BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7317_g1_i1 len=1617 path=[1:0-1616]

Length=1617
                                                                      Score     E

ref|XP_009776069.1|  PREDICTED: COBRA-like protein 6 isoform X1         607   0.0      
ref|XP_009602799.1|  PREDICTED: COBRA-like protein 6 isoform X1         598   0.0      
ref|XP_011087711.1|  PREDICTED: COBRA-like protein 6 isoform X2         590   0.0      
ref|XP_011087710.1|  PREDICTED: COBRA-like protein 6 isoform X1         591   0.0      
emb|CDO97585.1|  unnamed protein product                                589   0.0      
ref|XP_009776070.1|  PREDICTED: COBRA-like protein 6 isoform X2         573   0.0      
ref|XP_006349429.1|  PREDICTED: COBRA-like protein 6-like               564   0.0      
ref|XP_009602800.1|  PREDICTED: COBRA-like protein 6 isoform X2         563   0.0      
ref|XP_010314626.1|  PREDICTED: COBRA-like protein 6 isoform X1         561   0.0      
ref|XP_006471247.1|  PREDICTED: COBRA-like protein 6-like               558   0.0      
gb|EYU26510.1|  hypothetical protein MIMGU_mgv1a004710mg                557   0.0      
gb|EYU26509.1|  hypothetical protein MIMGU_mgv1a004710mg                556   0.0      
emb|CBI29736.3|  unnamed protein product                                543   0.0      
ref|XP_010658027.1|  PREDICTED: COBRA-like protein 6                    541   0.0      
ref|XP_011028305.1|  PREDICTED: COBRA-like protein 6                    526   6e-180   
ref|XP_010030140.1|  PREDICTED: COBRA-like protein 6 isoform X2         526   6e-180   
ref|XP_008365309.1|  PREDICTED: COBRA-like protein 6                    524   2e-179   
ref|XP_010030139.1|  PREDICTED: COBRA-like protein 6 isoform X1         524   5e-179   
gb|KDO43549.1|  hypothetical protein CISIN_1g040209mg                   521   1e-178   
ref|XP_009355440.1|  PREDICTED: COBRA-like protein 6                    525   3e-178   
ref|XP_004486234.1|  PREDICTED: COBRA-like protein 6-like               520   8e-178   
ref|XP_008456042.1|  PREDICTED: COBRA-like protein 6                    521   2e-177   
ref|XP_007042284.1|  COBRA-like protein 6 precursor                     518   4e-176   
ref|XP_009345837.1|  PREDICTED: COBRA-like protein 6                    515   9e-176   
ref|XP_010246052.1|  PREDICTED: COBRA-like protein 6                    506   7e-173   
ref|XP_004146282.1|  PREDICTED: COBRA-like protein 1-like               506   5e-172   
ref|XP_010919369.1|  PREDICTED: COBRA-like protein 7                    504   2e-171   
ref|XP_004159883.1|  PREDICTED: COBRA-like protein 1-like               503   3e-171   
ref|XP_008791642.1|  PREDICTED: COBRA-like protein 7                    503   7e-171   
ref|XP_010548878.1|  PREDICTED: COBRA-like protein 6                    499   2e-169   
ref|XP_004301494.1|  PREDICTED: protein COBRA-like                      499   5e-169   
ref|XP_006384995.1|  hypothetical protein POPTR_0004s22890g             492   2e-167   
ref|XP_004288992.1|  PREDICTED: COBRA-like protein 3-like               494   4e-167   
ref|XP_007226624.1|  hypothetical protein PRUPE_ppa022902mg             490   1e-166   
ref|XP_008218770.1|  PREDICTED: COBRA-like protein 6                    490   1e-166   
ref|XP_009397862.1|  PREDICTED: COBRA-like protein 7 isoform X2         480   2e-162   
ref|XP_002460985.1|  hypothetical protein SORBIDRAFT_02g038720          480   1e-161   Sorghum bicolor [broomcorn]
ref|XP_009397861.1|  PREDICTED: COBRA-like protein 7 isoform X1         477   4e-161   
ref|XP_004958241.1|  PREDICTED: COBRA-like protein 1-like               478   6e-161   
ref|XP_006658783.1|  PREDICTED: COBRA-like protein 1-like               475   9e-160   
ref|NP_001105970.1|  brittle stalk-2-like protein 6 precursor           475   1e-159   Zea mays [maize]
gb|EAZ04637.1|  hypothetical protein OsI_26785                          474   1e-159   Oryza sativa Indica Group [Indian rice]
ref|XP_009397863.1|  PREDICTED: COBRA-like protein 3 isoform X3         473   2e-159   
ref|NP_001060219.2|  Os07g0604300                                       474   2e-159   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009397865.1|  PREDICTED: COBRA-like protein 7 isoform X4         473   2e-159   
ref|XP_009395002.1|  PREDICTED: COBRA-like protein 1                    473   4e-159   
ref|XP_009386184.1|  PREDICTED: COBRA-like protein 1                    473   5e-159   
ref|XP_009415817.1|  PREDICTED: COBRA-like protein 1                    473   6e-159   
ref|XP_010939207.1|  PREDICTED: COBRA-like protein 1                    473   7e-159   
ref|XP_010936446.1|  PREDICTED: COBRA-like protein 1                    476   1e-158   
ref|XP_007148542.1|  hypothetical protein PHAVU_006G217400g             469   7e-158   
ref|XP_006431744.1|  hypothetical protein CICLE_v10001652mg             466   8e-158   
ref|XP_009151763.1|  PREDICTED: COBRA-like protein 2                    469   1e-157   
emb|CDX85277.1|  BnaC07g25880D                                          469   1e-157   
ref|XP_003527117.1|  PREDICTED: protein COBRA                           469   1e-157   
ref|XP_009602801.1|  PREDICTED: COBRA-like protein 6 isoform X3         467   1e-157   
gb|KHN19598.1|  Protein COBRA                                           469   2e-157   
gb|KDP24286.1|  hypothetical protein JCGZ_25582                         468   5e-157   
ref|XP_008785625.1|  PREDICTED: COBRA-like protein 1                    468   7e-157   
ref|XP_006651506.1|  PREDICTED: LOW QUALITY PROTEIN: COBRA-like p...    468   7e-157   
ref|XP_008775852.1|  PREDICTED: LOW QUALITY PROTEIN: COBRA-like p...    468   7e-157   
ref|XP_010660572.1|  PREDICTED: protein COBRA                           468   9e-157   
emb|CBI16946.3|  unnamed protein product                                466   1e-156   
emb|CAN68249.1|  hypothetical protein VITISV_020126                     468   1e-156   Vitis vinifera
gb|EPS70668.1|  hypothetical protein M569_04090                         465   1e-156   
ref|XP_002531000.1|  Protein COBRA precursor, putative                  467   2e-156   Ricinus communis
ref|XP_011014072.1|  PREDICTED: COBRA-like protein 1                    466   2e-156   
ref|XP_006338345.1|  PREDICTED: protein COBRA-like                      466   3e-156   
gb|AHC30880.1|  COBRA-like protein                                      466   4e-156   
gb|KHG21688.1|  COBRA-like protein 6                                    462   4e-156   
ref|XP_009373790.1|  PREDICTED: COBRA-like protein 1 isoform X1         466   5e-156   
ref|XP_010257980.1|  PREDICTED: protein COBRA-like isoform X1           466   5e-156   
ref|XP_011085599.1|  PREDICTED: protein COBRA                           465   6e-156   
gb|AFK45756.1|  unknown                                                 465   7e-156   
gb|AFZ78571.1|  COBRA-like protein                                      465   7e-156   
ref|XP_009373791.1|  PREDICTED: COBRA-like protein 1 isoform X2         465   8e-156   
ref|XP_008341799.1|  PREDICTED: COBRA-like protein 1 isoform X1         465   9e-156   
ref|XP_004232141.1|  PREDICTED: protein COBRA                           464   9e-156   
ref|XP_010514669.1|  PREDICTED: COBRA-like protein 2                    464   1e-155   
ref|XP_002305390.1|  phytochelatin synthetase family protein            464   1e-155   Populus trichocarpa [western balsam poplar]
ref|XP_008353506.1|  PREDICTED: COBRA-like protein 1 isoform X1         465   1e-155   
ref|XP_009763134.1|  PREDICTED: protein COBRA                           464   1e-155   
ref|XP_008341800.1|  PREDICTED: COBRA-like protein 1 isoform X2         464   1e-155   
gb|KHG07280.1|  COBRA-like protein 1                                    464   2e-155   
ref|XP_008353507.1|  PREDICTED: COBRA-like protein 1 isoform X2         464   2e-155   
gb|EPS71578.1|  hypothetical protein M569_03176                         463   2e-155   
ref|XP_008230280.1|  PREDICTED: COBRA-like protein 1                    464   3e-155   
ref|XP_010260537.1|  PREDICTED: protein COBRA-like isoform X1           464   3e-155   
ref|XP_004981735.1|  PREDICTED: COBRA-like protein 3-like               463   3e-155   
ref|XP_009600080.1|  PREDICTED: protein COBRA                           463   3e-155   
gb|ABK25014.1|  unknown                                                 463   4e-155   Picea sitchensis
ref|NP_001050367.1|  Os03g0416300                                       463   4e-155   Oryza sativa Japonica Group [Japonica rice]
gb|ACG27916.1|  COBRA-like protein 4 precursor                          463   5e-155   Zea mays [maize]
gb|KHG10282.1|  COBRA-like protein 1                                    463   5e-155   
ref|NP_001105969.1|  brittle stalk-2-like protein 4 precursor           462   5e-155   Zea mays [maize]
ref|XP_010314628.1|  PREDICTED: COBRA-like protein 6 isoform X2         462   6e-155   
ref|XP_002875546.1|  hypothetical protein ARALYDRAFT_484733             462   6e-155   
ref|XP_003559986.1|  PREDICTED: COBRA-like protein 1                    462   7e-155   
ref|XP_006395263.1|  hypothetical protein EUTSA_v10004232mg             462   8e-155   
ref|XP_004491893.1|  PREDICTED: protein COBRA-like                      462   8e-155   
ref|XP_003557716.1|  PREDICTED: COBRA-like protein 2                    462   9e-155   
ref|XP_007215357.1|  hypothetical protein PRUPE_ppa005522mg             462   1e-154   
ref|XP_011099033.1|  PREDICTED: COBRA-like protein 4                    461   1e-154   
ref|XP_006417537.1|  hypothetical protein EUTSA_v10007643mg             461   1e-154   
ref|XP_011087367.1|  PREDICTED: protein COBRA-like isoform X1           462   2e-154   
ref|XP_006368071.1|  PREDICTED: COBRA-like protein 4-like               460   2e-154   
ref|XP_007138374.1|  hypothetical protein PHAVU_009G203100g             461   2e-154   
ref|XP_003559251.1|  PREDICTED: COBRA-like protein 3                    461   2e-154   
ref|XP_006363258.1|  PREDICTED: COBRA-like protein 4-like               461   2e-154   
ref|XP_004138217.1|  PREDICTED: protein COBRA-like                      461   2e-154   
ref|XP_010502992.1|  PREDICTED: COBRA-like protein 2 isoform X4         461   2e-154   
ref|XP_006365658.1|  PREDICTED: protein COBRA-like                      461   3e-154   
ref|XP_007139435.1|  hypothetical protein PHAVU_008G029100g             461   3e-154   
ref|XP_006291010.1|  hypothetical protein CARUB_v10017122mg             462   3e-154   
ref|XP_010502989.1|  PREDICTED: COBRA-like protein 2 isoform X2         461   3e-154   
ref|XP_010694055.1|  PREDICTED: protein COBRA-like                      461   3e-154   
ref|XP_008777346.1|  PREDICTED: COBRA-like protein 3                    461   3e-154   
ref|XP_003522986.1|  PREDICTED: protein COBRA-like                      461   4e-154   
ref|XP_006650604.1|  PREDICTED: COBRA-like protein 3-like               460   5e-154   
ref|XP_010032552.1|  PREDICTED: protein COBRA-like                      461   5e-154   
ref|XP_010502991.1|  PREDICTED: COBRA-like protein 2 isoform X3         460   5e-154   
ref|XP_010425766.1|  PREDICTED: COBRA-like protein 2                    460   6e-154   
ref|XP_011099166.1|  PREDICTED: protein COBRA-like                      462   6e-154   
ref|XP_009616573.1|  PREDICTED: protein COBRA-like                      460   6e-154   
ref|XP_010502988.1|  PREDICTED: COBRA-like protein 2 isoform X1         460   7e-154   
ref|XP_002264600.1|  PREDICTED: protein COBRA                           460   7e-154   Vitis vinifera
ref|NP_001104946.1|  brittle stalk-2-like protein 3 precursor           460   7e-154   Zea mays [maize]
gb|EYU44225.1|  hypothetical protein MIMGU_mgv1a006751mg                459   7e-154   
gb|ACG33719.1|  COBRA-like protein 4 precursor                          460   7e-154   Zea mays [maize]
ref|XP_003552600.1|  PREDICTED: protein COBRA-like                      459   8e-154   
ref|NP_186870.1|  COBRA-like protein 1 precursor                        460   9e-154   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004507298.1|  PREDICTED: protein COBRA-like                      459   1e-153   
ref|XP_010502993.1|  PREDICTED: COBRA-like protein 2 isoform X5         459   1e-153   
gb|KEH21748.1|  COBRA-like protein 2 precursor                          459   1e-153   
ref|XP_007151374.1|  hypothetical protein PHAVU_004G041400g             459   1e-153   
ref|XP_006338344.1|  PREDICTED: COBRA-like protein 4-like               459   1e-153   
ref|NP_566851.1|  COBRA-like protein 2                                  459   1e-153   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006477706.1|  PREDICTED: protein COBRA-like                      459   1e-153   
ref|XP_004304213.1|  PREDICTED: protein COBRA-like                      459   1e-153   
ref|XP_004234909.1|  PREDICTED: COBRA-like protein 4                    458   1e-153   
ref|NP_001265883.1|  protein COBRA-like precursor                       459   2e-153   
ref|XP_006440798.1|  hypothetical protein CICLE_v10020097mg             459   2e-153   
gb|EYU44221.1|  hypothetical protein MIMGU_mgv1a006633mg                458   2e-153   
ref|XP_008453302.1|  PREDICTED: protein COBRA-like                      459   2e-153   
gb|ABS88990.1|  ch-cobra                                                459   2e-153   Cunninghamia lanceolata [China fir]
ref|XP_010528423.1|  PREDICTED: COBRA-like protein 2                    459   2e-153   
ref|XP_007037617.1|  COBRA-like extracellular glycosyl-phosphatid...    459   2e-153   
ref|NP_172450.2|  COBRA-like protein 6 precursor                        459   2e-153   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010037254.1|  PREDICTED: protein COBRA-like                      459   3e-153   
ref|XP_010937850.1|  PREDICTED: COBRA-like protein 1                    459   3e-153   
ref|XP_004232142.1|  PREDICTED: COBRA-like protein 4                    457   3e-153   
ref|XP_004488435.1|  PREDICTED: protein COBRA-like                      458   3e-153   
gb|KEH38144.1|  COBRA-like protein 2 precursor                          458   3e-153   
gb|ABD96927.1|  hypothetical protein                                    457   4e-153   Tarenaya spinosa
ref|XP_002463862.1|  hypothetical protein SORBIDRAFT_01g007760          458   4e-153   Sorghum bicolor [broomcorn]
ref|XP_010525122.1|  PREDICTED: COBRA-like protein 1                    458   4e-153   
dbj|BAB02996.1|  phytochelatin synthetase-like protein                  457   4e-153   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006655271.1|  PREDICTED: COBRA-like protein 3-like               458   4e-153   
gb|KCW48927.1|  hypothetical protein EUGRSUZ_K02540                     458   4e-153   
ref|XP_009346186.1|  PREDICTED: protein COBRA-like                      458   6e-153   
ref|XP_003559376.1|  PREDICTED: COBRA-like protein 3                    457   7e-153   
dbj|BAJ86473.1|  predicted protein                                      457   9e-153   
gb|AAM67179.1|  phytochelatin synthetase-like protein                   457   9e-153   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009782894.1|  PREDICTED: protein COBRA-like                      457   1e-152   
ref|XP_011085598.1|  PREDICTED: COBRA-like protein 4                    456   1e-152   
ref|XP_009776823.1|  PREDICTED: protein COBRA-like                      457   1e-152   
ref|XP_007155211.1|  hypothetical protein PHAVU_003G183000g             457   1e-152   
ref|XP_006345208.1|  PREDICTED: protein COBRA-like                      457   1e-152   
ref|XP_010551800.1|  PREDICTED: COBRA-like protein 1 isoform X2         457   1e-152   
ref|XP_007032845.1|  COBRA-like protein 1 precursor                     457   1e-152   
gb|EMT17778.1|  hypothetical protein F775_25414                         456   1e-152   
ref|XP_003581468.2|  PREDICTED: COBRA-like protein 7                    459   1e-152   
ref|XP_008374650.1|  PREDICTED: protein COBRA-like                      456   2e-152   
ref|XP_002884308.1|  phytochelatin synthetase family protein            456   2e-152   
emb|CDY31063.1|  BnaA08g26130D                                          456   2e-152   
ref|XP_004236067.1|  PREDICTED: COBRA-like protein 1                    456   2e-152   
ref|XP_009589606.1|  PREDICTED: COBRA-like protein 4                    455   3e-152   
gb|AAO86520.1|  phytochelatin synthetase                                456   3e-152   Triticum monococcum [einkorn wheat]
ref|XP_010551799.1|  PREDICTED: COBRA-like protein 1 isoform X1         457   3e-152   
gb|KHN18376.1|  Protein COBRA                                           455   4e-152   
gb|EAY91898.1|  hypothetical protein OsI_13550                          456   4e-152   Oryza sativa Indica Group [Indian rice]
emb|CDX93481.1|  BnaA06g05670D                                          455   4e-152   
ref|XP_009763133.1|  PREDICTED: COBRA-like protein 4                    455   5e-152   
ref|XP_002321786.2|  phytochelatin synthetase family protein            456   5e-152   Populus trichocarpa [western balsam poplar]
ref|XP_011006295.1|  PREDICTED: protein COBRA-like                      456   5e-152   
ref|XP_003550707.1|  PREDICTED: protein COBRA-like                      455   5e-152   
ref|XP_008464583.1|  PREDICTED: COBRA-like protein 1                    455   6e-152   
ref|XP_009761753.1|  PREDICTED: COBRA-like protein 4                    454   6e-152   
ref|XP_009600081.1|  PREDICTED: COBRA-like protein 4                    454   6e-152   
gb|KHN30325.1|  Protein COBRA                                           455   6e-152   
gb|AFZ78568.1|  COBRA-like protein                                      455   6e-152   
ref|XP_009124784.1|  PREDICTED: COBRA-like protein 2                    454   7e-152   
gb|EAY97880.1|  hypothetical protein OsI_19799                          455   7e-152   Oryza sativa Indica Group [Indian rice]
ref|NP_001055419.1|  Os05g0386800                                       455   7e-152   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004137135.1|  PREDICTED: protein COBRA-like                      455   7e-152   
emb|CDP21681.1|  unnamed protein product                                454   1e-151   
ref|XP_010087346.1|  hypothetical protein L484_012679                   454   1e-151   
gb|EEE63576.1|  hypothetical protein OsJ_18393                          454   1e-151   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK04997.1|  predicted protein                                      454   1e-151   
ref|XP_010694050.1|  PREDICTED: COBRA-like protein 4                    454   1e-151   
emb|CDP20883.1|  unnamed protein product                                454   1e-151   
ref|XP_006408435.1|  hypothetical protein EUTSA_v10020716mg             454   2e-151   
gb|KGN57605.1|  hypothetical protein Csa_3G225840                       450   2e-151   
gb|KDP31373.1|  hypothetical protein JCGZ_11749                         454   2e-151   
ref|XP_007208787.1|  hypothetical protein PRUPE_ppa024172mg             453   2e-151   
gb|KHG21362.1|  Protein COBRA -like protein                             453   3e-151   
ref|XP_008240087.1|  PREDICTED: protein COBRA-like isoform X1           453   3e-151   
ref|XP_006297664.1|  hypothetical protein CARUB_v10013688mg             453   3e-151   
gb|EMT09066.1|  hypothetical protein F775_27360                         453   3e-151   
ref|XP_009606717.1|  PREDICTED: COBRA-like protein 1                    453   3e-151   
gb|KFK25792.1|  hypothetical protein AALP_AA8G161300                    452   4e-151   
gb|KHN08345.1|  Protein COBRA                                           452   4e-151   
gb|KEH25134.1|  COBRA-like protein 2 precursor                          452   4e-151   
ref|XP_007032846.1|  COBRA-like extracellular glycosyl-phosphatid...    452   4e-151   
ref|XP_002892524.1|  hypothetical protein ARALYDRAFT_471080             453   4e-151   
ref|XP_009780772.1|  PREDICTED: COBRA-like protein 1                    453   4e-151   
ref|NP_001241986.1|  uncharacterized protein LOC100782876 precursor     452   5e-151   
gb|KHG07276.1|  COBRA-like protein 4                                    452   7e-151   
ref|XP_009148279.1|  PREDICTED: COBRA-like protein 6                    452   7e-151   
gb|AAM62930.1|  phytochelatin synthetase-like protein                   452   9e-151   Arabidopsis thaliana [mouse-ear cress]
emb|CDY60470.1|  BnaAnng16830D                                          452   1e-150   
ref|XP_010490321.1|  PREDICTED: COBRA-like protein 6                    451   1e-150   
ref|XP_009147371.1|  PREDICTED: COBRA-like protein 1                    452   1e-150   
ref|XP_004304207.1|  PREDICTED: protein COBRA-like                      451   1e-150   
ref|XP_009338021.1|  PREDICTED: protein COBRA-like                      452   1e-150   
ref|XP_003518180.1|  PREDICTED: protein COBRA-like                      451   2e-150   
ref|XP_010031023.1|  PREDICTED: COBRA-like protein 1                    451   2e-150   
emb|CDY43250.1|  BnaC05g48430D                                          451   2e-150   
ref|NP_568930.1|  glycosylphosphatidylinositol-anchored protein C...    451   2e-150   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010475826.1|  PREDICTED: COBRA-like protein 6                    451   2e-150   
ref|XP_003543887.1|  PREDICTED: protein COBRA-like isoform X1           451   3e-150   
gb|KHN04371.1|  COBRA-like protein 4                                    450   3e-150   
ref|XP_009110800.1|  PREDICTED: COBRA-like protein 6                    450   3e-150   
ref|XP_008393240.1|  PREDICTED: protein COBRA-like                      451   3e-150   
ref|XP_003554956.1|  PREDICTED: COBRA-like protein 4-like               450   4e-150   
ref|XP_010459308.1|  PREDICTED: COBRA-like protein 1                    450   4e-150   
ref|XP_006603925.1|  PREDICTED: protein COBRA-like                      450   5e-150   
gb|EMT25608.1|  hypothetical protein F775_09574                         451   5e-150   
ref|XP_002866404.1|  hypothetical protein ARALYDRAFT_496244             450   5e-150   
ref|XP_008453301.1|  PREDICTED: COBRA-like protein 4                    450   5e-150   
ref|XP_006306034.1|  hypothetical protein CARUB_v10011331mg             450   5e-150   
gb|EYU34590.1|  hypothetical protein MIMGU_mgv1a006245mg                450   5e-150   
gb|KFK27869.1|  hypothetical protein AALP_AA8G439700                    450   6e-150   
ref|XP_004299285.1|  PREDICTED: protein COBRA-like                      450   6e-150   
ref|XP_006394554.1|  hypothetical protein EUTSA_v10004178mg             450   6e-150   
gb|KGN63776.1|  hypothetical protein Csa_1G015700                       450   6e-150   
ref|XP_010463618.1|  PREDICTED: COBRA-like protein 1                    449   7e-150   
emb|CDY58691.1|  BnaC07g49800D                                          450   8e-150   
ref|XP_006280281.1|  hypothetical protein CARUB_v10026206mg             452   8e-150   
ref|XP_010551802.1|  PREDICTED: COBRA-like protein 4                    449   8e-150   
ref|XP_007037621.1|  COBRA-like extracellular glycosyl-phosphatid...    449   1e-149   
gb|KEH25135.1|  COBRA-like protein 2 precursor                          449   1e-149   
ref|XP_009373789.1|  PREDICTED: COBRA-like protein 4                    448   1e-149   
ref|XP_010456834.1|  PREDICTED: protein COBRA                           449   1e-149   
ref|XP_010443903.1|  PREDICTED: protein COBRA-like                      449   1e-149   
ref|XP_004138334.1|  PREDICTED: COBRA-like protein 4-like               447   1e-149   
gb|AAR14311.1|  phytochelatin synthetase                                449   2e-149   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010522480.1|  PREDICTED: protein COBRA                           449   2e-149   
ref|XP_007139432.1|  hypothetical protein PHAVU_008G029000g             448   2e-149   
gb|AAR13305.1|  phytochelatin synthetase-like protein                   449   2e-149   Phaseolus vulgaris [French bean]
gb|EMS47000.1|  hypothetical protein TRIUR3_01702                       448   3e-149   
gb|KHN10040.1|  Protein COBRA                                           447   3e-149   
ref|NP_001242075.1|  uncharacterized protein LOC100783410 precursor     447   3e-149   
ref|XP_009394778.1|  PREDICTED: COBRA-like protein 4 isoform X2         447   3e-149   
gb|KHN30324.1|  COBRA-like protein 4                                    447   3e-149   
ref|XP_009131486.1|  PREDICTED: COBRA-like protein 4                    447   3e-149   
ref|XP_007037616.1|  COBRA-like extracellular glycosyl-phosphatid...    449   4e-149   
gb|EMS68786.1|  hypothetical protein TRIUR3_15417                       448   4e-149   
ref|XP_010099317.1|  hypothetical protein L484_018179                   447   4e-149   
gb|EPS71579.1|  hypothetical protein M569_03177                         446   4e-149   
dbj|BAJ97141.1|  predicted protein                                      448   4e-149   
emb|CDX78644.1|  BnaA03g05560D                                          447   5e-149   
gb|EMT31496.1|  hypothetical protein F775_27513                         448   5e-149   
gb|KHN37931.1|  COBRA-like protein 4                                    447   6e-149   
ref|XP_008379442.1|  PREDICTED: LOW QUALITY PROTEIN: COBRA-like p...    447   6e-149   
ref|XP_006287794.1|  hypothetical protein CARUB_v10001005mg             446   6e-149   
ref|XP_002871675.1|  hypothetical protein ARALYDRAFT_488408             446   8e-149   
emb|CDY02184.1|  BnaA03g39830D                                          447   8e-149   
ref|XP_006400085.1|  hypothetical protein EUTSA_v10013604mg             446   9e-149   
emb|CDY16831.1|  BnaA09g05510D                                          447   9e-149   
ref|XP_008341798.1|  PREDICTED: COBRA-like protein 4                    446   1e-148   
ref|XP_010549989.1|  PREDICTED: COBRA-like protein 4                    446   1e-148   
emb|CDX87193.1|  BnaC09g05080D                                          446   2e-148   
gb|KEH21749.1|  COBRA-like protein 2 precursor                          445   2e-148   
ref|NP_197067.2|  COBRA-like protein 4                                  445   2e-148   
ref|XP_008240086.1|  PREDICTED: COBRA-like protein 4                    446   3e-148   
ref|XP_002514628.1|  Protein COBRA precursor, putative                  446   3e-148   
ref|XP_010492405.1|  PREDICTED: COBRA-like protein 4                    445   3e-148   
ref|XP_006440799.1|  hypothetical protein CICLE_v10020292mg             444   3e-148   
gb|AFZ78569.1|  COBRA-like protein                                      445   4e-148   
ref|XP_010420232.1|  PREDICTED: COBRA-like protein 4                    444   4e-148   
emb|CAH67392.1|  H0115B09.4                                             445   4e-148   
gb|EMS58622.1|  hypothetical protein TRIUR3_14619                       447   4e-148   
gb|KDO65677.1|  hypothetical protein CISIN_1g013089mg                   445   4e-148   
ref|XP_009136413.1|  PREDICTED: protein COBRA                           445   5e-148   
ref|XP_008464584.1|  PREDICTED: COBRA-like protein 4                    444   6e-148   
ref|XP_010453698.1|  PREDICTED: COBRA-like protein 4                    444   6e-148   
ref|XP_006374429.1|  phytochelatin synthetase-like family protein       445   7e-148   
ref|XP_010546210.1|  PREDICTED: protein COBRA-like                      445   7e-148   
ref|XP_010257979.1|  PREDICTED: COBRA-like protein 4                    445   7e-148   
emb|CDX90983.1|  BnaC02g06140D                                          444   8e-148   
ref|XP_004304208.1|  PREDICTED: COBRA-like protein 4-like               444   8e-148   
ref|XP_007209118.1|  hypothetical protein PRUPE_ppa005430mg             445   8e-148   
gb|KDP31374.1|  hypothetical protein JCGZ_11750                         444   1e-147   
ref|XP_010260547.1|  PREDICTED: COBRA-like protein 4                    444   1e-147   
ref|XP_009126060.1|  PREDICTED: COBRA-like protein 4                    443   1e-147   
ref|XP_006477707.1|  PREDICTED: COBRA-like protein 4-like               444   1e-147   
ref|NP_001105971.1|  brittle stalk-2-like protein 7 precursor           444   1e-147   
ref|XP_010092075.1|  hypothetical protein L484_007355                   446   2e-147   
ref|XP_010695259.1|  PREDICTED: COBRA-like protein 4                    444   2e-147   
ref|XP_010037255.1|  PREDICTED: COBRA-like protein 4                    444   2e-147   
gb|KHG24029.1|  COBRA-like protein 4                                    442   3e-147   
tpg|DAA63525.1|  TPA: hypothetical protein ZEAMMB73_009152              443   3e-147   
ref|XP_011006293.1|  PREDICTED: COBRA-like protein 4                    442   4e-147   
ref|XP_004491892.1|  PREDICTED: COBRA-like protein 4-like               442   5e-147   
ref|NP_001242777.1|  uncharacterized protein LOC100784352 precursor     442   5e-147   
dbj|BAM05576.1|  COBRA-like protein                                     441   6e-147   
dbj|BAJ99591.1|  predicted protein                                      444   6e-147   
gb|ABK25470.1|  unknown                                                 442   8e-147   
dbj|BAJ91851.1|  predicted protein                                      442   9e-147   
ref|XP_009394776.1|  PREDICTED: COBRA-like protein 4 isoform X1         442   1e-146   
ref|XP_009606716.1|  PREDICTED: COBRA-like protein 4                    441   1e-146   
sp|Q7XR91.2|COBL7_ORYSJ  RecName: Full=COBRA-like protein 7; AltN...    441   1e-146   
ref|XP_009111966.1|  PREDICTED: protein COBRA-like                      441   3e-146   
gb|KHG25808.1|  COBRA-like protein 6                                    438   3e-146   
ref|XP_010032553.1|  PREDICTED: COBRA-like protein 4                    439   3e-146   
gb|KGN53787.1|  hypothetical protein Csa_4G129040                       439   4e-146   
dbj|BAM05578.1|  COBRA-like protein                                     439   4e-146   
emb|CBI16945.3|  unnamed protein product                                439   5e-146   
gb|KDP24287.1|  hypothetical protein JCGZ_25583                         439   6e-146   
ref|XP_004137260.1|  PREDICTED: COBRA-like protein 4-like               439   6e-146   
ref|XP_004154765.1|  PREDICTED: COBRA-like protein 4-like               439   7e-146   
ref|XP_004299286.1|  PREDICTED: COBRA-like protein 4-like               439   7e-146   
ref|XP_010936445.1|  PREDICTED: COBRA-like protein 4                    440   8e-146   
ref|XP_009780773.1|  PREDICTED: COBRA-like protein 4                    439   1e-145   
ref|XP_009338030.1|  PREDICTED: COBRA-like protein 4                    439   2e-145   
gb|KCW83758.1|  hypothetical protein EUGRSUZ_B00629                     437   2e-145   
ref|XP_010660571.1|  PREDICTED: COBRA-like protein 4                    439   2e-145   
ref|XP_008775851.1|  PREDICTED: COBRA-like protein 4                    439   3e-145   
ref|XP_008669075.1|  PREDICTED: COBRA-like protein 7 isoform X2         437   3e-145   
gb|KHG27746.1|  COBRA-like protein 4                                    437   3e-145   
ref|XP_010031033.1|  PREDICTED: COBRA-like protein 4 isoform X1         437   3e-145   
ref|XP_008393239.1|  PREDICTED: COBRA-like protein 4                    437   6e-145   
ref|XP_011087370.1|  PREDICTED: COBRA-like protein 4                    436   6e-145   
gb|AFY03623.1|  COBRA-like protein                                      436   7e-145   
ref|XP_006440800.1|  hypothetical protein CICLE_v10023912mg             436   9e-145   
gb|KDO65676.1|  hypothetical protein CISIN_1g038127mg                   436   1e-144   
ref|XP_008374649.1|  PREDICTED: COBRA-like protein 4                    437   1e-144   
dbj|BAK05255.1|  predicted protein                                      436   2e-144   
ref|XP_004958242.1|  PREDICTED: COBRA-like protein 6-like isoform X1    436   2e-144   
ref|XP_008351868.1|  PREDICTED: COBRA-like protein 4                    436   2e-144   
ref|XP_007037618.1|  COBRA-like extracellular glycosyl-phosphatid...    436   2e-144   
ref|XP_002264378.1|  PREDICTED: COBRA-like protein 4                    436   2e-144   
ref|XP_006477734.1|  PREDICTED: COBRA-like protein 4-like               434   4e-144   
ref|XP_006345105.1|  PREDICTED: COBRA-like protein 4-like               435   4e-144   
ref|XP_010663466.1|  PREDICTED: COBRA-like protein 4 isoform X1         434   5e-144   
ref|XP_004236068.1|  PREDICTED: COBRA-like protein 4                    434   6e-144   
ref|XP_008230409.1|  PREDICTED: COBRA-like protein 4                    434   6e-144   
emb|CDX69511.1|  BnaA10g18600D                                          434   6e-144   
ref|XP_011087368.1|  PREDICTED: protein COBRA-like isoform X2           432   1e-143   
tpg|DAA05840.1|  TPA: brittle stalk-2-like protein 9                    434   1e-143   
ref|XP_010695258.1|  PREDICTED: protein COBRA-like                      434   1e-143   
ref|XP_002463861.1|  hypothetical protein SORBIDRAFT_01g007750          432   3e-143   
gb|KGN63777.1|  hypothetical protein Csa_1G015710                       431   3e-143   
ref|XP_008240111.1|  PREDICTED: COBRA-like protein 4                    432   4e-143   
ref|XP_009346173.1|  PREDICTED: COBRA-like protein 4                    432   4e-143   
ref|XP_002531001.1|  Protein COBRA precursor, putative                  431   4e-143   
emb|CDX94950.1|  BnaC05g07210D                                          436   4e-143   
ref|XP_007216522.1|  hypothetical protein PRUPE_ppa024465mg             431   5e-143   
emb|CDX70627.1|  BnaC03g07110D                                          445   6e-143   
gb|ACI24390.1|  COBRA-like protein                                      431   6e-143   
ref|XP_002446868.1|  hypothetical protein SORBIDRAFT_06g023970          431   7e-143   
ref|XP_004488434.1|  PREDICTED: COBRA-like protein 4-like isoform X2    432   8e-143   
ref|XP_010087345.1|  hypothetical protein L484_012678                   437   1e-142   
ref|XP_006650197.1|  PREDICTED: COBRA-like protein 5-like               431   1e-142   
dbj|BAK01816.1|  predicted protein                                      431   1e-142   
gb|EMT16702.1|  hypothetical protein F775_09866                         431   1e-142   
ref|XP_010483748.1|  PREDICTED: protein COBRA-like                      429   2e-142   
gb|ADE67015.1|  COBRA-like 4 protein                                    430   2e-142   
ref|XP_002463158.1|  hypothetical protein SORBIDRAFT_02g038740          430   3e-142   
emb|CDX85543.1|  BnaA02g02700D                                          430   3e-142   
gb|EMT09067.1|  COBRA-like protein 6                                    430   3e-142   
ref|XP_006856414.1|  hypothetical protein AMTR_s00047p00216760          428   3e-142   
gb|ADE67026.1|  COBRA-like 4 protein                                    429   4e-142   
gb|ADE67018.1|  COBRA-like 4 protein                                    429   4e-142   
ref|XP_010260542.1|  PREDICTED: protein COBRA-like isoform X2           428   5e-142   
ref|XP_006374430.1|  phytochelatin synthetase-like family protein       429   6e-142   
gb|ADE67012.1|  COBRA-like 4 protein                                    429   6e-142   
gb|ADE67014.1|  COBRA-like 4 protein                                    429   6e-142   
ref|XP_009784021.1|  PREDICTED: protein COBRA-like isoform X1           430   7e-142   
ref|XP_009784022.1|  PREDICTED: protein COBRA-like isoform X2           429   7e-142   
gb|ADE67017.1|  COBRA-like 4 protein                                    428   8e-142   
gb|ADE67031.1|  COBRA-like 4 protein                                    428   1e-141   
ref|XP_008379444.1|  PREDICTED: COBRA-like protein 4                    427   1e-141   
gb|ADE67025.1|  COBRA-like 4 protein                                    427   1e-141   
emb|CDY20671.1|  BnaC08g13870D                                          429   2e-141   
gb|ADE67042.1|  COBRA-like 4 protein                                    427   2e-141   
gb|ADE67039.1|  COBRA-like 4 protein                                    427   2e-141   
gb|ADE67011.1|  COBRA-like 4 protein                                    427   2e-141   
gb|ADE67032.1|  COBRA-like 4 protein                                    427   2e-141   
ref|XP_007210750.1|  hypothetical protein PRUPE_ppa021191mg             427   2e-141   
ref|XP_010102450.1|  hypothetical protein L484_006961                   427   2e-141   
gb|EYU23624.1|  hypothetical protein MIMGU_mgv1a006366mg                428   2e-141   
ref|XP_011014071.1|  PREDICTED: COBRA-like protein 4                    427   2e-141   
gb|ADE67037.1|  COBRA-like 4 protein                                    427   2e-141   
gb|KEH38143.1|  COBRA-like protein 2 precursor                          427   4e-141   
gb|ADE67020.1|  COBRA-like 4 protein                                    426   5e-141   
ref|XP_006363260.1|  PREDICTED: COBRA-like protein 3-like               427   5e-141   
gb|ADE67019.1|  COBRA-like 4 protein                                    426   6e-141   
gb|EMS49526.1|  hypothetical protein TRIUR3_12656                       424   8e-141   
ref|XP_010462612.1|  PREDICTED: COBRA-like protein 6                    424   9e-141   
emb|CDP15248.1|  unnamed protein product                                426   1e-140   
ref|XP_009589623.1|  PREDICTED: protein COBRA-like isoform X2           426   1e-140   
ref|XP_002306058.1|  phytochelatin synthetase-like family protein       425   1e-140   
ref|XP_004488433.1|  PREDICTED: COBRA-like protein 4-like isoform X1    426   1e-140   
ref|XP_009589615.1|  PREDICTED: protein COBRA-like isoform X1           426   2e-140   
emb|CDY70289.1|  BnaAnng33230D                                          423   3e-140   
ref|XP_007139433.1|  hypothetical protein PHAVU_008G029100g             423   3e-140   
gb|ADE67036.1|  COBRA-like 4 protein                                    424   3e-140   
ref|XP_007139434.1|  hypothetical protein PHAVU_008G029100g             426   4e-140   
emb|CDP20884.1|  unnamed protein product                                425   4e-140   
ref|XP_006856413.1|  hypothetical protein AMTR_s00047p00216570          424   4e-140   
gb|EMT05391.1|  hypothetical protein F775_18404                         424   5e-140   
ref|XP_010675963.1|  PREDICTED: COBRA-like protein 6                    422   6e-140   
ref|XP_011006292.1|  PREDICTED: COBRA-like protein 4                    424   6e-140   
ref|XP_003557715.1|  PREDICTED: COBRA-like protein 5                    424   8e-140   
ref|NP_001105928.1|  brittle stalk2 precursor                           424   1e-139   
gb|ACA04978.1|  GPI-anchored protein                                    422   3e-139   
gb|AFW88100.1|  hypothetical protein ZEAMMB73_767703                    424   3e-139   
ref|XP_002514627.1|  hypothetical protein RCOM_1468720                  441   3e-139   
gb|AFK33956.1|  unknown                                                 422   4e-139   
emb|CBI15331.3|  unnamed protein product                                437   1e-138   
gb|KHN19596.1|  COBRA-like protein 4                                    421   1e-138   
sp|Q6Z4G7.1|COBL6_ORYSJ  RecName: Full=COBRA-like protein 6; AltN...    421   2e-138   
emb|CDP21871.1|  unnamed protein product                                418   3e-138   
gb|KHN03079.1|  COBRA-like protein 4                                    421   3e-138   
ref|XP_003522282.1|  PREDICTED: COBRA-like protein 4-like isoform X1    420   4e-138   
ref|XP_003528239.1|  PREDICTED: COBRA-like protein 4-like               420   5e-138   
ref|XP_002987954.1|  hypothetical protein SELMODRAFT_271954             419   6e-138   
ref|XP_006593701.1|  PREDICTED: protein COBRA-like isoform X2           417   1e-137   
gb|KCW48930.1|  hypothetical protein EUGRSUZ_K02543                     417   1e-137   
ref|NP_001050366.1|  Os03g0416200                                       419   2e-137   
ref|XP_002991329.1|  hypothetical protein SELMODRAFT_133233             417   2e-137   
ref|XP_006657931.1|  PREDICTED: COBRA-like protein 6-like               417   2e-137   
gb|EAZ27328.1|  hypothetical protein OsJ_11270                          417   3e-137   
emb|CAC01762.1|  putative phytochelatin synthetase                      415   5e-137   
gb|EYU44224.1|  hypothetical protein MIMGU_mgv1a019628mg                416   7e-137   
ref|XP_010039079.1|  PREDICTED: COBRA-like protein 4                    417   8e-137   
ref|XP_006373387.1|  hypothetical protein POPTR_0017s13310g             414   8e-137   
gb|KHG18541.1|  COBRA-like protein 4                                    413   3e-136   
ref|XP_007138375.1|  hypothetical protein PHAVU_009G203200g             415   4e-136   
ref|XP_002467689.1|  hypothetical protein SORBIDRAFT_01g032480          414   6e-136   
ref|XP_004981736.1|  PREDICTED: COBRA-like protein 3-like               413   8e-136   
gb|KEH39624.1|  COBRA-like protein 2 precursor                          412   2e-135   
gb|AFZ78570.1|  COBRA-like protein                                      412   3e-135   
gb|KEH21750.1|  COBRA-like protein 2 precursor                          411   3e-135   
ref|XP_009606715.1|  PREDICTED: COBRA-like protein 4                    410   4e-135   
ref|XP_003562730.1|  PREDICTED: COBRA-like protein 6                    412   5e-135   
ref|XP_004984022.1|  PREDICTED: COBRA-like protein 5-like               411   1e-134   
ref|XP_011010808.1|  PREDICTED: COBRA-like protein 4                    409   2e-134   
ref|XP_001778885.1|  predicted protein                                  409   5e-134   
ref|XP_006373386.1|  hypothetical protein POPTR_0017s13300g             406   2e-133   
ref|XP_010031041.1|  PREDICTED: COBRA-like protein 4 isoform X2         402   2e-132   
ref|XP_004301102.1|  PREDICTED: COBRA-like protein 4-like               405   2e-132   
gb|AAG12670.1|AC027033_5  unknown protein; 31818-33764                  403   3e-132   
ref|XP_010663467.1|  PREDICTED: COBRA-like protein 4 isoform X2         402   4e-132   
ref|XP_006827863.1|  hypothetical protein AMTR_s00008p00083860          399   5e-131   
ref|XP_006602955.1|  PREDICTED: protein COBRA-like                      399   2e-130   
gb|KHN37929.1|  Protein COBRA                                           397   6e-130   
ref|XP_004958243.1|  PREDICTED: COBRA-like protein 6-like isoform X2    396   8e-130   
gb|AAB60732.1|  F21M12.17 gene product                                  398   1e-129   
gb|EYU34591.1|  hypothetical protein MIMGU_mgv1a006208mg                398   1e-129   
ref|XP_004137604.1|  PREDICTED: COBRA-like protein 4-like               396   2e-129   
gb|KGN64072.1|  hypothetical protein Csa_1G039860                       396   3e-129   
ref|XP_008240110.1|  PREDICTED: COBRA-like protein 4                    395   7e-129   
ref|XP_007210248.1|  hypothetical protein PRUPE_ppa014838mg             394   2e-128   
ref|XP_001766389.1|  predicted protein                                  394   4e-128   
ref|XP_007139436.1|  hypothetical protein PHAVU_008G029200g             392   5e-128   
gb|AFK41534.1|  unknown                                                 392   7e-128   
gb|EAZ04638.1|  hypothetical protein OsI_26786                          395   7e-128   
ref|XP_006856415.1|  hypothetical protein AMTR_s00047p00217040          389   1e-127   
ref|XP_002318574.2|  hypothetical protein POPTR_0012s05940g             389   5e-127   
gb|AAF24189.1|AF160475_1  phytochelatin synthetase-like protein         388   2e-126   
ref|XP_010099318.1|  hypothetical protein L484_018180                   388   2e-126   
ref|XP_007151373.1|  hypothetical protein PHAVU_004G041300g             387   9e-126   
ref|XP_011021064.1|  PREDICTED: COBRA-like protein 1                    385   3e-125   
ref|XP_001760765.1|  predicted protein                                  386   8e-125   
ref|XP_002964476.1|  hypothetical protein SELMODRAFT_405727             385   8e-125   
ref|XP_009122873.1|  PREDICTED: COBRA-like protein 4                    384   1e-124   
emb|CAA07251.1|  putative phytochelatin synthetase                      382   1e-124   
ref|XP_002975319.1|  hypothetical protein SELMODRAFT_174860             384   4e-124   
ref|XP_010257981.1|  PREDICTED: protein COBRA-like isoform X2           381   6e-124   
gb|KEH25133.1|  COBRA-like protein 2 precursor                          377   1e-122   
ref|XP_008445923.1|  PREDICTED: COBRA-like protein 4                    377   5e-122   
ref|XP_004309891.1|  PREDICTED: protein COBRA-like                      375   5e-121   
gb|EAY79078.1|  hypothetical protein OsI_34187                          368   2e-118   
ref|XP_006578523.1|  PREDICTED: COBRA-like protein 4-like isoform X2    365   6e-118   
ref|XP_006345207.1|  PREDICTED: uncharacterized protein LOC102589523    385   8e-118   
ref|XP_006852065.1|  hypothetical protein AMTR_s00041p00228050          367   1e-117   
gb|AFK36034.1|  unknown                                                 362   2e-117   



>ref|XP_009776069.1| PREDICTED: COBRA-like protein 6 isoform X1 [Nicotiana sylvestris]
Length=433

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/399 (72%), Positives = 333/399 (83%), Gaps = 6/399 (2%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             +GYDPLDPNG+ITIKWDI+  N+ +Q V VSI+NYQL+RHID PGWKLSW W G+ VIWD
Sbjct  19    NGYDPLDPNGNITIKWDIMLNNEGSQDVKVSIFNYQLFRHIDQPGWKLSWSWPGNEVIWD  78

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GAEATEQG+CSA K+ Q PHCCEKEPVI+DLLPG  +NKQ  NCCKGGVL+S+TQDPE
Sbjct  79    MSGAEATEQGDCSAIKATQPPHCCEKEPVIVDLLPGAPYNKQVANCCKGGVLTSLTQDPE  138

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPGYTCGEAFEVPPTKFVEDHGRRT  788
             KY AAFQM+IG  S   S            NFTLG+PGY+CG+ F+VPP+KF  D GRR 
Sbjct  139   KYGAAFQMNIGSASYNGSEPRLPE------NFTLGIPGYSCGDPFKVPPSKFNVDQGRRK  192

Query  789   TQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAGE  968
             TQAV TWN+ CSYSQFRA SSPTCCVSLS FYN TIV CP C+CGC+GQ G+ +C+K GE
Sbjct  193   TQAVATWNVICSYSQFRASSSPTCCVSLSAFYNNTIVPCPKCSCGCQGQLGADQCVKYGE  252

Query  969   QPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQWNL  1148
              PPV+QL H EPP+ +VQC+QHMCPI++HWHVK SYT++WRVK+TI N N+ KN+SQWNL
Sbjct  253   LPPVLQLDHNEPPKPVVQCSQHMCPIQIHWHVKQSYTKYWRVKMTIRNLNYVKNYSQWNL  312

Query  1149  VVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTELLMNK  1328
             VVLHPNL +VT+VFSFNY+ LNQYGD NDTGMFYGI+YYND+LLQAGE GNVQ+ELLM+K
Sbjct  313   VVLHPNLRSVTQVFSFNYKPLNQYGDTNDTGMFYGIEYYNDMLLQAGETGNVQSELLMHK  372

Query  1329  DPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             D   FTFREGWAFPR+ISFNGE+CVLP PDDYPRLPNS+
Sbjct  373   DAGIFTFREGWAFPRKISFNGEDCVLPSPDDYPRLPNSS  411



>ref|XP_009602799.1| PREDICTED: COBRA-like protein 6 isoform X1 [Nicotiana tomentosiformis]
Length=434

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/398 (71%), Positives = 328/398 (82%), Gaps = 6/398 (2%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDM  431
             GYDPLDPNG+ITIKWDI+  N+ +Q V VSI+NYQL+RHID PGWKLSW W G+ VIWDM
Sbjct  20    GYDPLDPNGNITIKWDIMLNNEGSQDVKVSIFNYQLFRHIDQPGWKLSWSWPGNEVIWDM  79

Query  432   WGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEK  611
              GAEATEQG+CSA K+ Q PHCCEKEPVI+DLL G  +NKQ  NCC+GGVL+S+TQDP K
Sbjct  80    SGAEATEQGDCSAIKATQPPHCCEKEPVIVDLLSGAPYNKQVANCCRGGVLTSLTQDPGK  139

Query  612   YLAAFQMsigrvssksssgaavaappipgNFTLGVPGYTCGEAFEVPPTKFVEDHGRRTT  791
             Y A+FQM+IG  S   S            NFTLG+PGYTCG+ F+VPP+KF  D GRR T
Sbjct  140   YGASFQMNIGSASYNGSEPRVPE------NFTLGIPGYTCGDPFKVPPSKFNVDQGRRKT  193

Query  792   QAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAGEQ  971
             QA+ TWN+ CSYSQFRA SSPTCCVSLS FYN TIV CP C+CGC+GQ G+  C+K GE 
Sbjct  194   QAIATWNVICSYSQFRASSSPTCCVSLSAFYNNTIVPCPKCSCGCQGQLGADHCVKYGEL  253

Query  972   PPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQWNLV  1151
             PPV+QL H EPP+ +VQC+ HMCPI++HWHVK SYTQ+WRVK+TI N N+ KN+SQWNLV
Sbjct  254   PPVLQLDHNEPPKPVVQCSHHMCPIQIHWHVKQSYTQYWRVKMTIRNLNYVKNYSQWNLV  313

Query  1152  VLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTELLMNKD  1331
             VLHPNL +VT+VFSFNY+ LNQYGD NDTGMFYGI+YYND+LLQAGE GNVQ+ELLM+KD
Sbjct  314   VLHPNLRSVTQVFSFNYKPLNQYGDTNDTGMFYGIEYYNDMLLQAGETGNVQSELLMHKD  373

Query  1332  PATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
                FTFREGWAFPR+ISFNGE+CVLP PDDYPRLPNS+
Sbjct  374   EGIFTFREGWAFPRKISFNGEDCVLPSPDDYPRLPNSS  411



>ref|XP_011087711.1| PREDICTED: COBRA-like protein 6 isoform X2 [Sesamum indicum]
Length=424

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/400 (70%), Positives = 327/400 (82%), Gaps = 10/400 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGND-ANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIW  425
             DGYDPLDPNG++TI+WD+++ ND   Q V ++I NYQL+RH++ PGWKLSW+W G+ VIW
Sbjct  9     DGYDPLDPNGNLTIRWDVLQQNDDGTQDVRLTIVNYQLFRHVELPGWKLSWKWPGNEVIW  68

Query  426   DMWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDP  605
             ++ GAEAT+QG+CS FK  Q PHCCEKEPVIIDLLPG  +NKQ  NCCKGGVLSSM QDP
Sbjct  69    NILGAEATDQGDCSVFKGKQLPHCCEKEPVIIDLLPGAPYNKQVANCCKGGVLSSMMQDP  128

Query  606   EKYLAAFQMsigrvssksssgaavaappipgNFTLGVPGYTCGEAFEVPPTKFVEDHGRR  785
              KYLAAFQM IG  S  S              FTLG+PGYTCGE F+VPPTKF ED GRR
Sbjct  129   GKYLAAFQMHIGSASDSSVPRLPA-------RFTLGLPGYTCGEPFKVPPTKFFEDQGRR  181

Query  786   TTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAG  965
              TQA+ TW++TCSYSQFRA S+PTCCVSLS FYN TIV CP C+C C G    A C+K G
Sbjct  182   RTQALATWDVTCSYSQFRASSAPTCCVSLSAFYNNTIVPCPKCSCACHGD--GAGCVKPG  239

Query  966   EQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQWN  1145
             + PPV+QL+H EPP+ +VQC+ HMCPIRVHWHVKLSYTQ+WRVKIT+TN N+ KN+S+WN
Sbjct  240   KLPPVLQLEHNEPPKPVVQCSDHMCPIRVHWHVKLSYTQYWRVKITVTNLNYVKNYSEWN  299

Query  1146  LVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTELLMN  1325
             LVVLHPNL +VT+VFSFNY+ LN YG+INDTGM YGIQYYND+LLQ GE GNVQTE+L++
Sbjct  300   LVVLHPNLRSVTQVFSFNYKPLNIYGNINDTGMLYGIQYYNDMLLQTGESGNVQTEMLLH  359

Query  1326  KDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             KDP  FTF+EGWAFPR+ISFNGEECV+P PDDYPRLPN+A
Sbjct  360   KDPGIFTFKEGWAFPRKISFNGEECVMPSPDDYPRLPNTA  399



>ref|XP_011087710.1| PREDICTED: COBRA-like protein 6 isoform X1 [Sesamum indicum]
Length=452

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/400 (70%), Positives = 327/400 (82%), Gaps = 10/400 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGND-ANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIW  425
             DGYDPLDPNG++TI+WD+++ ND   Q V ++I NYQL+RH++ PGWKLSW+W G+ VIW
Sbjct  37    DGYDPLDPNGNLTIRWDVLQQNDDGTQDVRLTIVNYQLFRHVELPGWKLSWKWPGNEVIW  96

Query  426   DMWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDP  605
             ++ GAEAT+QG+CS FK  Q PHCCEKEPVIIDLLPG  +NKQ  NCCKGGVLSSM QDP
Sbjct  97    NILGAEATDQGDCSVFKGKQLPHCCEKEPVIIDLLPGAPYNKQVANCCKGGVLSSMMQDP  156

Query  606   EKYLAAFQMsigrvssksssgaavaappipgNFTLGVPGYTCGEAFEVPPTKFVEDHGRR  785
              KYLAAFQM IG  S  S              FTLG+PGYTCGE F+VPPTKF ED GRR
Sbjct  157   GKYLAAFQMHIGSASDSSVPRLPA-------RFTLGLPGYTCGEPFKVPPTKFFEDQGRR  209

Query  786   TTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAG  965
              TQA+ TW++TCSYSQFRA S+PTCCVSLS FYN TIV CP C+C C G    A C+K G
Sbjct  210   RTQALATWDVTCSYSQFRASSAPTCCVSLSAFYNNTIVPCPKCSCACHGD--GAGCVKPG  267

Query  966   EQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQWN  1145
             + PPV+QL+H EPP+ +VQC+ HMCPIRVHWHVKLSYTQ+WRVKIT+TN N+ KN+S+WN
Sbjct  268   KLPPVLQLEHNEPPKPVVQCSDHMCPIRVHWHVKLSYTQYWRVKITVTNLNYVKNYSEWN  327

Query  1146  LVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTELLMN  1325
             LVVLHPNL +VT+VFSFNY+ LN YG+INDTGM YGIQYYND+LLQ GE GNVQTE+L++
Sbjct  328   LVVLHPNLRSVTQVFSFNYKPLNIYGNINDTGMLYGIQYYNDMLLQTGESGNVQTEMLLH  387

Query  1326  KDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             KDP  FTF+EGWAFPR+ISFNGEECV+P PDDYPRLPN+A
Sbjct  388   KDPGIFTFKEGWAFPRKISFNGEECVMPSPDDYPRLPNTA  427



>emb|CDO97585.1| unnamed protein product [Coffea canephora]
Length=433

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/398 (69%), Positives = 328/398 (82%), Gaps = 6/398 (2%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             D YDPLDP G++TIKWD+++ ND  Q V VSI+NYQL+RH++ PGWKLSW W G+GVIWD
Sbjct  17    DAYDPLDPRGNVTIKWDLMQDNDGTQDVRVSIFNYQLFRHVEPPGWKLSWIWPGNGVIWD  76

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             +WGAEATEQGNCSAF+  Q PH CEK+PVI+DLLPG  +NKQ  NCCKGGVL+S++QD  
Sbjct  77    IWGAEATEQGNCSAFRGRQLPHSCEKKPVIVDLLPGAPYNKQVANCCKGGVLTSLSQDQA  136

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPGYTCGEAFEVPPTKFVEDHGRRT  788
             K+ A+FQM+IG  S        V A     NF+LG+PGYTCG+ F+VPP+KF+ED GRR 
Sbjct  137   KFGASFQMNIGSSSVNGGPIPGVPA-----NFSLGLPGYTCGDPFKVPPSKFIEDQGRRR  191

Query  789   TQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAGE  968
             TQA+GTWN+TCSYSQFRA  SPTCCVSLS FYN TIV CP C+C C GQPG AKC+K GE
Sbjct  192   TQALGTWNVTCSYSQFRASVSPTCCVSLSAFYNDTIVHCPKCSCSCLGQPG-AKCVKPGE  250

Query  969   QPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQWNL  1148
              PPV+Q+Q  + P+ +V CT HMCPIRVHWHVKLSYTQ+WRVK+T+TN N  KN+SQWNL
Sbjct  251   LPPVLQVQQDQEPEPVVLCTHHMCPIRVHWHVKLSYTQYWRVKLTVTNLNLVKNYSQWNL  310

Query  1149  VVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTELLMNK  1328
             VVLHPNL N+T+VFSFNY+ LN YG INDTGMFYGIQYYND+LLQ+GE GNVQTELL+ K
Sbjct  311   VVLHPNLRNITQVFSFNYKPLNPYGQINDTGMFYGIQYYNDMLLQSGESGNVQTELLLRK  370

Query  1329  DPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNS  1442
             DP  FTFR GWAFPR++SFNGE+CV+P PD++PRLPN+
Sbjct  371   DPGLFTFRNGWAFPRKVSFNGEDCVMPLPDEFPRLPNA  408



>ref|XP_009776070.1| PREDICTED: COBRA-like protein 6 isoform X2 [Nicotiana sylvestris]
Length=397

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/378 (71%), Positives = 314/378 (83%), Gaps = 6/378 (2%)
 Frame = +3

Query  312   NDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDMWGAEATEQGNCSAFKSGQRP  491
             N+ +Q V VSI+NYQL+RHID PGWKLSW W G+ VIWDM GAEATEQG+CSA K+ Q P
Sbjct  4     NEGSQDVKVSIFNYQLFRHIDQPGWKLSWSWPGNEVIWDMSGAEATEQGDCSAIKATQPP  63

Query  492   HCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEKYLAAFQMsigrvssksssga  671
             HCCEKEPVI+DLLPG  +NKQ  NCCKGGVL+S+TQDPEKY AAFQM+IG  S   S   
Sbjct  64    HCCEKEPVIVDLLPGAPYNKQVANCCKGGVLTSLTQDPEKYGAAFQMNIGSASYNGSEPR  123

Query  672   avaappipgNFTLGVPGYTCGEAFEVPPTKFVEDHGRRTTQAVGTWNITCSYSQFRAQSS  851
                      NFTLG+PGY+CG+ F+VPP+KF  D GRR TQAV TWN+ CSYSQFRA SS
Sbjct  124   LPE------NFTLGIPGYSCGDPFKVPPSKFNVDQGRRKTQAVATWNVICSYSQFRASSS  177

Query  852   PTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAGEQPPVVQLQHYEPPQAIVQCTQ  1031
             PTCCVSLS FYN TIV CP C+CGC+GQ G+ +C+K GE PPV+QL H EPP+ +VQC+Q
Sbjct  178   PTCCVSLSAFYNNTIVPCPKCSCGCQGQLGADQCVKYGELPPVLQLDHNEPPKPVVQCSQ  237

Query  1032  HMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQWNLVVLHPNLGNVTRVFSFNYRTL  1211
             HMCPI++HWHVK SYT++WRVK+TI N N+ KN+SQWNLVVLHPNL +VT+VFSFNY+ L
Sbjct  238   HMCPIQIHWHVKQSYTKYWRVKMTIRNLNYVKNYSQWNLVVLHPNLRSVTQVFSFNYKPL  297

Query  1212  NQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTELLMNKDPATFTFREGWAFPRRISFNG  1391
             NQYGD NDTGMFYGI+YYND+LLQAGE GNVQ+ELLM+KD   FTFREGWAFPR+ISFNG
Sbjct  298   NQYGDTNDTGMFYGIEYYNDMLLQAGETGNVQSELLMHKDAGIFTFREGWAFPRKISFNG  357

Query  1392  EECVLPQPDDYPRLPNSA  1445
             E+CVLP PDDYPRLPNS+
Sbjct  358   EDCVLPSPDDYPRLPNSS  375



>ref|XP_006349429.1| PREDICTED: COBRA-like protein 6-like [Solanum tuberosum]
Length=427

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/397 (65%), Positives = 314/397 (79%), Gaps = 6/397 (2%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             DGYDP+DP G+ITI+WD+    + N  + VSI+NYQL+RH++ PGWKLSW W G  VIW 
Sbjct  13    DGYDPMDPMGNITIRWDVTTSTEVNHQIRVSIFNYQLFRHVEQPGWKLSWDWHGKEVIWQ  72

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             MWGAE TEQG+CSA K    PHCC KEPVI+DLLPG  +NKQ  NCCKGGVL+S+TQDPE
Sbjct  73    MWGAETTEQGDCSAIKGDTPPHCCLKEPVILDLLPGAPYNKQVANCCKGGVLTSLTQDPE  132

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPGYTCGEAFEVPPTKFVEDHGRRT  788
             KY+++F+MSIG   +  S            NFTLG+PGYTCG A ++PPTKF ED GRR 
Sbjct  133   KYVSSFEMSIGSALNDGSGPRMPE------NFTLGIPGYTCGVAVKIPPTKFHEDQGRRQ  186

Query  789   TQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAGE  968
             TQAV TW++ CSYSQFRA SSP CCVSLS FY++TIV C +C+CGC+GQ G+A+C+K GE
Sbjct  187   TQAVATWDVICSYSQFRASSSPACCVSLSAFYSETIVPCSVCSCGCQGQRGAAQCVKRGE  246

Query  969   QPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQWNL  1148
              PPV+QL H EPP  I++CT+HMCPI+VHWHVK SY ++WRVK+TI N N  +N+SQWNL
Sbjct  247   VPPVLQLGHNEPPTPILECTRHMCPIQVHWHVKQSYREYWRVKMTIRNLNLVRNYSQWNL  306

Query  1149  VVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTELLMNK  1328
             VVLHPNL ++T+VFSF+Y  L+QYGDINDTGMFYGI+YYND+LLQAG  G VQ+ELL++K
Sbjct  307   VVLHPNLRSITQVFSFDYMPLDQYGDINDTGMFYGIKYYNDMLLQAGRSGVVQSELLLHK  366

Query  1329  DPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPN  1439
             D   FTF EGW FPR+ISFNG ECVLP PD YP LPN
Sbjct  367   DAGIFTFNEGWMFPRKISFNGYECVLPSPDKYPMLPN  403



>ref|XP_009602800.1| PREDICTED: COBRA-like protein 6 isoform X2 [Nicotiana tomentosiformis]
Length=398

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/378 (70%), Positives = 310/378 (82%), Gaps = 6/378 (2%)
 Frame = +3

Query  312   NDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDMWGAEATEQGNCSAFKSGQRP  491
             N+ +Q V VSI+NYQL+RHID PGWKLSW W G+ VIWDM GAEATEQG+CSA K+ Q P
Sbjct  4     NEGSQDVKVSIFNYQLFRHIDQPGWKLSWSWPGNEVIWDMSGAEATEQGDCSAIKATQPP  63

Query  492   HCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEKYLAAFQMsigrvssksssga  671
             HCCEKEPVI+DLL G  +NKQ  NCC+GGVL+S+TQDP KY A+FQM+IG  S   S   
Sbjct  64    HCCEKEPVIVDLLSGAPYNKQVANCCRGGVLTSLTQDPGKYGASFQMNIGSASYNGSEPR  123

Query  672   avaappipgNFTLGVPGYTCGEAFEVPPTKFVEDHGRRTTQAVGTWNITCSYSQFRAQSS  851
                      NFTLG+PGYTCG+ F+VPP+KF  D GRR TQA+ TWN+ CSYSQFRA SS
Sbjct  124   VPE------NFTLGIPGYTCGDPFKVPPSKFNVDQGRRKTQAIATWNVICSYSQFRASSS  177

Query  852   PTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAGEQPPVVQLQHYEPPQAIVQCTQ  1031
             PTCCVSLS FYN TIV CP C+CGC+GQ G+  C+K GE PPV+QL H EPP+ +VQC+ 
Sbjct  178   PTCCVSLSAFYNNTIVPCPKCSCGCQGQLGADHCVKYGELPPVLQLDHNEPPKPVVQCSH  237

Query  1032  HMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQWNLVVLHPNLGNVTRVFSFNYRTL  1211
             HMCPI++HWHVK SYTQ+WRVK+TI N N+ KN+SQWNLVVLHPNL +VT+VFSFNY+ L
Sbjct  238   HMCPIQIHWHVKQSYTQYWRVKMTIRNLNYVKNYSQWNLVVLHPNLRSVTQVFSFNYKPL  297

Query  1212  NQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTELLMNKDPATFTFREGWAFPRRISFNG  1391
             NQYGD NDTGMFYGI+YYND+LLQAGE GNVQ+ELLM+KD   FTFREGWAFPR+ISFNG
Sbjct  298   NQYGDTNDTGMFYGIEYYNDMLLQAGETGNVQSELLMHKDEGIFTFREGWAFPRKISFNG  357

Query  1392  EECVLPQPDDYPRLPNSA  1445
             E+CVLP PDDYPRLPNS+
Sbjct  358   EDCVLPSPDDYPRLPNSS  375



>ref|XP_010314626.1| PREDICTED: COBRA-like protein 6 isoform X1 [Solanum lycopersicum]
Length=455

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/404 (65%), Positives = 315/404 (78%), Gaps = 10/404 (2%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDM  431
             GYDP+DP G+ITI+WD+    + N  + VSI+NYQL+RH++ PGWKLSW W G  VIW M
Sbjct  42    GYDPMDPMGNITIRWDVTTSTENNHHIRVSIFNYQLFRHVEQPGWKLSWDWHGKEVIWQM  101

Query  432   WGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEK  611
             WGAE TEQG+CSA K    PHCC KEPVI+DLLPG  +NKQ  NCCKGGVL+S+TQDPEK
Sbjct  102   WGAETTEQGDCSAIKGDTLPHCCLKEPVILDLLPGAPYNKQVANCCKGGVLTSLTQDPEK  161

Query  612   YLAAFQMsigrvssksssgaavaappipgNFTLGVPGYTCGEAFEVPPTKFVEDHGRRTT  791
             Y+++F+M I   S+  S            NFTLG+PGYTCG A +VPPTKF ED GRR T
Sbjct  162   YVSSFEMIIASASNDGSGPRMPE------NFTLGIPGYTCGVAVKVPPTKFHEDQGRRQT  215

Query  792   QAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAGEQ  971
             QAV TW++ CSYSQFRA SSP CCVSLS FY++TIV C +C+CGC+GQ G+A+C+K GE 
Sbjct  216   QAVATWDVICSYSQFRASSSPACCVSLSAFYSETIVPCSVCSCGCQGQRGAAQCVKRGEV  275

Query  972   PPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQWNLV  1151
             PPV+QL H E P  I++CT+HMCPI+VHWHVK SY ++WRVK+TI N N  +N+SQWNLV
Sbjct  276   PPVLQLGHNELPTPILECTRHMCPIQVHWHVKQSYREYWRVKMTIRNLNLVRNYSQWNLV  335

Query  1152  VLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTELLMNKD  1331
             VLHPNL ++T+VFSF+Y+ L+QYGDINDTGMFYGI+YYND+LLQAG  G VQ+ELL++KD
Sbjct  336   VLHPNLRSITQVFSFDYKPLDQYGDINDTGMFYGIKYYNDMLLQAGRSGVVQSELLLHKD  395

Query  1332  PATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPN----SAPP  1451
                FTF EGW FPR+ISFNG ECVLP PD YP LPN     APP
Sbjct  396   AGIFTFNEGWMFPRKISFNGYECVLPSPDKYPMLPNISQFLAPP  439



>ref|XP_006471247.1| PREDICTED: COBRA-like protein 6-like [Citrus sinensis]
Length=434

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/401 (66%), Positives = 316/401 (79%), Gaps = 10/401 (2%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDM  431
             GYDPLDP+G+ITIKWD+++ N  +  + VS++NYQLYRHID PGWKL+W W+GD VIW+M
Sbjct  21    GYDPLDPHGNITIKWDLMQSNSGSSDLRVSLFNYQLYRHIDQPGWKLNWGWQGDEVIWNM  80

Query  432   WGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEK  611
             WGAEATEQGNCS F  GQ PHCCEK PVI+DLLPG  +N+Q  NCCKGGVLSS+TQDP K
Sbjct  81    WGAEATEQGNCSKFTGGQLPHCCEKSPVIVDLLPGAPYNQQTANCCKGGVLSSLTQDPSK  140

Query  612   YLAAFQMsigrvssksssgaavaappipgNFTLGVPGYTCGEAFEVPPTKFVEDHGRRTT  791
             ++A FQM++G  +  +             NFTLG+PGYTCG A EVPP+KF  D GRR T
Sbjct  141   FVAGFQMNVGGSADYTGFQMPE-------NFTLGIPGYTCGNATEVPPSKFYSDGGRRRT  193

Query  792   QAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAGEQ  971
             QA+ TWN+TC YSQF A S+P CCVSLS FYN TIV CP C+C C+G    A C+K GE 
Sbjct  194   QALRTWNVTCIYSQFMASSNPKCCVSLSAFYNNTIVPCPKCSCHCQGL-SPANCIKYGET  252

Query  972   PPVVQLQH--YEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQWN  1145
             P ++Q +H   +    +V C+QHMCP+RVHWHVK SYTQ+WRVKITITN N  +N+SQWN
Sbjct  253   PSLLQQKHDPNKEQSPVVICSQHMCPVRVHWHVKQSYTQYWRVKITITNLNVVQNYSQWN  312

Query  1146  LVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTELLMN  1325
             LV LHPNL +VT+VFSFNY+ LNQYG INDTGMF+GI++YND+LLQAGE GNVQTE+L++
Sbjct  313   LVALHPNLQSVTQVFSFNYKPLNQYGYINDTGMFWGIEFYNDMLLQAGESGNVQTEMLLH  372

Query  1326  KDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             KD   FTFREGW FPRRI FNG+ECV+P PDDYPRLPN+AP
Sbjct  373   KDSGIFTFREGWGFPRRILFNGDECVMPLPDDYPRLPNNAP  413



>gb|EYU26510.1| hypothetical protein MIMGU_mgv1a004710mg [Erythranthe guttata]
Length=441

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/400 (66%), Positives = 314/400 (79%), Gaps = 10/400 (3%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEG-NDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             GYDPLDPNG+ITI+WD+++   DA+  V +SI NYQL+RHID PGWKLSW WR + VIW 
Sbjct  24    GYDPLDPNGNITIRWDVLQKPADAHHDVRLSIVNYQLFRHIDFPGWKLSWTWRNEEVIWS  83

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             + GAE TEQG+CS F  G  PHCCEK+PVIIDLLP   FNKQ  NCC+ G+LSSM QD  
Sbjct  84    ITGAETTEQGDCSKFTGGSLPHCCEKKPVIIDLLPNAPFNKQVSNCCRSGILSSMLQDSV  143

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPGYTCGEAFEVPPTKFVEDHGRRT  788
              Y++AFQM+IG   +  +            NFTLGVPGYTCG+ F VPPTKF EDHGRR+
Sbjct  144   NYISAFQMNIGSADTNLNISLPT-------NFTLGVPGYTCGDPFRVPPTKFPEDHGRRS  196

Query  789   TQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAGE  968
             TQA  TWN+TCSYSQ++A S PTCCVSLS FYN TIV CP C+C C+GQ G AKC+K GE
Sbjct  197   TQAFATWNVTCSYSQYKASSVPTCCVSLSAFYNSTIVDCPKCSCACQGQTG-AKCVKPGE  255

Query  969   QPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQWNL  1148
              PPV+ L H   P+ +V C+ HMCPI+VHWHVK SYTQ+WRVKIT+TN N A+N+SQW+L
Sbjct  256   SPPVLHLGHNGVPKPVVDCSSHMCPIKVHWHVKQSYTQYWRVKITVTNLNHARNYSQWDL  315

Query  1149  VVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTELLMNK  1328
             VVLHPNL N+T+VFSFNY+ LN YG+INDTG+FYGI+YYND+LLQ+GE GNVQ+ELLM K
Sbjct  316   VVLHPNLDNITQVFSFNYKPLNIYGNINDTGVFYGIKYYNDMLLQSGENGNVQSELLMQK  375

Query  1329  DPAT-FTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             D  T F+F  GW FPR+ISFNG+ECV+PQPDDYPR PN A
Sbjct  376   DSGTKFSFNGGWGFPRKISFNGDECVMPQPDDYPRSPNKA  415



>gb|EYU26509.1| hypothetical protein MIMGU_mgv1a004710mg [Erythranthe guttata]
Length=513

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/400 (66%), Positives = 314/400 (79%), Gaps = 10/400 (3%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEG-NDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             GYDPLDPNG+ITI+WD+++   DA+  V +SI NYQL+RHID PGWKLSW WR + VIW 
Sbjct  96    GYDPLDPNGNITIRWDVLQKPADAHHDVRLSIVNYQLFRHIDFPGWKLSWTWRNEEVIWS  155

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             + GAE TEQG+CS F  G  PHCCEK+PVIIDLLP   FNKQ  NCC+ G+LSSM QD  
Sbjct  156   ITGAETTEQGDCSKFTGGSLPHCCEKKPVIIDLLPNAPFNKQVSNCCRSGILSSMLQDSV  215

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPGYTCGEAFEVPPTKFVEDHGRRT  788
              Y++AFQM+IG   +  +            NFTLGVPGYTCG+ F VPPTKF EDHGRR+
Sbjct  216   NYISAFQMNIGSADTNLNISLPT-------NFTLGVPGYTCGDPFRVPPTKFPEDHGRRS  268

Query  789   TQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAGE  968
             TQA  TWN+TCSYSQ++A S PTCCVSLS FYN TIV CP C+C C+GQ G AKC+K GE
Sbjct  269   TQAFATWNVTCSYSQYKASSVPTCCVSLSAFYNSTIVDCPKCSCACQGQTG-AKCVKPGE  327

Query  969   QPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQWNL  1148
              PPV+ L H   P+ +V C+ HMCPI+VHWHVK SYTQ+WRVKIT+TN N A+N+SQW+L
Sbjct  328   SPPVLHLGHNGVPKPVVDCSSHMCPIKVHWHVKQSYTQYWRVKITVTNLNHARNYSQWDL  387

Query  1149  VVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTELLMNK  1328
             VVLHPNL N+T+VFSFNY+ LN YG+INDTG+FYGI+YYND+LLQ+GE GNVQ+ELLM K
Sbjct  388   VVLHPNLDNITQVFSFNYKPLNIYGNINDTGVFYGIKYYNDMLLQSGENGNVQSELLMQK  447

Query  1329  DPAT-FTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             D  T F+F  GW FPR+ISFNG+ECV+PQPDDYPR PN A
Sbjct  448   DSGTKFSFNGGWGFPRKISFNGDECVMPQPDDYPRSPNKA  487



>emb|CBI29736.3| unnamed protein product [Vitis vinifera]
Length=431

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/400 (65%), Positives = 317/400 (79%), Gaps = 8/400 (2%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             DGYDPLDPNG+I IKWD+++ + ++    VSI NYQLYRHI+ PGWKLSW W GD VIWD
Sbjct  19    DGYDPLDPNGNIAIKWDVLQWSSSSYDARVSIINYQLYRHIETPGWKLSWTWPGDEVIWD  78

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             MWGA A EQGNCS FK  Q P+CCEK P+I+D  PGT FNKQ  NCC+ G+L+SM QDP 
Sbjct  79    MWGALAHEQGNCSEFKGEQLPYCCEKTPLILDRGPGTPFNKQVANCCRDGLLTSMIQDPS  138

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPGYTCGEAFEVPPTKFVEDHGRRT  788
             K+ A FQM++G  SS  S            NF+LGVPGYTCG+ F+VPP++F E+ GRR 
Sbjct  139   KHGAMFQMNVGTASSNVSDMTMPR------NFSLGVPGYTCGDPFQVPPSRFPEEGGRRW  192

Query  789   TQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAGE  968
             TQA+ TWN++CSYSQF A ++PTCCVSLS FYN TIV CP C+CGCEG PG+ KC K GE
Sbjct  193   TQALMTWNVSCSYSQFLASTAPTCCVSLSAFYNSTIVPCPQCSCGCEGIPGT-KCAKPGE  251

Query  969   QPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQWNL  1148
              P ++     + P  +V+C++HMCPIRVHWHVK SY ++WRVKIT+TN N  KN+S WNL
Sbjct  252   TPLLLPQGDGQQPD-LVRCSRHMCPIRVHWHVKTSYREYWRVKITVTNLNLVKNYSAWNL  310

Query  1149  VVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTELLMNK  1328
             VVLHPNL ++T+VFSFNYR+LN++G INDTGMF+GIQYYN++LLQAGE GNVQTE+L++K
Sbjct  311   VVLHPNLQSITQVFSFNYRSLNEHGTINDTGMFWGIQYYNELLLQAGESGNVQTEMLLHK  370

Query  1329  DPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             DP  FTFREGWAFPR+ISFNG++CV+P PD+YPRLPN+ P
Sbjct  371   DPGIFTFREGWAFPRKISFNGDQCVMPSPDEYPRLPNTGP  410



>ref|XP_010658027.1| PREDICTED: COBRA-like protein 6 [Vitis vinifera]
Length=432

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/399 (64%), Positives = 316/399 (79%), Gaps = 8/399 (2%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDM  431
             GYDPLDPNG+I IKWD+++ + ++    VSI NYQLYRHI+ PGWKLSW W GD VIWDM
Sbjct  21    GYDPLDPNGNIAIKWDVLQWSSSSYDARVSIINYQLYRHIETPGWKLSWTWPGDEVIWDM  80

Query  432   WGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEK  611
             WGA A EQGNCS FK  Q P+CCEK P+I+D  PGT FNKQ  NCC+ G+L+SM QDP K
Sbjct  81    WGALAHEQGNCSEFKGEQLPYCCEKTPLILDRGPGTPFNKQVANCCRDGLLTSMIQDPSK  140

Query  612   YLAAFQMsigrvssksssgaavaappipgNFTLGVPGYTCGEAFEVPPTKFVEDHGRRTT  791
             + A FQM++G  SS  S            NF+LGVPGYTCG+ F+VPP++F E+ GRR T
Sbjct  141   HGAMFQMNVGTASSNVSDMTMPR------NFSLGVPGYTCGDPFQVPPSRFPEEGGRRWT  194

Query  792   QAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAGEQ  971
             QA+ TWN++CSYSQF A ++PTCCVSLS FYN TIV CP C+CGCEG PG+ KC K GE 
Sbjct  195   QALMTWNVSCSYSQFLASTAPTCCVSLSAFYNSTIVPCPQCSCGCEGIPGT-KCAKPGET  253

Query  972   PPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQWNLV  1151
             P ++     + P  +V+C++HMCPIRVHWHVK SY ++WRVKIT+TN N  KN+S WNLV
Sbjct  254   PLLLPQGDGQQPD-LVRCSRHMCPIRVHWHVKTSYREYWRVKITVTNLNLVKNYSAWNLV  312

Query  1152  VLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTELLMNKD  1331
             VLHPNL ++T+VFSFNYR+LN++G INDTGMF+GIQYYN++LLQAGE GNVQTE+L++KD
Sbjct  313   VLHPNLQSITQVFSFNYRSLNEHGTINDTGMFWGIQYYNELLLQAGESGNVQTEMLLHKD  372

Query  1332  PATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             P  FTFREGWAFPR+ISFNG++CV+P PD+YPRLPN+ P
Sbjct  373   PGIFTFREGWAFPRKISFNGDQCVMPSPDEYPRLPNTGP  411



>ref|XP_011028305.1| PREDICTED: COBRA-like protein 6 [Populus euphratica]
Length=430

 Score =   526 bits (1354),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 244/396 (62%), Positives = 305/396 (77%), Gaps = 10/396 (3%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDM  431
             G+DPLDP G+ITIKWD++  N     + VSIYN+Q YRH++ PGWKL+W W+G  VIW M
Sbjct  22    GFDPLDPYGNITIKWDLLLSNSGTNNLMVSIYNFQQYRHVEPPGWKLNWAWKGKEVIWSM  81

Query  432   WGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEK  611
              GAEATEQGNC+ FK    PHCCEKEP I+DLLPGT +N Q  NCCKGGVLSSM QDP K
Sbjct  82    QGAEATEQGNCTEFKESTLPHCCEKEPFIVDLLPGTNYNAQTQNCCKGGVLSSMKQDPSK  141

Query  612   YLAAFQMsigrvssksssgaavaappipgNFTLGVPGYTCGEAFEVPPTKFVEDHGRRTT  791
             Y+A FQM++G   + S             NFTLGVPGY+CG A +V P+++  D GRR T
Sbjct  142   YVATFQMAVGGSGTNSQFIMPE-------NFTLGVPGYSCGGAVKVEPSRYTTDGGRRWT  194

Query  792   QAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAGEQ  971
             QA+ TWN+TC YSQ  A  +P CCVSLS FYN+TIVSCP C+CGC+GQPG+ KC+K GE 
Sbjct  195   QALATWNVTCVYSQSLASPTPRCCVSLSAFYNQTIVSCPRCSCGCKGQPGT-KCVKYGET  253

Query  972   PPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQWNLV  1151
             PP+  L+  + P  +V+C++HMCPIRVHWH+K SY Q+WR K+T+TN++  KN+S+WNLV
Sbjct  254   PPL--LKQNQDPTPVVRCSEHMCPIRVHWHLKESYKQYWRAKMTVTNFHIMKNYSEWNLV  311

Query  1152  VLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTELLMNKD  1331
             VLHPNL ++T+VFSFNY  LN+YG INDTGMF+G+ +YND+LLQ G+ GN+QTE+L+ KD
Sbjct  312   VLHPNLQSLTQVFSFNYAPLNRYGYINDTGMFWGLPFYNDILLQEGKDGNLQTEILLRKD  371

Query  1332  PATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPN  1439
             P  FTFREGW FPR+I FNG+ECV+P PD+YP LPN
Sbjct  372   PGIFTFREGWGFPRKIQFNGDECVMPPPDEYPSLPN  407



>ref|XP_010030140.1| PREDICTED: COBRA-like protein 6 isoform X2 [Eucalyptus grandis]
 gb|KCW57103.1| hypothetical protein EUGRSUZ_I02750 [Eucalyptus grandis]
Length=443

 Score =   526 bits (1355),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 247/400 (62%), Positives = 315/400 (79%), Gaps = 5/400 (1%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDM  431
             GYDPLDPNG++TIKWDI++  D +  V VS++NYQL+RH++ PGW+LSW W GD VIW+M
Sbjct  24    GYDPLDPNGNLTIKWDIMKSEDTSYDVKVSLFNYQLFRHVEPPGWRLSWTWIGDEVIWNM  83

Query  432   WGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEK  611
             +GAEAT QGNCS FK GQ PH CEK+PVI+DLLPG  +N Q  NCCKGG+LSS+ QDP K
Sbjct  84    FGAEATLQGNCSRFK-GQLPHSCEKQPVIVDLLPGAPYNMQVANCCKGGILSSLIQDPSK  142

Query  612   YLAAFQMsigrvssksssgaavaappipgNFTLGVPGYTCGEAFEVPPTKFVEDHGRRTT  791
             Y A F M++G  S+  +  A  A      NFT+ +PGYTCG   EVPP++F  D GRR T
Sbjct  143   YGAGFLMTVGAASTFDAGHAPSAYSIPA-NFTVKLPGYTCGPPLEVPPSRFPSDSGRRWT  201

Query  792   QAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAGEQ  971
             QA+GTWN+TC +SQFRA  +P CCVSLS FYN TIV CP C+C C+G PG+ +C  + + 
Sbjct  202   QAIGTWNVTCIFSQFRASLTPKCCVSLSAFYNSTIVPCPTCSCRCQGLPGT-RCTNSSKV  260

Query  972   PPVVQLQH--YEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQWN  1145
             P ++QL H   E    +V C+QHMCPI+VHWHVK SY ++WRVK+TI+N+NFAKN+SQW+
Sbjct  261   PSLLQLPHDATEELPPLVSCSQHMCPIKVHWHVKQSYREYWRVKVTISNFNFAKNYSQWS  320

Query  1146  LVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTELLMN  1325
             LV+ HPNL ++T+VFSFNY+ L+Q+G INDTG+F+GIQYYND+L+ +G+ GNVQTE+L+N
Sbjct  321   LVMQHPNLRSLTQVFSFNYKPLDQHGTINDTGIFWGIQYYNDMLMHSGDDGNVQTEILLN  380

Query  1326  KDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             KD   FTFREGWAFPR+ISFNG+ECV+P P+ YPRLP+SA
Sbjct  381   KDATMFTFREGWAFPRKISFNGDECVMPPPEKYPRLPSSA  420



>ref|XP_008365309.1| PREDICTED: COBRA-like protein 6 [Malus domestica]
Length=432

 Score =   524 bits (1350),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 248/400 (62%), Positives = 308/400 (77%), Gaps = 9/400 (2%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
              G+DPLDP  +IT+ WD ++ +++   + VSIYN+Q +RH+D PGWKL W+W+GD VIW+
Sbjct  19    SGFDPLDPYANITVTWDFLQQSESTSDIKVSIYNFQQFRHVDRPGWKLGWRWQGDEVIWN  78

Query  429   MWGAEATEQGNCSAFKSG-QRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDP  605
             MWGAEA  QGNCS FK   +RPHCCEKEPVIIDLLPGT FNKQF NCCKGG LSSM QD 
Sbjct  79    MWGAEAIYQGNCSRFKGAPERPHCCEKEPVIIDLLPGTPFNKQFSNCCKGGELSSMVQDS  138

Query  606   EKYLAAFQMsigrvssksssgaavaappipgNFTLGVPGYTCGEAFEVPPTKFVEDHGRR  785
              K+L+AF+M++G  S+ S++           NFTLG+PGYTCG   +V PTK  +D GRR
Sbjct  139   SKFLSAFRMNVGAFSNNSTNINMPD------NFTLGLPGYTCGAPVQVQPTKTSQD-GRR  191

Query  786   TTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAG  965
              T+ + TWN+TC YSQFRA  SP CCVSLS+FYN TI  CP C+CGC+G PG AKC+K G
Sbjct  192   WTETLETWNVTCMYSQFRASPSPKCCVSLSSFYNSTIAKCPRCSCGCQGLPG-AKCVKPG  250

Query  966   EQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQWN  1145
             ++  +   +  E P  +V CT+HMCPI +HWHVK SY ++WRVKITITNYNF KN+S W 
Sbjct  251   DELQLPGERETEEPSPLVTCTRHMCPIGIHWHVKESYKEYWRVKITITNYNFVKNYSDWT  310

Query  1146  LVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTELLMN  1325
             LVV HPNL ++T++FSFNY  L QYG+INDTGMF+GI+YYND+LL  G+ GNVQTE++++
Sbjct  311   LVVQHPNLQSLTQLFSFNYHPLGQYGNINDTGMFWGIKYYNDMLLSTGKNGNVQTEMVLH  370

Query  1326  KDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             KD   FTFREGW FPRRISFNG+ECV+P PD+YPRLPN A
Sbjct  371   KDEGVFTFREGWTFPRRISFNGDECVMPSPDEYPRLPNRA  410



>ref|XP_010030139.1| PREDICTED: COBRA-like protein 6 isoform X1 [Eucalyptus grandis]
Length=444

 Score =   524 bits (1349),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 246/400 (62%), Positives = 313/400 (78%), Gaps = 4/400 (1%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDM  431
             GYDPLDPNG++TIKWDI++  D +  V VS++NYQL+RH++ PGW+LSW W GD VIW+M
Sbjct  24    GYDPLDPNGNLTIKWDIMKSEDTSYDVKVSLFNYQLFRHVEPPGWRLSWTWIGDEVIWNM  83

Query  432   WGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEK  611
             +GAEAT QGNCS FK GQ PH CEK+PVI+DLLPG  +N Q  NCCKGG+LSS+ QDP K
Sbjct  84    FGAEATLQGNCSRFK-GQLPHSCEKQPVIVDLLPGAPYNMQVANCCKGGILSSLIQDPSK  142

Query  612   YLAAFQMsigrvssksssgaavaappipgNFTLGVPGYTCGEAFEVPPTKFVEDHGRRTT  791
             Y A F M++G  S+  +  A  A      NFT+ +PGYTCG   EVPP++F  D GRR T
Sbjct  143   YGAGFLMTVGAASTFDAGHAPSAYSIPA-NFTVKLPGYTCGPPLEVPPSRFPSDSGRRWT  201

Query  792   QAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAGEQ  971
             QA+GTWN+TC +SQFRA  +P CCVSLS FYN TIV CP C+C C+G PG+     + + 
Sbjct  202   QAIGTWNVTCIFSQFRASLTPKCCVSLSAFYNSTIVPCPTCSCRCQGLPGTRCTNSSSKV  261

Query  972   PPVVQLQH--YEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQWN  1145
             P ++QL H   E    +V C+QHMCPI+VHWHVK SY ++WRVK+TI+N+NFAKN+SQW+
Sbjct  262   PSLLQLPHDATEELPPLVSCSQHMCPIKVHWHVKQSYREYWRVKVTISNFNFAKNYSQWS  321

Query  1146  LVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTELLMN  1325
             LV+ HPNL ++T+VFSFNY+ L+Q+G INDTG+F+GIQYYND+L+ +G+ GNVQTE+L+N
Sbjct  322   LVMQHPNLRSLTQVFSFNYKPLDQHGTINDTGIFWGIQYYNDMLMHSGDDGNVQTEILLN  381

Query  1326  KDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             KD   FTFREGWAFPR+ISFNG+ECV+P P+ YPRLP+SA
Sbjct  382   KDATMFTFREGWAFPRKISFNGDECVMPPPEKYPRLPSSA  421



>gb|KDO43549.1| hypothetical protein CISIN_1g040209mg, partial [Citrus sinensis]
Length=388

 Score =   521 bits (1341),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 248/374 (66%), Positives = 294/374 (79%), Gaps = 10/374 (3%)
 Frame = +3

Query  330   VTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDMWGAEATEQGNCSAFKSGQRPHCCEKE  509
             + VS++NYQLYRHID PGWKL+W W+GD VIW+MWGAEATEQGNCS F  GQ PHCCEK 
Sbjct  1     LRVSLFNYQLYRHIDQPGWKLNWGWQGDEVIWNMWGAEATEQGNCSKFTGGQLPHCCEKS  60

Query  510   PVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEKYLAAFQMsigrvssksssgaavaapp  689
             PVI+DLLPG  +N+Q  NCCKGGVLSS+TQDP K++A FQM++G  +  +          
Sbjct  61    PVIVDLLPGAPYNQQTANCCKGGVLSSLTQDPSKFVAGFQMNVGGSADYTGFQMPE----  116

Query  690   ipgNFTLGVPGYTCGEAFEVPPTKFVEDHGRRTTQAVGTWNITCSYSQFRAQSSPTCCVS  869
                NFTLG+PGYTCG A EVPP+KF  D GRR TQA+ TWN+TC YSQF A SSP CCVS
Sbjct  117   ---NFTLGIPGYTCGNATEVPPSKFYSDGGRRRTQALRTWNVTCIYSQFMASSSPKCCVS  173

Query  870   LSTFYNKTIVSCPICTCGCEGQPGSAKCLKAGEQPPVVQLQH--YEPPQAIVQCTQHMCP  1043
             LS FYN TIV CP C+C C+G    A C+K GE P ++Q +H   +    +V C+QHMCP
Sbjct  174   LSAFYNNTIVPCPKCSCHCQGL-SPANCIKYGETPSLLQQKHDPNKEQSPVVICSQHMCP  232

Query  1044  IRVHWHVKLSYTQHWRVKITITNYNFAKNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYG  1223
             +RVHWHVK SYTQ+WRVKITITN N  +N+SQWNLV LHPNL +VT+VFSFNY+ LNQYG
Sbjct  233   VRVHWHVKQSYTQYWRVKITITNLNVVQNYSQWNLVALHPNLQSVTQVFSFNYKPLNQYG  292

Query  1224  DINDTGMFYGIQYYNDVLLQAGEGGNVQTELLMNKDPATFTFREGWAFPRRISFNGEECV  1403
              INDTGMF+GI++YND+LLQAGE GNVQTE+L++KD   FTFREGW FPRRI FNG+ECV
Sbjct  293   YINDTGMFWGIEFYNDMLLQAGESGNVQTEMLLHKDSGIFTFREGWGFPRRILFNGDECV  352

Query  1404  LPQPDDYPRLPNSA  1445
             +P PDDYPRLPN+A
Sbjct  353   MPLPDDYPRLPNNA  366



>ref|XP_009355440.1| PREDICTED: COBRA-like protein 6 [Pyrus x bretschneideri]
Length=531

 Score =   525 bits (1353),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 248/399 (62%), Positives = 307/399 (77%), Gaps = 9/399 (2%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDM  431
             G+DPLDP  +IT+ WD ++ +++   + VSIYN+Q +RH+D PGWKL W W+GD VIW+M
Sbjct  119   GFDPLDPYANITVTWDFLQQSESTSDIKVSIYNFQQFRHVDRPGWKLGWIWKGDEVIWNM  178

Query  432   WGAEATEQGNCSAFKSG-QRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             WGAEA  QGNCS FK   +RPHCCEKEPVIIDLLPGT FNKQF NCCKGG LSSM QD  
Sbjct  179   WGAEAIYQGNCSRFKGAPERPHCCEKEPVIIDLLPGTPFNKQFSNCCKGGELSSMIQDSS  238

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPGYTCGEAFEVPPTKFVEDHGRRT  788
             K+L+AF+M++G  S+ S++           NFTLG+PGYTCG   +V PTK  +D GRR 
Sbjct  239   KFLSAFRMNVGAFSNNSTNINMPD------NFTLGLPGYTCGPPVQVQPTKTSQD-GRRW  291

Query  789   TQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAGE  968
             T+ + TWN+TC YSQFRA  SP CCVSLS+FYN TI  CP C+CGC+G PG AKC+K G+
Sbjct  292   TETLETWNVTCMYSQFRASPSPKCCVSLSSFYNSTIAKCPRCSCGCQGLPG-AKCVKPGD  350

Query  969   QPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQWNL  1148
             +  +   +  E P  +V CT+HMCPI +HWHVK SY ++WRVKITITNYNF KN+S W L
Sbjct  351   ELQLPGDRETEDPSPLVTCTRHMCPIGIHWHVKESYKEYWRVKITITNYNFVKNYSDWTL  410

Query  1149  VVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTELLMNK  1328
             VV HPNL ++T++FSFNY  L QYG+INDTGMF+GI+YYND+LL  G+ GNVQTE++++K
Sbjct  411   VVQHPNLQSLTQLFSFNYHPLGQYGNINDTGMFWGIKYYNDMLLSTGKNGNVQTEMVLHK  470

Query  1329  DPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             D   FTFREGW FPRRISFNG+ECV+P PD+YPRLPN A
Sbjct  471   DEGVFTFREGWTFPRRISFNGDECVMPSPDEYPRLPNRA  509



>ref|XP_004486234.1| PREDICTED: COBRA-like protein 6-like [Cicer arietinum]
Length=417

 Score =   520 bits (1338),  Expect = 8e-178, Method: Compositional matrix adjust.
 Identities = 246/399 (62%), Positives = 307/399 (77%), Gaps = 4/399 (1%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             DGYDPLDP G+IT+ WD +  N     V VSIYN+QL+RH++ PGWKLSW WRG+ VIW 
Sbjct  2     DGYDPLDPFGNITVTWDFLSDNGETVDVRVSIYNFQLFRHVEEPGWKLSWDWRGNEVIWA  61

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GAEA EQGNC+ F+  Q+PHCC+K PVIIDL+PGT +N Q  NCCKGGVL+S+TQ+  
Sbjct  62    MLGAEAIEQGNCTRFRGQQKPHCCKKHPVIIDLMPGTPYNMQSANCCKGGVLTSLTQNQA  121

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPGYTCGEAFEVPPTKFVEDHGRRT  788
             K+ A+FQM+  + S   S  ++  + P   NFTLG+PGY+CG  FEVPPTKF +D G R 
Sbjct  122   KHGASFQMNYMKSSFSVSGSSSNFSMPE--NFTLGIPGYSCGTPFEVPPTKFTKD-GYRW  178

Query  789   TQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAGE  968
              Q + TWN+TC YSQF A  SP CCVSLS FYN TIV CP+C+C C+G PG A C+ + +
Sbjct  179   QQVLETWNVTCIYSQFLASPSPKCCVSLSAFYNSTIVPCPVCSCNCQGLPG-AHCVNSDK  237

Query  969   QPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQWNL  1148
                +   Q  EPP+ +++C+ HMCPIRVHWHVK SY ++WRVKITITN NF KN+SQWNL
Sbjct  238   TSVLQMPQANEPPKPVIRCSHHMCPIRVHWHVKQSYKEYWRVKITITNLNFVKNYSQWNL  297

Query  1149  VVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTELLMNK  1328
             VVLHPNL ++T+VFSFNY+ L  YG++NDTGMF+G+ YYND+LL  GE GNVQTE+L++K
Sbjct  298   VVLHPNLRSLTQVFSFNYQALPIYGNLNDTGMFWGLPYYNDLLLTHGENGNVQTEILLHK  357

Query  1329  DPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             D   FTF+EGW FPR+ISFNG+ECV+P PDDYPRLPN+A
Sbjct  358   DQGEFTFKEGWTFPRKISFNGDECVMPSPDDYPRLPNTA  396



>ref|XP_008456042.1| PREDICTED: COBRA-like protein 6, partial [Cucumis melo]
Length=488

 Score =   521 bits (1343),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 250/401 (62%), Positives = 301/401 (75%), Gaps = 10/401 (2%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDM  431
             GYD LDP  +ITI WD +  N     V VS+YN+QL+RH++ PGWKL W W+G+ VIW M
Sbjct  75    GYDSLDPYANITITWDFLVENGDTYDVRVSLYNFQLFRHVELPGWKLGWSWKGEEVIWGM  134

Query  432   WGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEK  611
             WGAE T+QGNCS +   + PHCCEK+P I+DL+PG  +  Q  NCCK GVLSSM Q+P  
Sbjct  135   WGAETTQQGNCSKYVGRELPHCCEKKPEIVDLMPGAPYKLQVANCCKAGVLSSMRQEPSN  194

Query  612   YLAAFQMsigrvssksssgaavaappipgNFTLGVPGYTCGEAFEVPPTKFVEDHGRRTT  791
             Y AAFQM++G+ S K       A      NFTLG+PGYTC E F+VPPTKF +D GRR  
Sbjct  195   YGAAFQMNVGKSSGKDVDSKMPA------NFTLGLPGYTCSEPFQVPPTKFSKDGGRRWM  248

Query  792   QAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAGEQ  971
             Q + TWN+TC YSQFR+  +P CCVSLS+FYN TIV CP C+CGC+G  G+ KC+K GE 
Sbjct  249   QVLETWNVTCVYSQFRSSPTPGCCVSLSSFYNSTIVPCPQCSCGCQGLKGT-KCVKLGEA  307

Query  972   PPVVQLQHYE---PPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQW  1142
             P V+QL H       + +V+C+QHMCPIRVHWHVK SYT +WR KITITN NFAKN+S W
Sbjct  308   PSVLQLPHEHNTAEVEPLVRCSQHMCPIRVHWHVKQSYTLYWRAKITITNLNFAKNYSDW  367

Query  1143  NLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTELLM  1322
             NLVV+HPNL N+T+VFSFNY  LNQYG+INDTGMF+GI +YND+LL +GE GNVQTE+L+
Sbjct  368   NLVVMHPNLRNITQVFSFNYSPLNQYGNINDTGMFWGIHFYNDLLLTSGERGNVQTEILL  427

Query  1323  NKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
              KD   FTFREGWAFPRRI FNG+ECV+P PD YPRLPN A
Sbjct  428   QKDSEIFTFREGWAFPRRILFNGDECVMPPPDQYPRLPNKA  468



>ref|XP_007042284.1| COBRA-like protein 6 precursor [Theobroma cacao]
 gb|EOX98115.1| COBRA-like protein 6 precursor [Theobroma cacao]
Length=478

 Score =   518 bits (1333),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 248/400 (62%), Positives = 298/400 (75%), Gaps = 15/400 (4%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDM  431
             GYDPLDP+G+ITIKWD+++ N     + VSI N+QLYR I+ PGWKL W W GD VIW M
Sbjct  67    GYDPLDPHGNITIKWDLLQSNLDKNDLKVSILNHQLYRQIERPGWKLGWAWVGDEVIWSM  126

Query  432   WGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEK  611
              GAEATEQGNCS FK  + PHCCEK+PVI+DLLPG  +N Q  NCCKGGVL+SM QDP+K
Sbjct  127   QGAEATEQGNCSRFKGQELPHCCEKKPVIVDLLPGALYNLQTANCCKGGVLTSMVQDPDK  186

Query  612   YLAAFQMsigrvssksssgaavaappipgNFTLGVPGYTCGEAFEVPPTKFVEDHGRRTT  791
               A FQM  G V+                NFTLG+PGY+CG+   V P+K+  D GRR T
Sbjct  187   IAAVFQMVAGSVNVSDFIMPE--------NFTLGIPGYSCGKPVSVAPSKYTSDGGRRWT  238

Query  792   QAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAGEQ  971
             QA+GTWN+TC YS F A +SP CCVSLS FYN++IV CP C+C C+G P  AKC+K GE 
Sbjct  239   QALGTWNVTCIYSPFLASTSPKCCVSLSAFYNRSIVPCPKCSCSCQGLP-EAKCVKFGEA  297

Query  972   PPVVQLQHYEPPQ----AIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQ  1139
             P    LQ  E P     ++V+CTQHMCPIRVHWHVK SY ++WRVKIT+ N +  KN+S 
Sbjct  298   PS--PLQELEDPNKEQPSLVRCTQHMCPIRVHWHVKRSYKEYWRVKITVNNLHIMKNYSH  355

Query  1140  WNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTELL  1319
             WNLV  HPNL ++T+VFSFNY  LNQYG INDTGMF+GIQYYND+LL+ GE GNVQ+E+L
Sbjct  356   WNLVASHPNLKSLTQVFSFNYEPLNQYGYINDTGMFWGIQYYNDMLLEEGERGNVQSEML  415

Query  1320  MNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPN  1439
             ++K+   FTFREGWAFPRRI FNG+ECV+P PD+YPRLPN
Sbjct  416   LHKEQGVFTFREGWAFPRRIMFNGDECVMPPPDEYPRLPN  455



>ref|XP_009345837.1| PREDICTED: COBRA-like protein 6 [Pyrus x bretschneideri]
 ref|XP_009345842.1| PREDICTED: COBRA-like protein 6 [Pyrus x bretschneideri]
Length=436

 Score =   515 bits (1327),  Expect = 9e-176, Method: Compositional matrix adjust.
 Identities = 249/404 (62%), Positives = 303/404 (75%), Gaps = 14/404 (3%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDM  431
             GYDPLDP  +IT++WD ++ + ++  + VSIYN+Q +RH+D PGWKL W W+GD VIWDM
Sbjct  20    GYDPLDPYANITVRWDFLQQSGSSSDIKVSIYNFQQFRHVDRPGWKLGWTWKGDEVIWDM  79

Query  432   WGAEATEQGNCSAFK-SGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             WGAEATEQGNCS FK S   PHCC+K+PVIIDLLP   FNKQ+ NCCKGG LSSM QD  
Sbjct  80    WGAEATEQGNCSKFKGSPDLPHCCKKKPVIIDLLPEAPFNKQYFNCCKGGELSSMIQDSS  139

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPGYTCGEAFEVPPTKFVEDHGRRT  788
             K+ ++F MS+G ++ K              NFTLG+PGYTCG  F+V PTKF  D GRR 
Sbjct  140   KFGSSFAMSVGSLAGKDIVMPT--------NFTLGLPGYTCGMPFQVQPTKFSHD-GRRW  190

Query  789   TQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAGE  968
              Q + TWN+TC YS  RA  SP CCVSLS FY  TIV CP C+CGC+G PG     + GE
Sbjct  191   KQVLETWNVTCIYSLIRASPSPKCCVSLSAFYGSTIVPCPKCSCGCQGLPGVKCVNRPGE  250

Query  969   Q-PPVVQLQHY---EPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFS  1136
             + PP++QL H    E P  +V C++HMCPIRVHWHVK SY ++WRVKITITNYNF KN+S
Sbjct  251   ESPPLLQLPHAHETEEPSPLVTCSRHMCPIRVHWHVKQSYKEYWRVKITITNYNFVKNYS  310

Query  1137  QWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTEL  1316
              W LVV HPNL ++T++FSFNY  LNQYG  NDTGMF+GI+YYND+LL  G+ G VQTE+
Sbjct  311   YWTLVVQHPNLQSLTQLFSFNYHPLNQYGTRNDTGMFWGIKYYNDLLLTTGKNGVVQTEM  370

Query  1317  LMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             L++KD  TFTFREGW FPR+ISFNG+ECV+P PD+YPRLPN+AP
Sbjct  371   LLHKDTGTFTFREGWTFPRKISFNGDECVMPPPDEYPRLPNAAP  414



>ref|XP_010246052.1| PREDICTED: COBRA-like protein 6 [Nelumbo nucifera]
Length=390

 Score =   506 bits (1303),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 241/374 (64%), Positives = 296/374 (79%), Gaps = 12/374 (3%)
 Frame = +3

Query  336   VSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDMWGAEATEQGNCSAFKSGQRPHCCEKEPV  515
             VSI+N+QL+RH++ PGWKLSW+W    VIW++ GAEATEQG+CS  K  Q PH CEK+PV
Sbjct  8     VSIFNFQLFRHVETPGWKLSWEWSNLEVIWNIVGAEATEQGDCSRIKGSQLPHSCEKKPV  67

Query  516   IIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEKYLAAFQMsigrvssksssgaavaappip  695
             I+DLLPGT +N Q  NCCKGGVLSSMTQDP KY AAFQM++G VS   ++          
Sbjct  68    IVDLLPGTPYNMQVANCCKGGVLSSMTQDPTKYGAAFQMNVGMVSQAIANMTMPG-----  122

Query  696   gNFTLGVPGYTCGEAFEVPPTKFVEDHGRRTTQAVGTWNITCSYSQFRAQSSPTCCVSLS  875
              NF+LG+PGY+C E F V P+KF  D+GRR TQA+ TWN+TCSYSQ  A ++PTCCVSLS
Sbjct  123   -NFSLGLPGYSCSEPFNVTPSKFSSDNGRRWTQALRTWNVTCSYSQVLAYAAPTCCVSLS  181

Query  876   TFYNKTIVSCPICTCGCEGQPGSAKCLKAGEQPPVVQL-QHYEPPQAIVQCTQHMCPIRV  1052
              FYN+TIV CP C+C C+G PG+ KC+K GE P  +QL Q  +PP   V C++HMCPIRV
Sbjct  182   AFYNETIVPCPRCSCSCQGMPGT-KCIKPGESP--LQLPQKVQPP--TVMCSRHMCPIRV  236

Query  1053  HWHVKLSYTQHWRVKITITNYNFAKNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDIN  1232
             HWHVK SY ++WRVK+T+TN NF KN++ WNLV+ HPNL ++ ++FSFNY+ LN YG IN
Sbjct  237   HWHVKTSYREYWRVKVTVTNLNFVKNYTMWNLVIQHPNLRSIAQIFSFNYKPLNLYGPIN  296

Query  1233  DTGMFYGIQYYNDVLLQAGEGGNVQTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQ  1412
             DTGMF+GIQYYND+LLQ+G+ GNVQTE+L++KD   FTFREGWAFPRRISFNG+ECV+P 
Sbjct  297   DTGMFWGIQYYNDLLLQSGDSGNVQTEMLLHKDAEIFTFREGWAFPRRISFNGDECVMPS  356

Query  1413  PDDYPRLPNSAPPH  1454
             PDDYPRLPNS PPH
Sbjct  357   PDDYPRLPNSGPPH  370



>ref|XP_004146282.1| PREDICTED: COBRA-like protein 1-like [Cucumis sativus]
Length=433

 Score =   506 bits (1302),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 242/386 (63%), Positives = 295/386 (76%), Gaps = 11/386 (3%)
 Frame = +3

Query  300   IIEGNDA-NQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDMWGAEATEQGNCSAFK  476
              + G+D  N+ V VS+YN+QL+RH++ PGWKL W W+G+ VIW MWGAE T+QGNCS + 
Sbjct  35    FVNGSDGVNRSVRVSLYNFQLFRHVELPGWKLGWSWKGEEVIWGMWGAETTQQGNCSKYV  94

Query  477   SGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEKYLAAFQMsigrvssk  656
               + PHCCEK+P I+DL+PG  +  Q  NCCK GVLSSM Q+     AAFQM++G+ S K
Sbjct  95    GRELPHCCEKKPEIVDLMPGAPYKLQVANCCKAGVLSSMRQESSNSGAAFQMNVGKSSGK  154

Query  657   sssgaavaappipgNFTLGVPGYTCGEAFEVPPTKFVEDHGRRTTQAVGTWNITCSYSQF  836
                    A      NFTLG+PGYTC E F+VPPTKF +D GRR  Q + TWN+TC YSQF
Sbjct  155   DVDSKMPA------NFTLGLPGYTCSEPFQVPPTKFSKDGGRRWMQVLETWNVTCVYSQF  208

Query  837   RAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAGEQPPVVQLQHYE---PP  1007
             R+  +P CCVSLS+FYN TIV CP C+CGC+G  G+ KC+K+GE P V+QL H       
Sbjct  209   RSSPTPGCCVSLSSFYNSTIVPCPQCSCGCQGLKGT-KCVKSGEAPSVLQLPHEHNTAEV  267

Query  1008  QAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQWNLVVLHPNLGNVTRV  1187
             +A+V+C+QHMCPIRVHWHVK SYTQ+WRVKITITN NFAKN+S WNLVV+HPNL N+T+V
Sbjct  268   EALVRCSQHMCPIRVHWHVKQSYTQYWRVKITITNLNFAKNYSDWNLVVMHPNLRNITQV  327

Query  1188  FSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTELLMNKDPATFTFREGWAF  1367
             FSFNY  LNQYG+INDTGMF+GI +YND+LL +GE GNVQTE+L+ KD   FTFREGWAF
Sbjct  328   FSFNYSPLNQYGNINDTGMFWGIHFYNDLLLTSGERGNVQTEILLQKDSEIFTFREGWAF  387

Query  1368  PRRISFNGEECVLPQPDDYPRLPNSA  1445
             PRRI FNG+ECV+P PD YPRLPN A
Sbjct  388   PRRIMFNGDECVMPPPDQYPRLPNKA  413



>ref|XP_010919369.1| PREDICTED: COBRA-like protein 7 [Elaeis guineensis]
Length=440

 Score =   504 bits (1298),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 241/402 (60%), Positives = 303/402 (75%), Gaps = 9/402 (2%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             D YDP+DPNG+ITIKWDI    DA   V VSIYNYQLYRH++ PGW+LSW W  D VIWD
Sbjct  21    DAYDPMDPNGNITIKWDINSIEDATYNVIVSIYNYQLYRHVESPGWRLSWTWPKDEVIWD  80

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             + GAEATEQGNCS F+ G  PHCC+K PVI+DL  G  +N Q+ NCC+GGVLSS TQDP 
Sbjct  81    LRGAEATEQGNCSRFR-GSLPHCCDKTPVIVDLALGAPYNMQYKNCCRGGVLSSTTQDPT  139

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPGYTCGEAFEVPPTKFVEDHGRRT  788
             K++++FQMS+G V        A+ +     NF+LG+PGYTC  A  V P+K   D  +R+
Sbjct  140   KFMSSFQMSVGGVLDLRKVTKAIPS-----NFSLGLPGYTCSNATVVAPSKVRVD-SQRS  193

Query  789   TQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAGE  968
              Q + TW +TCSYSQFR   +P+CCVSLSTFYN TIVSCP+C+CGC+  P +++C + G+
Sbjct  194   IQYLMTWEVTCSYSQFRESVTPSCCVSLSTFYNSTIVSCPLCSCGCQNSPTTSECFRNGQ  253

Query  969   QPPVVQL--QHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQW  1142
             QP ++QL     E     V CTQHMCPIRVHWH+K+SY ++WRVK+TITN++  KN++ W
Sbjct  254   QPDLLQLPNDDDEGTSPFVLCTQHMCPIRVHWHLKVSYKEYWRVKVTITNFSILKNYTDW  313

Query  1143  NLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTELLM  1322
             NLV+ HPNL ++T+VFSFNY  L QYGDINDTGMF+GI+ YND+LLQ GE GNVQTE+L+
Sbjct  314   NLVIQHPNLQSITQVFSFNYNPLIQYGDINDTGMFWGIKNYNDMLLQYGENGNVQTEMLL  373

Query  1323  NKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             +KDP  FTF+ GWA PR+I FNG +CV+P PD YP LPNS+P
Sbjct  374   HKDPGDFTFKGGWALPRKIVFNGHDCVMPPPDMYPSLPNSSP  415



>ref|XP_004159883.1| PREDICTED: COBRA-like protein 1-like [Cucumis sativus]
Length=403

 Score =   503 bits (1294),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 240/380 (63%), Positives = 290/380 (76%), Gaps = 10/380 (3%)
 Frame = +3

Query  315   DANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDMWGAEATEQGNCSAFKSGQRPH  494
             D    V VS+YN+QL+RH++ PGWKL W W+G+ VIW MWGAE T+QGNCS +   + PH
Sbjct  11    DKRSQVRVSLYNFQLFRHVELPGWKLGWSWKGEEVIWGMWGAETTQQGNCSKYVGRELPH  70

Query  495   CCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEKYLAAFQMsigrvssksssgaa  674
             CCEK+P I+DL+PG  +  Q  NCCK GVLSSM Q+     AAFQM++G+ S K      
Sbjct  71    CCEKKPEIVDLMPGAPYKLQVANCCKAGVLSSMRQESSNSGAAFQMNVGKSSGKDVDSKM  130

Query  675   vaappipgNFTLGVPGYTCGEAFEVPPTKFVEDHGRRTTQAVGTWNITCSYSQFRAQSSP  854
              A      NFTLG+PGYTC E F+VPPTKF +D GRR  Q + TWN+TC YSQFR+  +P
Sbjct  131   PA------NFTLGLPGYTCSEPFQVPPTKFSKDGGRRWMQVLETWNVTCVYSQFRSSPTP  184

Query  855   TCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAGEQPPVVQLQHYE---PPQAIVQC  1025
              CCVSLS+FYN TIV CP C+CGC+G  G+ KC+K+GE P V+QL H       +A+V+C
Sbjct  185   GCCVSLSSFYNSTIVPCPQCSCGCQGLKGT-KCVKSGEAPSVLQLPHEHNTAEVEALVRC  243

Query  1026  TQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQWNLVVLHPNLGNVTRVFSFNYR  1205
             +QHMCPIRVHWHVK SYTQ+WRVKITITN NFAKN+S WNLVV+HPNL N+T+VFSFNY 
Sbjct  244   SQHMCPIRVHWHVKQSYTQYWRVKITITNLNFAKNYSDWNLVVMHPNLRNITQVFSFNYS  303

Query  1206  TLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTELLMNKDPATFTFREGWAFPRRISF  1385
              LNQYG+INDTGMF+GI +YND+LL +GE GNVQTE+L+ KD   FTFREGWAFPRRI F
Sbjct  304   PLNQYGNINDTGMFWGIHFYNDLLLTSGERGNVQTEILLQKDSEIFTFREGWAFPRRIMF  363

Query  1386  NGEECVLPQPDDYPRLPNSA  1445
             NG+ECV+P PD YPRLPN A
Sbjct  364   NGDECVMPPPDQYPRLPNKA  383



>ref|XP_008791642.1| PREDICTED: COBRA-like protein 7 [Phoenix dactylifera]
Length=440

 Score =   503 bits (1295),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 241/404 (60%), Positives = 308/404 (76%), Gaps = 13/404 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             D YDP+DPNG+ITIKWDI    DA   V VSIYNYQLYRH++ PGW++SW W  D VIWD
Sbjct  21    DAYDPMDPNGNITIKWDINSIEDATYNVIVSIYNYQLYRHVESPGWRMSWTWPKDEVIWD  80

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             + GAEATEQGNCS FK G  PHCC+K PVI+DL  G  +N Q+ NCC+GGVLSS TQDP 
Sbjct  81    LRGAEATEQGNCSRFK-GSLPHCCDKTPVIVDLALGAPYNMQYKNCCRGGVLSSTTQDPT  139

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPGYTCGEAFEVPPTKFVEDHGRRT  788
             K +++FQMS+G V    S+  A+ +     NF++G+PGYTC  A  V P+K V+  G+R+
Sbjct  140   KTMSSFQMSVGGVFVLDSATKAIPS-----NFSVGLPGYTCSNATVVAPSK-VQVDGQRS  193

Query  789   TQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAGE  968
              Q + TW +TCSYSQFR  ++P CCVSLS FYN T+VSCP+C+CGC+  P +++C + G+
Sbjct  194   IQYLMTWEVTCSYSQFRESATPGCCVSLSAFYNSTVVSCPLCSCGCQNSPATSECFRDGQ  253

Query  969   QPPVVQLQHYE----PPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFS  1136
             QP ++QL + +    PP   V CTQHMCPIRVHWH+K+SY ++WRVK+TITN+N  KN++
Sbjct  254   QPDLLQLPNGDDEGTPP--FVLCTQHMCPIRVHWHLKVSYKEYWRVKVTITNFNILKNYT  311

Query  1137  QWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTEL  1316
              WNLV+ HPNL ++T+VFSFNY  L QYGDINDTGMF+GI+ YN++LLQ G  GNVQTE+
Sbjct  312   DWNLVIQHPNLRSITQVFSFNYNPLIQYGDINDTGMFWGIKNYNEMLLQYGVDGNVQTEM  371

Query  1317  LMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             L+ KDP  FTF+ GWAFPR+I+FNG ECV+P PD +P LPNS+P
Sbjct  372   LLRKDPGDFTFKGGWAFPRKIAFNGHECVMPPPDMFPSLPNSSP  415



>ref|XP_010548878.1| PREDICTED: COBRA-like protein 6 [Tarenaya hassleriana]
Length=443

 Score =   499 bits (1285),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 239/404 (59%), Positives = 301/404 (75%), Gaps = 14/404 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             +GYDPLDPNG+ITIKWD+I G  A  V+ V+I N Q YRHI+ PGW++SW W+    IWD
Sbjct  29    EGYDPLDPNGNITIKWDLIVGGSAPTVL-VTITNLQQYRHIEQPGWRISWDWKNHEAIWD  87

Query  429   MWGAEATEQGNCSAFKSGQRP--HCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQD  602
             + GAEATEQGNCSAF S   P  HCC + PVI+DLLPG+ +N Q  NCC+GG +SSM QD
Sbjct  88    IRGAEATEQGNCSAFLSSSAPPPHCCLRHPVIVDLLPGSPYNLQVANCCRGGFISSMNQD  147

Query  603   PEKYLAAFQMsigrvssksssgaavaappipgNFTLGVPGYTCGEAFEVPPTKFVEDHGR  782
               K+ ++FQMSIG   ++    +         NFTLGVPGYTCG A  V PTKF E + R
Sbjct  148   SSKFASSFQMSIGSSDTEPYEFSVPE------NFTLGVPGYTCGNATSVEPTKFTEKNRR  201

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKA  962
                QA+ TW+ITC YSQ ++  +P CCVSLS FYN+T+V C  C+CGC+G  G A+C+  
Sbjct  202   HKKQALATWHITCVYSQIQSSPAPKCCVSLSAFYNETVVPCQRCSCGCQGLSG-ARCVNK  260

Query  963   GEQPPVVQLQHYEPPQAI---VQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
             GE P ++Q QH +P   +   VQCT+HMCPI+VHWHVK++Y ++WRVK+T+TN+N  KN+
Sbjct  261   GEAPQLLQ-QHQDPTVEVPPVVQCTRHMCPIKVHWHVKVNYREYWRVKVTVTNFNVIKNY  319

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             S+WNLVVLHPNL ++ +VFSFNY+ L QYG +NDT MFYG+ +YNDVLLQ+GE GNVQ+E
Sbjct  320   SEWNLVVLHPNLKSIQQVFSFNYKPLRQYGYLNDTAMFYGLPFYNDVLLQSGETGNVQSE  379

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             +L+ KD   FTF EGWAFPRRI FNG+ECV+P PDDYPRLPN A
Sbjct  380   ILLKKDQGNFTFSEGWAFPRRILFNGDECVMPSPDDYPRLPNRA  423



>ref|XP_004301494.1| PREDICTED: protein COBRA-like [Fragaria vesca subsp. vesca]
Length=469

 Score =   499 bits (1286),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 243/412 (59%), Positives = 308/412 (75%), Gaps = 15/412 (4%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDII-EGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             GYDPLDP G++TI WD + + N     + VSIYN Q YRH++ PGW+L W+W    VIWD
Sbjct  36    GYDPLDPYGNVTITWDFLAQSNTDTYDIKVSIYNLQQYRHVEFPGWRLQWKWNKSEVIWD  95

Query  429   MWGAEATEQGNCSAFK---SGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQ  599
             M GAEA EQG+CSAFK   +G  PHCC + PVI DLLPGT +N Q+ NCCKGGVLSSM Q
Sbjct  96    MRGAEAVEQGDCSAFKGSGAGDLPHCCLRRPVITDLLPGTPYNMQYKNCCKGGVLSSMNQ  155

Query  600   DPEKYLAAFQMsigrvssk---sssgaavaappipgNFTLGVPGYTCGEAFEVPPTKFVE  770
             DP KYL++F MSIG   +     +S        +P +F LG+PGYTCG+AF VPPT++++
Sbjct  156   DPSKYLSSFGMSIGNFHASPPGLNSSLDKLNLTMPTDFNLGIPGYTCGDAFLVPPTRYID  215

Query  771   D--HGRRTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGS  944
             +   GRR  Q + TWNITC+YSQF+A  +P CCVSLS FYN TIV CP C+CGC+ + G 
Sbjct  216   EKGQGRRWKQTLETWNITCTYSQFQASRAPKCCVSLSAFYNTTIVGCPRCSCGCQ-RLGG  274

Query  945   AKCLKAGEQPP--VVQL---QHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITIT  1109
             AKC+++G++PP  V++L   Q    P  +V C+QHMCPIRVHWHVK SY ++WRVKITIT
Sbjct  275   AKCIESGDKPPPSVLKLPTEQQAAIPPPLVTCSQHMCPIRVHWHVKQSYKEYWRVKITIT  334

Query  1110  NYNFAKNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAG  1289
             N NF KN++ WNLVV HPNL ++ ++FSFNY  L  YG+INDTGMF+GI++YND++L +G
Sbjct  335   NLNFLKNYTDWNLVVQHPNLKSIRQLFSFNYHPLTTYGNINDTGMFWGIKFYNDMILTSG  394

Query  1290  EGGNVQTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
               GN Q+E+L++KD  TFTFREGWAFPRRISFNG++CV+P PDDYP LPN A
Sbjct  395   NQGNAQSEMLLHKDEGTFTFREGWAFPRRISFNGDDCVMPPPDDYPTLPNIA  446



>ref|XP_006384995.1| hypothetical protein POPTR_0004s22890g [Populus trichocarpa]
 gb|ERP62792.1| hypothetical protein POPTR_0004s22890g [Populus trichocarpa]
Length=382

 Score =   492 bits (1266),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 229/370 (62%), Positives = 285/370 (77%), Gaps = 10/370 (3%)
 Frame = +3

Query  336   VSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDMWGAEATEQGNCSAFKSGQRPHCCEKEPV  515
             VSIYN+Q YRH++ PGWKL+W W+G  VIW M GAEATEQGNC+ FK    PHCCEKEP 
Sbjct  2     VSIYNFQQYRHVEPPGWKLNWAWKGKEVIWSMQGAEATEQGNCTEFKESTLPHCCEKEPF  61

Query  516   IIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEKYLAAFQMsigrvssksssgaavaappip  695
             I+DLLPGT +N Q  NCCKGGVLSSM QDP KY+A FQM++G   + S            
Sbjct  62    IVDLLPGTNYNAQTQNCCKGGVLSSMKQDPSKYVATFQMAVGGSGTNSQFKMPE------  115

Query  696   gNFTLGVPGYTCGEAFEVPPTKFVEDHGRRTTQAVGTWNITCSYSQFRAQSSPTCCVSLS  875
              NF LGVPGY+CG A +V P+++  D GRR TQA+ TWN+TC YSQ  A  +P CCVSLS
Sbjct  116   -NFKLGVPGYSCGGAVKVEPSRYTTDGGRRWTQALATWNVTCMYSQSLASPTPRCCVSLS  174

Query  876   TFYNKTIVSCPICTCGCEGQPGSAKCLKAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVH  1055
              FYN+TIVSCP C+CGC+GQPG+ KC+K GE PP+  L+  + P  +V+C++HMCPIRVH
Sbjct  175   AFYNQTIVSCPRCSCGCQGQPGT-KCVKYGETPPL--LKQNQDPTPVVRCSEHMCPIRVH  231

Query  1056  WHVKLSYTQHWRVKITITNYNFAKNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDIND  1235
             WH+K SY Q+WR K+T+TN++  KN+S+WNLVVLHPNL ++T+VFSFNY  LN+YG IND
Sbjct  232   WHLKESYKQYWRAKMTVTNFHIMKNYSEWNLVVLHPNLQSLTQVFSFNYAPLNRYGYIND  291

Query  1236  TGMFYGIQYYNDVLLQAGEGGNVQTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQP  1415
             TGMF+G+ +YND+LLQ G+ GN+QTE+L+ KDP  FTFREGW FPR+I FNG+ECV+P P
Sbjct  292   TGMFWGLPFYNDILLQEGKDGNLQTEILLRKDPGIFTFREGWGFPRKIQFNGDECVMPPP  351

Query  1416  DDYPRLPNSA  1445
             D+YP LPN  
Sbjct  352   DEYPSLPNKG  361



>ref|XP_004288992.1| PREDICTED: COBRA-like protein 3-like [Fragaria vesca subsp. vesca]
Length=470

 Score =   494 bits (1273),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 241/412 (58%), Positives = 302/412 (73%), Gaps = 15/412 (4%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEGNDANQV-VTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
              YDPLDP G +TI WD +  +D +   + VSI+N Q YRH++ PGW+L W W    VIWD
Sbjct  37    AYDPLDPYGTVTITWDFLTQSDTDTYDIKVSIFNLQQYRHVELPGWRLKWTWNKSEVIWD  96

Query  429   MWGAEATEQGNCSAFK---SGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQ  599
             M GAEA EQG+CSAFK   +G  PHCC K PVI DLLPGT +N Q+ NCCKGGVLSSM Q
Sbjct  97    MRGAEAVEQGDCSAFKGSGAGDLPHCCLKRPVITDLLPGTPYNMQYKNCCKGGVLSSMNQ  156

Query  600   DPEKYLAAFQMsi---grvssksssgaavaappipgNFTLGVPGYTCGEAFEVPPTKFVE  770
             DP KYL++F MSI       + S+         +P +F+LG+PGYTCG+AF VPPT++ +
Sbjct  157   DPSKYLSSFGMSIGNFHANPAGSNKSFDKLNLTMPTDFSLGIPGYTCGDAFRVPPTRYSD  216

Query  771   D--HGRRTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGS  944
             +   GRR  Q + TWNITC+YSQF+A  +P CCVSLS FYN TIV CP C+CGC+ + G 
Sbjct  217   EKGQGRRWKQTLETWNITCTYSQFQASRAPKCCVSLSAFYNTTIVGCPRCSCGCQ-RLGG  275

Query  945   AKCLKAGEQPPVVQLQHYEPPQA-----IVQCTQHMCPIRVHWHVKLSYTQHWRVKITIT  1109
             AKC+++G++PP   L+     QA     +V C+QHMCPIRVHWHVK SY ++WRVKITIT
Sbjct  276   AKCIESGDKPPPSVLKLPTEQQAAISPPLVTCSQHMCPIRVHWHVKQSYKEYWRVKITIT  335

Query  1110  NYNFAKNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAG  1289
             N NF KN+S WNLVV HPNL +V ++FSFNY  L  YG+INDTGMF+GI++YND++L +G
Sbjct  336   NLNFLKNYSDWNLVVQHPNLKSVRQLFSFNYHPLTTYGNINDTGMFWGIKFYNDMILTSG  395

Query  1290  EGGNVQTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
               GN Q+E+L++KD   FTFREGWAFPRRISFNG++CV+P PDDYP LPN A
Sbjct  396   NQGNAQSEMLLHKDEGIFTFREGWAFPRRISFNGDDCVMPPPDDYPTLPNIA  447



>ref|XP_007226624.1| hypothetical protein PRUPE_ppa022902mg [Prunus persica]
 gb|EMJ27823.1| hypothetical protein PRUPE_ppa022902mg [Prunus persica]
Length=388

 Score =   490 bits (1261),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 240/376 (64%), Positives = 287/376 (76%), Gaps = 14/376 (4%)
 Frame = +3

Query  336   VSIYNYQLYRHIDHPGWKLSWQWRGDG-VIWDMWGAEATEQGNCSAFKSG-QRPHCCEKE  509
             VSIYN+Q +RH+D PGWKLSW W+ D  VIWDMWGAEA EQGNCS F+S  Q PHCC+K+
Sbjct  2     VSIYNFQQFRHLDRPGWKLSWIWQDDDQVIWDMWGAEAMEQGNCSKFRSSPQLPHCCKKQ  61

Query  510   PVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEKYLAAFQMsigrvssksssgaavaapp  689
             PVIID LPG  +NKQF NCCKGG LSSM QD  K+L+AFQM++G   + + +        
Sbjct  62    PVIIDFLPGAPYNKQFSNCCKGGELSSMIQDSSKFLSAFQMNVGFGKTNNITEVMPT---  118

Query  690   ipgNFTLGVPGYTCGEAFEVPPTKFVEDHGRRTTQAVGTWNITCSYSQFRAQSSPTCCVS  869
                NFTLG+PGYTCG+AF V PT+   D GRR  Q + TWN+TC YSQFRA  SP CCVS
Sbjct  119   ---NFTLGIPGYTCGDAFLVSPTRSSPD-GRRWVQTLETWNVTCMYSQFRASPSPKCCVS  174

Query  870   LSTFYNKTIVSCPICTCGCEGQPGSAKCLKAGEQPP----VVQLQHYEPPQAIVQCTQHM  1037
             LS FYN TIV CP C+CGC+G PG AKCLK+GE+ P    + + Q  E    +V C+QHM
Sbjct  175   LSAFYNSTIVPCPKCSCGCQGLPG-AKCLKSGEKSPHLLELPRAQENEEVPPLVTCSQHM  233

Query  1038  CPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQ  1217
             CPIRVHWHVK SY ++WRVKITITN NF KN+S W+LVV HPNL +VT++FSFNY  LN 
Sbjct  234   CPIRVHWHVKQSYKEYWRVKITITNLNFVKNYSSWSLVVQHPNLRSVTQLFSFNYHPLNT  293

Query  1218  YGDINDTGMFYGIQYYNDVLLQAGEGGNVQTELLMNKDPATFTFREGWAFPRRISFNGEE  1397
             YG+INDTGMF+GI+ YND+LL +G+ GN Q+E+L+ KDP  FTFREGW FPRRISFNG+E
Sbjct  294   YGNINDTGMFWGIKSYNDMLLASGQSGNAQSEMLLQKDPGIFTFREGWTFPRRISFNGDE  353

Query  1398  CVLPQPDDYPRLPNSA  1445
             CV+P PD+YP LPNSA
Sbjct  354   CVMPPPDEYPTLPNSA  369



>ref|XP_008218770.1| PREDICTED: COBRA-like protein 6 [Prunus mume]
Length=393

 Score =   490 bits (1261),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 239/378 (63%), Positives = 289/378 (76%), Gaps = 14/378 (4%)
 Frame = +3

Query  330   VTVSIYNYQLYRHIDHPGWKLSWQWRGDG-VIWDMWGAEATEQGNCSAFKSG-QRPHCCE  503
             + VSIYN+Q +RH+D PGWKLSW W+ D  VIWDMWGAEA EQGNCS F+S  Q PHCC+
Sbjct  5     IKVSIYNFQQFRHLDRPGWKLSWIWKDDDQVIWDMWGAEAMEQGNCSKFRSSPQLPHCCK  64

Query  504   KEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEKYLAAFQMsigrvssksssgaavaa  683
             K+PVIID LPG  +NKQF NCCKGG LSSM QD  K+L+AFQM++G   + + +      
Sbjct  65    KQPVIIDFLPGAPYNKQFSNCCKGGELSSMIQDSSKFLSAFQMNVGFGKTNNITEVMPT-  123

Query  684   ppipgNFTLGVPGYTCGEAFEVPPTKFVEDHGRRTTQAVGTWNITCSYSQFRAQSSPTCC  863
                  NFTLG+PGYTCG+AF V PT+   D GRR  Q + TWN+TC YSQFRA  SP CC
Sbjct  124   -----NFTLGIPGYTCGDAFLVLPTRSSPD-GRRWVQTLETWNVTCMYSQFRASPSPKCC  177

Query  864   VSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAGEQPP----VVQLQHYEPPQAIVQCTQ  1031
             VSLS FYN TIV CP C+CGC+G PG AKCLK+GE+ P    + + +  E    +V C+Q
Sbjct  178   VSLSAFYNSTIVPCPKCSCGCQGLPG-AKCLKSGEKSPHLLELPRARENEEVPPLVTCSQ  236

Query  1032  HMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQWNLVVLHPNLGNVTRVFSFNYRTL  1211
             HMCPIRVHWHVK SY ++WRVKITITN NF KN+S W+LVV HPNL +VT++FSFNY  L
Sbjct  237   HMCPIRVHWHVKQSYKEYWRVKITITNLNFVKNYSSWSLVVQHPNLRSVTQLFSFNYHPL  296

Query  1212  NQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTELLMNKDPATFTFREGWAFPRRISFNG  1391
             N YG+INDTGMF+GI+ YND+LL +G+ GN Q+E+L++KDP  FTFREGW FPRRISFNG
Sbjct  297   NAYGNINDTGMFWGIKSYNDMLLASGQSGNAQSEMLLHKDPGIFTFREGWTFPRRISFNG  356

Query  1392  EECVLPQPDDYPRLPNSA  1445
             +ECV+P PD+YP LPNSA
Sbjct  357   DECVMPPPDEYPTLPNSA  374



>ref|XP_009397862.1| PREDICTED: COBRA-like protein 7 isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=416

 Score =   480 bits (1236),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 230/397 (58%), Positives = 289/397 (73%), Gaps = 10/397 (3%)
 Frame = +3

Query  264   LDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDMWGAE  443
             +DP+G+ITIKWD +  +    +V+VSIYNYQLYRHI+ PGW+L W W  D VIWDM GAE
Sbjct  1     MDPDGNITIKWDFMTNSGDMYMVSVSIYNYQLYRHIERPGWRLGWTWPNDEVIWDMRGAE  60

Query  444   ATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEKYLAA  623
              T QGNCS FK    PHCCEK P I+DLLPGT +N Q  NCC+GGVLSS+TQD    +A+
Sbjct  61    TTNQGNCSKFKGDNIPHCCEKSPTIVDLLPGTPYNMQTKNCCRGGVLSSLTQDRTLAMAS  120

Query  624   FQMsigrvssksssgaavaappipgNFTLGVPGYTCGEAFEVPPTKFVEDHGRRTTQAVG  803
             FQMS+   +  S +    +      NFTLG+PGYTC  A  V P+KF  D  +RTTQA+ 
Sbjct  121   FQMSMESANISSPATGKPS------NFTLGIPGYTCSNATVVAPSKFQFDK-QRTTQALM  173

Query  804   TWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAGEQPPVV  983
             TW ITCS+SQFR  ++P+CCVSLSTFYN TIVSCP C+CGC+G+P    C + GEQ   +
Sbjct  174   TWEITCSFSQFRESATPSCCVSLSTFYNSTIVSCPRCSCGCQGEPTLPTCSRDGEQSNFL  233

Query  984   QLQHYE---PPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQWNLVV  1154
             +L + +        V CT HMCPIRVHWHVK SY ++WRVK+TITN+N   N+S WNLV+
Sbjct  234   RLPNGDGGSTTSPAVLCTPHMCPIRVHWHVKESYREYWRVKVTITNFNMYSNYSDWNLVI  293

Query  1155  LHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTELLMNKDP  1334
              HPN  ++ ++FSFNY  L QYG+INDT MF+GI++YND+L+Q GE GNVQTE+L++KD 
Sbjct  294   QHPNFRSILQIFSFNYLPLVQYGEINDTAMFWGIKHYNDMLIQCGENGNVQTEMLLHKDA  353

Query  1335  ATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             A FTF  GWAFPRR+SFNG +CV+P PD YP +PN +
Sbjct  354   ADFTFGGGWAFPRRLSFNGHDCVMPPPDSYPTMPNGS  390



>ref|XP_002460985.1| hypothetical protein SORBIDRAFT_02g038720 [Sorghum bicolor]
 gb|EER97506.1| hypothetical protein SORBIDRAFT_02g038720 [Sorghum bicolor]
Length=458

 Score =   480 bits (1236),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 231/405 (57%), Positives = 288/405 (71%), Gaps = 12/405 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             D YDPLDPNG+ITIKWD+I+      V  VS+YNYQ YRHI  PGWKL W W    VIW 
Sbjct  36    DAYDPLDPNGNITIKWDVIQWTSDGYVAVVSLYNYQQYRHIQAPGWKLGWVWAKKEVIWA  95

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G +ATEQG+CS FK+   PHCC K+P ++DLLPGT +N Q  NCCKGGVL+S  QDP 
Sbjct  96    MTGGQATEQGDCSKFKT-NIPHCCRKDPEVVDLLPGTPYNMQIANCCKGGVLTSWAQDPS  154

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +A+FQ+S+G+  + + +           NFTL  PG  YTCG A  V PTKF+   GR
Sbjct  155   NAVASFQVSVGQAGTTNRTVKVPK------NFTLKAPGPGYTCGTAKLVTPTKFISPDGR  208

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKA  962
             R+TQA  TWN+TC+YSQF AQ SP+CCVSLS+FYN TIV+CP C+CGC+    +      
Sbjct  209   RSTQAHMTWNVTCTYSQFLAQRSPSCCVSLSSFYNDTIVNCPTCSCGCQNNSTAPGSCVE  268

Query  963   GEQP---PVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
             G  P    VV   +      +VQCT HMCPIRVHWHVK++Y ++WRVKIT+TN+N+  N+
Sbjct  269   GNSPYLASVVNDPNKNSLAPLVQCTSHMCPIRVHWHVKVNYKEYWRVKITVTNFNYRMNY  328

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             SQWNLV  HPN  N+T +FSFNY+ LN YG INDT M +GI+YYND+L+ AG  GNVQ+E
Sbjct  329   SQWNLVAQHPNFDNLTTIFSFNYKPLNPYGVINDTAMLWGIKYYNDLLMTAGPDGNVQSE  388

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             LL  K+P+TFTF++GWAFPRR+ FNG+ CV+P PD YP LPN++P
Sbjct  389   LLFRKEPSTFTFQKGWAFPRRVYFNGDNCVMPPPDAYPWLPNASP  433



>ref|XP_009397861.1| PREDICTED: COBRA-like protein 7 isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=419

 Score =   477 bits (1228),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 230/400 (58%), Positives = 291/400 (73%), Gaps = 13/400 (3%)
 Frame = +3

Query  264   LDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDMWGAE  443
             +DP+G+ITIKWD +  +    +V+VSIYNYQLYRHI+ PGW+L W W  D VIWDM GAE
Sbjct  1     MDPDGNITIKWDFMTNSGDMYMVSVSIYNYQLYRHIERPGWRLGWTWPNDEVIWDMRGAE  60

Query  444   ATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEKYLAA  623
              T QGNCS FK    PHCCEK P I+DLLPGT +N Q  NCC+GGVLSS+TQD    +A+
Sbjct  61    TTNQGNCSKFKGDNIPHCCEKSPTIVDLLPGTPYNMQTKNCCRGGVLSSLTQDRTLAMAS  120

Query  624   FQMsigrvssksssgaavaappipgNFTLGVPGYTCGEAFEVPPTKFVEDHGRRTTQAVG  803
             FQMS+   +  S +    +      NFTLG+PGYTC  A  V P+KF  D  +RTTQA+ 
Sbjct  121   FQMSMESANISSPATGKPS------NFTLGIPGYTCSNATVVAPSKFQFDK-QRTTQALM  173

Query  804   TWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGS---AKCLKAGEQP  974
             TW ITCS+SQFR  ++P+CCVSLSTFYN TIVSCP C+CGC+G+P     ++C + GEQ 
Sbjct  174   TWEITCSFSQFRESATPSCCVSLSTFYNSTIVSCPRCSCGCQGEPTHHLCSRCCRDGEQS  233

Query  975   PVVQLQHYE---PPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQWN  1145
               ++L + +        V CT HMCPIRVHWHVK SY ++WRVK+TITN+N   N+S WN
Sbjct  234   NFLRLPNGDGGSTTSPAVLCTPHMCPIRVHWHVKESYREYWRVKVTITNFNMYSNYSDWN  293

Query  1146  LVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTELLMN  1325
             LV+ HPN  ++ ++FSFNY  L QYG+INDT MF+GI++YND+L+Q GE GNVQTE+L++
Sbjct  294   LVIQHPNFRSILQIFSFNYLPLVQYGEINDTAMFWGIKHYNDMLIQCGENGNVQTEMLLH  353

Query  1326  KDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             KD A FTF  GWAFPRR+SFNG +CV+P PD YP +PN +
Sbjct  354   KDAADFTFGGGWAFPRRLSFNGHDCVMPPPDSYPTMPNGS  393



>ref|XP_004958241.1| PREDICTED: COBRA-like protein 1-like [Setaria italica]
Length=452

 Score =   478 bits (1230),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 230/409 (56%), Positives = 290/409 (71%), Gaps = 13/409 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             D YDPLDPNG+ITIKWD+++      V  VS+YNYQ YRHI  PGWKL W W    +IW 
Sbjct  30    DAYDPLDPNGNITIKWDVMQWTPDGYVAVVSLYNYQQYRHIQAPGWKLGWVWAKKEIIWA  89

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G +ATEQG+CS FKS   PHCC K+P I+DLLPGT +N Q  NCCKGGVL++  QDPE
Sbjct  90    MTGGQATEQGDCSKFKS-NIPHCCRKDPEIVDLLPGTPYNMQIANCCKGGVLTAWAQDPE  148

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +A+FQ+S+G+  + + +           NFTL  PG  YTCG A  V PTKF+   GR
Sbjct  149   NAVASFQISVGQAGTTNRTVKVPK------NFTLKAPGPGYTCGPAKLVKPTKFISQDGR  202

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKA  962
             R+TQA  TWN+TC+YSQF AQ SPTCCVSLS+FYN TIV+CP C+CGC+           
Sbjct  203   RSTQAHMTWNVTCTYSQFVAQRSPTCCVSLSSFYNDTIVNCPTCSCGCQNNSTEPGSCVE  262

Query  963   GEQPPVVQL----QHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKN  1130
             G  P +  +     +      +VQCT HMCPIRVHWHVK++Y ++WRVKIT++N+N+  N
Sbjct  263   GNSPYLASVVNDPNNKNNLAPLVQCTSHMCPIRVHWHVKVNYKEYWRVKITVSNFNYRMN  322

Query  1131  FSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQT  1310
             +SQWNLV  HPN  N+T +FSFNY++LN YG INDT M +GI+YYND+L+ AG  GNVQ+
Sbjct  323   YSQWNLVAQHPNFDNLTTIFSFNYKSLNPYGVINDTAMLWGIKYYNDLLMTAGPDGNVQS  382

Query  1311  ELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAPPHS  1457
             ELL  K+P+TFTF++GWAFPRR+ FNG+ CV+P PD YP LPN++P  S
Sbjct  383   ELLFRKEPSTFTFQKGWAFPRRVYFNGDNCVMPPPDAYPWLPNASPRQS  431



>ref|XP_006658783.1| PREDICTED: COBRA-like protein 1-like [Oryza brachyantha]
Length=448

 Score =   475 bits (1222),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 232/402 (58%), Positives = 289/402 (72%), Gaps = 10/402 (2%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YDPLDPNG+ITIKWD+++      V  VS+YNYQ YRHI  PGWKL W W    +IW 
Sbjct  29    EAYDPLDPNGNITIKWDVLQWTPDGYVAVVSLYNYQQYRHIQSPGWKLGWVWAKKEIIWA  88

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G +ATEQG+CS FKS   PHCC+K P I+DLLPGT +N Q  NCCKGGVL+S  QDP 
Sbjct  89    MNGGQATEQGDCSKFKS-NIPHCCKKNPEIVDLLPGTPYNMQIANCCKGGVLNSWAQDPA  147

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +A+FQ+S+G+  + + +           NFTL  PG  YTCG A  V PTKF    GR
Sbjct  148   NAVASFQVSVGQAGTTNKTVRVPR------NFTLKSPGPGYTCGSAKLVRPTKFFSQDGR  201

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGC-EGQPGSAKCLK  959
             RTTQA  TWN+TC+YSQ  AQ SPTCCVSLS+FYN TIV+CP C+CGC + +PGS     
Sbjct  202   RTTQAHMTWNVTCTYSQIVAQRSPTCCVSLSSFYNDTIVNCPTCSCGCQDNKPGSCVEGN  261

Query  960   AGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQ  1139
             +     VV + + +    +VQCT HMCPIRVHWHVK++Y ++WRVKIT+TN+N+  N+SQ
Sbjct  262   SPYLASVVNVNNKDSLAPLVQCTSHMCPIRVHWHVKVNYREYWRVKITVTNFNYRMNYSQ  321

Query  1140  WNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTELL  1319
             WNLV  HP+  N+T +FSFNY++LN YG INDT M +GI+YYND+L+ AG  GNVQ+ELL
Sbjct  322   WNLVTQHPSFDNLTTIFSFNYKSLNPYGVINDTAMLWGIKYYNDLLMTAGPDGNVQSELL  381

Query  1320  MNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
               KDP TFTF++GWAFPRRI FNG+ CV+P PD YP LPN++
Sbjct  382   FKKDPNTFTFQKGWAFPRRIYFNGDNCVMPPPDAYPWLPNAS  423



>ref|NP_001105970.1| brittle stalk-2-like protein 6 precursor [Zea mays]
 gb|ABL59986.1| brittle stalk-2-like protein 6 [Zea mays]
 gb|ACF88416.1| unknown [Zea mays]
 gb|ACL53060.1| unknown [Zea mays]
 gb|ACN33712.1| unknown [Zea mays]
 tpg|DAA63522.1| TPA: brittle stalk-2-like protein 6 [Zea mays]
Length=460

 Score =   475 bits (1223),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 231/410 (56%), Positives = 290/410 (71%), Gaps = 18/410 (4%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHP-GWKLSWQWRGDGVIWD  428
              YDPLDPNG+ITIKWD+I+      V  VS+YNYQ YRHI  P GW+L W W    VIW 
Sbjct  33    AYDPLDPNGNITIKWDVIQWTADGYVAVVSLYNYQQYRHIQAPPGWRLGWVWAKKEVIWA  92

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G +ATEQG+CS FK+   PHCC ++P ++DLLPGT +N Q  NCC+GGVL+S  QDP 
Sbjct  93    MTGGQATEQGDCSRFKASVLPHCCRRDPEVVDLLPGTPYNTQTANCCRGGVLASWAQDPS  152

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +A+FQ+S+G+  S + +           NFTL  PG  YTCG A  V PTKF+   GR
Sbjct  153   DAVASFQVSVGQAGSTNRTVKVPR------NFTLLAPGPGYTCGAAKLVKPTKFMSQDGR  206

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSA-----  947
             R+TQA  TWN+TC+YSQF AQ SPTCCVSLS+FYN TIVSCP C+CGC+    S+     
Sbjct  207   RSTQAHMTWNVTCTYSQFLAQRSPTCCVSLSSFYNDTIVSCPACSCGCQNNNSSSTAAPG  266

Query  948   KCLKAGEQPPVVQLQHYEPPQ----AIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNY  1115
              C++   + P +     +P +     +VQCT HMCP+RVHWHVK+SY ++WRVKIT+TN+
Sbjct  267   SCVEGSRRSPYLASVVNDPSKNSLAPLVQCTSHMCPVRVHWHVKVSYKEYWRVKITVTNF  326

Query  1116  NFAKNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEG  1295
             N+  N+SQWNLV  HPN  N+T +FSFNYR LN YG INDT M +GI+YYND+L+ AG  
Sbjct  327   NYRMNYSQWNLVAQHPNFDNLTTIFSFNYRPLNPYGVINDTAMLWGIKYYNDLLMTAGPD  386

Query  1296  GNVQTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             GNVQ+ELL  K+P+TFTF +GWAFPRR+ FNG+ CV+P PD YP LPN+A
Sbjct  387   GNVQSELLFRKEPSTFTFHKGWAFPRRVYFNGDNCVMPPPDAYPWLPNAA  436



>gb|EAZ04637.1| hypothetical protein OsI_26785 [Oryza sativa Indica Group]
Length=446

 Score =   474 bits (1221),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 231/402 (57%), Positives = 288/402 (72%), Gaps = 10/402 (2%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YDPLDPNG+ITIKWD+++      V  VS+YNYQ YRHI  PGWKL W W    +IW 
Sbjct  27    EAYDPLDPNGNITIKWDVLQWTPDGYVAVVSLYNYQQYRHIQSPGWKLGWVWAKKEIIWA  86

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G +ATEQG+CS FKS   PHCC+K+P I+DLLPGT +N Q  NCCKGGVL+S  QDP 
Sbjct  87    MNGGQATEQGDCSKFKS-NIPHCCKKDPEIVDLLPGTPYNMQIANCCKGGVLNSWAQDPA  145

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +A+FQ+S+G+  + + +           NFTL  PG  YTCG A  V PTKF    GR
Sbjct  146   NAIASFQVSVGQAGTTNKTVRVPR------NFTLKSPGPGYTCGSAKVVRPTKFFSQDGR  199

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG-QPGSAKCLK  959
             RTTQA  TWN+TC+YSQ  AQ SPTCCVSLS+FYN TIV+CP C+CGC+  +PGS     
Sbjct  200   RTTQAHMTWNVTCTYSQIVAQRSPTCCVSLSSFYNDTIVNCPTCSCGCQNNKPGSCVEGN  259

Query  960   AGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQ  1139
             +     VV   + +    +VQCT HMCPIRVHWHVK++Y ++WRVKIT+TN+N+  N+SQ
Sbjct  260   SPYLASVVNTHNKDSLTPLVQCTSHMCPIRVHWHVKVNYKEYWRVKITVTNFNYRMNYSQ  319

Query  1140  WNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTELL  1319
             WNLV  HP+  N+T +FSFNY++LN YG INDT M +GI+YYND+L+ AG  GNVQ+ELL
Sbjct  320   WNLVTQHPSFDNLTTIFSFNYKSLNPYGVINDTAMLWGIKYYNDLLMTAGPDGNVQSELL  379

Query  1320  MNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
               KDP +FTF +GWAFPRRI FNG+ CV+P PD YP LPN++
Sbjct  380   FKKDPKSFTFEKGWAFPRRIYFNGDNCVMPPPDAYPWLPNAS  421



>ref|XP_009397863.1| PREDICTED: COBRA-like protein 3 isoform X3 [Musa acuminata subsp. 
malaccensis]
Length=415

 Score =   473 bits (1216),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 228/397 (57%), Positives = 287/397 (72%), Gaps = 11/397 (3%)
 Frame = +3

Query  264   LDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDMWGAE  443
             +DP+G+ITIKWD +  +    +V+VSIYNYQLYRHI+ PGW+L W W  D VIWDM GAE
Sbjct  1     MDPDGNITIKWDFMTNSGDMYMVSVSIYNYQLYRHIERPGWRLGWTWPNDEVIWDMRGAE  60

Query  444   ATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEKYLAA  623
              T QGNCS FK    PHCCEK P I+DLLPGT +N Q  NCC+GGVLSS+TQD    +A+
Sbjct  61    TTNQGNCSKFKGDNIPHCCEKSPTIVDLLPGTPYNMQTKNCCRGGVLSSLTQDRTLAMAS  120

Query  624   FQMsigrvssksssgaavaappipgNFTLGVPGYTCGEAFEVPPTKFVEDHGRRTTQAVG  803
             FQMS+   +  S +    +      NFTLG+PGYTC  A  V P+KF  D  +RTTQA+ 
Sbjct  121   FQMSMESANISSPATGKPS------NFTLGIPGYTCSNATVVAPSKFQFDK-QRTTQALM  173

Query  804   TWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAGEQPPVV  983
             TW ITCS+SQFR  ++P+CCVSLSTFYN TIVSCP C+CGC+G+P    C +    P  +
Sbjct  174   TWEITCSFSQFRESATPSCCVSLSTFYNSTIVSCPRCSCGCQGEPTLPTCSRQAS-PYFL  232

Query  984   QLQHYE---PPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQWNLVV  1154
             +L + +        V CT HMCPIRVHWHVK SY ++WRVK+TITN+N   N+S WNLV+
Sbjct  233   RLPNGDGGSTTSPAVLCTPHMCPIRVHWHVKESYREYWRVKVTITNFNMYSNYSDWNLVI  292

Query  1155  LHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTELLMNKDP  1334
              HPN  ++ ++FSFNY  L QYG+INDT MF+GI++YND+L+Q GE GNVQTE+L++KD 
Sbjct  293   QHPNFRSILQIFSFNYLPLVQYGEINDTAMFWGIKHYNDMLIQCGENGNVQTEMLLHKDA  352

Query  1335  ATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             A FTF  GWAFPRR+SFNG +CV+P PD YP +PN +
Sbjct  353   ADFTFGGGWAFPRRLSFNGHDCVMPPPDSYPTMPNGS  389



>ref|NP_001060219.2| Os07g0604300 [Oryza sativa Japonica Group]
 sp|Q6Z4G8.1|COBL1_ORYSJ RecName: Full=COBRA-like protein 1; AltName: Full=Protein BRITTLE 
CULM1-like 6; Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAC83872.1| putative phytochelatin synthetase [Oryza sativa Japonica Group]
 gb|EAZ40580.1| hypothetical protein OsJ_25037 [Oryza sativa Japonica Group]
 dbj|BAG95261.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00705.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF22133.2| Os07g0604300 [Oryza sativa Japonica Group]
Length=446

 Score =   474 bits (1219),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 230/402 (57%), Positives = 288/402 (72%), Gaps = 10/402 (2%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YDPLDPNG+ITIKWD+++      V  VS+YNYQ YRHI  PGWKL W W    +IW 
Sbjct  27    EAYDPLDPNGNITIKWDVLQWTPDGYVAVVSLYNYQQYRHIQSPGWKLGWVWAKKEIIWA  86

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G +ATEQG+CS FKS   PHCC+K+P I+DLLPGT +N Q  NCCKGGVL+S  QDP 
Sbjct  87    MNGGQATEQGDCSKFKS-NIPHCCKKDPEIVDLLPGTPYNMQIANCCKGGVLNSWAQDPA  145

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +A+FQ+S+G+  + + +           NFTL  PG  YTCG A  V PTKF    GR
Sbjct  146   NAIASFQVSVGQAGTTNKTVRVPR------NFTLKSPGPGYTCGSAKVVRPTKFFSQDGR  199

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG-QPGSAKCLK  959
             RTTQA  TWN+TC+YSQ  AQ SPTCCVSLS+FYN TIV+CP C+CGC+  +PGS     
Sbjct  200   RTTQAHMTWNVTCTYSQIVAQRSPTCCVSLSSFYNDTIVNCPTCSCGCQNNKPGSCVEGN  259

Query  960   AGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQ  1139
             +     VV   + +    +VQCT HMCPIRVHWHVK++Y ++WRVKIT+TN+N+  N+SQ
Sbjct  260   SPYLASVVNTHNKDSLTPLVQCTSHMCPIRVHWHVKVNYKEYWRVKITVTNFNYRMNYSQ  319

Query  1140  WNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTELL  1319
             WNLV  HP+  N+T +FSFNY++LN YG INDT M +GI+YYND+L+ AG  GNVQ+ELL
Sbjct  320   WNLVTQHPSFDNLTTIFSFNYKSLNPYGVINDTAMLWGIKYYNDLLMTAGPDGNVQSELL  379

Query  1320  MNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
               KDP +FTF +GWAFPRR+ FNG+ CV+P PD YP LPN++
Sbjct  380   FKKDPKSFTFEKGWAFPRRVYFNGDNCVMPPPDAYPWLPNAS  421



>ref|XP_009397865.1| PREDICTED: COBRA-like protein 7 isoform X4 [Musa acuminata subsp. 
malaccensis]
Length=414

 Score =   473 bits (1216),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 228/397 (57%), Positives = 288/397 (73%), Gaps = 12/397 (3%)
 Frame = +3

Query  264   LDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDMWGAE  443
             +DP+G+ITIKWD +  +    +V+VSIYNYQLYRHI+ PGW+L W W  D VIWDM GAE
Sbjct  1     MDPDGNITIKWDFMTNSGDMYMVSVSIYNYQLYRHIERPGWRLGWTWPNDEVIWDMRGAE  60

Query  444   ATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEKYLAA  623
              T QGNCS FK    PHCCEK P I+DLLPGT +N Q  NCC+GGVLSS+TQD    +A+
Sbjct  61    TTNQGNCSKFKGDNIPHCCEKSPTIVDLLPGTPYNMQTKNCCRGGVLSSLTQDRTLAMAS  120

Query  624   FQMsigrvssksssgaavaappipgNFTLGVPGYTCGEAFEVPPTKFVEDHGRRTTQAVG  803
             FQMS+   +  S +    +      NFTLG+PGYTC  A  V P+KF  D  +RTTQA+ 
Sbjct  121   FQMSMESANISSPATGKPS------NFTLGIPGYTCSNATVVAPSKFQFDK-QRTTQALM  173

Query  804   TWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAGEQPPVV  983
             TW ITCS+SQFR  ++P+CCVSLSTFYN TIVSCP C+CGC+G+P    C +  +Q   +
Sbjct  174   TWEITCSFSQFRESATPSCCVSLSTFYNSTIVSCPRCSCGCQGEPTLPTCSR--QQSNFL  231

Query  984   QLQHYE---PPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQWNLVV  1154
             +L + +        V CT HMCPIRVHWHVK SY ++WRVK+TITN+N   N+S WNLV+
Sbjct  232   RLPNGDGGSTTSPAVLCTPHMCPIRVHWHVKESYREYWRVKVTITNFNMYSNYSDWNLVI  291

Query  1155  LHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTELLMNKDP  1334
              HPN  ++ ++FSFNY  L QYG+INDT MF+GI++YND+L+Q GE GNVQTE+L++KD 
Sbjct  292   QHPNFRSILQIFSFNYLPLVQYGEINDTAMFWGIKHYNDMLIQCGENGNVQTEMLLHKDA  351

Query  1335  ATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             A FTF  GWAFPRR+SFNG +CV+P PD YP +PN +
Sbjct  352   ADFTFGGGWAFPRRLSFNGHDCVMPPPDSYPTMPNGS  388



>ref|XP_009395002.1| PREDICTED: COBRA-like protein 1 [Musa acuminata subsp. malaccensis]
Length=457

 Score =   473 bits (1218),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 230/407 (57%), Positives = 295/407 (72%), Gaps = 18/407 (4%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDPNG+ITIKWDI++      V  V+++N+Q YRHI  PGW L W W    VIW 
Sbjct  38    EAYDSLDPNGNITIKWDIMQWTPDGYVAVVTMFNFQQYRHIQAPGWTLGWTWAKKEVIWS  97

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ TEQG+CS FK G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGV++S  QDP 
Sbjct  98    MVGAQTTEQGDCSRFK-GNTPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVINSWVQDPA  156

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                ++FQ+S+G   + + +           NFTL  PG  YTCG A  V PTKFV   GR
Sbjct  157   NAASSFQVSVGAAGTTNKTVRVPK------NFTLRAPGPGYTCGIAKIVKPTKFVTQDGR  210

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG---QPGSAKC  953
             RTTQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN TIV+CP CTCGC+    QPGS  C
Sbjct  211   RTTQALMTWNVTCTYSQFLAQKTPTCCVSLSSFYNDTIVNCPTCTCGCQNNATQPGS--C  268

Query  954   LKAGEQPPVVQLQHYEPPQA---IVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFA  1124
             ++ G+ P +    +     +   +VQCT HMCP+RVHWHVKL+Y ++WRVKI ITN+N+ 
Sbjct  269   VE-GDSPYLASAVNGPGKNSFTPLVQCTSHMCPVRVHWHVKLNYKEYWRVKIAITNFNYR  327

Query  1125  KNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNV  1304
              N++QWNLV+ HPNL N+T++FSFNY++L  YG INDT M +G++YYND+L++AG  GNV
Sbjct  328   MNYTQWNLVIQHPNLDNLTQLFSFNYKSLTPYGGINDTAMLWGVKYYNDLLMEAGPYGNV  387

Query  1305  QTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             Q+ELL  KDP+TFTF +GWAFPRRI FNG+ CV+P PD YP LPN+A
Sbjct  388   QSELLFKKDPSTFTFEKGWAFPRRIYFNGDNCVMPPPDSYPWLPNAA  434



>ref|XP_009386184.1| PREDICTED: COBRA-like protein 1 [Musa acuminata subsp. malaccensis]
Length=460

 Score =   473 bits (1218),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 229/411 (56%), Positives = 293/411 (71%), Gaps = 24/411 (6%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YDPLDPNG+ITIKWD+++      V  V+I+N+Q YRHI  PGW L W W    VIW 
Sbjct  38    EAYDPLDPNGNITIKWDVMQWAPDGYVAVVTIFNFQQYRHIQAPGWMLGWTWAKKEVIWS  97

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G +ATEQG+CS FK G  PHCC+K+P ++DLLPGT +N Q  NCCKGG++SS  QDP 
Sbjct  98    MVGGQATEQGDCSRFK-GNIPHCCKKDPSVVDLLPGTPYNMQIANCCKGGIISSWVQDPA  156

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                ++FQ+S+G   + + +           NFTL  PG  YTCG A  V P++FV   GR
Sbjct  157   NAASSFQISVGAAGTTNKTVRVPK------NFTLKSPGPGYTCGAAKIVKPSRFVSQDGR  210

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG---QPGSAKC  953
             RTTQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN TIV+CP C+CGC+    QPGS  C
Sbjct  211   RTTQALMTWNVTCTYSQFLAQKTPTCCVSLSSFYNDTIVNCPTCSCGCQNNITQPGS--C  268

Query  954   LKAGEQPPVVQL------QHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNY  1115
             ++ G+ P +           + P   +VQCT HMCPIRVHWH+KL+Y ++WRVKI ITN+
Sbjct  269   VE-GDSPYLASAINGPGKSSFTP---LVQCTSHMCPIRVHWHIKLNYREYWRVKIAITNF  324

Query  1116  NFAKNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEG  1295
             N+  N++QWNLV+ HPN  N+T++FSFNY +L  YG INDT M +GI+YYND+L+QAG  
Sbjct  325   NYRMNYTQWNLVIQHPNFDNLTQIFSFNYNSLTPYGGINDTAMLWGIKYYNDLLMQAGPS  384

Query  1296  GNVQTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             GNVQ+ELL  KD + FTF++GWAFPRRI FNG+ CV+P PD YPRLPN +P
Sbjct  385   GNVQSELLFQKDASAFTFQKGWAFPRRIYFNGDNCVMPPPDAYPRLPNDSP  435



>ref|XP_009415817.1| PREDICTED: COBRA-like protein 1 [Musa acuminata subsp. malaccensis]
Length=458

 Score =   473 bits (1218),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 230/407 (57%), Positives = 295/407 (72%), Gaps = 18/407 (4%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDPNG+ITIKWDI++      V  V+I+N+Q YRHI  PGW L W W    VIW 
Sbjct  40    EAYDSLDPNGNITIKWDIMQWTPDGYVAVVTIFNFQQYRHIQAPGWILGWTWAKKEVIWS  99

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ TEQG+CS FK G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGV++S  QDP 
Sbjct  100   MVGAQTTEQGDCSRFK-GNTPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVINSWVQDPA  158

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                ++FQ+S+G   + + +           NFTL  PG  YTCG A  V PTKFV   GR
Sbjct  159   NAASSFQVSVGAAGTTNKTVRVPK------NFTLRAPGPGYTCGIAKIVKPTKFVTQDGR  212

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG---QPGSAKC  953
             RTTQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN TIV+CP CTCGC+    QPGS  C
Sbjct  213   RTTQALMTWNVTCTYSQFLAQKTPTCCVSLSSFYNDTIVNCPTCTCGCQNNATQPGS--C  270

Query  954   LKAGEQPPVVQLQHYEPPQA---IVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFA  1124
             ++ G+ P +  + +     +   +VQCT HMCP+RVHWHVKL+Y ++WRVKI ITN+N+ 
Sbjct  271   VE-GDSPYLASVINGPGKNSFTPLVQCTSHMCPVRVHWHVKLNYKEYWRVKIAITNFNYR  329

Query  1125  KNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNV  1304
              N++QWNLV+ HPNL N+T++FSFNY++L  YG INDT M +G++YYND L++AG  GNV
Sbjct  330   MNYTQWNLVIQHPNLDNLTQLFSFNYKSLTPYGGINDTAMLWGVKYYNDFLMEAGPYGNV  389

Query  1305  QTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             Q+ELL  KDP+TFTF +GWAFPRR+ FNG+ CV+P PD YP LPN+A
Sbjct  390   QSELLFRKDPSTFTFEKGWAFPRRVYFNGDNCVMPPPDSYPWLPNAA  436



>ref|XP_010939207.1| PREDICTED: COBRA-like protein 1 [Elaeis guineensis]
Length=460

 Score =   473 bits (1217),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 233/411 (57%), Positives = 296/411 (72%), Gaps = 24/411 (6%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDPNG+ITIKWD+++      V  V+I+N+Q YRHI  PGW L W W    VIW 
Sbjct  39    EAYDSLDPNGNITIKWDVMQWTPDGYVAVVTIFNFQQYRHIQTPGWTLGWTWAKKEVIWS  98

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ TEQG+CS FK G  PHCC+K+P ++DLLPGT +N Q  NCCKGGV+SS  QDP 
Sbjct  99    MVGAQTTEQGDCSRFK-GNIPHCCKKDPTVVDLLPGTPYNMQIANCCKGGVISSWVQDPA  157

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                ++FQ+S+G+  + + +           NFTL  PG  YTCG A  V PTKF+   GR
Sbjct  158   NAASSFQLSVGQAGTTNKTVRVPK------NFTLRAPGPGYTCGIAKIVKPTKFISQDGR  211

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG---QPGSAKC  953
             RTTQA+ TWN+TC+YSQF +Q +PTCCVSLS+FYN TIV+CP CTCGC+    QPGS  C
Sbjct  212   RTTQALMTWNVTCTYSQFLSQKTPTCCVSLSSFYNDTIVNCPTCTCGCQNNITQPGS--C  269

Query  954   LKAGEQPPVVQLQH------YEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNY  1115
             ++ G+ P +    +      Y P   +VQCT HMCPIRVHWHVKL+Y ++WRVKITITN+
Sbjct  270   VE-GDSPYLASAINGPGKYSYTP---LVQCTSHMCPIRVHWHVKLNYKEYWRVKITITNF  325

Query  1116  NFAKNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEG  1295
             N+  N++QWNLVV HPN  N+T++FSFNY++L  YG INDT M +GI+YYND+L+ AG  
Sbjct  326   NYRMNYTQWNLVVQHPNFDNLTQIFSFNYKSLTPYGAINDTAMLWGIKYYNDLLMAAGPF  385

Query  1296  GNVQTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             GNVQ+ELL  KD +TFTF++GWAFPRRI FNG+ CV+P PD YP LPN++P
Sbjct  386   GNVQSELLFRKDSSTFTFQKGWAFPRRIYFNGDNCVMPPPDAYPWLPNASP  436



>ref|XP_010936446.1| PREDICTED: COBRA-like protein 1 [Elaeis guineensis]
Length=547

 Score =   476 bits (1224),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 235/411 (57%), Positives = 294/411 (72%), Gaps = 24/411 (6%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDPNG+ITIKWDI++      V  V++YN+Q YRHI  PGW L W W    VIW 
Sbjct  126   EAYDSLDPNGNITIKWDIMQWTPDGYVAVVTMYNFQQYRHIQAPGWTLGWTWAKKEVIWS  185

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ TEQG+CS FK G  PHCC+K+P ++DLLPGT +N Q  NCCKGGV+SS  QDP 
Sbjct  186   MVGAQTTEQGDCSKFK-GNIPHCCKKDPTVVDLLPGTPYNMQIANCCKGGVISSWIQDPA  244

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                ++FQ+S GR  + + +           NFTL  PG  YTCG A  V PTKFV   GR
Sbjct  245   NAASSFQISAGRAGTTNKTVRVPK------NFTLNAPGPGYTCGAAKIVKPTKFVTADGR  298

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG---QPGSAKC  953
             RTTQA+ TWN+TC+YSQF +Q +PTCCVSLS+FYN TIV+CP CTCGC+    QPGS  C
Sbjct  299   RTTQALMTWNVTCTYSQFLSQKTPTCCVSLSSFYNDTIVNCPTCTCGCQNNITQPGS--C  356

Query  954   LKAGEQPPVVQLQH------YEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNY  1115
             ++ G+ P +    +      Y P   +VQCT HMCPIRVHWHVKL+Y ++WRVK+TITN+
Sbjct  357   VE-GDSPYLASALNGPGKYSYTP---LVQCTSHMCPIRVHWHVKLNYKEYWRVKVTITNF  412

Query  1116  NFAKNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEG  1295
             N+  N++QWNLVV HPN  N+T++FSFNY++L  YG INDT M +GI+YYND+L+ AG  
Sbjct  413   NYRMNYTQWNLVVQHPNFDNLTQIFSFNYKSLTPYGGINDTAMLWGIKYYNDLLMAAGPL  472

Query  1296  GNVQTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             GNVQ+ELL  KD +TFTF +GWAFPRRI FNG+ CV+P PD YP LPN++P
Sbjct  473   GNVQSELLFQKDSSTFTFEKGWAFPRRIYFNGDNCVMPSPDAYPWLPNASP  523



>ref|XP_007148542.1| hypothetical protein PHAVU_006G217400g [Phaseolus vulgaris]
 gb|ESW20536.1| hypothetical protein PHAVU_006G217400g [Phaseolus vulgaris]
Length=414

 Score =   469 bits (1206),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 227/398 (57%), Positives = 279/398 (70%), Gaps = 26/398 (7%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDM  431
             G+D LDP G+ITI WD    N  +  V VS+ N QL+RH++ PGW L W W+GD VIW M
Sbjct  18    GFDSLDPLGNITITWDYFSDNGNSVDVRVSLNNLQLFRHVEEPGWNLGWAWKGDEVIWAM  77

Query  432   WGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEK  611
              GAEA EQGNC+ F+  Q+PHCC+KEPVIIDL+PGT +N Q  NCCKGGVL+S+ QD  K
Sbjct  78    LGAEAKEQGNCTRFRGQQKPHCCQKEPVIIDLMPGTPYNMQTANCCKGGVLTSLKQDHSK  137

Query  612   YLAAFQMsigrvssksssgaavaappipgNFTLGVPGYTCGEAFEVPPTKFVEDHGRRTT  791
               A FQM+  + S   S G+         NFTLGVPGY+CG  F+VPPTKF +D G R  
Sbjct  138   GGATFQMNYIKASVSDSGGSFSMPE----NFTLGVPGYSCGTPFQVPPTKFTKD-GHRWQ  192

Query  792   QAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAGEQ  971
             Q + TWN+TC YSQF A  +PTCCVSLS FYN TIV CP C+C C+G PG+  C      
Sbjct  193   QVLETWNVTCIYSQFLASPTPTCCVSLSAFYNSTIVPCPTCSCNCQGLPGATNC------  246

Query  972   PPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQWNLV  1151
                            V+C+ HMCPI +HWHVK SY +HWRVKITITN NF KN+SQWNLV
Sbjct  247   ---------------VECSHHMCPISIHWHVKQSYKEHWRVKITITNMNFVKNYSQWNLV  291

Query  1152  VLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTELLMNKD  1331
              +HPN  +VT+VFSFN++TL+ Y + +D GMF+G+ YYND LL  GE G+VQTE+L++KD
Sbjct  292   AVHPNFRSVTQVFSFNFQTLSVYANFSDIGMFWGLPYYNDRLLTHGENGHVQTEVLLHKD  351

Query  1332  PATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
                F F EGW+FPR+ISFNG+ECV+P PD YP LPN+A
Sbjct  352   RGEFRFNEGWSFPRKISFNGDECVMPSPDAYPTLPNTA  389



>ref|XP_006431744.1| hypothetical protein CICLE_v10001652mg [Citrus clementina]
 gb|ESR44984.1| hypothetical protein CICLE_v10001652mg [Citrus clementina]
Length=355

 Score =   466 bits (1200),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 225/341 (66%), Positives = 265/341 (78%), Gaps = 10/341 (3%)
 Frame = +3

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             MWGAEATEQGNCS F  GQ PHCCEK PVI+DLLPG  +N+Q  NCCKGGVLSS+TQDP 
Sbjct  1     MWGAEATEQGNCSKFTGGQLPHCCEKSPVIVDLLPGAPYNQQTANCCKGGVLSSLTQDPS  60

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPGYTCGEAFEVPPTKFVEDHGRRT  788
             K++A FQM++G  +  +             NFTLG+PGYTCG A EVPP+KF  D GRR 
Sbjct  61    KFVAGFQMNVGGSADYTGFQMPE-------NFTLGIPGYTCGNATEVPPSKFYSDGGRRR  113

Query  789   TQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAGE  968
             TQA+ TWN+TC YSQF A SSP CCVSLS FYN TIV CP C+C C+G    A C+K GE
Sbjct  114   TQALRTWNVTCIYSQFMASSSPKCCVSLSAFYNNTIVPCPKCSCHCQGL-SPANCIKYGE  172

Query  969   QPPVVQLQH--YEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQW  1142
              P ++Q +H   +    +V C+QHMCP+RVHWHVK SYTQ+WRVKITITN N  +N+SQW
Sbjct  173   TPSLLQQKHDPNKEQSPVVICSQHMCPVRVHWHVKQSYTQYWRVKITITNLNVVQNYSQW  232

Query  1143  NLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTELLM  1322
             NLV LHPNL +VT+VFSFNY+ LNQYG INDTGMF+GI++YND+LLQAGE GNVQTE+L+
Sbjct  233   NLVALHPNLQSVTQVFSFNYKPLNQYGYINDTGMFWGIEFYNDMLLQAGESGNVQTEMLL  292

Query  1323  NKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             +KD   FTFREGW FPRRI FNG+ECV+P PDDYPRLPN+A
Sbjct  293   HKDSGIFTFREGWGFPRRILFNGDECVMPLPDDYPRLPNNA  333



>ref|XP_009151763.1| PREDICTED: COBRA-like protein 2 [Brassica rapa]
 emb|CDX86358.1| BnaA06g30750D [Brassica napus]
Length=436

 Score =   469 bits (1207),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 229/401 (57%), Positives = 286/401 (71%), Gaps = 13/401 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDP G+ITIKWDII       V  VSI+N+Q YRHI  PGW+L W W    VIW 
Sbjct  25    EAYDALDPTGNITIKWDIISWTADGYVAVVSIFNFQQYRHIQAPGWQLGWSWYKKEVIWS  84

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ATEQG+CS FK G  PHCC+K P ++DLLPGT +N+Q  NCC+GGV+SS  QDP 
Sbjct  85    MVGAQATEQGDCSKFK-GNIPHCCKKTPTVVDLLPGTPYNQQISNCCRGGVISSWAQDPA  143

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +++FQ+S+G+  + +++  A        N TL  PG  YTCG A  VPPTKF+ +  R
Sbjct  144   TAVSSFQISVGQSGTTNTTVRAPR------NVTLKAPGPGYTCGPAKVVPPTKFISNDKR  197

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKA  962
             R TQA+ TWN+TC+YSQF AQ +PTCCVSLS FYNKTIV CP C+CGC+    +  C+  
Sbjct  198   RKTQAMLTWNMTCTYSQFLAQKTPTCCVSLSAFYNKTIVPCPTCSCGCQ----NGTCVDP  253

Query  963   GEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQW  1142
                  V  L      Q ++QCTQHMCPIRVHWHVK +Y ++WRVK+TITN+N+  N+SQW
Sbjct  254   KIASVVPALSGKNNLQPLLQCTQHMCPIRVHWHVKTNYKEYWRVKVTITNFNYNMNYSQW  313

Query  1143  NLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTELLM  1322
             NLVV HPN  N+T++FSFNY+ L+ Y  INDT M +GI++YND L QAG  GNVQ+ELL 
Sbjct  314   NLVVQHPNFDNITQLFSFNYKPLSPYSGINDTAMLWGIKFYNDFLSQAGPIGNVQSELLF  373

Query  1323  NKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
              KDP+TFTF +GWAFPRRI FNG+ CV+P PD YP LPN+A
Sbjct  374   QKDPSTFTFEKGWAFPRRIYFNGDNCVMPPPDSYPWLPNAA  414



>emb|CDX85277.1| BnaC07g25880D [Brassica napus]
Length=436

 Score =   469 bits (1206),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 229/401 (57%), Positives = 286/401 (71%), Gaps = 13/401 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDP G+ITIKWDII       V  VSI+N+Q YRHI  PGW+L W W    VIW 
Sbjct  25    EAYDALDPTGNITIKWDIISWTADGYVAVVSIFNFQQYRHIQAPGWQLGWSWYKKEVIWS  84

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ATEQG+CS FK G  PHCC+K P ++DLLPGT +N+Q  NCC+GGV+SS  QDP 
Sbjct  85    MVGAQATEQGDCSKFK-GNIPHCCKKTPTVVDLLPGTPYNQQISNCCRGGVISSWAQDPA  143

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +++FQ+S+G+  + +++  A        N TL  PG  YTCG A  VPPTKF+ +  R
Sbjct  144   TAVSSFQISVGQSGTTNTTVRAPR------NVTLKAPGPGYTCGPAKVVPPTKFISNDKR  197

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKA  962
             R TQA+ TWN+TC+YSQF AQ +PTCCVSLS FYNKTIV CP C+CGC+    +  C+  
Sbjct  198   RKTQAMLTWNMTCTYSQFLAQKTPTCCVSLSAFYNKTIVPCPTCSCGCQ----NGTCVDP  253

Query  963   GEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQW  1142
                  V  L      Q ++QCTQHMCPIRVHWHVK +Y ++WRVK+TITN+N+  N+SQW
Sbjct  254   KIASVVPALSGKNNLQQLLQCTQHMCPIRVHWHVKTNYKEYWRVKVTITNFNYNMNYSQW  313

Query  1143  NLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTELLM  1322
             NLVV HPN  N+T++FSFNY+ L+ Y  INDT M +GI++YND L QAG  GNVQ+ELL 
Sbjct  314   NLVVQHPNFDNITQLFSFNYKPLSPYSGINDTAMLWGIKFYNDFLSQAGPIGNVQSELLF  373

Query  1323  NKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
              KDP+TFTF +GWAFPRRI FNG+ CV+P PD YP LPN+A
Sbjct  374   QKDPSTFTFEKGWAFPRRIYFNGDNCVMPPPDSYPWLPNAA  414



>ref|XP_003527117.1| PREDICTED: protein COBRA [Glycine max]
Length=456

 Score =   469 bits (1208),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 225/403 (56%), Positives = 287/403 (71%), Gaps = 11/403 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YDPLDP G+ITIKWD+I       V  V++YN+Q YRHI  PGW L W W    VIW+
Sbjct  36    EAYDPLDPTGNITIKWDVISWTPDGYVAVVTMYNFQQYRHIQAPGWSLGWTWAKKEVIWN  95

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ TEQG+CS FK+G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGVL+S  QDP 
Sbjct  96    MMGAQTTEQGDCSKFKAG-IPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVLNSWGQDPS  154

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +++FQ+S+G   + + +           NFTL  PG  YTCG A  V PT F+ +  R
Sbjct  155   NAVSSFQISVGSAGTTNKTVKMPK------NFTLKAPGPGYTCGPAKVVKPTVFITNDKR  208

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG--QPGSAKCL  956
             RTTQA+ TWNITC+YSQF AQ +P+CCVSLS+FYN T+V+CP CTCGC    +PGS    
Sbjct  209   RTTQAMMTWNITCTYSQFLAQKAPSCCVSLSSFYNDTVVNCPTCTCGCRNKTEPGSCVDP  268

Query  957   KAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFS  1136
              +     VV          +VQCT HMCPIRVHWHVKL+Y ++WRVKITITN+N+  N+S
Sbjct  269   NSPHLASVVSASGKTANTPLVQCTSHMCPIRVHWHVKLNYKEYWRVKITITNFNYRMNYS  328

Query  1137  QWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTEL  1316
             QWNLVV HPNL N+T++FSFNY++LN Y  +NDT M +G+++YND L  AG  GNVQ+E+
Sbjct  329   QWNLVVQHPNLDNITQLFSFNYKSLNPYEGLNDTSMLWGVKFYNDFLSSAGSLGNVQSEI  388

Query  1317  LMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             L+ KD +TFTF +GWAFPRRI FNG+ CV+P PD YP LPN++
Sbjct  389   LLRKDKSTFTFDKGWAFPRRIYFNGDNCVMPPPDAYPWLPNAS  431



>ref|XP_009602801.1| PREDICTED: COBRA-like protein 6 isoform X3 [Nicotiana tomentosiformis]
Length=382

 Score =   467 bits (1201),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 222/325 (68%), Positives = 261/325 (80%), Gaps = 6/325 (2%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDM  431
             GYDPLDPNG+ITIKWDI+  N+ +Q V VSI+NYQL+RHID PGWKLSW W G+ VIWDM
Sbjct  20    GYDPLDPNGNITIKWDIMLNNEGSQDVKVSIFNYQLFRHIDQPGWKLSWSWPGNEVIWDM  79

Query  432   WGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEK  611
              GAEATEQG+CSA K+ Q PHCCEKEPVI+DLL G  +NKQ  NCC+GGVL+S+TQDP K
Sbjct  80    SGAEATEQGDCSAIKATQPPHCCEKEPVIVDLLSGAPYNKQVANCCRGGVLTSLTQDPGK  139

Query  612   YLAAFQMsigrvssksssgaavaappipgNFTLGVPGYTCGEAFEVPPTKFVEDHGRRTT  791
             Y A+FQM+IG  S   S            NFTLG+PGYTCG+ F+VPP+KF  D GRR T
Sbjct  140   YGASFQMNIGSASYNGSEPRVPE------NFTLGIPGYTCGDPFKVPPSKFNVDQGRRKT  193

Query  792   QAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAGEQ  971
             QA+ TWN+ CSYSQFRA SSPTCCVSLS FYN TIV CP C+CGC+GQ G+  C+K GE 
Sbjct  194   QAIATWNVICSYSQFRASSSPTCCVSLSAFYNNTIVPCPKCSCGCQGQLGADHCVKYGEL  253

Query  972   PPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQWNLV  1151
             PPV+QL H EPP+ +VQC+ HMCPI++HWHVK SYTQ+WRVK+TI N N+ KN+SQWNLV
Sbjct  254   PPVLQLDHNEPPKPVVQCSHHMCPIQIHWHVKQSYTQYWRVKMTIRNLNYVKNYSQWNLV  313

Query  1152  VLHPNLGNVTRVFSFNYRTLNQYGD  1226
             VLHPNL +VT+VFSFNY+ LNQYGD
Sbjct  314   VLHPNLRSVTQVFSFNYKPLNQYGD  338



>gb|KHN19598.1| Protein COBRA [Glycine soja]
Length=456

 Score =   469 bits (1208),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 225/403 (56%), Positives = 286/403 (71%), Gaps = 11/403 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YDPLDP G+ITIKWD+I       V  V++YN+Q YRHI  PGW L W W    VIW 
Sbjct  36    EAYDPLDPTGNITIKWDVISWTPDGYVAVVTMYNFQQYRHIQAPGWSLGWTWAKKEVIWS  95

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ TEQG+CS FK+G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGVL+S  QDP 
Sbjct  96    MMGAQTTEQGDCSKFKAG-IPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVLNSWGQDPS  154

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +++FQ+S+G   + + +           NFTL  PG  YTCG A  V PT F+ +  R
Sbjct  155   NAVSSFQISVGSAGTTNKTVKMPK------NFTLKAPGPGYTCGPAKVVKPTVFITNDKR  208

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG--QPGSAKCL  956
             RTTQA+ TWNITC+YSQF AQ +P+CCVSLS+FYN T+V+CP CTCGC    +PGS    
Sbjct  209   RTTQAMMTWNITCTYSQFLAQKAPSCCVSLSSFYNDTVVNCPTCTCGCRNKTEPGSCVDP  268

Query  957   KAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFS  1136
              +     VV          +VQCT HMCPIRVHWHVKL+Y ++WRVKITITN+N+  N+S
Sbjct  269   NSPHLASVVSASGKTANTPLVQCTSHMCPIRVHWHVKLNYKEYWRVKITITNFNYRMNYS  328

Query  1137  QWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTEL  1316
             QWNLVV HPNL N+T++FSFNY++LN Y  +NDT M +G+++YND L  AG  GNVQ+E+
Sbjct  329   QWNLVVQHPNLDNITQLFSFNYKSLNPYEGLNDTSMLWGVKFYNDFLSSAGSLGNVQSEI  388

Query  1317  LMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             L+ KD +TFTF +GWAFPRRI FNG+ CV+P PD YP LPN++
Sbjct  389   LLRKDKSTFTFDKGWAFPRRIYFNGDNCVMPPPDAYPWLPNAS  431



>gb|KDP24286.1| hypothetical protein JCGZ_25582 [Jatropha curcas]
Length=445

 Score =   468 bits (1204),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 226/404 (56%), Positives = 279/404 (69%), Gaps = 12/404 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDPNG+ITIKWDII       V  V++YN+Q YRHI+ PGW L W W    VIW 
Sbjct  24    EAYDALDPNGNITIKWDIISWTPDGYVAVVTMYNFQQYRHIEAPGWTLGWTWAKKEVIWS  83

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G +ATEQG+CS FK G  PHCC+K P ++DLLPGT +N+Q  NCCKGGV+SS  QDP 
Sbjct  84    MVGGQATEQGDCSKFK-GNIPHCCKKSPAVVDLLPGTPYNQQIANCCKGGVISSWAQDPS  142

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
             K ++AFQ+SIG   + + +           NFTL  PG  YTCG A  V P+KF+    R
Sbjct  143   KAVSAFQLSIGAAGTTNKTVRLPR------NFTLKAPGPGYTCGPAKIVRPSKFLTPDKR  196

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQ---PGSAKC  953
             R TQA+ TWN+TC+YSQF AQ +P+CCVSLS+FYN TIV CP C+C C      PG    
Sbjct  197   RVTQALMTWNVTCTYSQFLAQRTPSCCVSLSSFYNDTIVPCPTCSCACRSNNFLPGGCID  256

Query  954   LKAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
               A      V          +++CT HMCP+R+HWHVKL+Y  +WRVKITITN+N+  N+
Sbjct  257   PDASHLVSAVSSLGTNRLAPVIRCTDHMCPVRIHWHVKLNYKAYWRVKITITNFNYNMNY  316

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             SQWNLVV HPN  N+T +FSFNY++LN Y DINDT M YGIQ+YND+L+QAG  GNVQ+E
Sbjct  317   SQWNLVVQHPNFNNLTHIFSFNYKSLNPYADINDTAMLYGIQFYNDLLMQAGPAGNVQSE  376

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             LL  KD ATFTF +GWAFPR++ FNG+ CV+P PD YP LPN +
Sbjct  377   LLFQKDKATFTFEKGWAFPRKVYFNGDNCVMPPPDAYPWLPNGS  420



>ref|XP_008785625.1| PREDICTED: COBRA-like protein 1 [Phoenix dactylifera]
Length=461

 Score =   468 bits (1204),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 231/411 (56%), Positives = 294/411 (72%), Gaps = 24/411 (6%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDPNG+ITIKWD+++      V  V+IYN+Q YRHI  PGW L W W    VIW 
Sbjct  40    EAYDSLDPNGNITIKWDVMQWTPDGYVAVVTIYNFQQYRHIQTPGWTLGWTWAKKEVIWS  99

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ TEQG+CS FK G  PHCC+K+P ++DLLPGT +N Q  NCCKGGV+SS  QD  
Sbjct  100   MVGAQTTEQGDCSRFK-GNIPHCCKKDPTVVDLLPGTPYNMQIANCCKGGVISSWVQDQA  158

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                ++FQ+S+G+  + + +           NFTL  PG  YTCG A  V  +KFV   GR
Sbjct  159   NAASSFQLSVGQAGTTNKTVRVPK------NFTLRAPGPGYTCGIAKIVKSSKFVSQDGR  212

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG---QPGSAKC  953
             RTTQA+ TWN+TC+YSQF +Q +PTCCVSLS+FYN TIV+CP CTCGC+    QPGS  C
Sbjct  213   RTTQALMTWNVTCTYSQFLSQKTPTCCVSLSSFYNDTIVNCPTCTCGCQNNITQPGS--C  270

Query  954   LKAGEQPPVVQLQH------YEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNY  1115
             ++ G+ P +    +      Y P   +VQCT HMCPIRVHWHVKL+Y ++WRVKITITN+
Sbjct  271   VE-GDSPYLASAINGPGKYSYTP---LVQCTSHMCPIRVHWHVKLNYKEYWRVKITITNF  326

Query  1116  NFAKNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEG  1295
             N+  N++QWNLVV HPN  N+T++FSFNY++L  YG INDT M +G++YYND+L+ AG  
Sbjct  327   NYRMNYTQWNLVVQHPNFDNLTQIFSFNYKSLTPYGGINDTAMLWGVKYYNDLLMAAGPA  386

Query  1296  GNVQTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             GNVQ+ELL  KD +TFTF++GWAFPRRI FNG+ CV+P PD YP LPN++P
Sbjct  387   GNVQSELLFRKDSSTFTFQKGWAFPRRIYFNGDNCVMPPPDAYPWLPNASP  437



>ref|XP_006651506.1| PREDICTED: LOW QUALITY PROTEIN: COBRA-like protein 2-like [Oryza 
brachyantha]
Length=446

 Score =   468 bits (1203),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 235/406 (58%), Positives = 288/406 (71%), Gaps = 11/406 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YDPLDPNG+ITIKWDI +      V  V+IYNYQ YRHI  PGW L W W    +IW 
Sbjct  16    EAYDPLDPNGNITIKWDITQWTPDGYVAVVTIYNYQKYRHIQAPGWNLGWAWAKREIIWS  75

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G +ATEQG+CSAFK+   PHCC+++P ++DL+PG  +N QF NCCKGGVL+S  QDP 
Sbjct  76    MVGGQATEQGDCSAFKA-NIPHCCKRDPKVVDLVPGAPYNMQFGNCCKGGVLTSWVQDPV  134

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEV-PPTKFVEDHG  779
               +A+FQ+++G   + + +  A        NFTL  PG  Y+CG A EV PPT+F+   G
Sbjct  135   NAVASFQITVGHSGTSNKTVKAPK------NFTLKAPGPGYSCGLAQEVKPPTRFISLDG  188

Query  780   RRTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQ-PGSAKCL  956
             RRTTQA  TWN+TC+YSQF AQ SPTCCVSLS+FYN+TIV+CP C CGC+ + PGS    
Sbjct  189   RRTTQAHVTWNVTCTYSQFVAQRSPTCCVSLSSFYNETIVNCPKCACGCQNKKPGSCVEG  248

Query  957   KAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFS  1136
                    VV          +VQCT HMCPIRVHWHVKL+Y  +WRVK+TITN+N+  N+S
Sbjct  249   NLPHLESVVNGPGKSSLTPLVQCTPHMCPIRVHWHVKLNYRDYWRVKVTITNWNYRMNYS  308

Query  1137  QWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTEL  1316
             QWNLVV HPN  NV+ VFSFNY++LN YG INDT M +GI+YYND+L+ AG  GNVQ+EL
Sbjct  309   QWNLVVQHPNFENVSTVFSFNYKSLNPYGVINDTAMMWGIKYYNDLLMVAGPDGNVQSEL  368

Query  1317  LMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAPPH  1454
             L  KDP+TFTF +GW FPRRI FNGE CV+P PD YP LP S+ P 
Sbjct  369   LFRKDPSTFTFDKGWGFPRRIYFNGESCVMPSPDLYPWLPPSSTPR  414



>ref|XP_008775852.1| PREDICTED: LOW QUALITY PROTEIN: COBRA-like protein 1 [Phoenix 
dactylifera]
Length=460

 Score =   468 bits (1204),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 232/410 (57%), Positives = 292/410 (71%), Gaps = 24/410 (6%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDPNG+ITIKWDI++      V  V+++N+Q YRHI  PGW L W W    VIW 
Sbjct  40    EAYDSLDPNGNITIKWDIMQWTPDGYVAVVTMFNFQQYRHIQAPGWTLGWTWAKKEVIWS  99

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ TEQG+CS FK G  PHCC+K+P ++DLLPGT +N Q  NCCKGGVLSS  QDP 
Sbjct  100   MVGAQTTEQGDCSKFK-GNIPHCCKKDPTVVDLLPGTPYNMQIANCCKGGVLSSWVQDPA  158

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                ++FQ+S GR  + + +           NFTL  PG  YTCG A  V PTKFV   GR
Sbjct  159   NAASSFQISAGRAGTTNKTVRVPK------NFTLNAPGPGYTCGVAKIVKPTKFVSQDGR  212

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG---QPGSAKC  953
             RTTQA+ TWN+TC+YSQF +Q +P CCVSLS+FYN TIV+CP CTCGC+    QPGS  C
Sbjct  213   RTTQALMTWNVTCTYSQFLSQKTPACCVSLSSFYNDTIVNCPTCTCGCQNNITQPGS--C  270

Query  954   LKAGEQPPVVQLQH------YEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNY  1115
             ++ G+ P +    +      Y P   +VQCT HMCPIRVHWHVKL+Y ++WRVKITITN+
Sbjct  271   VE-GDSPYLASAINGPGKYSYTP---LVQCTSHMCPIRVHWHVKLNYKEYWRVKITITNF  326

Query  1116  NFAKNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEG  1295
             N+  N+++WNLVV HPN  N+T++FSFNY++L  YG INDT M +G++YYND+L+ AG  
Sbjct  327   NYRMNYTEWNLVVQHPNFDNLTQLFSFNYKSLTPYGAINDTAMLWGVKYYNDLLMAAGPL  386

Query  1296  GNVQTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             GNVQ+ELL  KD +TFTF +GWAFPRRI FNG+ CV+P PD YP LPN++
Sbjct  387   GNVQSELLFQKDLSTFTFEKGWAFPRRIYFNGDNCVMPPPDAYPWLPNAS  436



>ref|XP_010660572.1| PREDICTED: protein COBRA [Vitis vinifera]
Length=456

 Score =   468 bits (1203),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 226/404 (56%), Positives = 283/404 (70%), Gaps = 12/404 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDPNG+ITIKWDI+       V  V++YN+Q YRHI  PGW L W W    VIW 
Sbjct  35    EAYDALDPNGNITIKWDIMSWTPDGYVAVVTMYNFQQYRHIQSPGWSLQWTWAKKEVIWS  94

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G + TEQG+CS FK G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGV+SS  QDP 
Sbjct  95    MLGGQTTEQGDCSRFK-GNVPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVVSSWVQDPA  153

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                ++FQ+S+G   + + +           NFTL  PG  YTCG A  V PT+FV   GR
Sbjct  154   NAASSFQVSVGSAGTTNKTVRVPK------NFTLKAPGPGYTCGPAKIVKPTRFVTQDGR  207

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG---QPGSAKC  953
             R TQA+ TWN+TC+YSQF +Q +PTCCVSLS+FYN TIV CP CTCGC+    QPGS   
Sbjct  208   RVTQALMTWNVTCTYSQFLSQKTPTCCVSLSSFYNDTIVPCPTCTCGCQNNITQPGSCVE  267

Query  954   LKAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
               +     VV          +VQCT+HMCPIRVHWHVKLSY ++WRVK+TITN+N+  N+
Sbjct  268   EDSPYLASVVSGSGKNSYTPLVQCTKHMCPIRVHWHVKLSYKEYWRVKVTITNFNYRMNY  327

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             +QWNLVV HPN  N+T++FSFNY++L  Y  INDT M +G+++YND+L+QAG  GNVQ+E
Sbjct  328   TQWNLVVQHPNFDNLTQIFSFNYKSLTPYAAINDTAMLWGVKFYNDLLVQAGPLGNVQSE  387

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             LL  KD +TFTF +GWAFPRRI FNG+ CV+P PD YP LPN+ 
Sbjct  388   LLFRKDKSTFTFEKGWAFPRRIYFNGDNCVMPPPDSYPWLPNAT  431



>emb|CBI16946.3| unnamed protein product [Vitis vinifera]
Length=436

 Score =   466 bits (1200),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 226/404 (56%), Positives = 283/404 (70%), Gaps = 12/404 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDPNG+ITIKWDI+       V  V++YN+Q YRHI  PGW L W W    VIW 
Sbjct  35    EAYDALDPNGNITIKWDIMSWTPDGYVAVVTMYNFQQYRHIQSPGWSLQWTWAKKEVIWS  94

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G + TEQG+CS FK G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGV+SS  QDP 
Sbjct  95    MLGGQTTEQGDCSRFK-GNVPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVVSSWVQDPA  153

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                ++FQ+S+G   + + +           NFTL  PG  YTCG A  V PT+FV   GR
Sbjct  154   NAASSFQVSVGSAGTTNKTVRVPK------NFTLKAPGPGYTCGPAKIVKPTRFVTQDGR  207

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG---QPGSAKC  953
             R TQA+ TWN+TC+YSQF +Q +PTCCVSLS+FYN TIV CP CTCGC+    QPGS   
Sbjct  208   RVTQALMTWNVTCTYSQFLSQKTPTCCVSLSSFYNDTIVPCPTCTCGCQNNITQPGSCVE  267

Query  954   LKAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
               +     VV          +VQCT+HMCPIRVHWHVKLSY ++WRVK+TITN+N+  N+
Sbjct  268   EDSPYLASVVSGSGKNSYTPLVQCTKHMCPIRVHWHVKLSYKEYWRVKVTITNFNYRMNY  327

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             +QWNLVV HPN  N+T++FSFNY++L  Y  INDT M +G+++YND+L+QAG  GNVQ+E
Sbjct  328   TQWNLVVQHPNFDNLTQIFSFNYKSLTPYAAINDTAMLWGVKFYNDLLVQAGPLGNVQSE  387

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             LL  KD +TFTF +GWAFPRRI FNG+ CV+P PD YP LPN+ 
Sbjct  388   LLFRKDKSTFTFEKGWAFPRRIYFNGDNCVMPPPDSYPWLPNAT  431



>emb|CAN68249.1| hypothetical protein VITISV_020126 [Vitis vinifera]
Length=469

 Score =   468 bits (1203),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 226/404 (56%), Positives = 283/404 (70%), Gaps = 12/404 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDPNG+ITIKWDI+       V  V++YN+Q YRHI  PGW L W W    VIW 
Sbjct  35    EAYDALDPNGNITIKWDIMSWTPDGYVAVVTMYNFQQYRHIQSPGWSLQWTWAKKEVIWS  94

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G + TEQG+CS FK G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGV+SS  QDP 
Sbjct  95    MLGGQTTEQGDCSRFK-GNVPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVVSSWVQDPA  153

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                ++FQ+S+G   + + +           NFTL  PG  YTCG A  V PT+FV   GR
Sbjct  154   NAASSFQVSVGSAGTTNKTVRVPK------NFTLKAPGPGYTCGPAKIVKPTRFVTQDGR  207

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG---QPGSAKC  953
             R TQA+ TWN+TC+YSQF +Q +PTCCVSLS+FYN TIV CP CTCGC+    QPGS   
Sbjct  208   RVTQALMTWNVTCTYSQFLSQKTPTCCVSLSSFYNDTIVPCPTCTCGCQNNITQPGSCVE  267

Query  954   LKAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
               +     VV          +VQCT+HMCPIRVHWHVKLSY ++WRVK+TITN+N+  N+
Sbjct  268   EDSPYLASVVSGSGKNSYTPLVQCTKHMCPIRVHWHVKLSYKEYWRVKVTITNFNYRMNY  327

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             +QWNLVV HPN  N+T++FSFNY++L  Y  INDT M +G+++YND+L+QAG  GNVQ+E
Sbjct  328   TQWNLVVQHPNFDNLTQIFSFNYKSLTPYAAINDTAMLWGVKFYNDLLVQAGPLGNVQSE  387

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             LL  KD +TFTF +GWAFPRRI FNG+ CV+P PD YP LPN+ 
Sbjct  388   LLFRKDKSTFTFEKGWAFPRRIYFNGDNCVMPPPDSYPWLPNAT  431



>gb|EPS70668.1| hypothetical protein M569_04090, partial [Genlisea aurea]
Length=395

 Score =   465 bits (1196),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 218/402 (54%), Positives = 284/402 (71%), Gaps = 13/402 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YDPLDPNG+ITIKWD++       V T++I+N+Q YRHI+ PGWKL W W    VIW 
Sbjct  2     EAYDPLDPNGNITIKWDVMSWTGDGYVATITIFNFQKYRHIEPPGWKLGWVWSKKEVIWS  61

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
               G +AT+QG+CS FK    PHCC++ P ++DLLPG  +N+Q  NCCKGGVL+S  QDP 
Sbjct  62    ALGGQATDQGDCSRFKGSAIPHCCKRNPTVVDLLPGAPYNQQVANCCKGGVLTSSVQDPG  121

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                A+FQ+++G+  + + +           NFTLG PG  YTCG+A  V P++F+    R
Sbjct  122   NAAASFQLTVGQAGTSNRTVKVPL------NFTLGAPGPGYTCGKAQVVAPSEFISADKR  175

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG--QPGSAK-C  953
             R TQA+ TWN+TC+YSQF A  +PTCCVSLS+FYN TIVSCP C+CGC    QP      
Sbjct  176   RVTQALMTWNVTCTYSQFMAHKAPTCCVSLSSFYNDTIVSCPTCSCGCPNATQPNCINPA  235

Query  954   LKAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
             L     P          PQ  VQCT HMCP+R+HWHVKL+Y  +WRVKI +TN+NF +NF
Sbjct  236   LPEISLPSGSSSSGGMGPQ--VQCTSHMCPVRIHWHVKLNYKAYWRVKIAVTNFNFVRNF  293

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             +QWN+V+ HPN  N+T++FSFNY++L  YG INDTGM +G+Q+YND+L+Q G  GNVQ+E
Sbjct  294   TQWNVVIQHPNFDNLTQIFSFNYQSLTPYGSINDTGMMWGVQFYNDLLMQNGPDGNVQSE  353

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPN  1439
             +L  KDP++FTF +GWAFPRR+ FNG+ CV+PQPD+YP LPN
Sbjct  354   VLFGKDPSSFTFEKGWAFPRRVYFNGDNCVMPQPDEYPFLPN  395



>ref|XP_002531000.1| Protein COBRA precursor, putative [Ricinus communis]
 gb|EEF31388.1| Protein COBRA precursor, putative [Ricinus communis]
Length=456

 Score =   467 bits (1201),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 226/404 (56%), Positives = 281/404 (70%), Gaps = 12/404 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDP G+ITIKWDII       V  V++YN+Q YRHI  PGW L W W    VIW+
Sbjct  32    EAYDALDPTGNITIKWDIINWTPDGYVAVVTMYNFQQYRHIQAPGWTLGWTWAKKEVIWN  91

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G + TEQG+CS FK G  PHCC+K P ++DLLPGT +N+Q  NCCKGGV+SS  QDP 
Sbjct  92    MVGGQTTEQGDCSKFK-GNIPHCCKKNPTVVDLLPGTPYNQQIANCCKGGVISSWGQDPS  150

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
             K ++AFQ+S+G   + + +           NFTL  PG  YTCG A  V P++F     R
Sbjct  151   KAVSAFQLSVGAAGTTNKTVRVPK------NFTLKAPGPGYTCGPAKIVRPSRFFTTDKR  204

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPG-SAKCLK  959
             R TQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN TIV CP C CGC+     S  C+ 
Sbjct  205   RVTQALMTWNVTCTYSQFLAQKTPTCCVSLSSFYNNTIVPCPTCACGCQSNSSLSGGCVD  264

Query  960   --AGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
               A     VV       P  +VQCT+HMCP+R+HWHVKL+Y ++WRVKITITN+N+  N+
Sbjct  265   PDAPHLASVVSGSGKNSPAPLVQCTRHMCPVRIHWHVKLNYREYWRVKITITNFNYNMNY  324

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             SQWNLVV HPN  N+T++FSFNY++LN Y  INDT M +G+Q+YND+L+QAG  GNVQ+E
Sbjct  325   SQWNLVVQHPNFDNLTQIFSFNYKSLNPYAAINDTAMLWGVQFYNDLLMQAGPSGNVQSE  384

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             LL  KD  TFTF +GWAFPRRI FNG+ CV+P PD YP LPN+ 
Sbjct  385   LLFQKDKTTFTFEKGWAFPRRIYFNGDNCVMPPPDAYPWLPNAG  428



>ref|XP_011014072.1| PREDICTED: COBRA-like protein 1 [Populus euphratica]
Length=453

 Score =   466 bits (1200),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 225/404 (56%), Positives = 281/404 (70%), Gaps = 12/404 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YDPLDP G+ITIKWDII       V  V+IYN+Q YRHI  PGW L W W    VIW 
Sbjct  32    EAYDPLDPTGNITIKWDIISWTADGYVAVVTIYNFQQYRHIQAPGWSLGWTWAKKEVIWS  91

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G +ATEQG+CS FK G  PHCC+K P ++DLLPG  +N+Q  NCCKGGV+SS  QDP 
Sbjct  92    MLGGQATEQGDCSKFK-GNIPHCCKKSPTVVDLLPGIPYNQQTANCCKGGVISSWAQDPA  150

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                ++FQ+S+G   + + +           NFTL  PG  YTC  A  V PT+F+    R
Sbjct  151   NAASSFQLSVGSAGTSNKTVRLPK------NFTLKAPGPGYTCARAKIVKPTRFMSTDKR  204

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCE-GQPGSAKCL-  956
             R TQA+ TWN+TC+YSQF AQ +P+CCVSLS+FYN TIV CP C CGC+     S  C+ 
Sbjct  205   RITQALMTWNVTCTYSQFLAQKTPSCCVSLSSFYNDTIVRCPKCACGCQRNNSDSGGCVD  264

Query  957   -KAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
              KA     VV       P  +VQCT HMCPIRVHWHVKL+Y Q+WRVK+TITN+N+  N+
Sbjct  265   PKAPHLASVVSSLGNNNPMPLVQCTSHMCPIRVHWHVKLNYKQYWRVKVTITNFNYNMNY  324

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             +QWNLVV HPN  N+T++FSFNY++L+ Y  INDT M +G+++YND+L+QAG  GNVQ+E
Sbjct  325   TQWNLVVQHPNFNNLTQIFSFNYQSLSPYSAINDTAMLWGVKFYNDLLMQAGRSGNVQSE  384

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             LL  KD +TFTF +GWAFPRRI FNG+ CV+P PD YP LPN++
Sbjct  385   LLFRKDMSTFTFDKGWAFPRRIYFNGDNCVMPPPDAYPWLPNAS  428



>ref|XP_006338345.1| PREDICTED: protein COBRA-like [Solanum tuberosum]
Length=459

 Score =   466 bits (1199),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 224/404 (55%), Positives = 283/404 (70%), Gaps = 12/404 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             D +DPLDPNG+ITIKWD+I       V  V++YN+Q YRHI  PGW L W W    VIW 
Sbjct  38    DAFDPLDPNGNITIKWDVISWAPDGYVAVVTMYNFQQYRHIQAPGWSLGWTWAKKEVIWT  97

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G + TEQG+CS +K G  PHCC+K+P ++D+LPGT +N+Q  NCCKGGV++S  QDP 
Sbjct  98    MMGGQTTEQGDCSKYK-GNIPHCCKKDPTVVDMLPGTPYNQQIANCCKGGVINSWGQDPA  156

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +++FQ+S+G   + + +           NFTL  PG  YTCG A  V PTKFV   GR
Sbjct  157   NAVSSFQISVGAAGTTNKTVRVPK------NFTLKAPGPGYTCGPAKIVKPTKFVSADGR  210

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG---QPGSAKC  953
             R TQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN TIV CP CTCGC+    Q GS   
Sbjct  211   RVTQAMMTWNVTCTYSQFLAQKTPTCCVSLSSFYNDTIVPCPTCTCGCQSNGTQRGSCVD  270

Query  954   LKAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
              +      VV          +VQCT+HMCPIR+HWHVKL+Y ++WRVKITITN+N+  N+
Sbjct  271   PETPHLASVVSDHGKNNYVPLVQCTKHMCPIRIHWHVKLNYKEYWRVKITITNFNYRMNY  330

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             +QWNLVV HPN  N+T +FSFNY++L  YG INDT M +G+++YND+L+QAG  GNVQ+E
Sbjct  331   TQWNLVVQHPNFDNLTTLFSFNYKSLTPYGSINDTAMLWGVKFYNDLLMQAGPSGNVQSE  390

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             LL  KD +TFTF +GWAFP RI FNG+ CV+P PD YP LPN+ 
Sbjct  391   LLFRKDASTFTFEKGWAFPHRIYFNGDNCVMPPPDAYPYLPNAG  434



>gb|AHC30880.1| COBRA-like protein [Oncidium hybrid cultivar]
 gb|AHJ14778.1| COBRA-like protein [Oncidium hybrid cultivar]
Length=461

 Score =   466 bits (1199),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 226/408 (55%), Positives = 292/408 (72%), Gaps = 19/408 (5%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + +D LDPNG+ITIKWDI++      V  V+I N+Q YRHI  PGW L W W    VIW 
Sbjct  39    EAFDALDPNGNITIKWDIMQWTPDGYVAVVTINNFQQYRHIQSPGWTLGWTWAKKEVIWS  98

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ TEQG+CS FK G  PHCC+K+P ++DLLPGT +N Q  NCCKGGV+SS  QDP 
Sbjct  99    MVGAQTTEQGDCSKFK-GNIPHCCKKDPTVVDLLPGTPYNMQIANCCKGGVISSWAQDPP  157

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               ++AFQ+S+G   + + +           NFTL  PG  YTCG A  V  T+FV   GR
Sbjct  158   NAVSAFQVSVGAAGTTNKTVRVPK------NFTLRAPGPGYTCGAAKIVKQTQFVSQDGR  211

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG---QPGSAKC  953
             RTTQA+ TWN+TC+YSQF +Q +P+CCVSLS+FYN TIV CP C+CGC+    QPGS  C
Sbjct  212   RTTQALMTWNVTCTYSQFLSQKTPSCCVSLSSFYNDTIVDCPTCSCGCQNNLTQPGS--C  269

Query  954   LKAGEQPPVVQLQHYEPPQ----AIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNF  1121
             ++ G+ P +  + +  P +     +VQCT HMCP+RVHWHVKL+Y ++WR KITITN+N+
Sbjct  270   VE-GDSPYLASVVNNSPGKHSLVPLVQCTSHMCPVRVHWHVKLNYKEYWRAKITITNFNY  328

Query  1122  AKNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGN  1301
               N++QWNLVV HPN  N+T++FSF+Y++L  YG INDT M +G++YYND+L++AG GGN
Sbjct  329   RMNYTQWNLVVQHPNFDNITQIFSFDYKSLTPYGGINDTAMLWGMKYYNDLLMEAGPGGN  388

Query  1302  VQTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             VQ+ELL  KD +TFTF +GWAFPRRI FNG+ CV+P PD YP LPN+ 
Sbjct  389   VQSELLFRKDASTFTFEKGWAFPRRIYFNGDVCVMPAPDAYPWLPNAG  436



>gb|KHG21688.1| COBRA-like protein 6 [Gossypium arboreum]
Length=369

 Score =   462 bits (1190),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 224/356 (63%), Positives = 264/356 (74%), Gaps = 14/356 (4%)
 Frame = +3

Query  390   LSWQWRGDGVIWDMWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCC  569
             + W W  D VIW M GAEATEQGNCS FK GQ PHCCEK P I+DLLPG  +N Q  NCC
Sbjct  1     MGWDWTRDEVIWAMQGAEATEQGNCSRFKGGQLPHCCEKRPFIVDLLPGAPYNMQTTNCC  60

Query  570   KGGVLSSMTQDPEKYLAAFQMsigrvssksssgaavaappipgNFTLGVPGYTCGEAFEV  749
             KGG+LSSM QDP K+ A FQMS    +++S             NFT+GVPGYTC +  +V
Sbjct  61    KGGILSSMIQDPSKFGAVFQMSTSAATNESGFHMPE-------NFTIGVPGYTCAKPVQV  113

Query  750   PPTKFVEDHGRRTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCE  929
              P+K+  D GRR TQA+GTWN+TC YSQF A +SP CCVSLS FYN TIV CP C+C C+
Sbjct  114   APSKYSSDGGRRWTQALGTWNVTCMYSQFLASTSPKCCVSLSAFYNSTIVPCPKCSCSCQ  173

Query  930   GQPGSAKCLKAGEQPPVVQ----LQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVK  1097
             G PG AKC+K GE P +++    L    P  + V+C+QHMCPIRVHWHVK SYT +WRVK
Sbjct  174   GLPG-AKCVKFGETPSLLRQIKDLNRESP--SFVRCSQHMCPIRVHWHVKQSYTHYWRVK  230

Query  1098  ITITNYNFAKNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVL  1277
             IT+ N N  KN+SQWNLV LHPNL ++ +VFSFNY  LNQYG INDTGMF+GI+YYND+L
Sbjct  231   ITVNNLNILKNYSQWNLVALHPNLKSLIQVFSFNYEPLNQYGQINDTGMFWGIEYYNDML  290

Query  1278  LQAGEGGNVQTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             LQ GE GNVQTE+L+ KDP  FTFREGW FPRRI FNG+ECV+P PD YPRLP++A
Sbjct  291   LQEGESGNVQTEMLLLKDPDMFTFREGWGFPRRILFNGDECVMPPPDQYPRLPSTA  346



>ref|XP_009373790.1| PREDICTED: COBRA-like protein 1 isoform X1 [Pyrus x bretschneideri]
Length=457

 Score =   466 bits (1198),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 224/404 (55%), Positives = 285/404 (71%), Gaps = 12/404 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YDPLDPNG+ITIKWDII       V  V+++N+Q YRHI  PGW L W W    VIW+
Sbjct  36    EAYDPLDPNGNITIKWDIISWTADGYVAAVTLFNFQKYRHIQAPGWSLGWTWAKKEVIWN  95

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G +ATEQG+CS FK+   PHCC+K P I+DLLPGT +N+Q+ NCCKGGVLSS  QDPE
Sbjct  96    MVGGQATEQGDCSRFKT-TLPHCCKKTPTIVDLLPGTPYNQQYTNCCKGGVLSSWVQDPE  154

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
             K + +FQ+S+G+  + + +           NFTL  PG  YTC  A  V PTKF+    R
Sbjct  155   KAVGSFQISVGQAGTTNKTVRLPK------NFTLNTPGPGYTCARAKVVKPTKFISPDKR  208

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCE---GQPGSAKC  953
             R TQA+ TWN+TC+YSQ  AQ +PTCCVSLS+FYN TIV CP C+CGC+     PGS   
Sbjct  209   RVTQAMMTWNVTCTYSQILAQKTPTCCVSLSSFYNDTIVPCPKCSCGCQRNATHPGSCVE  268

Query  954   LKAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
               +     VV   +      +V+CT+HMCPIRVHWHVK++Y Q+WRVK+T+TN+N+  N+
Sbjct  269   PDSPYLASVVSASNKNSYTPLVRCTKHMCPIRVHWHVKVNYKQYWRVKVTVTNFNYRMNY  328

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             S WN+VV HPN  N+T+ FS+NY+++  Y  INDTGM +GI++YND+L+QAG  GNVQ+E
Sbjct  329   SDWNMVVQHPNFDNLTQSFSYNYKSITPYATINDTGMLWGIKFYNDILMQAGPLGNVQSE  388

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             LL  KD ATFTF +GWAFPRR+ FNG+ CV+P PD YP LPNS 
Sbjct  389   LLFRKDEATFTFDKGWAFPRRVYFNGDNCVMPPPDAYPWLPNSG  432



>ref|XP_010257980.1| PREDICTED: protein COBRA-like isoform X1 [Nelumbo nucifera]
Length=455

 Score =   466 bits (1198),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 228/414 (55%), Positives = 288/414 (70%), Gaps = 31/414 (7%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDPNG+ITIKWD+I       V  V+IYN+Q YRHI  PGW L W W    VIW 
Sbjct  35    EAYDALDPNGNITIKWDVISWTPDGYVAVVTIYNFQQYRHIQAPGWTLGWTWAKKEVIWS  94

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G++ TEQG+CS FK G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGV++S  QDP 
Sbjct  95    MMGSQTTEQGDCSRFK-GNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVINSWVQDPT  153

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                ++FQ+S+G   + + +           NFTL  PG  YTCG A  V PTKF     R
Sbjct  154   NAASSFQVSVGAAGTTNKTVKLPK------NFTLKAPGPGYTCGPAKIVKPTKFTTADQR  207

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG---QPGS---  944
             RTTQA+ TWN+TC+YSQF +Q +PTCCVSLS+FYN TIV CP CTCGC+    QPGS   
Sbjct  208   RTTQAMMTWNVTCTYSQFLSQKTPTCCVSLSSFYNDTIVPCPTCTCGCQNNITQPGSCVE  267

Query  945   ------AKCLKAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITI  1106
                   A  L AG+         Y P   +VQCT HMCPIRVHWHVKL+Y ++WRVK+TI
Sbjct  268   GNSPYLASALSAGKN-------SYVP---LVQCTNHMCPIRVHWHVKLNYKEYWRVKVTI  317

Query  1107  TNYNFAKNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQA  1286
             TN+N+  N++QWNLVV HPN  N+T++FSFNY++L  Y  +NDT M +G+++YND+L++A
Sbjct  318   TNFNYRMNYTQWNLVVQHPNFDNLTQIFSFNYKSLTPYAGLNDTAMLWGVKFYNDLLMEA  377

Query  1287  GEGGNVQTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             G  GNVQ+ELL  KD +TFTF +GWAFPRRI FNG+ CV+P PD YP LPN++P
Sbjct  378   GPLGNVQSELLFRKDKSTFTFEKGWAFPRRIYFNGDNCVMPPPDAYPWLPNASP  431



>ref|XP_011085599.1| PREDICTED: protein COBRA [Sesamum indicum]
Length=453

 Score =   465 bits (1197),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 228/405 (56%), Positives = 285/405 (70%), Gaps = 13/405 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDPNG+ITIKWD+I       V  V+I+N+Q YRHI  PGW L W W    VIW+
Sbjct  31    EAYDALDPNGNITIKWDVISWTPDGYVAVVTIFNFQQYRHIQAPGWTLGWTWAKKEVIWN  90

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G + TEQG+CS FK G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGV+SS  QDP 
Sbjct  91    MMGGQTTEQGDCSRFK-GNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVISSWGQDPA  149

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                ++FQ+S+G   + + +           NFTL  PG  YTCG A  V PTK+V   GR
Sbjct  150   NAASSFQVSVGAAGTTNKTVKVPK------NFTLKAPGPGYTCGPAKIVKPTKYVTKDGR  203

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG---QPGSAKC  953
             R TQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN TIV CP CTCGC+    QPGS   
Sbjct  204   RVTQAMMTWNVTCTYSQFLAQKTPTCCVSLSSFYNDTIVPCPTCTCGCQNNLTQPGSCVN  263

Query  954   LKAGEQPPVVQLQHYEPPQA-IVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKN  1130
               +     VV  Q      A +VQCT HMCPIRVHWHVK++Y  +WRVK+TITN+N+  N
Sbjct  264   PDSPYLASVVAEQEKRNSYAPLVQCTSHMCPIRVHWHVKVNYKDYWRVKVTITNFNYRMN  323

Query  1131  FSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQT  1310
             ++QWNLVV HPN  N+T++FSFNY+ LN Y +INDT M +G+Q+YND+L+QAG  GNVQ+
Sbjct  324   YTQWNLVVQHPNFDNLTQLFSFNYKPLNPYENINDTAMLWGVQFYNDLLMQAGPLGNVQS  383

Query  1311  ELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             ELL  KD +TFTF +GW FPRRI FNG+ CV+P PD YP LPN++
Sbjct  384   ELLFQKDKSTFTFEKGWGFPRRIYFNGDNCVMPPPDAYPYLPNAS  428



>gb|AFK45756.1| unknown [Lotus japonicus]
Length=448

 Score =   465 bits (1196),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 223/402 (55%), Positives = 280/402 (70%), Gaps = 10/402 (2%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             D YDPLDPNG+ITIKWDII       V  V++ N+Q YRHI  PGW L W W    VIW 
Sbjct  29    DAYDPLDPNGNITIKWDIITWTSDGYVAVVTMNNFQQYRHIAAPGWSLGWAWAKKEVIWS  88

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G +ATEQG+CS FK G  PHCC+K+P ++DLLPGT +N QF NCCKGGVLSS  QDP 
Sbjct  89    MVGGQATEQGDCSKFK-GSIPHCCKKDPTVVDLLPGTPYNMQFSNCCKGGVLSSWAQDPT  147

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +A+FQ+S+GR  + + +           NFTL  PG  YTCG A  V PTKF++   R
Sbjct  148   NAVASFQVSVGRAGTTNKTVKVPK------NFTLKAPGPGYTCGPAKIVKPTKFIQPDKR  201

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPG-SAKCLK  959
             R TQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN TIV CP C CGC+     S  C++
Sbjct  202   RVTQALMTWNVTCTYSQFLAQKTPTCCVSLSSFYNDTIVPCPTCACGCQSNSSRSGSCIE  261

Query  960   AGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQ  1139
             A        +        +VQCT+HMCP+R+HW VKL+Y ++WRVK+TITN+N+  N+S+
Sbjct  262   ADTPHLASVVAGSGKNTPLVQCTRHMCPVRIHWRVKLNYKEYWRVKVTITNFNYKMNYSE  321

Query  1140  WNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTELL  1319
             WNLV  HPN  N+T++FSFNY++L  YG INDT + +G+++YND L +AG  GNVQ+ELL
Sbjct  322   WNLVAQHPNFDNLTQLFSFNYKSLTPYGSINDTALLWGVKFYNDFLNEAGPSGNVQSELL  381

Query  1320  MNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
               KD +TFTF  GWAFPRRI FNG+ CV+P PD YP LPN+ 
Sbjct  382   FRKDKSTFTFERGWAFPRRIYFNGDNCVMPSPDAYPWLPNAG  423



>gb|AFZ78571.1| COBRA-like protein [Populus tomentosa]
Length=445

 Score =   465 bits (1196),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 223/405 (55%), Positives = 279/405 (69%), Gaps = 16/405 (4%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             DG+DPLDP G+ITIKWD++        + VSIYN+Q YRH++ PGWKL+W W+G  VIW 
Sbjct  30    DGFDPLDPYGNITIKWDLLLSTSGTNNLMVSIYNFQQYRHVEPPGWKLNWAWKGKEVIWS  89

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GAEATEQGNC+ FK    PHCCEKEP I+DLLPGT +N Q  NCCKGGVLSSM QDP 
Sbjct  90    MQGAEATEQGNCTEFKGSTLPHCCEKEPFIVDLLPGTNYNAQTQNCCKGGVLSSMKQDPS  149

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPGYTCGEAFEVPPTKFVEDHGRRT  788
             KY+A FQM               +   +P NF LGVPGY+CG A +V P+++  D GRR 
Sbjct  150   KYVATFQM-------AVGGSGTNSRFIMPENFNLGVPGYSCGGAVKVEPSRYTTDGGRRW  202

Query  789   TQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAGE  968
             TQA+ TWN+TC YSQ  A  +P CCVSLS FYN+TIVSCP C+CGC+GQPG+ KC+K GE
Sbjct  203   TQAIATWNVTCMYSQSLASPTPRCCVSLSAFYNQTIVSCPRCSCGCQGQPGT-KCVKYGE  261

Query  969   QPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQWNL  1148
              PP+  L+  + P  +V+C++HMCPIRVHWH+K SY Q+WR K+T+TN+N  KN+S+WNL
Sbjct  262   TPPL--LKQNQDPTPVVRCSEHMCPIRVHWHLKQSYKQYWRAKMTVTNFNIMKNYSEWNL  319

Query  1149  VVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTELLMNK  1328
             VVLHPNL ++T+VFSFNY  LN+YG I       G ++      +    G  + +    K
Sbjct  320   VVLHPNLQSLTQVFSFNYAPLNRYGYIMILECSGGFRFTMTFYYKKERMGIYRLKFYYAK  379

Query  1329  ------DPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
                       FTFREGW FPR+I FNG+ECV+P PD+YP LPN  
Sbjct  380   IQRFLLSERIFTFREGWGFPRKIQFNGDECVMPPPDEYPSLPNKG  424



>ref|XP_009373791.1| PREDICTED: COBRA-like protein 1 isoform X2 [Pyrus x bretschneideri]
Length=456

 Score =   465 bits (1197),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 224/403 (56%), Positives = 284/403 (70%), Gaps = 12/403 (3%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDM  431
              YDPLDPNG+ITIKWDII       V  V+++N+Q YRHI  PGW L W W    VIW+M
Sbjct  36    AYDPLDPNGNITIKWDIISWTADGYVAAVTLFNFQKYRHIQAPGWSLGWTWAKKEVIWNM  95

Query  432   WGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEK  611
              G +ATEQG+CS FK+   PHCC+K P I+DLLPGT +N+Q+ NCCKGGVLSS  QDPEK
Sbjct  96    VGGQATEQGDCSRFKT-TLPHCCKKTPTIVDLLPGTPYNQQYTNCCKGGVLSSWVQDPEK  154

Query  612   YLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGRR  785
              + +FQ+S+G+  + + +           NFTL  PG  YTC  A  V PTKF+    RR
Sbjct  155   AVGSFQISVGQAGTTNKTVRLPK------NFTLNTPGPGYTCARAKVVKPTKFISPDKRR  208

Query  786   TTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCE---GQPGSAKCL  956
              TQA+ TWN+TC+YSQ  AQ +PTCCVSLS+FYN TIV CP C+CGC+     PGS    
Sbjct  209   VTQAMMTWNVTCTYSQILAQKTPTCCVSLSSFYNDTIVPCPKCSCGCQRNATHPGSCVEP  268

Query  957   KAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFS  1136
              +     VV   +      +V+CT+HMCPIRVHWHVK++Y Q+WRVK+T+TN+N+  N+S
Sbjct  269   DSPYLASVVSASNKNSYTPLVRCTKHMCPIRVHWHVKVNYKQYWRVKVTVTNFNYRMNYS  328

Query  1137  QWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTEL  1316
              WN+VV HPN  N+T+ FS+NY+++  Y  INDTGM +GI++YND+L+QAG  GNVQ+EL
Sbjct  329   DWNMVVQHPNFDNLTQSFSYNYKSITPYATINDTGMLWGIKFYNDILMQAGPLGNVQSEL  388

Query  1317  LMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             L  KD ATFTF +GWAFPRR+ FNG+ CV+P PD YP LPNS 
Sbjct  389   LFRKDEATFTFDKGWAFPRRVYFNGDNCVMPPPDAYPWLPNSG  431



>ref|XP_008341799.1| PREDICTED: COBRA-like protein 1 isoform X1 [Malus domestica]
Length=457

 Score =   465 bits (1196),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 222/404 (55%), Positives = 285/404 (71%), Gaps = 12/404 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YDPLDPNG+ITIKWDI+       V  V+++N+Q YRHI  PGW L W W    VIW+
Sbjct  36    EAYDPLDPNGNITIKWDILSWTXDGYVAAVTLFNFQKYRHIQAPGWSLGWTWAKKEVIWN  95

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G +ATEQG+CS FK+   PHCC+K P ++DLLPGT +N+Q+ NCCKGGVLSS  QDPE
Sbjct  96    MVGGQATEQGDCSRFKT-TLPHCCKKTPTVVDLLPGTPYNQQYTNCCKGGVLSSWVQDPE  154

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
             K + +FQ+S+G+  + + +           NFTL  PG  YTC  A  V PTKF+    R
Sbjct  155   KAVGSFQISVGQAGTTNKTVRLPK------NFTLNTPGPGYTCARAKVVKPTKFISPDKR  208

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCE---GQPGSAKC  953
             R TQA+ TWN+TC+YSQ  AQ +PTCCVSLS+FYN TIV CP C+CGC+     PGS   
Sbjct  209   RVTQAMMTWNVTCTYSQILAQKTPTCCVSLSSFYNDTIVPCPNCSCGCQRNATHPGSCVE  268

Query  954   LKAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
               +     VV   +      +V+CT HMCPIRVHWHVK++Y Q+WRVK+T+TN+N+  N+
Sbjct  269   PDSPYLASVVSASNKNSYTPLVRCTAHMCPIRVHWHVKVNYKQYWRVKVTVTNFNYRMNY  328

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             S WN+VV HPN  N+T++FS+NY+++  Y  INDTGM +GI++YND+L+QAG  GNVQ+E
Sbjct  329   SDWNMVVQHPNFDNLTQIFSYNYKSITPYATINDTGMLWGIKFYNDILMQAGPLGNVQSE  388

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             LL  KD ATFTF +GWAFPRR+ FNG+ CV+P PD YP LPNS 
Sbjct  389   LLFQKDEATFTFDKGWAFPRRVYFNGDNCVMPPPDAYPWLPNSG  432



>ref|XP_004232141.1| PREDICTED: protein COBRA [Solanum lycopersicum]
Length=447

 Score =   464 bits (1195),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 224/404 (55%), Positives = 283/404 (70%), Gaps = 12/404 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             D +DPLDPNG+ITIKWD+I       V  V++YN+Q YRHI  PGW L W W    VIW 
Sbjct  26    DAFDPLDPNGNITIKWDVISWTPDGYVAVVTMYNFQQYRHIQAPGWSLGWTWAKKEVIWT  85

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ TEQG+CS +K G  PHCC+K+P ++D+LPGT +N+Q  NCCKGGV++S  QDP 
Sbjct  86    MMGAQTTEQGDCSKYK-GNIPHCCKKDPTVVDMLPGTPYNQQIANCCKGGVINSWGQDPA  144

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +++FQ+S+G   + + +           NFTL  PG  YTCG A  V  TKFV   GR
Sbjct  145   TAVSSFQVSVGAAGTTNKTVRVPK------NFTLKAPGPGYTCGPAKIVKSTKFVSADGR  198

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG---QPGSAKC  953
             R TQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN TIV CP CTCGC+    Q GS   
Sbjct  199   RVTQAMMTWNVTCTYSQFLAQKTPTCCVSLSSFYNDTIVPCPTCTCGCQSNGTQRGSCVD  258

Query  954   LKAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
              +      VV          +VQCT+HMCPIR+HWHVKL+Y ++WRVKITITN+N+  N+
Sbjct  259   PETPHLASVVSDHGKNNYVPLVQCTKHMCPIRIHWHVKLNYKEYWRVKITITNFNYRMNY  318

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             +QWNLVV HPN  N+T +FSFNY++L  YG INDT M +G+++YND+L+QAG  GNVQ+E
Sbjct  319   TQWNLVVQHPNFDNLTTLFSFNYKSLTPYGSINDTAMLWGVKFYNDLLMQAGPSGNVQSE  378

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             LL  KD +TFTF +GWAFP RI FNG+ CV+P PD YP LPN+ 
Sbjct  379   LLFRKDASTFTFEKGWAFPHRIYFNGDNCVMPPPDAYPFLPNAG  422



>ref|XP_010514669.1| PREDICTED: COBRA-like protein 2 [Camelina sativa]
Length=439

 Score =   464 bits (1194),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 225/404 (56%), Positives = 286/404 (71%), Gaps = 14/404 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDP G+ITIKWDI+       V  V+I+N+Q YRHI  PGW+L W WR   VIW 
Sbjct  25    EAYDALDPTGNITIKWDIMSWTPDGYVAVVTIFNFQQYRHIQAPGWQLGWSWRKKEVIWS  84

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ATEQG+CS FK G  PHCC+K P I+DLLPGT + +Q  NCC+GGV+SS  QDP 
Sbjct  85    MVGAQATEQGDCSKFK-GNIPHCCKKTPTIVDLLPGTPYTQQISNCCRGGVISSWAQDPA  143

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +++FQ+S+G+  + +++  A        N TL  PG  YTCG A  V P+KF+    R
Sbjct  144   TAISSFQISVGQSGTTNTTVRAPR------NVTLKGPGPGYTCGPAQIVKPSKFISADKR  197

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCE--GQPGSAKCL  956
             R TQA+ TWNITC+YSQF A+ +PTCCVSLS+FYN+TIV CP C+CGC+   QPGS    
Sbjct  198   RKTQALFTWNITCTYSQFLARKTPTCCVSLSSFYNETIVPCPTCSCGCQNSSQPGSCVDP  257

Query  957   KAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFS  1136
             K     P  +    EP   ++QCT+HMCPIRVHWHVK +Y ++WRVK+ ITN+N+  N+S
Sbjct  258   KIASVVPASRKNSLEP---LLQCTKHMCPIRVHWHVKTNYKEYWRVKVAITNFNYNMNYS  314

Query  1137  QWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTEL  1316
             QWNLVV HPN  N+T++FSFNY+ L  Y DINDT M +G+++YND+L QAG  GNVQ+EL
Sbjct  315   QWNLVVQHPNFDNITQLFSFNYKPLTPYADINDTAMLWGVKFYNDLLSQAGPVGNVQSEL  374

Query  1317  LMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             L  KDP+ FTF +GW FPRRI FNG+ CV+P PD YP LPN+ P
Sbjct  375   LFRKDPSKFTFEKGWGFPRRIYFNGDNCVMPSPDSYPWLPNATP  418



>ref|XP_002305390.1| phytochelatin synthetase family protein [Populus trichocarpa]
 gb|EEE85901.1| phytochelatin synthetase family protein [Populus trichocarpa]
Length=453

 Score =   464 bits (1195),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 225/404 (56%), Positives = 281/404 (70%), Gaps = 12/404 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YDPLDP G+ITIKWDII       V  V+IYN+Q YRHI  PGW L W W    VIW 
Sbjct  32    EAYDPLDPTGNITIKWDIISWTADGYVAVVTIYNFQQYRHIQAPGWSLGWTWAKKEVIWS  91

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G +AT+QG+CS FK G  PHCC+K P ++DLLPGT +N+Q  NCCKGGV+SS  QDP 
Sbjct  92    MLGGQATDQGDCSKFK-GNVPHCCKKSPTVVDLLPGTPYNQQTANCCKGGVISSWAQDPA  150

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                ++FQ+S+G   + + +           NFTL  PG  YTC  A  V PT+F+    R
Sbjct  151   NAASSFQLSVGSAGTSNKTVRLPK------NFTLKAPGPGYTCARAKIVKPTRFMSTDKR  204

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCE-GQPGSAKCL-  956
             R TQA+ TWN+TC+YSQF AQ +P+CCVSLS+FYN TIV CP CTCGC+     S  C+ 
Sbjct  205   RITQALMTWNVTCTYSQFLAQKTPSCCVSLSSFYNDTIVPCPKCTCGCQRNNSDSGGCVD  264

Query  957   -KAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
               A     VV       P  +VQCT HMCPIRVHWHVKL+Y Q+WRVK+TITN+N+  N+
Sbjct  265   PNAPHLASVVSSLGNNNPMPLVQCTSHMCPIRVHWHVKLNYKQYWRVKVTITNFNYNMNY  324

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             +QWNLVV HPN  N+T+ FSFNY++L+ Y  INDT M +G+++YND+L+QAG  GNVQ+E
Sbjct  325   TQWNLVVQHPNFDNLTQSFSFNYQSLSPYSAINDTAMLWGVKFYNDLLMQAGRSGNVQSE  384

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             LL  KD +TFTF +GWAFPRRI FNG+ CV+P PD YP LPN++
Sbjct  385   LLFRKDKSTFTFDKGWAFPRRIYFNGDNCVMPPPDAYPWLPNAS  428



>ref|XP_008353506.1| PREDICTED: COBRA-like protein 1 isoform X1 [Malus domestica]
Length=457

 Score =   465 bits (1196),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 222/404 (55%), Positives = 285/404 (71%), Gaps = 12/404 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YDPLDPNG+ITIKWDI+       V  V+++N+Q YRHI  PGW L W W    VIW+
Sbjct  36    EAYDPLDPNGNITIKWDILSWTXDGYVAAVTLFNFQKYRHIQAPGWSLGWTWAKKEVIWN  95

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G +ATEQG+CS FK+   PHCC+K P ++DLLPGT +N+Q+ NCCKGGVLSS  QDPE
Sbjct  96    MVGGQATEQGDCSRFKT-TLPHCCKKTPTVVDLLPGTPYNQQYTNCCKGGVLSSWVQDPE  154

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
             K + +FQ+S+G+  + + +           NFTL  PG  YTC  A  V PTKF+    R
Sbjct  155   KAVGSFQISVGQAGTTNKTVRLPK------NFTLNTPGPGYTCARAKVVKPTKFISPDKR  208

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCE---GQPGSAKC  953
             R TQA+ TWN+TC+YSQ  AQ +PTCCVSLS+FYN TIV CP C+CGC+     PGS   
Sbjct  209   RVTQAMMTWNVTCTYSQILAQKTPTCCVSLSSFYNDTIVPCPNCSCGCQRNATHPGSCVE  268

Query  954   LKAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
               +     VV   +      +V+CT HMCPIRVHWHVK++Y Q+WRVK+T+TN+N+  N+
Sbjct  269   PDSPYLASVVSASNKNSYTPLVRCTAHMCPIRVHWHVKVNYKQYWRVKVTVTNFNYRMNY  328

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             S WN+VV HPN  N+T++FS+NY+++  Y  INDTGM +GI++YND+L+QAG  GNVQ+E
Sbjct  329   SDWNMVVQHPNFDNLTQIFSYNYKSITPYATINDTGMLWGIKFYNDILMQAGPLGNVQSE  388

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             LL  KD ATFTF +GWAFPRR+ FNG+ CV+P PD YP LPNS 
Sbjct  389   LLFQKDEATFTFDKGWAFPRRVYFNGDNCVMPPPDAYPWLPNSG  432



>ref|XP_009763134.1| PREDICTED: protein COBRA [Nicotiana sylvestris]
Length=451

 Score =   464 bits (1195),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 226/404 (56%), Positives = 282/404 (70%), Gaps = 12/404 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             D +D LDPNG+ITIKWD+I       V  V+IYN+Q YRHI  PGW L W W    VIW 
Sbjct  30    DAFDALDPNGNITIKWDVITWTPDGYVAVVTIYNFQQYRHIQAPGWTLGWTWAKKEVIWT  89

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G + TEQG+CS +K G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGV++S  QDP 
Sbjct  90    MMGGQTTEQGDCSKYK-GNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVINSWGQDPT  148

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +++FQ+S+G   + + +           NFTL  PG  YTCG A  V PTKFV   GR
Sbjct  149   TAVSSFQISVGAAGTTNKTVRVPK------NFTLKAPGPGYTCGPAKIVKPTKFVSADGR  202

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG---QPGSAKC  953
             R TQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN TIV CP CTCGC+    Q G+   
Sbjct  203   RVTQAMMTWNVTCTYSQFLAQKTPTCCVSLSSFYNDTIVPCPTCTCGCQTNGTQRGNCVD  262

Query  954   LKAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
              K      VV          +VQCT HMCPIR+HWHVK++Y ++WRVKITITN+N+  N+
Sbjct  263   SKTPHLASVVSDHGKTNYVPLVQCTNHMCPIRIHWHVKVNYKEYWRVKITITNFNYRMNY  322

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             +QWNLVV HPN  N+T +FSFNY++L  YG INDT M +G+++YND+L+QAG  GNVQ+E
Sbjct  323   TQWNLVVQHPNFDNLTTLFSFNYKSLTPYGAINDTAMLWGVKFYNDLLMQAGPLGNVQSE  382

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             LL  KD +TFTF +GWAFPRRI FNG+ CV+P PD YP LPNS 
Sbjct  383   LLFRKDASTFTFEKGWAFPRRIYFNGDNCVMPPPDAYPYLPNSG  426



>ref|XP_008341800.1| PREDICTED: COBRA-like protein 1 isoform X2 [Malus domestica]
Length=456

 Score =   464 bits (1195),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 222/403 (55%), Positives = 284/403 (70%), Gaps = 12/403 (3%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDM  431
              YDPLDPNG+ITIKWDI+       V  V+++N+Q YRHI  PGW L W W    VIW+M
Sbjct  36    AYDPLDPNGNITIKWDILSWTXDGYVAAVTLFNFQKYRHIQAPGWSLGWTWAKKEVIWNM  95

Query  432   WGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEK  611
              G +ATEQG+CS FK+   PHCC+K P ++DLLPGT +N+Q+ NCCKGGVLSS  QDPEK
Sbjct  96    VGGQATEQGDCSRFKT-TLPHCCKKTPTVVDLLPGTPYNQQYTNCCKGGVLSSWVQDPEK  154

Query  612   YLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGRR  785
              + +FQ+S+G+  + + +           NFTL  PG  YTC  A  V PTKF+    RR
Sbjct  155   AVGSFQISVGQAGTTNKTVRLPK------NFTLNTPGPGYTCARAKVVKPTKFISPDKRR  208

Query  786   TTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCE---GQPGSAKCL  956
              TQA+ TWN+TC+YSQ  AQ +PTCCVSLS+FYN TIV CP C+CGC+     PGS    
Sbjct  209   VTQAMMTWNVTCTYSQILAQKTPTCCVSLSSFYNDTIVPCPNCSCGCQRNATHPGSCVEP  268

Query  957   KAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFS  1136
              +     VV   +      +V+CT HMCPIRVHWHVK++Y Q+WRVK+T+TN+N+  N+S
Sbjct  269   DSPYLASVVSASNKNSYTPLVRCTAHMCPIRVHWHVKVNYKQYWRVKVTVTNFNYRMNYS  328

Query  1137  QWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTEL  1316
              WN+VV HPN  N+T++FS+NY+++  Y  INDTGM +GI++YND+L+QAG  GNVQ+EL
Sbjct  329   DWNMVVQHPNFDNLTQIFSYNYKSITPYATINDTGMLWGIKFYNDILMQAGPLGNVQSEL  388

Query  1317  LMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             L  KD ATFTF +GWAFPRR+ FNG+ CV+P PD YP LPNS 
Sbjct  389   LFQKDEATFTFDKGWAFPRRVYFNGDNCVMPPPDAYPWLPNSG  431



>gb|KHG07280.1| COBRA-like protein 1 [Gossypium arboreum]
 gb|KHG08968.1| COBRA-like protein 1 [Gossypium arboreum]
Length=450

 Score =   464 bits (1194),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 227/402 (56%), Positives = 282/402 (70%), Gaps = 16/402 (4%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YDPLDPNG+ITIKWDI+       V  V+IYN+Q YRHI  PGWKL W W    VIW 
Sbjct  35    EAYDPLDPNGNITIKWDIMSWTSDGYVAVVTIYNFQQYRHIQAPGWKLGWTWAKKEVIWS  94

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G E TEQG+CS FK G  PHCC K P ++DLLPGT +N+Q  NCCKGGVL+S  QDP 
Sbjct  95    MMGGETTEQGDCSRFK-GNIPHCCNKHPTVVDLLPGTPYNQQIANCCKGGVLNSWAQDPA  153

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                ++FQ+S+G+  + + +           NFTL  PG  YTCG A  V P++FV   GR
Sbjct  154   TAASSFQLSVGQSGTTNKTVRVPV------NFTLKAPGPGYTCGPAKIVKPSRFVTPDGR  207

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCE--GQPGSAKCL  956
             R TQA+ TWN+TC+YSQF AQ +P+CCVS S+FYN TIV C  C CGC+   QPGS    
Sbjct  208   RETQAMMTWNVTCTYSQFLAQEAPSCCVSFSSFYNDTIVPCSKCACGCQNTSQPGSCVES  267

Query  957   KAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFS  1136
             KA    PV     Y P   +V+CT HMCP+RVHWH+KL+Y ++WRVKITITN+N+  N++
Sbjct  268   KASHIAPVAS--SYTP---LVRCTSHMCPVRVHWHIKLNYKEYWRVKITITNFNYNMNYT  322

Query  1137  QWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTEL  1316
             QWNLVV HPN  N+T+ FSFNY+++  Y  INDT M +G+++YND+LL+AG  GNVQ+EL
Sbjct  323   QWNLVVQHPNFDNLTQSFSFNYKSITPYTAINDTAMLWGVKFYNDMLLEAGPLGNVQSEL  382

Query  1317  LMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNS  1442
             L  KD ATFTF EGWAFPRRI FNG+ CV+P P+ YP LPN+
Sbjct  383   LFRKDKATFTFEEGWAFPRRIYFNGDNCVMPPPNVYPGLPNA  424



>ref|XP_008353507.1| PREDICTED: COBRA-like protein 1 isoform X2 [Malus domestica]
Length=456

 Score =   464 bits (1194),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 222/403 (55%), Positives = 284/403 (70%), Gaps = 12/403 (3%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDM  431
              YDPLDPNG+ITIKWDI+       V  V+++N+Q YRHI  PGW L W W    VIW+M
Sbjct  36    AYDPLDPNGNITIKWDILSWTXDGYVAAVTLFNFQKYRHIQAPGWSLGWTWAKKEVIWNM  95

Query  432   WGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEK  611
              G +ATEQG+CS FK+   PHCC+K P ++DLLPGT +N+Q+ NCCKGGVLSS  QDPEK
Sbjct  96    VGGQATEQGDCSRFKT-TLPHCCKKTPTVVDLLPGTPYNQQYTNCCKGGVLSSWVQDPEK  154

Query  612   YLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGRR  785
              + +FQ+S+G+  + + +           NFTL  PG  YTC  A  V PTKF+    RR
Sbjct  155   AVGSFQISVGQAGTTNKTVRLPK------NFTLNTPGPGYTCARAKVVKPTKFISPDKRR  208

Query  786   TTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCE---GQPGSAKCL  956
              TQA+ TWN+TC+YSQ  AQ +PTCCVSLS+FYN TIV CP C+CGC+     PGS    
Sbjct  209   VTQAMMTWNVTCTYSQILAQKTPTCCVSLSSFYNDTIVPCPNCSCGCQRNATHPGSCVEP  268

Query  957   KAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFS  1136
              +     VV   +      +V+CT HMCPIRVHWHVK++Y Q+WRVK+T+TN+N+  N+S
Sbjct  269   DSPYLASVVSASNKNSYTPLVRCTAHMCPIRVHWHVKVNYKQYWRVKVTVTNFNYRMNYS  328

Query  1137  QWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTEL  1316
              WN+VV HPN  N+T++FS+NY+++  Y  INDTGM +GI++YND+L+QAG  GNVQ+EL
Sbjct  329   DWNMVVQHPNFDNLTQIFSYNYKSITPYATINDTGMLWGIKFYNDILMQAGPLGNVQSEL  388

Query  1317  LMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             L  KD ATFTF +GWAFPRR+ FNG+ CV+P PD YP LPNS 
Sbjct  389   LFQKDEATFTFDKGWAFPRRVYFNGDNCVMPPPDAYPWLPNSG  431



>gb|EPS71578.1| hypothetical protein M569_03176, partial [Genlisea aurea]
Length=433

 Score =   463 bits (1192),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 230/408 (56%), Positives = 282/408 (69%), Gaps = 18/408 (4%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDPNG+ITIKWD+I       V  V+I+N+Q YRHI  PGW L W W    VIW 
Sbjct  16    EAYDALDPNGNITIKWDVISWTPDGYVAVVTIFNFQQYRHIQAPGWTLGWTWAKKEVIWS  75

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G++ TEQG+CS FK G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGV++S  QDP 
Sbjct  76    MMGSQTTEQGDCSRFK-GNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVINSWVQDPA  134

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                ++FQ+S+G   + + +           NFTL  PG  YTCG A  V PTKFV   GR
Sbjct  135   NAASSFQVSVGGAGTTNKTVKLPK------NFTLKAPGPGYTCGPAKNVKPTKFVTQDGR  188

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG---QPGSAKC  953
             R TQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN TIV CP CTCGC+    QPGS   
Sbjct  189   RVTQAMMTWNVTCTYSQFLAQKTPTCCVSLSSFYNNTIVPCPTCTCGCKNNLTQPGSCVD  248

Query  954   LKAGEQPPVVQLQ----HYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNF  1121
                     VV        Y PP  +VQCT HMCP+RVHWHVKL+Y  +WRVK+TITN+NF
Sbjct  249   QFTPHLASVVSGSGKNGAYLPP--LVQCTSHMCPVRVHWHVKLNYKAYWRVKVTITNFNF  306

Query  1122  AKNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGN  1301
               N+S WNLV+ HPN  N+T+VFSFNY+ LN Y +INDT M +G+++YND L QAG  GN
Sbjct  307   RMNYSMWNLVIQHPNFDNLTQVFSFNYKPLNPYENINDTAMLWGVKFYNDFLNQAGPLGN  366

Query  1302  VQTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             VQ+E L  KD +TFTF +GWAFPRRI FNG+ CV+P PD YP LPNS+
Sbjct  367   VQSEFLFQKDKSTFTFEKGWAFPRRIYFNGDNCVMPPPDAYPYLPNSS  414



>ref|XP_008230280.1| PREDICTED: COBRA-like protein 1 [Prunus mume]
Length=456

 Score =   464 bits (1193),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 225/404 (56%), Positives = 282/404 (70%), Gaps = 12/404 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YDPLDPNG+ITIKWDII       V  V+IYN+Q YRHI  PGW L W W    VIW+
Sbjct  35    EAYDPLDPNGNITIKWDIISWTPDGYVAVVTIYNFQKYRHIQAPGWSLQWTWAKKEVIWN  94

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G +ATEQG+CS FK+   PHCC+K P ++DLLPGT +N+Q  NCCKGGVL+S  QDP 
Sbjct  95    MVGGQATEQGDCSKFKT-TIPHCCKKNPTVVDLLPGTPYNQQITNCCKGGVLTSWVQDPA  153

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               + +FQ+S+G+  + + +  A        NFTL  PG  YTCG A  V PTKFV    R
Sbjct  154   NAVGSFQLSVGQAGTTNKTVRAPK------NFTLNAPGPGYTCGRANIVKPTKFVTPDKR  207

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG---QPGSAKC  953
             R TQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN T+V CP C+CGC+     PGS   
Sbjct  208   RVTQAMMTWNVTCTYSQFLAQKTPTCCVSLSSFYNDTVVPCPACSCGCQSNATHPGSCVE  267

Query  954   LKAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
               +     VV          +V+CT HMCPIRVHWHVKL+Y ++WRVK+T+TN+N+  N+
Sbjct  268   PDSPYLASVVSASSKNSYTPLVRCTNHMCPIRVHWHVKLNYKEYWRVKVTVTNFNYRMNY  327

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             S WNLVV HPN  N+T+ FS+NY+++  Y  INDT M +G+++YND+L+QAG  GNVQ+E
Sbjct  328   SDWNLVVQHPNFDNLTQSFSYNYKSITPYATINDTAMLWGLKFYNDLLMQAGPLGNVQSE  387

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             LL  KD ATFTF +GWAFPRRI FNG+ CV+P PD YP LPNS 
Sbjct  388   LLFRKDQATFTFDKGWAFPRRIYFNGDNCVMPPPDAYPWLPNSG  431



>ref|XP_010260537.1| PREDICTED: protein COBRA-like isoform X1 [Nelumbo nucifera]
Length=456

 Score =   464 bits (1193),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 228/410 (56%), Positives = 288/410 (70%), Gaps = 24/410 (6%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YDPLDPNG+ITIKWDII       V  V+I+N+Q YRHI  PGW L W W    VIW 
Sbjct  37    EAYDPLDPNGNITIKWDIISWTPDGYVAVVTIFNFQQYRHIQAPGWTLGWTWAKKEVIWS  96

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G + TEQG+CS FK G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGV++S  QDP 
Sbjct  97    MMGGQTTEQGDCSRFK-GNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVINSWVQDPA  155

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                ++FQ+S+G   + + +           NFTL  PG  YTCG A  V PTKF+    R
Sbjct  156   NAASSFQLSVGAAGTTNKTVRVPK------NFTLKAPGPGYTCGPAKIVKPTKFISADKR  209

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG---QPGSAKC  953
             R TQA+ TWN+TC+YSQF +Q +PTCCVSLS+FYN TIV CP CTCGC+    QPGS  C
Sbjct  210   RVTQAMMTWNVTCTYSQFLSQKTPTCCVSLSSFYNDTIVPCPTCTCGCQNNITQPGS--C  267

Query  954   LKAGEQP------PVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNY  1115
             ++ G+ P             Y P   +VQCT HMCPIRVHWHVKL+Y ++WRVKITITN+
Sbjct  268   VE-GDSPYLASALSSSSKNSYTP---LVQCTNHMCPIRVHWHVKLNYKEYWRVKITITNF  323

Query  1116  NFAKNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEG  1295
             N+  N+++WNLVV HPN  N+T++FSFNY++L  Y  INDT M +G+++YND+L+QAG  
Sbjct  324   NYRMNYTEWNLVVQHPNFDNLTQIFSFNYKSLTPYAAINDTAMLWGVKFYNDLLMQAGPL  383

Query  1296  GNVQTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             GNVQ+ELL  KD +TFTF +GWAFPRRI FNG+ CV+P PD YP LPN++
Sbjct  384   GNVQSELLFRKDKSTFTFEKGWAFPRRIYFNGDNCVMPPPDAYPWLPNAS  433



>ref|XP_004981735.1| PREDICTED: COBRA-like protein 3-like [Setaria italica]
Length=449

 Score =   463 bits (1192),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 224/407 (55%), Positives = 289/407 (71%), Gaps = 17/407 (4%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDPNG+ITIKWDI++      V  V+++NYQ +RHI  PGW+L W W    VIW 
Sbjct  29    EAYDSLDPNGNITIKWDIMQWTPDGYVAVVTMFNYQQFRHIGAPGWQLGWTWAKKEVIWS  88

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ TEQG+CS FK G  PHCC+K+P I+DLLPGT +N Q  NCCK GV+++  QDP 
Sbjct  89    MVGAQTTEQGDCSKFK-GNTPHCCKKDPTIVDLLPGTPYNMQIANCCKAGVINTFNQDPA  147

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                A+FQ+S+G   + + +           NFTL  PG  YTCG A    PTKF    GR
Sbjct  148   NAAASFQISVGLAGTTNKTVKVPK------NFTLKTPGPGYTCGRAIVGRPTKFFTSDGR  201

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKA  962
             R TQA+ TWN+TC+YSQF AQ +P+CCVSLS+FYN TIV+CP C+CGC+  P  + C+  
Sbjct  202   RATQALMTWNVTCTYSQFLAQKTPSCCVSLSSFYNDTIVNCPTCSCGCQ-NPNGSNCVN-  259

Query  963   GEQPPVVQLQHYEPP----QAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKN  1130
              E  P +Q     P     Q +VQCT HMCPIR+HWHVKL+Y ++WRVKITITN+NF  N
Sbjct  260   -EDSPNLQSAIDGPGKWTGQPLVQCTSHMCPIRIHWHVKLNYKEYWRVKITITNFNFRMN  318

Query  1131  FSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGD-INDTGMFYGIQYYNDVLLQAGEGGNVQ  1307
             ++QWNLV  HPN  N+T++FSFNY+ L  YG  INDT MF+G+++YND+L+QAG+ GNVQ
Sbjct  319   YTQWNLVAQHPNFDNITQLFSFNYKPLTPYGSGINDTAMFWGVKFYNDLLMQAGKLGNVQ  378

Query  1308  TELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             +ELL+ KD  TFTF +GWAFPRR+ FNG+ CV+P P++YP LPN++P
Sbjct  379   SELLLRKDSQTFTFEKGWAFPRRVYFNGDNCVMPSPENYPWLPNASP  425



>ref|XP_009600080.1| PREDICTED: protein COBRA [Nicotiana tomentosiformis]
Length=451

 Score =   463 bits (1192),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 224/404 (55%), Positives = 282/404 (70%), Gaps = 12/404 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             D +D LDPNG+ITIKWD+I       +  V+IYN+Q YRHI  PGW L W W    VIW 
Sbjct  30    DAFDALDPNGNITIKWDVITWTPDGYMAVVTIYNFQQYRHIQAPGWTLGWTWAKKEVIWT  89

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G + TEQG+CS +K G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGV++S  QDP 
Sbjct  90    MMGGQTTEQGDCSKYK-GNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVINSWGQDPT  148

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +++FQ+S+G   + + +           NFTL  PG  YTCG A  V PTKFV   GR
Sbjct  149   TAVSSFQISVGAAGTTNKTVRVPK------NFTLKAPGPGYTCGPAKIVKPTKFVSSDGR  202

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG---QPGSAKC  953
             R TQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN TIV CP CTCGC+    Q G+   
Sbjct  203   RVTQAMMTWNVTCTYSQFLAQKTPTCCVSLSSFYNDTIVPCPTCTCGCQSNGTQRGNCVD  262

Query  954   LKAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
              K      VV          +VQCT HMCPIR+HWHVK++Y ++WRVKITITN+N+  N+
Sbjct  263   SKTPHLASVVSDHGKTNYVPLVQCTNHMCPIRIHWHVKVNYKEYWRVKITITNFNYRMNY  322

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             +QWNLVV HPN  N+T +FSFNY++L  YG INDT M +G+++YND+L+QAG  GNVQ+E
Sbjct  323   TQWNLVVQHPNFDNLTTLFSFNYKSLTPYGAINDTAMLWGVKFYNDLLMQAGPLGNVQSE  382

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             LL  KD +TFTF +GWAFPRRI FNG+ CV+P PD YP LPN+ 
Sbjct  383   LLFRKDASTFTFEKGWAFPRRIYFNGDNCVMPPPDAYPYLPNAG  426



>gb|ABK25014.1| unknown [Picea sitchensis]
Length=458

 Score =   463 bits (1192),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 224/406 (55%), Positives = 291/406 (72%), Gaps = 17/406 (4%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDM  431
              YDPLDPNG+ITIKWDI+       +  V+I N+Q YRHI  PGW L W W    VIW M
Sbjct  39    AYDPLDPNGNITIKWDIMSWTPDGYLAVVTINNFQQYRHIQSPGWTLGWTWAKKEVIWSM  98

Query  432   WGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEK  611
              GA+ TEQG+CS +K G  PHCC K P ++DLLPGT +N+Q  NCCKGGV++S  QDP  
Sbjct  99    VGAQTTEQGDCSKYK-GNIPHCCNKNPTVVDLLPGTPYNQQIANCCKGGVIASWAQDPVN  157

Query  612   YLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGRR  785
              ++AFQ+S+G   + +++           NFTL  PG  YTCG A +V  +KF+   GRR
Sbjct  158   AVSAFQVSVGNAGTTNTTVRLPK------NFTLKAPGPGYTCGPAKKVRASKFLTTDGRR  211

Query  786   TTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG---QPGSAKCL  956
              TQA+ TWNITC+YSQF AQ +P+CCVSL++FYN TIV CP CTCGC+    QPG+  C+
Sbjct  212   VTQALMTWNITCTYSQFLAQKTPSCCVSLTSFYNDTIVPCPACTCGCQNNITQPGT--CV  269

Query  957   KAGEQPPVVQLQHYEPPQA--IVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKN  1130
             ++ + P +  L +  P     ++QCT HMCPI++HWHVKL+Y ++WRVK+TITN+N+  N
Sbjct  270   ES-DSPVLPSLLNTSPKNLAPLIQCTPHMCPIKIHWHVKLNYKEYWRVKVTITNFNYRMN  328

Query  1131  FSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQT  1310
             ++QWN+VV HPN  NVT++FSFNY+ L  YG INDT M +G++YYND+L+QAGE GNVQ+
Sbjct  329   YTQWNIVVQHPNFDNVTQLFSFNYKPLTPYGKINDTAMLWGVKYYNDMLMQAGEMGNVQS  388

Query  1311  ELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             ELL  KD  TFTF++GW FPRR+ FNG++CVLP PD YP LPN +P
Sbjct  389   ELLFQKDKQTFTFKQGWGFPRRVYFNGDDCVLPPPDAYPWLPNGSP  434



>ref|NP_001050367.1| Os03g0416300 [Oryza sativa Japonica Group]
 sp|Q75IW1.1|COBL2_ORYSJ RecName: Full=COBRA-like protein 2; AltName: Full=Protein BRITTLE 
CULM1-like 2; Flags: Precursor [Oryza sativa Japonica Group]
 gb|AAS07075.1| putative phytochelatin synthetase [Oryza sativa Japonica Group]
 gb|ABF96618.1| COBRA-like protein 2 precursor, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12281.1| Os03g0416300 [Oryza sativa Japonica Group]
 dbj|BAG96187.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC75472.1| hypothetical protein OsI_12048 [Oryza sativa Indica Group]
 gb|EEE59257.1| hypothetical protein OsJ_11271 [Oryza sativa Japonica Group]
Length=458

 Score =   463 bits (1192),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 232/406 (57%), Positives = 289/406 (71%), Gaps = 11/406 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YDPLDPNG+ITIKWDI +      V  V+IYN+Q YRHI  PGW L W W    +IW 
Sbjct  28    EAYDPLDPNGNITIKWDITQWTPDGYVAVVTIYNFQKYRHIQAPGWSLGWAWAKKEIIWS  87

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G +ATEQG+CSAFK+   PHCC+++P ++DL+PG  +N QF NCCKGGVL+S  QDP 
Sbjct  88    MAGGQATEQGDCSAFKA-NIPHCCKRDPRVVDLVPGAPYNMQFGNCCKGGVLTSWVQDPL  146

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEV-PPTKFVEDHG  779
               +A+FQ+++G   + + +  A        NFTL  PG  Y+CG A EV PPT+F+   G
Sbjct  147   NAVASFQITVGHSGTSNKTVKAPK------NFTLKAPGPGYSCGLAQEVKPPTRFISLDG  200

Query  780   RRTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQ-PGSAKCL  956
             RRTTQA  TWN+TC+YSQF AQ +PTCCVSLS+FYN+TIV+CP C CGC+ + PGS    
Sbjct  201   RRTTQAHVTWNVTCTYSQFVAQRAPTCCVSLSSFYNETIVNCPKCACGCQNKKPGSCVEG  260

Query  957   KAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFS  1136
              +     VV          +VQCT HMCPIRVHWHVKL+Y  +WRVK+TITN+N+  N+S
Sbjct  261   NSPYLASVVNGPGKGSLTPLVQCTPHMCPIRVHWHVKLNYRDYWRVKVTITNWNYRMNYS  320

Query  1137  QWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTEL  1316
             QWNLVV HPN  NV+ VFSFNY++LN YG INDT M +G++YYND+L+ AG  GNVQ+EL
Sbjct  321   QWNLVVQHPNFENVSTVFSFNYKSLNPYGVINDTAMMWGVKYYNDLLMVAGPDGNVQSEL  380

Query  1317  LMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAPPH  1454
             L  KD +TFTF +GWAFPRRI FNGE CV+P PD YP LP S+ P 
Sbjct  381   LFRKDRSTFTFDKGWAFPRRIYFNGESCVMPSPDLYPWLPPSSTPR  426



>gb|ACG27916.1| COBRA-like protein 4 precursor [Zea mays]
Length=449

 Score =   463 bits (1191),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 223/407 (55%), Positives = 289/407 (71%), Gaps = 17/407 (4%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDPNG+ITIKWDI++      V  V+++NYQ +RHI  PGW+L W W    VIW 
Sbjct  29    EAYDSLDPNGNITIKWDIMQWTPDGYVAVVTMFNYQQFRHIGAPGWQLGWTWAKKEVIWS  88

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ TEQG+CS FK G  PHCC+K+P I+DLLPGT +N Q  NCCK GV+++  QDP 
Sbjct  89    MVGAQTTEQGDCSKFK-GNTPHCCKKDPTIVDLLPGTPYNMQIANCCKAGVINTFNQDPA  147

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                ++FQ+S+G   + + +           NFTL  PG  YTCG A    PTKF    GR
Sbjct  148   NAASSFQISVGLAGTTNKTVKVPK------NFTLKTPGPGYTCGRAIVGRPTKFFSADGR  201

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKA  962
             R TQA+ TWN+TC+YSQF AQ +P+CCVSLS+FYN TIV+CP C+CGC+  P  + C+  
Sbjct  202   RVTQALMTWNVTCTYSQFLAQKTPSCCVSLSSFYNDTIVNCPTCSCGCQ-NPSGSNCVN-  259

Query  963   GEQPPVVQLQHYEPP----QAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKN  1130
              E  P +Q     P     Q +VQCT HMCPIR+HWHVKL+Y ++WRVKITITN+NF  N
Sbjct  260   -EDSPNLQAAIDGPGKWTGQPLVQCTSHMCPIRIHWHVKLNYKEYWRVKITITNFNFRMN  318

Query  1131  FSQWNLVVLHPNLGNVTRVFSFNYRTLNQY-GDINDTGMFYGIQYYNDVLLQAGEGGNVQ  1307
             ++QWNLV  HPN  N+T++FSFNY+ L  Y G INDT MF+G+++YND+L+QAG+ GNVQ
Sbjct  319   YTQWNLVAQHPNFDNITQLFSFNYKPLTPYGGGINDTAMFWGVKFYNDLLMQAGKLGNVQ  378

Query  1308  TELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             +ELL+ KD  TFTF +GWAFPRR+ FNG+ CV+P P++YP LPN++P
Sbjct  379   SELLLRKDSRTFTFEKGWAFPRRVYFNGDNCVMPSPENYPWLPNASP  425



>gb|KHG10282.1| COBRA-like protein 1 [Gossypium arboreum]
Length=455

 Score =   463 bits (1191),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 225/403 (56%), Positives = 284/403 (70%), Gaps = 11/403 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YDPLDPNG+ITIKWDI+       V  V+I+N+Q YRHI  PGW L W+W    VIW 
Sbjct  35    EAYDPLDPNGNITIKWDIMSWTADGYVAVVTIFNFQQYRHIQAPGWTLGWKWSKKEVIWS  94

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G + TEQG+CS FK G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGVL+S  QD  
Sbjct  95    MMGGQTTEQGDCSRFK-GNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVLNSWVQDSA  153

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                ++FQ+S+G+  + + +           NFTL  PG  YTCG A  V P++FV    R
Sbjct  154   TAASSFQVSVGQAGTTNKTVRVPK------NFTLKAPGPGYTCGPAKIVKPSRFVTADKR  207

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCE--GQPGSAKCL  956
             R TQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN+TIV CP C CGC+   QPGS    
Sbjct  208   RVTQALMTWNVTCTYSQFLAQKTPTCCVSLSSFYNETIVPCPQCACGCQNTSQPGSCVDP  267

Query  957   KAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFS  1136
             KA     VV          +VQCT HMCP+RVHWHVKL+Y ++WRVK+TITN+N+  N++
Sbjct  268   KAPHIASVVPSTGKNNYAPLVQCTSHMCPVRVHWHVKLNYKEYWRVKVTITNFNYNMNYT  327

Query  1137  QWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTEL  1316
             QWNLVV HPN  N+T++FSFNY++L  Y  INDT M +G+++YND+L QAG+ GNVQ+EL
Sbjct  328   QWNLVVQHPNFDNLTQIFSFNYKSLTPYTAINDTAMLWGVKFYNDLLSQAGQLGNVQSEL  387

Query  1317  LMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             L  KD ATFTF +GWAFPRRI FNG+ CV+P PD YP LPN +
Sbjct  388   LFRKDKATFTFEKGWAFPRRIYFNGDNCVMPPPDAYPWLPNGS  430



>ref|NP_001105969.1| brittle stalk-2-like protein 4 precursor [Zea mays]
 gb|ABL59984.1| brittle stalk-2-like protein 4 [Zea mays]
 gb|AFW67585.1| COBRA-like protein 4 [Zea mays]
Length=449

 Score =   462 bits (1190),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 223/407 (55%), Positives = 289/407 (71%), Gaps = 17/407 (4%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDPNG+ITIKWDI++      V  V+++NYQ +RHI  PGW+L W W    VIW 
Sbjct  29    EAYDSLDPNGNITIKWDIMQWTPDGYVAVVTMFNYQQFRHIGAPGWQLGWTWAKKEVIWS  88

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ TEQG+CS FK G  PHCC+K+P I+DLLPGT +N Q  NCCK GV+++  QDP 
Sbjct  89    MVGAQTTEQGDCSKFK-GNTPHCCKKDPTIVDLLPGTPYNMQIANCCKAGVINTFNQDPA  147

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                ++FQ+S+G   + + +           NFTL  PG  YTCG A    PTKF    GR
Sbjct  148   NAASSFQISVGLAGTTNKTVKVPK------NFTLKTPGPGYTCGRAIVGRPTKFFSADGR  201

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKA  962
             R TQA+ TWN+TC+YSQF AQ +P+CCVSLS+FYN TIV+CP C+CGC+  P  + C+  
Sbjct  202   RVTQALMTWNVTCTYSQFLAQKTPSCCVSLSSFYNDTIVNCPTCSCGCQ-NPSGSNCVN-  259

Query  963   GEQPPVVQLQHYEPP----QAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKN  1130
              E  P +Q     P     Q +VQCT HMCPIR+HWHVKL+Y ++WRVKITITN+NF  N
Sbjct  260   -EDSPNLQAAIDGPGKWTGQPLVQCTSHMCPIRIHWHVKLNYKEYWRVKITITNFNFRMN  318

Query  1131  FSQWNLVVLHPNLGNVTRVFSFNYRTLNQY-GDINDTGMFYGIQYYNDVLLQAGEGGNVQ  1307
             ++QWNLV  HPN  N+T++FSFNY+ L  Y G INDT MF+G+++YND+L+QAG+ GNVQ
Sbjct  319   YTQWNLVAQHPNFDNITQLFSFNYKPLTPYGGGINDTAMFWGVKFYNDLLMQAGKLGNVQ  378

Query  1308  TELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             +ELL+ KD  TFTF +GWAFPRR+ FNG+ CV+P P++YP LPN++P
Sbjct  379   SELLLRKDSRTFTFEKGWAFPRRVYFNGDNCVMPSPENYPWLPNASP  425



>ref|XP_010314628.1| PREDICTED: COBRA-like protein 6 isoform X2 [Solanum lycopersicum]
Length=438

 Score =   462 bits (1189),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 214/326 (66%), Positives = 259/326 (79%), Gaps = 6/326 (2%)
 Frame = +3

Query  330   VTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDMWGAEATEQGNCSAFKSGQRPHCCEKE  509
             + VSI+NYQL+RH++ PGWKLSW W G  VIW MWGAE TEQG+CSA K    PHCC KE
Sbjct  85    IRVSIFNYQLFRHVEQPGWKLSWDWHGKEVIWQMWGAETTEQGDCSAIKGDTLPHCCLKE  144

Query  510   PVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEKYLAAFQMsigrvssksssgaavaapp  689
             PVI+DLLPG  +NKQ  NCCKGGVL+S+TQDPEKY+++F+M I   S+  S         
Sbjct  145   PVILDLLPGAPYNKQVANCCKGGVLTSLTQDPEKYVSSFEMIIASASNDGSGPRMPE---  201

Query  690   ipgNFTLGVPGYTCGEAFEVPPTKFVEDHGRRTTQAVGTWNITCSYSQFRAQSSPTCCVS  869
                NFTLG+PGYTCG A +VPPTKF ED GRR TQAV TW++ CSYSQFRA SSP CCVS
Sbjct  202   ---NFTLGIPGYTCGVAVKVPPTKFHEDQGRRQTQAVATWDVICSYSQFRASSSPACCVS  258

Query  870   LSTFYNKTIVSCPICTCGCEGQPGSAKCLKAGEQPPVVQLQHYEPPQAIVQCTQHMCPIR  1049
             LS FY++TIV C +C+CGC+GQ G+A+C+K GE PPV+QL H E P  I++CT+HMCPI+
Sbjct  259   LSAFYSETIVPCSVCSCGCQGQRGAAQCVKRGEVPPVLQLGHNELPTPILECTRHMCPIQ  318

Query  1050  VHWHVKLSYTQHWRVKITITNYNFAKNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDI  1229
             VHWHVK SY ++WRVK+TI N N  +N+SQWNLVVLHPNL ++T+VFSF+Y+ L+QYGDI
Sbjct  319   VHWHVKQSYREYWRVKMTIRNLNLVRNYSQWNLVVLHPNLRSITQVFSFDYKPLDQYGDI  378

Query  1230  NDTGMFYGIQYYNDVLLQAGEGGNVQ  1307
             NDTGMFYGI+YYND+LLQAG  G VQ
Sbjct  379   NDTGMFYGIKYYNDMLLQAGRSGVVQ  404



>ref|XP_002875546.1| hypothetical protein ARALYDRAFT_484733 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51805.1| hypothetical protein ARALYDRAFT_484733 [Arabidopsis lyrata subsp. 
lyrata]
Length=439

 Score =   462 bits (1189),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 223/407 (55%), Positives = 286/407 (70%), Gaps = 14/407 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDP G+ITIKWDII       +  V+I+N+Q YRHI+ PGW+L W W    VIW 
Sbjct  25    EAYDALDPTGNITIKWDIISWTADGYLAVVTIFNFQQYRHIEAPGWQLGWSWLKKEVIWS  84

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G +ATEQG+CS FK G  PHCC+K P I+DLLPGT +N+Q  NCC+GGV+S+  QDP 
Sbjct  85    MVGGQATEQGDCSKFK-GNIPHCCKKTPAIVDLLPGTPYNQQISNCCRGGVISAWAQDPA  143

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +++FQ+S+G+  + +++  A        N TL  PG  YTCG A  V PTKF+    R
Sbjct  144   TAISSFQISVGQSGTTNTTVRAPR------NITLKAPGPGYTCGPAKLVKPTKFISADER  197

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCL--  956
             R TQA+ TWNITC+YSQF A+ +PTCCVSLS FYN+TI+ CP C+CGC+    +  C+  
Sbjct  198   RKTQALLTWNITCTYSQFLARKTPTCCVSLSAFYNETIIPCPTCSCGCQNSSQAGTCVDP  257

Query  957   KAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFS  1136
             K     P     + EP   ++QCTQHMCPIRVHWHVK +Y ++WRVK+ ITN+N+  N+S
Sbjct  258   KIASVVPASGKNNLEP---LLQCTQHMCPIRVHWHVKTNYKEYWRVKVAITNFNYNMNYS  314

Query  1137  QWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTEL  1316
             QWNLVV HPN  N+T++FSFNY+ LN Y +INDT M +GI++YND L QAG  GNVQ+EL
Sbjct  315   QWNLVVQHPNFDNLTQLFSFNYKPLNPYANINDTAMLWGIKFYNDFLSQAGPVGNVQSEL  374

Query  1317  LMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAPPHS  1457
             L  K+P  FTF +GWAFPRRI FNG+ CV+P PD YP LPN+ P H+
Sbjct  375   LFQKNPLEFTFEKGWAFPRRIYFNGDNCVMPPPDSYPWLPNATPNHA  421



>ref|XP_003559986.1| PREDICTED: COBRA-like protein 1 [Brachypodium distachyon]
Length=451

 Score =   462 bits (1190),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 225/406 (55%), Positives = 279/406 (69%), Gaps = 12/406 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             D YDPLDP G+ITIKWD+++      V  VS+YNYQ YRHI  PGWKL W W    +IW 
Sbjct  27    DAYDPLDPGGNITIKWDVMQWTADGYVAVVSLYNYQQYRHIQPPGWKLGWIWAKKEIIWS  86

Query  429   MWGAEATEQGNCSAFKSGQRP-HCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDP  605
               G + TEQG+CS FK+   P HCC K+P ++DLLP   ++ +  NCCKGGVL S  QDP
Sbjct  87    TMGGQTTEQGDCSRFKAAPAPPHCCRKDPEVVDLLPSAPYSARIANCCKGGVLGSWAQDP  146

Query  606   EKYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHG  779
                 A+FQ+S+G+  + S S           NFTL  PG  YTCG A  V PT+FV   G
Sbjct  147   ADAAASFQLSVGQAGTSSRSVRVPL------NFTLRAPGPGYTCGPAKVVRPTRFVSPDG  200

Query  780   RRTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLK  959
             RR+TQA+ TWN+TC+YSQF AQ SPTCCVSLS+FYN TIV CP C+CGC+          
Sbjct  201   RRSTQALMTWNVTCTYSQFVAQRSPTCCVSLSSFYNDTIVHCPTCSCGCQNTNSKTDTCV  260

Query  960   AGEQP---PVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKN  1130
              G+ P    VV     +    +V+CT HMCPIRVHWHVK+SY  +WRVKIT+TN+N+  N
Sbjct  261   EGDSPYLASVVNGDGKDSLVPLVECTPHMCPIRVHWHVKVSYRNYWRVKITVTNFNYRMN  320

Query  1131  FSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQT  1310
             +S+WNLV  HPN  N+T +FSFNY+ LN YG INDT M +GI+YYND+L+ AG  GNVQ+
Sbjct  321   YSRWNLVAQHPNFDNLTTIFSFNYKALNPYGTINDTAMLWGIKYYNDLLMTAGPDGNVQS  380

Query  1311  ELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             ELL  KD ATFTF++GWAFPRR+ FNG+ CV+P PD YP LPN++P
Sbjct  381   ELLFRKDAATFTFQKGWAFPRRVYFNGDNCVMPPPDAYPWLPNASP  426



>ref|XP_006395263.1| hypothetical protein EUTSA_v10004232mg [Eutrema salsugineum]
 gb|ESQ32549.1| hypothetical protein EUTSA_v10004232mg [Eutrema salsugineum]
Length=441

 Score =   462 bits (1189),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 225/406 (55%), Positives = 287/406 (71%), Gaps = 16/406 (4%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             D YD LDPNG+ITIKWDI+       V  V+I+N+Q YRHI  PGW+L W W    VIW 
Sbjct  25    DAYDALDPNGNITIKWDIMSWTPDGYVAVVTIFNFQQYRHIQAPGWQLGWTWLKKEVIWS  84

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ATEQG+CS FK G  PHCC+K P ++DLLPGT +N+Q  NCCKGGV+SS  QDP 
Sbjct  85    MVGAQATEQGDCSKFK-GNIPHCCKKTPTVVDLLPGTPYNQQISNCCKGGVISSWAQDPS  143

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +++FQ+S+G+  + + +  A        N TL  PG  YTCG A  V P+KF+    R
Sbjct  144   TAVSSFQISVGQSGTTNKTVRAPR------NITLKSPGPGYTCGPAKNVMPSKFISGDKR  197

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKA  962
             R TQA+ TWN+TC+YSQF A+ +PTCCVSLS+FYN+TIV CP C+CGC+    S  C+  
Sbjct  198   RKTQALLTWNMTCTYSQFLARKTPTCCVSLSSFYNQTIVPCPTCSCGCQNSSQSGTCVDN  257

Query  963   GEQPPVVQL----QHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKN  1130
              +   VV       + EP   ++QCTQHMCPIRVHWHVK +Y ++WRVK+TITN+N+  N
Sbjct  258   PKISSVVPATSGKNNLEP---LLQCTQHMCPIRVHWHVKTNYKEYWRVKVTITNFNYNMN  314

Query  1131  FSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQT  1310
             ++QWN+VV HPN  N+T++FSFNY+ LN Y  INDT M +GI++YND L QAG  GNVQ+
Sbjct  315   YTQWNMVVQHPNFDNLTQLFSFNYKPLNPYAGINDTAMLWGIKFYNDFLSQAGPIGNVQS  374

Query  1311  ELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             ELL  K+P+ FTF +GWAFPRRI FNG+ CV+P PD YP LPN+ P
Sbjct  375   ELLFRKNPSKFTFEKGWAFPRRIYFNGDNCVMPPPDSYPWLPNATP  420



>ref|XP_004491893.1| PREDICTED: protein COBRA-like [Cicer arietinum]
Length=446

 Score =   462 bits (1189),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 227/404 (56%), Positives = 281/404 (70%), Gaps = 12/404 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             D YDPLDPNG+ITIKWDII       V  V++ N+Q YRHI  PGW L W W    VIW 
Sbjct  26    DAYDPLDPNGNITIKWDIITWTPDGYVAVVTVNNFQQYRHIAAPGWSLGWTWAKKEVIWG  85

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G++ TEQG+CS FK G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGVLSS  QDP 
Sbjct  86    MVGSQTTEQGDCSKFK-GNVPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVLSSWAQDPT  144

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               + +FQ+S+GR  + + +           NFTL  PG  YTCG A  V PT+F++   R
Sbjct  145   NAVGSFQISVGRAGTTNKTVKVPK------NFTLKAPGPGYTCGPAKVVRPTQFIQPDKR  198

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG---QPGSAKC  953
             R TQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN+TIV CP C CGC+    Q GS   
Sbjct  199   RVTQALMTWNVTCTYSQFLAQKTPTCCVSLSSFYNETIVPCPTCACGCQSNSSQSGSCID  258

Query  954   LKAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
                     VV        Q +VQCT HMCPIR+HWHVKL+Y ++WRVK+TITN+N+  N+
Sbjct  259   RNTPHLASVVAGSGKNNFQPLVQCTSHMCPIRIHWHVKLNYKEYWRVKVTITNFNYRMNY  318

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             S WNLVV HPN  N+T++FSFNY++LN YG INDT M +G+++YND L  AG  GNVQ+E
Sbjct  319   SDWNLVVQHPNFDNLTQLFSFNYKSLNPYGSINDTAMLWGVKFYNDFLNYAGPSGNVQSE  378

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             LL  KD +TFTF +GWAFPRRI FNG+ CV+P PD YP LPN+ 
Sbjct  379   LLFRKDKSTFTFDKGWAFPRRIYFNGDNCVMPPPDAYPWLPNTG  422



>ref|XP_003557716.1| PREDICTED: COBRA-like protein 2 [Brachypodium distachyon]
Length=457

 Score =   462 bits (1190),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 235/409 (57%), Positives = 292/409 (71%), Gaps = 19/409 (5%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YDPLDPNG+ITIKWDII+      V  VSIYNYQ YRHI  PGW L W W    +IW 
Sbjct  24    EAYDPLDPNGNITIKWDIIQWTSDGYVAVVSIYNYQKYRHIQAPGWHLGWVWAKKEIIWT  83

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G +ATEQG+CS FK G  PHCC+++P  +DLLPG  +N Q  NCCKGGVL+S  QDP 
Sbjct  84    MTGGQATEQGDCSQFK-GDIPHCCKRDPTTVDLLPGAPYNMQVANCCKGGVLTSWVQDPV  142

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVP-PTKFVEDHG  779
               +A+FQ+S+GR  + + +  A        NFTL  PG  YTCG A  V  PTKF+   G
Sbjct  143   SAVASFQISVGRSGTNNKTVKAPK------NFTLKAPGPGYTCGVAENVKLPTKFISLDG  196

Query  780   RRTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG---QPGSAK  950
             RRTTQA  TW++TC+YSQF AQ +PTCCVSLS+FYN+TI++CP C+CGC     +PGS  
Sbjct  197   RRTTQAHVTWSVTCTYSQFVAQRAPTCCVSLSSFYNETIINCPKCSCGCHNNITKPGS--  254

Query  951   CLKAGEQPPVVQLQHYEPPQA---IVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNF  1121
             C++ G  P +V + +     +   +VQC+ HMCPIRVHWHVK +Y  +WRVKITITN+N+
Sbjct  255   CVE-GNSPYLVSVVNGPGKGSSIPLVQCSSHMCPIRVHWHVKFNYRDYWRVKITITNWNY  313

Query  1122  AKNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGN  1301
               N+SQWNLVV HPN  N+T +FSFNY+ LN +G INDT M +GI+YYND+L+ AG  GN
Sbjct  314   RMNYSQWNLVVQHPNFDNITTIFSFNYKALNPFGVINDTAMLWGIKYYNDLLMVAGPDGN  373

Query  1302  VQTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             VQ+ELL  K+P+TFT  +GWAFPRRI FNGE CV+P PD YP LPNS+P
Sbjct  374   VQSELLFRKEPSTFTLGKGWAFPRRIYFNGESCVMPPPDSYPWLPNSSP  422



>ref|XP_007215357.1| hypothetical protein PRUPE_ppa005522mg [Prunus persica]
 gb|EMJ16556.1| hypothetical protein PRUPE_ppa005522mg [Prunus persica]
Length=456

 Score =   462 bits (1189),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 224/404 (55%), Positives = 282/404 (70%), Gaps = 12/404 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YDPLDP+G+ITIKWDII       V  V+IYN+Q YRHI  PGW L W W    VIW+
Sbjct  35    EAYDPLDPSGNITIKWDIISWTPDGYVAVVTIYNFQKYRHIQAPGWSLGWTWAKKEVIWN  94

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G +ATEQG+CS FK+   PHCC+K P ++DLLPGT +N+Q  NCCKGGVL+S  QDP 
Sbjct  95    MVGGQATEQGDCSKFKT-TIPHCCKKNPTVVDLLPGTPYNQQITNCCKGGVLASWVQDPA  153

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               + +FQ+S+G+  + + +  A        N TL  PG  YTCG A  V PTKFV    R
Sbjct  154   NAVGSFQLSVGQAGTTNKTVRAPK------NLTLNAPGPGYTCGRANIVKPTKFVTADKR  207

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG---QPGSAKC  953
             R TQA+ TWN+TC+YSQF AQ++PTCCVSLS+FYN T+V CP C+CGC+     PGS   
Sbjct  208   RVTQAMMTWNVTCTYSQFLAQTTPTCCVSLSSFYNDTVVPCPACSCGCQSNATHPGSCVE  267

Query  954   LKAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
               +     VV          +V+CT HMCPIRVHWHVKL+Y ++WRVK+T+TN+N+  N+
Sbjct  268   PDSPYLASVVSASSKNSYMPLVRCTNHMCPIRVHWHVKLNYKEYWRVKVTVTNFNYRMNY  327

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             S WNLVV HPN  N+T+ FSFNY+++  Y  INDT M +G+++YND+L+QAG  GNVQ+E
Sbjct  328   SDWNLVVQHPNFDNLTQSFSFNYKSITPYATINDTAMLWGLKFYNDLLMQAGPLGNVQSE  387

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             LL  KD ATFTF +GWAFPRRI FNG+ CV+P PD YP LPNS 
Sbjct  388   LLFQKDQATFTFDKGWAFPRRIYFNGDNCVMPPPDAYPWLPNSG  431



>ref|XP_011099033.1| PREDICTED: COBRA-like protein 4 [Sesamum indicum]
Length=433

 Score =   461 bits (1187),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 221/405 (55%), Positives = 291/405 (72%), Gaps = 18/405 (4%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             D YDPLDPNG+ITIKWD++       V  V++ N+Q+YRHI  PGW + W W    VIW 
Sbjct  18    DAYDPLDPNGNITIKWDVMSWTPDGYVAVVTMNNFQMYRHIMSPGWTVGWTWAKKEVIWS  77

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ATEQG+CS FK G  PHCC+K P ++DLLPG  +N+QF NCCKGGVL++  QDP+
Sbjct  78    MVGAQATEQGDCSKFK-GNIPHCCKKTPTVVDLLPGVPYNQQFSNCCKGGVLAAWGQDPQ  136

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTL--GVPGYTCGEAFEVPPTKFVEDHGR  782
               ++AFQ+S+G+  + + +           NFTL    PGYTCG A  VPPT F+    R
Sbjct  137   ASVSAFQVSVGQAGTSNKTVKLPK------NFTLLGPGPGYTCGPAKIVPPTNFLTPDRR  190

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKA  962
             R TQA+ TWN+TC+YSQF A+  P+CCVS S+FYN+TI SCP C CGCE +    KC+K+
Sbjct  191   RKTQALMTWNVTCTYSQFLARKHPSCCVSFSSFYNETITSCPSCACGCENK---NKCIKS  247

Query  963   GEQPPVVQLQHYEPPQA----IVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKN  1130
               +  ++ +     P+     ++QCT HMCP+RVHWHVK++Y  +WRVKI +TN+N+  N
Sbjct  248   DSK--LLSVVGVNTPRKDNTPLIQCTHHMCPVRVHWHVKVNYKDYWRVKIAVTNFNYRMN  305

Query  1131  FSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQT  1310
             ++QW LVV HPNL NVT+VFSF+Y+ L  YG INDTGMFYG+++YND+L++AG  GNVQ+
Sbjct  306   YTQWTLVVQHPNLNNVTQVFSFDYKPLVPYGSINDTGMFYGMKFYNDLLMEAGPFGNVQS  365

Query  1311  ELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             E+L+ KD  TFT ++GWAFPR++ FNGEEC+LP PD YP LPNSA
Sbjct  366   EVLLQKDQNTFTLKQGWAFPRKVYFNGEECMLPPPDAYPFLPNSA  410



>ref|XP_006417537.1| hypothetical protein EUTSA_v10007643mg [Eutrema salsugineum]
 gb|ESQ35890.1| hypothetical protein EUTSA_v10007643mg [Eutrema salsugineum]
Length=443

 Score =   461 bits (1187),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 231/399 (58%), Positives = 284/399 (71%), Gaps = 13/399 (3%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDM  431
             GYDPLDP G I IKWD+++    +  V V+I N Q YRH++ PGWKLSW W    VIW M
Sbjct  24    GYDPLDPFGKIIIKWDLLQSLPGHHTVQVTIENKQEYRHVEKPGWKLSWHWENKEVIWGM  83

Query  432   WGAEATEQGNCSAFK-SGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
              GAE TEQGNCSAF  S   PHCC + P I+DLLPG  +N Q  NCC+GGVL+SM+QD  
Sbjct  84    TGAETTEQGNCSAFAASDNLPHCCLRRPTIVDLLPGAPYNMQVSNCCRGGVLTSMSQDSI  143

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPGYTCGEAFEVPPTKFVEDHGRRT  788
              +++AF M+IG    + +    +       +F +GVPGYTC  A  V PTKF  + GR  
Sbjct  144   NHVSAFHMTIGSFPDEDTGEFIMPY-----DFDIGVPGYTCDNATSVTPTKFSTNKGRHK  198

Query  789   TQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAGE  968
             TQA+ TW   C YSQFR+  SP CCVSLS FYN+TIV CP+C+        S+ C+K GE
Sbjct  199   TQALATWEAVCVYSQFRSSQSPKCCVSLSAFYNQTIVPCPVCS----CGCSSSHCVKPGE  254

Query  969   QPPVVQLQHY--EPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQW  1142
              PP ++ +H   E    +VQCT+HMCPI +HWHVK++Y ++WRVKIT TNYN  KN+S W
Sbjct  255   TPPYLEQKHDPDEEVSPVVQCTKHMCPIHIHWHVKVNYREYWRVKITATNYNTMKNYSDW  314

Query  1143  NLVVLHPNLGNVTRVFSFNYRTLNQYGD-INDTGMFYGIQYYNDVLLQAGEGGNVQTELL  1319
             NLVVLHPNL +V +VFSFNY++L  Y D INDTG+F+G+++YNDVLLQAGE GNVQTELL
Sbjct  315   NLVVLHPNLKSVQQVFSFNYKSLTPYHDGINDTGIFWGVKFYNDVLLQAGEIGNVQTELL  374

Query  1320  MNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLP  1436
             + KD   FTFREGWAFPRRI FNG+ECV+P PDDYPRLP
Sbjct  375   LKKDMGNFTFREGWAFPRRILFNGDECVMPSPDDYPRLP  413



>ref|XP_011087367.1| PREDICTED: protein COBRA-like isoform X1 [Sesamum indicum]
Length=454

 Score =   462 bits (1188),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 224/401 (56%), Positives = 277/401 (69%), Gaps = 11/401 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             D YD LDPNG+IT+KWD++       V  V+I+N+Q YRHI+ PGWKL W W    VIW 
Sbjct  33    DAYDALDPNGNITVKWDVMSWTPDGYVAVVTIFNFQKYRHIESPGWKLGWTWAKKEVIWS  92

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G +ATEQG+CS FK G  PHCC+K P I+DLLPGT +N+Q  NCCKGGV+SS  QDP 
Sbjct  93    MLGGQATEQGDCSRFK-GNIPHCCKKNPTIVDLLPGTPYNQQIANCCKGGVISSWVQDPA  151

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTL--GVPGYTCGEAFEVPPTKFVEDHGR  782
                ++FQ+S+G+  + + +           NFTL    PGYTCG A  V P+KF     R
Sbjct  152   NAASSFQLSVGQAGTSNKTVRLPK------NFTLLGPGPGYTCGPAKIVKPSKFTTPDKR  205

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG--QPGSAKCL  956
             R TQA+ TWN+TCSYSQF AQ +PTCCVSLS FYN TIV CP C+CGC+   QPG+    
Sbjct  206   RVTQALMTWNVTCSYSQFLAQKTPTCCVSLSAFYNDTIVGCPTCSCGCKNITQPGTCVDP  265

Query  957   KAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFS  1136
              +     VV          +VQCT HMCP+R+HWHVKL+Y ++WRVKI ITN+N+  N++
Sbjct  266   DSPHIASVVSNSDKNNLAPLVQCTSHMCPVRIHWHVKLNYKEYWRVKIAITNFNYRMNYT  325

Query  1137  QWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTEL  1316
             QWNLV  HPN  N+T++FSFNY  L  YG INDT M +G+++YND+L+QAG  GNVQ+EL
Sbjct  326   QWNLVAQHPNFDNLTQIFSFNYEPLTPYGSINDTAMLWGVKFYNDLLMQAGPYGNVQSEL  385

Query  1317  LMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPN  1439
             L  KD  TFTF +GWAFPRRI FNGE CV+P PD YP LPN
Sbjct  386   LFKKDKTTFTFDKGWAFPRRIYFNGENCVMPPPDSYPYLPN  426



>ref|XP_006368071.1| PREDICTED: COBRA-like protein 4-like, partial [Solanum tuberosum]
Length=408

 Score =   460 bits (1183),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 222/404 (55%), Positives = 289/404 (72%), Gaps = 18/404 (4%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDM  431
              YDPLDPNG+ITIKWD++       V  V++ N+Q+YRHI  PGW L W W    VIW M
Sbjct  8     AYDPLDPNGNITIKWDVMSWTPDGYVAVVTMNNFQMYRHIMSPGWTLGWTWAKKEVIWTM  67

Query  432   WGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEK  611
              GA+ATEQG+CS FK G  PHCC+K P ++D+LPG  +N+QF NCCKGGVL+S  QDP+ 
Sbjct  68    IGAQATEQGDCSKFK-GNIPHCCKKTPTVVDMLPGVPYNQQFTNCCKGGVLASWGQDPQS  126

Query  612   YLAAFQMsigrvssksssgaavaappipgNFTL--GVPGYTCGEAFEVPPTKFVEDHGRR  785
              ++AFQ+S+G+  + + +           NFTL    PGYTC  A  VPPTKF     RR
Sbjct  127   SVSAFQVSVGQAGTTNKTVKLPK------NFTLLGPGPGYTCSPAKIVPPTKFFTADLRR  180

Query  786   TTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAG  965
              TQA+ TWN+TC+YSQF AQ  P CCVSLSTFYN+TI SCP C CGCE +    KC+K+ 
Sbjct  181   KTQALMTWNVTCTYSQFVAQKHPKCCVSLSTFYNETITSCPSCACGCENK---HKCIKSD  237

Query  966   EQPPVVQLQHYEPPQA----IVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
              +  ++ +     P+     ++QCTQHMCP+R+HWHVKL+Y ++WRVKIT+TN+N+  N+
Sbjct  238   SK--LLSMVGVNTPRKDNAPLLQCTQHMCPVRIHWHVKLNYKEYWRVKITLTNFNYRVNY  295

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             +QW LV  HPNL NVT+VFSF+Y+ L  Y  INDTGMFYG+++YND+L++AG  GNVQ+E
Sbjct  296   TQWTLVAQHPNLNNVTQVFSFDYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPAGNVQSE  355

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             +L+ KD  TFT ++GWAFPR++ FNG+EC+LP PD YP LPN A
Sbjct  356   VLLQKDKDTFTLKQGWAFPRKVYFNGDECMLPPPDTYPYLPNFA  399



>ref|XP_007138374.1| hypothetical protein PHAVU_009G203100g [Phaseolus vulgaris]
 gb|ESW10368.1| hypothetical protein PHAVU_009G203100g [Phaseolus vulgaris]
Length=452

 Score =   461 bits (1187),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 221/403 (55%), Positives = 284/403 (70%), Gaps = 11/403 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YDPLDP G+ITIKWD+I       V  V++YN+Q YRHI  PGW L W W    VIW 
Sbjct  35    EAYDPLDPTGNITIKWDVISWTADGYVAVVTMYNFQQYRHIQAPGWSLGWTWAKKEVIWS  94

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G++ TEQG+CS FK+G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGVL+S  QDP 
Sbjct  95    MMGSQTTEQGDCSKFKAG-IPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVLNSWGQDPG  153

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +++FQ+S+G   + + +           NFTL  PG  YTCG A  V PT F+ +  R
Sbjct  154   SAVSSFQISVGSSGTTNKTVKMPK------NFTLKAPGPGYTCGPAKIVKPTTFITNDKR  207

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQ--PGSAKCL  956
             RTTQA+ TWNITC+YSQF AQ +P+CCVSLS+FYN T+V+CP CTCGC+ +  PGS    
Sbjct  208   RTTQAMMTWNITCTYSQFLAQKTPSCCVSLSSFYNDTVVNCPTCTCGCQNKTDPGSCVAP  267

Query  957   KAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFS  1136
              +     VV          +VQCT HMCPIRVHWHVK++Y ++WRVKITITN+N+  N+S
Sbjct  268   NSPHLASVVSSSGKGASTPLVQCTSHMCPIRVHWHVKVNYKEYWRVKITITNFNYRMNYS  327

Query  1137  QWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTEL  1316
             QWNLVV HPNL N+T++FSF Y++L  Y  +NDT M +GI++YND L  A   GNVQ+E+
Sbjct  328   QWNLVVQHPNLDNITQLFSFQYKSLTPYEGLNDTSMLWGIKFYNDFLSSAETLGNVQSEI  387

Query  1317  LMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             L+ KD +TFTF +GWAFPRRI FNG+ CV+P PD YP LPN++
Sbjct  388   LLRKDKSTFTFDKGWAFPRRIYFNGDNCVMPPPDAYPWLPNAS  430



>ref|XP_003559251.1| PREDICTED: COBRA-like protein 3 [Brachypodium distachyon]
Length=456

 Score =   461 bits (1187),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 223/410 (54%), Positives = 288/410 (70%), Gaps = 21/410 (5%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDPNG+ITIKWDI+E      V  V+++NYQ +RHI  PGW+L W W    VIW 
Sbjct  34    EAYDSLDPNGNITIKWDIMEWTADGYVAVVTMFNYQQFRHISAPGWQLGWTWAKKEVIWS  93

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ TEQG+CS FKS   PHCC+++P I+DLLPGT +N+Q  NCCK GV+++  QDP 
Sbjct  94    MVGAQTTEQGDCSKFKSSP-PHCCKRDPTIVDLLPGTPYNQQIANCCKAGVINTFNQDPS  152

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                ++FQ+S+G   + + +           NFTL  PG  YTCG A    PTKF    GR
Sbjct  153   NAASSFQVSVGLAGTTNKTVKVPK------NFTLKAPGPGYTCGRALVGRPTKFFTSDGR  206

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG---QPGSAKC  953
             R TQA+ TWN++C+YSQF AQ +P+CCVSLS+FYN TIV+CP C+CGC+    +PGS   
Sbjct  207   RATQALMTWNVSCTYSQFLAQKTPSCCVSLSSFYNDTIVNCPTCSCGCQNNNTRPGSC--  264

Query  954   LKAGEQPPVVQLQHYEPP----QAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNF  1121
                 E  P +Q     P     Q +VQCT HMCPIR+HWHVKL+Y  +WRVK+TITN+N+
Sbjct  265   --VNENSPYLQSAIDGPGKYTGQPLVQCTSHMCPIRIHWHVKLNYKDYWRVKVTITNFNY  322

Query  1122  AKNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQY-GDINDTGMFYGIQYYNDVLLQAGEGG  1298
               N++QWNLVV HPN  N+T++FSFNY+ L  Y G INDT MF+G+++YND+L+QAG  G
Sbjct  323   RMNYTQWNLVVQHPNFDNITKLFSFNYKPLTPYGGGINDTAMFWGMKFYNDLLMQAGPLG  382

Query  1299  NVQTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             N Q+E+LM KD ATFTF +GWAFPRR+ FNG+ CV+P PD YP LPN++P
Sbjct  383   NAQSEILMKKDSATFTFDKGWAFPRRVYFNGDNCVMPSPDAYPWLPNASP  432



>ref|XP_006363258.1| PREDICTED: COBRA-like protein 4-like [Solanum tuberosum]
Length=434

 Score =   461 bits (1185),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 222/404 (55%), Positives = 289/404 (72%), Gaps = 18/404 (4%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDM  431
              YDPLDPNG+ITIKWD++       V  V++ N+Q+YRHI  PGW L W W    VIW M
Sbjct  21    AYDPLDPNGNITIKWDVMSWTPDGYVAVVTMNNFQMYRHIMSPGWTLGWTWAKKEVIWTM  80

Query  432   WGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEK  611
              GA+ATEQG+CS FK G  PHCC+K P ++D+LPG  +N+QF NCCKGGVL+S  QDP+ 
Sbjct  81    IGAQATEQGDCSKFK-GNIPHCCKKTPTVVDMLPGVPYNQQFTNCCKGGVLASWGQDPQS  139

Query  612   YLAAFQMsigrvssksssgaavaappipgNFTL--GVPGYTCGEAFEVPPTKFVEDHGRR  785
              ++AFQ+S+G+  + + +           NFTL    PGYTC  A  VPPTKF     RR
Sbjct  140   SVSAFQVSVGQAGTTNKTVKLPK------NFTLLGPGPGYTCSPAKIVPPTKFFTADLRR  193

Query  786   TTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAG  965
              TQA+ TWN+TC+YSQF AQ  P CCVSLSTFYN+TI SCP C CGCE +    KC+K+ 
Sbjct  194   KTQALMTWNVTCTYSQFVAQKHPKCCVSLSTFYNETITSCPSCACGCENK---HKCIKSD  250

Query  966   EQPPVVQLQHYEPPQA----IVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
              +  ++ +     P+     ++QCTQHMCP+R+HWHVKL+Y ++WRVKIT+TN+N+  N+
Sbjct  251   SK--LLSMVGVNTPRKDNAPLLQCTQHMCPVRIHWHVKLNYKEYWRVKITLTNFNYRVNY  308

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             +QW LV  HPNL NVT+VFSF+Y+ L  Y  INDTGMFYG+++YND+L++AG  GNVQ+E
Sbjct  309   TQWTLVAQHPNLNNVTQVFSFDYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPAGNVQSE  368

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             +L+ KD  TFT ++GWAFPR++ FNG+EC+LP PD YP LPN A
Sbjct  369   VLLQKDKDTFTLKQGWAFPRKVYFNGDECMLPPPDTYPYLPNFA  412



>ref|XP_004138217.1| PREDICTED: protein COBRA-like [Cucumis sativus]
 ref|XP_004171717.1| PREDICTED: protein COBRA-like [Cucumis sativus]
Length=455

 Score =   461 bits (1187),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 224/417 (54%), Positives = 285/417 (68%), Gaps = 37/417 (9%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDPNG+ITIKWD++       V  V++YN+Q YRHI  PGW L W W    VIW 
Sbjct  35    EAYDALDPNGNITIKWDVMSWTPDGYVAVVTMYNFQQYRHIQAPGWTLGWTWAKKEVIWS  94

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G++ TEQG+CS FK G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGV++S  QDP 
Sbjct  95    MMGSQTTEQGDCSRFK-GNTPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVINSWAQDPA  153

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                ++FQ+S+G   + + +           NFTL  PG  YTCG A  V PTKFV    R
Sbjct  154   NAASSFQVSVGSAGTSNKTVKLPK------NFTLKAPGPGYTCGPAKIVRPTKFVSGDKR  207

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQ-PGSAKCL-  956
             R TQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN TIV+CP CTCGC+    GS  C+ 
Sbjct  208   RVTQALMTWNVTCTYSQFLAQKTPTCCVSLSSFYNDTIVNCPTCTCGCQNNTAGSGSCVD  267

Query  957   --------------KAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRV  1094
                           K+G  PP            +VQCT HMCPIRVHWHVKL+Y  +WRV
Sbjct  268   PDSPFLASVVSAPDKSGNNPP------------LVQCTSHMCPIRVHWHVKLNYKDYWRV  315

Query  1095  KITITNYNFAKNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDV  1274
             KITITN+N+  N++ WNLVV HPN  N+T++FSFNY++L+ YGD+NDT M +G+++YND+
Sbjct  316   KITITNFNYRMNYTLWNLVVQHPNFDNITKLFSFNYKSLSPYGDLNDTAMLWGVKFYNDL  375

Query  1275  LLQAGEGGNVQTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             L QAG  GNVQ+ELL  KD  TFTF +GWAFPRR+ FNG+ CV+P P+ YP LPN++
Sbjct  376   LNQAGPLGNVQSELLFQKDQNTFTFDKGWAFPRRVYFNGDNCVMPPPEAYPYLPNAS  432



>ref|XP_010502992.1| PREDICTED: COBRA-like protein 2 isoform X4 [Camelina sativa]
Length=439

 Score =   461 bits (1185),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 225/404 (56%), Positives = 284/404 (70%), Gaps = 14/404 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDP G+ITIKWDI+       V  V+I+N+Q YRHI  PGW+L W WR   VIW 
Sbjct  25    EAYDALDPTGNITIKWDIMSWTPDGYVAVVTIFNFQQYRHIQAPGWQLGWSWRKKEVIWS  84

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ATEQG+C  FK G  PHCC+K P I+DLLPGT + +Q  NCC+GGV+SS  QDP 
Sbjct  85    MVGAQATEQGDCFKFK-GNIPHCCKKTPTIVDLLPGTPYTQQISNCCRGGVISSWAQDPA  143

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +++FQ+S+G+  + +++  A        N TL  PG  YTCG A  V P+KF+    R
Sbjct  144   TAISSFQISVGQSGTTNTTVRAPR------NVTLKGPGPGYTCGPAQIVKPSKFISADKR  197

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCE--GQPGSAKCL  956
             R TQA+ TWNITC+YSQF A+ +PTCCVSLS+FYN+TIV CP C+CGC+   QPGS    
Sbjct  198   RKTQALFTWNITCTYSQFLARKTPTCCVSLSSFYNETIVPCPTCSCGCQNSSQPGSCVDP  257

Query  957   KAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFS  1136
             K     P       EP   ++QCT+HMCPIRVHWHVK +Y ++WRVK+ ITN+N+  N+S
Sbjct  258   KIASVVPASGKNSLEP---LLQCTKHMCPIRVHWHVKTNYKEYWRVKVAITNFNYNMNYS  314

Query  1137  QWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTEL  1316
             QWNLVV HPN  N+T++FSFNY+ L  Y DINDT M +GI++YND+L QAG  GNVQ+EL
Sbjct  315   QWNLVVQHPNFDNITQLFSFNYKPLTPYADINDTAMLWGIKFYNDLLSQAGPVGNVQSEL  374

Query  1317  LMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             L  KDP+ FTF +GW FPRRI FNG+ CV+P PD YP LPN+ P
Sbjct  375   LFRKDPSKFTFEKGWGFPRRIYFNGDNCVMPSPDSYPWLPNATP  418



>ref|XP_006365658.1| PREDICTED: protein COBRA-like [Solanum tuberosum]
Length=444

 Score =   461 bits (1185),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 221/407 (54%), Positives = 288/407 (71%), Gaps = 18/407 (4%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             D +D LDPNG+ITIKWD+I  +    V  V+++N+Q YRHI  PGW L W W    VIW 
Sbjct  23    DAFDALDPNGNITIKWDVISWSPDGYVAVVTMFNFQQYRHIQAPGWTLGWTWAKKEVIWG  82

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ TEQG+CS FK G  PHCC+++P +IDLLPGT +N+Q  NCCKGGV++S  QDPE
Sbjct  83    MVGAQTTEQGDCSKFK-GNIPHCCKRDPTVIDLLPGTPYNQQIANCCKGGVINSWGQDPE  141

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +++FQ+S+G   + + +           NFTL  PG  YTCG A  V PTKF  + GR
Sbjct  142   TAVSSFQVSVGSAGTTNKTVRVPK------NFTLKAPGPGYTCGPAKVVKPTKFFTNDGR  195

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKA  962
             R TQA+ TWNITC+YSQF AQ +PTCCVSLS+FYN TIV CP CTCGC+           
Sbjct  196   RVTQAMMTWNITCTYSQFLAQKTPTCCVSLSSFYNDTIVPCPTCTCGCQKNGTQHGNCVD  255

Query  963   GEQPPVVQL------QHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFA  1124
              ++P +  +       +Y P   +VQCT HMCPIR+HWHVKL+Y ++WRVK+TITN+N+ 
Sbjct  256   QDEPHLASVVSGLGKNNYAP---LVQCTSHMCPIRIHWHVKLNYKEYWRVKVTITNFNYN  312

Query  1125  KNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNV  1304
              N++QWNLVV HPN  N+T++FSF+Y++L  YG INDT M +G+++YND+L+QAG  GNV
Sbjct  313   MNYTQWNLVVQHPNFDNLTQLFSFHYKSLTPYGAINDTAMLWGMKFYNDLLMQAGPLGNV  372

Query  1305  QTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             Q+ELL  KD +TFTF +GWAFP R+ FNG+ CV+PQPD YP +PN+ 
Sbjct  373   QSELLFRKDMSTFTFEKGWAFPHRVYFNGDNCVMPQPDSYPYMPNTG  419



>ref|XP_007139435.1| hypothetical protein PHAVU_008G029100g [Phaseolus vulgaris]
 gb|AAR13304.1| phytochelatin synthetase-like protein [Phaseolus vulgaris]
 gb|ESW11429.1| hypothetical protein PHAVU_008G029100g [Phaseolus vulgaris]
Length=448

 Score =   461 bits (1186),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 221/404 (55%), Positives = 281/404 (70%), Gaps = 12/404 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             D YDPLDPNG+ITIKWDII       V  V++ N+Q YRHI  PGW+L W W    VIW 
Sbjct  28    DAYDPLDPNGNITIKWDIITWTPDGYVAVVTMNNFQQYRHIASPGWRLGWTWAKKEVIWS  87

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G + TEQG+CS FK+G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGVL S  QDP 
Sbjct  88    MMGGQTTEQGDCSKFKAG-IPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVLGSWVQDPT  146

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +++FQ+S+GR  + + +           NFTL  PG  YTCG A  V PT+F++   R
Sbjct  147   NAVSSFQVSVGRAGTTNKTVKVPK------NFTLSAPGPGYTCGPAKIVKPTQFIQADKR  200

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKA  962
             R TQA+ TWN+TC YSQF AQ +P+CCVSLS+FYN TIV CP C CGC+G    +     
Sbjct  201   RVTQALMTWNVTCQYSQFLAQKTPSCCVSLSSFYNDTIVPCPTCACGCQGNSSLSGSCVN  260

Query  963   GEQP---PVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
              + P    VV          +VQCT HMCP+R+HWHVK++Y ++WRVK+TITN+N+  N+
Sbjct  261   SQTPHLASVVSGSGKNNLSPLVQCTSHMCPVRIHWHVKVNYKEYWRVKVTITNFNYRMNY  320

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             S+WN+VV HPN  N+T++FSFNY++L  YG INDT M +G+++YND L QAG  GNVQ+E
Sbjct  321   SEWNMVVQHPNFDNLTQLFSFNYKSLTPYGSINDTAMLWGVKFYNDFLSQAGPNGNVQSE  380

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             LL  KD ATFTF +GWAFPRRI FNG+ CV+P PD YP LPN+ 
Sbjct  381   LLFRKDKATFTFDKGWAFPRRIYFNGDNCVMPPPDAYPWLPNAG  424



>ref|XP_006291010.1| hypothetical protein CARUB_v10017122mg [Capsella rubella]
 gb|EOA23908.1| hypothetical protein CARUB_v10017122mg [Capsella rubella]
Length=482

 Score =   462 bits (1189),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 223/404 (55%), Positives = 285/404 (71%), Gaps = 14/404 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDPNG+ITIKWDI+       V  V+I+N+Q YRHI+ PGW+L W WR   VIW 
Sbjct  68    EAYDALDPNGNITIKWDIMSWTPDGYVAVVTIFNFQQYRHIEAPGWQLGWSWRKKEVIWS  127

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ATEQG+CS FK G  PHCC+K P I+DLLPGT + +Q  NCC+GGV+SS  QDP 
Sbjct  128   MVGAQATEQGDCSKFK-GNIPHCCKKTPAIVDLLPGTPYTQQISNCCRGGVISSWAQDPA  186

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +++FQ+S+G+  + +++  A        N TL  PG  YTCG A  V P+KF+    R
Sbjct  187   TAVSSFQISVGQSGTTNTTVRAPR------NITLKGPGPGYTCGPAQLVRPSKFISADKR  240

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCL--  956
             R TQA+ TWNITC+YSQF A+ +PTCCVSL++FYN+TIV CP C+CGC+       CL  
Sbjct  241   RKTQALLTWNITCTYSQFLARKTPTCCVSLTSFYNETIVPCPTCSCGCQNSSQPDSCLDP  300

Query  957   KAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFS  1136
             K     P  +    EP   ++QCT+HMCPIRVHWHVK +Y ++WRVK+ ITN+N+  N+S
Sbjct  301   KIASVVPASRKNSLEP---LLQCTKHMCPIRVHWHVKTNYKEYWRVKVAITNFNYNMNYS  357

Query  1137  QWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTEL  1316
             QWNLVV HPN  N+T++FSFNY+ LN Y  INDT M +GI++YND+L QAG  GNVQ+EL
Sbjct  358   QWNLVVQHPNFDNLTQLFSFNYKALNPYARINDTAMLWGIKFYNDLLSQAGPVGNVQSEL  417

Query  1317  LMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             L  K+P  FTF +GW FPRRI FNG+ CV+P PD YP LPN+ P
Sbjct  418   LFQKNPLEFTFEKGWVFPRRIYFNGDNCVMPSPDSYPWLPNATP  461



>ref|XP_010502989.1| PREDICTED: COBRA-like protein 2 isoform X2 [Camelina sativa]
Length=451

 Score =   461 bits (1186),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 225/404 (56%), Positives = 284/404 (70%), Gaps = 14/404 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDP G+ITIKWDI+       V  V+I+N+Q YRHI  PGW+L W WR   VIW 
Sbjct  37    EAYDALDPTGNITIKWDIMSWTPDGYVAVVTIFNFQQYRHIQAPGWQLGWSWRKKEVIWS  96

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ATEQG+C  FK G  PHCC+K P I+DLLPGT + +Q  NCC+GGV+SS  QDP 
Sbjct  97    MVGAQATEQGDCFKFK-GNIPHCCKKTPTIVDLLPGTPYTQQISNCCRGGVISSWAQDPA  155

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +++FQ+S+G+  + +++  A        N TL  PG  YTCG A  V P+KF+    R
Sbjct  156   TAISSFQISVGQSGTTNTTVRAPR------NVTLKGPGPGYTCGPAQIVKPSKFISADKR  209

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCE--GQPGSAKCL  956
             R TQA+ TWNITC+YSQF A+ +PTCCVSLS+FYN+TIV CP C+CGC+   QPGS    
Sbjct  210   RKTQALFTWNITCTYSQFLARKTPTCCVSLSSFYNETIVPCPTCSCGCQNSSQPGSCVDP  269

Query  957   KAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFS  1136
             K     P       EP   ++QCT+HMCPIRVHWHVK +Y ++WRVK+ ITN+N+  N+S
Sbjct  270   KIASVVPASGKNSLEP---LLQCTKHMCPIRVHWHVKTNYKEYWRVKVAITNFNYNMNYS  326

Query  1137  QWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTEL  1316
             QWNLVV HPN  N+T++FSFNY+ L  Y DINDT M +GI++YND+L QAG  GNVQ+EL
Sbjct  327   QWNLVVQHPNFDNITQLFSFNYKPLTPYADINDTAMLWGIKFYNDLLSQAGPVGNVQSEL  386

Query  1317  LMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             L  KDP+ FTF +GW FPRRI FNG+ CV+P PD YP LPN+ P
Sbjct  387   LFRKDPSKFTFEKGWGFPRRIYFNGDNCVMPSPDSYPWLPNATP  430



>ref|XP_010694055.1| PREDICTED: protein COBRA-like [Beta vulgaris subsp. vulgaris]
Length=453

 Score =   461 bits (1186),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 229/409 (56%), Positives = 285/409 (70%), Gaps = 19/409 (5%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDM  431
              YDPLDPNG+ITIKWDII       V  VSI+N+Q YRHI  PGW+L W W    VIW M
Sbjct  30    AYDPLDPNGNITIKWDIINWTPDGYVAVVSIFNFQKYRHIQAPGWQLGWTWAKKEVIWSM  89

Query  432   WGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEK  611
              G +ATEQG+CS FK G  PHCC+K+P ++DL+PGT +N+Q  NCC+GGVLSS  QDP  
Sbjct  90    VGGQATEQGDCSKFK-GTIPHCCKKDPTVVDLMPGTPYNQQIANCCRGGVLSSWVQDPPT  148

Query  612   YLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGRR  785
              ++AFQ+S+GR  + + +           NFTL  PG  YTCG    V P+++    GRR
Sbjct  149   AISAFQISVGRSGTTNKTVKVPK------NFTLSAPGPGYTCGPGKIVRPSQYRTQDGRR  202

Query  786   TTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCE---GQPGSAKCL  956
             TTQA+ TWN+TC YSQF +Q +PTCCVSLS+FYN TI+SCP C+CGC+     PGS    
Sbjct  203   TTQALMTWNVTCMYSQFLSQKTPTCCVSLSSFYNDTIISCPTCSCGCQNNASNPGSCVEP  262

Query  957   KAGEQPPVVQLQH-----YEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNF  1121
              +     VV   H     Y PP  +V+CT HMCPIR+HWHVK SY  +WRVK+TITN+N+
Sbjct  263   DSPYLASVVSPAHSSKTSYLPP--LVRCTSHMCPIRIHWHVKTSYKDYWRVKVTITNFNY  320

Query  1122  AKNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGN  1301
               N+S WNLVV HPN  N+T +FSFNY  L  Y +INDT M +GI++YND+L+QAG  GN
Sbjct  321   RMNYSGWNLVVQHPNFDNLTELFSFNYEPLTPYSNINDTAMLWGIKFYNDLLMQAGPLGN  380

Query  1302  VQTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             VQ+ELL  KD +TFTF +GWAFPRRI FNG+ CV+P PD YP LPN++P
Sbjct  381   VQSELLFRKDSSTFTFEKGWAFPRRIYFNGDNCVMPPPDTYPWLPNASP  429



>ref|XP_008777346.1| PREDICTED: COBRA-like protein 3 [Phoenix dactylifera]
Length=460

 Score =   461 bits (1186),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 225/409 (55%), Positives = 287/409 (70%), Gaps = 20/409 (5%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDPNG+ITIKWDI++      V  V IYNYQ YRHI  PGW L W W    VIW 
Sbjct  39    EAYDSLDPNGNITIKWDIMQWTTDGYVALVMIYNYQQYRHIQAPGWTLGWAWEKKEVIWS  98

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ATEQG+CS FK    PHCC+K+P+++DLLPGT +N Q  NCCKGGV+SS+ QDP 
Sbjct  99    MVGAQATEQGDCSRFKE-NIPHCCKKDPIVVDLLPGTPYNLQIANCCKGGVMSSLVQDPG  157

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                ++FQ+S+G   +   +  A        NFT   PG  YTCG+   V P+KFV   GR
Sbjct  158   NAASSFQLSVGSTGTSIKTVQAPK------NFTFRAPGPGYTCGKTEAVEPSKFVSKDGR  211

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG---QPGSAKC  953
             R TQA+ TW  TC+YSQF +Q +PTCCVSLS+FYN TIV+CP CTCGC     QPGS  C
Sbjct  212   RKTQALMTWKATCTYSQFLSQKTPTCCVSLSSFYNDTIVNCPACTCGCPNNLTQPGS--C  269

Query  954   LKAGEQPPVVQLQHYEPPQA----IVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNF  1121
             +++    P +    + P ++    +VQCT HMCPIRVHWHVKL+Y  +WR K+T+TN+N+
Sbjct  270   VESNS--PHLASAIHGPGKSSFTPLVQCTSHMCPIRVHWHVKLNYRDYWRAKVTVTNFNY  327

Query  1122  AKNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGN  1301
               N++QWNLV+ HPN  N+T++FSFNY+ L  YG INDT M +GI++YN++L+ AG  GN
Sbjct  328   RMNYTQWNLVMQHPNFNNLTQIFSFNYKALTPYGTINDTAMMWGIKFYNELLVVAGPMGN  387

Query  1302  VQTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             VQ+ELL  KDP TFTF +GWAFPRR+ FNG+ CV+P PD YP LPN++P
Sbjct  388   VQSELLFRKDPLTFTFGKGWAFPRRVYFNGDNCVMPPPDAYPWLPNASP  436



>ref|XP_003522986.1| PREDICTED: protein COBRA-like [Glycine max]
 gb|KHN03078.1| Protein COBRA [Glycine soja]
Length=456

 Score =   461 bits (1185),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 222/403 (55%), Positives = 283/403 (70%), Gaps = 11/403 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YDPLDP G+ITIKWD+I       V  V++YN+Q YRHI  PGW L W W    VIW 
Sbjct  36    EAYDPLDPTGNITIKWDVISWTPDGYVAVVTMYNFQQYRHIQAPGWSLGWTWAKKEVIWS  95

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ TEQG+CS FK+G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGVL+S  QD  
Sbjct  96    MMGAQTTEQGDCSKFKAG-IPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVLNSWGQDAS  154

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +++FQ+S+G   + + +           NFTL  PG  YTCG A    PT F+ +  R
Sbjct  155   TAVSSFQVSVGSAGTTNRTVKMPK------NFTLKAPGPGYTCGPAKVGKPTVFITNDKR  208

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG--QPGSAKCL  956
             RTTQA+ TWNITC+YSQF AQ +P+CCVSLS+FYN T+V+CP CTCGC    +PGS    
Sbjct  209   RTTQAMMTWNITCTYSQFLAQKTPSCCVSLSSFYNDTVVNCPTCTCGCRNKTEPGSCVDP  268

Query  957   KAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFS  1136
              +     VV          +VQCT HMCPIRVHWHVKL+Y ++WRVKITITN+N+  N+S
Sbjct  269   NSPHLDSVVSSSGKAANTPLVQCTSHMCPIRVHWHVKLNYKEYWRVKITITNFNYRMNYS  328

Query  1137  QWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTEL  1316
             QWNLVV HPNL N+T++FSFNY++L  Y  +NDT M +G+++YND L  AG  GNVQ+E+
Sbjct  329   QWNLVVQHPNLDNITQLFSFNYKSLTPYEGLNDTSMLWGVKFYNDFLSSAGSLGNVQSEI  388

Query  1317  LMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             L+ KD +TFTF +GWAFPRRI FNG+ CV+P PD YP LPN++
Sbjct  389   LLRKDKSTFTFDKGWAFPRRIYFNGDNCVMPPPDAYPWLPNAS  431



>ref|XP_006650604.1| PREDICTED: COBRA-like protein 3-like [Oryza brachyantha]
Length=453

 Score =   460 bits (1184),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 223/410 (54%), Positives = 286/410 (70%), Gaps = 21/410 (5%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + +D LDPNG+ITIKWD+++      V  V+++NYQ +RHI  PGW+L W W    VIW 
Sbjct  31    EAFDSLDPNGNITIKWDVMQWTPDGYVAVVTMFNYQQFRHIQAPGWQLGWSWAKKEVIWS  90

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ TEQG+CS FK G  PHCC+K+P I+DLLPGT +N Q  NCCK GV+++  QDP 
Sbjct  91    MVGAQTTEQGDCSKFK-GNTPHCCKKDPTIVDLLPGTPYNMQIANCCKAGVINTFNQDPS  149

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                ++FQ+S+G   + + +           NFTL  PG  YTCG A  V PTKF    GR
Sbjct  150   NAASSFQISVGLAGTTNKTVKLPK------NFTLKAPGPGYTCGRAMIVRPTKFFTQDGR  203

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG---QPGSAKC  953
             R TQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN TIV+CP C+CGC+     PGS   
Sbjct  204   RATQALMTWNVTCTYSQFLAQKTPTCCVSLSSFYNDTIVNCPTCSCGCQNNRTSPGSC--  261

Query  954   LKAGEQPPVVQLQHYEPP----QAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNF  1121
                 E  P +Q     P     Q +VQCT HMCPIR+HWHVKL+Y ++WRVKITITN+N+
Sbjct  262   --VNENSPYLQSAIDGPGKWTGQPLVQCTSHMCPIRIHWHVKLNYKEYWRVKITITNFNY  319

Query  1122  AKNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGD-INDTGMFYGIQYYNDVLLQAGEGG  1298
               N++QWNLVV HPN  N+T++FSFNY+ L  YG  INDT MF+G+++YND+L+QAG  G
Sbjct  320   RMNYTQWNLVVQHPNFDNITQLFSFNYKPLTPYGSRINDTAMFWGVKFYNDLLMQAGPLG  379

Query  1299  NVQTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             N Q+ELL+ KD   FTF +GWAFPRR+ FNG+ CV+P PD YP LPN++P
Sbjct  380   NAQSELLLRKDSVAFTFDKGWAFPRRVYFNGDNCVMPPPDAYPWLPNASP  429



>ref|XP_010032552.1| PREDICTED: protein COBRA-like [Eucalyptus grandis]
 gb|KCW51945.1| hypothetical protein EUGRSUZ_J01392 [Eucalyptus grandis]
Length=480

 Score =   461 bits (1187),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 225/404 (56%), Positives = 280/404 (69%), Gaps = 14/404 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YDPLDPNG+ITI+WD++       V  V+I+N+Q YRHI  PGW L W W    VIW 
Sbjct  62    ESYDPLDPNGNITIRWDVMSWTPDGYVAVVTIFNFQQYRHIQAPGWSLGWTWAKKEVIWT  121

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G +ATEQG+CS +K G  PHCC+K P ++DLLPGT +N+Q  NCCKGGV+SS  QDP 
Sbjct  122   MLGGQATEQGDCSRYK-GNVPHCCKKNPTVVDLLPGTPYNQQIANCCKGGVISSWLQDPA  180

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                +AFQ+S+G   + + +           NFTL  PG  YTCG A  V PTKF     R
Sbjct  181   NAASAFQLSVGASGTTNKTVRLPK------NFTLKAPGPGYTCGPAKIVKPTKFPTADKR  234

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG---QPGSAKC  953
             R TQA  TWN+TC+YSQF AQ +PTCCVSLS+FYN T+VSCP C CGC+    QPGS  C
Sbjct  235   RFTQAQMTWNVTCAYSQFLAQKTPTCCVSLSSFYNDTVVSCPTCACGCQNNATQPGS--C  292

Query  954   LKAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
             ++         + +      +VQCT HMCPIRVHWHVKL+Y ++WRVKITITN+N+  N+
Sbjct  293   VEPNSPYLASVVSNAGTNSPLVQCTSHMCPIRVHWHVKLNYKEYWRVKITITNFNYNMNY  352

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             SQWNLVV HPN  N+T+ FSFNY+ L  Y  INDT M YGI++YND+L++ G  GNVQ+E
Sbjct  353   SQWNLVVQHPNFDNLTQSFSFNYKPLTPYAAINDTAMLYGIKFYNDLLMEDGPSGNVQSE  412

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             LL  KD +TFTF +GWAFPRRI FNG+ CV+P PD YP LPN++
Sbjct  413   LLFRKDASTFTFDKGWAFPRRIYFNGDNCVMPPPDAYPSLPNAS  456



>ref|XP_010502991.1| PREDICTED: COBRA-like protein 2 isoform X3 [Camelina sativa]
Length=439

 Score =   460 bits (1183),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 225/404 (56%), Positives = 284/404 (70%), Gaps = 14/404 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDP G+ITIKWDI+       V  V+I+N+Q YRHI  PGW+L W WR   VIW 
Sbjct  25    EAYDALDPTGNITIKWDIMSWTPDGYVAVVTIFNFQQYRHIQAPGWQLGWSWRKKEVIWS  84

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ATEQG+C  FK G  PHCC+K P I+DLLPGT + +Q  NCC+GGV+SS  QDP 
Sbjct  85    MVGAQATEQGDCFKFK-GNIPHCCKKTPTIVDLLPGTPYTQQISNCCRGGVISSWAQDPA  143

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +++FQ+S+G+  + +++  A        N TL  PG  YTCG A  V P+KF+    R
Sbjct  144   TAISSFQISVGQSGTTNTTVRAPR------NVTLKGPGPGYTCGPAQIVKPSKFISADKR  197

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCE--GQPGSAKCL  956
             R TQA+ TWNITC+YSQF A+ +PTCCVSLS+FYN+TIV CP C+CGC+   QPGS    
Sbjct  198   RKTQALFTWNITCTYSQFLARKTPTCCVSLSSFYNETIVPCPTCSCGCQNSSQPGSCVDP  257

Query  957   KAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFS  1136
             K     P       EP   ++QCT+HMCPIRVHWHVK +Y ++WRVK+ ITN+N+  N+S
Sbjct  258   KIALVVPASGKNSLEP---LLQCTKHMCPIRVHWHVKTNYKEYWRVKVAITNFNYNMNYS  314

Query  1137  QWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTEL  1316
             QWNLVV HPN  N+T++FSFNY+ L  Y DINDT M +GI++YND+L QAG  GNVQ+EL
Sbjct  315   QWNLVVQHPNFDNITQLFSFNYKPLTPYADINDTAMLWGIKFYNDLLSQAGPVGNVQSEL  374

Query  1317  LMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             L  KDP+ FTF +GW FPRRI FNG+ CV+P PD YP LPN+ P
Sbjct  375   LFRKDPSKFTFEKGWGFPRRIYFNGDNCVMPSPDSYPWLPNATP  418



>ref|XP_010425766.1| PREDICTED: COBRA-like protein 2 [Camelina sativa]
Length=439

 Score =   460 bits (1183),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 225/404 (56%), Positives = 284/404 (70%), Gaps = 14/404 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDP G+ITIKWDI+       V  V+I+N+Q YRHI  PGW+L W W    VIW 
Sbjct  25    EAYDALDPTGNITIKWDIMSWTPDGYVAVVTIFNFQQYRHIQAPGWQLGWSWMKKEVIWS  84

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ATEQG+CS FK G  PHCC+K P I+DLLPGT + +Q  NCC+GGV+SS  QDP 
Sbjct  85    MVGAQATEQGDCSKFK-GNIPHCCKKTPTIVDLLPGTPYTQQISNCCRGGVISSWAQDPA  143

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +++FQ+S+G+  + +++  A        N TL  PG  YTCG A  V P+KF+    R
Sbjct  144   TAISSFQISVGQSGTTNTTVRAPR------NVTLKGPGPGYTCGPAQIVKPSKFISADKR  197

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCE--GQPGSAKCL  956
             R TQA+ TWNITC+YSQF A+ +PTCCVSLS+FYN+TIV CP C+CGC+   QPGS    
Sbjct  198   RKTQALFTWNITCTYSQFLARKTPTCCVSLSSFYNETIVPCPTCSCGCQNSSQPGSCVDP  257

Query  957   KAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFS  1136
             K     P       EP   ++QCT+HMCPIRVHWHVK +Y ++WRVK+ ITN+N+  N+S
Sbjct  258   KIALVVPASGKNSLEP---LLQCTKHMCPIRVHWHVKTNYKEYWRVKVAITNFNYNMNYS  314

Query  1137  QWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTEL  1316
             QWNLVV HPN  N+T++FSFNY+ L  Y DINDT M +GI++YND+L QAG  GNVQ+EL
Sbjct  315   QWNLVVQHPNFDNITQLFSFNYKPLTPYADINDTAMLWGIKFYNDLLSQAGPVGNVQSEL  374

Query  1317  LMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             L  KDP+ FTF +GW FPRRI FNG+ CV+P PD YP LPN+ P
Sbjct  375   LFRKDPSKFTFEKGWGFPRRIYFNGDNCVMPSPDSYPWLPNATP  418



>ref|XP_011099166.1| PREDICTED: protein COBRA-like [Sesamum indicum]
Length=520

 Score =   462 bits (1190),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 226/405 (56%), Positives = 282/405 (70%), Gaps = 13/405 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             D YD LDPNG+ITIKWD+I       V  V+I+N+Q YRHI  PGW L W W    VIW 
Sbjct  81    DAYDALDPNGNITIKWDVISWTPDGYVAVVTIFNFQQYRHIQAPGWTLGWTWAKKEVIWS  140

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G + TEQG+CS FK G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGV++S  QDP 
Sbjct  141   MMGGQTTEQGDCSRFK-GNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVINSWGQDPT  199

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                ++FQ+S+G   + + +           NFTL  PG  YTCG A  V PTKFV   GR
Sbjct  200   SAASSFQLSVGAAGTTNKTVRVPK------NFTLKAPGPGYTCGPAKIVKPTKFVTQDGR  253

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG---QPGSAKC  953
             R TQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN TIV CP CTCGC+    QPGS   
Sbjct  254   RVTQAMMTWNVTCTYSQFLAQKTPTCCVSLSSFYNDTIVPCPTCTCGCQNNLTQPGSCVD  313

Query  954   LKAGEQPPVVQLQHYEPPQA-IVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKN  1130
               +     VV         A +VQCT HMCPIRVHWHVKL+Y  +WRVK+TITN+N+  N
Sbjct  314   PNSPYLASVVSDHGKSNSLAPLVQCTSHMCPIRVHWHVKLNYKDYWRVKVTITNFNYRMN  373

Query  1131  FSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQT  1310
             ++ WNLV+ HPN  N+T++FSFNY+ L  Y +INDT M +G+++YND+L+QAG  GNVQ+
Sbjct  374   YTLWNLVIQHPNFDNLTQIFSFNYKPLTPYQNINDTAMLWGVKFYNDLLMQAGPLGNVQS  433

Query  1311  ELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             ELL  KD +TFTF +GWAFPRRI FNG+ CV+P PD YP LPN++
Sbjct  434   ELLFQKDKSTFTFEKGWAFPRRIYFNGDNCVMPPPDAYPYLPNAS  478



>ref|XP_009616573.1| PREDICTED: protein COBRA-like [Nicotiana tomentosiformis]
Length=452

 Score =   460 bits (1184),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 221/406 (54%), Positives = 285/406 (70%), Gaps = 19/406 (5%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             D +DPLDPNG+ITIKWD+I       V  V+++N+Q YRHI  PGW L W W    VIW+
Sbjct  30    DAFDPLDPNGNITIKWDVISWTPDGYVAVVTMFNFQQYRHIQAPGWTLGWTWAKKEVIWN  89

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ TEQG+CS FK G  PHCC+K+P I+DLLPGT +N+Q  NCCKGGV++S  QD  
Sbjct  90    MMGAQTTEQGDCSKFK-GNIPHCCKKDPTIVDLLPGTPYNQQIANCCKGGVINSWGQDTA  148

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +++FQ+S+G   + + +           NFTL  PG  YTCG A  V PTKFV   GR
Sbjct  149   TAVSSFQVSVGAAGTTNKTVRVPK------NFTLKAPGPGYTCGPAKIVKPTKFVTQDGR  202

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKA  962
             R TQA+ TWN+TC+YSQF AQ +PTCCVS+S+FYN TIV CP CTCGC+           
Sbjct  203   RVTQAMMTWNVTCTYSQFLAQKTPTCCVSISSFYNDTIVPCPTCTCGCQKNGTQHGNCVD  262

Query  963   GEQPPVVQL-------QHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNF  1121
              ++P +  +         Y P   +VQCT HMCPIR+HWHVKL+Y ++WRVK+TITN+N+
Sbjct  263   QDEPHLASVVSDHGKKNTYAP---LVQCTNHMCPIRIHWHVKLNYKEYWRVKVTITNFNY  319

Query  1122  AKNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGN  1301
               N++QWNLVV HPN  N+T++FSFNY++L  YG INDT M +G+++YND+L+QAG  GN
Sbjct  320   NMNYTQWNLVVQHPNFDNLTQLFSFNYKSLTPYGAINDTAMLWGMKFYNDLLMQAGPLGN  379

Query  1302  VQTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPN  1439
             VQ+ELL  KD +TFTF +GWAFPRR+ FNG+ CV+P PD YP +PN
Sbjct  380   VQSELLFRKDLSTFTFDKGWAFPRRVYFNGDNCVMPPPDSYPYMPN  425



>ref|XP_010502988.1| PREDICTED: COBRA-like protein 2 isoform X1 [Camelina sativa]
Length=451

 Score =   460 bits (1183),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 225/404 (56%), Positives = 284/404 (70%), Gaps = 14/404 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDP G+ITIKWDI+       V  V+I+N+Q YRHI  PGW+L W WR   VIW 
Sbjct  37    EAYDALDPTGNITIKWDIMSWTPDGYVAVVTIFNFQQYRHIQAPGWQLGWSWRKKEVIWS  96

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ATEQG+C  FK G  PHCC+K P I+DLLPGT + +Q  NCC+GGV+SS  QDP 
Sbjct  97    MVGAQATEQGDCFKFK-GNIPHCCKKTPTIVDLLPGTPYTQQISNCCRGGVISSWAQDPA  155

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +++FQ+S+G+  + +++  A        N TL  PG  YTCG A  V P+KF+    R
Sbjct  156   TAISSFQISVGQSGTTNTTVRAPR------NVTLKGPGPGYTCGPAQIVKPSKFISADKR  209

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCE--GQPGSAKCL  956
             R TQA+ TWNITC+YSQF A+ +PTCCVSLS+FYN+TIV CP C+CGC+   QPGS    
Sbjct  210   RKTQALFTWNITCTYSQFLARKTPTCCVSLSSFYNETIVPCPTCSCGCQNSSQPGSCVDP  269

Query  957   KAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFS  1136
             K     P       EP   ++QCT+HMCPIRVHWHVK +Y ++WRVK+ ITN+N+  N+S
Sbjct  270   KIALVVPASGKNSLEP---LLQCTKHMCPIRVHWHVKTNYKEYWRVKVAITNFNYNMNYS  326

Query  1137  QWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTEL  1316
             QWNLVV HPN  N+T++FSFNY+ L  Y DINDT M +GI++YND+L QAG  GNVQ+EL
Sbjct  327   QWNLVVQHPNFDNITQLFSFNYKPLTPYADINDTAMLWGIKFYNDLLSQAGPVGNVQSEL  386

Query  1317  LMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             L  KDP+ FTF +GW FPRRI FNG+ CV+P PD YP LPN+ P
Sbjct  387   LFRKDPSKFTFEKGWGFPRRIYFNGDNCVMPSPDSYPWLPNATP  430



>ref|XP_002264600.1| PREDICTED: protein COBRA [Vitis vinifera]
 emb|CBI15330.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   460 bits (1184),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 224/404 (55%), Positives = 279/404 (69%), Gaps = 12/404 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDP G+ITIKWD++       V  V+++N+Q YRHI  PGW L W W    VIW 
Sbjct  35    EAYDSLDPEGNITIKWDVMSWTPDGYVAVVTMFNFQQYRHIQAPGWSLGWSWAKKEVIWS  94

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G + TEQG+CS FK G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGV++S  QDP 
Sbjct  95    MMGGQTTEQGDCSRFK-GNVPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVINSWVQDPA  153

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                ++FQ+S+G   + + +           NFTL  PG  YTCG A  V PTKF     R
Sbjct  154   NAASSFQVSVGAAGTTNKTVKLPK------NFTLRAPGPGYTCGPAKIVKPTKFTTADQR  207

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG---QPGSAKC  953
             R TQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN TIVSCP CTCGC+     PGS   
Sbjct  208   RVTQALMTWNVTCTYSQFLAQKTPTCCVSLSSFYNNTIVSCPTCTCGCQNNLTHPGSCVD  267

Query  954   LKAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
                     VV+       Q +VQCT HMCPIRVHWHVKL+Y  +WRVKITITN+N+  N+
Sbjct  268   PNNPYLASVVEGSGKTSYQPLVQCTSHMCPIRVHWHVKLNYKDYWRVKITITNFNYRMNY  327

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             +QWNLVV HPN  N+T++FSFNY++L  Y  INDT M +G+++YND+L QAG  GNVQ+E
Sbjct  328   TQWNLVVQHPNFDNLTQIFSFNYKSLTPYAAINDTAMLWGVKFYNDLLSQAGPLGNVQSE  387

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             LL  KD ATFTF +GWAFPRRI FNG+ CV+P PD YP LPN++
Sbjct  388   LLFRKDKATFTFDKGWAFPRRIYFNGDNCVMPPPDAYPWLPNAS  431



>ref|NP_001104946.1| brittle stalk-2-like protein 3 precursor [Zea mays]
 gb|ABL59983.1| brittle stalk-2-like protein 3 [Zea mays]
 tpg|DAA51439.1| TPA: COBRA-like protein 4 [Zea mays]
Length=448

 Score =   460 bits (1183),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 223/407 (55%), Positives = 288/407 (71%), Gaps = 17/407 (4%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDPNG+ITIKWDI++      V  V+++NYQ +RHI  PGW+L W W    VIW 
Sbjct  29    EAYDSLDPNGNITIKWDIMQWTPDGYVAVVTMFNYQQFRHIGAPGWQLGWTWAKKEVIWS  88

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ TEQG+CS FKS   PHCC+K+P I+DLLPGT +N Q  NCCK GV+++  QDP 
Sbjct  89    MVGAQTTEQGDCSKFKSSP-PHCCKKDPTIVDLLPGTPYNMQIANCCKAGVVNTFNQDPA  147

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                ++FQ+S+G   + + +           NFTL  PG  YTCG A    PTKF    GR
Sbjct  148   NAASSFQISVGLAGTTNKTVKVPR------NFTLKTPGPGYTCGRAIVGRPTKFFTADGR  201

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKA  962
             R TQA+ TWN+TC+YSQF AQ +P+CCVSLS+FYN TIV+CP C+CGC+  P  + C+  
Sbjct  202   RATQALMTWNVTCTYSQFLAQKTPSCCVSLSSFYNDTIVNCPTCSCGCQ-NPSGSNCVN-  259

Query  963   GEQPPVVQLQHYEPP----QAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKN  1130
              E  P +Q     P     Q +VQCT HMCPIR+HWHVKL+Y  +WRVKITITN+NF  N
Sbjct  260   -EDSPNLQAAIDGPGKWTGQPLVQCTSHMCPIRIHWHVKLNYKDYWRVKITITNFNFRMN  318

Query  1131  FSQWNLVVLHPNLGNVTRVFSFNYRTLNQY-GDINDTGMFYGIQYYNDVLLQAGEGGNVQ  1307
             ++QWNLV  HPN  N+T++FSFNY+ L  Y G INDT MF+G+++YND+L+QAG+ GNVQ
Sbjct  319   YTQWNLVAQHPNFDNITQLFSFNYKPLTPYGGGINDTAMFWGVKFYNDLLMQAGKLGNVQ  378

Query  1308  TELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             +ELL+ KD  TFTF +GWAFPRR+ FNG+ CV+P P++YP LPN++P
Sbjct  379   SELLLRKDSRTFTFEKGWAFPRRVYFNGDNCVMPSPENYPWLPNASP  425



>gb|EYU44225.1| hypothetical protein MIMGU_mgv1a006751mg [Erythranthe guttata]
Length=433

 Score =   459 bits (1181),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 221/405 (55%), Positives = 286/405 (71%), Gaps = 18/405 (4%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDM  431
              YD LDPNG+ITIKWDI+       V  V++ N+Q+YRHI  PGW + W W    VIW M
Sbjct  19    AYDSLDPNGNITIKWDIMAWTPDGYVAIVTVNNFQMYRHIMSPGWTVGWTWAKKEVIWSM  78

Query  432   WGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEK  611
              GA+ TEQG+CS FK G  PHCC K+P ++DLLPG  +N+QF NCCKGGVL++  QDP+ 
Sbjct  79    VGAQTTEQGDCSKFK-GNIPHCCNKKPTVVDLLPGVPYNQQFANCCKGGVLAAWGQDPQA  137

Query  612   YLAAFQMsigrvssksssgaavaappipgNFTL--GVPGYTCGEAFEVPPTKFVEDHGRR  785
              ++AFQ+S+G   + + +    +      NFTL    PGYTCG A  VPPT F+    RR
Sbjct  138   SVSAFQVSVGLAGTNNKTVKLPS------NFTLLGPGPGYTCGPAKTVPPTNFLSPDRRR  191

Query  786   TTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAG  965
              TQA+ TWN+TC+YSQF AQ  P+CCVS S+FYN+TI  CP C CGCE +    KC+K  
Sbjct  192   KTQALMTWNVTCTYSQFLAQKHPSCCVSFSSFYNETITPCPSCACGCENK---NKCVKGD  248

Query  966   EQPPVVQLQHYEPPQA----IVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
              +  ++ +     P+     +VQCT HMCP+RVHWHVK +Y ++WRVKI +TN+N+  N+
Sbjct  249   SK--LLSVVGVNTPRKDNAPLVQCTHHMCPVRVHWHVKTNYKEYWRVKIAVTNFNYRMNY  306

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             +QW LVV HPNL NVT+VFSF+Y+ L  YG INDTGMFYG+++YN++L++AGE GNVQ+E
Sbjct  307   TQWTLVVQHPNLNNVTQVFSFDYKPLLPYGSINDTGMFYGMKFYNEMLMEAGEFGNVQSE  366

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             +LM KD  TF+ +EGWAFPR++ FNGEEC LP PD YP LPNS P
Sbjct  367   VLMQKDTNTFSLKEGWAFPRKVYFNGEECTLPPPDSYPFLPNSTP  411



>gb|ACG33719.1| COBRA-like protein 4 precursor [Zea mays]
Length=448

 Score =   460 bits (1183),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 223/407 (55%), Positives = 288/407 (71%), Gaps = 17/407 (4%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDPNG+ITIKWDI++      V  V+++NYQ +RHI  PGW+L W W    VIW 
Sbjct  29    EAYDSLDPNGNITIKWDIMQWTPDGYVAVVTMFNYQQFRHIGAPGWQLGWTWAKKEVIWS  88

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ TEQG+CS FKS   PHCC+K+P I+DLLPGT +N Q  NCCK GV+++  QDP 
Sbjct  89    MVGAQTTEQGDCSKFKSSP-PHCCKKDPTIVDLLPGTPYNMQIANCCKAGVVNTFNQDPA  147

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                ++FQ+S+G   + + +           NFTL  PG  YTCG A    PTKF    GR
Sbjct  148   NAASSFQISVGLAGTTNKTVKVPR------NFTLKTPGPGYTCGRAIVGRPTKFFTADGR  201

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKA  962
             R TQA+ TWN+TC+YSQF AQ +P+CCVSLS+FYN TIV+CP C+CGC+  P  + C+  
Sbjct  202   RATQALMTWNVTCTYSQFLAQKTPSCCVSLSSFYNDTIVNCPTCSCGCQ-NPSGSNCVN-  259

Query  963   GEQPPVVQLQHYEPP----QAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKN  1130
              E  P +Q     P     Q +VQCT HMCPIR+HWHVKL+Y  +WRVKITITN+NF  N
Sbjct  260   -EDSPNLQAAIDGPGKCTGQPLVQCTSHMCPIRIHWHVKLNYKDYWRVKITITNFNFRMN  318

Query  1131  FSQWNLVVLHPNLGNVTRVFSFNYRTLNQY-GDINDTGMFYGIQYYNDVLLQAGEGGNVQ  1307
             ++QWNLV  HPN  N+T++FSFNY+ L  Y G INDT MF+G+++YND+L+QAG+ GNVQ
Sbjct  319   YTQWNLVAQHPNFDNITQLFSFNYKPLTPYGGGINDTAMFWGVKFYNDLLMQAGKLGNVQ  378

Query  1308  TELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             +ELL+ KD  TFTF +GWAFPRR+ FNG+ CV+P P++YP LPN++P
Sbjct  379   SELLLRKDSRTFTFEKGWAFPRRVYFNGDNCVMPSPENYPWLPNASP  425



>ref|XP_003552600.1| PREDICTED: protein COBRA-like [Glycine max]
 gb|KHN37930.1| Protein COBRA [Glycine soja]
Length=448

 Score =   459 bits (1182),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 219/407 (54%), Positives = 283/407 (70%), Gaps = 18/407 (4%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             D YDPLDPNG+ITIKWDII       V  V++ N+Q YRHI  PGW + W W    VIW 
Sbjct  28    DAYDPLDPNGNITIKWDIISWTPDGYVAVVTMNNFQQYRHIASPGWSMGWTWAKKEVIWS  87

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G + TEQG+CS FK G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGVLSS  QDP 
Sbjct  88    MMGGQTTEQGDCSKFKGG-IPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVLSSWAQDPT  146

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +++FQ+S+GR  + + +           NFTL  PG  YTCG A  V PTKF+    R
Sbjct  147   NAVSSFQVSVGRAGTTNKTVKVPK------NFTLKAPGPGYTCGPAKIVAPTKFITSDKR  200

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKA  962
             R TQA+ TWN+TC+YSQF AQ +P+CCVSLS+FYN T+V CP C CGC+     +     
Sbjct  201   RVTQALMTWNVTCTYSQFLAQKTPSCCVSLSSFYNDTLVPCPTCACGCQSNSSRSGTCVD  260

Query  963   GEQPPVVQL------QHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFA  1124
              + P +  +       ++ P   +VQCT+HMCP+R+HWHVKL+Y ++WRVK+TITN+N+ 
Sbjct  261   PDTPHLASVVAGSGKNNFSP---LVQCTRHMCPVRIHWHVKLNYKEYWRVKVTITNFNYR  317

Query  1125  KNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNV  1304
              N+S+WN+VV HPN  N+T++FSFNY++L  YG INDT M +G+++YND L QAG  GNV
Sbjct  318   MNYSEWNMVVQHPNFDNLTQLFSFNYKSLTPYGSINDTAMLWGVKFYNDFLNQAGPNGNV  377

Query  1305  QTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             Q+ELL  KD ATFTF +GWAFPRR+ FNG+ CV+P PD YP LPN+ 
Sbjct  378   QSELLFRKDKATFTFDKGWAFPRRVYFNGDNCVMPPPDSYPWLPNAG  424



>ref|NP_186870.1| COBRA-like protein 1 precursor [Arabidopsis thaliana]
 sp|Q9SRT7.1|COBL1_ARATH RecName: Full=COBRA-like protein 1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF02128.1|AC009755_21 unknown protein [Arabidopsis thaliana]
 dbj|BAC43156.1| GPI-anchored protein [Arabidopsis thaliana]
 gb|AAO63437.1| At3g02210 [Arabidopsis thaliana]
 gb|AEE73779.1| COBRA-like protein 1 precursor [Arabidopsis thaliana]
Length=452

 Score =   460 bits (1183),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 223/406 (55%), Positives = 286/406 (70%), Gaps = 16/406 (4%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YDPLDP+G+IT+KWDII       V TV++YN+Q YRHI  PGW L W W    VIW 
Sbjct  32    EAYDPLDPSGNITVKWDIITWTGDGYVATVTVYNFQQYRHIQAPGWTLGWSWAKREVIWG  91

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G + TEQG+CS FK G  PHCC+K P ++DLLPG+ +N+Q  NCC+GGVL+S  QDP 
Sbjct  92    MNGGQTTEQGDCSKFK-GTIPHCCKKTPSVVDLLPGSPYNQQIANCCRGGVLNSWAQDPA  150

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               ++AFQ+++G+  + + +           NFTL  PG  YTC  A  V PT+F+    R
Sbjct  151   TAVSAFQLTVGQAGTTNKTVRVPK------NFTLKAPGPGYTCSPAKIVKPTRFIGTDKR  204

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCE--GQPGSA---  947
             R TQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYNKTIVSCP C+CGC    QPG+    
Sbjct  205   RVTQALMTWNVTCTYSQFLAQKTPTCCVSLSSFYNKTIVSCPTCSCGCRNTSQPGNCVDP  264

Query  948   KCLKAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAK  1127
             K  +     P      Y PP  +VQCT+HMCP+R+HWHVK++Y Q+WRVK+TITN+N+  
Sbjct  265   KGPRIASVIPNPGKNAYIPP--LVQCTKHMCPVRIHWHVKVNYKQYWRVKVTITNFNYNM  322

Query  1128  NFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQ  1307
             N+SQWNLVV HPN  N+T+ FSFNY+ L  Y  INDTG+ +GI++YND+L+QAG  GNVQ
Sbjct  323   NYSQWNLVVQHPNFDNLTQTFSFNYKPLTPYASINDTGILWGIKFYNDLLMQAGPFGNVQ  382

Query  1308  TELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             +ELL  K+ + FTF +GWAFPRRI FNG+ CV+P PD YP LPN+ 
Sbjct  383   SELLFQKEASAFTFEKGWAFPRRIYFNGDNCVMPPPDSYPWLPNTG  428



>ref|XP_004507298.1| PREDICTED: protein COBRA-like [Cicer arietinum]
Length=447

 Score =   459 bits (1182),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 221/404 (55%), Positives = 281/404 (70%), Gaps = 11/404 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YDPLDPNG+ITIKWDII       V  V++ NYQ YRHI  PGW L W W    VIW+
Sbjct  26    EAYDPLDPNGNITIKWDIISWTQDGYVAVVTLNNYQQYRHISPPGWSLGWTWAKKEVIWN  85

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             + G + TEQG+CS FKS   PHCC+K+P ++DLLPGT +N+Q  NCC+GGVLSS+ QDP 
Sbjct  86    IVGGQTTEQGDCSRFKSSPPPHCCKKDPTVVDLLPGTPYNQQIANCCRGGVLSSLAQDPT  145

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               ++AFQ+S+G   + + +           NFTL  PG  YTCG A  V PTKF     R
Sbjct  146   NAVSAFQVSVGSSGTTNKTVKLPQ------NFTLKAPGPGYTCGPAKIVKPTKFRTPDKR  199

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG-QPGSAKCL-  956
             R TQA  TWN+TC+YSQF AQ +PTCCVSLS FYN+T+V CP C+CGC+G  P S  C+ 
Sbjct  200   RVTQAHMTWNVTCTYSQFLAQKTPTCCVSLSAFYNETVVPCPTCSCGCQGNSPQSGSCVD  259

Query  957   -KAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
               A     VV          +V+CT HMCPIRVHWHVKL+Y ++WRVK+T+TN+N+  N+
Sbjct  260   PSAPHLASVVSSLGKNGITPLVRCTSHMCPIRVHWHVKLNYKEYWRVKVTVTNFNYRMNY  319

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             S WNLV+ HPN  N+T++FSFNY +++ YG INDT M +G+++YND L+QAG  GN Q+E
Sbjct  320   SDWNLVIQHPNFDNLTQLFSFNYDSISPYGTINDTAMLWGVKFYNDFLMQAGPLGNAQSE  379

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             LL  KD +TFTF +GWAFPR++ FNG+ CV+P PD YP  PNSA
Sbjct  380   LLFRKDKSTFTFDKGWAFPRKVYFNGDNCVMPPPDAYPWSPNSA  423



>ref|XP_010502993.1| PREDICTED: COBRA-like protein 2 isoform X5 [Camelina sativa]
Length=438

 Score =   459 bits (1181),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 225/403 (56%), Positives = 283/403 (70%), Gaps = 14/403 (3%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDM  431
              YD LDP G+ITIKWDI+       V  V+I+N+Q YRHI  PGW+L W WR   VIW M
Sbjct  25    AYDALDPTGNITIKWDIMSWTPDGYVAVVTIFNFQQYRHIQAPGWQLGWSWRKKEVIWSM  84

Query  432   WGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEK  611
              GA+ATEQG+C  FK G  PHCC+K P I+DLLPGT + +Q  NCC+GGV+SS  QDP  
Sbjct  85    VGAQATEQGDCFKFK-GNIPHCCKKTPTIVDLLPGTPYTQQISNCCRGGVISSWAQDPAT  143

Query  612   YLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGRR  785
              +++FQ+S+G+  + +++  A        N TL  PG  YTCG A  V P+KF+    RR
Sbjct  144   AISSFQISVGQSGTTNTTVRAPR------NVTLKGPGPGYTCGPAQIVKPSKFISADKRR  197

Query  786   TTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCE--GQPGSAKCLK  959
              TQA+ TWNITC+YSQF A+ +PTCCVSLS+FYN+TIV CP C+CGC+   QPGS    K
Sbjct  198   KTQALFTWNITCTYSQFLARKTPTCCVSLSSFYNETIVPCPTCSCGCQNSSQPGSCVDPK  257

Query  960   AGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQ  1139
                  P       EP   ++QCT+HMCPIRVHWHVK +Y ++WRVK+ ITN+N+  N+SQ
Sbjct  258   IALVVPASGKNSLEP---LLQCTKHMCPIRVHWHVKTNYKEYWRVKVAITNFNYNMNYSQ  314

Query  1140  WNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTELL  1319
             WNLVV HPN  N+T++FSFNY+ L  Y DINDT M +GI++YND+L QAG  GNVQ+ELL
Sbjct  315   WNLVVQHPNFDNITQLFSFNYKPLTPYADINDTAMLWGIKFYNDLLSQAGPVGNVQSELL  374

Query  1320  MNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
               KDP+ FTF +GW FPRRI FNG+ CV+P PD YP LPN+ P
Sbjct  375   FRKDPSKFTFEKGWGFPRRIYFNGDNCVMPSPDSYPWLPNATP  417



>gb|KEH21748.1| COBRA-like protein 2 precursor [Medicago truncatula]
Length=446

 Score =   459 bits (1182),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 225/404 (56%), Positives = 280/404 (69%), Gaps = 12/404 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             D YDPLDPNG+ITIKWDII+      V TV++ N+Q YRHI  PGW L W W    VIW 
Sbjct  26    DAYDPLDPNGNITIKWDIIQWTPDGYVATVTMNNFQQYRHIASPGWSLGWTWAKKEVIWS  85

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G++ TEQG+CS FK G  PHCC+K P ++DLLPGT +N+Q  NCCKGGVLSS  QDP 
Sbjct  86    MVGSQTTEQGDCSKFK-GNVPHCCKKNPTVVDLLPGTPYNQQIANCCKGGVLSSWAQDPT  144

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               + AFQ+S+GR  + + +           NFTL  PG  YTCG A  V PT+F++   R
Sbjct  145   MAVGAFQISVGRAGTTNKTVKVPK------NFTLNAPGPGYTCGPAKIVRPTQFIQPDKR  198

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG---QPGSAKC  953
             R TQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN TIV CP C CGC+    Q G+   
Sbjct  199   RVTQALMTWNVTCTYSQFLAQKTPTCCVSLSSFYNDTIVPCPTCACGCQSNSSQSGTCVN  258

Query  954   LKAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
                     VV          +VQCT HMCPIR+HWHVK++Y ++WRVK++ITN+N+  N+
Sbjct  259   PNTPHLASVVSGNGKNNLSPLVQCTSHMCPIRIHWHVKVNYKEYWRVKVSITNFNYRMNY  318

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             S WNLVV HPN  N+T++FSFNY++LN YG INDT M +G+++YND L  AG  GNVQ+E
Sbjct  319   SDWNLVVQHPNFDNLTQLFSFNYKSLNPYGLINDTAMLWGVKFYNDFLNHAGPSGNVQSE  378

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             LL  KD +TFTF +GWAFPRRI FNG+ CV+P PD YP LPN+ 
Sbjct  379   LLFRKDKSTFTFDKGWAFPRRIYFNGDNCVMPPPDAYPWLPNTG  422



>ref|XP_007151374.1| hypothetical protein PHAVU_004G041400g [Phaseolus vulgaris]
 gb|ESW23368.1| hypothetical protein PHAVU_004G041400g [Phaseolus vulgaris]
Length=431

 Score =   459 bits (1180),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 219/406 (54%), Positives = 291/406 (72%), Gaps = 18/406 (4%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDM  431
              YDPLDPNG+ITIKWD++       V  V+++N+Q++RHI +PGW L W W    VIW M
Sbjct  19    AYDPLDPNGNITIKWDVMSWTPDGYVAVVTVHNFQMFRHIMNPGWTLGWTWAKKEVIWSM  78

Query  432   WGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEK  611
              GA+ TEQG+CS FK G  PHCC+K P ++DLLPG  +N+QF NCCKGGV+++  QDP +
Sbjct  79    VGAQTTEQGDCSKFK-GSIPHCCKKTPTVVDLLPGVPYNQQFSNCCKGGVVAAWGQDPSQ  137

Query  612   YLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGRR  785
              +++FQ+S+G+  + + +           NFTL  PG  Y+CG A  VP T F+    RR
Sbjct  138   AISSFQVSVGQAGTTNKTVKLPK------NFTLLAPGPGYSCGPAKIVPSTTFLTPDKRR  191

Query  786   TTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAG  965
              TQA+ TWN+TC+YSQF A+ +PTCCVSLS+FYN+TI  CP C CGC  +     C+K+ 
Sbjct  192   KTQALMTWNVTCTYSQFLARKNPTCCVSLSSFYNETITPCPSCACGCHNK---KNCVKSE  248

Query  966   EQPPVVQLQHYEPPQA----IVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
              +  ++++     P+     ++QCT HMCPIRVHWHVK++Y  +WRVKITITN+N+  N 
Sbjct  249   SK--ILRMVGVHSPKKDNEPLLQCTHHMCPIRVHWHVKVNYKDYWRVKITITNFNYRMNH  306

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             S W+L V HPNL N+T+VFSFNY+ L  Y  INDTGMFYG +Y+ND+L++AG  GNVQ+E
Sbjct  307   SLWSLAVQHPNLNNLTQVFSFNYKPLLPYASINDTGMFYGTKYFNDLLMEAGPTGNVQSE  366

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAPP  1451
             LL+ KD  TFTF++GWAFPR+I FNG+EC++PQPD YP LPNSAPP
Sbjct  367   LLLQKDKDTFTFKQGWAFPRKIYFNGDECMMPQPDTYPFLPNSAPP  412



>ref|XP_006338344.1| PREDICTED: COBRA-like protein 4-like [Solanum tuberosum]
Length=434

 Score =   459 bits (1180),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 228/440 (52%), Positives = 300/440 (68%), Gaps = 36/440 (8%)
 Frame = +3

Query  144   GLMGLNPFFLIHgssrgggsflilllslicllgngDGYDPLDPNGHITIKWDIIEGNDAN  323
             GL+G+  FFLI                          +DPLDPNG+ITIKWD++      
Sbjct  3     GLIGVAGFFLIALIPHTV------------------AFDPLDPNGNITIKWDVMSWTPDG  44

Query  324   QVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDMWGAEATEQGNCSAFKSGQRPHCCE  503
              V TV++ N+Q+YRHI  PGW L W W    VIW M GA+ TEQG+CS FK G  PHCC+
Sbjct  45    YVATVTMNNFQMYRHIMTPGWTLGWTWAKKEVIWSMVGAQTTEQGDCSKFK-GNIPHCCK  103

Query  504   KEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEKYLAAFQMsigrvssksssgaavaa  683
             K P ++DLLPGT +N+QF NCCKGGVL+S  QDP+  ++AFQ+S+G+  + + +      
Sbjct  104   KNPTVVDLLPGTPYNQQFTNCCKGGVLASWGQDPQSSVSAFQVSVGQAGTTNKTVKLPK-  162

Query  684   ppipgNFTL--GVPGYTCGEAFEVPPTKFVEDHGRRTTQAVGTWNITCSYSQFRAQSSPT  857
                  NFTL    PGYTCG A  VPPTKF     RR TQA+ TWN+TC+YSQF A+  P+
Sbjct  163   -----NFTLLGPGPGYTCGPAKIVPPTKFFTPDLRRKTQALMTWNVTCTYSQFLARKHPS  217

Query  858   CCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAGEQPPVVQLQHYEPPQA----IVQC  1025
             CCVS+S+FYN+TI +CP C CGCE +    KC+K+  +  ++ +     P+     ++QC
Sbjct  218   CCVSMSSFYNETITTCPSCACGCENR---NKCIKSDSK--LLSVVGVNTPRKDNAPLIQC  272

Query  1026  TQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQWNLVVLHPNLGNVTRVFSFNYR  1205
             T HMCPIRVHWHVKL+Y  +WRVK+T+TN+N+  N++QW LVV HPNL NVT+VFSF+Y+
Sbjct  273   THHMCPIRVHWHVKLNYKDYWRVKLTVTNFNYRINYTQWTLVVQHPNLNNVTQVFSFDYK  332

Query  1206  TLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTELLMNKDPATFTFREGWAFPRRISF  1385
              L  Y  INDTGMFYG+++YND+L++AG  G VQ+E+L+ KD  TF+F +GWAFPR++ F
Sbjct  333   PLVPYQSINDTGMFYGMKFYNDLLMEAGPSGTVQSEVLLQKDKETFSFNQGWAFPRKVYF  392

Query  1386  NGEECVLPQPDDYPRLPNSA  1445
             NG+EC+LP PD YP LPNSA
Sbjct  393   NGDECMLPPPDTYPYLPNSA  412



>ref|NP_566851.1| COBRA-like protein 2 [Arabidopsis thaliana]
 sp|Q8L8Q7.2|COBL2_ARATH RecName: Full=COBRA-like protein 2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE77616.1| COBRA-like protein 2 [Arabidopsis thaliana]
Length=441

 Score =   459 bits (1181),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 221/404 (55%), Positives = 286/404 (71%), Gaps = 14/404 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDP G+ITIKWDI+       V  V+I+N+Q YRHI+ PGW+L W W    VIW 
Sbjct  27    EAYDALDPYGNITIKWDIMSWTGDGYVAVVTIFNFQQYRHIEAPGWQLGWSWMKKEVIWS  86

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G +ATEQG+CS FK G  PHCC+K P I+DLLPGT +N+Q  NCC+GGV+S+  QDP 
Sbjct  87    MVGGQATEQGDCSKFK-GNIPHCCKKTPAIVDLLPGTPYNQQISNCCRGGVISAWAQDPA  145

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +++FQ+S+G+  + +++  A        N TL  PG  YTCG A  V P++F+    R
Sbjct  146   TAISSFQISVGQSGTTNTTVRAPR------NITLKAPGPGYTCGPAKLVKPSRFISADKR  199

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCL--  956
             R TQ++ TWNITC+YSQF A+ +PTCCVSLS FYN+TIV CP C+CGC+    +  C+  
Sbjct  200   RKTQSLLTWNITCTYSQFLARKTPTCCVSLSAFYNETIVPCPTCSCGCQNSSQAGTCVDP  259

Query  957   KAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFS  1136
             K     P +   + EP   ++QCTQHMCPIRVHWHVK SY ++WRVK+ ITN+N+  N+S
Sbjct  260   KIASVVPALGKNNLEP---LLQCTQHMCPIRVHWHVKTSYKEYWRVKVAITNFNYNMNYS  316

Query  1137  QWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTEL  1316
             QWNLVV HPN  N+T++FSFNY+ LN Y +INDT M +GI++YND L QAG  GNVQ+EL
Sbjct  317   QWNLVVQHPNFDNLTKLFSFNYKPLNPYLNINDTAMLWGIKFYNDFLSQAGPVGNVQSEL  376

Query  1317  LMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             L  K+P  FTF +GWAFPRRI FNG+ CV+P PD YP LPN++P
Sbjct  377   LFQKNPLEFTFEKGWAFPRRIYFNGDNCVMPPPDSYPWLPNASP  420



>ref|XP_006477706.1| PREDICTED: protein COBRA-like [Citrus sinensis]
Length=456

 Score =   459 bits (1182),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 220/403 (55%), Positives = 283/403 (70%), Gaps = 11/403 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDPNG+ITIKWD++  N    V  V+I+N+Q YRHI  PGW L W W    VIW 
Sbjct  36    EAYDALDPNGNITIKWDLMTWNPDGYVAVVTIFNFQQYRHIQAPGWTLGWTWAKKEVIWS  95

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G + TEQG+CS +K G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGV+SS  QDP 
Sbjct  96    MMGGQTTEQGDCSKYK-GNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVISSWAQDPT  154

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               L++FQ+S+G   + + +           NFTL  PG  YTCG A    PTKF+    R
Sbjct  155   TALSSFQLSVGAAGTTNKTVRVPK------NFTLKAPGPGYTCGPAKVGKPTKFITSDKR  208

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKA  962
             R TQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN+TIVSCP C CGC+     +     
Sbjct  209   RVTQAMMTWNVTCTYSQFLAQKTPTCCVSLSSFYNETIVSCPTCACGCQNNGTESGSCIN  268

Query  963   GEQPPVVQLQHY--EPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFS  1136
              + P +  + +   +P + +VQCT HMCPIRVHWHVKL+Y ++WRVKITITN+N+A N+S
Sbjct  269   PKTPHLASVVNTPGKPNRPMVQCTSHMCPIRVHWHVKLNYKEYWRVKITITNFNYAMNYS  328

Query  1137  QWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTEL  1316
              WNLVV HPN  N+T++FSF Y++L  Y  +NDT M +GI++YND L +AG  GNVQ+EL
Sbjct  329   LWNLVVQHPNFDNLTQLFSFYYKSLTPYEGLNDTAMLWGIKFYNDFLSEAGPNGNVQSEL  388

Query  1317  LMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             L  KD +TFTF +GWAFPRRI FNG+ CV+P PD YP LPN++
Sbjct  389   LFRKDASTFTFEKGWAFPRRIYFNGDNCVMPPPDAYPWLPNAS  431



>ref|XP_004304213.1| PREDICTED: protein COBRA-like [Fragaria vesca subsp. vesca]
Length=447

 Score =   459 bits (1181),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 225/404 (56%), Positives = 283/404 (70%), Gaps = 14/404 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             D YDPLDP+G+ITIKWDI        +  V+IYNYQ YRHI  PGW L W W+   VIWD
Sbjct  28    DAYDPLDPSGNITIKWDIKSWTPDGYLAMVTIYNYQQYRHIQAPGWSLGWAWKNKEVIWD  87

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G +ATEQG+CS FK+   PHCC+K+P I+DLLPGT +NKQ  NCCKGGVLSS  QDP 
Sbjct  88    MVGGQATEQGDCSRFKTFP-PHCCKKKPTIVDLLPGTPYNKQVSNCCKGGVLSSWMQDPF  146

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                A+FQ+S+G+  + +             NFTL  PG  YTCG    V PTK+     R
Sbjct  147   NAAASFQLSVGQAGTTNKKVKPPE------NFTLMAPGPGYTCGALKVVKPTKYFSPDKR  200

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG---QPGSAKC  953
             R TQA+ TW +TC+YSQF AQ +P CCVSLS+FYN T+V CP C+CGC+     PGS   
Sbjct  201   RVTQAMMTWKLTCTYSQFLAQKTPACCVSLSSFYNDTVVPCPTCSCGCQNNLTHPGSCVD  260

Query  954   LKAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
              K+     VV       P  +V+CT HMCPIRVHWH+KL+Y ++WRVK+TITN+++ +N+
Sbjct  261   PKSPYLASVVSAADKNSP--LVRCTHHMCPIRVHWHIKLNYREYWRVKVTITNFDYRRNY  318

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             S WNLV+ HPN  N+T+VFSFN ++L  YG  NDT M +GI++YND+L+Q+G  GNVQ+E
Sbjct  319   SDWNLVMQHPNFDNLTQVFSFNSKSLTPYGTFNDTAMLWGIKFYNDMLMQSGPVGNVQSE  378

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             LL +K+PATFTF +GWAFPRRISFNG+ CV+P PD YP LPN+ 
Sbjct  379   LLFHKNPATFTFEKGWAFPRRISFNGDTCVMPPPDAYPYLPNAG  422



>ref|XP_004234909.1| PREDICTED: COBRA-like protein 4 [Solanum lycopersicum]
Length=431

 Score =   458 bits (1179),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 221/404 (55%), Positives = 289/404 (72%), Gaps = 18/404 (4%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDM  431
              YDPLDPNG+ITIKWD++       V  V++ N+Q+YRHI  PGW L W W    VIW M
Sbjct  18    AYDPLDPNGNITIKWDVMSWTPDGYVAVVTMNNFQMYRHIMSPGWTLGWTWAKKEVIWTM  77

Query  432   WGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEK  611
              GA+ATEQG+CS FK G  PHCC+K P ++D+LPG  +N+QF NCCKGGVL+S  QDP+ 
Sbjct  78    IGAQATEQGDCSKFK-GNIPHCCKKTPTVVDMLPGVPYNQQFTNCCKGGVLASWGQDPQS  136

Query  612   YLAAFQMsigrvssksssgaavaappipgNFTL--GVPGYTCGEAFEVPPTKFVEDHGRR  785
              ++AFQ+S+G+  + + +           NFTL    PGYTC  A  VPPTKF     RR
Sbjct  137   SVSAFQVSVGQAGTTNKTVKLPK------NFTLLGPGPGYTCSPAKIVPPTKFFTPDLRR  190

Query  786   TTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAG  965
              TQA+ TWN+TC+YSQF AQ  P CCVSLSTFYN+TI SCP C CGCE +    KC+K+ 
Sbjct  191   KTQALMTWNLTCTYSQFVAQKHPRCCVSLSTFYNETITSCPSCACGCENK---HKCIKSD  247

Query  966   EQPPVVQLQHYEPPQA----IVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
              +  ++ +     P+     ++QCTQHMCP+R+HWHVKL+Y ++WRVKIT+TN+N+  N+
Sbjct  248   SK--LLSMVGVNTPRKDNAPLLQCTQHMCPVRIHWHVKLNYKEYWRVKITVTNFNYRVNY  305

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             +QW LV  HPNL NVT+VFSF+Y+ L  Y  INDTGMFYG+++YND+L++AG  GNVQ+E
Sbjct  306   TQWTLVAQHPNLNNVTQVFSFDYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPAGNVQSE  365

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             +L+ K+  TFT ++GWAFPR++ FNG+EC+LP PD YP LPN A
Sbjct  366   VLLQKNKDTFTLKQGWAFPRKVYFNGDECMLPPPDSYPYLPNFA  409



>ref|NP_001265883.1| protein COBRA-like precursor [Solanum lycopersicum]
 gb|AFD29886.1| COBRA protein [Solanum lycopersicum]
Length=444

 Score =   459 bits (1180),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 219/407 (54%), Positives = 286/407 (70%), Gaps = 18/407 (4%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             D +D LDPNG+ITIKWD+I       V  V+++N+Q YRHI  PGW L W W    VIW 
Sbjct  23    DAFDALDPNGNITIKWDVISWTPDGYVAVVTMFNFQQYRHIQAPGWTLGWTWAKKEVIWG  82

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ TEQG+CS FK G  PHCC+++P ++DLLPGT +N+Q  NCCKGGV++S  QDPE
Sbjct  83    MMGAQTTEQGDCSKFK-GNIPHCCKRDPTVVDLLPGTPYNQQIANCCKGGVINSWGQDPE  141

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +++FQ+S+G   + + +           NFTL  PG  YTCG A  V PTKF    GR
Sbjct  142   TAVSSFQVSVGAAGTTNKTVRVPK------NFTLKAPGPGYTCGPAKVVKPTKFSSGDGR  195

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKA  962
             R TQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN TIV CP CTCGC+           
Sbjct  196   RITQAMMTWNVTCTYSQFLAQKTPTCCVSLSSFYNDTIVPCPTCTCGCQKNGTQHGNCVD  255

Query  963   GEQPPVVQL------QHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFA  1124
              ++P +  +       +Y P   +VQCT HMCPIR+HWHVKL+Y ++WRVK+TITN+N+ 
Sbjct  256   QDEPHLASVVSGLGKNNYAP---LVQCTSHMCPIRIHWHVKLNYKEYWRVKVTITNFNYN  312

Query  1125  KNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNV  1304
              N++QWNLVV HPN  N+T++FSF+Y++L  YG INDT M +G+++YND+L+QAG  GNV
Sbjct  313   MNYTQWNLVVQHPNFDNLTQLFSFHYKSLTPYGAINDTAMLWGMKFYNDLLMQAGPLGNV  372

Query  1305  QTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             Q+ELL  KD +TFTF +GWAFP R+ FNG+ CV+PQPD YP +PN+ 
Sbjct  373   QSELLFRKDMSTFTFEKGWAFPHRVYFNGDNCVMPQPDSYPYMPNAG  419



>ref|XP_006440798.1| hypothetical protein CICLE_v10020097mg [Citrus clementina]
 gb|ESR54038.1| hypothetical protein CICLE_v10020097mg [Citrus clementina]
Length=456

 Score =   459 bits (1181),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 227/443 (51%), Positives = 296/443 (67%), Gaps = 27/443 (6%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDPNG+ITIKWDI+  N    V  V+I+N+Q YRHI  PGW L W W    VIW 
Sbjct  36    EAYDALDPNGNITIKWDIMTWNPDGYVAVVTIFNFQQYRHIQAPGWTLGWTWAKKEVIWS  95

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G   TEQG+CS +K G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGV+SS  QDP 
Sbjct  96    MMGGLTTEQGDCSKYK-GNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVISSWAQDPT  154

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               L++FQ+S+G   + + +           NFTL  PG  YTCG A    PTKF+    R
Sbjct  155   TALSSFQLSVGAAGTTNKTVRVPK------NFTLKAPGPGYTCGPAKVGKPTKFITSDKR  208

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKA  962
             R TQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN+TIVSCP C CGC+     +     
Sbjct  209   RVTQAMMTWNVTCTYSQFLAQKTPTCCVSLSSFYNETIVSCPTCACGCQNNGTESGSCIN  268

Query  963   GEQPPVVQLQHY--EPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFS  1136
              + P +  + +   +P + +VQCT HMCPIRVHWHVKL+Y ++WRVKITITN+N+A N+S
Sbjct  269   PKTPHLASVVNTPGKPNRPMVQCTSHMCPIRVHWHVKLNYKEYWRVKITITNFNYAMNYS  328

Query  1137  QWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTEL  1316
              WNLVV HPN  N+T++FSF Y++L  Y  +NDT M +GI++YND L +AG  GNVQ+EL
Sbjct  329   LWNLVVQHPNFDNLTQLFSFYYKSLTPYEGLNDTAMLWGIKFYNDFLSEAGSNGNVQSEL  388

Query  1317  LMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAPPHSCllqflfllflvt  1496
             L  KD +TFTF +GWAFPRRI FNG+ CV+P PD YP LPN++                +
Sbjct  389   LFRKDASTFTFEKGWAFPRRIYFNGDNCVMPPPDAYPWLPNAS----------------S  432

Query  1497  fvv*NIKKDS*ILICFWVILRIC  1565
               V ++ + + I++  WV+L  C
Sbjct  433   RPVISLLRSAIIILASWVLLLAC  455



>gb|EYU44221.1| hypothetical protein MIMGU_mgv1a006633mg [Erythranthe guttata]
Length=437

 Score =   458 bits (1179),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 221/405 (55%), Positives = 286/405 (71%), Gaps = 18/405 (4%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDM  431
              YD LDPNG+ITIKWDI+       V  V++ N+Q+YRHI  PGW + W W    VIW M
Sbjct  23    AYDSLDPNGNITIKWDIMTWTPDGYVAIVTVNNFQMYRHIMSPGWTVGWTWAKKEVIWSM  82

Query  432   WGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEK  611
              GA+ TEQG+CS FK G  PHCC K+P ++DLLPG  +N+QF NCCKGGVL++  QDP+ 
Sbjct  83    VGAQTTEQGDCSKFK-GNIPHCCNKKPTVVDLLPGVPYNQQFANCCKGGVLAAWGQDPQA  141

Query  612   YLAAFQMsigrvssksssgaavaappipgNFTL--GVPGYTCGEAFEVPPTKFVEDHGRR  785
              ++AFQ+S+G+  + + +    +      NFTL    PGYTCG A  VPPT F+    RR
Sbjct  142   SVSAFQVSVGQAGTTNKTVRLPS------NFTLLGPGPGYTCGPAKTVPPTNFLSPDLRR  195

Query  786   TTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAG  965
              TQA+ TWN+TC+YSQF A+  P+CCVS S+FYN+TI  CP C CGCE +    KC+K  
Sbjct  196   KTQALMTWNVTCTYSQFLARKHPSCCVSFSSFYNETITPCPSCACGCENK---NKCVKGD  252

Query  966   EQPPVVQLQHYEPPQA----IVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
              +  ++ +     P+     +VQCT HMCP+RVHWHVK +Y ++WRVKI +TN+N+  N+
Sbjct  253   SK--LLSVVGVNTPRKDNAPLVQCTHHMCPVRVHWHVKTNYKEYWRVKIAVTNFNYRMNY  310

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             +QW LVV HPNL NVT VFSF+Y+ L  YG INDTGMFYG+++YND+L++AGE GNVQ+E
Sbjct  311   TQWTLVVQHPNLNNVTHVFSFDYKPLLPYGSINDTGMFYGMKFYNDMLMEAGEFGNVQSE  370

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             +LM KD  TF+ +EGWAFPR++ FNGEEC LP PD YP LPNS P
Sbjct  371   VLMQKDTNTFSLKEGWAFPRKVYFNGEECTLPPPDSYPFLPNSTP  415



>ref|XP_008453302.1| PREDICTED: protein COBRA-like [Cucumis melo]
Length=455

 Score =   459 bits (1181),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 222/407 (55%), Positives = 284/407 (70%), Gaps = 17/407 (4%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDPNG+ITIKWD++       V  V++YN+Q YRHI  PGW L W W    VIW 
Sbjct  35    EAYDALDPNGNITIKWDVMSWTPDGYVAVVTMYNFQQYRHIQAPGWTLGWTWAKKEVIWS  94

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G + TEQG+CS FK G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGV++S  QDP 
Sbjct  95    MMGGQTTEQGDCSRFK-GNTPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVINSWAQDPA  153

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                ++FQ+S+G   + + +           NFTL  PG  YTCG A  V PTKFV    R
Sbjct  154   NAASSFQVSVGAAGTSNKTVKLPK------NFTLKAPGPGYTCGPAKIVRPTKFVSGDKR  207

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQ-PGSAKCLK  959
             R TQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN TIV+CP CTCGC+    GS  C+ 
Sbjct  208   RVTQALMTWNVTCTYSQFLAQKTPTCCVSLSSFYNDTIVNCPTCTCGCQNNTAGSGSCVD  267

Query  960   AGEQPPVVQLQHYEPPQA-----IVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFA  1124
                  P +      P ++     +VQCT HMCPIRVHWHVKL+Y  +WRVKITITN+N+ 
Sbjct  268   PDS--PYLASVVSAPDKSGNSAPLVQCTSHMCPIRVHWHVKLNYKDYWRVKITITNFNYR  325

Query  1125  KNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNV  1304
              N++ WNLVV HPN  N+T++FSFNY++L+ YGD+NDT M +G+++YND+L QAG  GNV
Sbjct  326   MNYTLWNLVVQHPNFDNITKLFSFNYKSLSPYGDLNDTAMLWGVKFYNDLLNQAGPLGNV  385

Query  1305  QTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             Q+ELL  KD  TFTF +GWAFPRR+ FNG+ CV+P P+ YP LPN++
Sbjct  386   QSELLFQKDQNTFTFDKGWAFPRRVYFNGDNCVMPPPEAYPYLPNAS  432



>gb|ABS88990.1| ch-cobra [Cunninghamia lanceolata]
Length=452

 Score =   459 bits (1180),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 223/407 (55%), Positives = 289/407 (71%), Gaps = 20/407 (5%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDM  431
              YDPLDPNG+ITIKWD+I       V  V++YN+Q YRHI  PGW L W W    VIW M
Sbjct  32    AYDPLDPNGNITIKWDVISWTPDGYVAVVTMYNFQQYRHIQAPGWSLGWTWAKKEVIWSM  91

Query  432   WGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEK  611
              GA+AT+QG+CS FK G  PHCC K P ++DLLPGT +N+Q  NCCKGGV++S  QDP  
Sbjct  92    VGAQATQQGDCSRFK-GNIPHCCLKTPNVVDLLPGTPYNQQIANCCKGGVIASWAQDPIN  150

Query  612   YLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGRR  785
              ++AFQ+S+G   + +++           NFTL  PG  YTCG A +V  + F+   GRR
Sbjct  151   AVSAFQVSVGSAGTSNTTVRLPK------NFTLKAPGPGYTCGPAKKVKSSLFLSADGRR  204

Query  786   TTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG---QPGSAKCL  956
              TQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN TIV CP+CTCGC+    QPG+  C+
Sbjct  205   FTQALMTWNVTCTYSQFLAQKTPTCCVSLSSFYNDTIVPCPVCTCGCQNNITQPGT--CV  262

Query  957   KAGEQPPVVQLQHYEPPQA----IVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFA  1124
             + G Q  V++      P      ++QCT HMCPIR+HWHVKL+Y  +WRVK+T+TN+N+ 
Sbjct  263   EQGSQ--VLKTPGINTPTKNFAPLIQCTPHMCPIRIHWHVKLNYKAYWRVKVTVTNFNYR  320

Query  1125  KNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNV  1304
              N+SQWN+V  HPN  N+T++FSF+Y+ L  YG INDT M +G++YYND+L++AG  GNV
Sbjct  321   MNYSQWNIVAQHPNFDNITQLFSFDYKPLTPYGTINDTAMLWGVKYYNDMLMEAGPDGNV  380

Query  1305  QTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             Q+E+L  KD  TFTF++GWAFPRRI FNG++CVLP PD YP LPN +
Sbjct  381   QSEILFQKDMQTFTFKQGWAFPRRIYFNGDDCVLPPPDAYPWLPNRS  427



>ref|XP_010528423.1| PREDICTED: COBRA-like protein 2 [Tarenaya hassleriana]
Length=445

 Score =   459 bits (1180),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 217/402 (54%), Positives = 280/402 (70%), Gaps = 9/402 (2%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDPNG+ITIKWD++       V  V++YN+Q YRHI  PGW+L W W    VIW 
Sbjct  25    EAYDALDPNGNITIKWDVMSWTPDGYVAVVTMYNFQQYRHIQAPGWQLGWTWAKKEVIWS  84

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G ++TEQG+CS FK G  PHCC+K P I+DLLPGT +N+Q  NCCKGGV++S  QDP 
Sbjct  85    MLGGQSTEQGDCSKFK-GNIPHCCKKSPTIVDLLPGTPYNQQIANCCKGGVINSWAQDPA  143

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                A+FQ+S+G+  + + +           NFTL  PG  YTCG A  V P++F+    R
Sbjct  144   TASASFQISVGQAGTSNKTVRVPR------NFTLKAPGPGYTCGPAKIVKPSRFITADNR  197

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKA  962
             R TQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN TIVSCP C CGC        C+  
Sbjct  198   RFTQALMTWNVTCTYSQFLAQKTPTCCVSLSSFYNDTIVSCPTCACGCRNTTAPDTCVDP  257

Query  963   GEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQW  1142
                  +           +VQCTQHMCPIRVHWH+K++Y ++WRVK+TITN+N+  N++QW
Sbjct  258   NIASVIPAPSGKNNLAPLVQCTQHMCPIRVHWHIKVNYKEYWRVKVTITNFNYNMNYTQW  317

Query  1143  NLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTELLM  1322
             NLVV HPN  N+T++FSFNY+ L  Y +INDT M +GI++YND+L QAG  GNVQ+ELL 
Sbjct  318   NLVVQHPNFDNLTQIFSFNYKPLTPYTNINDTAMLWGIKFYNDLLSQAGPLGNVQSELLF  377

Query  1323  NKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
              K+P+TFTF +GWAFPRR+ FNG+ CV+P PD YP  PN++P
Sbjct  378   RKNPSTFTFEKGWAFPRRVYFNGDNCVMPPPDAYPWFPNASP  419



>ref|XP_007037617.1| COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored 
protein family isoform 2 [Theobroma cacao]
 gb|EOY22118.1| COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored 
protein family isoform 2 [Theobroma cacao]
Length=456

 Score =   459 bits (1180),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 221/404 (55%), Positives = 280/404 (69%), Gaps = 12/404 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDP G++TIKWD+I       V  V+IYN+Q YRHI  PGW L W W    VIW 
Sbjct  35    EAYDALDPTGNVTIKWDVISWTPDGYVAVVTIYNFQQYRHIQAPGWTLGWTWAKKEVIWS  94

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ TEQG+CS FK G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGV++S  QDP 
Sbjct  95    MMGAQTTEQGDCSKFK-GNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVINSWVQDPA  153

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                ++FQ+S+G   + + +           NFTL  PG  YTCG A  V PTKFV    R
Sbjct  154   NAASSFQVSVGAAGTTNKTVRVPR------NFTLRAPGPGYTCGPAKIVRPTKFVTPDKR  207

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG---QPGSAKC  953
             R TQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN TIVSCP C CGC+    +PGS   
Sbjct  208   RITQAMMTWNVTCTYSQFLAQKTPTCCVSLSSFYNDTIVSCPTCACGCQNNITEPGSCVS  267

Query  954   LKAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
              ++      V          ++QCT HMCP+RVHWHVKL+Y ++WRVKITITN+N+  N+
Sbjct  268   ERSPYLASAVSGPGKSSNSPLLQCTSHMCPVRVHWHVKLNYKEYWRVKITITNFNYRMNY  327

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             +QWNLVV HPN  N+T++FSF+Y++L  Y  +NDT M +G+++YND+L +AG  GNVQ+E
Sbjct  328   TQWNLVVQHPNFDNLTQLFSFHYKSLTPYAGLNDTAMLWGVKFYNDLLSEAGPLGNVQSE  387

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             LL  KD ATFTF +GWAFPRRI FNG+ CV+P PD YP LPNS 
Sbjct  388   LLFQKDAATFTFEKGWAFPRRIYFNGDNCVMPPPDAYPWLPNSG  431



>ref|NP_172450.2| COBRA-like protein 6 precursor [Arabidopsis thaliana]
 sp|O04500.2|COBL6_ARATH RecName: Full=COBRA-like protein 6; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE28492.1| COBRA-like protein 6 precursor [Arabidopsis thaliana]
Length=454

 Score =   459 bits (1180),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 227/400 (57%), Positives = 279/400 (70%), Gaps = 14/400 (4%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             DGYDPLDP G I IKWD++  +     V V++ N Q YRH++ PGWKLSW W    VIWD
Sbjct  34    DGYDPLDPFGKIIIKWDLLLSSPGQHHVQVTLENMQEYRHVEKPGWKLSWHWLNQEVIWD  93

Query  429   MWGAEATEQGNCSAF-KSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDP  605
             M GAE TEQGNCSAF  SG  PHCC + P I+DLLPG   N Q  NCC+GGVL+SM+QD 
Sbjct  94    MKGAETTEQGNCSAFASSGNLPHCCLERPTIVDLLPGASLNVQVANCCRGGVLTSMSQDH  153

Query  606   EKYLAAFQMsigrvssksssgaavaappipgNFTLGVPGYTCGEAFEVPPTKFVEDHGRR  785
               +++AF M++G            +      NF +GVPGY+C  A  V PTKF  D GRR
Sbjct  154   ANHVSAFHMTVGSSPDGPEEFNMPS------NFDIGVPGYSCDNATSVSPTKFSTDKGRR  207

Query  786   TTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAG  965
              TQA+ TW   C YSQFR+  SP CCVSLS FY + IV CP C+        S+ C+K G
Sbjct  208   KTQALATWEAVCVYSQFRSSPSPKCCVSLSAFYYQNIVPCPTCS----CGCSSSHCVKDG  263

Query  966   EQPPVVQLQHY--EPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQ  1139
             E PP ++ +H   E    +V+C+ HMCPIR+HWHVK++Y ++WRVKIT TN+N  KN++ 
Sbjct  264   ELPPYLEQKHDPDEEVSPVVKCSDHMCPIRIHWHVKVNYREYWRVKITATNFNTMKNYTN  323

Query  1140  WNLVVLHPNLGNVTRVFSFNYRTLNQY-GDINDTGMFYGIQYYNDVLLQAGEGGNVQTEL  1316
             WNLVVLHPNL +V +VFSFNY++L  Y   INDTGMF+G+Q+YNDVLLQ G+ GNVQTEL
Sbjct  324   WNLVVLHPNLKSVQQVFSFNYKSLTPYQNSINDTGMFWGVQFYNDVLLQEGKIGNVQTEL  383

Query  1317  LMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLP  1436
             L+ KD   FTFREGWAFPRRI FNG+ECV+P PDD+PRLP
Sbjct  384   LLKKDMGNFTFREGWAFPRRILFNGDECVMPSPDDFPRLP  423



>ref|XP_010037254.1| PREDICTED: protein COBRA-like [Eucalyptus grandis]
 gb|KCW48926.1| hypothetical protein EUGRSUZ_K02540 [Eucalyptus grandis]
Length=458

 Score =   459 bits (1180),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 220/406 (54%), Positives = 281/406 (69%), Gaps = 13/406 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDPNG+ITIKWD+I       V  V+++N+Q YRHI  PGW L W W    VIW 
Sbjct  36    EAYDALDPNGNITIKWDVISWTPDGYVAVVTMFNFQQYRHIQSPGWTLGWTWAKKEVIWS  95

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G++ TEQG+CS +K G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGVL+S  QDP 
Sbjct  96    MMGSQTTEQGDCSRYK-GNTPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVLNSWVQDPA  154

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                ++FQ+S+G   + + +           NFTL  PG  YTCG A  V  TKFV    R
Sbjct  155   NAASSFQVSVGAAGTSNKTVRLPK------NFTLKAPGPGYTCGPAKIVRSTKFVSADKR  208

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKA  962
             RTTQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN TIV CP CTCGC+           
Sbjct  209   RTTQALMTWNVTCTYSQFLAQKTPTCCVSLSSFYNDTIVRCPTCTCGCQNNATDTGGCVQ  268

Query  963   GEQPPVVQLQHYEPPQA----IVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKN  1130
              + P + Q+       +    +VQCT HMCPIRVHWHVKL+Y ++WRVKITITN+N+  N
Sbjct  269   ADSPHLAQVVAGSGKSSSNTPLVQCTSHMCPIRVHWHVKLNYKEYWRVKITITNFNYRMN  328

Query  1131  FSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQT  1310
             ++QWNLVV HPN  N+T++FSFNY++L  Y  +NDT M +G+++YND L +AG  GNVQ+
Sbjct  329   YTQWNLVVQHPNFDNLTQLFSFNYKSLTPYAGLNDTAMLWGVKFYNDFLSEAGPYGNVQS  388

Query  1311  ELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             ELL  KD +TFTF +GWAFPRRI FNG+ CV+P PD YP LPN++P
Sbjct  389   ELLFQKDQSTFTFEKGWAFPRRIYFNGDNCVMPPPDAYPWLPNASP  434



>ref|XP_010937850.1| PREDICTED: COBRA-like protein 1 [Elaeis guineensis]
Length=460

 Score =   459 bits (1180),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 225/411 (55%), Positives = 283/411 (69%), Gaps = 24/411 (6%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDPNG+ITIKWDI++      V  V +YNYQ YRHI+ PGW L W W    VIW 
Sbjct  39    EAYDALDPNGNITIKWDIMQWTTDGYVAVVMVYNYQQYRHIEAPGWTLGWTWAKKEVIWS  98

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ TEQG+CS FK    PHCC+K+P ++DLLP T F  Q  NCCKGGV+SS+ QDP 
Sbjct  99    MVGAQTTEQGDCSKFKE-NIPHCCKKDPTVVDLLPETPFGLQIANCCKGGVMSSVVQDPG  157

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
             K  ++FQ+S+G   +   +  A        NFT  VPG  YTC     V P+KFV   GR
Sbjct  158   KAASSFQLSVGLAGTSIKTAKAPK------NFTFRVPGPGYTCANTETVEPSKFVSKDGR  211

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG---QPGSAKC  953
             R TQA+ TW +TC+YSQF +Q +PTCCVSLS+FYN TIV+CP CTCGC     +PGS  C
Sbjct  212   RKTQALMTWKVTCTYSQFLSQKTPTCCVSLSSFYNDTIVNCPACTCGCPNNLTKPGS--C  269

Query  954   LKAGEQPPVVQL------QHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNY  1115
             ++ G  P +           + P   +VQCT HMCPIRVHWHVKL+Y ++WR KI++TN+
Sbjct  270   VE-GNSPYLASAVNGLGKSSFTP---LVQCTSHMCPIRVHWHVKLNYKEYWRAKISVTNF  325

Query  1116  NFAKNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEG  1295
             N+  N++QWNLV+ HPN  N+TR FSFNY+ L  YG INDT M +GI++YN++L+ AG  
Sbjct  326   NYRMNYTQWNLVMQHPNFNNLTRTFSFNYKALTPYGTINDTAMMWGIKFYNELLMVAGPM  385

Query  1296  GNVQTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             GNVQ+ELL  KDP TFTF +GWAFPRR+ FNGE CV+P PD YP LPN++P
Sbjct  386   GNVQSELLFQKDPLTFTFGKGWAFPRRVYFNGENCVMPPPDAYPWLPNASP  436



>ref|XP_004232142.1| PREDICTED: COBRA-like protein 4 [Solanum lycopersicum]
Length=434

 Score =   457 bits (1177),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 220/404 (54%), Positives = 291/404 (72%), Gaps = 18/404 (4%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDM  431
              +DPLDPNG+ITIKWD++       V TV++ N+Q+YRHI  PGW L W W    VIW M
Sbjct  21    AFDPLDPNGNITIKWDVMSWTPDGYVATVTMNNFQMYRHIMTPGWTLGWTWAKKEVIWSM  80

Query  432   WGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEK  611
              GA+ TEQG+CS FK G  PHCC+K P ++DLLPGT +N+QF NCCKGGVL+S  QDP+ 
Sbjct  81    VGAQTTEQGDCSKFK-GNIPHCCKKNPTVVDLLPGTPYNQQFTNCCKGGVLASWGQDPQS  139

Query  612   YLAAFQMsigrvssksssgaavaappipgNFTL--GVPGYTCGEAFEVPPTKFVEDHGRR  785
              ++AFQ+S+G+  + + +           NFTL    PGYTCG A  VPPTKF     RR
Sbjct  140   SVSAFQVSVGQAGTTNKTVKLPK------NFTLLGPGPGYTCGPAKIVPPTKFFTPDLRR  193

Query  786   TTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAG  965
              TQA+ TWN+TC+YSQF A+  P+CCVS+S+FYN+TI SCP C CGCE +    KC+K+ 
Sbjct  194   KTQALMTWNVTCTYSQFLARKHPSCCVSMSSFYNETITSCPSCACGCENR---NKCIKSD  250

Query  966   EQPPVVQLQHYEPPQA----IVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
              +  ++ +     P+     ++QCT HMCPIRVHWHVKL+Y  +WRVK+T+TN+N+  N+
Sbjct  251   SK--LLSVVGVNTPRKDNAPLIQCTHHMCPIRVHWHVKLNYKDYWRVKLTVTNFNYRINY  308

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             +QW LVV HPNL NVT+VFSF+Y+ L  Y  +NDTGMFYG+++YND+L++AG  G VQ+E
Sbjct  309   TQWTLVVQHPNLNNVTQVFSFDYKPLVPYQSVNDTGMFYGMKFYNDLLMEAGPSGTVQSE  368

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             +L+ KD  TF+F++GWAFPR++ FNG+EC+LP PD YP LPN A
Sbjct  369   VLLQKDKETFSFKQGWAFPRKVYFNGDECMLPPPDTYPYLPNFA  412



>ref|XP_004488435.1| PREDICTED: protein COBRA-like [Cicer arietinum]
Length=442

 Score =   458 bits (1178),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 220/403 (55%), Positives = 281/403 (70%), Gaps = 11/403 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YDPLDPNG+IT+KWD+I       V  V++YN+Q YRHI  PGW L W W    VIW+
Sbjct  23    EAYDPLDPNGNITLKWDVISWTPDGYVAVVTMYNFQQYRHIQEPGWTLGWTWAKKEVIWN  82

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G++ TEQG+CS FK+G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGVL+S  QDP 
Sbjct  83    MMGSQTTEQGDCSKFKAG-IPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVLNSWAQDPN  141

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +++FQ+S+G   + + +           NFTL  PG  YTCG A  V PT+F+ +  R
Sbjct  142   NAVSSFQISVGSAGTTNKTVKLPR------NFTLKAPGPGYTCGPAKIVRPTQFITNDKR  195

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG--QPGSAKCL  956
             R TQA+ TWNITC+YSQF AQ +PTCCVSLS+FYN TIV CP CTCGC+   QP S    
Sbjct  196   RVTQALMTWNITCTYSQFLAQKTPTCCVSLSSFYNDTIVDCPTCTCGCQNKTQPDSCVNP  255

Query  957   KAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFS  1136
              +     VV          +VQCT HMCPIRVHWHVKL+Y ++WR+KITITN+N+  N+S
Sbjct  256   DSPHLSSVVSSSGKPTNTPLVQCTSHMCPIRVHWHVKLNYKEYWRIKITITNFNYRMNYS  315

Query  1137  QWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTEL  1316
             QWNLVV HPN  N+T++FSF Y++L  Y  +NDTGM +G+++YND L  A   GNVQ+E+
Sbjct  316   QWNLVVQHPNFDNLTQLFSFKYKSLTPYEGLNDTGMLWGVKFYNDFLSSAASYGNVQSEI  375

Query  1317  LMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             L  KD +TFTF +GWAFPRRI FNG+ CV+P PD YP  PN+ 
Sbjct  376   LFRKDKSTFTFDKGWAFPRRIYFNGDNCVMPPPDAYPWSPNAT  418



>gb|KEH38144.1| COBRA-like protein 2 precursor [Medicago truncatula]
Length=452

 Score =   458 bits (1179),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 218/403 (54%), Positives = 282/403 (70%), Gaps = 11/403 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YDPLDPNG+ITIKWD++  N    +  V++YN+Q YRHI  PGW L W W    VIW+
Sbjct  33    EAYDPLDPNGNITIKWDVMGWNPDGYIAIVTMYNFQQYRHIQEPGWTLGWTWAKKEVIWN  92

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G++ TEQG+CS FK+G  PHCC+K+P ++DLLPGT +N+Q  NCCKGG+L+S  QDP 
Sbjct  93    MMGSQTTEQGDCSKFKAG-IPHCCKKDPTVVDLLPGTPYNQQIANCCKGGILNSWAQDPS  151

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +++FQ+S+G   + + +           NFTL  PG  YTCG A  V PT+F+    R
Sbjct  152   NAVSSFQISVGSAGTTNKTVKLPR------NFTLRAPGPGYTCGPAKIVRPTQFITTDKR  205

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG--QPGSAKCL  956
             R TQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN TIV CP CTCGC+   QP S    
Sbjct  206   RVTQALMTWNVTCTYSQFLAQKTPTCCVSLSSFYNDTIVDCPTCTCGCQNKTQPDSCVNP  265

Query  957   KAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFS  1136
              +     VV          +VQCT HMCPIRVHWHVKL+Y ++WR+K+TITN+N+  N+S
Sbjct  266   DSPHLSSVVSASGKPINTPLVQCTSHMCPIRVHWHVKLNYKEYWRIKVTITNFNYRMNYS  325

Query  1137  QWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTEL  1316
             QWNLVV HPN  N+T++FSF Y++LN Y  +NDT M +G+++YND L  AG  GNVQ+E+
Sbjct  326   QWNLVVQHPNFDNLTQLFSFKYKSLNPYEGLNDTAMLWGVKFYNDFLSSAGSLGNVQSEI  385

Query  1317  LMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             L  KD +TFTF +GWAFPRRI FNG+ CV+P PD YP  PN+ 
Sbjct  386   LFRKDKSTFTFDKGWAFPRRIYFNGDNCVMPPPDAYPWSPNAT  428



>gb|ABD96927.1| hypothetical protein [Cleome spinosa]
Length=436

 Score =   457 bits (1177),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 217/404 (54%), Positives = 281/404 (70%), Gaps = 16/404 (4%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDP+G+ITIKWDI+       V  V+IYN+Q YRHI  PGW L W W    VIW 
Sbjct  15    EAYDALDPDGNITIKWDIMTWTADGYVAVVTIYNFQQYRHIQAPGWSLGWTWAKREVIWG  74

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G + TEQG+CS FK G  PHCC+++P ++DL+PGT +N+Q  NCCKGGV++S  QDP 
Sbjct  75    MNGGQTTEQGDCSRFK-GNIPHCCKQDPTVVDLMPGTPYNQQIANCCKGGVINSFAQDPA  133

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               ++AFQ+++G+  + + +           NFTL  PG  YTC     V P++F+    R
Sbjct  134   TTVSAFQLTVGQAGTTNKTVRVPK------NFTLKAPGPGYTCSPGNIVKPSRFISADKR  187

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCL--  956
             R TQA+ TWN+TC+YSQF AQ +PTCCVSLS+FY  TIVSCP C CGC     +  C+  
Sbjct  188   RITQALMTWNVTCTYSQFLAQKTPTCCVSLSSFYTNTIVSCPTCACGCRKTSETGTCVDP  247

Query  957   KAGEQPPVVQ---LQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAK  1127
             K      V+Q      Y PP  +VQCT HMCPIR+HWHVK++Y ++WRVKI+ITN+N+  
Sbjct  248   KGPRIASVIQSPGKNSYMPP--LVQCTNHMCPIRIHWHVKVNYKEYWRVKISITNFNYVM  305

Query  1128  NFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQ  1307
             N+SQWN+VV HPN  N+T++FSFNY+ L  Y  INDTG+ +G++YYND+L+QAG  GNVQ
Sbjct  306   NYSQWNVVVQHPNFDNLTQIFSFNYKPLTPYASINDTGILWGVKYYNDLLMQAGPSGNVQ  365

Query  1308  TELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPN  1439
             +ELL  KDP +FT  +GWAFPRRI FNG+ CV+P PD YPRLPN
Sbjct  366   SELLFRKDPLSFTLEKGWAFPRRIYFNGDNCVMPPPDSYPRLPN  409



>ref|XP_002463862.1| hypothetical protein SORBIDRAFT_01g007760 [Sorghum bicolor]
 gb|AAO17706.1| phytochelatin synthetase-like protein 2 [Sorghum bicolor]
 gb|EER90860.1| hypothetical protein SORBIDRAFT_01g007760 [Sorghum bicolor]
Length=449

 Score =   458 bits (1178),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 222/407 (55%), Positives = 288/407 (71%), Gaps = 17/407 (4%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDP G+ITIKWDI++      V  V++YN+Q +RHI  PGW+L W W    VIW 
Sbjct  29    EAYDSLDPTGNITIKWDIMQWTPDGYVAVVTMYNFQQFRHIGAPGWQLGWTWAKKEVIWS  88

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ TEQG+CS FK G  PHCC+K+P I+DLLPGT +N Q  NCCK GV+++  QDP 
Sbjct  89    MVGAQTTEQGDCSKFK-GNTPHCCKKDPTIVDLLPGTPYNMQIANCCKAGVINTFNQDPA  147

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                ++FQ+S+G   + + +           NFTL  PG  YTCG A    PTKF    GR
Sbjct  148   NAASSFQISVGLAGTTNKTVKVPK------NFTLKTPGPGYTCGRAIVGRPTKFWSADGR  201

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKA  962
             R TQA+ TWN+TC+YSQF AQ +P+CCVSLS+FYN TIV+CP C+CGC+  P  + C+  
Sbjct  202   RATQALMTWNVTCTYSQFLAQKTPSCCVSLSSFYNDTIVNCPTCSCGCQ-NPSGSNCVN-  259

Query  963   GEQPPVVQLQHYEPP----QAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKN  1130
              E  P +Q     P     Q +VQCT HMCPIR+HWHVKL+Y ++WRVKITITN+NF  N
Sbjct  260   -EDSPNLQAAIDGPGKWTGQPLVQCTSHMCPIRIHWHVKLNYKEYWRVKITITNFNFRMN  318

Query  1131  FSQWNLVVLHPNLGNVTRVFSFNYRTLNQY-GDINDTGMFYGIQYYNDVLLQAGEGGNVQ  1307
             ++QWNLV  HPN  N+T++FSFNY+ L  Y G INDT MF+G+++YND+L+QAG+ GNVQ
Sbjct  319   YTQWNLVAQHPNFDNITQLFSFNYKPLTPYGGGINDTAMFWGVKFYNDLLMQAGKLGNVQ  378

Query  1308  TELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             +ELL+ KD  TFTF +GWAFPRR+ FNG+ CV+P P++YP LPN++P
Sbjct  379   SELLLRKDSRTFTFDKGWAFPRRVYFNGDNCVMPSPENYPWLPNASP  425



>ref|XP_010525122.1| PREDICTED: COBRA-like protein 1 [Tarenaya hassleriana]
Length=450

 Score =   458 bits (1178),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 217/404 (54%), Positives = 281/404 (70%), Gaps = 16/404 (4%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDP+G+ITIKWDI+       V  V+IYN+Q YRHI  PGW L W W    VIW 
Sbjct  29    EAYDALDPDGNITIKWDIMTWTADGYVAVVTIYNFQQYRHIQAPGWSLGWTWAKREVIWG  88

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G + TEQG+CS FK G  PHCC+++P ++DL+PGT +N+Q  NCCKGGV++S  QDP 
Sbjct  89    MNGGQTTEQGDCSRFK-GNIPHCCKQDPTVVDLMPGTPYNQQIANCCKGGVINSFAQDPA  147

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               ++AFQ+++G+  + + +           NFTL  PG  YTC     V P++F+    R
Sbjct  148   TTVSAFQLTVGQAGTTNKTVRVPK------NFTLKAPGPGYTCSPGNIVKPSRFISADKR  201

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCL--  956
             R TQA+ TWN+TC+YSQF AQ +PTCCVSLS+FY  TIVSCP C CGC     +  C+  
Sbjct  202   RITQALMTWNVTCTYSQFLAQKTPTCCVSLSSFYTNTIVSCPTCACGCRKTSETGTCVDP  261

Query  957   KAGEQPPVVQ---LQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAK  1127
             K      V+Q      Y PP  +VQCT HMCPIR+HWHVK++Y ++WRVKI+ITN+N+  
Sbjct  262   KGPRIASVIQSPGKNSYMPP--LVQCTNHMCPIRIHWHVKVNYKEYWRVKISITNFNYVM  319

Query  1128  NFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQ  1307
             N+SQWN+VV HPN  N+T++FSFNY+ L  Y  INDTG+ +G++YYND+L+QAG  GNVQ
Sbjct  320   NYSQWNVVVQHPNFDNLTQIFSFNYKPLTPYASINDTGILWGVKYYNDLLMQAGPSGNVQ  379

Query  1308  TELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPN  1439
             +ELL  KDP +FT  +GWAFPRRI FNG+ CV+P PD YPRLPN
Sbjct  380   SELLFRKDPLSFTLEKGWAFPRRIYFNGDNCVMPPPDSYPRLPN  423



>dbj|BAB02996.1| phytochelatin synthetase-like protein [Arabidopsis thaliana]
Length=442

 Score =   457 bits (1177),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 221/407 (54%), Positives = 286/407 (70%), Gaps = 17/407 (4%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDP G+ITIKWDI+       V  V+I+N+Q YRHI+ PGW+L W W    VIW 
Sbjct  25    EAYDALDPYGNITIKWDIMSWTGDGYVAVVTIFNFQQYRHIEAPGWQLGWSWMKKEVIWS  84

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G +ATEQG+CS FK G  PHCC+K P I+DLLPGT +N+Q  NCC+GGV+S+  QDP 
Sbjct  85    MVGGQATEQGDCSKFK-GNIPHCCKKTPAIVDLLPGTPYNQQISNCCRGGVISAWAQDPA  143

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +++FQ+S+G+  + +++  A        N TL  PG  YTCG A  V P++F+    R
Sbjct  144   TAISSFQISVGQSGTTNTTVRAPR------NITLKAPGPGYTCGPAKLVKPSRFISADKR  197

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCL--  956
             R TQ++ TWNITC+YSQF A+ +PTCCVSLS FYN+TIV CP C+CGC+    +  C+  
Sbjct  198   RKTQSLLTWNITCTYSQFLARKTPTCCVSLSAFYNETIVPCPTCSCGCQNSSQAGTCVDC  257

Query  957   ---KAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAK  1127
                K     P +   + EP   ++QCTQHMCPIRVHWHVK SY ++WRVK+ ITN+N+  
Sbjct  258   DSPKIASVVPALGKNNLEP---LLQCTQHMCPIRVHWHVKTSYKEYWRVKVAITNFNYNM  314

Query  1128  NFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQ  1307
             N+SQWNLVV HPN  N+T++FSFNY+ LN Y +INDT M +GI++YND L QAG  GNVQ
Sbjct  315   NYSQWNLVVQHPNFDNLTKLFSFNYKPLNPYLNINDTAMLWGIKFYNDFLSQAGPVGNVQ  374

Query  1308  TELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             +ELL  K+P  FTF +GWAFPRRI FNG+ CV+P PD YP LPN++P
Sbjct  375   SELLFQKNPLEFTFEKGWAFPRRIYFNGDNCVMPPPDSYPWLPNASP  421



>ref|XP_006655271.1| PREDICTED: COBRA-like protein 3-like [Oryza brachyantha]
Length=452

 Score =   458 bits (1178),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 221/410 (54%), Positives = 286/410 (70%), Gaps = 21/410 (5%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDPNG+ITIKWD+++      V  V+++N+Q +RHI  PGW+L W W    VIW 
Sbjct  30    EAYDSLDPNGNITIKWDVMQWTPDGYVAVVTMFNFQQFRHIQAPGWQLGWTWAKKEVIWS  89

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ TEQG+CS FK G  PHCC+K+P I+DLLPGT +N Q  NCCK GV+++  QDP 
Sbjct  90    MVGAQTTEQGDCSKFK-GNTPHCCKKDPTIVDLLPGTPYNMQIANCCKAGVINTFNQDPS  148

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                ++FQ+S+G   + + +           NFTL  PG  YTCG A  V PTKF    GR
Sbjct  149   NAASSFQISVGLAGTTNKTVKLPK------NFTLKAPGPGYTCGRAMIVRPTKFFTQDGR  202

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQ---PGSAKC  953
             R TQA+ TWN+TC+YSQF AQ +P+CCVSLS+FYN TIV+CP C+CGC+     PGS   
Sbjct  203   RATQALMTWNVTCTYSQFLAQKTPSCCVSLSSFYNDTIVNCPTCSCGCQNNKTAPGSC--  260

Query  954   LKAGEQPPVVQLQHYEPP----QAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNF  1121
                 E  P +Q     P     Q +VQCT HMCPIR+HWHVKL+Y ++WRVKITITN+N+
Sbjct  261   --VNENSPYLQSAIDGPGKWTGQPLVQCTSHMCPIRIHWHVKLNYKEYWRVKITITNFNY  318

Query  1122  AKNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGD-INDTGMFYGIQYYNDVLLQAGEGG  1298
               N++QWNLVV HPN  N+T++FSFNY+ L  YG  INDT MF+G+++YND+L+QAG  G
Sbjct  319   RMNYTQWNLVVQHPNFDNITQLFSFNYKPLTPYGSRINDTAMFWGVKFYNDLLMQAGPLG  378

Query  1299  NVQTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             N Q+E+L+ KD   FTF +GWAFPRR+ FNG+ CV+P PD YP LPN++P
Sbjct  379   NAQSEILLRKDSMAFTFDKGWAFPRRVYFNGDNCVMPPPDAYPWLPNASP  428



>gb|KCW48927.1| hypothetical protein EUGRSUZ_K02540 [Eucalyptus grandis]
Length=457

 Score =   458 bits (1179),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 220/405 (54%), Positives = 280/405 (69%), Gaps = 13/405 (3%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDM  431
              YD LDPNG+ITIKWD+I       V  V+++N+Q YRHI  PGW L W W    VIW M
Sbjct  36    AYDALDPNGNITIKWDVISWTPDGYVAVVTMFNFQQYRHIQSPGWTLGWTWAKKEVIWSM  95

Query  432   WGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEK  611
              G++ TEQG+CS +K G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGVL+S  QDP  
Sbjct  96    MGSQTTEQGDCSRYK-GNTPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVLNSWVQDPAN  154

Query  612   YLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGRR  785
               ++FQ+S+G   + + +           NFTL  PG  YTCG A  V  TKFV    RR
Sbjct  155   AASSFQVSVGAAGTSNKTVRLPK------NFTLKAPGPGYTCGPAKIVRSTKFVSADKRR  208

Query  786   TTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAG  965
             TTQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN TIV CP CTCGC+            
Sbjct  209   TTQALMTWNVTCTYSQFLAQKTPTCCVSLSSFYNDTIVRCPTCTCGCQNNATDTGGCVQA  268

Query  966   EQPPVVQLQHYEPPQA----IVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
             + P + Q+       +    +VQCT HMCPIRVHWHVKL+Y ++WRVKITITN+N+  N+
Sbjct  269   DSPHLAQVVAGSGKSSSNTPLVQCTSHMCPIRVHWHVKLNYKEYWRVKITITNFNYRMNY  328

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             +QWNLVV HPN  N+T++FSFNY++L  Y  +NDT M +G+++YND L +AG  GNVQ+E
Sbjct  329   TQWNLVVQHPNFDNLTQLFSFNYKSLTPYAGLNDTAMLWGVKFYNDFLSEAGPYGNVQSE  388

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             LL  KD +TFTF +GWAFPRRI FNG+ CV+P PD YP LPN++P
Sbjct  389   LLFQKDQSTFTFEKGWAFPRRIYFNGDNCVMPPPDAYPWLPNASP  433



>ref|XP_009346186.1| PREDICTED: protein COBRA-like [Pyrus x bretschneideri]
Length=456

 Score =   458 bits (1178),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 220/405 (54%), Positives = 281/405 (69%), Gaps = 12/405 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDPNG+ITIKWD+I       V  V+++N+Q YRHI  PGW L W W    VIW 
Sbjct  35    EAYDALDPNGNITIKWDVISWTPDGYVAVVTMFNFQQYRHIQAPGWTLGWTWAKKEVIWS  94

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ATEQG+CS +K G  PHCC+K+P I+DLLPGT +N+Q  NCCKGGV+ S  QDP+
Sbjct  95    MVGAQATEQGDCSKYK-GNVPHCCKKDPTIVDLLPGTPYNQQIANCCKGGVMQSWIQDPD  153

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +++FQ+S+G   + + +           NFTL  PG  Y+CG A  V PT+F+    R
Sbjct  154   NAISSFQISVGAAGTTNKTVRLPK------NFTLKAPGPGYSCGIAKIVKPTRFLTSDKR  207

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQ---PGSAKC  953
             R TQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN+TIVSCP C CGC+     PGS   
Sbjct  208   RWTQAMMTWNVTCTYSQFLAQKTPTCCVSLSSFYNQTIVSCPTCACGCQNNATDPGSCVE  267

Query  954   LKAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
                      V          +VQCT HMCPIRVHWHVKL+Y ++WRVK+TITN+N+  N+
Sbjct  268   PNNPYLASAVSGSGKSANTPLVQCTSHMCPIRVHWHVKLNYKEYWRVKVTITNFNYRMNY  327

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             + WNLVV HPN  N+T++FSFNY++L  Y  +NDT M +G+++YND L QAG  GNVQ+E
Sbjct  328   TLWNLVVQHPNFDNLTKIFSFNYKSLTPYVGLNDTAMLWGVKFYNDFLSQAGPLGNVQSE  387

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             LL  KD +TFTF +GWAFPRRI FNG+ CV+P PD YP LPN++P
Sbjct  388   LLFRKDTSTFTFEKGWAFPRRIYFNGDNCVMPPPDSYPWLPNASP  432



>ref|XP_003559376.1| PREDICTED: COBRA-like protein 3 [Brachypodium distachyon]
Length=456

 Score =   457 bits (1177),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 222/410 (54%), Positives = 286/410 (70%), Gaps = 21/410 (5%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDPNG+ITIKWDI E      V  V+++NYQ +RHI  PGW+L W W    VIW 
Sbjct  34    EAYDSLDPNGNITIKWDIREWTADGYVAVVTMFNYQQFRHISAPGWQLGWTWAKKEVIWS  93

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ATEQG+CS FKS   PH C+++P I+DLLPGT +N+Q  NCCK GV+ +  QDP 
Sbjct  94    MVGAQATEQGDCSKFKSSP-PHSCKRDPTIVDLLPGTPYNQQIANCCKAGVIDTFNQDPS  152

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                ++FQ+S+G   + + +           NFTL  PG  YTCG A    PTK+    GR
Sbjct  153   NAASSFQVSVGLAGTTNKTVKVPK------NFTLKAPGPGYTCGRAIVGKPTKYFTSDGR  206

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG---QPGSAKC  953
             R TQA+ TWN+TC+YSQF AQ +P+CCVSLS+FYN TIV+CP C+CGC+    +PGS   
Sbjct  207   RATQALMTWNVTCTYSQFLAQKTPSCCVSLSSFYNDTIVNCPTCSCGCQNNNTRPGSC--  264

Query  954   LKAGEQPPVVQLQHYEPP----QAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNF  1121
                 E  P +Q     P     Q +VQCT HMCPIR+HWHVKL+Y  +WRVK+TITN+N+
Sbjct  265   --VNENSPYLQSAIDGPGKYTGQPLVQCTSHMCPIRIHWHVKLNYKDYWRVKVTITNFNY  322

Query  1122  AKNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQY-GDINDTGMFYGIQYYNDVLLQAGEGG  1298
               N++QWNLVV HPN  N+T++FSFNY+ L  Y G INDT MF+G+++YND+L+QAG  G
Sbjct  323   RMNYTQWNLVVQHPNFDNITKLFSFNYKPLTPYGGGINDTAMFWGMKFYNDLLMQAGPLG  382

Query  1299  NVQTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             N Q+E+L+ KD ATFTF +GWAFPRR+ FNG+ CV+P PD YP LPN++P
Sbjct  383   NAQSEILLKKDSATFTFDKGWAFPRRVYFNGDNCVMPSPDAYPWLPNASP  432



>dbj|BAJ86473.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92260.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=457

 Score =   457 bits (1176),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 223/410 (54%), Positives = 286/410 (70%), Gaps = 21/410 (5%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDPNG+ITIKWDII       V TV+++NYQ +RHI  PGW+L W W    VIW 
Sbjct  34    EAYDSLDPNGNITIKWDIISWTPDGYVATVTMFNYQQFRHISAPGWQLGWSWAKKEVIWS  93

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ATEQG+CS FKS   PHCC+++P I+DLLPGT FN+Q  NCCK GV+ +  QDP 
Sbjct  94    MVGAQATEQGDCSKFKSAP-PHCCKRDPTIVDLLPGTPFNQQIANCCKAGVIKTFNQDPG  152

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                ++FQ+S+G   + + +           NFTL  PG  YTCG A    PTK+    GR
Sbjct  153   NAASSFQISVGLAGTTNKTVKMPK------NFTLKAPGPGYTCGRALVGRPTKYYSSDGR  206

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG---QPGSAKC  953
             R TQA+ +WN+TC+YSQF AQ +PTCCVSLS+FYN TIV+CP C+CGC+    +PGS   
Sbjct  207   RVTQALMSWNVTCTYSQFLAQKTPTCCVSLSSFYNDTIVNCPTCSCGCQNNITRPGSC--  264

Query  954   LKAGEQPPVVQLQHYEPP----QAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNF  1121
                 +  P +Q     P     Q +VQCT HMCPIR+HWHVKL+Y  +WRVK+TITN+N+
Sbjct  265   --VNDNSPYLQSAINGPGKLTGQPLVQCTSHMCPIRIHWHVKLNYKDYWRVKVTITNFNY  322

Query  1122  AKNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGD-INDTGMFYGIQYYNDVLLQAGEGG  1298
               N++ WNLV  HPN  N+T++FSFNY+ L  YG  INDT MF+G+++YND+L QAG  G
Sbjct  323   RMNYTDWNLVAQHPNFDNITKLFSFNYKPLTPYGGRINDTAMFWGMKFYNDLLNQAGPLG  382

Query  1299  NVQTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             N Q+ELLM KD  TFTF++GWAFPRR+ FNG+ CV+P PDDYP LP+++P
Sbjct  383   NAQSELLMRKDSETFTFQKGWAFPRRVYFNGDNCVMPSPDDYPWLPSASP  432



>gb|AAM67179.1| phytochelatin synthetase-like protein [Arabidopsis thaliana]
Length=441

 Score =   457 bits (1175),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 220/404 (54%), Positives = 285/404 (71%), Gaps = 14/404 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDP G+ITIKWDI+       V  V+I+N+Q YRHI+ PGW+L W W    VIW 
Sbjct  27    EAYDALDPYGNITIKWDIMSWTGDGYVAVVTIFNFQQYRHIEAPGWQLGWSWMKKEVIWS  86

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G +ATEQG+CS FK G  PHCC+K P I+DLLPGT +N+Q  NCC+GGV+S+  QDP 
Sbjct  87    MVGGQATEQGDCSKFK-GNIPHCCKKTPAIVDLLPGTPYNQQISNCCRGGVISAWAQDPA  145

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +++FQ+S+G+  + +++  A        N TL  PG  YTCG A  V P++F+    R
Sbjct  146   TAISSFQISVGQSGTTNTTVRAPR------NITLKAPGPGYTCGPAKLVKPSRFISADKR  199

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCL--  956
             R TQ++ TWNITC+YSQF A+ +PTCCVSLS FYN+TIV CP C+CGC+    +  C+  
Sbjct  200   RKTQSLLTWNITCTYSQFLARKTPTCCVSLSAFYNETIVPCPTCSCGCQNSSQAGTCVDP  259

Query  957   KAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFS  1136
             K     P +   + EP   ++QCTQHMCPIRVHWHVK SY ++WRVK+ ITN+N+  N+S
Sbjct  260   KIASVVPALGKNNLEP---LLQCTQHMCPIRVHWHVKTSYKEYWRVKVAITNFNYNMNYS  316

Query  1137  QWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTEL  1316
             QWNLV  HPN  N+T++FSFNY+ LN Y +INDT M +GI++YND L QAG  GNVQ+EL
Sbjct  317   QWNLVFQHPNFDNLTQLFSFNYKPLNPYLNINDTAMLWGIKFYNDFLSQAGPVGNVQSEL  376

Query  1317  LMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             L  K+P  FTF +GWAFPRRI FNG+ CV+P PD YP LPN++P
Sbjct  377   LFQKNPLEFTFEKGWAFPRRIYFNGDNCVMPPPDSYPWLPNASP  420



>ref|XP_009782894.1| PREDICTED: protein COBRA-like [Nicotiana sylvestris]
Length=452

 Score =   457 bits (1176),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 219/408 (54%), Positives = 285/408 (70%), Gaps = 19/408 (5%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             D +D LDPNG+ITIKWD+I       V  V+++N+Q YRHI  PGW L W W    VIW+
Sbjct  30    DAFDALDPNGNITIKWDVISWTPDGYVAVVTMFNFQQYRHIQAPGWTLGWTWAKKEVIWN  89

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ TEQG+CS FK G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGV++S  QD  
Sbjct  90    MMGAQTTEQGDCSKFK-GNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVINSWGQDTA  148

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +++FQ+S+G   + + +           NFTL  PG  YTCG A  V PTKFV   GR
Sbjct  149   TAVSSFQVSVGAAGTTNKTVRVPK------NFTLKAPGPGYTCGPAKIVKPTKFVTQDGR  202

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKA  962
             R TQA+ TWN+TC+YSQF AQ +PTCCVS+S+FYN TIV CP CTCGC+           
Sbjct  203   RVTQAMMTWNVTCTYSQFLAQKTPTCCVSISSFYNDTIVPCPTCTCGCQKNGTQHGNCVD  262

Query  963   GEQPPVVQL-------QHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNF  1121
              ++P +  +         Y P   +VQCT HMCPIR+HWHVKL+Y ++WRVK+TITN+N+
Sbjct  263   QDEPHLASVVSDHGKKNTYAP---LVQCTNHMCPIRIHWHVKLNYKEYWRVKVTITNFNY  319

Query  1122  AKNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGN  1301
               N++QWNLVV HPN  N+T++FSFNY++L  YG INDT M +G+++YND+L+QAG  GN
Sbjct  320   NMNYTQWNLVVQHPNFDNLTQLFSFNYKSLTPYGAINDTAMLWGMKFYNDLLMQAGPLGN  379

Query  1302  VQTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             VQ+ELL  KD +TFTF +GWAFPRR+ FNG+ CV+P PD YP +PN+ 
Sbjct  380   VQSELLFRKDLSTFTFDKGWAFPRRVYFNGDNCVMPPPDSYPYMPNAG  427



>ref|XP_011085598.1| PREDICTED: COBRA-like protein 4 [Sesamum indicum]
Length=431

 Score =   456 bits (1173),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 219/407 (54%), Positives = 290/407 (71%), Gaps = 18/407 (4%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             D YDPLDPNG+ITIKWDI+       V  V++ N+Q+YRHI  PGW + W W    VIW 
Sbjct  18    DAYDPLDPNGNITIKWDIMSWTPDGYVAVVTMNNFQMYRHIMSPGWTVGWTWAKKEVIWS  77

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ TEQG+CS FK G  PHCC+K+P ++DLLPG  +N+QF NCCKGGVL++  QDP+
Sbjct  78    MVGAQTTEQGDCSKFK-GNIPHCCKKDPTVVDLLPGAPYNQQFSNCCKGGVLAAWAQDPQ  136

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTL--GVPGYTCGEAFEVPPTKFVEDHGR  782
               ++AFQ+S+G+  + + +           NFTL    PGYTCG A  VPPT F+    R
Sbjct  137   ASVSAFQVSVGQAGTTNKTVKLPK------NFTLLGPGPGYTCGPAKVVPPTNFLTPDRR  190

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKA  962
             R TQA+ TWN+TC+YSQF AQ  P+CCVS S+FYN+TI+ CP C CGCE +    KC+K 
Sbjct  191   RKTQALMTWNVTCTYSQFIAQKHPSCCVSFSSFYNETIIPCPSCACGCENK---DKCIKR  247

Query  963   GEQPPVVQLQHYEPPQA----IVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKN  1130
               +  ++ +     P+     ++QCT HMCP+RVHWHVK++Y  +WRVKI ITN+N+  N
Sbjct  248   DSK--LLSVVGVNTPRKDNTPLLQCTHHMCPVRVHWHVKVNYKDYWRVKIAITNFNYRMN  305

Query  1131  FSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQT  1310
             ++QW LVV HPNL NVT+VFSF+Y+ L  YG INDTGMFYG+++YN++ ++AG  GN+Q+
Sbjct  306   YTQWTLVVQHPNLNNVTQVFSFDYKPLVPYGSINDTGMFYGMKFYNELFMEAGPFGNLQS  365

Query  1311  ELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAPP  1451
             E+L+ KD  TFT ++GWAFPR++ FNG+EC+LP PD YP LPNSA P
Sbjct  366   EVLLQKDINTFTLKQGWAFPRKVYFNGDECMLPPPDSYPFLPNSAHP  412



>ref|XP_009776823.1| PREDICTED: protein COBRA-like [Nicotiana sylvestris]
Length=452

 Score =   457 bits (1175),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 219/408 (54%), Positives = 285/408 (70%), Gaps = 19/408 (5%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             D +D LDPNG+ITIKWD+I       V  V+++N+Q YRHI  PGW L W W    VIW+
Sbjct  30    DAFDALDPNGNITIKWDVISWTPDGYVAVVTMFNFQQYRHIQAPGWTLGWTWAKKEVIWN  89

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ TEQG+CS FK G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGV++S  QD  
Sbjct  90    MMGAQTTEQGDCSKFK-GNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVINSWGQDTA  148

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +++FQ+S+G   + + +           NFTL  PG  YTCG A  V PTKFV   GR
Sbjct  149   TAVSSFQVSVGAAGTTNKTVRVPK------NFTLKAPGPGYTCGPAKIVKPTKFVTQDGR  202

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKA  962
             R TQA+ TWN+TC+YSQF AQ +PTCCVS+S+FYN TIV CP CTCGC+           
Sbjct  203   RVTQAMMTWNVTCTYSQFLAQKTPTCCVSISSFYNDTIVPCPTCTCGCQKNGTQHGNCVD  262

Query  963   GEQPPVVQL-------QHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNF  1121
              ++P +  +         Y P   +VQCT HMCPIR+HWHVKL+Y ++WRVK+TITN+N+
Sbjct  263   QDEPHLASVVSDHGKKNTYAP---LVQCTNHMCPIRIHWHVKLNYKEYWRVKVTITNFNY  319

Query  1122  AKNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGN  1301
               N++QWNLVV HPN  N+T++FSFNY++L  YG INDT M +G+++YND+L+QAG  GN
Sbjct  320   NMNYTQWNLVVQHPNFDNLTQLFSFNYKSLTPYGAINDTAMLWGMKFYNDLLMQAGPLGN  379

Query  1302  VQTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             VQ+ELL  KD +TFTF +GWAFPRR+ FNG+ CV+P PD YP +PN+ 
Sbjct  380   VQSELLFRKDLSTFTFDKGWAFPRRVYFNGDNCVMPPPDSYPYMPNAG  427



>ref|XP_007155211.1| hypothetical protein PHAVU_003G183000g [Phaseolus vulgaris]
 gb|ESW27205.1| hypothetical protein PHAVU_003G183000g [Phaseolus vulgaris]
Length=454

 Score =   457 bits (1175),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 220/402 (55%), Positives = 282/402 (70%), Gaps = 11/402 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDP G+ITIKWD+I       +  V++YN+Q YRHI+ PGW L W W    VIW+
Sbjct  36    EAYDALDPTGNITIKWDVISWTPDGYMAVVTMYNFQQYRHIEAPGWILGWTWAKKEVIWN  95

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             + G + TEQG+CS FK G  PHCC+K+P I+DLLPG+ +N+Q  NCC GGVL+S  QDPE
Sbjct  96    VMGGQTTEQGDCSRFK-GNIPHCCKKDPTIVDLLPGSPYNQQIANCCTGGVLTSWAQDPE  154

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +++FQ+S+G   + + +           NFTL  PG  YTCG A  V PTKF+    R
Sbjct  155   HAISSFQLSVGSAGTTNKTVKLPR------NFTLKAPGPGYTCGPAKIVKPTKFITKDKR  208

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCL--  956
             R+TQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN TIV+CP CTCGC+ +   + C+  
Sbjct  209   RSTQALMTWNVTCTYSQFLAQKTPTCCVSLSSFYNSTIVNCPTCTCGCQNRTEPSSCVDP  268

Query  957   KAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFS  1136
              +     VV          +V+CT HMCPIRVHWHVKL Y ++WR+KITITN+N+  N+S
Sbjct  269   NSPHLASVVSPPGKSINTPLVRCTNHMCPIRVHWHVKLQYKEYWRIKITITNFNYVVNYS  328

Query  1137  QWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTEL  1316
             QWNLVV HPN  NVT+VFSFNY+ L  Y  +NDTGM +G+++YND+L  AG  GNVQ+EL
Sbjct  329   QWNLVVQHPNFDNVTQVFSFNYKPLTPYVGLNDTGMLWGVKFYNDLLTSAGPFGNVQSEL  388

Query  1317  LMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNS  1442
             L  KD +TFTF +GWAFPRRI FNG+ CV+P PD YP LPN+
Sbjct  389   LFRKDKSTFTFDKGWAFPRRIYFNGDNCVMPPPDAYPWLPNA  430



>ref|XP_006345208.1| PREDICTED: protein COBRA-like, partial [Solanum tuberosum]
Length=451

 Score =   457 bits (1175),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 217/404 (54%), Positives = 283/404 (70%), Gaps = 12/404 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             D YD LDPNG+IT+KWDI        +  V+IYN+Q YRHI  PGW+L W W    +IW 
Sbjct  36    DAYDSLDPNGNITVKWDIKSWTPDGYIAIVTIYNFQKYRHIQAPGWQLGWTWAKKEIIWS  95

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
               G +ATEQG+CS FK G  PHCC+++P I+DLLPGT +N+Q  NCC+GGV+SS  QDPE
Sbjct  96    AAGGQATEQGDCSKFK-GSIPHCCKRDPFIVDLLPGTPYNQQVSNCCRGGVISSWVQDPE  154

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
             K ++AFQ+++G+  + + +           NFTL  PG  YTCG A +  PTKF+   GR
Sbjct  155   KAVSAFQITVGQAGTSNKTVRLPK------NFTLKAPGHGYTCGPAMKGKPTKFLTPDGR  208

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG---QPGSAKC  953
             R TQA+ TWN+ C+YSQF AQ +PTCCVSLS+FYN TI++CP CTCGC+    QPG+   
Sbjct  209   RFTQALMTWNVICTYSQFLAQRTPTCCVSLSSFYNNTIINCPTCTCGCQNNITQPGTCVE  268

Query  954   LKAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
               +      +     +    +V+CT+HMCPIRVHWH+K +Y  +WRVKITITN+N+  N+
Sbjct  269   PDSPYLASTLLSSGKDDDSPVVRCTKHMCPIRVHWHIKTNYKAYWRVKITITNFNYKMNY  328

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             SQWNLVV HP+  N+T++FSFNY  L  YG INDT MF+GIQYYND L+Q G  GNVQ+E
Sbjct  329   SQWNLVVQHPSFENLTQIFSFNYEPLLPYGSINDTAMFWGIQYYNDQLMQGGPSGNVQSE  388

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             +++ KD   FTF +GWAFPR++ FNG+ CV+P PD YP LPN++
Sbjct  389   IILQKDKLKFTFEKGWAFPRKVYFNGDNCVMPPPDAYPYLPNAS  432



>ref|XP_010551800.1| PREDICTED: COBRA-like protein 1 isoform X2 [Tarenaya hassleriana]
Length=450

 Score =   457 bits (1175),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 219/405 (54%), Positives = 281/405 (69%), Gaps = 16/405 (4%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDM  431
              YD LDP G+ITIKWDI+       V  V+IYN+Q YRHI  PGW L W W    VIW M
Sbjct  30    AYDALDPFGNITIKWDIMTWTADGYVAVVTIYNFQQYRHIQAPGWSLGWTWAKREVIWGM  89

Query  432   WGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEK  611
              G + TEQG+CS FK G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGV++S  QDP  
Sbjct  90    NGGQTTEQGDCSRFK-GNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVINSWAQDPAT  148

Query  612   YLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGRR  785
              +AAFQ+++G+  + + +           NFTL  PG  YTCG    + P++F+    RR
Sbjct  149   AVAAFQLTVGQAGTTNKTVRVPK------NFTLKAPGPGYTCGAGNIIKPSRFISPDKRR  202

Query  786   TTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCL--K  959
              TQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN TIVSCP C+CGC   P S  C+  K
Sbjct  203   VTQALMTWNVTCTYSQFLAQKTPTCCVSLSSFYNNTIVSCPTCSCGCRKTPQSGTCVDPK  262

Query  960   AGEQPPVVQ---LQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKN  1130
                   V+Q      Y PP  +VQCT HMCPIR+HWHVK++Y ++WRVKI+ITN+N+  N
Sbjct  263   GPRIASVIQSPGKNAYIPP--LVQCTNHMCPIRIHWHVKVNYKEYWRVKISITNFNYIMN  320

Query  1131  FSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQT  1310
             +SQWN+VV HPN  N+T+ FSFN + L  Y  INDT + +G++YYND+L+ AG  GNVQ+
Sbjct  321   YSQWNVVVQHPNFDNLTKTFSFNSKPLTPYASINDTAILWGVKYYNDLLMHAGPSGNVQS  380

Query  1311  ELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             ELL  KDP++FT  +GWAFPRRI FNG+ CV+P PD YP LPN++
Sbjct  381   ELLFQKDPSSFTLEKGWAFPRRIYFNGDNCVMPPPDSYPWLPNTS  425



>ref|XP_007032845.1| COBRA-like protein 1 precursor [Theobroma cacao]
 gb|EOY03771.1| COBRA-like protein 1 precursor [Theobroma cacao]
Length=455

 Score =   457 bits (1175),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 225/409 (55%), Positives = 288/409 (70%), Gaps = 23/409 (6%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YDPLDPNG+ITIKWDI+       V  V+IYN+Q YRHI  PGW L W+W    VIW 
Sbjct  35    EAYDPLDPNGNITIKWDIMSWTPDGYVAVVTIYNFQQYRHIQSPGWTLGWKWAKKEVIWG  94

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G + TEQG+CS FK G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGVL+S  QDP 
Sbjct  95    MMGGQTTEQGDCSRFK-GNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVLNSWVQDPA  153

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                ++FQ+S+G+  + + +           NFTL  PG  YTCG A  V P++FV    R
Sbjct  154   AAASSFQVSVGQAGTTNKTVRVPK------NFTLKAPGPGYTCGPAKIVKPSRFVSPDKR  207

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCE--GQPGSAKCL  956
             R TQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN TIV CP C+CGC+   QPGS  CL
Sbjct  208   RVTQALMTWNVTCTYSQFLAQKTPTCCVSLSSFYNDTIVPCPQCSCGCQNTSQPGS--CL  265

Query  957   KAGEQPPVVQL------QHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYN  1118
                E P +  +        Y P   +VQCT HMCP+R+HWHVKL+Y ++WRVKI+ITN+N
Sbjct  266   DP-ETPHIASVIPSTGKNSYTP---LVQCTSHMCPVRIHWHVKLNYKEYWRVKISITNFN  321

Query  1119  FAKNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGG  1298
             +  N++ WNLVV HPN  N+T++FSFNY+++  Y  INDT M +G+++YND+L QAG  G
Sbjct  322   YNMNYTLWNLVVQHPNFDNLTQIFSFNYKSITPYAAINDTAMLWGVKFYNDLLSQAGPLG  381

Query  1299  NVQTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             NVQ+ELL  KD +TFTF +GWAFPRRI FNG+ CV+P PD YP LPN++
Sbjct  382   NVQSELLFRKDKSTFTFEKGWAFPRRIYFNGDICVMPPPDAYPWLPNAS  430



>gb|EMT17778.1| hypothetical protein F775_25414 [Aegilops tauschii]
Length=447

 Score =   456 bits (1174),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 225/411 (55%), Positives = 288/411 (70%), Gaps = 21/411 (5%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDPNG+ITIKWD+ E      V  V+IYNYQ +RHI  PGW+L W W    VIW 
Sbjct  24    EAYDSLDPNGNITIKWDLKEWTPDGYVAMVTIYNYQQFRHISAPGWQLGWTWAKKEVIWS  83

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ TEQG+CS FK+   PHCC+++P +IDLLPGT +  Q  NCCKGGV+S+  QDP 
Sbjct  84    MVGAQTTEQGDCSKFKTNP-PHCCKRDPTVIDLLPGTPYKDQVANCCKGGVISTFNQDPA  142

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                ++FQ+S+G   + + +           NFTL  PG  YTCG A  V PTKF+   GR
Sbjct  143   NAASSFQISVGLAGTTNKTVKVPK------NFTLKTPGPGYTCGRATVVRPTKFLMGDGR  196

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG---QPGSAKC  953
             RTTQA+ TWN+TC+YSQF AQ +PTCCV+LS+FYN TIV CP C+CGC+     PGS  C
Sbjct  197   RTTQALMTWNVTCTYSQFLAQKTPTCCVALSSFYNNTIVGCPTCSCGCQNNNTHPGS--C  254

Query  954   LKAGEQPPVVQLQHYEPP----QAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNF  1121
             +      P +Q     P     Q +VQCT HMCP++VHWHVKL+Y  +WRVK+TITN+N+
Sbjct  255   VNPNS--PYLQSAIDGPGKYTGQPLVQCTSHMCPVKVHWHVKLNYKDYWRVKVTITNFNY  312

Query  1122  AKNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGD-INDTGMFYGIQYYNDVLLQAGEGG  1298
               N++ WNLVV HPN  N+T++FSFNY+ L+ YG  IND+ MF+G+++YND+L QAG  G
Sbjct  313   RMNYTDWNLVVQHPNFNNITKLFSFNYKPLSPYGGRINDSAMFWGMKFYNDLLNQAGPFG  372

Query  1299  NVQTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAPP  1451
             N QTE+L+ KDP TFTF +GWAFPRR+ FNG+ CV+P PD YP LPN++PP
Sbjct  373   NAQTEILLQKDPETFTFEKGWAFPRRVYFNGDNCVMPPPDAYPWLPNASPP  423



>ref|XP_003581468.2| PREDICTED: COBRA-like protein 7 [Brachypodium distachyon]
Length=522

 Score =   459 bits (1181),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 221/403 (55%), Positives = 268/403 (67%), Gaps = 13/403 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             D YDPLDP+G+ITI WD    +     V  SI+NYQLYRHI+ PGW+L W W G+ +IW+
Sbjct  101   DAYDPLDPHGNITINWDFQAIDTGGYTVMASIHNYQLYRHIERPGWRLGWAWSGNEIIWE  160

Query  429   MWGAEATEQGNCSAFKS----GQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMT  596
              WG E TEQG CS        G  PHCCEK PV++DL PG    KQ  NCC+GGVLSS+T
Sbjct  161   TWGGETTEQGKCSGVHGSGPGGAAPHCCEKRPVMVDLPPGAPVKKQVANCCRGGVLSSLT  220

Query  597   QDPEKYLAAFQMsigrvssksssgaavaappipgNFTLGVPGYTCGEAFEVPPTKFVEDH  776
             Q+    +AAFQM +      +             NF++GVPGYTC    +VP T+ + D 
Sbjct  221   QNNRTAVAAFQMYVNGFDHDARGNPEKPV-----NFSIGVPGYTCSNVSDVPATRSMVD-  274

Query  777   GRRTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCL  956
             G+R  Q + TW I CSYSQFR   SP+CCVSLS+FYN TIV CP C+CGC+G   +  CL
Sbjct  275   GQRHVQVLMTWQIICSYSQFRDGPSPSCCVSLSSFYNNTIVGCPQCSCGCQGSASAPHCL  334

Query  957   KAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFS  1136
               GEQ     L    PP  +V+CT HMCPIRVHWHVK +Y  +WRVK TITNYN   N+S
Sbjct  335   SGGEQSKAQALPDGGPPAPLVRCTDHMCPIRVHWHVKQNYKAYWRVKATITNYNLVSNYS  394

Query  1137  QWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTEL  1316
              WNLVV HPNL ++T++FSFNY  L QYG INDTGMF+GIQ YN +LLQ    GNVQTE+
Sbjct  395   DWNLVVRHPNLRSLTQLFSFNYEPLIQYGAINDTGMFWGIQNYNQMLLQ---DGNVQTEM  451

Query  1317  LMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             ++ KD   FTF  GWAFPRR+ F+G EC +P PD YP LPN+A
Sbjct  452   ILKKDVGDFTFSGGWAFPRRVYFDGHECAMPSPDQYPALPNAA  494



>ref|XP_008374650.1| PREDICTED: protein COBRA-like [Malus domestica]
Length=456

 Score =   456 bits (1174),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 219/405 (54%), Positives = 281/405 (69%), Gaps = 12/405 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDPNG+ITIKWD+I       V  V+++N+Q YRHI  PGW L W W    VIW 
Sbjct  35    EAYDALDPNGNITIKWDVISWTPDGYVAVVTMFNFQQYRHIQAPGWTLGWTWAKKEVIWS  94

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ATEQG+CS +K G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGV+ S  QDP+
Sbjct  95    MVGAQATEQGDCSKYK-GNVPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVMQSWIQDPD  153

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +++FQ+S+G   + + +           NFTL  PG  Y+CG A  V PT+F+    R
Sbjct  154   NAISSFQISVGAAGTTNKTVRLPK------NFTLKAPGPGYSCGIAKIVKPTRFLTSDKR  207

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQ---PGSAKC  953
             R TQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN+TIVSCP C CGC+     PGS   
Sbjct  208   RWTQAMMTWNVTCTYSQFLAQKTPTCCVSLSSFYNQTIVSCPTCACGCQNNATDPGSCVE  267

Query  954   LKAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
                      V          +VQCT HMCPIRVHWHVKL+Y ++WRVK+TITN+N+  N+
Sbjct  268   PNNPYLASAVSGSGKSTNTPLVQCTSHMCPIRVHWHVKLNYKEYWRVKVTITNFNYRMNY  327

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             + WNLVV HPN  N+T++FSFNY++L  Y  +NDT M +G+++YND L QAG  GNVQ+E
Sbjct  328   TLWNLVVQHPNFDNLTKIFSFNYKSLTPYVGLNDTAMLWGVKFYNDFLSQAGPLGNVQSE  387

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             LL  KD +TFTF +GWAFPRRI FNG+ CV+P PD YP LPN++P
Sbjct  388   LLFRKDTSTFTFEKGWAFPRRIYFNGDNCVMPPPDSYPWLPNASP  432



>ref|XP_002884308.1| phytochelatin synthetase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60567.1| phytochelatin synthetase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=451

 Score =   456 bits (1174),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 224/406 (55%), Positives = 283/406 (70%), Gaps = 16/406 (4%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YDPLDP G+IT+KWDII       V TV+IYN+Q YRHI  PGW L W W    VIW 
Sbjct  31    EAYDPLDPTGNITVKWDIITWTGDGYVATVTIYNFQQYRHIQAPGWTLGWSWAKREVIWG  90

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G + TEQG+CS FK G  PHCC+K P ++DLLPGT +N+Q  NCC+GGVL+S  QD  
Sbjct  91    MNGGQTTEQGDCSKFK-GNIPHCCKKTPSVVDLLPGTPYNQQIANCCRGGVLNSWAQDSA  149

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               ++AFQ++IG+  + + +           NFTL  PG  YTC  A  V PT+F+    R
Sbjct  150   TAVSAFQLTIGQAGTTNKTVRVPK------NFTLKAPGPGYTCSPAKIVKPTRFIGTDKR  203

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCE--GQPGSA---  947
             R TQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN TIVSCP C+CGC    QPG+    
Sbjct  204   RVTQALMTWNVTCTYSQFLAQKTPTCCVSLSSFYNSTIVSCPTCSCGCRNTSQPGNCVDP  263

Query  948   KCLKAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAK  1127
             K  +     P      Y PP  +VQCT+HMCP+R+HWHVK++Y Q+WRVK+TITN+N+  
Sbjct  264   KGPRIASVIPNPGKNAYIPP--LVQCTKHMCPVRIHWHVKVNYKQYWRVKVTITNFNYNM  321

Query  1128  NFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQ  1307
             N+SQWNLVV HPN  N+T+ FSFNY+ L  Y  INDTG+ +GI++YND+L+QAG  GNVQ
Sbjct  322   NYSQWNLVVQHPNFDNLTQTFSFNYKPLTPYASINDTGILWGIKFYNDLLMQAGPFGNVQ  381

Query  1308  TELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             +ELL  K+ + FTF +GWAFPRRI FNG+ CV+P PD YP LPN+ 
Sbjct  382   SELLFQKEASAFTFEKGWAFPRRIYFNGDNCVMPPPDSYPWLPNTG  427



>emb|CDY31063.1| BnaA08g26130D [Brassica napus]
Length=434

 Score =   456 bits (1172),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 224/400 (56%), Positives = 282/400 (71%), Gaps = 13/400 (3%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDM  431
             G+DPLDP G + IKWD+++ +  +  V V I N Q YRH++ PGWKLSW W    VIWDM
Sbjct  21    GFDPLDPYGEMIIKWDLLQSSPGHHTVLVKIENKQEYRHVEKPGWKLSWHWVNKTVIWDM  80

Query  432   WGAEATEQGNCSAFKSGQR-PHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
              GAE TEQGNCSAF + +  PHCC + P I+DLLPG  FN Q  NCC+GGVL+SM+QD  
Sbjct  81    RGAETTEQGNCSAFAASETLPHCCLRRPTIVDLLPGAPFNMQVSNCCRGGVLTSMSQDRI  140

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPGYTCGEAFEVPPTKFVEDHGRRT  788
              Y++AF M+IG           +       +F +GVPGYTCG A  V PTK+  D GRR 
Sbjct  141   NYVSAFHMTIGSFPDDDPGEFTMPY-----DFDIGVPGYTCGNATSVDPTKYSTDKGRRK  195

Query  789   TQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAGE  968
             TQA+ TW   C YSQ ++  SP CCVSLS FY + IV CP C+        S+ C+K GE
Sbjct  196   TQALATWEAECVYSQTKSSQSPKCCVSLSAFYYQNIVPCPTCS----CGCSSSNCVKPGE  251

Query  969   QPPVVQLQH--YEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQW  1142
              PP+++ +H  +     +VQCT+HMCPI +HWHVK++Y ++WRVKIT TN N  KN+S W
Sbjct  252   MPPILEQKHDPHVEVSPLVQCTKHMCPIHIHWHVKVNYKKYWRVKITATNLNTMKNYSDW  311

Query  1143  NLVVLHPNLGNVTRVFSFNYRTLNQ-YGDINDTGMFYGIQYYNDVLLQAGEGGNVQTELL  1319
             NLVVLHPNL NVT+VFSFNY+ +   +  INDTGMF+G+++YNDVLLQAGE GNVQTE+L
Sbjct  312   NLVVLHPNLNNVTQVFSFNYKPMTPLHKSINDTGMFWGLKFYNDVLLQAGEFGNVQTEIL  371

Query  1320  MNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPN  1439
             + KD  +FTF++GW FPRRI FNG+ECV+P PDDYPRLPN
Sbjct  372   LEKDMGSFTFKDGWGFPRRILFNGDECVMPSPDDYPRLPN  411



>ref|XP_004236067.1| PREDICTED: COBRA-like protein 1 [Solanum lycopersicum]
Length=458

 Score =   456 bits (1174),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 216/404 (53%), Positives = 283/404 (70%), Gaps = 12/404 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             D YD LDPNG+IT+KWDI        +  V+IYN+Q+YRHI+ PGW+L W W    +IW 
Sbjct  36    DAYDTLDPNGNITVKWDIKSWTTDGYMAIVTIYNFQMYRHIEAPGWQLGWTWTKKEIIWS  95

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
               G +ATE+G+CS FK    PHCC+++P I+DLLPGT +N+Q  NCC+GGV+SS  QDPE
Sbjct  96    AVGGQATEEGDCSKFKE-NIPHCCKRDPSIVDLLPGTPYNQQISNCCRGGVISSWVQDPE  154

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               ++AFQ+++G   + + +           NFTL  PG  YTCG A +  PTKF+   GR
Sbjct  155   NAVSAFQLTVGLAGTSNKTVRLPK------NFTLQTPGHGYTCGPAVKGKPTKFLTPDGR  208

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG---QPGSAKC  953
             R TQA+ TWN+ C+YSQF AQ +PTCCVSLS+FYN TI++CP CTCGC+    QPG+   
Sbjct  209   RFTQALMTWNVICTYSQFLAQRTPTCCVSLSSFYNNTIINCPTCTCGCQNNITQPGTCVE  268

Query  954   LKAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
               +      +     +    +V+CT+HMCPIRVHWH+K +Y  +WRVKITITN+N+  N+
Sbjct  269   PDSPYLASTLLSSGKDDDSPVVRCTKHMCPIRVHWHIKSNYKAYWRVKITITNFNYKMNY  328

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             SQWNLVV HPN  N+T++FSFNY  L  YG INDT MF+GIQYYND L+QAG  GNVQ+E
Sbjct  329   SQWNLVVQHPNFENLTQIFSFNYEPLLPYGSINDTAMFWGIQYYNDQLMQAGPSGNVQSE  388

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             ++  KD + FTF +GWAFPR++ FNG+ CV+P PD YP LPN++
Sbjct  389   IIFQKDKSKFTFEKGWAFPRKVYFNGDNCVMPPPDAYPYLPNAS  432



>ref|XP_009589606.1| PREDICTED: COBRA-like protein 4 [Nicotiana tomentosiformis]
Length=434

 Score =   455 bits (1171),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 224/404 (55%), Positives = 287/404 (71%), Gaps = 18/404 (4%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDM  431
              YDPLDPNG+ITIKWD++       V  V++ N+Q+YRHI  PGW L W W    VIW M
Sbjct  21    AYDPLDPNGNITIKWDVMSWTPDGYVAVVTMNNFQMYRHIMTPGWTLGWTWAKKEVIWTM  80

Query  432   WGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEK  611
              GA+ATEQG+CS FK G  PHCC+K P I+D+LPG  +N+QF NCCKGGVL+S  QDP+ 
Sbjct  81    VGAQATEQGDCSKFK-GNVPHCCKKTPTIVDMLPGVPYNQQFTNCCKGGVLASWGQDPQA  139

Query  612   YLAAFQMsigrvssksssgaavaappipgNFTL--GVPGYTCGEAFEVPPTKFVEDHGRR  785
              ++AFQ+S+G+  + + +           NFTL    PGYTCG A  VP TKF     RR
Sbjct  140   SVSAFQVSVGQAGTSNKTVKLPK------NFTLLGPGPGYTCGPAKIVPSTKFFTPDLRR  193

Query  786   TTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAG  965
              TQA+ TWN+TC+YSQF AQ  P+CCVSLSTFYN+TI  CP C CGCE +    KC+K+ 
Sbjct  194   KTQALMTWNVTCTYSQFIAQKHPSCCVSLSTFYNETITPCPSCACGCENK---HKCIKSD  250

Query  966   EQPPVVQLQHYEPPQA----IVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
              +  ++ +     P+     ++QCT HMCP+RVHWHVKL+Y  +WRVKITITN+N+  N 
Sbjct  251   SK--LLSVVGINTPRKDNSPLLQCTHHMCPVRVHWHVKLNYKDYWRVKITITNFNYRVNH  308

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             +QW LV  HPNL NVT+VFSF+Y+ L  Y  INDTGMFYG+++YND+L++AG  GNVQ+E
Sbjct  309   TQWTLVAQHPNLNNVTQVFSFDYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSE  368

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             +L+ KD  TFTF++GWAFPR++ FNG+EC+LP PD YP LPN A
Sbjct  369   VLLQKDKDTFTFKQGWAFPRKVYFNGDECMLPPPDTYPYLPNFA  412



>gb|AAO86520.1| phytochelatin synthetase [Triticum monococcum]
Length=457

 Score =   456 bits (1173),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 222/410 (54%), Positives = 286/410 (70%), Gaps = 21/410 (5%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDPNG+ITIKWDII       V TV+++NYQ +RHI  PGW+L W W    VIW 
Sbjct  34    EAYDSLDPNGNITIKWDIISWTPDGYVATVTMFNYQQFRHIPAPGWQLGWSWAKKEVIWS  93

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ATEQG+CS FKS   PHCC+++P I+DLLPGT FN+Q  NCCK GV+ +  QDP 
Sbjct  94    MVGAQATEQGDCSKFKSAP-PHCCKRDPTIVDLLPGTPFNQQIANCCKAGVIKTFNQDPG  152

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                ++FQ+S+G   + + +           NFTL  PG  YTCG A    PTK+    GR
Sbjct  153   NAASSFQISVGLAGTTNKTVKMPK------NFTLRAPGPGYTCGRALVGRPTKYYSSDGR  206

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG---QPGSAKC  953
             R TQA+ +WN+TC+YSQF AQ +PTCCVSLS+FYN TIV+CP C+CGC+    +PGS   
Sbjct  207   RVTQALMSWNVTCTYSQFLAQKTPTCCVSLSSFYNDTIVNCPTCSCGCQNNITRPGSC--  264

Query  954   LKAGEQPPVVQLQHYEPP----QAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNF  1121
                 +  P +Q     P     Q +VQCT HMCPIR+HWHVKL+Y  +WRVK+TITN+N+
Sbjct  265   --VNDNSPYLQSAINGPGKLTGQPLVQCTSHMCPIRIHWHVKLNYKDYWRVKVTITNFNY  322

Query  1122  AKNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGD-INDTGMFYGIQYYNDVLLQAGEGG  1298
               N++ WN+V  HPN  N+T++FSFNY+ L  YG  INDT MF+G+++YND+L QAG  G
Sbjct  323   RMNYTDWNMVAQHPNFDNITKLFSFNYKPLTPYGGRINDTAMFWGMKFYNDLLNQAGPLG  382

Query  1299  NVQTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             N Q+ELLM KD  TFTF++GWAFPRR+ FNG+ CV+P PDDYP LP+++P
Sbjct  383   NAQSELLMRKDSETFTFQKGWAFPRRVYFNGDNCVMPSPDDYPWLPSASP  432



>ref|XP_010551799.1| PREDICTED: COBRA-like protein 1 isoform X1 [Tarenaya hassleriana]
Length=502

 Score =   457 bits (1177),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 219/405 (54%), Positives = 281/405 (69%), Gaps = 16/405 (4%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDM  431
              YD LDP G+ITIKWDI+       V  V+IYN+Q YRHI  PGW L W W    VIW M
Sbjct  82    AYDALDPFGNITIKWDIMTWTADGYVAVVTIYNFQQYRHIQAPGWSLGWTWAKREVIWGM  141

Query  432   WGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEK  611
              G + TEQG+CS FK G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGV++S  QDP  
Sbjct  142   NGGQTTEQGDCSRFK-GNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVINSWAQDPAT  200

Query  612   YLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGRR  785
              +AAFQ+++G+  + + +           NFTL  PG  YTCG    + P++F+    RR
Sbjct  201   AVAAFQLTVGQAGTTNKTVRVPK------NFTLKAPGPGYTCGAGNIIKPSRFISPDKRR  254

Query  786   TTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCL--K  959
              TQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN TIVSCP C+CGC   P S  C+  K
Sbjct  255   VTQALMTWNVTCTYSQFLAQKTPTCCVSLSSFYNNTIVSCPTCSCGCRKTPQSGTCVDPK  314

Query  960   AGEQPPVVQ---LQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKN  1130
                   V+Q      Y PP  +VQCT HMCPIR+HWHVK++Y ++WRVKI+ITN+N+  N
Sbjct  315   GPRIASVIQSPGKNAYIPP--LVQCTNHMCPIRIHWHVKVNYKEYWRVKISITNFNYIMN  372

Query  1131  FSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQT  1310
             +SQWN+VV HPN  N+T+ FSFN + L  Y  INDT + +G++YYND+L+ AG  GNVQ+
Sbjct  373   YSQWNVVVQHPNFDNLTKTFSFNSKPLTPYASINDTAILWGVKYYNDLLMHAGPSGNVQS  432

Query  1311  ELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             ELL  KDP++FT  +GWAFPRRI FNG+ CV+P PD YP LPN++
Sbjct  433   ELLFQKDPSSFTLEKGWAFPRRIYFNGDNCVMPPPDSYPWLPNTS  477



>gb|KHN18376.1| Protein COBRA, partial [Glycine soja]
Length=431

 Score =   455 bits (1170),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 220/403 (55%), Positives = 282/403 (70%), Gaps = 11/403 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDP G+ITIKWD+I       +  V++YN+Q YRHI  PGW L W W    VIW+
Sbjct  13    EAYDALDPIGNITIKWDVISWTPDGYIAVVTMYNFQQYRHIQAPGWILGWTWAKKEVIWN  72

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             + G + TEQG+CS FK G  PHCC+K+P ++DLLPGT +N+Q  NCC GGVL+S  QDPE
Sbjct  73    VMGGQTTEQGDCSRFK-GNIPHCCKKDPTVVDLLPGTPYNQQIANCCSGGVLTSWAQDPE  131

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +++FQ+S+G   + + +           NFTL  PG  YTCG A  V PTKF+    R
Sbjct  132   NAISSFQLSVGSAGTTNKTVKLPK------NFTLKAPGPGYTCGPAKIVKPTKFITKDKR  185

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG--QPGSAKCL  956
             RTTQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN T+V+CP CTCGC+   +PGS    
Sbjct  186   RTTQALMTWNVTCTYSQFLAQKTPTCCVSLSSFYNNTVVNCPTCTCGCQNKTEPGSCVDP  245

Query  957   KAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFS  1136
              +     VV          +V+CT HMCPIRVHWHVKL Y ++WRVKITITN+N+  N+S
Sbjct  246   NSPHLASVVSPPGKATNTPLVRCTNHMCPIRVHWHVKLQYKEYWRVKITITNFNYRMNYS  305

Query  1137  QWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTEL  1316
             QWNLVV HPN  NVT+VFSFN++ L  Y  +NDTGM +G+++YND+L  AG  GNVQ+E+
Sbjct  306   QWNLVVQHPNFDNVTQVFSFNFKPLTPYVGLNDTGMLWGVKFYNDLLTSAGPLGNVQSEV  365

Query  1317  LMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             L  KD ++FTF +GWAFPRRI FNG+ CV+P PD YP LPN++
Sbjct  366   LFRKDKSSFTFDKGWAFPRRIYFNGDNCVMPPPDAYPWLPNAS  408



>gb|EAY91898.1| hypothetical protein OsI_13550 [Oryza sativa Indica Group]
 gb|EAZ28622.1| hypothetical protein OsJ_12609 [Oryza sativa Japonica Group]
Length=456

 Score =   456 bits (1172),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 219/407 (54%), Positives = 286/407 (70%), Gaps = 15/407 (4%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDPNG+ITIKWD+++      V  V+++NYQ +RHI  PGW+L W W    VIW 
Sbjct  34    EAYDSLDPNGNITIKWDVMQWTPDGYVAVVTMFNYQQFRHIQAPGWQLGWTWAKKEVIWS  93

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ TEQG+CS FK G  PHCC+K+P I+DLLPGT +N Q  NCCK GV+++  QDP 
Sbjct  94    MVGAQTTEQGDCSKFK-GNPPHCCKKDPTIVDLLPGTPYNMQIANCCKAGVINTFNQDPL  152

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                ++FQ+S+G   + + +           NFTL  PG  YTCG A  V PTKF  + GR
Sbjct  153   NAASSFQISVGLAGTTNKTVKLPK------NFTLKAPGPGYTCGRAMIVRPTKFFTNDGR  206

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKA  962
             R TQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN TIV+CP C+CGC+   G++     
Sbjct  207   RATQALMTWNVTCTYSQFLAQKTPTCCVSLSSFYNDTIVNCPTCSCGCQNN-GTSPGSCV  265

Query  963   GEQPPVVQLQHYEPP----QAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKN  1130
              E  P +Q     P     Q +VQCT HMCPIR+HWHVKL+Y ++WRVK+TITN+N+  N
Sbjct  266   NENSPYLQSAIDGPGKWTGQPLVQCTSHMCPIRIHWHVKLNYKEYWRVKVTITNFNYRMN  325

Query  1131  FSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGD-INDTGMFYGIQYYNDVLLQAGEGGNVQ  1307
             ++QWNLV+ HPN  N+T++FSFNY+ L  YG  INDT MF+G+++YND+L+QAG  GN Q
Sbjct  326   YTQWNLVIQHPNFNNITQLFSFNYKPLTPYGGRINDTAMFWGVKFYNDLLMQAGPLGNAQ  385

Query  1308  TELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             +ELL+ KD   FTF +GWAFP R+ FNG+ CV+P PD YP LPN++P
Sbjct  386   SELLLRKDSMAFTFDKGWAFPHRVYFNGDNCVMPPPDAYPWLPNASP  432



>emb|CDX93481.1| BnaA06g05670D [Brassica napus]
Length=439

 Score =   455 bits (1170),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 229/399 (57%), Positives = 282/399 (71%), Gaps = 14/399 (4%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDM  431
             GYDPLDP G ITIKWD++  +  +  V V + N Q YRHID PGWKLSW W    VIWDM
Sbjct  24    GYDPLDPFGKITIKWDLLLSSPGHHTVQVKLENMQEYRHIDKPGWKLSWHWESKQVIWDM  83

Query  432   WGAEATEQGNCSAF-KSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
              GAE TEQGNCSAF  SG  PHCC + P I+DLLPG+ FN Q  NCC+GGVL+SM+QD  
Sbjct  84    RGAETTEQGNCSAFASSGTLPHCCLRRPTIVDLLPGSPFNSQVSNCCRGGVLTSMSQDHT  143

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPGYTCGEAFEVPPTKFVEDHGRRT  788
              +++ F M+IG     S      +      NF +GVPGY+C  A  V PTK+  D GRR 
Sbjct  144   NHVSVFHMTIGSFPDDSGEFTMPS------NFDIGVPGYSCDNATSVAPTKYSTDKGRRK  197

Query  789   TQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAGE  968
             TQA+ TW   C YSQFR+  +P CCVSLS FY + IV CP C+        S+ C+K GE
Sbjct  198   TQALATWEAVCVYSQFRSSQTPKCCVSLSAFYYRNIVPCPTCS----CGCSSSHCVKPGE  253

Query  969   QPPVVQLQH--YEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQW  1142
              PP ++ +H   E    +V+CT+HMCPI +HWHVK++Y ++WRVKIT TN N  KN++ W
Sbjct  254   MPPYLEQKHDPEEEVPPVVECTKHMCPIHIHWHVKVNYREYWRVKITATNLNTMKNYTDW  313

Query  1143  NLVVLHPNLGNVTRVFSFNYRTLNQYGD-INDTGMFYGIQYYNDVLLQAGEGGNVQTELL  1319
             NLVVLHPNL +V +VFSFNY++L  Y + INDTGMF+G+++YNDVLLQAG+ GNVQTELL
Sbjct  314   NLVVLHPNLKSVEQVFSFNYKSLTPYHNGINDTGMFWGVKFYNDVLLQAGKIGNVQTELL  373

Query  1320  MNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLP  1436
             + KD   F+FREGWAFPRRI FNG+ECV+P PDDYPRLP
Sbjct  374   LKKDMGNFSFREGWAFPRRILFNGDECVMPSPDDYPRLP  412



>ref|XP_009763133.1| PREDICTED: COBRA-like protein 4 [Nicotiana sylvestris]
Length=435

 Score =   455 bits (1170),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 218/404 (54%), Positives = 290/404 (72%), Gaps = 18/404 (4%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDM  431
              +DPLDPNG+ITIKWD++       V  V++ N+Q+YRHI  PGW L W W    VIW M
Sbjct  22    AFDPLDPNGNITIKWDVMSWTPDGYVAVVTMNNFQMYRHIMTPGWTLGWTWAKKEVIWSM  81

Query  432   WGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEK  611
              GA+ TEQG+CS FK G  PHCC+K P ++DLLPG  +N+QF NCCKGGVL+S  QDP+ 
Sbjct  82    VGAQTTEQGDCSKFK-GNIPHCCKKNPTVVDLLPGVPYNQQFTNCCKGGVLASWGQDPQS  140

Query  612   YLAAFQMsigrvssksssgaavaappipgNFTL--GVPGYTCGEAFEVPPTKFVEDHGRR  785
              ++AFQ+S+G+  + + +           NFTL    PGYTCG A  VPPTKF     RR
Sbjct  141   SVSAFQISVGQAGTSNKTVKLPK------NFTLLGPGPGYTCGPAKIVPPTKFFTPDLRR  194

Query  786   TTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAG  965
              TQA+ TWN+TC+YSQF A+  P+CCVSLS+FYN+TI SCP C CGCE +    KC+K+ 
Sbjct  195   KTQALMTWNVTCTYSQFLARKHPSCCVSLSSFYNETITSCPSCACGCENK---HKCIKSD  251

Query  966   EQPPVVQLQHYEPPQA----IVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
              +  ++ +     P+     ++QCT HMCP+RVHWHVKL+Y  +WRVK+++TN+N+  N+
Sbjct  252   SK--LLSVVGINTPRKDNAPLIQCTHHMCPVRVHWHVKLNYKDYWRVKLSVTNFNYRINY  309

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             +QW LVV HPNL NVT+VFSF+Y+ L  Y  INDTGMFYG++++ND+L++AG  GNVQ+E
Sbjct  310   TQWTLVVQHPNLNNVTQVFSFDYKPLVPYQSINDTGMFYGMKFFNDLLMEAGPSGNVQSE  369

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             +L+ KD  TFTF++GWAFPR++ FNG+EC+LP PD YP LP+ A
Sbjct  370   VLLQKDKDTFTFKQGWAFPRKVYFNGDECMLPPPDSYPYLPSFA  413



>ref|XP_002321786.2| phytochelatin synthetase family protein [Populus trichocarpa]
 gb|ABK92936.1| unknown [Populus trichocarpa]
 gb|EEF05913.2| phytochelatin synthetase family protein [Populus trichocarpa]
Length=457

 Score =   456 bits (1172),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 218/405 (54%), Positives = 280/405 (69%), Gaps = 13/405 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDPNG+ITIKWD+I+      V  V++YN+Q YRHI  PGW L W W    VIW+
Sbjct  35    EAYDALDPNGNITIKWDVIQWTPDGYVAVVTMYNFQQYRHIQAPGWTLGWTWAKKEVIWN  94

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ TEQG+CS FK G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGV++S  QDP 
Sbjct  95    MMGAQTTEQGDCSKFK-GNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVINSWAQDPA  153

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +++FQ+S+G   + + +           N TL  PG  YTCG A  V PTKF+    R
Sbjct  154   NAVSSFQISVGAAGTTNKTVRVPK------NITLKAPGPGYTCGPAKIVRPTKFISADKR  207

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKA  962
             R TQA+ TWNITC+YSQF AQ +PTCCVSLS+FYN TIVSCP C CGC+   G+      
Sbjct  208   RITQALMTWNITCTYSQFLAQKTPTCCVSLSSFYNDTIVSCPTCACGCQNTTGAGSGTCV  267

Query  963   GEQPPVVQLQHYEPPQA----IVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKN  1130
                 P +      P ++    +VQCT HMCPIRVHWHVKL+Y ++WRVK+T+TN+N+  N
Sbjct  268   HPDTPHLASVISPPGKSDNTPLVQCTSHMCPIRVHWHVKLNYKEYWRVKVTVTNFNYRMN  327

Query  1131  FSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQT  1310
             +S WN+VV HPN  N+T++FSF Y++L  Y  +NDT M +G+++YND L QAG  GNVQ+
Sbjct  328   YSLWNMVVQHPNFDNLTKIFSFQYKSLTPYEGLNDTAMLWGVKFYNDFLSQAGPLGNVQS  387

Query  1311  ELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             ELL  KD +TFTF +GWAFPRRI FNG+ CV+P PD YP LPN +
Sbjct  388   ELLFRKDKSTFTFEKGWAFPRRIYFNGDNCVMPPPDAYPWLPNDS  432



>ref|XP_011006295.1| PREDICTED: protein COBRA-like [Populus euphratica]
Length=458

 Score =   456 bits (1172),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 222/409 (54%), Positives = 283/409 (69%), Gaps = 20/409 (5%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDPNG+ITIKWD+I+      V  V++YN+Q YRHI  PGW L W W    VIW+
Sbjct  35    EAYDALDPNGNITIKWDVIQWTPDGYVAVVTMYNFQQYRHIQAPGWTLGWTWAKKEVIWN  94

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ TEQG+CS FK G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGV++S  QDP 
Sbjct  95    MMGAQTTEQGDCSKFK-GNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVINSWAQDPA  153

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +++FQ+S+G   + + +           N TL  PG  YTCG A  V PTKF+    R
Sbjct  154   NAVSSFQISVGAAGTTNKTVRVPK------NITLRAPGPGYTCGPAKIVRPTKFISADKR  207

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQ---PGSAKC  953
             R TQA+ TWNITC+YSQF AQ +PTCCVSLS+FYN TIVSCP C CGC+      GS  C
Sbjct  208   RITQALMTWNITCTYSQFLAQKTPTCCVSLSSFYNDTIVSCPTCACGCQNSTTGAGSGTC  267

Query  954   LKAGEQPPVVQLQHYEPP-----QAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYN  1118
             +   + P +  +    PP       +VQCT HMCPIRVHWHVKL+Y ++WRVK+TITN+N
Sbjct  268   VHP-DTPHLASV--ISPPGKSDNTPLVQCTSHMCPIRVHWHVKLNYKEYWRVKVTITNFN  324

Query  1119  FAKNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGG  1298
             +  N+S WN+VV HPN  N+T++FSF Y++L  Y  +NDT M +G+++YND L QAG  G
Sbjct  325   YRMNYSLWNMVVQHPNFDNLTKIFSFQYKSLTPYEGLNDTAMLWGVKFYNDFLSQAGPLG  384

Query  1299  NVQTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             NVQ+ELL  KD +TFTF +GWAFPRRI FNG+ CV+P PD YP LPN +
Sbjct  385   NVQSELLFRKDKSTFTFEKGWAFPRRIYFNGDNCVMPPPDAYPWLPNDS  433



>ref|XP_003550707.1| PREDICTED: protein COBRA-like [Glycine max]
Length=454

 Score =   455 bits (1171),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 220/403 (55%), Positives = 282/403 (70%), Gaps = 11/403 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDP G+ITIKWD+I       +  V++YN+Q YRHI  PGW L W W    VIW+
Sbjct  36    EAYDALDPIGNITIKWDVISWTPDGYIAVVTMYNFQQYRHIQAPGWILGWTWAKKEVIWN  95

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             + G + TEQG+CS FK G  PHCC+K+P ++DLLPGT +N+Q  NCC GGVL+S  QDPE
Sbjct  96    VMGGQTTEQGDCSRFK-GNIPHCCKKDPTVVDLLPGTPYNQQIANCCSGGVLTSWAQDPE  154

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +++FQ+S+G   + + +           NFTL  PG  YTCG A  V PTKF+    R
Sbjct  155   NAISSFQLSVGSAGTTNKTVKLPK------NFTLKAPGPGYTCGPAKIVKPTKFITKDKR  208

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG--QPGSAKCL  956
             RTTQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN T+V+CP CTCGC+   +PGS    
Sbjct  209   RTTQALMTWNVTCTYSQFLAQKTPTCCVSLSSFYNNTVVNCPTCTCGCQNKTEPGSCVDP  268

Query  957   KAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFS  1136
              +     VV          +V+CT HMCPIRVHWHVKL Y ++WRVKITITN+N+  N+S
Sbjct  269   NSPHLASVVSPPGKATNTPLVRCTNHMCPIRVHWHVKLQYKEYWRVKITITNFNYRMNYS  328

Query  1137  QWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTEL  1316
             QWNLVV HPN  NVT+VFSFN++ L  Y  +NDTGM +G+++YND+L  AG  GNVQ+E+
Sbjct  329   QWNLVVQHPNFDNVTQVFSFNFKPLTPYVGLNDTGMLWGVKFYNDLLTSAGPLGNVQSEV  388

Query  1317  LMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             L  KD ++FTF +GWAFPRRI FNG+ CV+P PD YP LPN++
Sbjct  389   LFRKDKSSFTFDKGWAFPRRIYFNGDNCVMPPPDAYPWLPNAS  431



>ref|XP_008464583.1| PREDICTED: COBRA-like protein 1 [Cucumis melo]
Length=455

 Score =   455 bits (1171),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 217/406 (53%), Positives = 284/406 (70%), Gaps = 14/406 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YDPLDPNG+ITIKWD++       V  V++YN+Q YRHI  PGW L W+W    VIW+
Sbjct  31    EAYDPLDPNGNITIKWDVMSWTADGYVAVVTLYNFQQYRHIQTPGWSLQWKWAKKEVIWN  90

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G +ATEQG+CS FK G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGVL+S  QDP 
Sbjct  91    MMGGQATEQGDCSRFK-GNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVLNSWVQDPA  149

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +++FQ+++G   + + +           NFTL  PG  YTCG A  V P+KF     R
Sbjct  150   TAVSSFQLTVGSAGTSNKTVRLPK------NFTLKAPGPGYTCGPAKIVKPSKFKSPDKR  203

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKA  962
             R TQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN TIVSCP C+CGC+    + +    
Sbjct  204   RVTQALMTWNVTCTYSQFLAQKTPTCCVSLSSFYNNTIVSCPKCSCGCQSNLNAPQNCVE  263

Query  963   GEQPPVVQLQHYEPPQA-----IVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAK  1127
                P +  + +           +VQCT HMCPIRVHWHVK++Y ++WRVKITITN+N+  
Sbjct  264   PNSPYLASVVNSASSSKNNLTPLVQCTGHMCPIRVHWHVKINYKEYWRVKITITNFNYMM  323

Query  1128  NFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQ  1307
             N++ WNLVV HPN  N+T++FSFNY+++N YG INDT + +G+++YND+L+QAG  GNVQ
Sbjct  324   NYTNWNLVVQHPNFDNLTQIFSFNYQSINPYGTINDTAILWGVKFYNDLLMQAGPLGNVQ  383

Query  1308  TELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             TELL  KD + FTF +GWAFPRRI FNG+ CV+P P+ YP LPN  
Sbjct  384   TELLFRKDQSDFTFDKGWAFPRRIYFNGDNCVMPPPEAYPYLPNKG  429



>ref|XP_009761753.1| PREDICTED: COBRA-like protein 4 [Nicotiana sylvestris]
Length=434

 Score =   454 bits (1169),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 224/404 (55%), Positives = 285/404 (71%), Gaps = 18/404 (4%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDM  431
              YDPLDPNG+ITIKWD++       V  V+I N+Q+YRHI  PGW L W W    VIW M
Sbjct  21    AYDPLDPNGNITIKWDVMSWTPDGYVAVVTINNFQMYRHIMTPGWTLGWTWAKKEVIWTM  80

Query  432   WGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEK  611
              GA+ TEQG+CS FK G  PHCC+K P  +D+LPG  +N+QF NCCKGGVL+S  QDP+ 
Sbjct  81    VGAQTTEQGDCSKFK-GNVPHCCKKTPTTVDMLPGVPYNQQFTNCCKGGVLASWGQDPQA  139

Query  612   YLAAFQMsigrvssksssgaavaappipgNFTL--GVPGYTCGEAFEVPPTKFVEDHGRR  785
              ++AFQ+S+G+  + + +           NFTL    PGYTCG A  VP TKF     RR
Sbjct  140   SVSAFQVSVGQAGTSNKTVKLPK------NFTLLGPGPGYTCGPAKIVPSTKFFTPDLRR  193

Query  786   TTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAG  965
              TQA+ TWN+TC+YSQF AQ  PTCCVSLSTFYN+TI  CP C CGCE +    KC+K+ 
Sbjct  194   KTQALMTWNVTCTYSQFIAQKHPTCCVSLSTFYNETITPCPSCACGCENK---HKCIKSD  250

Query  966   EQPPVVQLQHYEPPQA----IVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
              +  ++ +     P+     ++QCT HMCP+RVHWHVKL+Y  +WRVKITITN+N+  N 
Sbjct  251   SK--LLSVVGINTPRKDNSPLLQCTHHMCPVRVHWHVKLNYKDYWRVKITITNFNYRVNH  308

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             +QW LV  HPNL NVT+VFSF+Y+ L  Y  INDTGMFYG+++YND+L++AG  GNVQ+E
Sbjct  309   TQWTLVAQHPNLNNVTQVFSFDYKPLVPYQSINDTGMFYGMKFYNDLLMEAGPSGNVQSE  368

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             +L+ KD  TFTF++GWAFPR++ FNG+EC+LP PD YP LPN A
Sbjct  369   VLLQKDKDTFTFKQGWAFPRKVYFNGDECMLPPPDTYPYLPNLA  412



>ref|XP_009600081.1| PREDICTED: COBRA-like protein 4 [Nicotiana tomentosiformis]
Length=435

 Score =   454 bits (1169),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 219/404 (54%), Positives = 289/404 (72%), Gaps = 18/404 (4%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDM  431
              +DPLDPNG+ITIKWD++       V  V++ N+Q+YRHI  PGW L W W    VIW M
Sbjct  22    AFDPLDPNGNITIKWDVMSWTPDGYVAVVTMNNFQMYRHIMTPGWTLGWTWAKKEVIWSM  81

Query  432   WGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEK  611
              GA+ TEQG+CS FK G  PHCC+K P I+DLLPG  +N+QF NCCKGGVL+S  QDP+ 
Sbjct  82    VGAQTTEQGDCSKFK-GNIPHCCKKNPTIVDLLPGVPYNQQFTNCCKGGVLASWGQDPQS  140

Query  612   YLAAFQMsigrvssksssgaavaappipgNFTL--GVPGYTCGEAFEVPPTKFVEDHGRR  785
              ++AFQ+S+G+  + + +           NFTL    PGYTCG A  VPPTKF     RR
Sbjct  141   SVSAFQISVGQAGTSNKTVKLPK------NFTLLGPGPGYTCGPAKIVPPTKFFTPDLRR  194

Query  786   TTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAG  965
              TQA+ TWN+TC+YSQF A+  P CCVSLS+FYN+TI SCP C CGCE +    KC+K+ 
Sbjct  195   KTQALMTWNVTCTYSQFLARKHPNCCVSLSSFYNETITSCPSCACGCENK---HKCIKSD  251

Query  966   EQPPVVQLQHYEPPQA----IVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
              +  ++ +     P+     ++QCT HMCP+RVHWHVKL+Y  +WRVK+++TN+N+  N+
Sbjct  252   SK--LLSVVGINTPRKDNAPLIQCTHHMCPVRVHWHVKLNYKDYWRVKLSVTNFNYRINY  309

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             +QW LVV HPNL NVT+VFSF+Y+ L  Y  INDTGMFYG++++ND+L++AG  GNVQ+E
Sbjct  310   TQWTLVVQHPNLNNVTQVFSFDYKPLVPYQSINDTGMFYGMKFFNDLLMEAGPSGNVQSE  369

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             +L+ KD  TFTF++GWAFPR++ FNG+EC+LP PD YP LP+ A
Sbjct  370   VLLQKDKNTFTFKQGWAFPRKVYFNGDECMLPPPDTYPYLPSFA  413



>gb|KHN30325.1| Protein COBRA [Glycine soja]
Length=448

 Score =   455 bits (1170),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 219/407 (54%), Positives = 280/407 (69%), Gaps = 18/407 (4%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             D YDPLDPNG+ITIKWDII       V  V++ N+Q YRHI  PGW + W W    VIW 
Sbjct  28    DAYDPLDPNGNITIKWDIISWTPDGYVAVVTMNNFQQYRHIASPGWSMGWTWAKKEVIWS  87

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G + TEQG+CS FK G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGVLSS  QDP 
Sbjct  88    MMGGQTTEQGDCSKFKGG-IPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVLSSWVQDPT  146

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +++FQ+S+GR  + + +           NFTL  PG  YTCG A  V PTKF+    R
Sbjct  147   NAVSSFQVSVGRAGTTNRTVKVPK------NFTLKAPGPGYTCGPAKIVAPTKFITSDKR  200

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKA  962
             R TQA+ TWN+TC+YSQF AQ +P+CCVSLS+FYN T+V C  C CGC+     +     
Sbjct  201   RVTQALMTWNVTCTYSQFLAQKTPSCCVSLSSFYNDTLVPCLTCACGCQSNSSQSGTCVD  260

Query  963   GEQPPVVQL------QHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFA  1124
              + P +  +       ++ P   +VQCT HMCP+ +HWHVKL+Y ++WRVK+TITNYN+ 
Sbjct  261   PDTPHLASVVAGSGKNNFSP---LVQCTHHMCPVSIHWHVKLNYKEYWRVKVTITNYNYR  317

Query  1125  KNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNV  1304
              N+S+WN+VV HPN  N+T++FSFNY++L  YG INDT M +G+++YND L QAG  GNV
Sbjct  318   MNYSEWNMVVQHPNFDNLTQLFSFNYKSLTPYGSINDTAMLWGVKFYNDFLNQAGPNGNV  377

Query  1305  QTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             Q+ELL  KD ATFTF +GWAFPRRI FNG+ CV+P PD YP LPN+ 
Sbjct  378   QSELLFRKDKATFTFDKGWAFPRRIYFNGDNCVMPPPDAYPWLPNAG  424



>gb|AFZ78568.1| COBRA-like protein [Populus tomentosa]
Length=453

 Score =   455 bits (1170),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 220/404 (54%), Positives = 277/404 (69%), Gaps = 12/404 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YDPLDP G+ITIKWDII       V  V+IYN+Q YRHI  PGW L W W    VIW 
Sbjct  32    EAYDPLDPTGNITIKWDIISWTADGYVAVVTIYNFQQYRHIQAPGWSLGWTWAKKEVIWS  91

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G +AT+QG+CS FK G  PHCC+K P ++DLLPG  +N+Q  NCCKGGV+SS  QD  
Sbjct  92    MLGGQATDQGDCSKFK-GNIPHCCKKSPTVVDLLPGIPYNQQTANCCKGGVISSWAQDSA  150

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                ++FQ+S+G   + + +           NFTL  PG  YTC  A  V PT+F+    R
Sbjct  151   NAASSFQLSVGSAGTSNKTVRLPK------NFTLKAPGPGYTCARAKIVKPTRFMSTDKR  204

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCE---GQPGSAKC  953
             R TQA+ TWN+TC+YSQF AQ +P+CCVSLS+FYN TIV CP C+CGC+      G    
Sbjct  205   RITQALMTWNVTCTYSQFLAQKTPSCCVSLSSFYNDTIVPCPKCSCGCQRNNSDLGGCVD  264

Query  954   LKAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
               A     VV       P  +VQCT HMCPIRVHWHVKL+Y Q+WRVK+TITN+N+  N+
Sbjct  265   PNAPHLASVVSSLGNNNPMPLVQCTSHMCPIRVHWHVKLNYKQYWRVKVTITNFNYNMNY  324

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             +QWNLVV HPN  N+T++F FNY++L+ Y  INDT M +G+++YND+L+QAG  GNVQ+E
Sbjct  325   TQWNLVVQHPNFDNLTQIFGFNYQSLSPYSAINDTAMLWGVKFYNDLLMQAGPSGNVQSE  384

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             LL  KD +TFTF +GWAFPRRI FNG+ CV+P PD YP LPN++
Sbjct  385   LLFQKDMSTFTFDKGWAFPRRIYFNGDNCVMPPPDAYPWLPNAS  428



>ref|XP_009124784.1| PREDICTED: COBRA-like protein 2 [Brassica rapa]
Length=439

 Score =   454 bits (1169),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 218/402 (54%), Positives = 282/402 (70%), Gaps = 10/402 (2%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDP G+ITIKWDI+       V  V+I+NYQ YRHI+ PGW+L W W    VIW+
Sbjct  25    EAYDALDPTGNITIKWDILSWTPDGYVARVTIFNYQQYRHIESPGWQLGWTWLKKEVIWN  84

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ATEQG+CS FK G  PHCC+K P ++DLLPGT +N Q  NCC+GGV+S+  QD  
Sbjct  85    MVGAQATEQGDCSKFK-GDPPHCCKKTPTVVDLLPGTPYNHQISNCCRGGVVSAWAQDSA  143

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               ++AFQ+S+G+  + +++  A        N TL  PG  YTCG A  V PTKF  D  R
Sbjct  144   TAVSAFQISVGQSGTTNTTVRAPR------NITLKAPGPGYTCGPAKTVAPTKFFSDDKR  197

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKA  962
             R TQA+ TWN+TC+YSQF A+ SPTCCVSLS+FYN+TIV CP C+CGC+    +  C+  
Sbjct  198   RKTQAMLTWNMTCTYSQFLAKKSPTCCVSLSSFYNETIVPCPTCSCGCQNNSQTGTCVNQ  257

Query  963   GEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQW  1142
              +   V+Q       Q ++QCTQHMCPIRVHWHVK +Y ++WRVK+ ITN+N+  N+S W
Sbjct  258   -KIASVIQASGKNNHQPLLQCTQHMCPIRVHWHVKTNYKEYWRVKVAITNFNYNMNYSLW  316

Query  1143  NLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTELLM  1322
             N+V  HPN  NVT++FSFNY+ L+ Y  INDT + +GI++YND+L QAG  GNVQ+E+L 
Sbjct  317   NMVAQHPNFDNVTKLFSFNYKPLSPYAGINDTAILWGIKFYNDMLSQAGPLGNVQSEILF  376

Query  1323  NKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
              K P+ FT  +GWAFPRRI FNG+ CV+P PD YP LPN+ P
Sbjct  377   RKSPSKFTLDKGWAFPRRIYFNGDNCVMPPPDSYPWLPNATP  418



>gb|EAY97880.1| hypothetical protein OsI_19799 [Oryza sativa Indica Group]
Length=456

 Score =   455 bits (1170),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 218/407 (54%), Positives = 283/407 (70%), Gaps = 15/407 (4%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDPNG+ITIKWD++       V  V+++NYQ +RHI  PGW+L W W    VIW 
Sbjct  34    EAYDALDPNGNITIKWDVMSWTPDGYVAVVTMFNYQQFRHIQAPGWQLGWTWAKKEVIWS  93

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ TEQG+CS FK G  PHCC+K+P ++DLLPGT +N Q  NCCK GV+++  QDP 
Sbjct  94    MVGAQTTEQGDCSKFKGGT-PHCCKKDPTVVDLLPGTPYNMQIANCCKAGVINTFNQDPS  152

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                ++FQ+S+G   + + +           NFTL  PG  YTCG A  V PTKF    GR
Sbjct  153   NAASSFQISVGLAGTTNKTVKLPK------NFTLKAPGPGYTCGRAMIVRPTKFFTGDGR  206

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKA  962
             R TQA+ TWN+TC+YSQF AQ +P+CCVSLS+FYN TIV+CP C+CGC+   G++     
Sbjct  207   RATQALMTWNVTCTYSQFLAQKTPSCCVSLSSFYNDTIVNCPTCSCGCQNN-GTSPGSCV  265

Query  963   GEQPPVVQLQHYEPP----QAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKN  1130
              E  P +Q     P     Q +VQCT HMCPIR+HWHVKL+Y ++WRVKITITN+N+  N
Sbjct  266   NENSPYLQSAIDGPGKWTGQPLVQCTSHMCPIRIHWHVKLNYKEYWRVKITITNFNYRMN  325

Query  1131  FSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGD-INDTGMFYGIQYYNDVLLQAGEGGNVQ  1307
             ++QWNLV  HPN  N+T++FSFNY+ L  YG  INDT MF+G+++YND+L+QAG  GN Q
Sbjct  326   YTQWNLVAQHPNFNNITQLFSFNYKPLTPYGSKINDTAMFWGVKFYNDLLMQAGPLGNAQ  385

Query  1308  TELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             +ELL+ KD   FTF +GWAFP R+ FNG+ CV+P PD YP LPN++P
Sbjct  386   SELLLRKDSKDFTFDKGWAFPHRVYFNGDNCVMPPPDAYPWLPNASP  432



>ref|NP_001055419.1| Os05g0386800 [Oryza sativa Japonica Group]
 sp|Q60E70.1|COBL3_ORYSJ RecName: Full=COBRA-like protein 3; AltName: Full=Protein BRITTLE 
CULM1-like 4; Flags: Precursor [Oryza sativa Japonica Group]
 gb|AAV31332.1| putative phytochelatin synthetase [Oryza sativa Japonica Group]
 dbj|BAF17333.1| Os05g0386800 [Oryza sativa Japonica Group]
 dbj|BAG87603.1| unnamed protein product [Oryza sativa Japonica Group]
Length=457

 Score =   455 bits (1170),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 218/407 (54%), Positives = 283/407 (70%), Gaps = 15/407 (4%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDPNG+ITIKWD++       V  V+++NYQ +RHI  PGW+L W W    VIW 
Sbjct  35    EAYDALDPNGNITIKWDVMSWTPDGYVAVVTMFNYQQFRHIQAPGWQLGWTWAKKEVIWS  94

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ TEQG+CS FK G  PHCC+K+P ++DLLPGT +N Q  NCCK GV+++  QDP 
Sbjct  95    MVGAQTTEQGDCSKFKGGT-PHCCKKDPTVVDLLPGTPYNMQIANCCKAGVINTFNQDPS  153

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                ++FQ+S+G   + + +           NFTL  PG  YTCG A  V PTKF    GR
Sbjct  154   NAASSFQISVGLAGTTNKTVKLPK------NFTLKAPGPGYTCGRAMIVRPTKFFTGDGR  207

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKA  962
             R TQA+ TWN+TC+YSQF AQ +P+CCVSLS+FYN TIV+CP C+CGC+   G++     
Sbjct  208   RATQALMTWNVTCTYSQFLAQKTPSCCVSLSSFYNDTIVNCPTCSCGCQNN-GTSPGSCV  266

Query  963   GEQPPVVQLQHYEPP----QAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKN  1130
              E  P +Q     P     Q +VQCT HMCPIR+HWHVKL+Y ++WRVKITITN+N+  N
Sbjct  267   NENSPYLQSAIDGPGKWTGQPLVQCTSHMCPIRIHWHVKLNYKEYWRVKITITNFNYRMN  326

Query  1131  FSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGD-INDTGMFYGIQYYNDVLLQAGEGGNVQ  1307
             ++QWNLV  HPN  N+T++FSFNY+ L  YG  INDT MF+G+++YND+L+QAG  GN Q
Sbjct  327   YTQWNLVAQHPNFNNITQLFSFNYKPLTPYGSKINDTAMFWGVKFYNDLLMQAGPLGNAQ  386

Query  1308  TELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             +ELL+ KD   FTF +GWAFP R+ FNG+ CV+P PD YP LPN++P
Sbjct  387   SELLLRKDSKDFTFDKGWAFPHRVYFNGDNCVMPPPDAYPWLPNASP  433



>ref|XP_004137135.1| PREDICTED: protein COBRA-like [Cucumis sativus]
 ref|XP_004154723.1| PREDICTED: protein COBRA-like [Cucumis sativus]
 gb|KGN53788.1| hypothetical protein Csa_4G129050 [Cucumis sativus]
Length=455

 Score =   455 bits (1170),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 218/406 (54%), Positives = 284/406 (70%), Gaps = 14/406 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YDPLDPNG+ITIKWDI+       V  V++YN+Q YRHI  PGW L W+W    VIW+
Sbjct  31    EAYDPLDPNGNITIKWDIMSWTADGYVAVVTLYNFQQYRHIQTPGWSLQWKWAKKEVIWN  90

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G +ATEQG+CS FK G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGVL+S  QDP 
Sbjct  91    MLGGQATEQGDCSRFK-GNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVLNSWVQDPA  149

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +++FQ+++G   + + +           NFTL  PG  YTCG A  V P+KF     R
Sbjct  150   TAVSSFQLTVGSAGTSNKTVRLPK------NFTLKAPGPGYTCGPAKIVKPSKFKSPDKR  203

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKA  962
             R TQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN TIVSCP C+CGC+    + +    
Sbjct  204   RVTQALMTWNVTCTYSQFLAQKTPTCCVSLSSFYNDTIVSCPKCSCGCQSNLNAPQNCVE  263

Query  963   GEQPPVVQLQHYEPPQA-----IVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAK  1127
                P +  + +           +VQCT HMCPIRVHWHVK++Y ++WRVKITITN+N+  
Sbjct  264   PNSPYLASVVNSASSSKNNLTPLVQCTGHMCPIRVHWHVKINYKEYWRVKITITNFNYVM  323

Query  1128  NFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQ  1307
             N++ WNLVV HPN  N+T++FSFNY+++N YG INDT + +G+++YND+L+QAG  GNVQ
Sbjct  324   NYTNWNLVVQHPNFDNLTQIFSFNYQSINPYGTINDTAILWGVKFYNDLLMQAGPLGNVQ  383

Query  1308  TELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             TELL  KD + FTF +GWAFPRRI FNG+ CV+P P+ YP LPN  
Sbjct  384   TELLFRKDQSDFTFDKGWAFPRRIYFNGDNCVMPPPEAYPFLPNKG  429



>emb|CDP21681.1| unnamed protein product [Coffea canephora]
Length=454

 Score =   454 bits (1169),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 223/403 (55%), Positives = 279/403 (69%), Gaps = 13/403 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDPNG+ITIKWD+I       V  V+++N+Q YRHI  PGW L W W    VIW 
Sbjct  32    EAYDALDPNGNITIKWDVITWTPDGYVAVVTMFNFQQYRHIQAPGWTLGWTWAKKEVIWS  91

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ TEQG+CS FK    PHCC+K+P ++DLLPGT +N+Q  NCCKGGV++S  QDP 
Sbjct  92    MVGAQTTEQGDCSRFKLNT-PHCCKKDPTVVDLLPGTPYNQQIANCCKGGVINSWVQDPA  150

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               ++AFQ+S+G   + + +           NFTL  PG  YTCG A    PTKF    GR
Sbjct  151   TAVSAFQVSVGSSGTTNRTVRMPK------NFTLKAPGPGYTCGPAKVGKPTKFSTADGR  204

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCE---GQPGSAKC  953
             RTTQA+ TWN+TC+YSQF AQ +P+CCVSLS+FYN TIV CP CTCGC+     PGS   
Sbjct  205   RTTQAMMTWNVTCTYSQFLAQKTPSCCVSLSSFYNDTIVPCPTCTCGCQNNGSHPGSCVD  264

Query  954   LKAGEQPPVVQLQHYEPPQA-IVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKN  1130
               A     VV         A ++QCT HMCPIRVHWHVK++Y ++WRVK+TITN+N+  N
Sbjct  265   ADAPHLASVVSDHGKSNNLAPLIQCTSHMCPIRVHWHVKVNYKEYWRVKVTITNFNYRMN  324

Query  1131  FSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQT  1310
             +SQWNLVV HPN  N+T++FSFN++ L  Y  INDT M +GI++YND L++AG  GNVQ+
Sbjct  325   YSQWNLVVQHPNFDNLTQIFSFNFKPLTPYQAINDTAMLFGIKFYNDFLMEAGPYGNVQS  384

Query  1311  ELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPN  1439
             ELL  KD +TFTF +GWAFPRRI FNG+ CV+P PD YP LPN
Sbjct  385   ELLFRKDKSTFTFDKGWAFPRRIYFNGDNCVMPPPDSYPYLPN  427



>ref|XP_010087346.1| hypothetical protein L484_012679 [Morus notabilis]
 gb|EXB28920.1| hypothetical protein L484_012679 [Morus notabilis]
Length=449

 Score =   454 bits (1169),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 215/407 (53%), Positives = 277/407 (68%), Gaps = 13/407 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDP G+ITIKWD++       V  V++YN+Q YRHI  PGW L W W    VIW 
Sbjct  27    EAYDALDPTGNITIKWDVMSWTPDGYVAVVTMYNFQQYRHIQAPGWTLGWTWAKKEVIWS  86

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ TEQG+CS FK G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGVL+S  QDP 
Sbjct  87    MVGAQTTEQGDCSRFK-GNVPHCCKKDPTVVDLLPGTAYNQQIANCCKGGVLNSWVQDPA  145

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                ++FQ+S+G   + + +           NFTL  PG  YTCG A  V  TKF+    R
Sbjct  146   NAASSFQISVGAAGTTNKTVKLPK------NFTLKAPGPGYTCGPAKIVRATKFITADKR  199

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKA  962
             R TQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN TIV+CP CTCGC+     ++    
Sbjct  200   RVTQALMTWNVTCTYSQFLAQKTPTCCVSLSSFYNDTIVNCPTCTCGCKSNSTDSESCVN  259

Query  963   GEQPPVVQLQHYEPPQAI----VQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKN  1130
                P +           I    VQCT HMCP+R+HWHVK++Y ++WRVK++ITN+N+  N
Sbjct  260   PNHPHLASAVSGSGKSNINTPLVQCTSHMCPVRIHWHVKINYKEYWRVKVSITNFNYRMN  319

Query  1131  FSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQT  1310
             +SQWNLV  HPN  N+T++FSFNY++L  Y  +NDT M +G+++YND L +AG  GNVQ+
Sbjct  320   YSQWNLVAQHPNFDNLTQIFSFNYKSLTPYAGLNDTAMMWGVKFYNDFLNEAGPLGNVQS  379

Query  1311  ELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAPP  1451
             ELL  KD +TFTF +GWAFPRRI FNG+ CV+P PD YP LPN+ PP
Sbjct  380   ELLFRKDKSTFTFEKGWAFPRRIYFNGDNCVMPPPDSYPWLPNAGPP  426



>gb|EEE63576.1| hypothetical protein OsJ_18393 [Oryza sativa Japonica Group]
Length=441

 Score =   454 bits (1168),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 218/407 (54%), Positives = 283/407 (70%), Gaps = 15/407 (4%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDPNG+ITIKWD++       V  V+++NYQ +RHI  PGW+L W W    VIW 
Sbjct  19    EAYDALDPNGNITIKWDVMSWTPDGYVAVVTMFNYQQFRHIQAPGWQLGWTWAKKEVIWS  78

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ TEQG+CS FK G  PHCC+K+P ++DLLPGT +N Q  NCCK GV+++  QDP 
Sbjct  79    MVGAQTTEQGDCSKFKGGT-PHCCKKDPTVVDLLPGTPYNMQIANCCKAGVINTFNQDPS  137

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                ++FQ+S+G   + + +           NFTL  PG  YTCG A  V PTKF    GR
Sbjct  138   NAASSFQISVGLAGTTNKTVKLPK------NFTLKAPGPGYTCGRAMIVRPTKFFTGDGR  191

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKA  962
             R TQA+ TWN+TC+YSQF AQ +P+CCVSLS+FYN TIV+CP C+CGC+   G++     
Sbjct  192   RATQALMTWNVTCTYSQFLAQKTPSCCVSLSSFYNDTIVNCPTCSCGCQNN-GTSPGSCV  250

Query  963   GEQPPVVQLQHYEPP----QAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKN  1130
              E  P +Q     P     Q +VQCT HMCPIR+HWHVKL+Y ++WRVKITITN+N+  N
Sbjct  251   NENSPYLQSAIDGPGKWTGQPLVQCTSHMCPIRIHWHVKLNYKEYWRVKITITNFNYRMN  310

Query  1131  FSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGD-INDTGMFYGIQYYNDVLLQAGEGGNVQ  1307
             ++QWNLV  HPN  N+T++FSFNY+ L  YG  INDT MF+G+++YND+L+QAG  GN Q
Sbjct  311   YTQWNLVAQHPNFNNITQLFSFNYKPLTPYGSKINDTAMFWGVKFYNDLLMQAGPLGNAQ  370

Query  1308  TELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             +ELL+ KD   FTF +GWAFP R+ FNG+ CV+P PD YP LPN++P
Sbjct  371   SELLLRKDSKDFTFDKGWAFPHRVYFNGDNCVMPPPDAYPWLPNASP  417



>dbj|BAK04997.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=452

 Score =   454 bits (1169),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 226/404 (56%), Positives = 276/404 (68%), Gaps = 13/404 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             D YD LDP G+ITIKWD+ +  D   V TVS+YN+Q YRHI  PGWKL W W    +IW 
Sbjct  32    DAYDSLDPTGNITIKWDVRQWTDDGYVATVSLYNHQQYRHIQAPGWKLGWVWAEKEMIWK  91

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ TEQG+CS FK+    HCC  +P ++DLLPG  +NKQ  NCCKGGVLSS  QDP 
Sbjct  92    MTGAQTTEQGDCSRFKA--EAHCCRTDPEVVDLLPGAPYNKQTSNCCKGGVLSSWGQDPA  149

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +A F++ +G+  +  SS  A        NFTL  PG  YTCG A +V  TKF++   R
Sbjct  150   NAIATFEVRVGQAGTSRSSIKAPT------NFTLMAPGPGYTCGPAKKVERTKFIDGDAR  203

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGS-AKCLK  959
             RT QA+ TWN+TC+YSQF A  +PTCCV LS+FYN TIV C  C+CGC+    S   C+K
Sbjct  204   RTIQALETWNVTCTYSQFVAGRTPTCCVELSSFYNSTIVECNTCSCGCQDNSTSPVSCVK  263

Query  960   AGE--QPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
             A       VV       P  +VQCT HMCPIRVHWHVK +Y ++WRVKIT TN N+  N+
Sbjct  264   ANSPYLASVVNGDSTNIPAPLVQCTSHMCPIRVHWHVKANYKEYWRVKITATNLNYRMNY  323

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             SQWNLV  HPN  N+T +FSF Y+ LN YG INDTGM +GI+YYND+L+ A   GNVQ+E
Sbjct  324   SQWNLVAQHPNFANLTTIFSFKYKDLNPYGIINDTGMMWGIKYYNDLLMTADRNGNVQSE  383

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             LL  KDP TFTF++GWAFPRR+ FNGE CV+P PD YP LPN++
Sbjct  384   LLFRKDPETFTFQKGWAFPRRVYFNGENCVMPPPDVYPWLPNAS  427



>ref|XP_010694050.1| PREDICTED: COBRA-like protein 4 [Beta vulgaris subsp. vulgaris]
Length=435

 Score =   454 bits (1167),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 221/400 (55%), Positives = 279/400 (70%), Gaps = 11/400 (3%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDM  431
              YDPLDPNG+IT+KWDI+       V TV+I N+Q+YRH+  PGW+L W W    VIW M
Sbjct  19    AYDPLDPNGNITVKWDIMSWTPDGYVATVTINNFQMYRHVGDPGWQLGWTWAKKEVIWSM  78

Query  432   WGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEK  611
              GA+ TEQG+CS FK G  PHCC+K P ++DLLPGT +N+QF NCCKGGVL+S  QD   
Sbjct  79    VGAQTTEQGDCSKFK-GNIPHCCKKTPTVVDLLPGTPYNQQFSNCCKGGVLNSWGQDKSG  137

Query  612   YLAAFQMsigrvssksssgaavaappipgNFTL--GVPGYTCGEAFEVPPTKFVEDHGRR  785
              ++ FQ+S+G+  + + +           NFTL    PGYTCG A  VP T F+    RR
Sbjct  138   SVSQFQVSVGQAGTTNKTVKLPK------NFTLLGPGPGYTCGPAKIVPSTNFLTQDRRR  191

Query  786   TTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAG  965
              TQA+ TWN+TC+YSQF A+  P+CCVSLSTFYN TI  CP C+CGCE +    K     
Sbjct  192   KTQALMTWNVTCTYSQFIARKYPSCCVSLSTFYNDTITPCPTCSCGCEHKKNCVKSDSKI  251

Query  966   EQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQWN  1145
                  ++ + Y  P  ++ CT HMCPIRVHWHVK++Y  +WRVK++ITN+N+  NFSQW 
Sbjct  252   LSMAGLKSKRYNSP--LLHCTHHMCPIRVHWHVKVNYKDYWRVKVSITNFNYHTNFSQWT  309

Query  1146  LVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTELLMN  1325
             LV  HPNL NVT VFSFNY+ L  YG INDTGMFYG ++YND+L++AG  GNVQ+E+LM 
Sbjct  310   LVAQHPNLNNVTEVFSFNYKPLVPYGSINDTGMFYGTKFYNDLLMEAGPFGNVQSEVLMQ  369

Query  1326  KDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             KD  TFTFR+GWAFPR++ FNG+EC +P PD +P LPNS 
Sbjct  370   KDQNTFTFRQGWAFPRKVYFNGDECRMPPPDTFPFLPNSG  409



>emb|CDP20883.1| unnamed protein product [Coffea canephora]
Length=462

 Score =   454 bits (1169),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 213/406 (52%), Positives = 282/406 (69%), Gaps = 11/406 (3%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDM  431
             GYD  DP G+ITIKWDI   N    V  V+I+N+  YRHI+ PGW+L W W    VIW+M
Sbjct  41    GYDAFDPTGNITIKWDIKTWNADGYVAVVTIFNFYKYRHIESPGWQLGWTWAKKEVIWNM  100

Query  432   WGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEK  611
              G +ATEQG+CS FK    PHCC ++P I+DL+PGT +N+Q  NCC+GGV+SS  QDP  
Sbjct  101   MGGQATEQGDCSRFKGTIIPHCCNRKPTIVDLMPGTPYNQQVANCCRGGVISSWVQDPAN  160

Query  612   YLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGRR  785
              +++FQ+++ +  + +++  A        NFTL  PG  YTCG A  V P+KFV D  RR
Sbjct  161   AVSSFQLTVSQAGTNNTTARAPQ------NFTLNTPGPGYTCGPARTVNPSKFVSDDKRR  214

Query  786   TTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG---QPGSAKCL  956
              TQA+ TWNITC YSQF AQ +P CCVSLS+FY+K+IVSCP C CGC+    QPG     
Sbjct  215   VTQALMTWNITCMYSQFLAQKTPACCVSLSSFYSKSIVSCPTCACGCQNSITQPGICVES  274

Query  957   KAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFS  1136
             ++   P  +          +VQCT+HMCPIRVHWH+K++Y ++WRVK+T+TN+N+  N+S
Sbjct  275   ESPNVPSALSRSGKNSHTPLVQCTRHMCPIRVHWHIKVNYKEYWRVKVTVTNFNYRMNYS  334

Query  1137  QWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTEL  1316
             QWNLVV HPN  ++TR FSFNY+ L  Y  INDT MF+G ++YND+L+ AG  GN+Q+EL
Sbjct  335   QWNLVVQHPNFKHLTRTFSFNYQPLTPYASINDTAMFWGTKFYNDLLMHAGPSGNIQSEL  394

Query  1317  LMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAPPH  1454
             +  KD +TF+F +GW FP+RI FNG+ CV+P PD YP LPN++ P 
Sbjct  395   IFWKDKSTFSFEKGWGFPQRIYFNGDNCVMPPPDLYPNLPNASVPR  440



>ref|XP_006408435.1| hypothetical protein EUTSA_v10020716mg [Eutrema salsugineum]
 gb|ESQ49888.1| hypothetical protein EUTSA_v10020716mg [Eutrema salsugineum]
Length=451

 Score =   454 bits (1167),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 221/406 (54%), Positives = 280/406 (69%), Gaps = 16/406 (4%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YDPLDP G+ITIKWDII       V TV++YN+Q YRHI  PGW L W W    VIW 
Sbjct  30    EAYDPLDPTGNITIKWDIITWTGDGYVATVTLYNFQQYRHIQAPGWTLGWSWAKREVIWG  89

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G + TEQG+CS FK G  PHCC+K P ++DLLPGT +N+Q  NCC+GGV++S  QDP 
Sbjct  90    MNGGQTTEQGDCSKFK-GNIPHCCKKTPSVVDLLPGTPYNQQIANCCRGGVINSWAQDPA  148

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               ++AFQ+++G+  + + +           NFTL  PG  YTCG    V PT+F+    R
Sbjct  149   TAVSAFQLTVGQAGTTNKTVRVPK------NFTLKAPGPGYTCGPGKIVKPTRFIATDKR  202

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCE--GQPGSA---  947
             R TQA  TWN+TC+YSQF AQ +PTCCVSLS+FYN TIV CP C+CGC    QPG+    
Sbjct  203   RATQAFMTWNVTCTYSQFLAQKTPTCCVSLSSFYNSTIVPCPTCSCGCRNTSQPGNCVDP  262

Query  948   KCLKAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAK  1127
             K  +     P      Y PP  +VQCT HMCP+R+HWHVK++Y  +WRVK+TITN+N+  
Sbjct  263   KGPRIASVVPNSGKNAYIPP--LVQCTDHMCPVRIHWHVKVNYKAYWRVKVTITNFNYNM  320

Query  1128  NFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQ  1307
             N+SQWNLVV HPN  N+T+ FSFNY+ L  Y  INDTG+ +GI++YND+L+QAG  GNVQ
Sbjct  321   NYSQWNLVVQHPNFDNLTQTFSFNYKPLTPYASINDTGILWGIKFYNDLLMQAGPYGNVQ  380

Query  1308  TELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             +ELL  K+ + FTF +GWAFPRRI FNG+ CV+P PD YP LPN+ 
Sbjct  381   SELLFQKEASAFTFEKGWAFPRRIYFNGDNCVMPPPDSYPWLPNTG  426



>gb|KGN57605.1| hypothetical protein Csa_3G225840 [Cucumis sativus]
Length=355

 Score =   450 bits (1157),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 219/342 (64%), Positives = 262/342 (77%), Gaps = 10/342 (3%)
 Frame = +3

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             MWGAE T+QGNCS +   + PHCCEK+P I+DL+PG  +  Q  NCCK GVLSSM Q+  
Sbjct  1     MWGAETTQQGNCSKYVGRELPHCCEKKPEIVDLMPGAPYKLQVANCCKAGVLSSMRQESS  60

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPGYTCGEAFEVPPTKFVEDHGRRT  788
                AAFQM++G+ S K       A      NFTLG+PGYTC E F+VPPTKF +D GRR 
Sbjct  61    NSGAAFQMNVGKSSGKDVDSKMPA------NFTLGLPGYTCSEPFQVPPTKFSKDGGRRW  114

Query  789   TQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAGE  968
              Q + TWN+TC YSQFR+  +P CCVSLS+FYN TIV CP C+CGC+G  G+ KC+K+GE
Sbjct  115   MQVLETWNVTCVYSQFRSSPTPGCCVSLSSFYNSTIVPCPQCSCGCQGLKGT-KCVKSGE  173

Query  969   QPPVVQLQHYE---PPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQ  1139
              P V+QL H       +A+V+C+QHMCPIRVHWHVK SYTQ+WRVKITITN NFAKN+S 
Sbjct  174   APSVLQLPHEHNTAEVEALVRCSQHMCPIRVHWHVKQSYTQYWRVKITITNLNFAKNYSD  233

Query  1140  WNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTELL  1319
             WNLVV+HPNL N+T+VFSFNY  LNQYG+INDTGMF+GI +YND+LL +GE GNVQTE+L
Sbjct  234   WNLVVMHPNLRNITQVFSFNYSPLNQYGNINDTGMFWGIHFYNDLLLTSGERGNVQTEIL  293

Query  1320  MNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             + KD   FTFREGWAFPRRI FNG+ECV+P PD YPRLPN A
Sbjct  294   LQKDSEIFTFREGWAFPRRIMFNGDECVMPPPDQYPRLPNKA  335



>gb|KDP31373.1| hypothetical protein JCGZ_11749 [Jatropha curcas]
Length=457

 Score =   454 bits (1167),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 220/407 (54%), Positives = 280/407 (69%), Gaps = 21/407 (5%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDPNG+ITIKWD+I       V  V++YN+Q YRHI  PGW L W W    VIW 
Sbjct  35    EAYDALDPNGNITIKWDVISWTPDGYVAVVTMYNFQQYRHIQAPGWTLGWTWAKKEVIWS  94

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G + TEQG+CS +K G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGVL+S  QDP 
Sbjct  95    MVGGQTTEQGDCSKYK-GNVPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVLNSWAQDPA  153

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +++FQ+S+G   + + +           NFTL  PG  YTCG A  V PTKF+    R
Sbjct  154   TAVSSFQVSVGAAGTSNKTVRLPK------NFTLKAPGPGYTCGPAKIVRPTKFISSDKR  207

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQ---PGSAKC  953
             R+TQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN+TIVSCP C CGC+      G+  C
Sbjct  208   RSTQALMTWNVTCTYSQFLAQKTPTCCVSLSSFYNETIVSCPTCACGCQNSTTGAGAGTC  267

Query  954   LKAGEQPPVVQLQHYEPPQA-----IVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYN  1118
             +     P    L     P       +VQCT HMCPIRVHWHVKL+Y ++WRVK+T+TN+N
Sbjct  268   V----NPDSPHLASVVSPTKNDNTPLVQCTSHMCPIRVHWHVKLNYKEYWRVKVTVTNFN  323

Query  1119  FAKNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGG  1298
             +  N++QWNLVV HPN  N+T++FSF+Y+ L  Y  +NDT M +G+Q+YND L QAG  G
Sbjct  324   YRMNYTQWNLVVQHPNFDNLTQIFSFHYKPLTPYDGLNDTAMLWGVQFYNDFLSQAGPLG  383

Query  1299  NVQTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPN  1439
             NVQ+ELL  KD +TFTF +GWAFPRR+ FNG+ CV+P PD YP LPN
Sbjct  384   NVQSELLFRKDKSTFTFEKGWAFPRRVYFNGDNCVMPPPDAYPWLPN  430



>ref|XP_007208787.1| hypothetical protein PRUPE_ppa024172mg [Prunus persica]
 gb|EMJ09986.1| hypothetical protein PRUPE_ppa024172mg [Prunus persica]
Length=447

 Score =   453 bits (1166),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 217/406 (53%), Positives = 283/406 (70%), Gaps = 23/406 (6%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDP G+ITIKWD+I       V  V+++N+Q YRHI  PGW L W W    VIW 
Sbjct  35    EAYDALDPTGNITIKWDVISWTPDGYVAVVTMFNFQQYRHIQTPGWTLGWTWAKKEVIWS  94

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ TEQG+CS +K G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGV++S  QDP 
Sbjct  95    MVGAQTTEQGDCSRYK-GNVPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVMNSWIQDPA  153

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +++FQ+S+G   + + +           NFTL  PG  Y+CG A  V PT+F+    R
Sbjct  154   NAISSFQISVGAAGTTNKTVRLPK------NFTLKAPGPGYSCGIAKIVKPTRFLTADKR  207

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQ---PGS-AK  950
             R TQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN+TIVSCP C CGC+     PGS   
Sbjct  208   RWTQAMMTWNVTCTYSQFLAQKTPTCCVSLSSFYNETIVSCPTCACGCQNNATDPGSCVD  267

Query  951   CLKAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKN  1130
             C+  G+               +VQCT HMCP+RVHWHVK++Y ++WRVK+TITN+N+  N
Sbjct  268   CIGPGKSTNA----------PLVQCTSHMCPVRVHWHVKINYKEYWRVKVTITNFNYRMN  317

Query  1131  FSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQT  1310
             ++ WNLVV HPN  N+T++FSFNY++L  Y  +NDT M +G+++YND+L QAG  GNVQ+
Sbjct  318   YTLWNLVVQHPNFDNLTKIFSFNYKSLTPYAGLNDTAMLWGVKFYNDLLTQAGPLGNVQS  377

Query  1311  ELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             ELL  KD +TFTF +GWAFPRRI FNG+ CV+P PD YP LPNS+P
Sbjct  378   ELLFRKDASTFTFEKGWAFPRRIYFNGDNCVMPPPDAYPWLPNSSP  423



>gb|KHG21362.1| Protein COBRA -like protein [Gossypium arboreum]
Length=455

 Score =   453 bits (1166),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 217/403 (54%), Positives = 280/403 (69%), Gaps = 13/403 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDP G+ITIKWD+I       V  V++YN+Q YRHI  PGW L W W    VIW 
Sbjct  35    EAYDALDPTGNITIKWDVISWTPDGYVAVVTMYNFQQYRHIQAPGWTLGWTWAKKEVIWS  94

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G++ TEQG+CS +K G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGVL+S  QDP 
Sbjct  95    MMGSQTTEQGDCSKYK-GNVPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVLNSWVQDPA  153

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                ++FQ+S+G   + + +           NFTL  PG  YTCG A  V PTKF+    R
Sbjct  154   NAASSFQVSVGAAGTTNKTVRVPR------NFTLKAPGPGYTCGPAKIVKPTKFITADKR  207

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG---QPGSAKC  953
             R TQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN TIV+CP C CGC+    + GS   
Sbjct  208   RITQAMMTWNVTCTYSQFLAQKTPTCCVSLSSFYNNTIVNCPTCACGCQNNSTESGSCVS  267

Query  954   LKAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
              ++      V  +    P  ++QCT HMCP+R+HWHVKL+Y ++WRVKITITN+N+A N+
Sbjct  268   ERSSHLASAVLGKSTNAP-PLLQCTSHMCPVRIHWHVKLNYKEYWRVKITITNFNYALNY  326

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             S+WNLVV HPN  N+T++FSFNY+ L  Y  +NDT M +G+++YND L +AG  GNVQ+E
Sbjct  327   SEWNLVVQHPNFDNLTQLFSFNYKPLTPYAGLNDTAMLWGLKFYNDFLNEAGPLGNVQSE  386

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNS  1442
             LL  KD +TFTF +GWAFPRRI FNG+ CV+P PD YP LPN+
Sbjct  387   LLFRKDASTFTFEKGWAFPRRIYFNGDNCVMPPPDAYPWLPNT  429



>ref|XP_008240087.1| PREDICTED: protein COBRA-like isoform X1 [Prunus mume]
Length=456

 Score =   453 bits (1166),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 219/409 (54%), Positives = 287/409 (70%), Gaps = 20/409 (5%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDP G+ITIKWD+I       V  V+++N+Q YRHI  PGW L W W    VIW 
Sbjct  35    EAYDALDPTGNITIKWDVISWTPDGYVAVVTMFNFQQYRHIQTPGWTLGWTWAKKEVIWS  94

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ TEQG+CS +K G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGV++S  QDP 
Sbjct  95    MVGAQTTEQGDCSRYK-GNVPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVMNSWIQDPA  153

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +++FQ+S+G   + + +           NFTL  PG  Y+CG A  V PT+F+    R
Sbjct  154   NAISSFQISVGAAGTTNKTVRMPK------NFTLKAPGPGYSCGIAKIVKPTRFLTADKR  207

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQ---PGSAKC  953
             R TQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN+TIVSCP C CGC+     PGS  C
Sbjct  208   RWTQAMMTWNVTCTYSQFLAQKTPTCCVSLSSFYNETIVSCPTCACGCQNNATDPGS--C  265

Query  954   LKAGEQPPVVQLQHYEPPQA----IVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNF  1121
             ++     P +      P ++    +VQCT HMCP+RVHWHVKL+Y ++WRVK+TITN+N+
Sbjct  266   VEPNN--PYLASAVSGPGKSTNAPLVQCTSHMCPVRVHWHVKLNYKEYWRVKVTITNFNY  323

Query  1122  AKNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGN  1301
               N++ WNLVV HPN  N+T++FSFNY++L  Y  +NDT M +G+++YND+L QAG  GN
Sbjct  324   RMNYTLWNLVVQHPNFDNLTKIFSFNYKSLTPYAGLNDTAMLWGVKFYNDLLTQAGPLGN  383

Query  1302  VQTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             VQ+ELL  KD +TFTF +GWAFPRRI FNG+ CV+P PD YP LPNS+P
Sbjct  384   VQSELLFRKDASTFTFEKGWAFPRRIYFNGDNCVMPPPDAYPWLPNSSP  432



>ref|XP_006297664.1| hypothetical protein CARUB_v10013688mg [Capsella rubella]
 gb|EOA30562.1| hypothetical protein CARUB_v10013688mg [Capsella rubella]
Length=450

 Score =   453 bits (1166),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 220/406 (54%), Positives = 282/406 (69%), Gaps = 16/406 (4%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YDPLDP+G+ITIKWDII       +  V+IYN+Q YRHI  PGW L W W    VIW 
Sbjct  30    EAYDPLDPSGNITIKWDIISWTADGYMAVVTIYNFQQYRHIQAPGWTLGWSWAKREVIWG  89

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G +ATEQG+CS FK G  PHCC+K P ++DLLPGT +N+Q  NCC+GGV++S  QDP 
Sbjct  90    MSGGQATEQGDCSKFK-GNIPHCCKKTPSVVDLLPGTPYNQQIANCCRGGVINSWAQDPA  148

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               ++AFQ+ +G+  + + +           NFTL  PG  YTC     V PT+F+    R
Sbjct  149   TAVSAFQLIVGQAGTTNKTVRVPK------NFTLNAPGPGYTCSPGKIVKPTRFIGTDKR  202

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCE--GQPGSA---  947
             R TQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN TIVSCP C+CGC+   QPG+    
Sbjct  203   RVTQALMTWNVTCTYSQFLAQKTPTCCVSLSSFYNSTIVSCPTCSCGCQNTSQPGNCVDP  262

Query  948   KCLKAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAK  1127
             K  +     P      Y PP  +VQCT HMCP+R+HWHVK++Y Q+WRVK+TITN+N+  
Sbjct  263   KGPRIASVIPNPGKNAYLPP--LVQCTHHMCPVRIHWHVKVNYKQYWRVKVTITNFNYNM  320

Query  1128  NFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQ  1307
             N++QWNLVV HPN  N+T+ FSFNY+ L  Y  INDTG+ +GI++YND+L+QAG  GNVQ
Sbjct  321   NYTQWNLVVQHPNFDNLTQTFSFNYKPLTPYASINDTGILWGIKFYNDLLMQAGPFGNVQ  380

Query  1308  TELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             +ELL  K+ + FT  +GWAFPRRI FNG+ CV+P PD YP LPN+ 
Sbjct  381   SELLFQKEASAFTLEKGWAFPRRIYFNGDNCVMPPPDSYPWLPNAG  426



>gb|EMT09066.1| hypothetical protein F775_27360 [Aegilops tauschii]
Length=455

 Score =   453 bits (1166),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 227/406 (56%), Positives = 277/406 (68%), Gaps = 13/406 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             D YD LDP G+ITIKWD+ + +    V TVS+YNYQ YRHI  PGWKL W W G  +IW 
Sbjct  31    DAYDSLDPVGNITIKWDVKKWSHDGYVATVSLYNYQQYRHIQAPGWKLGWVWAGKEIIWK  90

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ TEQG+CS F+    PHCC  +P ++D LPG  ++KQ  NCCKGGVLSS  Q+P 
Sbjct  91    MAGAQTTEQGDCSRFREEPPPHCCRTDPEVVDFLPGAAYSKQTPNCCKGGVLSSWGQNPA  150

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHG-  779
               +A F +++G+    +SS  A        NFTL  PG  YTCG A EV PTKF++  G 
Sbjct  151   NAIATFDVTVGQAGISNSSVKAPT------NFTLKAPGPGYTCGPAKEVEPTKFIDKDGD  204

Query  780   -RRTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGC-EGQPGSAKC  953
              RRTTQA+ TWN+TC+YSQF A  SPTCCV LS+FYN TIV C  C+CGC +       C
Sbjct  205   GRRTTQAIKTWNVTCTYSQFGAGRSPTCCVVLSSFYNSTIVDCNKCSCGCQDNSTNPVSC  264

Query  954   LKAGEQ--PPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAK  1127
             +K        VV       P  +VQC+ HMCPIRVHWHVK +Y ++WRVKIT TN N+  
Sbjct  265   IKPNSPYLASVVPGDSTNIPVPLVQCSPHMCPIRVHWHVKANYKEYWRVKITATNLNYLM  324

Query  1128  NFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQ  1307
             N+SQWNLV  HPN  N+T +FSF Y+ LN YG INDTGM +GI+YYND+L+ A   GNVQ
Sbjct  325   NYSQWNLVAQHPNFNNLTTIFSFRYKDLNPYGTINDTGMMWGIKYYNDLLMTAQHNGNVQ  384

Query  1308  TELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             +ELL  KDPATFTF++GWAFPRR+ FNGE CV+P PD YP LPN +
Sbjct  385   SELLFRKDPATFTFQKGWAFPRRVYFNGENCVMPPPDAYPWLPNDS  430



>ref|XP_009606717.1| PREDICTED: COBRA-like protein 1 [Nicotiana tomentosiformis]
Length=457

 Score =   453 bits (1166),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 221/409 (54%), Positives = 286/409 (70%), Gaps = 22/409 (5%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             D YD LDPNG+ITIKWD+I        V V+IYN+Q YRHI  PGW+L W W    VIW 
Sbjct  35    DAYDALDPNGNITIKWDVISWTPDGYNVVVTIYNFQKYRHIQAPGWQLGWTWAKKEVIWS  94

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
               G +ATEQG+CS FK G  PHCC+++P I+DLLPGT +N+Q  NCCKGGV+SS  QDP+
Sbjct  95    ATGGQATEQGDCSRFK-GNIPHCCKRDPTIVDLLPGTPYNQQTANCCKGGVISSWVQDPQ  153

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
             K +++FQ+ +G+  + + +           NFTL  PG  YTCG A +  P+KF    GR
Sbjct  154   KAVSSFQLGVGQAGTSNKTVRLPK------NFTLKAPGPGYTCGPAKKGKPSKFPTPDGR  207

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG---QPGSAKC  953
             R TQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN TIV+CP C CGC+    QPG+  C
Sbjct  208   RVTQALMTWNVTCTYSQFLAQKTPTCCVSLSSFYNDTIVNCPTCACGCKNNITQPGT--C  265

Query  954   LKAGEQPPVVQL-----QHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYN  1118
             ++         L       Y P   +V+CT+HMCPIRVHWH+K +Y ++WRVK+TI N+N
Sbjct  266   VEQDSPYLASALVSSGKNDYSP---LVRCTEHMCPIRVHWHIKTNYKEYWRVKLTIQNFN  322

Query  1119  FAKNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGG  1298
             +  N+SQWNLVV HPN  N+T++FSFNY  L  YG INDT MF+GI++YND+L+Q G  G
Sbjct  323   YRMNYSQWNLVVQHPNFDNLTQIFSFNYEPLVSYGSINDTAMFWGIKFYNDLLMQGGPFG  382

Query  1299  NVQTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             NVQ+E++  KD + F+F +GWAFPRRI FNG+ CV+P PD YP LPN++
Sbjct  383   NVQSEIIFQKDKSKFSFEKGWAFPRRIYFNGDNCVMPPPDAYPYLPNAS  431



>gb|KFK25792.1| hypothetical protein AALP_AA8G161300 [Arabis alpina]
Length=433

 Score =   452 bits (1163),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 218/405 (54%), Positives = 283/405 (70%), Gaps = 18/405 (4%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
               YDPLDPNG+ITIKWDI+       V TV+I N+Q+YRHI +PGW L W W    VIW 
Sbjct  18    SAYDPLDPNGNITIKWDIMSWTADGYVATVAINNFQIYRHIQNPGWTLGWTWAKKEVIWS  77

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ TEQG+CS FK G  PHCC+K P ++DLLPG  +N+QF NCCKGGV+++  QDP 
Sbjct  78    MVGAQTTEQGDCSKFK-GNVPHCCKKTPTVVDLLPGVPYNQQFTNCCKGGVVAAWGQDPS  136

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               ++ FQ+S+G   + + +           NFTL  PG  YTCG A  VP T F+    R
Sbjct  137   SAVSQFQVSVGLAGTTNKTVKLPK------NFTLLGPGLGYTCGPAKIVPSTAFLTADKR  190

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKA  962
             R TQA+ TWN+TC+YSQF A+  P+CCVS STFYN TI  CP C CGCE + G   C+KA
Sbjct  191   RKTQALMTWNVTCTYSQFLARKHPSCCVSFSTFYNDTITPCPSCACGCENKKG---CVKA  247

Query  963   GEQPPVVQLQHYEPPQA----IVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKN  1130
               +  ++ ++    P+     ++QCT HMCP+RVHWHVK++Y  +WRVKI ITN+N+  N
Sbjct  248   DSK--ILTMKGINTPKKDNSPLLQCTHHMCPVRVHWHVKVNYKDYWRVKIAITNFNYRMN  305

Query  1131  FSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQT  1310
              + W L + HPNL NVT+VFSF+Y+ +  YG INDTGMFYG ++YND+L++AG  GNVQ+
Sbjct  306   HTLWTLAIQHPNLNNVTQVFSFDYKPVAPYGSINDTGMFYGTKFYNDLLMEAGPSGNVQS  365

Query  1311  ELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             E+L+ KD  TFTF++GWAFPR++ FNG+EC+LP PD YP LPNSA
Sbjct  366   EVLLQKDLKTFTFKQGWAFPRKVYFNGDECMLPPPDSYPFLPNSA  410



>gb|KHN08345.1| Protein COBRA, partial [Glycine soja]
Length=438

 Score =   452 bits (1163),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 217/406 (53%), Positives = 284/406 (70%), Gaps = 14/406 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YDPLDPNG+ITIKWDII       V  V++YN+Q YRHI  PGW L W W    VIW 
Sbjct  16    EAYDPLDPNGNITIKWDIISWTPDGYVAVVTMYNFQQYRHISAPGWSLGWTWAKKEVIWS  75

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G + TEQG+CS +K+   PHCC+K P+++DLLPGT +N+Q  NCCKGGVLSS  QD  
Sbjct  76    MMGGQTTEQGDCSKYKA-NIPHCCKKNPIVVDLLPGTPYNQQISNCCKGGVLSSWAQDQS  134

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
             K +AAFQ+S+G  S+ + +           +FTL  PG  YTCG A  V PT+F++   R
Sbjct  135   KAVAAFQVSVGSASTTNKTVKVPK------DFTLKAPGPGYTCGPATIVKPTQFLQPDKR  188

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPG-SAKCLK  959
             R TQA+ TWN+TC+YSQF AQ +P+CCVSLS+FYN T+V C  C CGC+G    S +C+ 
Sbjct  189   RVTQALMTWNVTCTYSQFLAQRTPSCCVSLSSFYNNTVVPCTTCACGCQGNSSQSGECVD  248

Query  960   AGEQPPVVQLQHYEPPQA----IVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAK  1127
                      + +  P ++    +V+CT+HMCPIRVHWHVKL+Y ++WRVK+T+TN+N+  
Sbjct  249   PDSPHLQSVVSNAGPGKSSITPLVRCTRHMCPIRVHWHVKLNYKEYWRVKVTVTNFNYGM  308

Query  1128  NFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQ  1307
             N+S WNLVV HPN  N+T++FSFNY+ +  YG INDT M +G+++YND L+QAG  GNVQ
Sbjct  309   NYSDWNLVVQHPNFDNLTQLFSFNYKAITPYGSINDTAMLWGLKFYNDFLMQAGPLGNVQ  368

Query  1308  TELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             +ELL  KD +TFTF +GWAFPRR+ FNG+ CV+  PD YP LPN+ 
Sbjct  369   SELLFRKDKSTFTFDKGWAFPRRVYFNGDVCVMSPPDAYPWLPNAG  414



>gb|KEH25134.1| COBRA-like protein 2 precursor [Medicago truncatula]
Length=446

 Score =   452 bits (1164),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 222/404 (55%), Positives = 280/404 (69%), Gaps = 13/404 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YDPLDPNG+ITIKWDII       V TV++ N+Q YRHI  PGW L W W    VIW+
Sbjct  27    EAYDPLDPNGNITIKWDIISWTADGYVATVTMNNFQQYRHISSPGWSLGWTWAKKEVIWN  86

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G++ TEQG+CS FK G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGVLSS  QDP 
Sbjct  87    MVGSQTTEQGDCSKFK-GNIPHCCKKDPTVVDLLPGTPYNQQTANCCKGGVLSSWAQDPT  145

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +A+FQ+ +GR  + + +           NFTL  PG  YTCG A    PTKF     R
Sbjct  146   NAVASFQVIVGRAGTTNKTVKLPQ------NFTLKAPGPGYTCGRAKTGTPTKFTTPDKR  199

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG-QPGSAKCL-  956
             R TQA+ TWN+TC+YSQF AQ +PTCCV+LS+FYN TIV CP C+CGC+G  P S  C+ 
Sbjct  200   RVTQALMTWNVTCTYSQFLAQQTPTCCVALSSFYNDTIVPCPTCSCGCQGNSPQSGSCID  259

Query  957   -KAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
               A     VV          +VQCT HMCPIRVHWH+KL+Y ++WRVK+T+TN+N+  N+
Sbjct  260   PSASHLASVVNGFPKNSITPLVQCTSHMCPIRVHWHIKLNYKEYWRVKVTVTNFNYRMNY  319

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             S WNLVV HPN  N+T++FSFN + +  YG INDT M +G+++YND+L+QAG  GNVQ+E
Sbjct  320   SDWNLVVQHPNFDNLTQLFSFNSKPITPYGSINDTAMLWGVKFYNDLLMQAGPIGNVQSE  379

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             LL  KD + F F +GWAFPRRI FNG+ CV+P PD YP LPN+ 
Sbjct  380   LLFRKD-SNFNFDKGWAFPRRIYFNGDNCVMPPPDAYPWLPNAG  422



>ref|XP_007032846.1| COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored 
protein family [Theobroma cacao]
 gb|EOY03772.1| COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored 
protein family [Theobroma cacao]
Length=432

 Score =   452 bits (1163),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 219/404 (54%), Positives = 287/404 (71%), Gaps = 18/404 (4%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDM  431
              YDPLDPNG++TIKWDI+       V  V++ N+Q+YRHI  PGW L W W    VIW M
Sbjct  19    AYDPLDPNGNVTIKWDIVSWTPDGYVAVVTMNNFQMYRHIMSPGWTLGWTWAKKEVIWSM  78

Query  432   WGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEK  611
              GA+ TEQG+CS FK G  PHCC+K P ++DLLPG  +N+QF NCCKGGVLS+  QDP+ 
Sbjct  79    VGAQTTEQGDCSKFK-GNIPHCCKKTPTVVDLLPGVPYNQQFTNCCKGGVLSAWGQDPQA  137

Query  612   YLAAFQMsigrvssksssgaavaappipgNFTL--GVPGYTCGEAFEVPPTKFVEDHGRR  785
              ++AFQ+SIG   + + +           NFTL    PGYTCG A  VP T F+    RR
Sbjct  138   AVSAFQVSIGLAGTSNKTVKLPK------NFTLLGPGPGYTCGPAKVVPSTTFLTPDRRR  191

Query  786   TTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAG  965
              TQA+ TWN+TC+YSQF A+ +P CCVS S+FYN+TI  CP C CGC+ +     C+K+ 
Sbjct  192   RTQALMTWNVTCTYSQFLARKNPNCCVSFSSFYNETITPCPSCACGCQNK---KNCVKSD  248

Query  966   EQPPVVQLQHYEPPQA----IVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
              +  ++++     P+     ++QCT HMCP+RVHWHVKL+Y  +WRVK++ITN+N+  N+
Sbjct  249   SK--ILKMVGVNTPRKDNAPLLQCTHHMCPVRVHWHVKLNYKDYWRVKVSITNFNYRLNY  306

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             + W+LVV HPNL NVT+VFSF+Y+ L  Y  INDTGMFYG++YYND+L++AG  GNVQ+E
Sbjct  307   TLWSLVVQHPNLNNVTQVFSFDYKPLVPYESINDTGMFYGMKYYNDLLMEAGPFGNVQSE  366

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             +L+ KD  TFTF+EGWAFPR++ FNG+EC+LP PD YP LPNSA
Sbjct  367   VLLQKDQNTFTFKEGWAFPRKVYFNGDECMLPPPDTYPFLPNSA  410



>ref|XP_002892524.1| hypothetical protein ARALYDRAFT_471080 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68783.1| hypothetical protein ARALYDRAFT_471080 [Arabidopsis lyrata subsp. 
lyrata]
Length=456

 Score =   453 bits (1165),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 225/400 (56%), Positives = 277/400 (69%), Gaps = 14/400 (4%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             DGYDPLDP G I IKWD++  +     V V++ N Q YRH++ PGWKLSW W  + VIW+
Sbjct  34    DGYDPLDPFGKIIIKWDLLLSSPGQHHVLVTLENMQEYRHVEKPGWKLSWHWLNNEVIWE  93

Query  429   MWGAEATEQGNCSAF-KSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDP  605
             M GAE TEQGNCSAF  SG  PHCC + P I+DLLPG   N Q  NCC+GGVL+SM+QD 
Sbjct  94    MKGAETTEQGNCSAFASSGNLPHCCLQRPTIVDLLPGASLNVQVANCCRGGVLTSMSQDH  153

Query  606   EKYLAAFQMsigrvssksssgaavaappipgNFTLGVPGYTCGEAFEVPPTKFVEDHGRR  785
               +++AFQM +G                   NF +GVPGY+C  A  V PTKF  D GRR
Sbjct  154   ANHVSAFQMVVGSSPDGPEEFYIPY------NFDIGVPGYSCDNATSVTPTKFSTDKGRR  207

Query  786   TTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAG  965
              TQA+ TW   C YSQFR+  SP CCVSLS FY + IV        C     S+ C+K G
Sbjct  208   KTQALATWEAVCVYSQFRSSQSPKCCVSLSAFYYQNIVP----CPTCSCGCSSSPCVKDG  263

Query  966   EQPPVVQLQH--YEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQ  1139
             E PP ++ +H   E    +V+C+ HMCPIR+HWHVK++Y ++WRVKIT TN+N  KN++ 
Sbjct  264   ELPPYLEQKHDPEEEVSPVVKCSDHMCPIRIHWHVKVNYREYWRVKITATNFNTMKNYTN  323

Query  1140  WNLVVLHPNLGNVTRVFSFNYRTLNQYGD-INDTGMFYGIQYYNDVLLQAGEGGNVQTEL  1316
             WNLVVLHPNL +V +VFSFNY++L  Y + INDTGMF+G+Q+YNDVLLQ G+ GNVQTEL
Sbjct  324   WNLVVLHPNLKSVQQVFSFNYKSLTPYQNGINDTGMFWGVQFYNDVLLQEGKIGNVQTEL  383

Query  1317  LMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLP  1436
             L+ KD   FTFREGWAFPRRI FNG+ECV+P PDD+PRLP
Sbjct  384   LLKKDMGNFTFREGWAFPRRILFNGDECVMPSPDDFPRLP  423



>ref|XP_009780772.1| PREDICTED: COBRA-like protein 1 [Nicotiana sylvestris]
Length=457

 Score =   453 bits (1165),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 221/409 (54%), Positives = 286/409 (70%), Gaps = 22/409 (5%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             D YD LDPNG+ITIKWDII          V+IYN+Q YRHI  PGW+L W W    VIW 
Sbjct  35    DAYDALDPNGNITIKWDIISWTPDGYNAVVTIYNFQKYRHIQAPGWQLGWTWAKKEVIWS  94

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
               G++ATEQG+CS FK G  PHCC+++P I+DLLPGT +N+Q  NCCKGGV+SS  QDP+
Sbjct  95    ATGSQATEQGDCSKFK-GNIPHCCKRDPTIVDLLPGTPYNQQTANCCKGGVISSWVQDPQ  153

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
             K +++FQ+ +G+  + + +           NFTL  PG  YTCG A +  P+KF    GR
Sbjct  154   KAVSSFQLGVGQAGTSNKTVRLPK------NFTLKAPGPGYTCGPAKKGKPSKFPTPDGR  207

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG---QPGSAKC  953
             R TQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN TIV+CP C CGC+    QPG+  C
Sbjct  208   RVTQALMTWNVTCTYSQFLAQKTPTCCVSLSSFYNDTIVNCPTCACGCKNNITQPGT--C  265

Query  954   LKAGEQPPVVQL-----QHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYN  1118
             ++         L       Y P   +V+CT+HMCPIRVHWH+K +Y ++WRVK+TI N+N
Sbjct  266   VEPDSPYLASALVSSGKNDYNP---LVRCTEHMCPIRVHWHIKTNYKEYWRVKLTIQNFN  322

Query  1119  FAKNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGG  1298
             +  N+SQWNLVV HPN  N+T++FSFNY  L  YG INDT MF+GI++YND+L+Q G  G
Sbjct  323   YRMNYSQWNLVVQHPNFDNLTQIFSFNYEPLVSYGSINDTAMFWGIKFYNDLLMQGGPFG  382

Query  1299  NVQTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             NVQ+E++  KD + FTF +GWAFPRR+ FNG+ CV+P PD YP LPN++
Sbjct  383   NVQSEIIFQKDKSRFTFEKGWAFPRRVYFNGDNCVMPPPDAYPYLPNAS  431



>ref|NP_001241986.1| uncharacterized protein LOC100782876 precursor [Glycine max]
 gb|ACU21272.1| unknown [Glycine max]
Length=448

 Score =   452 bits (1164),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 218/407 (54%), Positives = 279/407 (69%), Gaps = 18/407 (4%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             D YDPLDPNG+ITIKWDII       V  V++ N+Q YRHI  PGW + W W    VIW 
Sbjct  28    DAYDPLDPNGNITIKWDIISWTPDGYVAVVTMNNFQQYRHIASPGWSMGWTWAKKEVIWS  87

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G + TEQG+CS FK G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGVLSS  QDP 
Sbjct  88    MMGGQTTEQGDCSKFKGG-IPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVLSSWVQDPT  146

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +++FQ+S+GR  + + +           NFTL  PG  YTCG A  V PTKF+    R
Sbjct  147   NAVSSFQVSVGRAGTTNRTVKVPK------NFTLKAPGPGYTCGPAKIVAPTKFITSDKR  200

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKA  962
             R TQA+ TWN+TC+YSQF AQ +P+CCVSLS+FYN T+V C  C CGC+     +     
Sbjct  201   RVTQALMTWNVTCTYSQFLAQKTPSCCVSLSSFYNDTLVPCLTCACGCQSNSSQSGTCVD  260

Query  963   GEQPPVVQL------QHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFA  1124
              + P +  +       ++ P   +VQCT HMCP+ +HWHVKL+Y ++WRVK+TITNYN+ 
Sbjct  261   PDTPHLASVVAGSGKNNFSP---LVQCTHHMCPVSIHWHVKLNYKEYWRVKVTITNYNYR  317

Query  1125  KNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNV  1304
              N+S+WN+VV HPN  N+T++FSFNY++L  YG INDT M +G+++YND L QA   GNV
Sbjct  318   MNYSEWNMVVQHPNFDNLTQLFSFNYKSLTPYGSINDTAMLWGVKFYNDFLNQADPNGNV  377

Query  1305  QTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             Q+ELL  KD ATFTF +GWAFPRRI FNG+ CV+P PD YP LPN+ 
Sbjct  378   QSELLFRKDKATFTFDKGWAFPRRIYFNGDNCVMPPPDAYPWLPNAG  424



>gb|KHG07276.1| COBRA-like protein 4 [Gossypium arboreum]
 gb|KHG08964.1| COBRA-like protein 4 [Gossypium arboreum]
Length=433

 Score =   452 bits (1162),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 217/407 (53%), Positives = 288/407 (71%), Gaps = 18/407 (4%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDM  431
              YDPLDPNG++TIKWDI+       V  V++ N+Q+YRHI  PGW L W W    VIW M
Sbjct  19    AYDPLDPNGNVTIKWDIVSWTPDGYVAVVTMNNFQMYRHIMSPGWTLGWTWAKKEVIWSM  78

Query  432   WGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEK  611
              GA+ TEQG+CS FK G  PHCC+K P ++DLLPG  +N+QF NCCKGGVL++  QDP+ 
Sbjct  79    VGAQTTEQGDCSKFK-GNIPHCCKKTPTVVDLLPGVPYNQQFTNCCKGGVLAAWGQDPQS  137

Query  612   YLAAFQMsigrvssksssgaavaappipgNFTL--GVPGYTCGEAFEVPPTKFVEDHGRR  785
              ++AFQ+S+G   + + +           NFTL    PGYTCG A  VP T F+    RR
Sbjct  138   AVSAFQISVGLAGTSNKTVKLPK------NFTLLGPGPGYTCGPAKVVPSTTFLTPDRRR  191

Query  786   TTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAG  965
              TQA+ TWN+TC+YSQF A+ +P CCVS S+FYN+TI  CP C CGC+ +     C+K+ 
Sbjct  192   KTQALMTWNVTCTYSQFLARKNPNCCVSFSSFYNETITPCPTCACGCQNK---NNCVKSD  248

Query  966   EQPPVVQLQHYEPPQA----IVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
              +   +++     P+     ++QCT HMCP+RVHWHVKL+Y ++WRVK++ITN+N+  N+
Sbjct  249   SK--FLKMVGLNTPRKDNAPLLQCTHHMCPVRVHWHVKLNYKEYWRVKVSITNFNYRMNY  306

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             + W+LVV HPNL NVT+VFSF+Y+ L  Y  INDTGMFYG++YYND+L++AG  GNVQ+E
Sbjct  307   TLWSLVVQHPNLNNVTQVFSFDYKPLVPYESINDTGMFYGMKYYNDLLMEAGPLGNVQSE  366

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAPPH  1454
             +L+ KD  TFTF++GWAFPR++ FNG+EC+LP PD YP LPNSA  H
Sbjct  367   VLLRKDKDTFTFKQGWAFPRKVYFNGDECMLPPPDTYPFLPNSAHQH  413



>ref|XP_009148279.1| PREDICTED: COBRA-like protein 6 [Brassica rapa]
Length=454

 Score =   452 bits (1163),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 228/399 (57%), Positives = 281/399 (70%), Gaps = 14/399 (4%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDM  431
             GYDPLDP G ITIKWD++  +  +  V V + N Q YRHID PGWKLSW W    VIWDM
Sbjct  40    GYDPLDPFGKITIKWDLLLSSPGHHTVQVKLENMQEYRHIDKPGWKLSWHWESKQVIWDM  99

Query  432   WGAEATEQGNCSAF-KSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
              GAE TEQGNCSAF  SG  PHCC + P I+DLLPG+ FN Q  NCC+GGVL+SM+QD  
Sbjct  100   RGAETTEQGNCSAFASSGTLPHCCLRRPTIVDLLPGSPFNSQVSNCCRGGVLTSMSQDHT  159

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPGYTCGEAFEVPPTKFVEDHGRRT  788
              +++ F M+IG     S      +      NF +GV GY+C  A  V PTK+  D GRR 
Sbjct  160   NHVSVFHMTIGSFPDDSGEFTMPS------NFDIGVSGYSCDNATSVAPTKYSTDKGRRK  213

Query  789   TQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAGE  968
             TQA+ TW   C YSQFR+  +P CCVSLS FY + IV CP C+        S+ C+K GE
Sbjct  214   TQALATWEAVCVYSQFRSSQTPKCCVSLSAFYYRNIVPCPTCS----CGCSSSHCVKPGE  269

Query  969   QPPVVQLQH--YEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQW  1142
              PP ++ +H   E    +V+CT+HMCPI +HWHVK++Y ++WRVKIT TN N  KN++ W
Sbjct  270   MPPYLEQKHDPEEEVPPVVECTKHMCPIHIHWHVKVNYREYWRVKITATNLNTMKNYTDW  329

Query  1143  NLVVLHPNLGNVTRVFSFNYRTLNQYGD-INDTGMFYGIQYYNDVLLQAGEGGNVQTELL  1319
             NLVVLHPNL +V +VFSFNY++L  Y + INDTGMF+G+++YNDVLLQAG+ GNVQTELL
Sbjct  330   NLVVLHPNLKSVEQVFSFNYKSLTPYHNGINDTGMFWGVKFYNDVLLQAGKIGNVQTELL  389

Query  1320  MNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLP  1436
             + KD   F+FREGWAFPRRI FNG+ECV+P PDDYPRLP
Sbjct  390   LKKDMGNFSFREGWAFPRRILFNGDECVMPSPDDYPRLP  428



>gb|AAM62930.1| phytochelatin synthetase-like protein [Arabidopsis thaliana]
Length=456

 Score =   452 bits (1163),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 221/406 (54%), Positives = 282/406 (69%), Gaps = 18/406 (4%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDP G+ITIKWD++       V  V+++N+Q YRHI  PGW L W+W    VIW 
Sbjct  35    EAYDALDPEGNITIKWDVMSWTPDGYVAVVTMFNFQKYRHIQSPGWTLGWKWAKKEVIWS  94

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ TEQG+CS +K G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGV++S  QDP 
Sbjct  95    MVGAQTTEQGDCSKYK-GNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVMNSWVQDPA  153

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                ++FQ+S+G   + + +           NFTL  PG  YTCG A  V PTKFV    R
Sbjct  154   TAASSFQISVGAAGTTNKTVRVPR------NFTLMGPGPGYTCGPAKIVRPTKFVTTDTR  207

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG-QPGSAKCLK  959
             RTTQA+ TWNITC+YSQF AQ +PTCCVSLS+FYN+TIV CP C CGC+  +  S  CL 
Sbjct  208   RTTQAMMTWNITCTYSQFLAQRTPTCCVSLSSFYNETIVGCPTCACGCQNNRTESGACLD  267

Query  960   ------AGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNF  1121
                   A    P  +     PP  +VQCT+HMCPIRVHWHVK +Y ++WRVKITITN+N+
Sbjct  268   PDTPHLASVVSPPTKKGTVLPP--LVQCTRHMCPIRVHWHVKQNYKEYWRVKITITNFNY  325

Query  1122  AKNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGN  1301
               N++QWNLV  HPNL N+T++FSFNY++L  Y  +NDT M +G+++YND L +AG  GN
Sbjct  326   RLNYTQWNLVAQHPNLDNITQIFSFNYKSLTPYAGLNDTAMLWGVKFYNDFLSEAGPLGN  385

Query  1302  VQTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPN  1439
             VQ+E+L  KD +TFTF +GWAFPRRI FNG+ CV+P PD YP LPN
Sbjct  386   VQSEILFRKDQSTFTFEKGWAFPRRIYFNGDNCVMPPPDSYPFLPN  431



>emb|CDY60470.1| BnaAnng16830D [Brassica napus]
Length=458

 Score =   452 bits (1163),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 221/407 (54%), Positives = 282/407 (69%), Gaps = 17/407 (4%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             D YDPLDP+G+ITIKWDII       V TV++YN+Q YRHI  PGW L W W    VIW 
Sbjct  33    DAYDPLDPSGNITIKWDIITWTGDGYVATVTMYNFQQYRHIQAPGWTLGWSWAKREVIWG  92

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G + TEQG+CS FK G  PHCC+K P ++DLLPGT +N+Q  NCC+GGV++S  QDP 
Sbjct  93    MNGGQTTEQGDCSKFK-GTIPHCCKKTPSVVDLLPGTPYNQQVANCCRGGVINSWAQDPA  151

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +++FQ+++G+  + + +           NFTL  PG  YTCG    V P++FV    R
Sbjct  152   TAVSSFQLTVGQAGTTNKTVRVPK------NFTLKAPGPGYTCGPGKIVKPSRFVGTDKR  205

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCE--GQPGSAKCL  956
             R TQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN TIV CP C+CGC    QPG+    
Sbjct  206   RVTQAMMTWNVTCTYSQFLAQRTPTCCVSLSSFYNSTIVPCPTCSCGCRNTSQPGNCVDS  265

Query  957   KAGEQPPVV----QLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFA  1124
             K      VV        Y PP  +VQCT HMCP+R+HWHVK++Y  +WRVK+TITN+N+ 
Sbjct  266   KGPRIASVVVPNTGKSLYVPP--LVQCTNHMCPVRIHWHVKVNYKAYWRVKVTITNFNYN  323

Query  1125  KNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNV  1304
              N+SQWNLVV HPN  N+T+ FSFNY+ L  Y  INDTG+ +G+++YND+L+QAG  GNV
Sbjct  324   MNYSQWNLVVQHPNFDNLTQTFSFNYKPLIPYASINDTGILWGVKFYNDLLMQAGPYGNV  383

Query  1305  QTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             Q+ELL  K+ + FT  +GWAFPRRI FNG+ CV+P PD YP LPN+A
Sbjct  384   QSELLFQKEASAFTLEKGWAFPRRIYFNGDNCVMPPPDSYPWLPNTA  430



>ref|XP_010490321.1| PREDICTED: COBRA-like protein 6 [Camelina sativa]
Length=439

 Score =   451 bits (1161),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 224/399 (56%), Positives = 271/399 (68%), Gaps = 14/399 (4%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDM  431
             GYDPLDP G I IKWD++  +     V V++ N Q YRH++ PGWKLSW W    VIWDM
Sbjct  20    GYDPLDPFGKIIIKWDLLLSSPGRHSVQVTVENMQEYRHVEKPGWKLSWHWLNKEVIWDM  79

Query  432   WGAEATEQGNCSAFKSGQR-PHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
              GAE TEQGNCSAF S    PHCC + P I+DLLPG  +N Q  NCC+GGVL+SM+QD  
Sbjct  80    RGAETTEQGNCSAFASSNNLPHCCLRRPTIVDLLPGASYNLQVSNCCRGGVLTSMSQDHA  139

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPGYTCGEAFEVPPTKFVEDHGRRT  788
              +++ F M IG                   NF +GVPGY+C  A  V PTKF  D GRR 
Sbjct  140   NHVSTFTMDIGSSPDDPEKFNIPY------NFDIGVPGYSCDNATSVAPTKFSTDKGRRK  193

Query  789   TQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAGE  968
              QA+ TW   C YSQFR+  SP CCVSLS FY + IV        C     S+ C+K GE
Sbjct  194   MQALATWEAVCVYSQFRSSQSPKCCVSLSAFYYQNIVP----CPTCSCGCSSSPCVKKGE  249

Query  969   QPPVVQLQH--YEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQW  1142
              PP ++ +H  YE    +V C+ HMCPIR+HWHVK++Y ++WRVKIT TN N  KN++ W
Sbjct  250   MPPYLEQKHDPYEEVSPVVTCSDHMCPIRIHWHVKVNYREYWRVKITATNLNTVKNYTNW  309

Query  1143  NLVVLHPNLGNVTRVFSFNYRTLNQY-GDINDTGMFYGIQYYNDVLLQAGEGGNVQTELL  1319
             NLVVLHPNL +V +VFSFNY++L  Y   INDTGMF+G+Q+YNDVLLQAG+ GNVQTELL
Sbjct  310   NLVVLHPNLKSVQQVFSFNYKSLTPYQNSINDTGMFWGVQFYNDVLLQAGKIGNVQTELL  369

Query  1320  MNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLP  1436
             + KD   FTF+EGWAFPRRI FNG+ECV+P PDDYPRLP
Sbjct  370   LKKDMGNFTFKEGWAFPRRILFNGDECVMPSPDDYPRLP  408



>ref|XP_009147371.1| PREDICTED: COBRA-like protein 1 [Brassica rapa]
Length=455

 Score =   452 bits (1162),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 219/406 (54%), Positives = 283/406 (70%), Gaps = 16/406 (4%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             D YDPLDP+G+ITIKWDII       V TV++YN+Q YRHI  PGW L W W    VIW 
Sbjct  35    DAYDPLDPSGNITIKWDIITWTGDGYVATVTMYNFQQYRHIQAPGWTLGWSWAKREVIWG  94

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G + TEQG+CS FK G  PHCC+K P ++DLLPGT +N+Q  NCC+GGV++S  QDP 
Sbjct  95    MNGGQTTEQGDCSKFK-GTIPHCCKKTPSVVDLLPGTPYNQQVANCCRGGVINSWAQDPA  153

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +++FQ+++G+  + + +           NFTL  PG  YTCG    V P++FV    R
Sbjct  154   TAVSSFQLTVGQAGTTNKTVRVPK------NFTLKAPGPGYTCGPGKIVKPSRFVGTDKR  207

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCE--GQPGS---A  947
             R TQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN TIV CP C+CGC    QPG+   +
Sbjct  208   RVTQAMMTWNVTCTYSQFLAQRTPTCCVSLSSFYNSTIVPCPTCSCGCRNTSQPGNCVDS  267

Query  948   KCLKAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAK  1127
             K  +     P      Y PP  +VQCT HMCP+R+HWHVK++Y  +WRVK+TITN+N+  
Sbjct  268   KGPRIASVVPNTGKSLYVPP--LVQCTNHMCPVRIHWHVKVNYKAYWRVKVTITNFNYNM  325

Query  1128  NFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQ  1307
             N+SQWNLVV HPN  N+T+ FSFNY+ L  Y  INDTG+ +G+++YND+L++AG  GNVQ
Sbjct  326   NYSQWNLVVQHPNFDNLTQTFSFNYKPLIPYASINDTGILWGVKFYNDLLMEAGPYGNVQ  385

Query  1308  TELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             +ELL  K+ + FT  +GWAFPRRI FNG+ CV+P PD YP LPN+A
Sbjct  386   SELLFQKEASAFTLEKGWAFPRRIYFNGDNCVMPPPDSYPWLPNTA  431



>ref|XP_004304207.1| PREDICTED: protein COBRA-like [Fragaria vesca subsp. vesca]
Length=448

 Score =   451 bits (1161),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 222/404 (55%), Positives = 282/404 (70%), Gaps = 14/404 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             D YDPLDPNG+ITIKWDII       V  V+++N+Q YRHI  PGW + W W    VIW+
Sbjct  29    DAYDPLDPNGNITIKWDIISWTPDGYVAVVTLFNFQQYRHIQAPGWTVGWTWAKKEVIWN  88

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G +ATEQG+CS FK    PHCC+K P I+DLLPGT +N+Q+ NCCKGGVLSS  QDP 
Sbjct  89    MVGGQATEQGDCSKFKP-TPPHCCKKTPTIVDLLPGTPYNQQYSNCCKGGVLSSWMQDPS  147

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                A+FQ+S+GR  + + +           N+TL  PG  YTCG A  V PTKF     R
Sbjct  148   NAAASFQLSVGRSGTTNKTVRLPK------NYTLMGPGPGYTCGVAKVVKPTKFFTADKR  201

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG---QPGSAKC  953
             R +QA+ TWN+TC+YSQF AQ +P CCVSLS+FYN T+V CP C+CGC+     PGS   
Sbjct  202   RVSQAMMTWNVTCTYSQFLAQRAPPCCVSLSSFYNDTVVPCPTCSCGCQNNITHPGSCVV  261

Query  954   LKAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
              ++     VV       P  +V+CT HMCPIRVHWH+K +Y ++WRVKITITN+++ +N+
Sbjct  262   PESPYLASVVSAADKNSP--LVRCTSHMCPIRVHWHIKQNYKEYWRVKITITNFDYRRNY  319

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             S WNLVV HPN  N+T VFSFN ++L  YG INDT M +GI+++ND+L+Q+G  GNVQ+E
Sbjct  320   SDWNLVVQHPNFDNLTEVFSFNAKSLTPYGTINDTVMLWGIKFFNDMLVQSGPLGNVQSE  379

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             LL  K+PATFTF +GWAFPRRI FNG+ CV+P PD +P LPN+ 
Sbjct  380   LLFRKNPATFTFDKGWAFPRRIYFNGDTCVMPPPDAFPHLPNAG  423



>ref|XP_009338021.1| PREDICTED: protein COBRA-like [Pyrus x bretschneideri]
Length=456

 Score =   452 bits (1162),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 217/405 (54%), Positives = 279/405 (69%), Gaps = 12/405 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDP G+ITIKWD+I       V  V+++N+Q YRHI  PGW L W W    VIW 
Sbjct  35    EAYDALDPTGNITIKWDVISWTPDGYVAVVTMFNFQQYRHIQAPGWTLGWTWAKKEVIWS  94

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ TEQG+CS +K G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGV+ S  QDP 
Sbjct  95    MVGAQTTEQGDCSKYK-GNVPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVMQSWIQDPP  153

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +++FQ+S+G   + + +           NFTL  PG  Y+CG A  V PT+F+    R
Sbjct  154   NAISSFQVSVGAAGTTNKTVRLPK------NFTLRAPGPGYSCGIAKIVKPTRFLTSDKR  207

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG---QPGSAKC  953
             R TQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN+TIVSCP C CGC+    +PGS   
Sbjct  208   RWTQAMMTWNVTCTYSQFLAQKTPTCCVSLSSFYNETIVSCPTCACGCQNNATEPGSCVE  267

Query  954   LKAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
              K       V          +VQCT HMCPIRVHWHVKL+Y  +WRVK+TITN+N+  N+
Sbjct  268   PKNPYLASAVAGSGKSANTPLVQCTSHMCPIRVHWHVKLNYKDYWRVKVTITNFNYRMNY  327

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             + WNLVV HPN  N+T++FSFNY++L  Y  +NDT M +G+++YND L +AG  GNVQ+E
Sbjct  328   TLWNLVVQHPNFDNLTKIFSFNYKSLTPYVGLNDTAMLWGVKFYNDFLSEAGPLGNVQSE  387

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             LL  KD +TFTF +GWAFPRRI FNG+ CV+P PD YP LPN++P
Sbjct  388   LLFRKDTSTFTFEKGWAFPRRIYFNGDNCVMPPPDAYPWLPNASP  432



>ref|XP_003518180.1| PREDICTED: protein COBRA-like [Glycine max]
Length=458

 Score =   451 bits (1161),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 217/406 (53%), Positives = 285/406 (70%), Gaps = 14/406 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YDPLDPNG+ITIKWDII       V  V++YN+Q YRHI  PGW L W W    VIW 
Sbjct  36    EAYDPLDPNGNITIKWDIISWTPDGYVAVVTMYNFQQYRHISVPGWSLGWTWAKKEVIWS  95

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G + TEQG+CS +K+   PHCC+K P+++DLLPGT +N+Q  NCCKGGVLSS  QD  
Sbjct  96    MIGGQTTEQGDCSKYKA-NIPHCCKKNPIVVDLLPGTPYNQQISNCCKGGVLSSWAQDQS  154

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
             K +AAFQ+S+G  S+ + +           +FTL  PG  YTCG A  V PT+F++   R
Sbjct  155   KAVAAFQVSVGSASTTNKTVKVPK------DFTLKAPGPGYTCGPATIVKPTQFLQPDKR  208

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPG-SAKCLK  959
             R TQA+ TWN+TC+YSQF AQ +P+CCVSLS+FY+ T+V C  C CGC+G    S +C+ 
Sbjct  209   RVTQALMTWNVTCTYSQFLAQRTPSCCVSLSSFYDNTVVPCTTCACGCQGNSSQSGECVD  268

Query  960   AGEQPPVVQLQHYEPPQA----IVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAK  1127
                      + +  P ++    +V+CT+HMCPIRVHWHVKL+Y ++WRVK+T+TN+N+  
Sbjct  269   PDSPHLQSVVSNAGPGKSSITPLVRCTRHMCPIRVHWHVKLNYKEYWRVKVTVTNFNYGM  328

Query  1128  NFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQ  1307
             N+S WNLVV HPN  N+T++FSFNY+ +  YG INDT M +G+++YND L+QAG  GNVQ
Sbjct  329   NYSDWNLVVQHPNFDNLTQLFSFNYKAITPYGSINDTAMLWGLKFYNDFLMQAGPLGNVQ  388

Query  1308  TELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             +ELL  KD +TFTF +GWAFPRR+ FNG+ CV+P PD YP LPN+ 
Sbjct  389   SELLFRKDKSTFTFDKGWAFPRRVYFNGDVCVMPPPDAYPWLPNAG  434



>ref|XP_010031023.1| PREDICTED: COBRA-like protein 1 [Eucalyptus grandis]
 gb|KCW83757.1| hypothetical protein EUGRSUZ_B00628 [Eucalyptus grandis]
Length=447

 Score =   451 bits (1160),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 217/405 (54%), Positives = 282/405 (70%), Gaps = 14/405 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YDP+DP G+IT+KWDI+       V  VS+YN+Q YRHI  PGW+L W W    VIW 
Sbjct  26    EAYDPIDPIGNITVKWDILSWTSDGYVAMVSMYNFQQYRHIQAPGWQLGWTWAKKEVIWS  85

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G +  EQG+CS F  G  PHCC+++P ++DLLPGT FN Q  NCC+GGVLSS  QDP 
Sbjct  86    MSGGQTMEQGDCSKFH-GSIPHCCKRDPTVVDLLPGTPFNLQTANCCRGGVLSSWVQDPL  144

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               ++AFQ+++G   + + +  +         FTL  PG  YTCG    V PT+FV    R
Sbjct  145   NAVSAFQITVGLAGTTNKTVRSPK------KFTLKAPGPGYTCGNPKLVRPTRFVMPDKR  198

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQP-GSAKCLK  959
             R TQA+ TWN+TC+YSQF AQ  PTCCVSLS+FYN T+V+CP CTCGC      S  C++
Sbjct  199   RATQAMMTWNVTCTYSQFLAQKMPTCCVSLSSFYNDTVVNCPRCTCGCRNNATDSGSCIQ  258

Query  960   AGEQPPVVQLQHYEPPQA---IVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKN  1130
             A + P +  +  +    A   ++QCT HMCP+RVHWHVKL+Y + WRVKITITN+N+  N
Sbjct  259   A-DSPHLASVVSHPGKSANAPLLQCTSHMCPVRVHWHVKLNYKEFWRVKITITNFNYRMN  317

Query  1131  FSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQT  1310
             F+QWNLVV HPN  N+T++FSFNY+ L  Y  +NDT M +G++YYND+L++AG  GNVQ+
Sbjct  318   FTQWNLVVQHPNFDNLTQIFSFNYKPLTPYAGLNDTAMLWGVKYYNDLLMEAGPSGNVQS  377

Query  1311  ELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             ELL  KD ++FTF +GWAFPRRI FNG++CV+P PD YP LPNS+
Sbjct  378   ELLFWKDKSSFTFDKGWAFPRRIYFNGDDCVMPPPDAYPWLPNSS  422



>emb|CDY43250.1| BnaC05g48430D [Brassica napus]
Length=457

 Score =   451 bits (1161),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 221/407 (54%), Positives = 282/407 (69%), Gaps = 17/407 (4%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             D YDPLDP+G+ITIKWDII       V TV++YN+Q YRHI  PGW L W W    VIW 
Sbjct  32    DAYDPLDPSGNITIKWDIITWTGDGYVATVTLYNFQQYRHIQAPGWTLGWSWAKREVIWG  91

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G + TEQG+CS FK G  PHCC+K P ++DLLPGT +N+Q  NCC+GGV++S  QDP 
Sbjct  92    MNGGQTTEQGDCSKFK-GTIPHCCKKTPSVVDLLPGTPYNQQVANCCRGGVINSWAQDPA  150

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +++FQ+++G+  + + +           NFTL  PG  YTCG    V P++FV    R
Sbjct  151   TAVSSFQLTVGQAGTTNKTVRVPK------NFTLKAPGPGYTCGPGKIVKPSRFVGTDKR  204

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCE--GQPGSAKCL  956
             R TQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN TIV CP C+CGC    QPG+    
Sbjct  205   RVTQAMMTWNVTCTYSQFLAQRTPTCCVSLSSFYNSTIVPCPTCSCGCRNTSQPGNCVDS  264

Query  957   KAGEQPPVV----QLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFA  1124
             K      VV        Y PP  +VQCT HMCP+R+HWHVK++Y  +WRVK+TITN+N+ 
Sbjct  265   KGPRIASVVVPNTGKSLYVPP--LVQCTNHMCPVRIHWHVKVNYKAYWRVKVTITNFNYN  322

Query  1125  KNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNV  1304
              N+SQWNLVV HPN  N+T+ FSFNY+ L  Y  INDTG+ +G+++YND+L+QAG  GNV
Sbjct  323   MNYSQWNLVVQHPNFDNLTQTFSFNYKPLIPYASINDTGILWGVKFYNDLLMQAGPYGNV  382

Query  1305  QTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             Q+ELL  K+ + FT  +GWAFPRRI FNG+ CV+P PD YP LPN+A
Sbjct  383   QSELLFQKEASAFTLEKGWAFPRRIYFNGDNCVMPPPDSYPWLPNTA  429



>ref|NP_568930.1| glycosylphosphatidylinositol-anchored protein COBRA [Arabidopsis 
thaliana]
 sp|Q94KT8.1|COBRA_ARATH RecName: Full=Protein COBRA; AltName: Full=Cell expansion protein; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAK56072.1|AF319663_1 putative glycosylphosphatidylinositol-anchored protein [Arabidopsis 
thaliana]
 gb|AAM19781.1| AT5g60920/MSL3_40 [Arabidopsis thaliana]
 gb|AAN64510.1| At5g60920/MSL3_40 [Arabidopsis thaliana]
 gb|AED97397.1| glycosylphosphatidylinositol-anchored protein COBRA [Arabidopsis 
thaliana]
Length=456

 Score =   451 bits (1160),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 220/406 (54%), Positives = 282/406 (69%), Gaps = 18/406 (4%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDP G+IT+KWD++       V  V+++N+Q YRHI  PGW L W+W    VIW 
Sbjct  35    EAYDALDPEGNITMKWDVMSWTPDGYVAVVTMFNFQKYRHIQSPGWTLGWKWAKKEVIWS  94

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ TEQG+CS +K G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGV++S  QDP 
Sbjct  95    MVGAQTTEQGDCSKYK-GNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVMNSWVQDPA  153

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                ++FQ+S+G   + + +           NFTL  PG  YTCG A  V PTKFV    R
Sbjct  154   TAASSFQISVGAAGTTNKTVRVPR------NFTLMGPGPGYTCGPAKIVRPTKFVTTDTR  207

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG-QPGSAKCLK  959
             RTTQA+ TWNITC+YSQF AQ +PTCCVSLS+FYN+TIV CP C CGC+  +  S  CL 
Sbjct  208   RTTQAMMTWNITCTYSQFLAQRTPTCCVSLSSFYNETIVGCPTCACGCQNNRTESGACLD  267

Query  960   ------AGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNF  1121
                   A    P  +     PP  +VQCT+HMCPIRVHWHVK +Y ++WRVKITITN+N+
Sbjct  268   PDTPHLASVVSPPTKKGTVLPP--LVQCTRHMCPIRVHWHVKQNYKEYWRVKITITNFNY  325

Query  1122  AKNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGN  1301
               N++QWNLV  HPNL N+T++FSFNY++L  Y  +NDT M +G+++YND L +AG  GN
Sbjct  326   RLNYTQWNLVAQHPNLDNITQIFSFNYKSLTPYAGLNDTAMLWGVKFYNDFLSEAGPLGN  385

Query  1302  VQTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPN  1439
             VQ+E+L  KD +TFTF +GWAFPRRI FNG+ CV+P PD YP LPN
Sbjct  386   VQSEILFRKDQSTFTFEKGWAFPRRIYFNGDNCVMPPPDSYPFLPN  431



>ref|XP_010475826.1| PREDICTED: COBRA-like protein 6 [Camelina sativa]
Length=440

 Score =   451 bits (1159),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 225/399 (56%), Positives = 271/399 (68%), Gaps = 14/399 (4%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDM  431
             GYDPLDP G I IKWD++  +     V V + N Q YRH++ PGWKLSW W    VIWDM
Sbjct  20    GYDPLDPFGKIIIKWDLLLSSPGRHSVQVIVENMQEYRHVEKPGWKLSWHWLNKEVIWDM  79

Query  432   WGAEATEQGNCSAFKSGQR-PHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
              GAE TEQGNCSAF S    PHCC   P I+DLLPG  +N Q  NCC+GGVL+SM+QD  
Sbjct  80    RGAETTEQGNCSAFASSNNLPHCCLPRPTIVDLLPGASYNLQVSNCCRGGVLTSMSQDHA  139

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPGYTCGEAFEVPPTKFVEDHGRRT  788
              +++ F M IG         +         NF +GVPGY+C  A  V PTKF  D GRR 
Sbjct  140   NHVSTFTMDIGSSPDGPEEFSIPY------NFDIGVPGYSCDNATSVAPTKFSTDKGRRK  193

Query  789   TQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAGE  968
             TQA+ TW   C YSQFR+  SP CCVSLS FY + IV        C     S+ C+K GE
Sbjct  194   TQALATWEAVCVYSQFRSSQSPKCCVSLSAFYYQNIVP----CPTCSCGCSSSPCVKKGE  249

Query  969   QPPVVQLQH--YEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQW  1142
              PP ++ +H  YE    +V C+ HMCPIR+HWHVK++Y ++WRVKIT TN N  KN++ W
Sbjct  250   MPPYLEQKHDPYEEVSPVVTCSDHMCPIRIHWHVKVNYREYWRVKITATNLNTMKNYTNW  309

Query  1143  NLVVLHPNLGNVTRVFSFNYRTLNQY-GDINDTGMFYGIQYYNDVLLQAGEGGNVQTELL  1319
             NLVVLHPNL +V +VFSFNY++L  Y   INDTGMF+G+Q+YNDVLLQAG+ GNVQTELL
Sbjct  310   NLVVLHPNLKSVQQVFSFNYKSLTPYQNSINDTGMFWGVQFYNDVLLQAGKIGNVQTELL  369

Query  1320  MNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLP  1436
             + KD   FTF+EGWAFPRRI FNG+ECV+P PDDYPRLP
Sbjct  370   LKKDMGNFTFKEGWAFPRRILFNGDECVMPSPDDYPRLP  408



>ref|XP_003543887.1| PREDICTED: protein COBRA-like isoform X1 [Glycine max]
Length=458

 Score =   451 bits (1160),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 217/406 (53%), Positives = 284/406 (70%), Gaps = 14/406 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YDPLDPNG+ITIKWDII       V  V++YN+Q YRHI  PGW L W W    VIW 
Sbjct  36    EAYDPLDPNGNITIKWDIISWTPDGYVAVVTMYNFQQYRHISAPGWSLGWTWAKKEVIWS  95

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G + TEQG+CS +K+   PHCC+K P+++DLLPGT +N+Q  NCCKGGVLSS  QD  
Sbjct  96    MMGGQTTEQGDCSKYKA-NIPHCCKKNPIVVDLLPGTPYNQQISNCCKGGVLSSWAQDQS  154

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
             K +AAFQ+S+G  S+ + +           +FTL  PG  YTCG A  V PT+F++   R
Sbjct  155   KAVAAFQVSVGSASTTNKTVKVPK------DFTLKAPGPGYTCGPATIVKPTQFLQPDKR  208

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPG-SAKCLK  959
             R TQA+ TWN+TC+YSQF AQ +P+CCVSLS+FYN T+V C  C CGC+G    S +C+ 
Sbjct  209   RVTQALMTWNVTCTYSQFLAQRTPSCCVSLSSFYNNTVVPCTTCACGCQGNSSQSGECVD  268

Query  960   AGEQPPVVQLQHYEPPQA----IVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAK  1127
                      + +  P ++    +V+CT+HMCPIRVHWHVKL+Y ++WRVK+T+TN+N+  
Sbjct  269   PDSPHLQSVVSNAGPGKSSITPLVRCTRHMCPIRVHWHVKLNYKEYWRVKVTVTNFNYGM  328

Query  1128  NFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQ  1307
             N+S WNLVV HPN  N+T++FSFNY+ +  YG INDT M +G+++YND L+QAG  GNVQ
Sbjct  329   NYSDWNLVVQHPNFDNLTQLFSFNYKAITPYGSINDTAMLWGLKFYNDFLMQAGPLGNVQ  388

Query  1308  TELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             +ELL  KD +TFTF +GWAFPRR+ FNG+ CV+  PD YP LPN+ 
Sbjct  389   SELLFRKDKSTFTFDKGWAFPRRVYFNGDVCVMSPPDAYPWLPNAG  434



>gb|KHN04371.1| COBRA-like protein 4 [Glycine soja]
Length=431

 Score =   450 bits (1157),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 214/405 (53%), Positives = 287/405 (71%), Gaps = 18/405 (4%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDM  431
              YDPLDPNG++TIKWD++       V  V+++N+Q++RHI +PGW L W W    VIW M
Sbjct  19    AYDPLDPNGNVTIKWDVMSWTPDGYVAVVTMHNFQMFRHIMNPGWTLGWTWAKKEVIWSM  78

Query  432   WGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEK  611
              GA+ TEQG+CS FK G  PHCC+K P ++DLLPG  +N+QF NCCKGGV+++  QDP +
Sbjct  79    IGAQTTEQGDCSKFK-GNIPHCCKKIPTVVDLLPGVPYNQQFSNCCKGGVVAAWGQDPSQ  137

Query  612   YLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGRR  785
              +++FQ+S+G+  + + +           NFTL  PG  YTCG A  VP T F+    RR
Sbjct  138   AISSFQVSVGQAGTSNKTVKLPK------NFTLFAPGPGYTCGPAKIVPSTNFLTPDKRR  191

Query  786   TTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAG  965
              TQA+ TWN+TC+YSQF A+ +P+CCVSLS+FYN+TI  CP C CGC+ +     C+K  
Sbjct  192   KTQALMTWNVTCTYSQFLARKNPSCCVSLSSFYNETITPCPSCACGCQNK---KHCVKGN  248

Query  966   EQPPVVQLQHYEPPQA----IVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
              +  ++ +     P+     ++QCT HMCPIRVHWHVK +Y  +WRVK+ ITN+N+  N 
Sbjct  249   SK--ILSMVGVHTPKKDNEPLLQCTHHMCPIRVHWHVKTNYKDYWRVKVAITNFNYRMNH  306

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             S W+L V HPNL N+T+VFSFNY+ L  YG INDTGMFYG++Y+ND+L++AG  GNVQ+E
Sbjct  307   SLWSLAVQHPNLNNLTQVFSFNYKPLLPYGSINDTGMFYGMKYFNDLLMEAGPTGNVQSE  366

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             LL+ KD   FTF++GWAFPR++ FNG+EC+LP PD YP LPNSAP
Sbjct  367   LLLQKDKDAFTFKQGWAFPRKVYFNGDECMLPPPDTYPFLPNSAP  411



>ref|XP_009110800.1| PREDICTED: COBRA-like protein 6 [Brassica rapa]
Length=433

 Score =   450 bits (1157),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 224/400 (56%), Positives = 279/400 (70%), Gaps = 14/400 (4%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDM  431
             G+DPLDP G +TIKWD+ + +  +  V V I N Q YRH++ PGWKLSW W    VIWDM
Sbjct  21    GFDPLDPYGEMTIKWDLQQSSPGHHTVLVKIENKQEYRHVEKPGWKLSWHWVNKTVIWDM  80

Query  432   WGAEATEQGNCSAFKSGQR-PHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
              GAE TEQGNCSAF S +  PHCC + P I+DLLPG  FN Q  NCC+GGVL+SM+QD  
Sbjct  81    RGAETTEQGNCSAFASSETLPHCCLRRPTIVDLLPGAPFNMQVSNCCRGGVLTSMSQDRI  140

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPGYTCGEAFEVPPTKFVEDHGRRT  788
              Y++AF M+IG                   +F +GVPGYTCG A  V PTK+  D GRR 
Sbjct  141   NYVSAFHMTIGSFPGDPGEFIMPY------DFDIGVPGYTCGNATSVDPTKYSTDKGRRK  194

Query  789   TQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAGE  968
             TQA+ TW   C YSQ ++  SP CCVSLS FY + IV CP C+        S+ C+K G 
Sbjct  195   TQALATWEAECVYSQTKSSQSPKCCVSLSAFYYQNIVPCPTCS----CGCSSSNCVKPGV  250

Query  969   QPPVVQLQH--YEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQW  1142
              PP+++ +H  +     +VQCT HMCPI +HWHVK++Y ++WRVKIT TN N  +N+S W
Sbjct  251   VPPLLEQKHDPHVEVSPVVQCTNHMCPIHIHWHVKVNYKKYWRVKITATNLNTMRNYSDW  310

Query  1143  NLVVLHPNLGNVTRVFSFNYRTLN-QYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTELL  1319
             NLVVLHPNL NVT+VFSFNY+ +   +  INDTGMF+G+++YNDVLLQAGE GNVQTE+L
Sbjct  311   NLVVLHPNLNNVTQVFSFNYKPMTPLHKSINDTGMFWGLKFYNDVLLQAGEFGNVQTEIL  370

Query  1320  MNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPN  1439
             + KD  +FTF++GW FPRRI FNG+ECV+P PDDYPRLPN
Sbjct  371   LEKDMGSFTFKDGWGFPRRILFNGDECVMPSPDDYPRLPN  410



>ref|XP_008393240.1| PREDICTED: protein COBRA-like [Malus domestica]
Length=456

 Score =   451 bits (1159),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 217/405 (54%), Positives = 278/405 (69%), Gaps = 12/405 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDP G+ITIKWD+I       V  V+++N+Q YRHI  PGW L W W    VIW 
Sbjct  35    EAYDALDPTGNITIKWDVISWTPDGYVAVVTMFNFQQYRHIQAPGWTLGWTWAKKEVIWS  94

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ TEQG+CS +K G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGV+ S  QDP 
Sbjct  95    MVGAQTTEQGDCSKYK-GNVPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVMQSWIQDPP  153

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +++FQ+S+G   + + +           NFTL  PG  Y+CG A  V PT+F+    R
Sbjct  154   NAISSFQVSVGAAGTTNKTVRLPK------NFTLRAPGPGYSCGIAKIVKPTRFLTSDKR  207

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQ---PGSAKC  953
             R TQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN+TIVSCP C CGC+     PGS   
Sbjct  208   RWTQAMMTWNVTCTYSQFLAQKTPTCCVSLSSFYNETIVSCPTCACGCQNNATDPGSCVE  267

Query  954   LKAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
              K       V          +VQCT HMCPIRVHWHVKL+Y  +WRVK+TITN+N+  N+
Sbjct  268   PKNPYLASAVAGSGKSANTPLVQCTSHMCPIRVHWHVKLNYKDYWRVKVTITNFNYRMNY  327

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             + WNLVV HPN  N+T++FSFNY++L  Y  +NDT M +G+++YND L +AG  GNVQ+E
Sbjct  328   TLWNLVVQHPNFDNLTKIFSFNYKSLTPYVGLNDTAMLWGVKFYNDFLSEAGPLGNVQSE  387

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             LL  KD +TFTF +GWAFPRRI FNG+ CV+P PD YP LPN++P
Sbjct  388   LLFRKDTSTFTFEKGWAFPRRIYFNGDNCVMPPPDAYPWLPNASP  432



>ref|XP_003554956.1| PREDICTED: COBRA-like protein 4-like [Glycine max]
Length=431

 Score =   450 bits (1157),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 214/405 (53%), Positives = 287/405 (71%), Gaps = 18/405 (4%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDM  431
              YDPLDPNG++TIKWD++       V  V+++N+Q++RHI +PGW L W W    VIW M
Sbjct  19    AYDPLDPNGNVTIKWDLMSWTPDGYVAVVTMHNFQMFRHIMNPGWTLGWTWAKKEVIWSM  78

Query  432   WGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEK  611
              GA+ TEQG+CS FK G  PHCC+K P ++DLLPG  +N+QF NCCKGGV+++  QDP +
Sbjct  79    IGAQTTEQGDCSKFK-GNIPHCCKKIPTVVDLLPGVPYNQQFSNCCKGGVVAAWGQDPSQ  137

Query  612   YLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGRR  785
              +++FQ+S+G+  + + +           NFTL  PG  YTCG A  VP T F+    RR
Sbjct  138   AISSFQVSVGQAGTSNKTVKLPK------NFTLFAPGPGYTCGPAKIVPSTNFLTPDKRR  191

Query  786   TTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAG  965
              TQA+ TWN+TC+YSQF A+ +P+CCVSLS+FYN+TI  CP C CGC+ +     C+K  
Sbjct  192   KTQALMTWNVTCTYSQFLARKNPSCCVSLSSFYNETITPCPSCACGCQNK---KHCVKGN  248

Query  966   EQPPVVQLQHYEPPQA----IVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
              +  ++ +     P+     ++QCT HMCPIRVHWHVK +Y  +WRVK+ ITN+N+  N 
Sbjct  249   SK--ILSMVGVHTPKKDNEPLLQCTHHMCPIRVHWHVKTNYKDYWRVKVAITNFNYRMNH  306

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             S W+L V HPNL N+T+VFSFNY+ L  YG INDTGMFYG++Y+ND+L++AG  GNVQ+E
Sbjct  307   SLWSLAVQHPNLNNLTQVFSFNYKPLLPYGSINDTGMFYGMKYFNDLLMEAGPTGNVQSE  366

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             LL+ KD   FTF++GWAFPR++ FNG+EC+LP PD YP LPNSAP
Sbjct  367   LLLQKDKDAFTFKQGWAFPRKVYFNGDECMLPPPDTYPFLPNSAP  411



>ref|XP_010459308.1| PREDICTED: COBRA-like protein 1 [Camelina sativa]
Length=451

 Score =   450 bits (1158),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 219/406 (54%), Positives = 281/406 (69%), Gaps = 16/406 (4%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YDPLDP+G+ITIKWDI+       V  V+IYN+Q YRHI  PGW L W W    VIW 
Sbjct  30    EAYDPLDPSGNITIKWDIMTWTADGYVAVVTIYNFQQYRHIQAPGWTLGWSWAKREVIWG  89

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G + TEQG+CS FK G  PHCC+K P ++DLLPGT +N+Q  NCC+GGV++S  QDP 
Sbjct  90    MNGGQTTEQGDCSKFK-GNIPHCCKKTPSVVDLLPGTPYNQQIANCCRGGVINSWAQDPA  148

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               ++AFQ+++G+  + + +           NFTL  PG  YTC     V PT+F+    R
Sbjct  149   TAVSAFQLTVGQAGTTNKTVRVPK------NFTLKAPGPGYTCSPGKIVKPTRFIGTDKR  202

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCE--GQPGSA---  947
             R TQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN TIVSCP C+CGC    QPG+    
Sbjct  203   RVTQALMTWNVTCTYSQFLAQKTPTCCVSLSSFYNSTIVSCPTCSCGCRNTSQPGNCVDP  262

Query  948   KCLKAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAK  1127
             K  +     P      Y PP  +VQCT HMCP+R+HWHVK++Y  +WRVK+TITN+N+  
Sbjct  263   KGPRIASVIPNPGKNAYIPP--LVQCTHHMCPVRIHWHVKVNYKLYWRVKVTITNFNYNM  320

Query  1128  NFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQ  1307
             N++QWNLVV HPN  N+T+ FSFNY+ L  Y  INDTG+ +GI++YND+L++AG  GNVQ
Sbjct  321   NYTQWNLVVQHPNFDNLTQTFSFNYKPLTPYASINDTGILWGIKFYNDLLMKAGPFGNVQ  380

Query  1308  TELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             +ELL  KD + FTF +GWAFPRRI FNG+ CV+P PD YP LPN+ 
Sbjct  381   SELLFQKDASAFTFEKGWAFPRRIYFNGDNCVMPPPDSYPWLPNTG  426



>ref|XP_006603925.1| PREDICTED: protein COBRA-like [Glycine max]
 gb|KHN04372.1| Protein COBRA [Glycine soja]
Length=454

 Score =   450 bits (1158),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 216/407 (53%), Positives = 280/407 (69%), Gaps = 15/407 (4%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YDPLDP G+ITIKWDII       V  V++ N+Q YRHI  PGW L W W    VIW 
Sbjct  31    EAYDPLDPYGNITIKWDIISWTPDGYVAVVTMNNFQQYRHISEPGWSLGWTWAKKEVIWS  90

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G + TEQG+CS +K G  PHCC+K PV++DLLPGT +N+Q  NCCKGGVLSS  QD  
Sbjct  91    MVGGQTTEQGDCSKYK-GNIPHCCKKNPVVVDLLPGTPYNQQIANCCKGGVLSSWAQDQS  149

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
             K ++AFQ+S+G   + + +           +FTL  PG  YTCG A  V PT F++   R
Sbjct  150   KAVSAFQVSVGSAGTTNKTVKLPK------DFTLKAPGPGYTCGPATIVKPTLFIQPDKR  203

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGS-AKCLK  959
             R TQA+ TWN+TC+YSQF AQ +P+CCVSLS+FYN T+V C  C CGC+G      +C+ 
Sbjct  204   RVTQALMTWNVTCTYSQFLAQRTPSCCVSLSSFYNDTVVPCTTCACGCQGNSSQLGECVD  263

Query  960   AGEQPPVVQLQHYEPP-----QAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFA  1124
                 P +  +     P       +V+CT+HMCPIRVHWHVKL+Y ++WRVK+T+TN+N+ 
Sbjct  264   PDSSPHLQSVVSNPGPGKSSITPLVRCTRHMCPIRVHWHVKLNYKEYWRVKVTVTNFNYG  323

Query  1125  KNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNV  1304
              N+S WNLVV HPN  N+T++FSFNY+++  YG INDT M +G+++YND L+QAG  GNV
Sbjct  324   MNYSNWNLVVQHPNFDNLTQLFSFNYKSITPYGSINDTAMLWGVKFYNDFLMQAGPLGNV  383

Query  1305  QTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             Q+ELL  KD +TFTF +GWAFPRR+ FNG+ CV+P PD YP LPN+ 
Sbjct  384   QSELLFRKDKSTFTFDKGWAFPRRVYFNGDVCVMPPPDSYPWLPNAG  430



>gb|EMT25608.1| hypothetical protein F775_09574 [Aegilops tauschii]
Length=461

 Score =   451 bits (1159),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 226/406 (56%), Positives = 278/406 (68%), Gaps = 13/406 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YDPLDP G+ITIKWDI +      +  VSI NYQ YRHI  PGW L W W    VIW 
Sbjct  29    EAYDPLDPTGNITIKWDITQWTADGYIAVVSINNYQKYRHIQAPGWHLGWAWTKKEVIWG  88

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+  EQG+CS FK G  PHCC ++P  +DLLPG     Q  NCCKGGVLSS  QDP 
Sbjct  89    MMGAQTIEQGDCSQFK-GNIPHCCRRDPTTVDLLPGAPNGMQVGNCCKGGVLSSWVQDPV  147

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEV-PPTKFVEDHG  779
               +A+FQ+++GR  + + +  A        NFTL  PG  YTCG A +V PPTKF+   G
Sbjct  148   NAVASFQITVGRSGTSNRTVKAPK------NFTLKAPGPGYTCGAAQKVKPPTKFISPDG  201

Query  780   RRTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQ---PGSAK  950
             RRTTQA  TW++ C+YSQF AQ  P CCV+LS+FYN+TIV CP C+CGC+     PGS  
Sbjct  202   RRTTQAHVTWDVICTYSQFVAQRGPACCVALSSFYNETIVDCPKCSCGCQNNITNPGSCV  261

Query  951   CLKAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKN  1130
              + +     VV          +V+C+ HMCPI+VHWHVK +Y  +WRVKITI+N+N+  N
Sbjct  262   EVNSPYLASVVNGPGKGSSTPLVRCSPHMCPIKVHWHVKANYRDYWRVKITISNWNYRTN  321

Query  1131  FSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQT  1310
             +SQWNLVV HPN  NVT +FSFNY+ LN YG INDT M +G++YYND+L+ AG  GNVQ+
Sbjct  322   YSQWNLVVQHPNFDNVTTIFSFNYKALNPYGVINDTAMLWGLKYYNDLLMVAGPNGNVQS  381

Query  1311  ELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             ELL  KDP+TFTF +GW FPRRI FNGE CV+PQPD YP LP+S+P
Sbjct  382   ELLFRKDPSTFTFEKGWGFPRRIYFNGESCVMPQPDLYPWLPSSSP  427



>ref|XP_002866404.1| hypothetical protein ARALYDRAFT_496244 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42663.1| hypothetical protein ARALYDRAFT_496244 [Arabidopsis lyrata subsp. 
lyrata]
Length=456

 Score =   450 bits (1158),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 220/406 (54%), Positives = 282/406 (69%), Gaps = 18/406 (4%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDP G+IT+KWD++       V  V+++N+Q YRHI  PGW L W+W    VIW 
Sbjct  35    EAYDALDPEGNITMKWDVMSWTPDGYVAVVTMFNFQKYRHIQSPGWTLGWKWAKKEVIWS  94

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ TEQG+CS +K G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGV++S  QDP 
Sbjct  95    MVGAQTTEQGDCSKYK-GNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVMNSWVQDPA  153

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTL--GVPGYTCGEAFEVPPTKFVEDHGR  782
                ++FQ+S+G   + + +           NFTL    PGYTCG A  V PTKFV    R
Sbjct  154   TAASSFQISVGAAGTTNKTVRVPR------NFTLLGPGPGYTCGPAKIVRPTKFVTTDTR  207

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG-QPGSAKCLK  959
             RTTQA+ TWNITC+YSQF AQ +PTCCVSLS+FYN+TIV CP C CGC+  +  S  CL 
Sbjct  208   RTTQAMMTWNITCTYSQFLAQRTPTCCVSLSSFYNETIVGCPTCACGCQNNKTESGACLD  267

Query  960   ------AGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNF  1121
                   A    P  +     PP  +VQCT+HMCPIRVHWHVK +Y ++WRVKITITN+N+
Sbjct  268   PDTPHLASVVSPPTKKGTVLPP--LVQCTRHMCPIRVHWHVKQNYKEYWRVKITITNFNY  325

Query  1122  AKNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGN  1301
               N++QWNLV  HPNL N+T++FSFNY++L  Y  +NDT M +G+++YND L +AG  GN
Sbjct  326   RLNYTQWNLVAQHPNLDNITQIFSFNYKSLTPYAGLNDTAMLWGVKFYNDFLSEAGPLGN  385

Query  1302  VQTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPN  1439
             VQ+E+L  KD +TFTF +GWAFPRRI FNG+ CV+P PD YP LPN
Sbjct  386   VQSEILFRKDQSTFTFEKGWAFPRRIYFNGDNCVMPPPDSYPFLPN  431



>ref|XP_008453301.1| PREDICTED: COBRA-like protein 4 [Cucumis melo]
Length=456

 Score =   450 bits (1158),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 216/405 (53%), Positives = 284/405 (70%), Gaps = 18/405 (4%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDM  431
              YDPLDPNG+ITIKWD++       V  V++ N+Q+YRHI+ PGW L W W    VIW M
Sbjct  43    AYDPLDPNGNITIKWDVVSWTPDGYVAVVTMNNFQMYRHINSPGWTLGWSWAKKEVIWSM  102

Query  432   WGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEK  611
              GA+ TEQG+CS FK G  PHCC+K P ++DLLPG  +N+QF NCCKGGVL+S  QDP  
Sbjct  103   VGAQTTEQGDCSKFK-GNVPHCCKKTPTVVDLLPGVPYNQQFSNCCKGGVLASWGQDPTS  161

Query  612   YLAAFQMsigrvssksssgaavaappipgNFTL--GVPGYTCGEAFEVPPTKFVEDHGRR  785
              ++AFQ+S+G   + + +           NFTL    PGYTCG A  VP T F+    RR
Sbjct  162   SVSAFQVSVGLAGTSNKTVKLPK------NFTLLGPGPGYTCGPAKVVPSTVFLTPDRRR  215

Query  786   TTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAG  965
              TQA+ TWN+TC+YSQF A  +PTCCVSLSTFYN TI SCP C CGC+ +     C+K+ 
Sbjct  216   KTQALMTWNVTCTYSQFLASKNPTCCVSLSTFYNDTITSCPTCACGCQNK---HNCIKSD  272

Query  966   EQPPVVQLQHYEPPQA----IVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
              +  ++  +    P+     ++QCT HMCP+RVHWHVK++Y  +WRVK+ +TN+N+  N+
Sbjct  273   SK--LLHKEGINTPKKDNTPLLQCTHHMCPVRVHWHVKINYKDYWRVKVAVTNFNYRMNY  330

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             + W L V HPNL NVT+VFSF+Y+ L  Y  INDTGMFYG+++YND+L++AG  GNVQ+E
Sbjct  331   TLWTLAVQHPNLNNVTQVFSFDYKPLVPYESINDTGMFYGMKFYNDLLMEAGPFGNVQSE  390

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             +LM KD  TFTF++GWAFPR++ FNG+EC +P P+ YP LPNS+P
Sbjct  391   VLMKKDKDTFTFKQGWAFPRKVYFNGDECQMPPPESYPFLPNSSP  435



>ref|XP_006306034.1| hypothetical protein CARUB_v10011331mg [Capsella rubella]
 gb|EOA38932.1| hypothetical protein CARUB_v10011331mg [Capsella rubella]
Length=442

 Score =   450 bits (1157),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 225/399 (56%), Positives = 273/399 (68%), Gaps = 14/399 (4%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDM  431
             GYDPLDP G I IKWD++  +     V V++ N Q YRH++ PGWKLSW W    VIWDM
Sbjct  24    GYDPLDPFGKIIIKWDLLLSSPGRHSVQVTVENMQEYRHVEKPGWKLSWHWLNKEVIWDM  83

Query  432   WGAEATEQGNCSAFKSGQR-PHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
              GAE TEQGNCSAF S    PHCC   P I+DLLPG  +N Q  NCC+GGVL+SM+QD  
Sbjct  84    RGAETTEQGNCSAFASSSNLPHCCLHRPTIVDLLPGAPYNLQVSNCCRGGVLTSMSQDHA  143

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPGYTCGEAFEVPPTKFVEDHGRRT  788
              ++++F M IG                   NF +GVPGY+C  A  V PTKF  D GRR 
Sbjct  144   HHVSSFTMDIGSSPDDPEEFNIPY------NFDIGVPGYSCDNATSVSPTKFSTDKGRRK  197

Query  789   TQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAGE  968
             TQA+ TW   C YSQFR+  SP CCVSLS+FY + IV        C     S+ C+K GE
Sbjct  198   TQALATWEAVCVYSQFRSSQSPKCCVSLSSFYYQNIVP----CPTCSCGCSSSPCVKKGE  253

Query  969   QPPVVQLQH--YEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNFSQW  1142
              PP ++ +H   E    +V C+ HMCPIR+HWHVK++Y ++WRVKIT TN+N  KN+S W
Sbjct  254   LPPYLEQKHDIEEEVSPVVTCSNHMCPIRIHWHVKVNYREYWRVKITATNFNTMKNYSNW  313

Query  1143  NLVVLHPNLGNVTRVFSFNYRTLNQY-GDINDTGMFYGIQYYNDVLLQAGEGGNVQTELL  1319
             NLVVLHPNL +V +VFSFNY++L  Y   INDTGMF+G+Q+YNDVLLQAG+ GNVQTELL
Sbjct  314   NLVVLHPNLKSVQQVFSFNYKSLTPYQNSINDTGMFWGVQFYNDVLLQAGKIGNVQTELL  373

Query  1320  MNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLP  1436
             + KD   FTF+EGWAFPRRI FNG+ECV+P PDDYPRLP
Sbjct  374   LKKDMGNFTFKEGWAFPRRILFNGDECVMPSPDDYPRLP  412



>gb|EYU34590.1| hypothetical protein MIMGU_mgv1a006245mg [Erythranthe guttata]
Length=451

 Score =   450 bits (1157),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 223/405 (55%), Positives = 280/405 (69%), Gaps = 13/405 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDPNG+ITIKWD+        V  V+++N+Q YRHI  PGW L W W    VIW 
Sbjct  32    EAYDALDPNGNITIKWDVTSWTADGYVALVTMFNFQQYRHIQAPGWTLGWTWAKKEVIWS  91

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G + TEQG+CS FK G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGV++S  QDP 
Sbjct  92    MMGGQTTEQGDCSRFK-GNIPHCCKKDPTVVDLLPGTPYNQQIGNCCKGGVINSWAQDPS  150

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                +AFQ+S+G   + + +           NFTL  PG  YTCG A  V PTK++   GR
Sbjct  151   NSASAFQVSVGGAGTTNKTVKLPR------NFTLRAPGPGYTCGPAKIVKPTKYLTGDGR  204

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQ---PGSAKC  953
             R TQA+ TWNITC+YSQF AQ +P+CCVSLS+FYN TIV CP CTCGC+     PGS   
Sbjct  205   RVTQAMMTWNITCTYSQFLAQKTPSCCVSLSSFYNDTIVPCPTCTCGCQNNLTNPGSCVN  264

Query  954   LKAGEQPPVVQLQHYEPPQA-IVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKN  1130
               +     VV  +      A +VQCT HMCP+RVHWHVKL+Y  +WRVK+TITN+N+  N
Sbjct  265   PDSPYLASVVSERGKSNNMAPLVQCTSHMCPVRVHWHVKLNYKDYWRVKVTITNFNYRMN  324

Query  1131  FSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQT  1310
             +SQWNLVV HPN  N+T++FSFNY+ LN Y +INDT M +G+++YND L QAG  GNVQ+
Sbjct  325   YSQWNLVVQHPNFDNLTQLFSFNYKPLNPYQNINDTAMLWGVKFYNDFLNQAGPLGNVQS  384

Query  1311  ELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             ELL  KD +TFTF +GW FPRRI FNG+ CV+P P+ YP LPNS+
Sbjct  385   ELLFRKDKSTFTFDKGWGFPRRIYFNGDNCVMPPPEAYPYLPNSS  429



>gb|KFK27869.1| hypothetical protein AALP_AA8G439700 [Arabis alpina]
Length=455

 Score =   450 bits (1158),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 219/406 (54%), Positives = 282/406 (69%), Gaps = 18/406 (4%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDP G+IT+KWD++       V  V+++N+Q YRHI  PGW L W+W    VIW 
Sbjct  35    EAYDALDPEGNITMKWDVMSWTPDGYVAVVTMFNFQKYRHIQTPGWTLGWKWAKKEVIWS  94

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ TEQG+CS +K G  PHCC+K+P ++DLLPGT +N+Q  NCC+GGV++S  QDP 
Sbjct  95    MVGAQTTEQGDCSKYK-GNIPHCCKKDPTVVDLLPGTPYNQQIANCCRGGVMNSWVQDPA  153

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                ++FQ+S+G   + + +           NFTL  PG  YTCG A  V PTKFV    R
Sbjct  154   TAASSFQISVGAAGTTNKTVRVPR------NFTLMGPGPGYTCGPAKIVKPTKFVTTDTR  207

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG-QPGSAKCLK  959
             RTTQA+ TWNITC+YSQF AQ +PTCCVSLS+FYN+TIV CP C CGC+  +  S  CL 
Sbjct  208   RTTQAMMTWNITCTYSQFLAQRTPTCCVSLSSFYNETIVGCPTCACGCQNNKTESGACLD  267

Query  960   ------AGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNF  1121
                   A    P  +     PP  +VQCT+HMCPIRVHWHVK +Y ++WRVKITITN+N+
Sbjct  268   PDTPHLASVVSPPTKKGVILPP--LVQCTRHMCPIRVHWHVKQNYKEYWRVKITITNFNY  325

Query  1122  AKNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGN  1301
               N++QWNLV  HPNL N+T++FSFNY++L  Y  +NDT M +G+++YND L +AG  GN
Sbjct  326   RLNYTQWNLVAQHPNLDNITQIFSFNYKSLTPYAGLNDTAMLWGVKFYNDFLSEAGPLGN  385

Query  1302  VQTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPN  1439
             VQ+E+L  KD +TFTF +GWAFPRRI FNG+ CV+P PD YP LPN
Sbjct  386   VQSEILFRKDQSTFTFEKGWAFPRRIYFNGDNCVMPAPDSYPFLPN  431



>ref|XP_004299285.1| PREDICTED: protein COBRA-like [Fragaria vesca subsp. vesca]
Length=456

 Score =   450 bits (1158),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 212/405 (52%), Positives = 279/405 (69%), Gaps = 12/405 (3%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDP G++TIKWD+I       V  V+++N+Q YRHI  PGW L W W    VIW 
Sbjct  35    EAYDALDPLGNVTIKWDVISWTPDGYVAVVTMFNFQQYRHIQAPGWTLGWTWAKKEVIWS  94

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ TEQG+CS +K G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGV+ S  QDP 
Sbjct  95    MVGAQTTEQGDCSRYK-GNVPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVMQSWIQDPG  153

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               +++FQ+S+G   + + +           NFTL  PG  Y+CG A  V PT+++    R
Sbjct  154   NAVSSFQVSVGAAGTTNKTVRLPK------NFTLKAPGPGYSCGRAAIVKPTRYLTADKR  207

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQ---PGSAKC  953
             R TQA+ TWNITC+YSQF AQ +PTCCVSLS+FYN TIV+CP C CGCE     PGS   
Sbjct  208   RWTQAMMTWNITCTYSQFLAQKTPTCCVSLSSFYNDTIVNCPTCACGCENNSTNPGSCVE  267

Query  954   LKAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
               +      V          +VQCT HMCP+RVHWHVKL+Y ++WRVK+T+TN+N+  N+
Sbjct  268   PDSPYLASAVAGNGKSANSPLVQCTSHMCPVRVHWHVKLNYKEYWRVKVTVTNFNYRMNY  327

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             + WNLVV HPN  N+T++FSFNY++L  Y  +NDT M +G+++YND+L+QAG  GN Q+E
Sbjct  328   TLWNLVVQHPNFDNLTKIFSFNYKSLTPYAGLNDTAMLWGVKFYNDLLMQAGPLGNAQSE  387

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             LL  KD +TFTF +GWAFPRR+ FNG+ CV+P PD YP LPN++P
Sbjct  388   LLFRKDTSTFTFEKGWAFPRRVYFNGDNCVMPPPDAYPWLPNASP  432



>ref|XP_006394554.1| hypothetical protein EUTSA_v10004178mg [Eutrema salsugineum]
 gb|ESQ31840.1| hypothetical protein EUTSA_v10004178mg [Eutrema salsugineum]
Length=458

 Score =   450 bits (1158),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 221/406 (54%), Positives = 282/406 (69%), Gaps = 18/406 (4%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDP G+IT+KWD++       V  V+++N+Q YRHI  PGW L W+W    VIW 
Sbjct  35    EAYDALDPEGNITMKWDVMSWTPDGYVAVVTMFNFQKYRHIQSPGWTLGWKWAKKEVIWS  94

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ TEQG+CS +K G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGVL+S  QDP 
Sbjct  95    MVGAQTTEQGDCSKYK-GNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVLNSWVQDPG  153

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                ++FQ+S+G   + + +           NFTL  PG  YTCG A  V PTKFV    R
Sbjct  154   NAASSFQISVGAAGTTNKTVRVPR------NFTLMGPGPGYTCGPAKIVKPTKFVTPDTR  207

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG-QPGSAKCLK  959
             RTTQA+ TWNITC+YSQF AQ +PTCCVSLS+FYN+TIV CP C CGC+  +  S  CL 
Sbjct  208   RTTQAMMTWNITCTYSQFLAQRTPTCCVSLSSFYNETIVGCPTCACGCQNNKTESGACLD  267

Query  960   ------AGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNF  1121
                   A    P  +     PP  +VQCT+HMCPIRVHWHVK +Y ++WRVKITITN+N+
Sbjct  268   PDTPHLASVVSPPTKKGTILPP--LVQCTRHMCPIRVHWHVKQNYKEYWRVKITITNFNY  325

Query  1122  AKNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGN  1301
               N+SQWN+V  HPNL N+T++FSFNY++L  Y  +NDT M +G+++YND L +AG  GN
Sbjct  326   RLNYSQWNMVAQHPNLDNITQIFSFNYKSLTPYAGLNDTAMLWGVKFYNDFLSEAGPLGN  385

Query  1302  VQTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPN  1439
             VQ+E+L  KD +TFTF +GWAFPRRI FNG+ CV+P PD YP LPN
Sbjct  386   VQSEILFRKDQSTFTFEKGWAFPRRIYFNGDNCVMPPPDTYPFLPN  431



>gb|KGN63776.1| hypothetical protein Csa_1G015700 [Cucumis sativus]
Length=457

 Score =   450 bits (1157),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 215/405 (53%), Positives = 285/405 (70%), Gaps = 18/405 (4%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDM  431
              YDPLDPNG+ITIKWD++       V  V++ N+Q+YRHI+ PGW L W W    VIW M
Sbjct  43    AYDPLDPNGNITIKWDVVSWTPDGYVAVVTMNNFQMYRHINSPGWTLGWSWAKKEVIWSM  102

Query  432   WGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEK  611
              GA+ TEQG+CS FK G  PHCC+K P+++DLLPG  +N+QF NCCKGGVL+S  QDP  
Sbjct  103   VGAQTTEQGDCSKFK-GNVPHCCKKTPIVVDLLPGVPYNQQFSNCCKGGVLASWGQDPTS  161

Query  612   YLAAFQMsigrvssksssgaavaappipgNFTL--GVPGYTCGEAFEVPPTKFVEDHGRR  785
              ++AFQ+S+G   + + +           NFTL    PGYTCG A  VP T F+    RR
Sbjct  162   SVSAFQVSVGLAGTSNKTVKLPK------NFTLLGPGPGYTCGPAKVVPSTVFLTPDRRR  215

Query  786   TTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAG  965
              TQA+ TWN+TC+YSQF A  +PTCCVSLSTFYN TI SCP C CGC+ +     C+K+ 
Sbjct  216   KTQALMTWNVTCTYSQFLASKNPTCCVSLSTFYNDTITSCPTCACGCQNK---HNCIKSD  272

Query  966   EQPPVVQLQHYEPPQA----IVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
              +  ++  +    P+     ++QCT HMCP+RVHWHVK++Y  +WRVK+ +TN+N+  N+
Sbjct  273   SK--LLHKEGINTPKKDNTPLLQCTHHMCPVRVHWHVKINYKDYWRVKVAVTNFNYRMNY  330

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             + W L V HPNL NVT+VFSF+Y+ L  Y  INDTGMFYG+++YND+L++AG  GNVQ+E
Sbjct  331   TLWTLAVQHPNLNNVTQVFSFDYKPLVPYESINDTGMFYGMKFYNDLLMEAGPFGNVQSE  390

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSAP  1448
             +LM KD  TF+F++GWAFPR++ FNG+EC +P P+ YP LPNS+P
Sbjct  391   VLMKKDKDTFSFKQGWAFPRKVYFNGDECQMPPPESYPFLPNSSP  435



>ref|XP_010463618.1| PREDICTED: COBRA-like protein 1 [Camelina sativa]
Length=451

 Score =   449 bits (1156),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 218/406 (54%), Positives = 281/406 (69%), Gaps = 16/406 (4%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YDPLDP+G+ITIKWDI+       V  V+IYN+Q YRHI  PGW + W W    VIW 
Sbjct  30    EAYDPLDPSGNITIKWDIMTWTADGYVAVVTIYNFQQYRHIQAPGWTVGWSWAKREVIWG  89

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M G + TEQG+CS FK G  PHCC+K P ++DLLPGT +N+Q  NCC+GGV++S  QDP 
Sbjct  90    MNGGQTTEQGDCSKFK-GNIPHCCKKTPSVVDLLPGTPYNQQIANCCRGGVINSWAQDPA  148

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
               ++AFQ+++G+  + + +           NFTL  PG  YTC     V PT+F+    R
Sbjct  149   TAVSAFQLTVGQAGTTNKTVRVPK------NFTLKAPGPGYTCSPGKIVKPTRFIGTDKR  202

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCE--GQPGSA---  947
             R TQA+ TWN+TC+YSQF AQ +PTCCVSLS+FYN TIVSCP C+CGC    QPG+    
Sbjct  203   RVTQALMTWNVTCTYSQFLAQKTPTCCVSLSSFYNSTIVSCPTCSCGCRNTSQPGNCVDP  262

Query  948   KCLKAGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAK  1127
             K  +     P      Y PP  +VQCT HMCP+R+HWHVK++Y  +WRVK+TITN+N+  
Sbjct  263   KGPRIASVIPNPGKNAYIPP--LVQCTNHMCPVRIHWHVKVNYKLYWRVKVTITNFNYNM  320

Query  1128  NFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQ  1307
             N++QWN+VV HPN  N+T+ FSFNY+ L  Y  INDTG+ +GI++YND+L+QAG  GNVQ
Sbjct  321   NYTQWNIVVQHPNFDNLTQTFSFNYKPLTPYASINDTGILWGIKFYNDLLMQAGPFGNVQ  380

Query  1308  TELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             +ELL  KD + FTF +GWAFPRRI FNG+ CV+P PD YP LPN+ 
Sbjct  381   SELLFQKDASAFTFEKGWAFPRRIYFNGDNCVMPPPDSYPWLPNTG  426



>emb|CDY58691.1| BnaC07g49800D [Brassica napus]
Length=458

 Score =   450 bits (1157),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 220/406 (54%), Positives = 284/406 (70%), Gaps = 18/406 (4%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDP G+IT+KWD++       V  V+++N+Q YRHI  PGW L W+W    VIW 
Sbjct  35    EAYDALDPEGNITMKWDVMSWTPDGYVAVVTMFNFQKYRHIPSPGWTLGWKWAKKEVIWS  94

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ TEQG+CS +K G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGVL+S  QDP 
Sbjct  95    MVGAQTTEQGDCSKYK-GNLPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVLNSWVQDPG  153

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                ++FQ+S+G   + + +           NFTL  PG  YTCG A  V PT+FV    R
Sbjct  154   TAASSFQISVGAAGTTNKTVRVPR------NFTLMGPGPGYTCGPAKIVRPTQFVTPDTR  207

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG-QPGSAKCLK  959
             RTTQA+ TWNITC+YSQF AQ +PTCCVSLS+FYN+TIV CP C CGC+  + GS  CL 
Sbjct  208   RTTQAMMTWNITCTYSQFLAQRTPTCCVSLSSFYNETIVGCPTCACGCQNNKTGSGACLD  267

Query  960   ------AGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNF  1121
                   A    P  +     PP  +VQCT+H+CPIRVHWHVK +Y ++WRVKITITN+N+
Sbjct  268   PDTPHLASVISPPTKKGTILPP--LVQCTRHLCPIRVHWHVKQNYKEYWRVKITITNFNY  325

Query  1122  AKNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGN  1301
               N+SQWN+V  HPNL N+T++FSFNY++L+ Y  +NDT M +G+++YND L +AG  GN
Sbjct  326   RLNYSQWNMVAQHPNLDNITQIFSFNYKSLSPYAGLNDTAMLWGMKFYNDFLSEAGPLGN  385

Query  1302  VQTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPN  1439
             VQ+E+L  KD +TFTF +GWAFPRRI FNG+ CV+P PD YP LPN
Sbjct  386   VQSEILFRKDQSTFTFEKGWAFPRRIYFNGDNCVMPPPDAYPFLPN  431



>ref|XP_006280281.1| hypothetical protein CARUB_v10026206mg, partial [Capsella rubella]
 gb|EOA13179.1| hypothetical protein CARUB_v10026206mg, partial [Capsella rubella]
Length=537

 Score =   452 bits (1164),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 221/408 (54%), Positives = 283/408 (69%), Gaps = 18/408 (4%)
 Frame = +3

Query  249   DGYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWD  428
             + YD LDP G+IT+KWD++       V  V+++N+Q YRHI  PGW L W+W    VIW 
Sbjct  116   EAYDALDPEGNITMKWDVMSWTPDGYVAVVTMFNFQKYRHIQSPGWTLGWKWAKKEVIWS  175

Query  429   MWGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPE  608
             M GA+ TEQG+CS +K G  PHCC+K+P ++DLLPGT +N+Q  NCCKGGV++S  QDP 
Sbjct  176   MVGAQTTEQGDCSKYK-GNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVMNSWVQDPA  234

Query  609   KYLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGR  782
                ++FQ+S+G   + + +           NFTL  PG  YTCG A  V PTKFV    R
Sbjct  235   TAASSFQISVGAAGTTNKTVRVPR------NFTLMGPGPGYTCGPAKIVRPTKFVTTDTR  288

Query  783   RTTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEG-QPGSAKCLK  959
             RTTQA+ TWNITC+YSQF AQ +PTCCVSLS+FYN+TIV CP C CGC+  +  S  CL 
Sbjct  289   RTTQAMMTWNITCTYSQFLAQRTPTCCVSLSSFYNETIVGCPTCACGCQNNRTESGACLD  348

Query  960   ------AGEQPPVVQLQHYEPPQAIVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNF  1121
                   A    P  +     PP  +VQCT+HMCPIRVHWHVK +Y ++WRVKITITN+N+
Sbjct  349   PDTPHLASVVSPPTKKGVILPP--LVQCTRHMCPIRVHWHVKQNYKEYWRVKITITNFNY  406

Query  1122  AKNFSQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGN  1301
               N++QWNLV  HPNL N+T++FSFNY++L  Y  +NDT M +G+++YND L +AG  GN
Sbjct  407   RLNYTQWNLVAQHPNLDNITQIFSFNYKSLTPYAGLNDTAMLWGVKFYNDFLSEAGPLGN  466

Query  1302  VQTELLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             VQ+E+L  KD +TFTF +GWAFPRRI FNG+ CV+P PD YP LPN A
Sbjct  467   VQSEILFRKDLSTFTFEKGWAFPRRIYFNGDNCVMPPPDSYPFLPNGA  514



>ref|XP_010551802.1| PREDICTED: COBRA-like protein 4 [Tarenaya hassleriana]
Length=433

 Score =   449 bits (1154),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 213/404 (53%), Positives = 284/404 (70%), Gaps = 18/404 (4%)
 Frame = +3

Query  252   GYDPLDPNGHITIKWDIIEGNDANQVVTVSIYNYQLYRHIDHPGWKLSWQWRGDGVIWDM  431
              YDPLDPNG+ITIKWD++       V  V++ N+Q+YRH+ +PGW L W W    VIW M
Sbjct  21    AYDPLDPNGNITIKWDVMSWTSDGYVAVVTMNNFQMYRHVPNPGWTLGWTWAKKEVIWSM  80

Query  432   WGAEATEQGNCSAFKSGQRPHCCEKEPVIIDLLPGTRFNKQFLNCCKGGVLSSMTQDPEK  611
              GA+ TEQG+CS FK G  PHCC+K P I+DLLPG  +N+QF NCCKGGV+++  QDP  
Sbjct  81    VGAQTTEQGDCSKFK-GNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVMAAWGQDPSA  139

Query  612   YLAAFQMsigrvssksssgaavaappipgNFTLGVPG--YTCGEAFEVPPTKFVEDHGRR  785
              ++ FQ+S+G   + + +           NFTL  PG  YTCG A  VP T F+    RR
Sbjct  140   SVSQFQVSVGLAGTTNKTVKLPK------NFTLLGPGLGYTCGPAKIVPSTTFLTPDKRR  193

Query  786   TTQAVGTWNITCSYSQFRAQSSPTCCVSLSTFYNKTIVSCPICTCGCEGQPGSAKCLKAG  965
              TQA+ TWN+TC+YSQF A+  P+CCVS S+FYN TI  CP C CGCE + G   C+K+ 
Sbjct  194   KTQALMTWNVTCTYSQFLARKHPSCCVSFSSFYNDTITPCPSCACGCENKKG---CVKSN  250

Query  966   EQPPVVQLQHYEPPQA----IVQCTQHMCPIRVHWHVKLSYTQHWRVKITITNYNFAKNF  1133
              +  ++ ++    P+     ++QCT HMCP+RVHWHVK++Y  +WRVKI +TN+N+  N+
Sbjct  251   SK--ILSMKGINTPKKDNAPLLQCTHHMCPVRVHWHVKVNYKDYWRVKIAVTNFNYRMNY  308

Query  1134  SQWNLVVLHPNLGNVTRVFSFNYRTLNQYGDINDTGMFYGIQYYNDVLLQAGEGGNVQTE  1313
             + W L + HPNL NVT+VFSF+Y+ L  YG INDTGMFYG+++YND+L++AG  GNVQ+E
Sbjct  309   TLWTLAIQHPNLNNVTQVFSFDYKPLVPYGSINDTGMFYGMKFYNDLLMEAGPFGNVQSE  368

Query  1314  LLMNKDPATFTFREGWAFPRRISFNGEECVLPQPDDYPRLPNSA  1445
             +L+ KD  TFTF++GWAFPR++ FNG+EC+LP PD YP LPNSA
Sbjct  369   VLLQKDKNTFTFKQGWAFPRKVYFNGDECMLPPPDTYPFLPNSA  412



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4554914126840