BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c73433_g1_i1 len=117 path=[1:0-116]

Length=117
                                                                      Score     E

ref|XP_007712890.1|  hypothetical protein COCCADRAFT_97819            80.9    3e-16   
gb|EUN23368.1|  hypothetical protein COCVIDRAFT_108893                80.9    3e-16   
ref|XP_007692148.1|  hypothetical protein COCMIDRAFT_106445           80.9    3e-16   
ref|XP_008021989.1|  hypothetical protein SETTUDRAFT_102821           80.5    4e-16   
ref|XP_007703898.1|  hypothetical protein COCSADRAFT_244591           80.5    4e-16   
gb|EMD90255.1|  hypothetical protein COCHEDRAFT_1157273               80.5    4e-16   
ref|XP_003295503.1|  hypothetical protein PTT_01335                   80.5    5e-16   
ref|XP_001930486.1|  F-box/WD repeat containing protein lin-23        80.1    5e-16   Pyrenophora tritici-repentis Pt-1C-BFP
ref|XP_001801907.1|  hypothetical protein SNOG_11667                  79.0    1e-15   Parastagonospora nodorum SN15
ref|XP_003835078.1|  similar to F-box/WD repeat containing protei...  77.8    4e-15   
ref|XP_007581064.1|  putative f-box and wd40 domain protein           50.1    2e-05   
gb|EKG17113.1|  hypothetical protein MPH_05685                        49.7    2e-05   
ref|XP_011109207.1|  hypothetical protein H072_3224                   49.7    3e-05   
ref|XP_007778854.1|  hypothetical protein W97_02765                   48.5    5e-05   
ref|XP_002790954.1|  F-box/WD repeat-containing protein 1A            47.0    2e-04   Paracoccidioides lutzii Pb01
ref|XP_010756056.1|  hypothetical protein PADG_00949                  47.0    2e-04   
gb|EEH20265.1|  hypothetical protein PABG_02524                       47.0    2e-04   Paracoccidioides brasiliensis Pb03
ref|XP_007802299.1|  hypothetical protein EPUS_04990                  47.0    2e-04   
ref|XP_003176918.1|  beta-TrCP                                        46.2    3e-04   
ref|XP_003022170.1|  hypothetical protein TRV_03694                   46.2    4e-04   
emb|CCU80382.1|  F-box/WD repeat-containing protein                   45.8    4e-04   
ref|XP_003016292.1|  hypothetical protein ARB_05691                   45.8    4e-04   
ref|XP_003238548.1|  F-box and WD40 domain-containing protein         45.8    4e-04   
dbj|GAD96691.1|  F-box and WD40 domain protein, putative              45.8    4e-04   
gb|EPQ62670.1|  F-box protein                                         45.8    4e-04   
ref|XP_002850878.1|  F-box and WD-40 domain-containing protein 11     45.4    6e-04   Arthroderma otae CBS 113480
gb|KHJ32151.1|  putative f-box and wd40 domain protein                45.4    6e-04   
gb|EHL02579.1|  putative E3 ubiquitin ligase complex SCF subunit ...  43.9    6e-04   
gb|EGE85066.1|  F-box and WD40 domain-containing protein              45.4    7e-04   
gb|EQL33796.1|  hypothetical protein BDFG_04322                       45.4    7e-04   
ref|XP_002626724.1|  F-box and domain-containing protein              45.4    7e-04   Blastomyces gilchristii SLH14081
ref|XP_001539001.1|  conserved hypothetical protein                   45.1    7e-04   Histoplasma capsulatum NAm1
gb|EZF10728.1|  hypothetical protein H100_07975                       45.1    8e-04   
gb|KEY79485.1|  hypothetical protein F box and WD40                   45.1    8e-04   
ref|XP_001271186.1|  F-box and WD40 domain protein, putative          45.1    8e-04   Aspergillus clavatus NRRL 1
gb|EER42163.1|  F-box and WD40 domain-containing protein              45.1    8e-04   Histoplasma capsulatum H143
gb|EZF69494.1|  hypothetical protein H105_07960                       44.7    8e-04   
gb|EZF58895.1|  hypothetical protein H104_07907                       44.7    8e-04   
ref|XP_754434.1|  F-box and WD40 domain protein                       45.1    8e-04   Aspergillus fumigatus Af293
gb|EDP52565.1|  F-box and WD40 domain protein, putative               45.1    8e-04   Aspergillus fumigatus A1163
ref|XP_001263278.1|  F-box and WD40 domain protein, putative          45.1    8e-04   Aspergillus fischeri NRRL 181
gb|KEZ42716.1|  WD domain-containing protein                          45.1    9e-04   
ref|XP_003068529.1|  WD domain and F-box domain containing protein    45.1    9e-04   
gb|EZF35024.1|  hypothetical protein H101_01444                       45.1    9e-04   
ref|XP_002561901.1|  Pc18g00540                                       45.1    9e-04   Penicillium rubens Wisconsin 54-1255
gb|EGE02351.1|  F-box and WD40 domain-containing protein              45.1    0.001   
gb|EGD97836.1|  F-box and WD40 domain-containing protein              45.1    0.001   
gb|EKV07253.1|  hypothetical protein PDIP_74950                       45.1    0.001   
ref|XP_001244307.1|  hypothetical protein CIMG_03748                  45.1    0.001   Coccidioides immitis RS



>ref|XP_007712890.1| hypothetical protein COCCADRAFT_97819 [Bipolaris zeicola 26-R-13]
 gb|EUC32783.1| hypothetical protein COCCADRAFT_97819 [Bipolaris zeicola 26-R-13]
Length=758

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 38/38 (100%), Positives = 38/38 (100%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    LVHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSDY  115
            LVHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSDY
Sbjct  666  LVHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSDY  703



>gb|EUN23368.1| hypothetical protein COCVIDRAFT_108893 [Bipolaris victoriae FI3]
Length=760

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 38/38 (100%), Positives = 38/38 (100%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    LVHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSDY  115
            LVHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSDY
Sbjct  668  LVHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSDY  705



>ref|XP_007692148.1| hypothetical protein COCMIDRAFT_106445 [Bipolaris oryzae ATCC 
44560]
 gb|EUC41328.1| hypothetical protein COCMIDRAFT_106445 [Bipolaris oryzae ATCC 
44560]
Length=752

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 38/38 (100%), Positives = 38/38 (100%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    LVHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSDY  115
            LVHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSDY
Sbjct  660  LVHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSDY  697



>ref|XP_008021989.1| hypothetical protein SETTUDRAFT_102821 [Setosphaeria turcica 
Et28A]
 gb|EOA90053.1| hypothetical protein SETTUDRAFT_102821 [Setosphaeria turcica 
Et28A]
Length=733

 Score = 80.5 bits (197),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 38/38 (100%), Positives = 38/38 (100%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    LVHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSDY  115
            LVHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSDY
Sbjct  641  LVHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSDY  678



>ref|XP_007703898.1| hypothetical protein COCSADRAFT_244591 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD60589.1| hypothetical protein COCSADRAFT_244591 [Bipolaris sorokiniana 
ND90Pr]
Length=749

 Score = 80.5 bits (197),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 38/38 (100%), Positives = 38/38 (100%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    LVHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSDY  115
            LVHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSDY
Sbjct  657  LVHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSDY  694



>gb|EMD90255.1| hypothetical protein COCHEDRAFT_1157273 [Bipolaris maydis C5]
 gb|ENI09531.1| hypothetical protein COCC4DRAFT_37066 [Bipolaris maydis ATCC 
48331]
Length=752

 Score = 80.5 bits (197),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 38/38 (100%), Positives = 38/38 (100%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    LVHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSDY  115
            LVHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSDY
Sbjct  660  LVHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSDY  697



>ref|XP_003295503.1| hypothetical protein PTT_01335 [Pyrenophora teres f. teres 0-1]
 gb|EFQ96403.1| hypothetical protein PTT_01335 [Pyrenophora teres f. teres 0-1]
Length=708

 Score = 80.5 bits (197),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 38/38 (100%), Positives = 38/38 (100%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    LVHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSDY  115
            LVHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSDY
Sbjct  616  LVHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSDY  653



>ref|XP_001930486.1| F-box/WD repeat containing protein lin-23 [Pyrenophora tritici-repentis 
Pt-1C-BFP]
 gb|EDU39591.1| F-box/WD repeat containing protein lin-23 [Pyrenophora tritici-repentis 
Pt-1C-BFP]
Length=708

 Score = 80.1 bits (196),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 38/38 (100%), Positives = 38/38 (100%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    LVHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSDY  115
            LVHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSDY
Sbjct  616  LVHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSDY  653



>ref|XP_001801907.1| hypothetical protein SNOG_11667 [Phaeosphaeria nodorum SN15]
 gb|EAT80711.1| hypothetical protein SNOG_11667 [Phaeosphaeria nodorum SN15]
Length=727

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 37/38 (97%), Positives = 38/38 (100%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    LVHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSDY  115
            LVHSRVKH+GLVRSLFLDAFNGRIVSGSYDQSIQVSDY
Sbjct  630  LVHSRVKHEGLVRSLFLDAFNGRIVSGSYDQSIQVSDY  667



>ref|XP_003835078.1| similar to F-box/WD repeat containing protein lin-23 [Leptosphaeria 
maculans JN3]
 emb|CBX91713.1| similar to F-box/WD repeat containing protein lin-23 [Leptosphaeria 
maculans JN3]
Length=730

 Score = 77.8 bits (190),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 37/38 (97%), Positives = 38/38 (100%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    LVHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSDY  115
            LVHSRVKH+GLVRSLFLDAFNGRIVSGSYDQSIQVSDY
Sbjct  638  LVHSRVKHEGLVRSLFLDAFNGRIVSGSYDQSIQVSDY  675



>ref|XP_007581064.1| putative f-box and wd40 domain protein [Neofusicoccum parvum 
UCRNP2]
 gb|EOD51451.1| putative f-box and wd40 domain protein [Neofusicoccum parvum 
UCRNP2]
Length=692

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  23   HDGLVRSLFLDAFNGRIVSGSYDQSIQVSDY  115
            H GLVRSLFLD  N R++SGSYDQSI+V DY
Sbjct  606  HTGLVRSLFLDTPNRRVLSGSYDQSIRVYDY  636



>gb|EKG17113.1| hypothetical protein MPH_05685 [Macrophomina phaseolina MS6]
Length=693

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  23   HDGLVRSLFLDAFNGRIVSGSYDQSIQVSDY  115
            H GLVRSLFLD  N R++SGSYDQSI+V DY
Sbjct  607  HTGLVRSLFLDTPNRRVLSGSYDQSIRVYDY  637



>ref|XP_011109207.1| hypothetical protein H072_3224 [Dactylellina haptotyla CBS 200.50]
 gb|EPS42864.1| hypothetical protein H072_3224 [Dactylellina haptotyla CBS 200.50]
Length=1153

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +2

Query  14   RVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSD  112
            R  H  LVRSL+LD+ NGRIVSGSYDQS++V D
Sbjct  471  RDAHRSLVRSLYLDSQNGRIVSGSYDQSVRVWD  503



>ref|XP_007778854.1| hypothetical protein W97_02765 [Coniosporium apollinis CBS 100218]
 gb|EON63537.1| hypothetical protein W97_02765 [Coniosporium apollinis CBS 100218]
Length=749

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    LVHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSDY  115
            +V++   H GLVRSLFLD  N R++SGSYDQSI+V  +
Sbjct  628  IVNTYRGHTGLVRSLFLDVHNNRVLSGSYDQSIRVYKF  665



>ref|XP_002790954.1| F-box/WD repeat-containing protein 1A [Paracoccidioides sp. 'lutzii' 
Pb01]
 gb|EEH36772.1| F-box/WD repeat-containing protein 1A [Paracoccidioides sp. 'lutzii' 
Pb01]
Length=756

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    LVHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSD  112
            LV+    H GLVRSL +D+ NGRIVSGSYD S++V D
Sbjct  666  LVNELKGHTGLVRSLHMDSSNGRIVSGSYDMSVKVFD  702



>ref|XP_010756056.1| hypothetical protein PADG_00949 [Paracoccidioides brasiliensis 
Pb18]
 gb|EEH44660.2| hypothetical protein PADG_00949 [Paracoccidioides brasiliensis 
Pb18]
Length=755

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    LVHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSD  112
            LV+    H GLVRSL +D+ NGRIVSGSYD S++V D
Sbjct  665  LVNELKGHTGLVRSLHMDSSNGRIVSGSYDMSVKVFD  701



>gb|EEH20265.1| hypothetical protein PABG_02524 [Paracoccidioides brasiliensis 
Pb03]
Length=767

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    LVHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSD  112
            LV+    H GLVRSL +D+ NGRIVSGSYD S++V D
Sbjct  677  LVNELKGHTGLVRSLHMDSSNGRIVSGSYDMSVKVFD  713



>ref|XP_007802299.1| hypothetical protein EPUS_04990 [Endocarpon pusillum Z07020]
 gb|ERF72072.1| hypothetical protein EPUS_04990 [Endocarpon pusillum Z07020]
Length=710

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    LVHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSD  112
            LV   + H GLVRSL LD+ N R+VSGSYD S++V D
Sbjct  614  LVRELIGHKGLVRSLHLDSSNNRVVSGSYDMSVKVWD  650



>ref|XP_003176918.1| beta-TrCP [Microsporum gypseum CBS 118893]
 gb|EFQ97966.1| beta-TrCP [Microsporum gypseum CBS 118893]
Length=687

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    LVHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSD  112
            LV     H GLVRSL +D  NGR+VSGSYD SI+V D
Sbjct  597  LVKELEGHSGLVRSLHMDNANGRVVSGSYDMSIKVFD  633



>ref|XP_003022170.1| hypothetical protein TRV_03694 [Trichophyton verrucosum HKI 0517]
 gb|EFE41552.1| hypothetical protein TRV_03694 [Trichophyton verrucosum HKI 0517]
Length=716

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    LVHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSD  112
            LV     H GLVRSL +D  NGR++SGSYD SI+V D
Sbjct  626  LVKELEGHSGLVRSLHMDNVNGRVISGSYDMSIKVFD  662



>emb|CCU80382.1| F-box/WD repeat-containing protein [Blumeria graminis f. sp. 
hordei DH14]
Length=664

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 21/37 (57%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    LVHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSD  112
            ++ S V H+ LVRSL +D+ +GR+VSGSYDQ I+V D
Sbjct  574  ILKSIVAHENLVRSLHIDSISGRLVSGSYDQDIKVFD  610



>ref|XP_003016292.1| hypothetical protein ARB_05691 [Arthroderma benhamiae CBS 112371]
 gb|EFE35647.1| hypothetical protein ARB_05691 [Arthroderma benhamiae CBS 112371]
Length=716

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    LVHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSD  112
            LV     H GLVRSL +D  NGR++SGSYD SI+V D
Sbjct  626  LVKELEGHSGLVRSLHMDNVNGRVISGSYDMSIKVFD  662



>ref|XP_003238548.1| F-box and WD40 domain-containing protein [Trichophyton rubrum 
CBS 118892]
Length=695

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    LVHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSD  112
            LV     H GLVRSL +D  NGR++SGSYD SI+V D
Sbjct  605  LVKELEGHSGLVRSLHMDNVNGRVISGSYDMSIKVFD  641



>dbj|GAD96691.1| F-box and WD40 domain protein, putative [Byssochlamys spectabilis 
No. 5]
Length=725

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    LVHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSD  112
            LV+    H GLVRSL LD  N RIVSGSYD S++V D
Sbjct  635  LVNELKGHTGLVRSLHLDDMNNRIVSGSYDMSVKVFD  671



>gb|EPQ62670.1| F-box protein [Blumeria graminis f. sp. tritici 96224]
Length=663

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 21/37 (57%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    LVHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSD  112
            ++ S V H+ LVRSL +D+ +GR+VSGSYDQ I+V D
Sbjct  573  ILKSIVAHENLVRSLHIDSISGRLVSGSYDQDIKVFD  609



>ref|XP_002850878.1| F-box and WD-40 domain-containing protein 11 [Arthroderma otae 
CBS 113480]
 gb|EEQ28094.1| F-box and WD-40 domain-containing protein 11 [Arthroderma otae 
CBS 113480]
Length=685

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    LVHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSD  112
            LV     H GLVRSL +D  NGR+VSGSYD SI+V D
Sbjct  595  LVKELEGHSGLVRSLHMDNANGRVVSGSYDMSIKVFD  631



>gb|KHJ32151.1| putative f-box and wd40 domain protein [Erysiphe necator]
Length=653

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  5    VHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSD  112
            + S   HD LVRSL +D+ +GR+VSGSYDQ I+V D
Sbjct  564  LKSIAAHDNLVRSLHIDSISGRLVSGSYDQDIKVFD  599



>gb|EHL02579.1| putative E3 ubiquitin ligase complex SCF subunit sconB [Glarea 
lozoyensis 74030]
Length=209

 Score = 43.9 bits (102),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  5    VHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSD  112
            +HS   H+ LVRSL +D+ +GR++SGSYDQ I+V D
Sbjct  118  LHSIAAHENLVRSLHIDSVSGRLISGSYDQDIKVFD  153



>gb|EGE85066.1| F-box and WD40 domain-containing protein [Blastomyces dermatitidis 
ATCC 18188]
Length=736

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    LVHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSD  112
            LV     H GLVRSL +D+ NGRIVSGSYD+S++V D
Sbjct  646  LVDELKGHWGLVRSLHMDSANGRIVSGSYDRSVKVYD  682



>gb|EQL33796.1| hypothetical protein BDFG_04322 [Blastomyces dermatitidis ATCC 
26199]
Length=736

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    LVHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSD  112
            LV     H GLVRSL +D+ NGRIVSGSYD+S++V D
Sbjct  646  LVDELKGHWGLVRSLHMDSANGRIVSGSYDRSVKVYD  682



>ref|XP_002626724.1| F-box and domain-containing protein [Blastomyces dermatitidis 
SLH14081]
 gb|EEQ76377.1| F-box and domain-containing protein [Blastomyces dermatitidis 
SLH14081]
 gb|EEQ84317.1| F-box and domain-containing protein [Blastomyces dermatitidis 
ER-3]
Length=587

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    LVHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSD  112
            LV     H GLVRSL +D+ NGRIVSGSYD+S++V D
Sbjct  497  LVDELKGHWGLVRSLHMDSANGRIVSGSYDRSVKVYD  533



>ref|XP_001539001.1| conserved hypothetical protein [Histoplasma capsulatum NAm1]
 gb|EDN09439.1| conserved hypothetical protein [Histoplasma capsulatum NAm1]
Length=605

 Score = 45.1 bits (105),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    LVHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSD  112
            LV+    H  LVRSL +D+ NGRIVSGSYD+S++V D
Sbjct  515  LVNELKGHWALVRSLHMDSTNGRIVSGSYDRSVRVYD  551



>gb|EZF10728.1| hypothetical protein H100_07975 [Trichophyton rubrum MR850]
 gb|EZF37625.1| hypothetical protein H102_07935 [Trichophyton rubrum CBS 100081]
 gb|EZF48305.1| hypothetical protein H103_07960 [Trichophyton rubrum CBS 288.86]
 gb|EZF80183.1| hypothetical protein H110_07959 [Trichophyton rubrum MR1448]
 gb|EZF90844.1| hypothetical protein H113_08024 [Trichophyton rubrum MR1459]
 gb|EZG12410.1| hypothetical protein H107_08100 [Trichophyton rubrum CBS 202.88]
 gb|KDB29458.1| hypothetical protein H112_07948 [Trichophyton rubrum D6]
 gb|EGD84257.2| hypothetical protein TERG_00539 [Trichophyton rubrum CBS 118892]
Length=433

 Score = 45.1 bits (105),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    LVHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSD  112
            LV     H GLVRSL +D  NGR++SGSYD SI+V D
Sbjct  343  LVKELEGHSGLVRSLHMDNVNGRVISGSYDMSIKVFD  379



>gb|KEY79485.1| hypothetical protein F box and WD40 [Aspergillus fumigatus var. 
RP-2014]
Length=680

 Score = 45.1 bits (105),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 21/30 (70%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +2

Query  23   HDGLVRSLFLDAFNGRIVSGSYDQSIQVSD  112
            H GLVRSL LD+ N RIVSGSYD S++V D
Sbjct  597  HAGLVRSLHLDSMNQRIVSGSYDMSVKVFD  626



>ref|XP_001271186.1| F-box and WD40 domain protein, putative [Aspergillus clavatus 
NRRL 1]
 gb|EAW09760.1| F-box and WD40 domain protein, putative [Aspergillus clavatus 
NRRL 1]
Length=673

 Score = 45.1 bits (105),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 21/30 (70%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +2

Query  23   HDGLVRSLFLDAFNGRIVSGSYDQSIQVSD  112
            H GLVRSL LD+ N RIVSGSYD S++V D
Sbjct  590  HAGLVRSLHLDSTNQRIVSGSYDMSVKVFD  619



>gb|EER42163.1| F-box and WD40 domain-containing protein [Histoplasma capsulatum 
H143]
Length=713

 Score = 45.1 bits (105),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    LVHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSD  112
            LV+    H  LVRSL +D+ NGRIVSGSYD+S++V D
Sbjct  623  LVNELKGHWALVRSLHMDSTNGRIVSGSYDRSVRVYD  659



>gb|EZF69494.1| hypothetical protein H105_07960 [Trichophyton soudanense CBS 
452.61]
 gb|EZG01761.1| hypothetical protein H106_07831 [Trichophyton rubrum CBS 735.88]
Length=433

 Score = 44.7 bits (104),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    LVHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSD  112
            LV     H GLVRSL +D  NGR++SGSYD SI+V D
Sbjct  343  LVKELEGHSGLVRSLHMDNVNGRVISGSYDMSIKVFD  379



>gb|EZF58895.1| hypothetical protein H104_07907 [Trichophyton rubrum CBS 289.86]
Length=433

 Score = 44.7 bits (104),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    LVHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSD  112
            LV     H GLVRSL +D  NGR++SGSYD SI+V D
Sbjct  343  LVKELEGHSGLVRSLHMDNVNGRVISGSYDMSIKVFD  379



>ref|XP_754434.1| F-box and WD40 domain protein [Aspergillus fumigatus Af293]
 gb|EAL92396.1| F-box and WD40 domain protein, putative [Aspergillus fumigatus 
Af293]
Length=680

 Score = 45.1 bits (105),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 21/30 (70%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +2

Query  23   HDGLVRSLFLDAFNGRIVSGSYDQSIQVSD  112
            H GLVRSL LD+ N RIVSGSYD S++V D
Sbjct  597  HAGLVRSLHLDSMNQRIVSGSYDMSVKVFD  626



>gb|EDP52565.1| F-box and WD40 domain protein, putative [Aspergillus fumigatus 
A1163]
Length=680

 Score = 45.1 bits (105),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 21/30 (70%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +2

Query  23   HDGLVRSLFLDAFNGRIVSGSYDQSIQVSD  112
            H GLVRSL LD+ N RIVSGSYD S++V D
Sbjct  597  HAGLVRSLHLDSMNQRIVSGSYDMSVKVFD  626



>ref|XP_001263278.1| F-box and WD40 domain protein, putative [Neosartorya fischeri 
NRRL 181]
 gb|EAW21381.1| F-box and WD40 domain protein, putative [Neosartorya fischeri 
NRRL 181]
Length=681

 Score = 45.1 bits (105),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 21/30 (70%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +2

Query  23   HDGLVRSLFLDAFNGRIVSGSYDQSIQVSD  112
            H GLVRSL LD+ N RIVSGSYD S++V D
Sbjct  598  HAGLVRSLHLDSMNQRIVSGSYDMSVKVFD  627



>gb|KEZ42716.1| WD domain-containing protein [Scedosporium apiospermum]
Length=724

 Score = 45.1 bits (105),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 19/30 (63%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +2

Query  23   HDGLVRSLFLDAFNGRIVSGSYDQSIQVSD  112
            HDGLVRSL +D+ +GR++SGSYD  I+V D
Sbjct  630  HDGLVRSLHIDSVSGRLISGSYDTDIKVFD  659



>ref|XP_003068529.1| WD domain and F-box domain containing protein [Coccidioides posadasii 
C735 delta SOWgp]
 gb|EER26384.1| WD domain and F-box domain containing protein [Coccidioides posadasii 
C735 delta SOWgp]
 gb|EFW20361.1| F-box/WD repeat protein [Coccidioides posadasii str. Silveira]
Length=713

 Score = 45.1 bits (105),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 21/37 (57%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    LVHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSD  112
            LV+    H GLVRSL +D  NGR++SGSYD S++V D
Sbjct  623  LVNELKGHSGLVRSLHMDNENGRVISGSYDMSVKVFD  659



>gb|EZF35024.1| hypothetical protein H101_01444 [Trichophyton interdigitale H6]
 gb|KDB22512.1| hypothetical protein H109_05583 [Trichophyton interdigitale MR816]
Length=696

 Score = 45.1 bits (105),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    LVHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSD  112
            LV     H GLVRSL +D  NGR++SGSYD SI+V D
Sbjct  606  LVKELEGHSGLVRSLHMDNVNGRVISGSYDMSIKVFD  642



>ref|XP_002561901.1| Pc18g00540 [Penicillium rubens Wisconsin 54-1255]
 emb|CAP94278.1| Pc18g00540 [Penicillium rubens Wisconsin 54-1255]
Length=702

 Score = 45.1 bits (105),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    LVHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSD  112
            LV+    H GL+RSL LD+ N RI+SGSYD SI+V D
Sbjct  612  LVNELHGHSGLIRSLHLDSANKRIISGSYDMSIKVFD  648



>gb|EGE02351.1| F-box and WD40 domain-containing protein [Trichophyton equinum 
CBS 127.97]
Length=694

 Score = 45.1 bits (105),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    LVHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSD  112
            LV     H GLVRSL +D  NGR++SGSYD SI+V D
Sbjct  604  LVKELEGHSGLVRSLHMDNVNGRVISGSYDMSIKVFD  640



>gb|EGD97836.1| F-box and WD40 domain-containing protein [Trichophyton tonsurans 
CBS 112818]
Length=698

 Score = 45.1 bits (105),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    LVHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSD  112
            LV     H GLVRSL +D  NGR++SGSYD SI+V D
Sbjct  608  LVKELEGHSGLVRSLHMDNVNGRVISGSYDMSIKVFD  644



>gb|EKV07253.1| hypothetical protein PDIP_74950 [Penicillium digitatum Pd1]
 gb|EKV08699.1| hypothetical protein PDIG_65630 [Penicillium digitatum PHI26]
Length=701

 Score = 45.1 bits (105),  Expect = 0.001, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    LVHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSD  112
            LV+    H GLVRSL LD+ N RI+SGSYD S++V D
Sbjct  611  LVNELHGHTGLVRSLHLDSANKRIISGSYDMSVKVFD  647



>ref|XP_001244307.1| hypothetical protein CIMG_03748 [Coccidioides immitis RS]
 gb|EAS32888.2| F-box and WD40 domain-containing protein [Coccidioides immitis 
RS]
Length=713

 Score = 45.1 bits (105),  Expect = 0.001, Method: Composition-based stats.
 Identities = 21/37 (57%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    LVHSRVKHDGLVRSLFLDAFNGRIVSGSYDQSIQVSD  112
            LV+    H GLVRSL +D  NGR++SGSYD S++V D
Sbjct  623  LVNELKGHSGLVRSLHMDNENGRVISGSYDMSVKVFD  659



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 519686539684