emb|CDX91981.1|  BnaC03g32830D                                        51.2    1e-04   
gb|AFK42937.1|  unknown                                               50.8    1e-04   
gb|KDP41319.1|  hypothetical protein JCGZ_15726                       50.8    1e-04   
gb|KCW77484.1|  hypothetical protein EUGRSUZ_D01822                   50.4    1e-04   
ref|XP_010532521.1|  PREDICTED: protein SPIRAL1-like 1                50.4    1e-04   
ref|XP_002323906.1|  hypothetical protein POPTR_0017s13090g           50.4    1e-04   Populus trichocarpa [western balsam poplar]
ref|XP_009134653.1|  PREDICTED: protein SPIRAL1-like 3                50.8    1e-04   
gb|EYU28873.1|  hypothetical protein MIMGU_mgv1a016596mg              50.4    2e-04   
ref|XP_006288895.1|  hypothetical protein CARUB_v10002258mg           50.4    2e-04   
ref|XP_009365969.1|  PREDICTED: protein SPIRAL1-like 2                50.8    2e-04   
ref|NP_001173473.1|  Os03g0417800                                     50.8    2e-04   
ref|XP_007151340.1|  hypothetical protein PHAVU_004G038000g           50.4    2e-04   
emb|CDX74269.1|  BnaA03g27780D                                        51.6    2e-04   
ref|XP_010525121.1|  PREDICTED: protein SPIRAL1-like 3                50.1    2e-04   
gb|ABD96926.1|  hypothetical protein                                  50.1    2e-04   Tarenaya spinosa
ref|XP_010551372.1|  PREDICTED: protein SPIRAL1-like 2                50.4    2e-04   
ref|XP_010549990.1|  PREDICTED: protein SPIRAL1-like 2                50.1    2e-04   
ref|XP_010089653.1|  hypothetical protein L484_021046                 50.4    2e-04   
ref|XP_010511947.1|  PREDICTED: protein SPIRAL1-like 2                50.1    2e-04   
emb|CDY54148.1|  BnaCnng26280D                                        50.1    2e-04   
ref|XP_002888708.1|  hypothetical protein ARALYDRAFT_476049           50.1    2e-04   
gb|AFK48679.1|  unknown                                               50.4    2e-04   
tpg|DAA45815.1|  TPA: NAP16kDa protein                                50.4    2e-04   
gb|AAM64731.1|  nitrilase associated protein-like                     50.1    2e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010463613.1|  PREDICTED: protein SPIRAL1-like 3                50.1    2e-04   
ref|NP_177083.1|  protein SPIRAL1-like2                               50.1    2e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002875225.1|  hypothetical protein ARALYDRAFT_322665           50.1    2e-04   
ref|NP_197064.1|  protein SPIRAL1-like4                               50.1    2e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010470896.1|  PREDICTED: protein SPIRAL1-like 2                50.1    2e-04   
ref|XP_010492403.1|  PREDICTED: protein SPIRAL1-like 4                50.1    2e-04   
ref|XP_010415555.1|  PREDICTED: protein SPIRAL1-like 2                49.7    2e-04   
ref|XP_006828929.1|  hypothetical protein AMTR_s00001p00214730        49.7    3e-04   
ref|XP_010923629.1|  PREDICTED: protein SPIRAL1-like 1                49.7    3e-04   
ref|XP_006408438.1|  hypothetical protein EUTSA_v10021779mg           49.7    3e-04   
ref|XP_004984003.1|  PREDICTED: protein SPIRAL1-like 1-like isofo...  49.7    3e-04   
ref|XP_002451163.1|  hypothetical protein SORBIDRAFT_05g025170        49.7    3e-04   Sorghum bicolor [broomcorn]
ref|XP_003532924.1|  PREDICTED: protein SPIRAL1-like 5-like           49.3    3e-04   
ref|XP_010455021.1|  PREDICTED: protein SPIRAL1-like 3 isoform X1     49.7    3e-04   
ref|XP_006303022.1|  hypothetical protein CARUB_v10021178mg           49.7    3e-04   
ref|NP_001238317.1|  uncharacterized protein LOC100499684             49.7    3e-04   
ref|XP_010420229.1|  PREDICTED: protein SPIRAL1-like 4                49.7    3e-04   
ref|XP_010485455.1|  PREDICTED: protein SPIRAL1-like 3                49.7    3e-04   
ref|XP_010453696.1|  PREDICTED: protein SPIRAL1-like 4                49.7    3e-04   
ref|XP_010455733.1|  PREDICTED: protein SPIRAL1-like 3 isoform X2     49.7    3e-04   
ref|XP_006298828.1|  hypothetical protein CARUB_v10014933mg           49.7    3e-04   
gb|AFW60310.1|  SPR1                                                  49.3    3e-04   
ref|NP_001148014.1|  LOC100281623                                     49.3    3e-04   Zea mays [maize]
ref|XP_008379871.1|  PREDICTED: LOW QUALITY PROTEIN: putative met...  52.4    4e-04   
gb|ABF50107.1|  nitrilase associated protein-like                     48.9    4e-04   Musa acuminata [banana]
ref|XP_002311347.2|  hypothetical protein POPTR_0008s09660g           50.4    4e-04   Populus trichocarpa [western balsam poplar]
ref|XP_010091590.1|  hypothetical protein L484_026438                 49.3    4e-04   
ref|XP_006366253.1|  PREDICTED: protein SPIRAL1-like 1-like isofo...  49.3    4e-04   
ref|XP_008677707.1|  PREDICTED: LOC100283729 isoform X1               50.1    4e-04   
ref|XP_009127712.1|  PREDICTED: protein SPIRAL1-like 1                49.3    4e-04   
ref|XP_008243833.1|  PREDICTED: protein SPIRAL1-like 1 isoform X2     49.3    4e-04   
ref|XP_009798020.1|  PREDICTED: protein SPIRAL1-like 3 isoform X1     49.3    4e-04   
ref|XP_004228412.1|  PREDICTED: protein SPIRAL1-like 1                48.9    4e-04   
ref|XP_008243832.1|  PREDICTED: protein SPIRAL1-like 1 isoform X1     49.3    5e-04   
ref|XP_007153506.1|  hypothetical protein PHAVU_003G041500g           48.9    5e-04   
emb|CAN70558.1|  hypothetical protein VITISV_027475                   48.9    5e-04   Vitis vinifera
gb|EYU42122.1|  hypothetical protein MIMGU_mgv1a016618mg              48.9    6e-04   
ref|XP_009419546.1|  PREDICTED: protein SPIRAL1-like 3                48.5    6e-04   
ref|XP_009338090.1|  PREDICTED: protein SPIRAL1-like 3                48.5    7e-04   
ref|XP_009612685.1|  PREDICTED: protein SPIRAL1-like 1                48.5    7e-04   
gb|ACH63211.1|  nitrilase-associated protein                          48.5    7e-04   Rheum australe [Himalayan rhubarb]
ref|XP_008785613.1|  PREDICTED: protein SPIRAL1-like 3                48.1    8e-04   
ref|XP_009769296.1|  PREDICTED: protein SPIRAL1-like 1                48.1    8e-04   
emb|CDY50305.1|  BnaA02g14630D                                        48.5    8e-04   
ref|XP_004239040.1|  PREDICTED: protein SPIRAL1-like 1                48.1    9e-04   
ref|XP_010032547.1|  PREDICTED: protein SPIRAL1-like 2                48.5    9e-04   
gb|AAD27575.1|AF114171_17  hypothetical protein                       49.7    0.001   Sorghum bicolor [broomcorn]



>ref|XP_004245571.1| PREDICTED: protein SPIRAL1-like 5 [Solanum lycopersicum]
 ref|XP_006343937.1| PREDICTED: protein SPIRAL1-like 5-like [Solanum tuberosum]
Length=105

 Score = 81.6 bits (200),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 56/85 (66%), Gaps = 7/85 (8%)
 Frame = +1

Query  256  DDKHNKRNETPPPSP-ICAPPYGIDSDVDNTTVSKpppppNSPGNTFERTLSQNSGNFAI  432
            DDK  ++ + PPPSP I APPYGID D + +         N+   T++R+  QNSG F I
Sbjct  26   DDKKQQKIDEPPPSPTILAPPYGIDDDTNYS-----QNNSNTTSITYQRSQGQNSGIF-I  79

Query  433  ASRPSTKVKSAPGGDSSLGYLFGDK  507
              RPSTKV S PGGDSSLGYLFGDK
Sbjct  80   TGRPSTKVNSVPGGDSSLGYLFGDK  104



>ref|XP_009768724.1| PREDICTED: protein SPIRAL1-like 5 [Nicotiana sylvestris]
Length=106

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 58/87 (67%), Gaps = 11/87 (13%)
 Frame = +1

Query  256  DDKHNKRNETPPPSP-ICAPPYGIDSDVDNTTVSKpppppNSPGN--TFERTLSQNSGNF  426
            DDK  ++ + PPPSP + APPYGID   +N +        NSP    T++++  QNSG F
Sbjct  27   DDKKQQKIDDPPPSPTVYAPPYGIDDSTENPS-------ENSPSTSITYQKSQGQNSGIF  79

Query  427  AIASRPSTKVKSAPGGDSSLGYLFGDK  507
             I  RPSTKVKS PGGDSSLGYLFGDK
Sbjct  80   -ITGRPSTKVKSVPGGDSSLGYLFGDK  105



>ref|XP_009604284.1| PREDICTED: protein SPIRAL1-like 5 [Nicotiana tomentosiformis]
Length=106

 Score = 79.7 bits (195),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 58/87 (67%), Gaps = 11/87 (13%)
 Frame = +1

Query  256  DDKHNKRNETPPPSP-ICAPPYGIDSDVDNTTVSKpppppNSP--GNTFERTLSQNSGNF  426
            DDK  ++ + PPPSP + APPYGID   +N +        NSP    T++++  QNSG F
Sbjct  27   DDKKQQKIDDPPPSPTVYAPPYGIDYTTENPS-------QNSPPTSITYQKSQGQNSGIF  79

Query  427  AIASRPSTKVKSAPGGDSSLGYLFGDK  507
             I  RPSTKVKS PGGDSSLGYLFGDK
Sbjct  80   -ITGRPSTKVKSVPGGDSSLGYLFGDK  105



>ref|XP_002278988.1| PREDICTED: protein SPIRAL1-like 5 [Vitis vinifera]
 emb|CBI34378.3| unnamed protein product [Vitis vinifera]
Length=100

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 50/75 (67%), Gaps = 2/75 (3%)
 Frame = +1

Query  286  PPPSP-ICAPPYGIDSDVDNTTVSKpppppNSPGNTFERTLSQNSGNFAIASRPSTKVKS  462
            PP SP I  PPYGID+  +      PP    S  N ++RT  QN+GNF I  RPSTKV+S
Sbjct  27   PPVSPTIQLPPYGIDTIPEKPPNRPPPAEKQSSSNNYQRTQGQNTGNF-ITDRPSTKVRS  85

Query  463  APGGDSSLGYLFGDK  507
             PGGDSSLGYLFGDK
Sbjct  86   VPGGDSSLGYLFGDK  100



>gb|ABK93358.1| unknown [Populus trichocarpa]
Length=99

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 46/74 (62%), Gaps = 2/74 (3%)
 Frame = +1

Query  286  PPPSPICAPPYGIDSDVDNTTVSKpppppNSPGNTFERTLSQNSGNFAIASRPSTKVKSA  465
            PP  P+  PPYG+D  V+    S          N + R   QN+GNF IA RPSTKVKS 
Sbjct  28   PPLRPVNLPPYGVDITVEKPPDSGSAEKKQV-SNNYHRAQGQNTGNF-IADRPSTKVKSV  85

Query  466  PGGDSSLGYLFGDK  507
            PGGDSSLGYLFGDK
Sbjct  86   PGGDSSLGYLFGDK  99



>ref|XP_011022628.1| PREDICTED: protein SPIRAL1-like 5 [Populus euphratica]
Length=99

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 48/75 (64%), Gaps = 3/75 (4%)
 Frame = +1

Query  286  PPPS-PICAPPYGIDSDVDNTTVSKpppppNSPGNTFERTLSQNSGNFAIASRPSTKVKS  462
            PPPS P+  PPYG+D  ++ +  S          N + R   QN+GNF I  RPSTKVKS
Sbjct  27   PPPSRPVNLPPYGVDITIEKSPDSGSSEKKQV-SNNYHRAQGQNTGNF-ITDRPSTKVKS  84

Query  463  APGGDSSLGYLFGDK  507
             PGGDSSLGYLFGDK
Sbjct  85   VPGGDSSLGYLFGDK  99



>ref|XP_010448700.1| PREDICTED: protein SPIRAL1-like 5 [Camelina sativa]
Length=101

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 49/74 (66%), Gaps = 4/74 (5%)
 Frame = +1

Query  289  PPSPICAPPYGIDSDVDNTTVSKpppppNSPGNTFERTLSQNSGNFAIASRPSTKVKSAP  468
            P +P  APPYG+DS  ++    KP    N   N ++R   QNSGNF +  RP+TKVKS P
Sbjct  30   PVAPKPAPPYGVDSTEEDGADQKPKISNN---NNYQRVQGQNSGNF-VTDRPTTKVKSVP  85

Query  469  GGDSSLGYLFGDKI  510
            GG SSLGYLFGDK+
Sbjct  86   GGGSSLGYLFGDKV  99



>ref|XP_006439489.1| hypothetical protein CICLE_v10023365mg [Citrus clementina]
 ref|XP_006476507.1| PREDICTED: protein SPIRAL1-like 5-like [Citrus sinensis]
 gb|ESR52729.1| hypothetical protein CICLE_v10023365mg [Citrus clementina]
 gb|KDO76317.1| hypothetical protein CISIN_1g034283mg [Citrus sinensis]
Length=99

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 48/74 (65%), Gaps = 2/74 (3%)
 Frame = +1

Query  286  PPPSPICAPPYGIDSDVDNTTVSKpppppNSPGNTFERTLSQNSGNFAIASRPSTKVKSA  465
            P P  +  PPYGID+  +    ++ P  PN   N + R   QN+GNF I  RPSTKVKS 
Sbjct  28   PAPQTVSLPPYGIDTTTEKPQDNQAPNKPNV-SNNYHRAQGQNTGNF-ITDRPSTKVKSV  85

Query  466  PGGDSSLGYLFGDK  507
            PGGDSSLGYLFGDK
Sbjct  86   PGGDSSLGYLFGDK  99



>ref|XP_002299512.1| hypothetical protein POPTR_0001s09780g [Populus trichocarpa]
 gb|EEE84317.1| hypothetical protein POPTR_0001s09780g [Populus trichocarpa]
Length=99

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 45/74 (61%), Gaps = 2/74 (3%)
 Frame = +1

Query  286  PPPSPICAPPYGIDSDVDNTTVSKpppppNSPGNTFERTLSQNSGNFAIASRPSTKVKSA  465
            PP  P+  PPYG+D  V+    S          N + R   QN+GNF I  RPSTKVKS 
Sbjct  28   PPLRPVNLPPYGVDITVEKPPDSGSAEKKQV-SNNYHRAQGQNTGNF-ITDRPSTKVKSV  85

Query  466  PGGDSSLGYLFGDK  507
            PGGDSSLGYLFGDK
Sbjct  86   PGGDSSLGYLFGDK  99



>ref|XP_002303604.1| hypothetical protein POPTR_0003s13150g [Populus trichocarpa]
 gb|ABK92866.1| unknown [Populus trichocarpa]
 gb|ABK93985.1| unknown [Populus trichocarpa]
 gb|EEE78583.1| hypothetical protein POPTR_0003s13150g [Populus trichocarpa]
Length=99

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 48/75 (64%), Gaps = 3/75 (4%)
 Frame = +1

Query  286  PPPS-PICAPPYGIDSDVDNTTVSKpppppNSPGNTFERTLSQNSGNFAIASRPSTKVKS  462
            PPPS P+  PPYG+D  ++ +  S          N + R   QN+GNF I  RPSTKVKS
Sbjct  27   PPPSRPVNLPPYGVDITIEKSPDS-GSSEKKPVSNNYHRAQGQNTGNF-ITDRPSTKVKS  84

Query  463  APGGDSSLGYLFGDK  507
             PGGDSSLGYLFGDK
Sbjct  85   VPGGDSSLGYLFGDK  99



>ref|XP_002509849.1| SP1L, putative [Ricinus communis]
 gb|EEF51236.1| SP1L, putative [Ricinus communis]
Length=100

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 46/76 (61%), Gaps = 2/76 (3%)
 Frame = +1

Query  283  TPPPSP-ICAPPYGIDSDVDNTTVSKpppppNSPGNTFERTLSQNSGNFAIASRPSTKVK  459
            TPPPS  +  PPYG+D   +    +          N + R   QN+GNF I  RPSTKVK
Sbjct  26   TPPPSQTVNLPPYGVDVIPEKNNPNNLSAEKGKVSNNYHRAQGQNTGNF-ITDRPSTKVK  84

Query  460  SAPGGDSSLGYLFGDK  507
            S PGGDSSLGYLFGDK
Sbjct  85   SVPGGDSSLGYLFGDK  100



>ref|XP_010439167.1| PREDICTED: protein SPIRAL1-like 5 [Camelina sativa]
Length=101

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 51/82 (62%), Gaps = 8/82 (10%)
 Frame = +1

Query  277  NETP----PPSPICAPPYGIDSDVDNTTVSKpppppNSPGNTFERTLSQNSGNFAIASRP  444
            NE P    P +P   PPYG+DS  ++    KP    N   N ++R   QNSGNF +  RP
Sbjct  22   NEIPKTPQPVAPKPTPPYGVDSTEEDGADQKPKISNN---NNYQRVQGQNSGNF-VTDRP  77

Query  445  STKVKSAPGGDSSLGYLFGDKI  510
            +TKVKS PGG SSLGYLFGDK+
Sbjct  78   TTKVKSVPGGGSSLGYLFGDKV  99



>ref|XP_010433899.1| PREDICTED: protein SPIRAL1-like 5 [Camelina sativa]
Length=101

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 51/82 (62%), Gaps = 8/82 (10%)
 Frame = +1

Query  277  NETP----PPSPICAPPYGIDSDVDNTTVSKpppppNSPGNTFERTLSQNSGNFAIASRP  444
            NE P    P +P  APPYG+D   ++    KP    N   N ++R   QNSGNF +  RP
Sbjct  22   NEIPKTPQPVAPKPAPPYGVDPTEEDGADQKPKISNN---NNYQRVQGQNSGNF-VTDRP  77

Query  445  STKVKSAPGGDSSLGYLFGDKI  510
            +TKVKS PGG SSLGYLFGDK+
Sbjct  78   TTKVKSVPGGGSSLGYLFGDKV  99



>ref|XP_011029345.1| PREDICTED: protein SPIRAL1-like 5 [Populus euphratica]
Length=99

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 44/74 (59%), Gaps = 2/74 (3%)
 Frame = +1

Query  286  PPPSPICAPPYGIDSDVDNTTVSKpppppNSPGNTFERTLSQNSGNFAIASRPSTKVKSA  465
            PP  P+  PPYG+D  V+    S          N + R    N+GNF I  RPSTKVKS 
Sbjct  28   PPLRPVNLPPYGVDITVEKPPDSGSAEKKEV-SNNYHRAQDHNTGNF-ITDRPSTKVKSV  85

Query  466  PGGDSSLGYLFGDK  507
            PGGDSSLGYLFGDK
Sbjct  86   PGGDSSLGYLFGDK  99



>gb|KDP25393.1| hypothetical protein JCGZ_20549 [Jatropha curcas]
Length=106

 Score = 68.2 bits (165),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 47/84 (56%), Gaps = 10/84 (12%)
 Frame = +1

Query  277  NETPPPSPICAPPYGIDS-------DVDNTTVSKpppppNSPGNTFERTLSQNSGNFAIA  435
            N  PP   I  PPYGID+         DN +         S  N + R   QNSGNF I 
Sbjct  26   NAAPPSRIINLPPYGIDTIEQEEKPRHDNPSDKNKHNKVTS--NNYHRAEGQNSGNF-IT  82

Query  436  SRPSTKVKSAPGGDSSLGYLFGDK  507
             RPSTKVKS PGGDSSLGYLFGDK
Sbjct  83   DRPSTKVKSVPGGDSSLGYLFGDK  106



>ref|XP_007040334.1| Uncharacterized protein TCM_016326 [Theobroma cacao]
 gb|EOY24835.1| Uncharacterized protein TCM_016326 [Theobroma cacao]
Length=103

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 47/79 (59%), Gaps = 7/79 (9%)
 Frame = +1

Query  286  PPPSPICAPPYGIDSDVD-----NTTVSKpppppNSPGNTFERTLSQNSGNFAIASRPST  450
            P  +P   PPYGID+  +     N   S+     N   N + R   QNSGNF I  RPST
Sbjct  27   PAVTPPIQPPYGIDTTPETPPAPNKLRSEKRTEKNV-NNNYHRAQGQNSGNF-ITDRPST  84

Query  451  KVKSAPGGDSSLGYLFGDK  507
            KVKS PGGDSSLGYLFGDK
Sbjct  85   KVKSVPGGDSSLGYLFGDK  103



>gb|KHG30592.1| 3-isopropylmalate dehydratase large subunit [Gossypium arboreum]
Length=103

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 46/78 (59%), Gaps = 5/78 (6%)
 Frame = +1

Query  286  PPPSPICAPPYGIDSDVDN----TTVSKpppppNSPGNTFERTLSQNSGNFAIASRPSTK  453
            P  +P   PPYGID   +N       S       +  N ++R   QN+GNF I  RPSTK
Sbjct  27   PTVTPAIQPPYGIDITPENPPPQYKPSSEQQTEKNTTNNYQRAKGQNAGNF-ITDRPSTK  85

Query  454  VKSAPGGDSSLGYLFGDK  507
            VKS PGGDSSLGYLFGDK
Sbjct  86   VKSVPGGDSSLGYLFGDK  103



>ref|XP_009345127.1| PREDICTED: protein SPIRAL1-like 5 [Pyrus x bretschneideri]
Length=105

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 54/85 (64%), Gaps = 9/85 (11%)
 Frame = +1

Query  274  RNETPPPS--PICAPPYGIDSDVDNTTVSKpppppNSP-----GNTFERTLSQNSGNFAI  432
            + ++PPP+  P+  PPYGID    +T    P  P NS       N + R   QNSGNF +
Sbjct  23   QQQSPPPTAKPVI-PPYGIDRFDSSTEFKPPDTPTNSSEKHKISNNYHRADGQNSGNF-L  80

Query  433  ASRPSTKVKSAPGGDSSLGYLFGDK  507
              RP+TKVKSAPGGDSSLGYLFGDK
Sbjct  81   TDRPTTKVKSAPGGDSSLGYLFGDK  105



>ref|XP_008452039.1| PREDICTED: protein SPIRAL1-like 5 [Cucumis melo]
Length=102

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 46/80 (58%), Gaps = 21/80 (26%)
 Frame = +1

Query  301  ICAPPYGIDSDVDN-----------TTVSKpppppNSPGNTFERTLSQNSGNFAIASRPS  447
            +  PPYGID + D+             VSK         N + R   QNSGNF I  RPS
Sbjct  33   VLPPPYGIDLNPDDDHHNNPSPSPKQLVSK---------NNYPRAHGQNSGNF-ITDRPS  82

Query  448  TKVKSAPGGDSSLGYLFGDK  507
            TKVKSAPGGDSSLGYLFGDK
Sbjct  83   TKVKSAPGGDSSLGYLFGDK  102



>ref|XP_004298827.1| PREDICTED: protein SPIRAL1-like 5-like [Fragaria vesca subsp. 
vesca]
Length=99

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 48/78 (62%), Gaps = 4/78 (5%)
 Frame = +1

Query  280  ETPPPS--PICAPPYGIDSDVDNTTVSKpppppNSPGNTFERTLSQNSGNFAIASRPSTK  453
            +TPPP+  P+  PPYGID+               S  N ++R    NSGNF +  RP+TK
Sbjct  24   QTPPPAAKPVL-PPYGIDTTTTYDHHKPSDHKTPSNTNNYQRADGPNSGNF-VTDRPTTK  81

Query  454  VKSAPGGDSSLGYLFGDK  507
            VKS PGGDSSLGYLFGDK
Sbjct  82   VKSVPGGDSSLGYLFGDK  99



>ref|XP_004146520.1| PREDICTED: protein SPIRAL1-like 5-like [Cucumis sativus]
 ref|XP_004160958.1| PREDICTED: protein SPIRAL1-like 5-like [Cucumis sativus]
 gb|KGN53333.1| hypothetical protein Csa_4G047940 [Cucumis sativus]
Length=104

 Score = 65.5 bits (158),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 45/72 (63%), Gaps = 8/72 (11%)
 Frame = +1

Query  301  ICAPPYGIDSDVD----NTTVSKpppppNSPGNTFERTLSQNSGNFAIASRPSTKVKSAP  468
            +  PPYGID + D    N + S      N   N + R   QNSGNF I  RPSTKVKSAP
Sbjct  33   VLPPPYGIDLNPDDHNNNPSPSPKQLVSN---NNYPRAHGQNSGNF-ITDRPSTKVKSAP  88

Query  469  GGDSSLGYLFGD  504
            GGDSSLGYLFGD
Sbjct  89   GGDSSLGYLFGD  100



>gb|EYU23461.1| hypothetical protein MIMGU_mgv1a020916mg [Erythranthe guttata]
Length=117

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 56/96 (58%), Gaps = 13/96 (14%)
 Frame = +1

Query  256  DDKHNKRNETPPPSPICA--PPYGIDSDVDN-----TTVSKpppppNS-----PGNTFER  399
            D  + ++N+  PPSP  A  PPY  D+D +      ++ S+     N+       N + R
Sbjct  21   DSNNKQKNKAAPPSPTTAYKPPYATDTDNEKPPENPSSASQDHKITNAIPNNDNNNNYPR  80

Query  400  TLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFGDK  507
               Q SGNF I  RPSTKVKSAPGGDSSLGYLFGD+
Sbjct  81   VQGQISGNF-ITGRPSTKVKSAPGGDSSLGYLFGDQ  115



>ref|XP_009363401.1| PREDICTED: protein SPIRAL1-like 5 [Pyrus x bretschneideri]
Length=105

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 53/85 (62%), Gaps = 9/85 (11%)
 Frame = +1

Query  274  RNETPPPS--PICAPPYGIDSDVDNTTVSKpppppNSP-----GNTFERTLSQNSGNFAI  432
            + ++PPP+  P+  PPYGID    +T    P  P NS       N + R   QNSGNF +
Sbjct  23   QKQSPPPTAKPVI-PPYGIDRFDSSTEFKPPDTPTNSSEKQKNSNNYHRAEGQNSGNF-L  80

Query  433  ASRPSTKVKSAPGGDSSLGYLFGDK  507
              RP+TKVKSAPGGDSSLGYLFG K
Sbjct  81   TDRPTTKVKSAPGGDSSLGYLFGAK  105



>ref|XP_008392950.1| PREDICTED: protein SPIRAL1-like 5 [Malus domestica]
Length=105

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 45/73 (62%), Gaps = 6/73 (8%)
 Frame = +1

Query  304  CAPPYGIDSDVDNTTVSKpppppNSP-----GNTFERTLSQNSGNFAIASRPSTKVKSAP  468
              PPYGID    +T    P  P NS       N + R   QNSGNF +  RP+TKVKSAP
Sbjct  34   VIPPYGIDRFDSSTEFKPPDTPTNSSEKHKISNNYHRADGQNSGNF-LTDRPTTKVKSAP  92

Query  469  GGDSSLGYLFGDK  507
            GGDSSLGYLFGDK
Sbjct  93   GGDSSLGYLFGDK  105



>ref|XP_010541163.1| PREDICTED: protein SPIRAL1-like 5 [Tarenaya hassleriana]
Length=97

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 46/83 (55%), Gaps = 11/83 (13%)
 Frame = +1

Query  274  RNETPP--PSPICA---PPYGIDSDVDNTTVSKpppppNSPGNTFERTLSQNSGNFAIAS  438
             N+ PP  P P  A   PPYG+D   D   +           N + R   QNSGNF +  
Sbjct  21   ENDQPPQTPHPAAAKPTPPYGVDDGDDKPKIQIAISN-----NNYHRAHGQNSGNF-VTD  74

Query  439  RPSTKVKSAPGGDSSLGYLFGDK  507
            RP+TKVKS PGG SSLGYLFGDK
Sbjct  75   RPTTKVKSVPGGGSSLGYLFGDK  97



>ref|XP_010676425.1| PREDICTED: protein SPIRAL1-like 5 [Beta vulgaris subsp. vulgaris]
Length=110

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 45/69 (65%), Gaps = 6/69 (9%)
 Frame = +1

Query  301  ICAPPYGIDSDVDNTTVSKpppppNSPGNTFERTLSQNSGNFAIASRPSTKVKSAPGGDS  480
            + +PPYG D + +     KPP   ++  N + R   QNSGNF I  RPSTKVKS PGG S
Sbjct  48   LVSPPYGTDIEGE-----KPPQKSDTSNNNYHRAQGQNSGNF-ITDRPSTKVKSVPGGSS  101

Query  481  SLGYLFGDK  507
            SLGYLFGDK
Sbjct  102  SLGYLFGDK  110



>ref|XP_009108605.1| PREDICTED: protein SPIRAL1-like 5 [Brassica rapa]
 emb|CDY68263.1| BnaAnng26650D [Brassica napus]
Length=99

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 48/81 (59%), Gaps = 8/81 (10%)
 Frame = +1

Query  277  NETPPPSPICAP----PYGIDSDVDNTTVSKpppppNSPGNTFERTLSQNSGNFAIASRP  444
            NETP   P  AP    PYGID   D+ +  KP    N   N + R   QNSGNF +  RP
Sbjct  22   NETPKNLPSAAPKPTPPYGIDPTDDDKSDQKPKISNN---NNYYRAQGQNSGNF-VTDRP  77

Query  445  STKVKSAPGGDSSLGYLFGDK  507
            +TKVKS PGG SSLGYLFG K
Sbjct  78   TTKVKSVPGGGSSLGYLFGVK  98



>ref|XP_010053222.1| PREDICTED: protein SPIRAL1-like 5 [Eucalyptus grandis]
 gb|KCW77485.1| hypothetical protein EUGRSUZ_D01822 [Eucalyptus grandis]
Length=114

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 43/69 (62%), Gaps = 3/69 (4%)
 Frame = +1

Query  307  APPYGIDSDVDNTTVSKpppppNSP--GNTFERTLSQNSGNFAIASRPSTKVKSAPGGDS  480
            APP+ +D   +    S+ P     P   N + R   QNSGNF I  RPST+VKS PGGDS
Sbjct  47   APPHRVDKIAEKNEDSRSPSDDRKPNISNNYHRAQGQNSGNF-ITERPSTQVKSVPGGDS  105

Query  481  SLGYLFGDK  507
            SLGYLFGDK
Sbjct  106  SLGYLFGDK  114



>emb|CDY65232.1| BnaCnng46230D [Brassica napus]
Length=99

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 47/81 (58%), Gaps = 8/81 (10%)
 Frame = +1

Query  277  NETPPPSPICAP----PYGIDSDVDNTTVSKpppppNSPGNTFERTLSQNSGNFAIASRP  444
            NETP   P  AP    PYGID   D  +  KP    N   N + R   QNSGNF +  RP
Sbjct  22   NETPKNLPSAAPKPTPPYGIDPTDDEKSDQKPKISNN---NNYYRAQGQNSGNF-VTDRP  77

Query  445  STKVKSAPGGDSSLGYLFGDK  507
            +TKVKS PGG SSLGYLFG K
Sbjct  78   TTKVKSVPGGGSSLGYLFGVK  98



>ref|XP_006284828.1| hypothetical protein CARUB_v10006108mg [Capsella rubella]
 gb|EOA17726.1| hypothetical protein CARUB_v10006108mg [Capsella rubella]
Length=101

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 46/81 (57%), Gaps = 5/81 (6%)
 Frame = +1

Query  277  NETP----PPSPICAPPYGIDSDVDNTTVSKpppppNSPGNTFERTLSQNSGNFAIASRP  444
            NE P    P +P  APPYG+D         K     N+  N ++R   QNS NF +  RP
Sbjct  22   NEIPKTPQPVAPKPAPPYGVDYTEKEEADHKKQKISNNNNNNYQRAQGQNSDNF-VTDRP  80

Query  445  STKVKSAPGGDSSLGYLFGDK  507
            +TKV S PGG SSLGYLFGDK
Sbjct  81   TTKVTSVPGGGSSLGYLFGDK  101



>ref|XP_002867704.1| hypothetical protein ARALYDRAFT_492521 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43963.1| hypothetical protein ARALYDRAFT_492521 [Arabidopsis lyrata subsp. 
lyrata]
Length=97

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 42/64 (66%), Gaps = 5/64 (8%)
 Frame = +1

Query  316  YGIDSDVDNTTVSKpppppNSPGNTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYL  495
            YG+DS  DN    KP    N+    ++R   QNSGNF +  RP+TKVKS PGG SSLGYL
Sbjct  39   YGVDSTEDNEADKKPMISNNN----YQRAQGQNSGNF-VTDRPTTKVKSVPGGGSSLGYL  93

Query  496  FGDK  507
            FGDK
Sbjct  94   FGDK  97



>ref|XP_011074179.1| PREDICTED: protein SPIRAL1-like 5 [Sesamum indicum]
Length=105

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 32/41 (78%), Gaps = 1/41 (2%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFGDK  507
            N + R   QNSGNF I  RPSTKV SAPGGDSSLGYLFGDK
Sbjct  65   NNYNRVQGQNSGNF-ITGRPSTKVTSAPGGDSSLGYLFGDK  104



>ref|XP_006422032.1| hypothetical protein CICLE_v10006293mg [Citrus clementina]
 ref|XP_006490693.1| PREDICTED: protein SPIRAL1-like 5-like [Citrus sinensis]
 gb|ESR35272.1| hypothetical protein CICLE_v10006293mg [Citrus clementina]
 gb|KDO56790.1| hypothetical protein CISIN_1g046463mg [Citrus sinensis]
Length=102

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 48/78 (62%), Gaps = 7/78 (9%)
 Frame = +1

Query  292  PSPICAPPYGIDSDVDNTTVSKpppppNSPG------NTFERTLSQNSGNFAIASRPSTK  453
            PS   A P  I +  D+   +K PP  +SP       N + R   QNSGNF I  RP+T+
Sbjct  24   PSQPPASPAAIKAPWDDDNTTKKPPNNSSPSEKLTVSNNYHRAQGQNSGNF-ITDRPTTR  82

Query  454  VKSAPGGDSSLGYLFGDK  507
            V+SAPGGDSSLGYLFGDK
Sbjct  83   VQSAPGGDSSLGYLFGDK  100



>ref|XP_006413549.1| hypothetical protein EUTSA_v10027042mg [Eutrema salsugineum]
 gb|ESQ55002.1| hypothetical protein EUTSA_v10027042mg [Eutrema salsugineum]
Length=98

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 41/64 (64%), Gaps = 4/64 (6%)
 Frame = +1

Query  316  YGIDSDVDNTTVSKpppppNSPGNTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYL  495
            YG+DS  D+    KP    N   N + R   QNSGNF +  RP+TKVKS PGG SSLGYL
Sbjct  39   YGVDSTDDDKADQKPEISNN---NNYHRAQGQNSGNF-VTDRPTTKVKSVPGGGSSLGYL  94

Query  496  FGDK  507
            FGDK
Sbjct  95   FGDK  98



>ref|NP_567685.1| protein SPIRAL1-like5 [Arabidopsis thaliana]
 sp|Q8LGD1.1|SP1L5_ARATH RecName: Full=Protein SPIRAL1-like 5 [Arabidopsis thaliana]
 gb|AAM60920.1| putative nitrilase-associated protein [Arabidopsis thaliana]
 gb|AAO42000.1| unknown protein [Arabidopsis thaliana]
 gb|AAO50587.1| unknown protein [Arabidopsis thaliana]
 gb|AEE84767.1| protein SPIRAL1-like5 [Arabidopsis thaliana]
Length=99

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 42/64 (66%), Gaps = 4/64 (6%)
 Frame = +1

Query  316  YGIDSDVDNTTVSKpppppNSPGNTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYL  495
            YG+DS  ++    + P   N   N ++R   QNSGNF +  RP+TKVKS PGG SSLGYL
Sbjct  40   YGVDSTEEDHEADQKPKISN---NNYQRVQGQNSGNF-VTDRPTTKVKSVPGGGSSLGYL  95

Query  496  FGDK  507
            FGDK
Sbjct  96   FGDK  99



>ref|XP_009137067.1| PREDICTED: protein SPIRAL1-like 5 [Brassica rapa]
 emb|CDY44103.1| BnaA01g13110D [Brassica napus]
Length=99

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 44/65 (68%), Gaps = 5/65 (8%)
 Frame = +1

Query  316  YGID-SDVDNTTVSKpppppNSPGNTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGY  492
            YG+D +D DN +  KP    N   N + R   QNSGNF + +RP+TKVKS PGG SSLGY
Sbjct  39   YGVDFTDGDNKSDQKPTLSEN---NNYPRAQGQNSGNF-VTARPTTKVKSVPGGGSSLGY  94

Query  493  LFGDK  507
            LFGDK
Sbjct  95   LFGDK  99



>ref|XP_007038807.1| Glycerol dehydrogenase large subunit, putative [Theobroma cacao]
 gb|EOY23308.1| Glycerol dehydrogenase large subunit, putative [Theobroma cacao]
Length=98

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 45/75 (60%), Gaps = 8/75 (11%)
 Frame = +1

Query  289  PPSPICAPPYGIDSDVDNTTVS--KpppppNSPGNTFERTLSQNSGNFAIASRPSTKVKS  462
            P +PI AP      + DNTT          +S  N + R   QNSGNF I  RP+TKV+S
Sbjct  30   PSTPIKAP-----WNDDNTTKKPPNNSSKKSSVTNNYHRAQGQNSGNF-ITDRPTTKVQS  83

Query  463  APGGDSSLGYLFGDK  507
            APGGDSSLGYLFG K
Sbjct  84   APGGDSSLGYLFGHK  98



>ref|XP_007208852.1| hypothetical protein PRUPE_ppa025762mg [Prunus persica]
 gb|EMJ10051.1| hypothetical protein PRUPE_ppa025762mg [Prunus persica]
Length=104

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 32/41 (78%), Gaps = 1/41 (2%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFGDK  507
            N + R   QNSGNF +  RP+TKVKS PGGDSSLGYLFGDK
Sbjct  65   NNYHRAEGQNSGNF-LTDRPTTKVKSVPGGDSSLGYLFGDK  104



>ref|XP_010529620.1| PREDICTED: protein SPIRAL1-like 5 isoform X1 [Tarenaya hassleriana]
 ref|XP_010529621.1| PREDICTED: protein SPIRAL1-like 5 isoform X2 [Tarenaya hassleriana]
Length=97

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 39/64 (61%), Gaps = 6/64 (9%)
 Frame = +1

Query  316  YGIDSDVDNTTVSKpppppNSPGNTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYL  495
            YGID   D     KP        N + R   QNSGNF +  RP+TKVKSAPGG SSLGYL
Sbjct  40   YGIDDGED-----KPKMKITVSNNNYHRAHGQNSGNF-VTDRPTTKVKSAPGGGSSLGYL  93

Query  496  FGDK  507
            FGDK
Sbjct  94   FGDK  97



>ref|XP_008805554.1| PREDICTED: protein SPIRAL1-like 5 [Phoenix dactylifera]
Length=98

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 31/41 (76%), Gaps = 1/41 (2%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFGDK  507
            N + R   QNSGNF I  RPSTKV SAPGG SSLGYLFGDK
Sbjct  59   NNYHRAQGQNSGNF-ITGRPSTKVLSAPGGSSSLGYLFGDK  98



>ref|XP_010919118.1| PREDICTED: protein SPIRAL1-like 5 isoform X2 [Elaeis guineensis]
Length=101

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 31/41 (76%), Gaps = 1/41 (2%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFGDK  507
            N + R   QNSGNF I  RPSTKV SAPGG SSLGYLFGDK
Sbjct  62   NNYHRAQGQNSGNF-ITGRPSTKVLSAPGGSSSLGYLFGDK  101



>ref|XP_010933980.1| PREDICTED: protein SPIRAL1-like 5 [Elaeis guineensis]
Length=101

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 31/41 (76%), Gaps = 1/41 (2%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFGDK  507
            N + R   QNSGNF I  RPSTKV+S PGG SSLGYLFGDK
Sbjct  62   NNYHRAQGQNSGNF-ITGRPSTKVQSVPGGSSSLGYLFGDK  101



>emb|CDP12063.1| unnamed protein product [Coffea canephora]
Length=105

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 53/90 (59%), Gaps = 12/90 (13%)
 Frame = +1

Query  256  DDKHNKRNETPPPSPIC-APPYGIDSDV-----DNTTVSKpppppNSPGNTFERTLSQNS  417
            DDK  K++  PP +P+  APPYGID+       DN + S      N  G+        NS
Sbjct  21   DDK--KKDTAPPATPVVFAPPYGIDTGEEEKPPDNPSPS---SKGNVSGDPKRSPKDLNS  75

Query  418  GNFAIASRPSTKVKSAPGGDSSLGYLFGDK  507
            G  +I  RPSTKVKS PGGDSSLGYLFGDK
Sbjct  76   GK-SITIRPSTKVKSVPGGDSSLGYLFGDK  104



>ref|XP_008377589.1| PREDICTED: protein SPIRAL1-like 5 [Malus domestica]
Length=105

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 44/75 (59%), Gaps = 10/75 (13%)
 Frame = +1

Query  304  CAPPYGID---SDVD----NTTVSKpppppNSPGNTFERTLSQNSGNFAIASRPSTKVKS  462
              PPYGID   S  +    +T  +      NS  N + R   QNSGNF +  RP+ KVKS
Sbjct  34   VIPPYGIDRFDSSXEFKPPBTPTNSSEKQKNS--NNYHRAEGQNSGNF-LTDRPTXKVKS  90

Query  463  APGGDSSLGYLFGDK  507
            APGGDSSLGYLFG K
Sbjct  91   APGGDSSLGYLFGAK  105



>ref|XP_008810118.1| PREDICTED: protein SPIRAL1-like 5 [Phoenix dactylifera]
Length=101

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 31/41 (76%), Gaps = 1/41 (2%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFGDK  507
            N + R   QNSGNF I  RPSTKV+S PGG SSLGYLFGDK
Sbjct  62   NNYHRAQGQNSGNF-ITGRPSTKVQSVPGGSSSLGYLFGDK  101



>ref|XP_010089057.1| hypothetical protein L484_024230 [Morus notabilis]
 gb|EXB37304.1| hypothetical protein L484_024230 [Morus notabilis]
Length=107

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 31/41 (76%), Gaps = 1/41 (2%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFGDK  507
            N + R   QN GNF +  RPSTKVKS PGGDSSLGYLFGDK
Sbjct  68   NNYHRAEGQNLGNF-VTDRPSTKVKSVPGGDSSLGYLFGDK  107



>emb|CDY63421.1| BnaCnng42090D [Brassica napus]
Length=99

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 44/65 (68%), Gaps = 5/65 (8%)
 Frame = +1

Query  316  YGID-SDVDNTTVSKpppppNSPGNTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGY  492
            YG+D +D DN +  KP    N   N + R   QNSGNF + +RP+TKVKS PGG SSLGY
Sbjct  39   YGVDFTDGDNKSDQKPTLSEN---NNYPRAQGQNSGNF-VTARPTTKVKSVPGGGSSLGY  94

Query  493  LFGDK  507
            LFG+K
Sbjct  95   LFGNK  99



>ref|XP_007158524.1| hypothetical protein PHAVU_002G159400g [Phaseolus vulgaris]
 ref|XP_007158525.1| hypothetical protein PHAVU_002G159400g [Phaseolus vulgaris]
 gb|ESW30518.1| hypothetical protein PHAVU_002G159400g [Phaseolus vulgaris]
 gb|ESW30519.1| hypothetical protein PHAVU_002G159400g [Phaseolus vulgaris]
Length=99

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 50/80 (63%), Gaps = 4/80 (5%)
 Frame = +1

Query  271  KRNETPPPSPICAPPYGIDSDVDNTTVSKpppppNSP-GNTFERTLSQNSGNFAIASRPS  447
            ++N+  P + +  PPYG++  +DNT +     PPN+    T  R+   + GN  +  RPS
Sbjct  23   QQNQPQPTATVPLPPYGVE--IDNTMLPHAVNPPNTQLVVTNNRSQGHHLGNI-VTDRPS  79

Query  448  TKVKSAPGGDSSLGYLFGDK  507
            TKVKS PGG SSLGYLFGDK
Sbjct  80   TKVKSVPGGHSSLGYLFGDK  99



>ref|XP_010919117.1| PREDICTED: protein SPIRAL1-like 5 isoform X1 [Elaeis guineensis]
Length=145

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 31/41 (76%), Gaps = 1/41 (2%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFGDK  507
            N + R   QNSGNF I  RPSTKV SAPGG SSLGYLFGDK
Sbjct  106  NNYHRAQGQNSGNF-ITGRPSTKVLSAPGGSSSLGYLFGDK  145



>ref|XP_008238945.1| PREDICTED: protein SPIRAL1-like 5 [Prunus mume]
Length=104

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 31/41 (76%), Gaps = 1/41 (2%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFGDK  507
            N + R   QNSGNF +  RP+TKV S PGGDSSLGYLFGDK
Sbjct  65   NNYHRAEGQNSGNF-LTDRPTTKVNSVPGGDSSLGYLFGDK  104



>ref|XP_007210726.1| hypothetical protein PRUPE_ppa022393mg [Prunus persica]
 gb|EMJ11925.1| hypothetical protein PRUPE_ppa022393mg [Prunus persica]
Length=104

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 31/41 (76%), Gaps = 1/41 (2%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFGDK  507
            N + R   QNSGNF +  RP+TKV S PGGDSSLGYLFGDK
Sbjct  65   NNYHRAEGQNSGNF-LTDRPTTKVNSVPGGDSSLGYLFGDK  104



>ref|XP_006829075.1| hypothetical protein AMTR_s00001p00259880 [Amborella trichopoda]
 gb|ERM96491.1| hypothetical protein AMTR_s00001p00259880 [Amborella trichopoda]
Length=93

 Score = 56.6 bits (135),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 30/41 (73%), Gaps = 1/41 (2%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFGDK  507
            N + R   QN+GNF I  RP+TKV   PGGDSSLGYLFGDK
Sbjct  54   NNYHRAQGQNTGNF-ITDRPTTKVHRVPGGDSSLGYLFGDK  93



>gb|ABR17819.1| unknown [Picea sitchensis]
Length=102

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 31/41 (76%), Gaps = 1/41 (2%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFGDK  507
            N + R   QNSGNF I  RPSTKV+S PGG SSLGYLFG+K
Sbjct  62   NNYHRADGQNSGNF-ITGRPSTKVQSVPGGGSSLGYLFGEK  101



>gb|ACC91277.1| unknown [Capsella rubella]
Length=98

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 43/81 (53%), Gaps = 8/81 (10%)
 Frame = +1

Query  277  NETP----PPSPICAPPYGIDSDVDNTTVSKpppppNSPGNTFERTLSQNSGNFAIASRP  444
            NE P    P +P  APPYG+D         K     N+  N ++R   QNS NF      
Sbjct  22   NEIPKTPQPVAPKPAPPYGVDYTEKEEADHKKQKISNNNNNNYQRAQGQNSDNFVT----  77

Query  445  STKVKSAPGGDSSLGYLFGDK  507
            +TKV S PGG SSLGYLFGDK
Sbjct  78   TTKVTSVPGGGSSLGYLFGDK  98



>ref|XP_009382259.1| PREDICTED: protein SPIRAL1-like 5 [Musa acuminata subsp. malaccensis]
Length=102

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 30/41 (73%), Gaps = 1/41 (2%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFGDK  507
            N + R   QNSGNF I  RP TKV+S PGG SSLGYLFGDK
Sbjct  63   NNYYRARGQNSGNF-ITGRPFTKVQSVPGGSSSLGYLFGDK  102



>ref|XP_010460317.1| PREDICTED: protein SPIRAL1-like 1 [Camelina sativa]
 ref|XP_010460318.1| PREDICTED: protein SPIRAL1-like 1 [Camelina sativa]
Length=113

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 44/87 (51%), Gaps = 8/87 (9%)
 Frame = +1

Query  244  APADDDKHNKRNETPPPSPICAPPYGIDSDVDNTTVSKpppppNSPGNTFERTLSQNSGN  423
            APA        N  P P P  A P        N T   P    NS  N + RT  QN+GN
Sbjct  31   APAPQSDTLPVNADPSPKPAAAQP-------ANVTKQIPAGISNSSTNNYARTDGQNTGN  83

Query  424  FAIASRPSTKVKSAPGGDSSLGYLFGD  504
            F +  RPSTKV +APGG SSL YLFGD
Sbjct  84   F-LTDRPSTKVHAAPGGGSSLNYLFGD  109



>ref|XP_002977573.1| hypothetical protein SELMODRAFT_443554 [Selaginella moellendorffii]
 gb|EFJ21577.1| hypothetical protein SELMODRAFT_443554 [Selaginella moellendorffii]
Length=130

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 41/74 (55%), Gaps = 5/74 (7%)
 Frame = +1

Query  286  PPPSPICAPPYGIDSDVDNTTVSKpppppNSPGNTFERTLSQNSGNFAIASRPSTKVKSA  465
            P P+P  AP      +  +  V K     N+    + R   QN+GNF I  RPSTKV SA
Sbjct  62   PTPTPTHAPAACKHEENGDAGVVKLGRNNNN----YHRADGQNTGNF-ITDRPSTKVHSA  116

Query  466  PGGDSSLGYLFGDK  507
            PGG SSLGYLFG K
Sbjct  117  PGGGSSLGYLFGGK  130



>ref|XP_006856449.1| hypothetical protein AMTR_s00047p00230680, partial [Amborella 
trichopoda]
 gb|ERN17916.1| hypothetical protein AMTR_s00047p00230680, partial [Amborella 
trichopoda]
Length=53

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 30/40 (75%), Gaps = 1/40 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFGD  504
            N + R   QNSGNF I  RPSTKV SAPGG SSLGYLFG+
Sbjct  11   NNYFRAEGQNSGNF-ITDRPSTKVHSAPGGGSSLGYLFGN  49



>ref|XP_010477864.1| PREDICTED: protein SPIRAL1-like 1 [Camelina sativa]
 ref|XP_010477865.1| PREDICTED: protein SPIRAL1-like 1 [Camelina sativa]
Length=114

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 41/75 (55%), Gaps = 8/75 (11%)
 Frame = +1

Query  277  NETPPPSPICAPPYGIDSDVDNTTVSKpppppNSPGNTFERTLSQNSGNFAIASRPSTKV  456
            N  P P P+ A P        N T   P    NS  N + RT  QN+GNF +  RPSTKV
Sbjct  43   NADPSPKPVVAQPA-------NVTKQIPAGISNSSTNNYTRTDGQNTGNF-LTDRPSTKV  94

Query  457  KSAPGGDSSLGYLFG  501
             +APGG SSL YLFG
Sbjct  95   HAAPGGGSSLNYLFG  109



>ref|XP_006338353.1| PREDICTED: protein SPIRAL1-like 1-like [Solanum tuberosum]
Length=110

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 47/86 (55%), Gaps = 2/86 (2%)
 Frame = +1

Query  247  PADDDKHNKRNETPPPSPICAPPYGIDSDVDNTTVSKpppppNSPGNTFERTLSQNSGNF  426
            PA++ +  +  E  P +   + P  +   VD+T         N+  N F R   QN GNF
Sbjct  23   PANNSQTARNQEKAPTNEPASKPAAVAQPVDSTKNVPAGIHSNNTNNYF-RADGQNCGNF  81

Query  427  AIASRPSTKVKSAPGGDSSLGYLFGD  504
             +  R STKV++APGG SSLGYLFGD
Sbjct  82   -LTERRSTKVQAAPGGGSSLGYLFGD  106



>ref|XP_007216070.1| hypothetical protein PRUPE_ppa017965mg [Prunus persica]
 gb|EMJ17269.1| hypothetical protein PRUPE_ppa017965mg [Prunus persica]
Length=122

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 29/41 (71%), Gaps = 1/41 (2%)
 Frame = +1

Query  379  PGNTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            P N + R   QN GNF I  RPSTKV SAPGG SSLGYLFG
Sbjct  80   PTNNYHRAEGQNCGNF-ITDRPSTKVHSAPGGGSSLGYLFG  119



>ref|XP_004232154.1| PREDICTED: protein SPIRAL1-like 1 [Solanum lycopersicum]
Length=110

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 46/86 (53%), Gaps = 2/86 (2%)
 Frame = +1

Query  247  PADDDKHNKRNETPPPSPICAPPYGIDSDVDNTTVSKpppppNSPGNTFERTLSQNSGNF  426
            PA++ +  +  E  P +   + P      VDNT         N+  N F R   QN GNF
Sbjct  23   PANNSQTARNQEKAPTNEPVSRPAAAAQPVDNTKNVPAGIHSNNTNNYF-RADGQNCGNF  81

Query  427  AIASRPSTKVKSAPGGDSSLGYLFGD  504
             +  R STKV++APGG SSLGYLFGD
Sbjct  82   -LTERRSTKVQAAPGGGSSLGYLFGD  106



>ref|XP_008230904.1| PREDICTED: protein SPIRAL1-like 2 [Prunus mume]
Length=120

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 29/41 (71%), Gaps = 1/41 (2%)
 Frame = +1

Query  379  PGNTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            P N + R   QN GNF I  RPSTKV SAPGG SSLGYLFG
Sbjct  78   PTNNYHRAEGQNCGNF-ITDRPSTKVHSAPGGGSSLGYLFG  117



>emb|CDY34708.1| BnaA01g33170D [Brassica napus]
Length=91

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 33/42 (79%), Gaps = 2/42 (5%)
 Frame = +1

Query  376  SPGNTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            SP N F R+  QNSGNF +  RPSTKV+SAPGG SSLGYLFG
Sbjct  42   SPNNYF-RSEGQNSGNF-LTERPSTKVRSAPGGVSSLGYLFG  81



>ref|XP_003525379.1| PREDICTED: protein SPIRAL1-like 5-like [Glycine max]
 gb|KHM99952.1| hypothetical protein glysoja_017650 [Glycine soja]
Length=87

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 39/66 (59%), Gaps = 16/66 (24%)
 Frame = +1

Query  310  PPYGIDSDVDNTTVSKpppppNSPGNTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLG  489
            PPYGID D+++          N P         Q+ GN  + +RPSTKVKS PGG SSLG
Sbjct  38   PPYGIDIDINH----------NPP-----TAQGQHLGN-VLTNRPSTKVKSVPGGHSSLG  81

Query  490  YLFGDK  507
            YLFGDK
Sbjct  82   YLFGDK  87



>ref|XP_003581695.1| PREDICTED: protein SPIRAL1-like 1 [Brachypodium distachyon]
 ref|XP_010235871.1| PREDICTED: protein SPIRAL1-like 1 [Brachypodium distachyon]
Length=100

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 1/41 (2%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFGDK  507
            N + R+  QN+GNF +  RPSTKV +APGG SSLGYLFG K
Sbjct  61   NNYHRSEGQNTGNF-LTDRPSTKVHAAPGGGSSLGYLFGGK  100



>gb|KHN25680.1| hypothetical protein glysoja_018254 [Glycine soja]
Length=96

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 38/66 (58%), Gaps = 5/66 (8%)
 Frame = +1

Query  310  PPYGIDSDVDNTTVSKpppppNSPGNTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLG  489
            PPYGID  +DN+             N   R+   + GN  +  RPSTKVKS PGG SSLG
Sbjct  36   PPYGID--IDNSMPHHGSNCQLVVSNN--RSQGHHLGNI-VTDRPSTKVKSVPGGHSSLG  90

Query  490  YLFGDK  507
            YLFGDK
Sbjct  91   YLFGDK  96



>gb|ABK23093.1| unknown [Picea sitchensis]
Length=97

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  391  FERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFGDK  507
            +     QNSGNF I  RPSTKV+S PGG SSLGYLFG+K
Sbjct  59   YHLAAGQNSGNF-ITKRPSTKVQSVPGGGSSLGYLFGEK  96



>ref|XP_010255226.1| PREDICTED: protein SPIRAL1-like 5 [Nelumbo nucifera]
Length=98

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 47/77 (61%), Gaps = 6/77 (8%)
 Frame = +1

Query  283  TPPPSPICA-PPYGIDSDVDNT-TVSKpppppNSPGNTFERTLSQNSGNFAIASRPSTKV  456
            T P +P+   PP+G D+  +N   +  P    ++P    +R    N+G F I  RPSTKV
Sbjct  26   TAPVAPVVTRPPWGDDNSTENAPYLLSPVQKRDAPD---QRDRGSNTGTF-ITDRPSTKV  81

Query  457  KSAPGGDSSLGYLFGDK  507
            KS PGG+SSLGYLFGDK
Sbjct  82   KSVPGGNSSLGYLFGDK  98



>ref|NP_001237130.1| uncharacterized protein LOC100306586 [Glycine max]
 gb|ACU14834.1| unknown [Glycine max]
Length=96

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 38/66 (58%), Gaps = 5/66 (8%)
 Frame = +1

Query  310  PPYGIDSDVDNTTVSKpppppNSPGNTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLG  489
            PPYGID  +DN+             N   R+   + GN  +  RPSTKVKS PGG SSLG
Sbjct  36   PPYGID--IDNSMPHHGSNCQLVVSN--NRSQGHHLGNI-VTDRPSTKVKSVPGGHSSLG  90

Query  490  YLFGDK  507
            YLFGDK
Sbjct  91   YLFGDK  96



>ref|XP_011070925.1| PREDICTED: protein SPIRAL1-like 1 [Sesamum indicum]
 ref|XP_011070926.1| PREDICTED: protein SPIRAL1-like 1 [Sesamum indicum]
 ref|XP_011070927.1| PREDICTED: protein SPIRAL1-like 1 [Sesamum indicum]
 ref|XP_011070928.1| PREDICTED: protein SPIRAL1-like 1 [Sesamum indicum]
 ref|XP_011070929.1| PREDICTED: protein SPIRAL1-like 1 [Sesamum indicum]
Length=106

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +1

Query  376  SPGNTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            S  N + RT  QN+GNF I  RPSTKV +APGG SSLGYLFG
Sbjct  64   STANNYVRTDGQNTGNF-ITDRPSTKVHAAPGGGSSLGYLFG  104



>ref|NP_001150321.1| nitrilase-associated protein [Zea mays]
 gb|ACG26777.1| nitrilase-associated protein [Zea mays]
 gb|ACG30754.1| nitrilase-associated protein [Zea mays]
 gb|ACG38644.1| nitrilase-associated protein [Zea mays]
 gb|AFW56393.1| nitrilase-associated protein [Zea mays]
Length=101

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = +1

Query  373  NSPGNTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLF  498
            +S  N ++R+  QN GNF +  RPSTKV++APGGDSSLGYLF
Sbjct  54   SSKSNNYKRSEGQNCGNF-LTDRPSTKVQAAPGGDSSLGYLF  94



>gb|ACG30822.1| nitrilase-associated protein [Zea mays]
Length=101

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 1/38 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLF  498
            N ++R+  QN GNF +  RPSTKV++APGGDSSLGYLF
Sbjct  58   NNYKRSEGQNCGNF-LTDRPSTKVQAAPGGDSSLGYLF  94



>ref|XP_011070923.1| PREDICTED: protein SPIRAL1-like 1 [Sesamum indicum]
 ref|XP_011070924.1| PREDICTED: protein SPIRAL1-like 1 [Sesamum indicum]
Length=106

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +1

Query  376  SPGNTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            S  N + RT  QN+GNF I  RPSTKV +APGG SSLGYLFG
Sbjct  64   STANNYLRTDGQNTGNF-ITDRPSTKVHAAPGGGSSLGYLFG  104



>ref|XP_010258011.1| PREDICTED: protein SPIRAL1-like 2 [Nelumbo nucifera]
Length=110

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 30/42 (71%), Gaps = 1/42 (2%)
 Frame = +1

Query  376  SPGNTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            S  N + R   QNSGNF I  RPSTKV SAPGG SSLGYLFG
Sbjct  67   SQANNYFRADGQNSGNF-ITDRPSTKVHSAPGGGSSLGYLFG  107



>ref|XP_009400057.1| PREDICTED: protein SPIRAL1-like 3 [Musa acuminata subsp. malaccensis]
Length=98

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 41/83 (49%), Gaps = 16/83 (19%)
 Frame = +1

Query  256  DDKHNKRNETPPPSPICAPPYGIDSDVDNTTVSKpppppNSPGNTFERTLSQNSGNFAIA  435
            DD    + + PPP      P GI S               S   TF R   QN GNF I 
Sbjct  29   DDAAPVQKQAPPPPINKEIPAGIQS---------------SQAKTFYRADGQNCGNF-IT  72

Query  436  SRPSTKVKSAPGGDSSLGYLFGD  504
             RPSTKV +APGG SSLGYLFG+
Sbjct  73   DRPSTKVHAAPGGGSSLGYLFGN  95



>ref|XP_010680669.1| PREDICTED: protein SPIRAL1-like 1 [Beta vulgaris subsp. vulgaris]
Length=110

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 31/43 (72%), Gaps = 1/43 (2%)
 Frame = +1

Query  373  NSPGNTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            NS  N + R   QN+GNF I  RPSTKV +APGG SSLGYLFG
Sbjct  64   NSNINNYHRADGQNTGNF-ITDRPSTKVHAAPGGGSSLGYLFG  105



>ref|XP_009117803.1| PREDICTED: protein SPIRAL1-like 3 [Brassica rapa]
 ref|XP_009117811.1| PREDICTED: protein SPIRAL1-like 3 [Brassica rapa]
Length=124

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 33/42 (79%), Gaps = 2/42 (5%)
 Frame = +1

Query  376  SPGNTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            SP N F R+  QNSGNF +  RPSTKV+SAPGG SSLGYLFG
Sbjct  75   SPNNYF-RSEGQNSGNF-LTERPSTKVRSAPGGVSSLGYLFG  114



>ref|XP_004304219.1| PREDICTED: protein SPIRAL1-like 1-like [Fragaria vesca subsp. 
vesca]
Length=143

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 30/42 (71%), Gaps = 1/42 (2%)
 Frame = +1

Query  376  SPGNTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            SP N + R   QN GNF I  RPSTKV SAPGG SSLGYLFG
Sbjct  98   SPTNNYLRLDGQNCGNF-ITDRPSTKVHSAPGGGSSLGYLFG  138



>ref|XP_008810744.1| PREDICTED: protein SPIRAL1-like 3 isoform X2 [Phoenix dactylifera]
Length=97

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QNSGNF I  RPSTKV SAPGG SSLGYLFG
Sbjct  56   NNYFRADGQNSGNF-ITERPSTKVHSAPGGGSSLGYLFG  93



>gb|ACA58349.1| putative nitrilase-associated protein [Sandersonia aurantiaca]
Length=107

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 42/88 (48%), Gaps = 5/88 (6%)
 Frame = +1

Query  250  ADDDKHNKRNETPPPSPICAP---PYGIDSDVDNTTVSKpppppNSPGNTFERTLSQNSG  420
             D + H      PP +    P   P G     DN          N+  N + R   QN G
Sbjct  19   GDGEAHKPATSIPPAAGNAEPALKPSGASPPADNIKQVPAGIQGNNA-NNYLRMDGQNCG  77

Query  421  NFAIASRPSTKVKSAPGGDSSLGYLFGD  504
            NF I  RPSTKV +APGG SSLGYLFGD
Sbjct  78   NF-ITDRPSTKVHAAPGGGSSLGYLFGD  104



>gb|AIG20404.1| At3g02200-like protein, partial [Brassica oleracea var. alboglabra]
Length=219

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 33/42 (79%), Gaps = 2/42 (5%)
 Frame = +1

Query  376  SPGNTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            SP N F R+  QNSGNF +  RPSTKV+SAPGG SSLGYLFG
Sbjct  75   SPNNYF-RSEGQNSGNF-LTERPSTKVRSAPGGVSSLGYLFG  114



>ref|XP_010663458.1| PREDICTED: protein SPIRAL1-like 1 isoform X2 [Vitis vinifera]
 ref|XP_010663459.1| PREDICTED: protein SPIRAL1-like 1 isoform X2 [Vitis vinifera]
Length=128

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 30/40 (75%), Gaps = 1/40 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFGD  504
            N + R   QN+GNF I  RPSTKV +APGG SSLGYLFGD
Sbjct  87   NNYFRADGQNTGNF-ITDRPSTKVHAAPGGGSSLGYLFGD  125



>ref|XP_009406308.1| PREDICTED: protein SPIRAL1-like 3 [Musa acuminata subsp. malaccensis]
Length=100

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 30/39 (77%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QN+GNF I  RPSTKV++APGG SSLGYLFG
Sbjct  59   NNYHRADGQNTGNF-ITDRPSTKVQAAPGGGSSLGYLFG  96



>emb|CDP02330.1| unnamed protein product [Coffea canephora]
Length=109

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 29/40 (73%), Gaps = 1/40 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFGD  504
            N + R   QN GNF +  RPSTKV +APGG SSLGYLFGD
Sbjct  68   NNYMRADGQNCGNF-LTERPSTKVHAAPGGGSSLGYLFGD  106



>ref|XP_007160098.1| hypothetical protein PHAVU_002G292200g [Phaseolus vulgaris]
 gb|ESW32092.1| hypothetical protein PHAVU_002G292200g [Phaseolus vulgaris]
Length=90

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 45/81 (56%), Gaps = 17/81 (21%)
 Frame = +1

Query  280  ETPPPSP-----ICAPPYGIDSDVDNTTVSKpppppNSPGNTFERTLSQNSGNFAIASRP  444
            E P PSP        PPYGI+ D +N  ++ PPP              Q+ GN  + +RP
Sbjct  22   EKPKPSPPKTVSCSLPPYGIEMDNNNPPIAHPPPSQG-----------QHLGNL-LTNRP  69

Query  445  STKVKSAPGGDSSLGYLFGDK  507
            STKVKS PGG  SLGYLFGDK
Sbjct  70   STKVKSVPGGHLSLGYLFGDK  90



>ref|XP_010936457.1| PREDICTED: protein SPIRAL1-like 3 [Elaeis guineensis]
Length=97

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QNSGNF I  RPSTKV SAPGG SSLGYLFG
Sbjct  56   NNYFRADGQNSGNF-ITDRPSTKVHSAPGGGSSLGYLFG  93



>ref|XP_001758605.1| predicted protein [Physcomitrella patens]
 gb|EDQ76583.1| predicted protein [Physcomitrella patens]
Length=118

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QN+GNF I  RPSTKV +APGG SSLGYLFG
Sbjct  79   NNYHRADGQNTGNF-ITDRPSTKVHAAPGGGSSLGYLFG  116



>ref|XP_009126059.1| PREDICTED: protein SPIRAL1-like 4 [Brassica rapa]
Length=106

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + RT  QN GNF +  RPSTKV +APGG SSLGYLFG
Sbjct  64   NNYIRTEGQNCGNF-LTERPSTKVHAAPGGGSSLGYLFG  101



>emb|CDX85544.1| BnaA02g02690D [Brassica napus]
Length=148

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + RT  QN GNF +  RPSTKV +APGG SSLGYLFG
Sbjct  106  NNYIRTEGQNCGNF-LTERPSTKVHAAPGGGSSLGYLFG  143



>ref|NP_001236360.1| uncharacterized protein LOC100526947 [Glycine max]
 gb|ACU15978.1| unknown [Glycine max]
 gb|KHN35038.1| hypothetical protein glysoja_004804 [Glycine soja]
Length=99

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 40/71 (56%), Gaps = 12/71 (17%)
 Frame = +1

Query  310  PPYGIDSDVDNTTVSKpppppNSPGNTF-----ERTLSQNSGNFAIASRPSTKVKSAPGG  474
            PPYGID  +DN           +P NT       R+   + GN  +  RPSTKVKS PGG
Sbjct  36   PPYGID--IDNAAPPHAV----APSNTQLVVSNNRSQGHHLGNI-VTDRPSTKVKSVPGG  88

Query  475  DSSLGYLFGDK  507
             SSLGYLFGDK
Sbjct  89   HSSLGYLFGDK  99



>ref|XP_011018777.1| PREDICTED: protein SPIRAL1-like 1 [Populus euphratica]
 ref|XP_011018786.1| PREDICTED: protein SPIRAL1-like 1 [Populus euphratica]
 ref|XP_011018795.1| PREDICTED: protein SPIRAL1-like 1 [Populus euphratica]
Length=113

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 40/76 (53%), Gaps = 9/76 (12%)
 Frame = +1

Query  277  NETPPPSPICAP-PYGIDSDVDNTTVSKpppppNSPGNTFERTLSQNSGNFAIASRPSTK  453
            N  PP  P  AP P  I+  V     S          N + R   QN+GNF I  RPSTK
Sbjct  42   NNLPPSKPAAAPQPADINKQVPAGINSTSA-------NNYMRADGQNTGNF-ITDRPSTK  93

Query  454  VKSAPGGDSSLGYLFG  501
            V +APGG SSLGYLFG
Sbjct  94   VHAAPGGGSSLGYLFG  109



>emb|CBI15321.3| unnamed protein product [Vitis vinifera]
Length=137

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 30/40 (75%), Gaps = 1/40 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFGD  504
            N + R   QN+GNF I  RPSTKV +APGG SSLGYLFGD
Sbjct  96   NNYFRADGQNTGNF-ITDRPSTKVHAAPGGGSSLGYLFGD  134



>ref|XP_010663457.1| PREDICTED: protein SPIRAL1-like 1 isoform X1 [Vitis vinifera]
Length=142

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 30/40 (75%), Gaps = 1/40 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFGD  504
            N + R   QN+GNF I  RPSTKV +APGG SSLGYLFGD
Sbjct  101  NNYFRADGQNTGNF-ITDRPSTKVHAAPGGGSSLGYLFGD  139



>gb|EPS62977.1| hypothetical protein M569_11815 [Genlisea aurea]
Length=94

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 30/40 (75%), Gaps = 1/40 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFGD  504
            N + R   QN+GNF +  RPSTKV +APGG SSLGYLFGD
Sbjct  53   NNYFRADGQNTGNF-LTDRPSTKVHAAPGGGSSLGYLFGD  91



>ref|XP_009767263.1| PREDICTED: protein SPIRAL1-like 1 [Nicotiana sylvestris]
Length=112

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 30/40 (75%), Gaps = 1/40 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFGD  504
            N + R   QN+GNF +  RPSTKV +APGG SSLGYLFGD
Sbjct  71   NNYFRADGQNTGNF-LTDRPSTKVHAAPGGGSSLGYLFGD  109



>ref|XP_009416560.1| PREDICTED: protein SPIRAL1-like 3 [Musa acuminata subsp. malaccensis]
 ref|XP_009416561.1| PREDICTED: protein SPIRAL1-like 3 [Musa acuminata subsp. malaccensis]
 ref|XP_009416562.1| PREDICTED: protein SPIRAL1-like 3 [Musa acuminata subsp. malaccensis]
Length=100

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QN GNF I  RPSTKV++APGG SSLGYLFG
Sbjct  59   NNYHRADGQNCGNF-ITDRPSTKVQAAPGGGSSLGYLFG  96



>ref|XP_011085678.1| PREDICTED: protein SPIRAL1-like 2 [Sesamum indicum]
Length=108

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 29/40 (73%), Gaps = 1/40 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFGD  504
            N + RT  QN GNF I  RP+TKV SAPGG SSL YLFGD
Sbjct  67   NNYYRTDGQNCGNF-ITDRPTTKVHSAPGGSSSLNYLFGD  105



>ref|XP_002533540.1| SP1L, putative [Ricinus communis]
 gb|EEF28843.1| SP1L, putative [Ricinus communis]
Length=107

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 43/93 (46%), Gaps = 23/93 (25%)
 Frame = +1

Query  244  APADDDKHNKRNETPPPSPICAPP-------YGIDSDVDNTTVSKpppppNSPGNTFERT  402
            +PA        N +P P P+ A P        GI  ++ N                + R 
Sbjct  27   SPAAKSVGQAANNSPSPKPVVASPPINKEIPAGIHGNLTNN---------------YYRA  71

Query  403  LSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
              QN GNF I  RPSTKV +APGG SSLGYLFG
Sbjct  72   DGQNCGNF-ITDRPSTKVHAAPGGGSSLGYLFG  103



>gb|EYU23621.1| hypothetical protein MIMGU_mgv1a016534mg [Erythranthe guttata]
Length=117

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 30/40 (75%), Gaps = 1/40 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFGD  504
            N + R   QN+GNF +  RPSTKV +APGG SSLGYLFGD
Sbjct  76   NNYLRADGQNTGNF-LTDRPSTKVHAAPGGGSSLGYLFGD  114



>ref|XP_004236061.1| PREDICTED: protein SPIRAL1-like 1 [Solanum lycopersicum]
Length=111

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 30/40 (75%), Gaps = 1/40 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFGD  504
            N + R   QN+GNF +  RPSTKV +APGG SSLGYLFGD
Sbjct  70   NNYFRADGQNTGNF-LTDRPSTKVHAAPGGGSSLGYLFGD  108



>ref|XP_004297225.1| PREDICTED: protein SPIRAL1-like 1-like isoform 2 [Fragaria vesca 
subsp. vesca]
Length=118

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QN+GNF I  RPSTKV SAPGG SSLGYLFG
Sbjct  76   NNYLRADGQNTGNF-ITDRPSTKVHSAPGGGSSLGYLFG  113



>ref|XP_002975167.1| hypothetical protein SELMODRAFT_415236 [Selaginella moellendorffii]
 gb|EFJ23952.1| hypothetical protein SELMODRAFT_415236 [Selaginella moellendorffii]
Length=411

 Score = 55.1 bits (131),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 41/74 (55%), Gaps = 5/74 (7%)
 Frame = +1

Query  286  PPPSPICAPPYGIDSDVDNTTVSKpppppNSPGNTFERTLSQNSGNFAIASRPSTKVKSA  465
            P P+P  AP      +  +  V K     N+    + R   QN+GNF I  RPSTKV SA
Sbjct  343  PTPTPTHAPAACKHEENGDAGVVKLGRNNNN----YHRADGQNTGNF-ITDRPSTKVHSA  397

Query  466  PGGDSSLGYLFGDK  507
            PGG SSLGYLFG K
Sbjct  398  PGGGSSLGYLFGGK  411



>ref|XP_009596273.1| PREDICTED: protein SPIRAL1-like 1 [Nicotiana tomentosiformis]
Length=112

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 30/40 (75%), Gaps = 1/40 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFGD  504
            N + R   QN+GNF +  RPSTKV +APGG SSLGYLFGD
Sbjct  71   NNYFRADGQNTGNF-LTDRPSTKVHAAPGGGSSLGYLFGD  109



>ref|XP_010937691.1| PREDICTED: protein SPIRAL1-like 1 [Elaeis guineensis]
Length=107

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 30/39 (77%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N++ R   QNSGNF +  RPSTKV+SAPGG SSL YLFG
Sbjct  66   NSYHRADGQNSGNF-LTDRPSTKVQSAPGGGSSLSYLFG  103



>ref|XP_006345113.1| PREDICTED: protein SPIRAL1-like 1-like [Solanum tuberosum]
Length=111

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 30/40 (75%), Gaps = 1/40 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFGD  504
            N + R   QN+GNF +  RPSTKV +APGG SSLGYLFGD
Sbjct  70   NNYFRADGQNTGNF-LTDRPSTKVHAAPGGGSSLGYLFGD  108



>gb|AFW88103.1| hypothetical protein ZEAMMB73_001069, partial [Zea mays]
Length=68

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QN+GNF +  RPSTKV +APGG SSLGYLFG
Sbjct  29   NNYHRADGQNTGNF-LTDRPSTKVHAAPGGGSSLGYLFG  66



>ref|XP_001754081.1| predicted protein [Physcomitrella patens]
 gb|EDQ80982.1| predicted protein [Physcomitrella patens]
Length=125

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 39/69 (57%), Gaps = 4/69 (6%)
 Frame = +1

Query  295  SPICAPPYGIDSDVDNTTVSKpppppNSPGNTFERTLSQNSGNFAIASRPSTKVKSAPGG  474
            +P  AP   +D   + T++           N + R   QN+GNF I  RP+TKV +APGG
Sbjct  59   APAAAPVSKVD---EGTSLDMGANKMGRNSNNYHRADGQNNGNF-ITDRPTTKVHAAPGG  114

Query  475  DSSLGYLFG  501
             SSLGYLFG
Sbjct  115  GSSLGYLFG  123



>emb|CDX90984.1| BnaC02g06130D [Brassica napus]
Length=109

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + RT  QN GNF +  RPSTKV +APGG SSLGYLFG
Sbjct  67   NNYIRTEGQNCGNF-LTERPSTKVHAAPGGGSSLGYLFG  104



>dbj|BAK01594.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=100

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 30/41 (73%), Gaps = 1/41 (2%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFGDK  507
            N + R   QN+GNF +  RPSTKV +APGG SSLGYLFG K
Sbjct  61   NNYYRADGQNTGNF-LTDRPSTKVHAAPGGGSSLGYLFGGK  100



>ref|XP_006437905.1| hypothetical protein CICLE_v10033140mg [Citrus clementina]
 ref|XP_006437906.1| hypothetical protein CICLE_v10033140mg [Citrus clementina]
 ref|XP_006437907.1| hypothetical protein CICLE_v10033140mg [Citrus clementina]
 ref|XP_006437908.1| hypothetical protein CICLE_v10033140mg [Citrus clementina]
 gb|ESR51145.1| hypothetical protein CICLE_v10033140mg [Citrus clementina]
 gb|ESR51146.1| hypothetical protein CICLE_v10033140mg [Citrus clementina]
 gb|ESR51147.1| hypothetical protein CICLE_v10033140mg [Citrus clementina]
 gb|ESR51148.1| hypothetical protein CICLE_v10033140mg [Citrus clementina]
Length=106

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QN+GNF I  RPSTKV +APGG SSLGYLFG
Sbjct  65   NNYMRADGQNTGNF-ITDRPSTKVHAAPGGGSSLGYLFG  102



>gb|AAU05601.1| hypothetical protein [Fragaria x ananassa]
Length=140

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QN+GNF I  RPSTKV SAPGG SSLGYLFG
Sbjct  98   NNYMRADGQNTGNF-ITDRPSTKVHSAPGGGSSLGYLFG  135



>ref|XP_006484225.1| PREDICTED: protein SPIRAL1-like 1-like isoform X1 [Citrus sinensis]
 ref|XP_006484226.1| PREDICTED: protein SPIRAL1-like 1-like isoform X2 [Citrus sinensis]
 gb|KDO70334.1| hypothetical protein CISIN_1g034005mg [Citrus sinensis]
 gb|KDO70335.1| hypothetical protein CISIN_1g034005mg [Citrus sinensis]
 gb|KDO70336.1| hypothetical protein CISIN_1g034005mg [Citrus sinensis]
Length=106

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QN+GNF I  RPSTKV +APGG SSLGYLFG
Sbjct  65   NNYMRADGQNTGNF-ITDRPSTKVHAAPGGGSSLGYLFG  102



>ref|XP_008810743.1| PREDICTED: protein SPIRAL1-like 3 isoform X1 [Phoenix dactylifera]
Length=137

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QNSGNF I  RPSTKV SAPGG SSLGYLFG
Sbjct  96   NNYFRADGQNSGNF-ITERPSTKVHSAPGGGSSLGYLFG  133



>gb|EEC68488.1| hypothetical protein OsI_36745 [Oryza sativa Indica Group]
Length=115

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 29/41 (71%), Gaps = 1/41 (2%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFGDK  507
            N + R   QN GNF +  RPSTKV +APGG SSLGYLFG K
Sbjct  76   NNYFRAQGQNCGNF-LTDRPSTKVHAAPGGGSSLGYLFGGK  115



>gb|KDO70333.1| hypothetical protein CISIN_1g034005mg [Citrus sinensis]
Length=96

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QN+GNF I  RPSTKV +APGG SSLGYLFG
Sbjct  55   NNYMRADGQNTGNF-ITDRPSTKVHAAPGGGSSLGYLFG  92



>gb|EMS45081.1| hypothetical protein TRIUR3_32047 [Triticum urartu]
Length=100

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 30/41 (73%), Gaps = 1/41 (2%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFGDK  507
            N + R   QN+GNF +  RPSTKV +APGG SSLGYLFG K
Sbjct  61   NNYYRADGQNTGNF-LTDRPSTKVHAAPGGGSSLGYLFGGK  100



>ref|NP_001068314.1| Os11g0629400 [Oryza sativa Japonica Group]
 sp|Q2R0W8.1|SP1L2_ORYSJ RecName: Full=Protein SPIRAL1-like 2 [Oryza sativa Japonica Group]
 gb|ABA94943.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF28677.1| Os11g0629400 [Oryza sativa Japonica Group]
 gb|EAZ18984.1| hypothetical protein OsJ_34517 [Oryza sativa Japonica Group]
 dbj|BAG94131.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC68494.1| hypothetical protein OsI_36752 [Oryza sativa Indica Group]
Length=115

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 29/41 (71%), Gaps = 1/41 (2%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFGDK  507
            N + R   QN GNF +  RPSTKV +APGG SSLGYLFG K
Sbjct  76   NNYFRAQGQNCGNF-LTDRPSTKVHAAPGGGSSLGYLFGGK  115



>ref|XP_009800170.1| PREDICTED: protein SPIRAL1-like 1 [Nicotiana sylvestris]
Length=112

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 30/40 (75%), Gaps = 2/40 (5%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFGD  504
            N F R   QN+GNF I  RPSTKV +APGG SSLGYLFGD
Sbjct  72   NHFRRD-GQNTGNF-ITDRPSTKVHAAPGGGSSLGYLFGD  109



>ref|XP_008805159.1| PREDICTED: protein SPIRAL1-like 1 [Phoenix dactylifera]
 ref|XP_008805160.1| PREDICTED: protein SPIRAL1-like 1 [Phoenix dactylifera]
Length=107

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 44/84 (52%), Gaps = 14/84 (17%)
 Frame = +1

Query  250  ADDDKHNKRNETPPPSPICAPPYGIDSDVDNTTVSKpppppNSPGNTFERTLSQNSGNFA  429
            ADD  H+++  T       +PP  +   +      K         N + R+  QNSGNF 
Sbjct  34   ADDTAHSQKPST------ASPPVDVSKQIPAGIQQKTA-------NNYHRSDGQNSGNF-  79

Query  430  IASRPSTKVKSAPGGDSSLGYLFG  501
            +  RPSTKV++APGG SSL YLFG
Sbjct  80   LTDRPSTKVQAAPGGGSSLSYLFG  103



>ref|XP_001769047.1| predicted protein [Physcomitrella patens]
 gb|EDQ66125.1| predicted protein [Physcomitrella patens]
Length=123

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QN+GNF I  RPSTKV +APGG SSLGYLFG
Sbjct  84   NNYHRADGQNNGNF-ITDRPSTKVHAAPGGGSSLGYLFG  121



>ref|NP_001132152.1| uncharacterized protein LOC100193571 [Zea mays]
 ref|XP_008658115.1| PREDICTED: uncharacterized protein LOC100193571 isoform X1 [Zea 
mays]
 gb|ACF80875.1| unknown [Zea mays]
 gb|ACF84731.1| unknown [Zea mays]
 gb|ACF86238.1| unknown [Zea mays]
 gb|ACF86315.1| unknown [Zea mays]
 gb|ACG30060.1| nitrilase-associated protein [Zea mays]
 gb|AFW88105.1| hypothetical protein ZEAMMB73_001069 [Zea mays]
 gb|AFW88106.1| hypothetical protein ZEAMMB73_001069 [Zea mays]
 gb|AFW88107.1| hypothetical protein ZEAMMB73_001069 [Zea mays]
 gb|AFW88108.1| hypothetical protein ZEAMMB73_001069 [Zea mays]
 gb|AFW88109.1| hypothetical protein ZEAMMB73_001069 [Zea mays]
Length=99

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QN+GNF +  RPSTKV +APGG SSLGYLFG
Sbjct  60   NNYHRADGQNTGNF-LTDRPSTKVHAAPGGGSSLGYLFG  97



>emb|CDP18053.1| unnamed protein product [Coffea canephora]
Length=113

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QNSGNF +  RPSTKV +APGG SSLGYLFG
Sbjct  72   NNYFRAEGQNSGNF-LTDRPSTKVHAAPGGGSSLGYLFG  109



>emb|CDY26443.1| BnaC09g42250D [Brassica napus]
Length=117

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + RT  QN GNF +  RPSTKV +APGG SSLGYLFG
Sbjct  75   NNYLRTEGQNCGNF-LTDRPSTKVHAAPGGGSSLGYLFG  112



>ref|XP_009593870.1| PREDICTED: protein SPIRAL1-like 1 [Nicotiana tomentosiformis]
Length=112

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 30/40 (75%), Gaps = 2/40 (5%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFGD  504
            N F R   QN+GNF I  RPSTKV +APGG SSLGYLFGD
Sbjct  72   NHFRRD-GQNTGNF-ITDRPSTKVHAAPGGGSSLGYLFGD  109



>ref|XP_008339794.1| PREDICTED: protein SPIRAL1-like 1 [Malus domestica]
 ref|XP_008339795.1| PREDICTED: protein SPIRAL1-like 1 [Malus domestica]
Length=119

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QN+GNF I  RPSTKV +APGG SSLGYLFG
Sbjct  77   NNYMRADGQNTGNF-ITDRPSTKVHAAPGGGSSLGYLFG  114



>ref|XP_004297224.1| PREDICTED: protein SPIRAL1-like 1-like isoform 1 [Fragaria vesca 
subsp. vesca]
Length=152

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QN+GNF I  RPSTKV SAPGG SSLGYLFG
Sbjct  110  NNYLRADGQNTGNF-ITDRPSTKVHSAPGGGSSLGYLFG  147



>ref|XP_009121557.1| PREDICTED: protein SPIRAL1-like 4 [Brassica rapa]
 emb|CDX69512.1| BnaA10g18610D [Brassica napus]
Length=129

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + RT  QN GNF +  RPSTKV +APGG SSLGYLFG
Sbjct  87   NNYLRTEGQNCGNF-LTDRPSTKVHAAPGGGSSLGYLFG  124



>gb|ACF74272.1| putative nitrilase-associated protein [Arachis hypogaea]
Length=114

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 28/40 (70%), Gaps = 1/40 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFGD  504
            N + R   QN GNF +  RPSTKV +APGG SSLGYLFG 
Sbjct  70   NNYHRAEGQNCGNF-LTDRPSTKVHAAPGGGSSLGYLFGG  108



>ref|XP_009402969.1| PREDICTED: protein SPIRAL1-like 3 [Musa acuminata subsp. malaccensis]
 ref|XP_009402978.1| PREDICTED: protein SPIRAL1-like 3 [Musa acuminata subsp. malaccensis]
Length=100

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 30/39 (77%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QN+GNF I  +PSTKV++APGG SSLGYLFG
Sbjct  59   NNYHRADGQNTGNF-ITDKPSTKVQAAPGGGSSLGYLFG  96



>ref|XP_002465124.1| hypothetical protein SORBIDRAFT_01g032430 [Sorghum bicolor]
 gb|EER92122.1| hypothetical protein SORBIDRAFT_01g032430 [Sorghum bicolor]
Length=100

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QN+GNF +  RPSTKV +APGG SSLGYLFG
Sbjct  61   NNYHRADGQNTGNF-LTDRPSTKVHAAPGGGSSLGYLFG  98



>ref|XP_011014914.1| PREDICTED: protein SPIRAL1-like 1 [Populus euphratica]
 ref|XP_011014915.1| PREDICTED: protein SPIRAL1-like 1 [Populus euphratica]
Length=113

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QN+GNF I  RPSTKV +APGG SSLGYLFG
Sbjct  72   NNYMRADGQNAGNF-ITDRPSTKVHAAPGGGSSLGYLFG  109



>ref|XP_008360088.1| PREDICTED: protein SPIRAL1-like 1 [Malus domestica]
 ref|XP_008360089.1| PREDICTED: protein SPIRAL1-like 1 [Malus domestica]
 ref|XP_008360090.1| PREDICTED: protein SPIRAL1-like 1 [Malus domestica]
 ref|XP_008367034.1| PREDICTED: protein SPIRAL1-like 1 [Malus domestica]
 ref|XP_008367035.1| PREDICTED: protein SPIRAL1-like 1 [Malus domestica]
 ref|XP_008367036.1| PREDICTED: protein SPIRAL1-like 1 [Malus domestica]
Length=112

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QN+GNF I  RPSTKV +APGG SSLGYLFG
Sbjct  70   NNYMRADGQNTGNF-ITDRPSTKVHAAPGGGSSLGYLFG  107



>ref|XP_011011852.1| PREDICTED: protein SPIRAL1-like 1 [Populus euphratica]
 ref|XP_011011857.1| PREDICTED: protein SPIRAL1-like 1 [Populus euphratica]
Length=113

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QN+GNF I  RPSTKV +APGG SSLGYLFG
Sbjct  72   NNYMRADGQNAGNF-ITDRPSTKVHAAPGGGSSLGYLFG  109



>ref|XP_009356421.1| PREDICTED: protein SPIRAL1-like 1 [Pyrus x bretschneideri]
 ref|XP_009356422.1| PREDICTED: protein SPIRAL1-like 1 [Pyrus x bretschneideri]
Length=114

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QN+GNF I  RPSTKV +APGG SSLGYLFG
Sbjct  72   NNYMRADGQNTGNF-ITDRPSTKVHAAPGGGSSLGYLFG  109



>ref|XP_006650199.1| PREDICTED: protein SPIRAL1-like 1-like [Oryza brachyantha]
Length=118

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QN+GNF +  RPSTKV +APGG SSLGYLFG
Sbjct  79   NNYHRADGQNTGNF-LTDRPSTKVHAAPGGGSSLGYLFG  116



>gb|ABK26309.1| unknown [Picea sitchensis]
Length=114

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 28/39 (72%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QN GNF I  RPSTKV +APGG SSLGYLFG
Sbjct  72   NNYFRAEGQNCGNF-ITDRPSTKVHAAPGGGSSLGYLFG  109



>ref|XP_001770348.1| predicted protein [Physcomitrella patens]
 gb|EDQ64838.1| predicted protein [Physcomitrella patens]
Length=103

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N ++R   QN GNF I  RPST+V+++PGG SSLGYLFG
Sbjct  66   NNYQRVDGQNCGNF-ITDRPSTRVQASPGGQSSLGYLFG  103



>ref|XP_006482790.1| PREDICTED: protein SPIRAL1-like 2-like [Citrus sinensis]
 gb|KDO35963.1| hypothetical protein CISIN_1g036270mg [Citrus sinensis]
Length=126

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 35/56 (63%), Gaps = 4/56 (7%)
 Frame = +1

Query  343  TTVSKpppppNSPGN---TFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
             TV K   P   PGN    + R   QN GNF I +RPSTKV +APGG SSLGYLFG
Sbjct  68   ATVDKLQIPAGIPGNRTNNYYRADGQNCGNF-ITNRPSTKVHAAPGGGSSLGYLFG  122



>gb|AAM64577.1| putative nitrilase-associated protein [Arabidopsis thaliana]
Length=110

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 28/39 (72%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QN+GNF I  RPSTKV SAPGG SSL YLFG
Sbjct  69   NNYMRAEGQNTGNF-ITDRPSTKVHSAPGGGSSLAYLFG  106



>ref|XP_007045838.1| T1K7.26 protein [Theobroma cacao]
 gb|EOY01670.1| T1K7.26 protein [Theobroma cacao]
Length=117

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QN+GNF I  RPSTKV +APGG SSLGYLFG
Sbjct  73   NNYLRADGQNTGNF-ITDRPSTKVHAAPGGGSSLGYLFG  110



>ref|XP_006400083.1| hypothetical protein EUTSA_v10015075mg [Eutrema salsugineum]
 gb|ESQ41536.1| hypothetical protein EUTSA_v10015075mg [Eutrema salsugineum]
Length=108

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + RT  QN GNF +  RPSTKV +APGG SSLGYLFG
Sbjct  63   NNYFRTEGQNCGNF-LTDRPSTKVHAAPGGGSSLGYLFG  100



>sp|Q7Y1L9.1|SP1L1_ORYSJ RecName: Full=Protein SPIRAL1-like 1 [Oryza sativa Japonica Group]
 gb|AAP44613.1| unknown protein [Oryza sativa Japonica Group]
 gb|ABF96634.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABF96635.1| expressed protein [Oryza sativa Japonica Group]
 gb|EAY90472.1| hypothetical protein OsI_12060 [Oryza sativa Indica Group]
 gb|EAZ27335.1| hypothetical protein OsJ_11276 [Oryza sativa Japonica Group]
 gb|ABR25754.1| nap16kDa protein [Oryza sativa Indica Group]
 dbj|BAH00594.1| unnamed protein product [Oryza sativa Japonica Group]
Length=116

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QN+GNF +  RPSTKV +APGG SSLGYLFG
Sbjct  77   NNYHRADGQNTGNF-LTDRPSTKVHAAPGGGSSLGYLFG  114



>gb|ABK94106.1| unknown [Populus trichocarpa]
 gb|ABK94453.1| unknown [Populus trichocarpa]
Length=113

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QN+GNF I  RPSTKV +APGG SSLGYLFG
Sbjct  72   NNYLRADGQNTGNF-ITDRPSTKVHAAPGGGSSLGYLFG  109



>ref|XP_002285501.1| PREDICTED: protein SPIRAL1-like 1 [Vitis vinifera]
 ref|XP_010650586.1| PREDICTED: protein SPIRAL1-like 1 [Vitis vinifera]
 emb|CBI16802.3| unnamed protein product [Vitis vinifera]
Length=113

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QN+GNF I  RPSTKV +APGG SSLGYLFG
Sbjct  72   NNYFRADGQNTGNF-ITDRPSTKVHAAPGGGSSLGYLFG  109



>ref|NP_001150100.1| LOC100283729 [Zea mays]
 gb|ACF88406.1| unknown [Zea mays]
 gb|ACG24684.1| NAP16kDa protein [Zea mays]
 gb|ACG30443.1| NAP16kDa protein [Zea mays]
 gb|ACG36046.1| NAP16kDa protein [Zea mays]
 gb|ACG37831.1| NAP16kDa protein [Zea mays]
 gb|ACG42532.1| NAP16kDa protein [Zea mays]
 gb|ACG43559.1| NAP16kDa protein [Zea mays]
 tpg|DAA45812.1| TPA: NAP16kDa protein isoform 1 [Zea mays]
 tpg|DAA45813.1| TPA: NAP16kDa protein isoform 2 [Zea mays]
Length=106

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QN+GNF +  RPSTKV +APGG SSLGYLFG
Sbjct  67   NNYHRADGQNTGNF-LTDRPSTKVHAAPGGGSSLGYLFG  104



>gb|KDP27263.1| hypothetical protein JCGZ_19962 [Jatropha curcas]
Length=100

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 28/39 (72%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QN GNF I  RPSTKV +APGG SSLGYLFG
Sbjct  59   NNYYRADGQNCGNF-ITDRPSTKVHAAPGGGSSLGYLFG  96



>ref|XP_008341789.1| PREDICTED: protein SPIRAL1-like 2 [Malus domestica]
Length=117

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 28/39 (72%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QN GNF I  RPSTKV SAPGG SSLGYLFG
Sbjct  75   NNYFRVDGQNCGNF-ITDRPSTKVHSAPGGGSSLGYLFG  112



>ref|XP_002316083.1| hypothetical protein POPTR_0010s16510g [Populus trichocarpa]
 gb|ABK93882.1| unknown [Populus trichocarpa]
 gb|EEF02254.1| hypothetical protein POPTR_0010s16510g [Populus trichocarpa]
Length=113

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QN+GNF I  RPSTKV +APGG SSLGYLFG
Sbjct  72   NNYLRADGQNAGNF-ITDRPSTKVHAAPGGGSSLGYLFG  109



>ref|XP_002512065.1| SP1L, putative [Ricinus communis]
 gb|EEF50734.1| SP1L, putative [Ricinus communis]
Length=113

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QN+GNF +  RPSTKV +APGG SSLGYLFG
Sbjct  72   NNYMRADGQNTGNF-LTDRPSTKVHAAPGGGSSLGYLFG  109



>emb|CDX91981.1| BnaC03g32830D [Brassica napus]
Length=145

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 31/42 (74%), Gaps = 2/42 (5%)
 Frame = +1

Query  376  SPGNTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            SP N F R+  QN GNF +  RPSTKV +APGG SSLGYLFG
Sbjct  95   SPNNYF-RSEGQNCGNF-LTERPSTKVHAAPGGGSSLGYLFG  134



>gb|AFK42937.1| unknown [Lotus japonicus]
Length=132

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 28/39 (72%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QN GNF +  RPSTKV +APGG SSLGYLFG
Sbjct  90   NNYHRADGQNCGNF-LTDRPSTKVHAAPGGGSSLGYLFG  127



>gb|KDP41319.1| hypothetical protein JCGZ_15726 [Jatropha curcas]
Length=113

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QN+GNF +  RPSTKV +APGG SSLGYLFG
Sbjct  72   NNYMRADGQNTGNF-LTDRPSTKVHAAPGGGSSLGYLFG  109



>gb|KCW77484.1| hypothetical protein EUGRSUZ_D01822 [Eucalyptus grandis]
Length=108

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 37/69 (54%), Gaps = 9/69 (13%)
 Frame = +1

Query  307  APPYGIDSDVDNTTVSKpppppNSP--GNTFERTLSQNSGNFAIASRPSTKVKSAPGGDS  480
            APP+ +D   +    S+ P     P   N + R   QNSGNF         VKS PGGDS
Sbjct  47   APPHRVDKIAEKNEDSRSPSDDRKPNISNNYHRAQGQNSGNF-------ITVKSVPGGDS  99

Query  481  SLGYLFGDK  507
            SLGYLFGDK
Sbjct  100  SLGYLFGDK  108



>ref|XP_010532521.1| PREDICTED: protein SPIRAL1-like 1 [Tarenaya hassleriana]
Length=109

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QN+GNF +  RPSTKV +APGG SSLGYLFG
Sbjct  68   NNYMRADGQNTGNF-LTDRPSTKVHAAPGGGSSLGYLFG  105



>ref|XP_002323906.1| hypothetical protein POPTR_0017s13090g [Populus trichocarpa]
 ref|XP_011009243.1| PREDICTED: protein SPIRAL1-like 1 [Populus euphratica]
 ref|XP_011009244.1| PREDICTED: protein SPIRAL1-like 1 [Populus euphratica]
 ref|XP_011009245.1| PREDICTED: protein SPIRAL1-like 1 [Populus euphratica]
 ref|XP_011009246.1| PREDICTED: protein SPIRAL1-like 1 [Populus euphratica]
 gb|EEF04039.1| hypothetical protein POPTR_0017s13090g [Populus trichocarpa]
Length=107

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 28/39 (72%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QN GNF I  RPSTKV +APGG SSLGYLFG
Sbjct  66   NNYYRADGQNCGNF-ITDRPSTKVHAAPGGGSSLGYLFG  103



>ref|XP_009134653.1| PREDICTED: protein SPIRAL1-like 3 [Brassica rapa]
Length=123

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 31/42 (74%), Gaps = 2/42 (5%)
 Frame = +1

Query  376  SPGNTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            SP N F R+  QN GNF +  RPSTKV +APGG SSLGYLFG
Sbjct  73   SPNNYF-RSEGQNCGNF-LTERPSTKVHAAPGGGSSLGYLFG  112



>gb|EYU28873.1| hypothetical protein MIMGU_mgv1a016596mg [Erythranthe guttata]
 gb|EYU28874.1| hypothetical protein MIMGU_mgv1a016596mg [Erythranthe guttata]
Length=115

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 42/76 (55%), Gaps = 10/76 (13%)
 Frame = +1

Query  280  ETPPPSPICAPPYGIDSDVDNTTVSKp--ppppNSPGNTFERTLSQNSGNFAIASRPSTK  453
            + P P P  APP  +D       +SK       +S  N + R   QN+ NF I  RPSTK
Sbjct  44   KEPSPKPNAAPPQPVD-------ISKQIPAGIHSSTNNNYIRADGQNTCNF-ITDRPSTK  95

Query  454  VKSAPGGDSSLGYLFG  501
            V +APGG SSLGYLFG
Sbjct  96   VHAAPGGGSSLGYLFG  111



>ref|XP_006288895.1| hypothetical protein CARUB_v10002258mg [Capsella rubella]
 ref|XP_006288896.1| hypothetical protein CARUB_v10002258mg [Capsella rubella]
 gb|EOA21793.1| hypothetical protein CARUB_v10002258mg [Capsella rubella]
 gb|EOA21794.1| hypothetical protein CARUB_v10002258mg [Capsella rubella]
Length=127

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R+  QN GNF I  RPSTKV +APGG SSLGYLFG
Sbjct  82   NNYYRSDGQNCGNF-ITDRPSTKVHAAPGGGSSLGYLFG  119



>ref|XP_009365969.1| PREDICTED: protein SPIRAL1-like 2, partial [Pyrus x bretschneideri]
Length=145

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 29/41 (71%), Gaps = 1/41 (2%)
 Frame = +1

Query  379  PGNTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            P N + R   QN GNF I  RPSTKV +APGG SSLGYLFG
Sbjct  101  PTNNYLRVDGQNCGNF-ITDRPSTKVHAAPGGRSSLGYLFG  140



>ref|NP_001173473.1| Os03g0417800 [Oryza sativa Japonica Group]
 dbj|BAH92201.1| Os03g0417800, partial [Oryza sativa Japonica Group]
Length=148

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QN+GNF +  RPSTKV +APGG SSLGYLFG
Sbjct  109  NNYHRADGQNTGNF-LTDRPSTKVHAAPGGGSSLGYLFG  146



>ref|XP_007151340.1| hypothetical protein PHAVU_004G038000g [Phaseolus vulgaris]
 gb|ESW23334.1| hypothetical protein PHAVU_004G038000g [Phaseolus vulgaris]
Length=131

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 28/39 (72%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QN GNF +  RPSTKV +APGG SSLGYLFG
Sbjct  89   NNYHRADGQNCGNF-LTDRPSTKVHAAPGGGSSLGYLFG  126



>emb|CDX74269.1| BnaA03g27780D [Brassica napus]
Length=203

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 31/42 (74%), Gaps = 2/42 (5%)
 Frame = +1

Query  376  SPGNTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            SP N F R+  QN GNF +  RPSTKV +APGG SSLGYLFG
Sbjct  153  SPNNYF-RSEGQNCGNF-LTERPSTKVHAAPGGGSSLGYLFG  192



>ref|XP_010525121.1| PREDICTED: protein SPIRAL1-like 3 [Tarenaya hassleriana]
Length=100

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R+  QN GNF +  RPSTKV +APGG SSLGYLFG
Sbjct  56   NNYVRSEGQNCGNF-LTDRPSTKVHAAPGGGSSLGYLFG  93



>gb|ABD96926.1| hypothetical protein [Cleome spinosa]
Length=100

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R+  QN GNF +  RPSTKV +APGG SSLGYLFG
Sbjct  56   NNYVRSEGQNCGNF-LTDRPSTKVHAAPGGGSSLGYLFG  93



>ref|XP_010551372.1| PREDICTED: protein SPIRAL1-like 2 [Tarenaya hassleriana]
Length=111

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QN+GNF +  RPSTKV +APGG SSLGYLFG
Sbjct  69   NNYMRADGQNTGNF-LTDRPSTKVHAAPGGGSSLGYLFG  106



>ref|XP_010549990.1| PREDICTED: protein SPIRAL1-like 2 [Tarenaya hassleriana]
Length=106

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R+  QN GNF +  RPSTKV +APGG SSLGYLFG
Sbjct  62   NNYLRSEGQNCGNF-LTDRPSTKVHAAPGGGSSLGYLFG  99



>ref|XP_010089653.1| hypothetical protein L484_021046 [Morus notabilis]
 gb|EXB38124.1| hypothetical protein L484_021046 [Morus notabilis]
Length=124

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 37/71 (52%), Gaps = 8/71 (11%)
 Frame = +1

Query  286  PPPSPICAPPYGIDSDVDNTTVSKpppppNSPGNTFERTLSQNSGNFAIASRPSTKVKSA  465
            PP     AP   ID  +       P     SP N + R   QN GNF I  RPSTKV +A
Sbjct  54   PPQKTAVAPKSSIDKQI-------PAGIHGSPTNNYFRADGQNCGNF-ITDRPSTKVHAA  105

Query  466  PGGDSSLGYLF  498
            PGG SSLGYLF
Sbjct  106  PGGGSSLGYLF  116



>ref|XP_010511947.1| PREDICTED: protein SPIRAL1-like 2 [Camelina sativa]
Length=110

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 28/39 (72%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QN+GNF I  RPSTKV SAPGG SSL YLFG
Sbjct  69   NNYMRAEGQNTGNF-ITDRPSTKVHSAPGGGSSLNYLFG  106



>emb|CDY54148.1| BnaCnng26280D [Brassica napus]
Length=111

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 40/75 (53%), Gaps = 3/75 (4%)
 Frame = +1

Query  280  ETPPPSPICAPPYGIDSD-VDNTTVSKpppppNSPGNTFERTLSQNSGNFAIASRPSTKV  456
            ET PP P    P  +    VD T         NS  N + R   QNSGNF +  RPSTKV
Sbjct  34   ETQPPPPSTTRPKTVAPKPVDITKQGPAGLNSNS-ANNYMRADGQNSGNF-LTDRPSTKV  91

Query  457  KSAPGGDSSLGYLFG  501
             SAPGG SSL YLFG
Sbjct  92   HSAPGGGSSLNYLFG  106



>ref|XP_002888708.1| hypothetical protein ARALYDRAFT_476049 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64967.1| hypothetical protein ARALYDRAFT_476049 [Arabidopsis lyrata subsp. 
lyrata]
Length=110

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 28/39 (72%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QN+GNF I  RPSTKV SAPGG SSL YLFG
Sbjct  69   NNYMRAEGQNTGNF-ITDRPSTKVHSAPGGGSSLNYLFG  106



>gb|AFK48679.1| unknown [Medicago truncatula]
 gb|KEH25070.1| SPIRAL protein, putative [Medicago truncatula]
Length=139

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 28/39 (72%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QN GNF +  RPSTKV +APGG SSLGYLFG
Sbjct  96   NNYHRADGQNCGNF-LTDRPSTKVHAAPGGGSSLGYLFG  133



>tpg|DAA45815.1| TPA: NAP16kDa protein [Zea mays]
Length=138

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QN+GNF +  RPSTKV +APGG SSLGYLFG
Sbjct  99   NNYHRADGQNTGNF-LTDRPSTKVHAAPGGGSSLGYLFG  136



>gb|AAM64731.1| nitrilase associated protein-like [Arabidopsis thaliana]
Length=127

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R+  QN GNF +  RPSTKV +APGG SSLGYLFG
Sbjct  82   NNYYRSDGQNCGNF-LTERPSTKVHAAPGGGSSLGYLFG  119



>ref|XP_010463613.1| PREDICTED: protein SPIRAL1-like 3 [Camelina sativa]
 ref|XP_010463614.1| PREDICTED: protein SPIRAL1-like 3 [Camelina sativa]
Length=123

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R+  QN GNF +  RPSTKV +APGG SSLGYLFG
Sbjct  75   NNYFRSEGQNCGNF-LTERPSTKVHAAPGGGSSLGYLFG  112



>ref|NP_177083.1| protein SPIRAL1-like2 [Arabidopsis thaliana]
 ref|NP_974110.1| protein SPIRAL1-like2 [Arabidopsis thaliana]
 sp|Q9LE54.1|SP1L2_ARATH RecName: Full=Protein SPIRAL1-like 2 [Arabidopsis thaliana]
 gb|AAF27065.1|AC008262_14 F4N2.18 [Arabidopsis thaliana]
 gb|AAG52493.1|AC018364_11 putative nitrilase-associated protein; 69823-70365 [Arabidopsis 
thaliana]
 gb|ABD57501.1| At1g69230 [Arabidopsis thaliana]
 gb|AEE34898.1| protein SPIRAL1-like2 [Arabidopsis thaliana]
 gb|AEE34899.1| protein SPIRAL1-like2 [Arabidopsis thaliana]
Length=110

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 28/39 (72%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QN+GNF I  RPSTKV SAPGG SSL YLFG
Sbjct  69   NNYMRAEGQNTGNF-ITDRPSTKVHSAPGGGSSLDYLFG  106



>ref|XP_002875225.1| hypothetical protein ARALYDRAFT_322665 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51484.1| hypothetical protein ARALYDRAFT_322665 [Arabidopsis lyrata subsp. 
lyrata]
Length=120

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 30/41 (73%), Gaps = 1/41 (2%)
 Frame = +1

Query  376  SPGNTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLF  498
            +P N + R   QN+GNF +  RPSTKV +APGG SSLGYLF
Sbjct  77   TPVNNYARAEGQNTGNF-LTDRPSTKVHAAPGGGSSLGYLF  116



>ref|NP_197064.1| protein SPIRAL1-like4 [Arabidopsis thaliana]
 sp|Q9LF22.1|SP1L4_ARATH RecName: Full=Protein SPIRAL1-like 4 [Arabidopsis thaliana]
 emb|CAC01759.1| nitrilase associated protein-like [Arabidopsis thaliana]
 gb|AAO42183.1| putative nitrilase associated protein [Arabidopsis thaliana]
 gb|AAO50584.1| putative nitrilase associated protein [Arabidopsis thaliana]
 gb|AED92182.1| protein SPIRAL1-like4 [Arabidopsis thaliana]
Length=127

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R+  QN GNF +  RPSTKV +APGG SSLGYLFG
Sbjct  82   NNYYRSDGQNCGNF-LTERPSTKVHAAPGGGSSLGYLFG  119



>ref|XP_010470896.1| PREDICTED: protein SPIRAL1-like 2 [Camelina sativa]
 ref|XP_010470897.1| PREDICTED: protein SPIRAL1-like 2 [Camelina sativa]
 ref|XP_010470898.1| PREDICTED: protein SPIRAL1-like 2 [Camelina sativa]
Length=110

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R+  QN+GNF I  RPSTKV SAPGG SSL YLFG
Sbjct  69   NNYMRSEGQNTGNF-IMDRPSTKVHSAPGGGSSLDYLFG  106



>ref|XP_010492403.1| PREDICTED: protein SPIRAL1-like 4 [Camelina sativa]
Length=130

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R+  QN GNF +  RPSTKV +APGG SSLGYLFG
Sbjct  84   NNYYRSDGQNCGNF-LTERPSTKVHAAPGGGSSLGYLFG  121



>ref|XP_010415555.1| PREDICTED: protein SPIRAL1-like 2 [Camelina sativa]
 ref|XP_010415556.1| PREDICTED: protein SPIRAL1-like 2 [Camelina sativa]
 ref|XP_010415557.1| PREDICTED: protein SPIRAL1-like 2 [Camelina sativa]
Length=110

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R+  QN+GNF I  RPSTKV SAPGG SSL YLFG
Sbjct  69   NNYMRSEGQNTGNF-ITDRPSTKVHSAPGGGSSLDYLFG  106



>ref|XP_006828929.1| hypothetical protein AMTR_s00001p00214730 [Amborella trichopoda]
 gb|ERM96345.1| hypothetical protein AMTR_s00001p00214730 [Amborella trichopoda]
Length=114

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N ++R+  QN+GNF I  RP+TKV +APGG SSL YLFG
Sbjct  73   NNYQRSEGQNTGNF-ITDRPTTKVHAAPGGGSSLNYLFG  110



>ref|XP_010923629.1| PREDICTED: protein SPIRAL1-like 1 [Elaeis guineensis]
Length=107

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 28/39 (72%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QNSGNF +  RPSTKV +APGG SSL YLFG
Sbjct  66   NNYHRADGQNSGNF-LTDRPSTKVHAAPGGGSSLSYLFG  103



>ref|XP_006408438.1| hypothetical protein EUTSA_v10021779mg [Eutrema salsugineum]
 gb|ESQ49891.1| hypothetical protein EUTSA_v10021779mg [Eutrema salsugineum]
Length=122

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R+  QN GNF +  RPSTKV +APGG SSLGYLFG
Sbjct  75   NNYFRSEGQNCGNF-LTDRPSTKVHAAPGGGSSLGYLFG  112



>ref|XP_004984003.1| PREDICTED: protein SPIRAL1-like 1-like isoform X2 [Setaria italica]
Length=102

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 30/44 (68%), Gaps = 1/44 (2%)
 Frame = +1

Query  376  SPGNTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFGDK  507
            S  N + R   QN+GNF +  RPSTKV +APGG SSL YLFG K
Sbjct  60   SQTNNYHRADGQNTGNF-LTDRPSTKVHAAPGGGSSLDYLFGGK  102



>ref|XP_002451163.1| hypothetical protein SORBIDRAFT_05g025170 [Sorghum bicolor]
 gb|EES10151.1| hypothetical protein SORBIDRAFT_05g025170 [Sorghum bicolor]
Length=121

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 28/39 (72%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QN GNF +  RPSTKV +APGG SSLGYLFG
Sbjct  77   NNYFRAQGQNCGNF-LTDRPSTKVHAAPGGGSSLGYLFG  114



>ref|XP_003532924.1| PREDICTED: protein SPIRAL1-like 5-like [Glycine max]
 gb|KHN16796.1| hypothetical protein glysoja_002893 [Glycine soja]
Length=87

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 38/67 (57%), Gaps = 16/67 (24%)
 Frame = +1

Query  307  APPYGIDSDVDNTTVSKpppppNSPGNTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSL  486
             PPYGID D ++          N P         Q+ GN  + +RPSTKV+S PGG SSL
Sbjct  37   LPPYGIDIDNNH----------NPPTGQ-----GQHLGN-VLTNRPSTKVQSVPGGHSSL  80

Query  487  GYLFGDK  507
            GYLFGDK
Sbjct  81   GYLFGDK  87



>ref|XP_010455021.1| PREDICTED: protein SPIRAL1-like 3 isoform X1 [Camelina sativa]
Length=129

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R+  QN GNF +  RPSTKV +APGG SSLGYLFG
Sbjct  82   NNYFRSEGQNCGNF-LTDRPSTKVHAAPGGGSSLGYLFG  119



>ref|XP_006303022.1| hypothetical protein CARUB_v10021178mg [Capsella rubella]
 gb|EOA35920.1| hypothetical protein CARUB_v10021178mg [Capsella rubella]
Length=112

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 28/39 (72%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QN+GNF I  RPSTKV SAPGG SSL YLFG
Sbjct  71   NNYMRAEGQNTGNF-ITDRPSTKVHSAPGGGSSLDYLFG  108



>ref|NP_001238317.1| uncharacterized protein LOC100499684 [Glycine max]
 ref|XP_006572818.1| PREDICTED: uncharacterized protein LOC100499684 isoform X1 [Glycine 
max]
 gb|ACU13223.1| unknown [Glycine max]
 gb|KHN44938.1| hypothetical protein glysoja_036149 [Glycine soja]
Length=108

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 28/35 (80%), Gaps = 1/35 (3%)
 Frame = +1

Query  400  TLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFGD  504
            T  QN+GNF I  RPSTKV +APGG SSLGYLFG+
Sbjct  70   TDGQNTGNF-ITDRPSTKVHAAPGGGSSLGYLFGE  103



>ref|XP_010420229.1| PREDICTED: protein SPIRAL1-like 4 [Camelina sativa]
Length=130

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R+  QN GNF +  RPSTKV +APGG SSLGYLFG
Sbjct  84   NNYYRSDGQNCGNF-LTDRPSTKVHAAPGGGSSLGYLFG  121



>ref|XP_010485455.1| PREDICTED: protein SPIRAL1-like 3 [Camelina sativa]
 ref|XP_010485456.1| PREDICTED: protein SPIRAL1-like 3 [Camelina sativa]
Length=123

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R+  QN GNF +  RPSTKV +APGG SSLGYLFG
Sbjct  75   NNYFRSEGQNCGNF-LTDRPSTKVHAAPGGGSSLGYLFG  112



>ref|XP_010453696.1| PREDICTED: protein SPIRAL1-like 4 [Camelina sativa]
Length=131

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R+  QN GNF +  RPSTKV +APGG SSLGYLFG
Sbjct  85   NNYYRSDGQNCGNF-LTDRPSTKVHAAPGGGSSLGYLFG  122



>ref|XP_010455733.1| PREDICTED: protein SPIRAL1-like 3 isoform X2 [Camelina sativa]
Length=122

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R+  QN GNF +  RPSTKV +APGG SSLGYLFG
Sbjct  75   NNYFRSEGQNCGNF-LTDRPSTKVHAAPGGGSSLGYLFG  112



>ref|XP_006298828.1| hypothetical protein CARUB_v10014933mg [Capsella rubella]
 gb|EOA31726.1| hypothetical protein CARUB_v10014933mg [Capsella rubella]
Length=123

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R+  QN GNF +  RPSTKV +APGG SSLGYLFG
Sbjct  75   NNYFRSEGQNCGNF-LTDRPSTKVHAAPGGGSSLGYLFG  112



>gb|AFW60310.1| SPR1 [Zea mays]
Length=113

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 28/39 (72%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QN GNF +  RPSTKV +APGG SSLGYLFG
Sbjct  69   NNYFRAQGQNCGNF-LTDRPSTKVHAAPGGGSSLGYLFG  106



>ref|NP_001148014.1| LOC100281623 [Zea mays]
 gb|ACG27427.1| SPR1 [Zea mays]
 gb|ACG29406.1| SPR1 [Zea mays]
Length=114

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 28/39 (72%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QN GNF +  RPSTKV +APGG SSLGYLFG
Sbjct  70   NNYFRAQGQNCGNF-LTDRPSTKVHAAPGGGSSLGYLFG  107



>ref|XP_008379871.1| PREDICTED: LOW QUALITY PROTEIN: putative methylesterase 11, chloroplastic 
[Malus domestica]
Length=529

 Score = 52.4 bits (124),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 29/41 (71%), Gaps = 1/41 (2%)
 Frame = +1

Query  379  PGNTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            P N + R   QN GNF I  RPSTKV +APGG SSLGYLFG
Sbjct  485  PTNNYLRVDGQNCGNF-ITDRPSTKVHAAPGGGSSLGYLFG  524



>gb|ABF50107.1| nitrilase associated protein-like [Musa acuminata AAA Group]
Length=71

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 27/36 (75%), Gaps = 1/36 (3%)
 Frame = +1

Query  397  RTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFGD  504
            R   QN GNF I  RPSTKV +APGG SSLGYLFG+
Sbjct  34   RADGQNCGNF-ITDRPSTKVHAAPGGGSSLGYLFGN  68



>ref|XP_002311347.2| hypothetical protein POPTR_0008s09660g [Populus trichocarpa]
 gb|EEE88714.2| hypothetical protein POPTR_0008s09660g [Populus trichocarpa]
Length=194

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QN+GNF I  RPSTKV +APGG SSLGYLFG
Sbjct  153  NNYLRADGQNTGNF-ITDRPSTKVHAAPGGGSSLGYLFG  190



>ref|XP_010091590.1| hypothetical protein L484_026438 [Morus notabilis]
 gb|EXB44856.1| hypothetical protein L484_026438 [Morus notabilis]
Length=117

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 41/76 (54%), Gaps = 10/76 (13%)
 Frame = +1

Query  277  NETPPPSPICAPPYGIDSDVDNTTVSKp--ppppNSPGNTFERTLSQNSGNFAIASRPST  450
            N+ P   P  APP  +D       VSK       ++  N + R   QN+GNF I  RPST
Sbjct  42   NDVPASKPTAAPPQPVD-------VSKQIPAGINSTSTNNYMRADGQNTGNF-ITDRPST  93

Query  451  KVKSAPGGDSSLGYLF  498
            KV +APGG SSL YLF
Sbjct  94   KVHAAPGGGSSLDYLF  109



>ref|XP_006366253.1| PREDICTED: protein SPIRAL1-like 1-like isoform X1 [Solanum tuberosum]
 ref|XP_006366254.1| PREDICTED: protein SPIRAL1-like 1-like isoform X2 [Solanum tuberosum]
Length=108

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 1/35 (3%)
 Frame = +1

Query  397  RTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            R   QN+GNF I  RPSTKV +APGG SSLGYLFG
Sbjct  71   RADGQNTGNF-ITDRPSTKVHAAPGGGSSLGYLFG  104



>ref|XP_008677707.1| PREDICTED: LOC100283729 isoform X1 [Zea mays]
Length=183

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QN+GNF +  RPSTKV +APGG SSLGYLFG
Sbjct  144  NNYHRADGQNTGNF-LTDRPSTKVHAAPGGGSSLGYLFG  181



>ref|XP_009127712.1| PREDICTED: protein SPIRAL1-like 1 [Brassica rapa]
Length=111

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 28/39 (72%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QNSGNF +  RPSTKV SAPGG SSL YLFG
Sbjct  69   NNYMRADGQNSGNF-LTDRPSTKVHSAPGGGSSLNYLFG  106



>ref|XP_008243833.1| PREDICTED: protein SPIRAL1-like 1 isoform X2 [Prunus mume]
Length=119

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 28/39 (72%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QN+GNF I  RPSTKV SAPGG SSL YLFG
Sbjct  77   NNYMRADGQNTGNF-ITDRPSTKVHSAPGGGSSLDYLFG  114



>ref|XP_009798020.1| PREDICTED: protein SPIRAL1-like 3 isoform X1 [Nicotiana sylvestris]
Length=112

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 45/85 (53%), Gaps = 3/85 (4%)
 Frame = +1

Query  247  PADDDKHNKRNETPPPSPICAPPYGIDSDVDNTTVSKpppppNSPGNTFERTLSQNSGNF  426
            P ++ +  +  E  P +   + P  +   VDNT     P    S  N + R   QN GNF
Sbjct  23   PGNNSQPTRSQEKAPTNEPASKPAAVSPPVDNTK--NVPAGIQSSTNNYFRADGQNCGNF  80

Query  427  AIASRPSTKVKSAPGGDSSLGYLFG  501
             +  R STKV++APGG SSLGYLFG
Sbjct  81   -LTERRSTKVQAAPGGGSSLGYLFG  104



>ref|XP_004228412.1| PREDICTED: protein SPIRAL1-like 1 [Solanum lycopersicum]
 ref|XP_004228413.1| PREDICTED: protein SPIRAL1-like 1 [Solanum lycopersicum]
Length=104

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 1/35 (3%)
 Frame = +1

Query  397  RTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            R   QN+GNF I  RPSTKV +APGG SSLGYLFG
Sbjct  67   RADGQNTGNF-ITDRPSTKVHAAPGGGSSLGYLFG  100



>ref|XP_008243832.1| PREDICTED: protein SPIRAL1-like 1 isoform X1 [Prunus mume]
Length=131

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 28/39 (72%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QN+GNF I  RPSTKV SAPGG SSL YLFG
Sbjct  89   NNYMRADGQNTGNF-ITDRPSTKVHSAPGGGSSLDYLFG  126



>ref|XP_007153506.1| hypothetical protein PHAVU_003G041500g [Phaseolus vulgaris]
 gb|ESW25500.1| hypothetical protein PHAVU_003G041500g [Phaseolus vulgaris]
Length=106

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 27/34 (79%), Gaps = 1/34 (3%)
 Frame = +1

Query  400  TLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            T  QN+GNF I  RPSTKV +APGG SSLGYLFG
Sbjct  68   TEGQNTGNF-ITDRPSTKVHAAPGGGSSLGYLFG  100



>emb|CAN70558.1| hypothetical protein VITISV_027475 [Vitis vinifera]
Length=122

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 27/38 (71%), Gaps = 1/38 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLF  498
            N + R   QN GNF I  RPSTKV +APGG SSLGYLF
Sbjct  72   NNYYRADGQNCGNF-ITDRPSTKVHAAPGGGSSLGYLF  108



>gb|EYU42122.1| hypothetical protein MIMGU_mgv1a016618mg [Erythranthe guttata]
 gb|EYU42123.1| hypothetical protein MIMGU_mgv1a016618mg [Erythranthe guttata]
 gb|EYU42124.1| hypothetical protein MIMGU_mgv1a016618mg [Erythranthe guttata]
 gb|EYU42125.1| hypothetical protein MIMGU_mgv1a016618mg [Erythranthe guttata]
Length=114

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QN+GNF I  R STKV++APGG SSLGYLFG
Sbjct  73   NNYVRADGQNTGNF-ITDRRSTKVQAAPGGGSSLGYLFG  110



>ref|XP_009419546.1| PREDICTED: protein SPIRAL1-like 3 [Musa acuminata subsp. malaccensis]
Length=99

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 27/36 (75%), Gaps = 1/36 (3%)
 Frame = +1

Query  397  RTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFGD  504
            R   QN GNF I  RPSTKV +APGG SSLGYLFG+
Sbjct  62   RADGQNCGNF-ITDRPSTKVHAAPGGGSSLGYLFGN  96



>ref|XP_009338090.1| PREDICTED: protein SPIRAL1-like 3 [Pyrus x bretschneideri]
Length=117

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 30/44 (68%), Gaps = 4/44 (9%)
 Frame = +1

Query  379  PGNT---FERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            PGNT   + R   QN GNF I  RPSTKV SAPGG SSL YLFG
Sbjct  69   PGNTSNNYFRADGQNCGNF-ITDRPSTKVHSAPGGGSSLDYLFG  111



>ref|XP_009612685.1| PREDICTED: protein SPIRAL1-like 1 [Nicotiana tomentosiformis]
Length=107

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 27/35 (77%), Gaps = 1/35 (3%)
 Frame = +1

Query  397  RTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            R   QN+GNF I  RPSTK+ +APGG SSLGYLFG
Sbjct  70   RADGQNTGNF-ITDRPSTKIHAAPGGGSSLGYLFG  103



>gb|ACH63211.1| nitrilase-associated protein [Rheum australe]
Length=112

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 28/39 (72%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QNSGNF +  RP+ KV +APGG SSLGYLFG
Sbjct  71   NNYFRADGQNSGNF-LTDRPTVKVHAAPGGGSSLGYLFG  108



>ref|XP_008785613.1| PREDICTED: protein SPIRAL1-like 3 [Phoenix dactylifera]
 ref|XP_008785614.1| PREDICTED: protein SPIRAL1-like 3 [Phoenix dactylifera]
 ref|XP_008785615.1| PREDICTED: protein SPIRAL1-like 3 [Phoenix dactylifera]
 ref|XP_008785616.1| PREDICTED: protein SPIRAL1-like 3 [Phoenix dactylifera]
Length=97

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 28/39 (72%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QNSGNF I  RPSTKV +APGG SSL YLFG
Sbjct  56   NNYFRADGQNSGNF-ITDRPSTKVHAAPGGGSSLDYLFG  93



>ref|XP_009769296.1| PREDICTED: protein SPIRAL1-like 1 [Nicotiana sylvestris]
Length=107

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 27/35 (77%), Gaps = 1/35 (3%)
 Frame = +1

Query  397  RTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            R   QN+GNF I  RPSTK+ +APGG SSLGYLFG
Sbjct  70   RADGQNTGNF-ITDRPSTKIHAAPGGGSSLGYLFG  103



>emb|CDY50305.1| BnaA02g14630D [Brassica napus]
Length=120

 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 29/47 (62%), Gaps = 8/47 (17%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIAS--------RPSTKVKSAPGGDSSLGYLFG  501
            N + R   QNSGNF  AS        RPSTKV SAPGG SSL YLFG
Sbjct  69   NNYMRADGQNSGNFLTASCLLLDMQDRPSTKVHSAPGGGSSLNYLFG  115



>ref|XP_004239040.1| PREDICTED: protein SPIRAL1-like 1 [Solanum lycopersicum]
 ref|XP_006348678.1| PREDICTED: protein SPIRAL1-like 1-like [Solanum tuberosum]
Length=112

 Score = 48.1 bits (113),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 26/31 (84%), Gaps = 1/31 (3%)
 Frame = +1

Query  409  QNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            QN+GNF I  RPSTKV +APGG SSLGYLFG
Sbjct  79   QNTGNF-ITDRPSTKVHAAPGGGSSLGYLFG  108



>ref|XP_010032547.1| PREDICTED: protein SPIRAL1-like 2 [Eucalyptus grandis]
 gb|KCW51939.1| hypothetical protein EUGRSUZ_J01387 [Eucalyptus grandis]
 gb|KCW51940.1| hypothetical protein EUGRSUZ_J01387 [Eucalyptus grandis]
Length=126

 Score = 48.5 bits (114),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 27/39 (69%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QN GNF I  RPSTKV SAPGG SSL YLFG
Sbjct  85   NNYFRADGQNCGNF-ITDRPSTKVHSAPGGGSSLNYLFG  122



>gb|AAD27575.1|AF114171_17 hypothetical protein [Sorghum bicolor]
Length=214

 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 28/39 (72%), Gaps = 1/39 (3%)
 Frame = +1

Query  385  NTFERTLSQNSGNFAIASRPSTKVKSAPGGDSSLGYLFG  501
            N + R   QN GNF +  RPSTKV +APGG SSLGYLFG
Sbjct  170  NNYFRAQGQNCGNF-LTDRPSTKVHAAPGGGSSLGYLFG  207



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2195854201911