BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7306_g1_i1 len=1480 path=[1:0-1479]

Length=1480
                                                                      Score     E

ref|XP_006353588.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    397   3e-131   
ref|XP_009793237.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    396   6e-131   
ref|XP_006353587.1|  PREDICTED: 3'-hydroxy-N-methyl-(S)-coclaurin...    390   5e-128   
ref|XP_004251689.1|  PREDICTED: 3'-hydroxy-N-methyl-(S)-coclaurin...    388   2e-127   
ref|XP_009606162.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    383   7e-126   
ref|XP_009602880.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    377   2e-123   
ref|XP_009802633.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    375   8e-123   
ref|XP_006364535.1|  PREDICTED: 3'-hydroxy-N-methyl-(S)-coclaurin...    371   4e-121   
ref|XP_004231071.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    366   3e-119   
gb|AGK93044.1|  OMT3 protein                                            347   9e-112   
ref|XP_007041719.1|  RS-norcoclaurine 6-O-methyltransferase             347   1e-111   
ref|XP_011045540.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    346   1e-111   
gb|AGN70880.1|  O-methyltransferase OMT4                                346   2e-111   
gb|AGK93042.1|  OMT3 protein                                            345   2e-111   
gb|AGN70871.1|  O-methyltransferase OMT3                                345   3e-111   
gb|AGN70875.1|  O-methyltransferase OMT3                                345   6e-111   
ref|XP_002312933.2|  hypothetical protein POPTR_0009s14170g             344   8e-111   Populus trichocarpa [western balsam poplar]
ref|XP_002529795.1|  o-methyltransferase, putative                      343   1e-110   Ricinus communis
gb|AGK93045.1|  VvOMT4 protein                                          343   2e-110   
ref|XP_011092949.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    343   2e-110   
ref|XP_006422511.1|  hypothetical protein CICLE_v10028731mg             343   2e-110   
ref|XP_002281110.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    343   2e-110   Vitis vinifera
emb|CBI37808.3|  unnamed protein product                                344   3e-110   
ref|XP_004144871.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    342   5e-110   
ref|XP_004144927.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    342   5e-110   
ref|XP_002281120.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    342   8e-110   Vitis vinifera
gb|AGK93043.1|  OMT3 protein                                            342   9e-110   
gb|KDO68213.1|  hypothetical protein CISIN_1g018565mg                   340   3e-109   
ref|XP_006486669.1|  PREDICTED: 3'-hydroxy-N-methyl-(S)-coclaurin...    340   4e-109   
ref|XP_011092948.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    337   7e-108   
ref|XP_002529799.1|  o-methyltransferase, putative                      335   2e-107   Ricinus communis
gb|AGN70876.1|  O-methyltransferase OMT4                                335   6e-107   
ref|XP_008236081.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    334   7e-107   
ref|XP_003601618.1|  O-methyltransferase                                334   1e-106   
ref|XP_007201642.1|  hypothetical protein PRUPE_ppa021776mg             333   1e-106   
ref|XP_007201351.1|  hypothetical protein PRUPE_ppa007692mg             333   3e-106   
ref|XP_010066313.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    330   3e-105   
ref|XP_010526871.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    329   8e-105   
ref|XP_010066314.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    327   5e-104   
ref|XP_010526872.1|  PREDICTED: LOW QUALITY PROTEIN: (R,S)-reticu...    326   2e-103   
ref|XP_008447906.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    326   2e-103   
ref|XP_008236085.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    325   3e-103   
ref|XP_008236084.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    326   3e-103   
ref|XP_010690296.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    325   4e-103   
ref|XP_008382454.1|  PREDICTED: 3'-hydroxy-N-methyl-(S)-coclaurin...    325   4e-103   
ref|XP_011092950.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    321   5e-102   
ref|XP_008236091.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    319   7e-101   
gb|KDP27133.1|  hypothetical protein JCGZ_20945                         317   3e-100   
ref|XP_011045555.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    317   3e-100   
gb|KDP24054.1|  hypothetical protein JCGZ_26737                         315   2e-99    
gb|AJD20228.1|  3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltra...    315   2e-99    
ref|XP_004290757.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    315   2e-99    
ref|XP_007200597.1|  hypothetical protein PRUPE_ppa007742mg             314   6e-99    
ref|XP_010526877.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    313   8e-99    
ref|XP_010526874.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    312   2e-98    
ref|XP_002312934.1|  hypothetical protein POPTR_0009s14160g             312   2e-98    Populus trichocarpa [western balsam poplar]
ref|XP_008236083.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    311   1e-97    
ref|XP_008236088.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    309   3e-97    
ref|XP_008236089.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    309   6e-97    
ref|XP_010102650.1|  3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-meth...    310   2e-96    
ref|XP_006412140.1|  hypothetical protein EUTSA_v10025519mg             306   6e-96    
ref|XP_003538520.1|  PREDICTED: 3'-hydroxy-N-methyl-(S)-coclaurin...    306   6e-96    
gb|ACU21493.1|  unknown                                                 306   9e-96    Glycine max [soybeans]
ref|XP_008358432.1|  PREDICTED: 3'-hydroxy-N-methyl-(S)-coclaurin...    305   3e-95    
ref|XP_004144872.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    303   1e-94    
ref|XP_007200810.1|  hypothetical protein PRUPE_ppa025618mg             303   1e-94    
gb|KHN44492.1|  3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltra...    302   1e-94    
gb|KHG12207.1|  3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltra...    302   2e-94    
emb|CBI37807.3|  unnamed protein product                                301   2e-94    
ref|XP_010526878.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    300   8e-94    
gb|KHF98068.1|  RS-norcoclaurine 6-O-methyltransferase                  298   8e-94    
ref|XP_010103289.1|  3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-meth...    300   2e-93    
ref|XP_006283957.1|  hypothetical protein CARUB_v10005080mg             298   8e-93    
ref|XP_008447904.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    298   1e-92    
ref|NP_195242.1|  O-methyltransferase family protein                    298   1e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007163840.1|  hypothetical protein PHAVU_001G268700g             297   2e-92    
ref|XP_009108679.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    296   7e-92    
gb|AFK49425.1|  unknown                                                 296   9e-92    
gb|KFK30150.1|  hypothetical protein AALP_AA7G223500                    295   1e-91    
ref|XP_009138346.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    295   2e-91    
ref|XP_010526873.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    292   1e-90    
ref|XP_009138347.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    293   1e-90    
ref|XP_007199647.1|  hypothetical protein PRUPE_ppa015631mg             292   1e-90    
ref|XP_010432319.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    290   9e-90    
ref|XP_008447905.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    290   1e-89    
ref|XP_010437514.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    289   4e-89    
gb|KHG19041.1|  3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltra...    287   4e-89    
ref|XP_002867087.1|  O-methyltransferase family 2 protein               288   6e-89    
ref|XP_008358438.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    288   7e-89    
ref|XP_010446970.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    288   8e-89    
ref|XP_009113527.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    286   6e-88    
ref|XP_010103004.1|  3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-meth...    284   3e-87    
gb|KHG11439.1|  RS-norcoclaurine 6-O-methyltransferase                  280   1e-86    
ref|XP_010530940.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    275   4e-84    
emb|CDY51573.1|  BnaAnng10770D                                          275   3e-83    
ref|XP_010548126.1|  PREDICTED: LOW QUALITY PROTEIN: (RS)-norcocl...    272   6e-83    
ref|XP_011091586.1|  PREDICTED: 3'-hydroxy-N-methyl-(S)-coclaurin...    271   1e-82    
ref|XP_011091582.1|  PREDICTED: 3'-hydroxy-N-methyl-(S)-coclaurin...    265   3e-80    
emb|CDY17512.1|  BnaC03g65510D                                          262   7e-79    
gb|KDP20353.1|  hypothetical protein JCGZ_06876                         256   4e-77    
ref|XP_004144926.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    256   1e-76    
emb|CDX76316.1|  BnaA08g10840D                                          253   1e-75    
emb|CDY17514.1|  BnaC03g65490D                                          252   3e-75    
emb|CDY09084.1|  BnaC08g10380D                                          252   3e-75    
ref|XP_008365879.1|  PREDICTED: LOW QUALITY PROTEIN: (RS)-norcocl...    248   1e-73    
emb|CDX72521.1|  BnaC07g45430D                                          244   1e-72    
gb|KHG16452.1|  3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltra...    239   2e-70    
gb|AGN70864.1|  O-methyltransferase OMT2                                240   3e-70    
gb|AGN70870.1|  O-methyltransferase OMT2                                238   8e-70    
gb|AGN70869.1|  O-methyltransferase OMT2                                238   1e-69    
ref|XP_002277476.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    238   1e-69    Vitis vinifera
ref|XP_002529797.1|  o-methyltransferase, putative                      234   1e-69    Ricinus communis
gb|KFK41372.1|  hypothetical protein AALP_AA2G121800                    236   1e-69    
gb|KCW64163.1|  hypothetical protein EUGRSUZ_G01808                     235   1e-69    
gb|ADJ66851.1|  O-methyltransferase                                     237   4e-69    
gb|ACC63885.1|  caffeic acid 3-O-methyltransferase                      235   1e-68    Populus trichocarpa [western balsam poplar]
gb|AFZ78576.1|  caffeic acid O-methyltransferase                        235   1e-68    
ref|XP_008236086.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    232   1e-68    
ref|XP_006371585.1|  caffeic acid O-methyltransferase family protein    234   3e-68    
gb|KCW64164.1|  hypothetical protein EUGRSUZ_G01810                     231   1e-67    
emb|CDP18090.1|  unnamed protein product                                236   3e-67    
ref|NP_195241.1|  O-methyltransferase family protein                    230   3e-67    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002517958.1|  o-methyltransferase, putative                      231   5e-67    Ricinus communis
gb|EYU32603.1|  hypothetical protein MIMGU_mgv1a009168mg                230   8e-67    
gb|ADJ66850.1|  O-methyltransferase                                     231   9e-67    
gb|EYU40461.1|  hypothetical protein MIMGU_mgv1a023007mg                226   1e-66    
gb|AGN70858.1|  O-methyltransferase OMT1                                230   1e-66    
gb|AFM73600.1|  caffeate O-methyltransferase                            228   2e-66    
gb|ADE76636.1|  unknown                                                 229   3e-66    
ref|XP_002277602.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    229   3e-66    Vitis vinifera
ref|XP_010051712.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    229   3e-66    
emb|CAN64492.1|  hypothetical protein VITISV_006040                     228   8e-66    Vitis vinifera
ref|XP_002517957.1|  o-methyltransferase, putative                      227   1e-65    Ricinus communis
ref|XP_007043544.1|  O-methyltransferase                                227   2e-65    
emb|CAN77813.1|  hypothetical protein VITISV_028341                     227   2e-65    Vitis vinifera
ref|XP_010035708.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    226   4e-65    
gb|AAC49708.1|  caffeic acid O-methyltransferase                        226   1e-64    Pinus taeda
gb|KDP24165.1|  hypothetical protein JCGZ_25822                         224   1e-64    
ref|XP_010094294.1|  (RS)-norcoclaurine 6-O-methyltransferase           224   1e-64    
gb|AAD24001.1|AF119225_1  caffeic acid ortho-methyltransferase          224   3e-64    Pinus radiata
ref|XP_007043543.1|  O-methyltransferase                                223   3e-64    
gb|EYU32600.1|  hypothetical protein MIMGU_mgv1a009130mg                223   7e-64    
gb|AAB09044.1|  O-methyltransferase                                     223   1e-63    Pinus radiata
ref|XP_008236087.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    218   3e-63    
gb|AFU50297.1|  flavonoid O-methyltransferase 3                         220   5e-63    
ref|XP_004299536.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    219   1e-62    
ref|XP_010094297.1|  (RS)-norcoclaurine 6-O-methyltransferase           219   1e-62    
ref|XP_008230261.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    218   3e-62    
ref|XP_010526875.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    214   7e-62    
ref|XP_010051722.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    217   8e-62    
ref|XP_011039887.1|  PREDICTED: LOW QUALITY PROTEIN: (R,S)-reticu...    217   1e-61    
gb|ACO90220.1|  putative O-methyltransferase                            217   1e-61    Eschscholzia californica
gb|AGB06348.1|  o-methyltransferase                                     216   2e-61    
ref|XP_007215606.1|  hypothetical protein PRUPE_ppa007776mg             216   2e-61    
ref|XP_006481835.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    216   2e-61    
gb|KDO61043.1|  hypothetical protein CISIN_1g018775mg                   216   2e-61    
gb|KHG03500.1|  3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltra...    216   3e-61    
ref|XP_009357074.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    215   5e-61    
gb|AFU50299.1|  flavonoid O-methyltransferase 5                         214   5e-61    
gb|KHG18226.1|  RS-norcoclaurine 6-O-methyltransferase                  215   5e-61    
ref|XP_008358433.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    213   6e-61    
ref|XP_008346111.1|  PREDICTED: LOW QUALITY PROTEIN: (RS)-norcocl...    211   1e-60    
ref|XP_006430285.1|  hypothetical protein CICLE_v10012087mg             214   1e-60    
ref|XP_004139935.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    214   1e-60    
dbj|BAC78828.1|  caffeic acid O-methyltransferase                       214   2e-60    Rosa chinensis var. spontanea
ref|XP_006858228.1|  hypothetical protein AMTR_s00062p00190100          213   3e-60    
ref|XP_010052213.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    213   3e-60    
gb|KCW89506.1|  hypothetical protein EUGRSUZ_A01797                     212   8e-60    
gb|KDP26293.1|  hypothetical protein JCGZ_22278                         208   1e-59    
gb|KCW89504.1|  hypothetical protein EUGRSUZ_A01795                     211   2e-59    
gb|AAR09599.1|  flavonoid 7-O-methyltransferase                         210   3e-59    Mentha x piperita
ref|XP_010051706.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    211   3e-59    
ref|XP_006446728.1|  hypothetical protein CICLE_v10015708mg             210   3e-59    
ref|XP_006841690.1|  hypothetical protein AMTR_s00003p00247710          210   4e-59    
ref|XP_008341892.1|  PREDICTED: LOW QUALITY PROTEIN: (R,S)-reticu...    210   4e-59    
ref|XP_010036415.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    210   4e-59    
gb|AAR09602.1|  flavonoid 4'-O-methyltransferase                        209   4e-59    Mentha x piperita
ref|XP_006469135.1|  PREDICTED: trans-resveratrol di-O-methyltran...    211   5e-59    
ref|XP_008365438.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    210   6e-59    
ref|XP_009357073.1|  PREDICTED: LOW QUALITY PROTEIN: (R,S)-reticu...    209   7e-59    
gb|AFU50300.1|  flavonoid O-methyltransferase 6                         208   1e-58    
ref|XP_006446726.1|  hypothetical protein CICLE_v10015705mg             209   2e-58    
ref|XP_010035715.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    208   3e-58    
ref|XP_008448276.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    209   3e-58    
ref|XP_008357818.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    207   5e-58    
ref|XP_004304125.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    207   7e-58    
ref|XP_011045483.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    206   9e-58    
dbj|BAM37634.1|  O-methyltransferase                                    206   1e-57    
gb|KDP24163.1|  hypothetical protein JCGZ_25820                         204   4e-57    
ref|XP_010035712.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    204   9e-57    
gb|ABK94890.1|  unknown                                                 203   1e-56    Populus trichocarpa [western balsam poplar]
gb|ACO90232.1|  putative norcoclaurine 6-O-methyltransferase            203   2e-56    Papaver bracteatum [great scarlet poppy]
ref|XP_002319364.2|  hypothetical protein POPTR_0013s13990g             203   2e-56    Populus trichocarpa [western balsam poplar]
ref|XP_002319365.2|  hypothetical protein POPTR_0013s14000g             202   3e-56    Populus trichocarpa [western balsam poplar]
gb|AAP45315.1|  S-adenosyl-L-methionine:norcoclaurine 6-O-methylt...    202   3e-56    Papaver somniferum
ref|XP_006841695.1|  hypothetical protein AMTR_s00003p00249810          202   4e-56    
emb|CDY67665.1|  BnaA03g59140D                                          199   5e-56    
ref|XP_007200242.1|  hypothetical protein PRUPE_ppa015101mg             198   5e-56    
ref|XP_011045485.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    201   7e-56    
ref|XP_011045486.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    201   7e-56    
ref|XP_010035711.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    201   8e-56    
ref|XP_006420396.1|  hypothetical protein CICLE_v10005309mg             201   1e-55    
ref|XP_010036413.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    201   1e-55    
sp|Q6WUC1.1|6OMT_PAPSO  RecName: Full=(RS)-norcoclaurine 6-O-meth...    201   1e-55    Papaver somniferum
gb|KHN31955.1|  3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltra...    200   2e-55    
gb|AFU50298.1|  flavonoid O-methyltransferase 4                         199   2e-55    
ref|XP_006480224.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    200   2e-55    
ref|XP_009108678.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    199   2e-55    
ref|XP_006428632.1|  hypothetical protein CICLE_v10012033mg             200   3e-55    
ref|XP_002278127.1|  PREDICTED: trans-resveratrol di-O-methyltran...    200   3e-55    Vitis vinifera
ref|XP_006469137.1|  PREDICTED: trans-resveratrol di-O-methyltran...    200   3e-55    
ref|XP_003539906.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    199   4e-55    
sp|Q6WUC2.1|7OMT_PAPSO  RecName: Full=(R,S)-reticuline 7-O-methyl...    199   5e-55    Papaver somniferum
ref|XP_010088827.1|  (RS)-norcoclaurine 6-O-methyltransferase           199   5e-55    
ref|XP_006480453.1|  PREDICTED: trans-resveratrol di-O-methyltran...    199   8e-55    
gb|AAP45314.1|  S-adenosyl-L-methionine:3'-hydroxy-N-methylcoclau...    199   8e-55    Papaver somniferum
ref|XP_006480221.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    198   8e-55    
gb|AAR09598.1|  flavonoid 7-O-methyltransferase                         197   2e-54    Mentha x piperita
emb|CAN75970.1|  hypothetical protein VITISV_009881                     197   2e-54    Vitis vinifera
gb|ABZ89566.1|  O-methyltransferase 2                                   197   3e-54    Humulus lupulus [common hop]
ref|XP_010035710.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    196   5e-54    
gb|ABK22503.1|  unknown                                                 197   5e-54    Picea sitchensis
ref|NP_001243073.1|  3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-meth...    197   5e-54    
ref|XP_010244054.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    195   9e-54    
ref|XP_006364318.1|  PREDICTED: trans-resveratrol di-O-methyltran...    196   1e-53    
ref|XP_011002662.1|  PREDICTED: trans-resveratrol di-O-methyltran...    194   5e-53    
ref|XP_011002663.1|  PREDICTED: trans-resveratrol di-O-methyltran...    193   7e-53    
ref|XP_010276063.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    193   7e-53    
gb|AFK39321.1|  unknown                                                 193   1e-52    
ref|XP_003633245.1|  PREDICTED: trans-resveratrol di-O-methyltran...    192   1e-52    
ref|XP_010035709.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    192   1e-52    
ref|XP_010247901.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    192   1e-52    
ref|XP_003544914.1|  PREDICTED: trans-resveratrol di-O-methyltran...    192   1e-52    
ref|XP_003527407.1|  PREDICTED: trans-resveratrol di-O-methyltran...    192   2e-52    
ref|XP_010932727.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    192   2e-52    
ref|XP_004232928.1|  PREDICTED: trans-resveratrol di-O-methyltran...    192   2e-52    
ref|XP_008448112.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    190   2e-52    
sp|Q9LEL6.1|6OMT_COPJA  RecName: Full=(RS)-norcoclaurine 6-O-meth...    191   4e-52    Coptis japonica
gb|KCW47151.1|  hypothetical protein EUGRSUZ_K00956                     191   5e-52    
ref|XP_011002666.1|  PREDICTED: trans-resveratrol di-O-methyltran...    191   8e-52    
emb|CDP15888.1|  unnamed protein product                                190   2e-51    
ref|XP_003557042.1|  PREDICTED: trans-resveratrol di-O-methyltran...    189   2e-51    
ref|XP_011045482.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    189   2e-51    
emb|CDX72522.1|  BnaC07g45440D                                          188   2e-51    
ref|XP_003544912.1|  PREDICTED: trans-resveratrol di-O-methyltran...    189   3e-51    
ref|XP_010097399.1|  8-hydroxyquercetin 8-O-methyltransferase           189   3e-51    
gb|AFU50296.1|  flavonoid O-methyltransferase 2                         188   4e-51    
ref|XP_006480226.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    189   4e-51    
ref|XP_006364328.1|  PREDICTED: trans-resveratrol di-O-methyltran...    188   5e-51    
ref|XP_004303127.1|  PREDICTED: trans-resveratrol di-O-methyltran...    189   5e-51    
ref|XP_003615967.1|  O-methyltransferase                                188   6e-51    
gb|KDO39394.1|  hypothetical protein CISIN_1g021867mg                   186   7e-51    
ref|XP_010260367.1|  PREDICTED: trans-resveratrol di-O-methyltran...    188   1e-50    
dbj|BAM37633.1|  3'-hydroxy-N-methylcoclaurine-4'-O-methyltransfe...    187   1e-50    
ref|XP_006480222.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    187   2e-50    
dbj|BAE79723.1|  reticuline-7-O-methyltransferase                       187   2e-50    Eschscholzia californica
ref|XP_010088036.1|  8-hydroxyquercetin 8-O-methyltransferase           187   2e-50    
gb|KDP40527.1|  hypothetical protein JCGZ_24526                         187   2e-50    
ref|XP_007142076.1|  hypothetical protein PHAVU_008G250600g             187   2e-50    
gb|AFU50295.1|  flavonoid O-methyltransferase 1                         186   3e-50    
ref|XP_006447892.1|  hypothetical protein CICLE_v10015993mg             185   3e-50    
gb|ACO90227.1|  reticuline 7-O-methyltransferase-like protein           186   3e-50    Papaver bracteatum [great scarlet poppy]
gb|KHG08356.1|  3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltra...    181   4e-50    
ref|XP_007132709.1|  hypothetical protein PHAVU_011G118100g             186   5e-50    
ref|XP_002278211.1|  PREDICTED: trans-resveratrol di-O-methyltran...    186   5e-50    Vitis vinifera
emb|CAJ65638.1|  putative orcinol O-methyltransferase                   185   7e-50    Rosa hugonis
gb|AAM23004.1|AF502433_1  orcinol O-methyltransferase                   186   8e-50    Rosa hybrid cultivar
ref|XP_010110665.1|  8-hydroxyquercetin 8-O-methyltransferase           186   9e-50    
gb|AAP45313.1|  S-adenosyl-L-methionine:3'-hydroxy-N-methylcoclau...    185   9e-50    Papaver somniferum
ref|XP_009764108.1|  PREDICTED: trans-resveratrol di-O-methyltran...    185   1e-49    
gb|AJD20222.1|  norcoclaurine 6-O-methyltransferase                     184   1e-49    
ref|XP_009594948.1|  PREDICTED: trans-resveratrol di-O-methyltran...    184   1e-49    
ref|XP_004490696.1|  PREDICTED: trans-resveratrol di-O-methyltran...    184   1e-49    
ref|XP_008229109.1|  PREDICTED: trans-resveratrol di-O-methyltran...    184   1e-49    
emb|CAN61955.1|  hypothetical protein VITISV_020020                     184   2e-49    Vitis vinifera
ref|XP_006420393.1|  hypothetical protein CICLE_v10005297mg             184   2e-49    
ref|XP_007142043.1|  hypothetical protein PHAVU_008G247600g             184   2e-49    
ref|XP_010938927.1|  PREDICTED: trans-resveratrol di-O-methyltran...    184   2e-49    
ref|XP_006368013.1|  PREDICTED: trans-resveratrol di-O-methyltran...    184   2e-49    
emb|CDP21836.1|  unnamed protein product                                184   2e-49    
ref|XP_006364329.1|  PREDICTED: uncharacterized protein LOC102587683    190   4e-49    
ref|XP_003605745.1|  Caffeic acid 3-O-methyltransferase                 183   4e-49    
ref|XP_004232927.1|  PREDICTED: trans-resveratrol di-O-methyltran...    183   4e-49    
ref|XP_004235335.1|  PREDICTED: trans-resveratrol di-O-methyltran...    185   5e-49    
emb|CAJ65661.1|  putative orcinol O-methyltransferase                   182   5e-49    
gb|KDO40717.1|  hypothetical protein CISIN_1g037127mg                   181   6e-49    
gb|KHN07780.1|  Tabersonine 16-O-methyltransferase                      182   6e-49    
ref|XP_008230260.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    182   6e-49    
gb|AEC13057.1|  orcinol O-methyltransferase-like protein                183   7e-49    
ref|XP_003605744.1|  Caffeic acid 3-O-methyltransferase                 183   7e-49    
emb|CAJ65639.1|  putative orcinol O-methyltransferase                   182   8e-49    
gb|AAB71213.1|  methyltransferase                                       182   8e-49    
ref|XP_010038642.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    182   1e-48    
ref|XP_007142077.1|  hypothetical protein PHAVU_008G250700g             182   1e-48    
ref|XP_006346268.1|  PREDICTED: trans-resveratrol di-O-methyltran...    182   1e-48    
ref|XP_002278092.1|  PREDICTED: trans-resveratrol di-O-methyltran...    182   2e-48    
ref|XP_010094290.1|  3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-meth...    181   2e-48    
ref|XP_011045484.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    180   2e-48    
ref|XP_003615973.1|  O-methyltransferase                                182   2e-48    
ref|XP_010066803.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    181   2e-48    
emb|CDP19840.1|  unnamed protein product                                181   2e-48    
emb|CDP21787.1|  unnamed protein product                                182   2e-48    
ref|XP_007043718.1|  Flavonoid o-methyltransferase related              181   2e-48    
emb|CDP19711.1|  unnamed protein product                                181   3e-48    
emb|CAJ65614.1|  putative orcinol O-methyltransferase                   181   3e-48    
ref|XP_004304126.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    179   3e-48    
emb|CAJ65618.1|  putative orcinol O-methyltransferase                   180   3e-48    
gb|ABZ89567.1|  O-methyltransferase 3                                   181   4e-48    
emb|CAJ65609.1|  putative orcinol O-methyltransferase                   180   4e-48    
emb|CAJ65615.1|  putative orcinol O-methyltransferase                   180   5e-48    
ref|XP_008778546.1|  PREDICTED: trans-resveratrol di-O-methyltran...    180   5e-48    
emb|CAJ65610.1|  putative orcinol O-methyltransferase                   180   6e-48    
gb|ACO90250.1|  norcoclaurine 6-O-methyltransferase-like protein        180   6e-48    
ref|XP_002262833.1|  PREDICTED: trans-resveratrol di-O-methyltran...    180   6e-48    
emb|CAJ65642.1|  putative orcinol O-methyltransferase                   180   6e-48    
emb|CAJ65597.1|  putative orcinol O-methyltransferase                   180   6e-48    
ref|XP_009780941.1|  PREDICTED: trans-resveratrol di-O-methyltran...    180   7e-48    
emb|CAJ65599.1|  putative orcinol O-methyltransferase                   179   7e-48    
emb|CAJ65648.1|  putative orcinol O-methyltransferase                   179   8e-48    
emb|CAJ65602.1|  putative orcinol O-methyltransferase                   179   8e-48    
emb|CAJ65665.1|  putative orcinol O-methyltransferase                   179   1e-47    
ref|XP_008229108.1|  PREDICTED: trans-resveratrol di-O-methyltran...    179   1e-47    
ref|XP_004490686.1|  PREDICTED: trans-resveratrol di-O-methyltran...    179   1e-47    
emb|CAJ65601.1|  putative orcinol O-methyltransferase                   179   1e-47    
emb|CAJ65624.1|  putative orcinol O-methyltransferase                   179   1e-47    
emb|CAJ65640.1|  putative orcinol O-methyltransferase                   179   1e-47    
emb|CAJ65664.1|  putative orcinol O-methyltransferase                   179   1e-47    
emb|CAJ65607.1|  putative orcinol O-methyltransferase                   179   1e-47    
gb|KEH17409.1|  caffeic acid O-methyltransferase                        179   1e-47    
gb|AFB74613.1|  O-methyltransferase 3                                   179   1e-47    
emb|CAH05091.1|  putative orcinol O-methyltransferase                   179   2e-47    
emb|CAJ65622.1|  putative orcinol O-methyltransferase                   179   2e-47    
emb|CAJ65623.1|  putative orcinol O-methyltransferase                   179   2e-47    
emb|CAJ65611.1|  putative orcinol O-methyltransferase                   179   2e-47    
emb|CAJ65621.1|  putative orcinol O-methyltransferase                   178   2e-47    
emb|CAJ65606.1|  putative orcinol O-methyltransferase                   178   2e-47    
emb|CAJ65620.1|  putative orcinol O-methyltransferase                   178   2e-47    
emb|CAJ65598.1|  putative orcinol O-methyltransferase                   178   2e-47    
emb|CAH05084.1|  orcinol O-methyltransferase 3                          178   2e-47    
emb|CAJ65608.1|  putative orcinol O-methyltransferase                   178   2e-47    
emb|CAJ65663.1|  putative orcinol O-methyltransferase                   178   2e-47    
gb|AAM23005.1|AF502434_1  orcinol O-methyltransferase                   179   2e-47    
emb|CAJ65613.1|  putative orcinol O-methyltransferase                   178   2e-47    
emb|CAJ65605.1|  putative orcinol O-methyltransferase                   178   2e-47    
gb|KHN08844.1|  8-hydroxyquercetin 8-O-methyltransferase                178   2e-47    
emb|CAJ65633.1|  putative orcinol O-methyltransferase                   178   3e-47    
emb|CDP17644.1|  unnamed protein product                                178   3e-47    
ref|XP_010110664.1|  8-hydroxyquercetin 8-O-methyltransferase           179   3e-47    
emb|CAD29556.1|  orcinol O-methyltransferase                            178   3e-47    
emb|CAJ65655.1|  putative orcinol O-methyltransferase                   177   3e-47    
emb|CAJ65634.1|  putative orcinol O-methyltransferase                   177   4e-47    
ref|XP_010690135.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    177   4e-47    
ref|XP_011100227.1|  PREDICTED: 8-hydroxyquercetin 8-O-methyltran...    178   4e-47    
gb|AES89720.2|  orcinol O-methyltransferase                             178   4e-47    
emb|CAJ65628.1|  putative orcinol O-methyltransferase                   177   4e-47    
emb|CAJ65612.1|  putative orcinol O-methyltransferase                   177   4e-47    
dbj|BAN63363.1|  flavonoid O-methyltransferase                          177   4e-47    
emb|CAJ65632.1|  putative orcinol O-methyltransferase                   177   5e-47    
gb|KCW74501.1|  hypothetical protein EUGRSUZ_E03213                     178   5e-47    
emb|CAH05082.1|  putative orcinol O-methyltransferase                   177   5e-47    
ref|XP_010094292.1|  (RS)-norcoclaurine 6-O-methyltransferase           174   5e-47    
emb|CAJ65641.1|  putative orcinol O-methyltransferase                   177   6e-47    
emb|CAJ65630.1|  putative orcinol O-methyltransferase                   177   7e-47    
emb|CAH05083.1|  putative orcinol O-methyltransferase                   177   7e-47    
emb|CAH05081.1|  putative orcinol O-methyltransferase                   177   8e-47    
emb|CAH05085.1|  orcinol O-methyltransferase 3                          177   8e-47    
gb|ABY75613.1|  S-adenosyl-L-methionine:3'-hydroxy-N-methylcoclau...    177   9e-47    
ref|XP_009597680.1|  PREDICTED: trans-resveratrol di-O-methyltran...    177   9e-47    
gb|AAR09603.1|  O-methyltransferase                                     177   9e-47    
gb|KDP21022.1|  hypothetical protein JCGZ_21493                         177   1e-46    
emb|CAH05089.1|  putative orcinol O-methyltransferase                   176   1e-46    
emb|CAJ65603.1|  putative orcinol O-methyltransferase                   176   1e-46    
ref|XP_010057350.1|  PREDICTED: trans-resveratrol di-O-methyltran...    178   1e-46    
emb|CAH05079.1|  putative orcinol O-methyltransferase                   176   1e-46    
emb|CAJ65656.1|  putative orcinol O-methyltransferase                   176   1e-46    
emb|CAJ65636.1|  putative orcinol O-methyltransferase                   176   1e-46    
emb|CAJ65646.1|  putative orcinol O-methyltransferase                   176   1e-46    
emb|CAJ65604.1|  putative orcinol O-methyltransferase                   176   1e-46    
emb|CAD29555.1|  orcinol O-methyltransferase                            176   1e-46    
sp|Q9LEL5.1|4OMT_COPJA  RecName: Full=3'-hydroxy-N-methyl-(S)-coc...    176   1e-46    
emb|CDP19709.1|  unnamed protein product                                176   1e-46    
emb|CAJ65627.1|  putative orcinol O-methyltransferase                   176   1e-46    
emb|CAJ65659.1|  putative orcinol O-methyltransferase                   176   2e-46    
emb|CAJ65645.1|  putative orcinol O-methyltransferase                   176   2e-46    
emb|CAJ65625.1|  putative orcinol O-methyltransferase                   176   2e-46    
emb|CAJ65600.1|  putative orcinol O-methyltransferase                   176   2e-46    
emb|CAJ65647.1|  putative orcinol O-methyltransferase                   176   2e-46    
emb|CDY67664.1|  BnaA03g59130D                                          175   2e-46    
emb|CAJ65626.1|  putative orcinol O-methyltransferase                   176   2e-46    
ref|XP_002278190.1|  PREDICTED: trans-resveratrol di-O-methyltran...    176   2e-46    
ref|XP_010103003.1|  3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-meth...    174   2e-46    
ref|XP_008245137.1|  PREDICTED: trans-resveratrol di-O-methyltran...    176   2e-46    
ref|XP_006474725.1|  PREDICTED: trans-resveratrol di-O-methyltran...    176   2e-46    
ref|XP_006346269.1|  PREDICTED: trans-resveratrol di-O-methyltran...    176   2e-46    
emb|CAJ65631.1|  putative orcinol O-methyltransferase                   176   2e-46    
emb|CAJ65617.1|  putative orcinol O-methyltransferase                   175   3e-46    
emb|CAJ65629.1|  putative orcinol O-methyltransferase                   175   3e-46    
ref|XP_003615966.1|  O-methyltransferase                                176   3e-46    
dbj|BAO79381.1|  matairesinol O-methyltransferase                       175   3e-46    
ref|XP_007025514.1|  Flavonoid o-methyltransferase related              175   3e-46    
gb|AAU20765.1|  (S)-norcoclaurine 6-O-methyltransferase                 175   4e-46    
emb|CAJ65649.1|  putative orcinol O-methyltransferase                   175   4e-46    
ref|XP_002326036.2|  hypothetical protein POPTR_0019s12290g             175   4e-46    
ref|XP_009612081.1|  PREDICTED: trans-resveratrol di-O-methyltran...    174   6e-46    
emb|CAJ65657.1|  putative orcinol O-methyltransferase                   174   7e-46    
ref|XP_011085377.1|  PREDICTED: chavicol O-methyltransferase-like       174   8e-46    
ref|XP_009343397.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    174   1e-45    
gb|KEH16872.1|  caffeic acid O-methyltransferase                        173   1e-45    
ref|XP_010247902.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    173   1e-45    
ref|XP_004252468.1|  PREDICTED: trans-resveratrol di-O-methyltran...    174   1e-45    
emb|CAH05086.1|  orcinol O-methyltransferase 4                          173   1e-45    
emb|CAJ65635.1|  putative orcinol O-methyltransferase                   173   2e-45    
emb|CAJ65662.1|  putative orcinol O-methyltransferase                   173   2e-45    
ref|XP_003607523.1|  O-methyltransferase                                174   2e-45    
ref|XP_009602136.1|  PREDICTED: trans-resveratrol di-O-methyltran...    173   2e-45    
ref|XP_010272383.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    174   2e-45    
gb|KCW47149.1|  hypothetical protein EUGRSUZ_K00954                     172   2e-45    
emb|CAJ65666.1|  putative orcinol O-methyltransferase                   173   2e-45    
ref|XP_009791022.1|  PREDICTED: trans-resveratrol di-O-methyltran...    174   2e-45    
emb|CDP15886.1|  unnamed protein product                                173   2e-45    
emb|CAH05090.1|  putative orcinol O-methyltransferase                   173   2e-45    
gb|AFK43640.1|  unknown                                                 173   2e-45    
ref|XP_002278517.1|  PREDICTED: trans-resveratrol di-O-methyltran...    173   2e-45    
gb|KHN07781.1|  Tabersonine 16-O-methyltransferase                      173   2e-45    
gb|KDO73905.1|  hypothetical protein CISIN_1g017835mg                   173   3e-45    
emb|CAH05087.1|  orcinol O-methyltransferase 4                          172   3e-45    
emb|CAJ65660.1|  putative orcinol O-methyltransferase                   172   3e-45    
emb|CAH05080.1|  putative orcinol O-methyltransferase                   172   3e-45    
ref|XP_004505627.1|  PREDICTED: trans-resveratrol di-O-methyltran...    173   4e-45    
emb|CAH05088.1|  putative orcinol O-methyltransferase                   172   4e-45    
ref|XP_002278294.1|  PREDICTED: trans-resveratrol di-O-methyltran...    172   4e-45    
ref|XP_006376388.1|  6a-hydroxymaackiain methyltransferase family...    172   5e-45    
emb|CDP19839.1|  unnamed protein product                                171   5e-45    
ref|XP_011100233.1|  PREDICTED: 8-hydroxyquercetin 8-O-methyltran...    172   5e-45    
ref|XP_007216765.1|  hypothetical protein PRUPE_ppa024697mg             172   5e-45    
ref|XP_011100228.1|  PREDICTED: trans-resveratrol di-O-methyltran...    172   6e-45    
ref|XP_002513062.1|  o-methyltransferase, putative                      172   6e-45    
ref|XP_006452811.1|  hypothetical protein CICLE_v10008718mg             172   6e-45    
emb|CDP21661.1|  unnamed protein product                                172   8e-45    
emb|CAJ65643.1|  putative orcinol O-methyltransferase                   171   8e-45    
emb|CAJ65616.1|  putative orcinol O-methyltransferase                   171   8e-45    
gb|AFK40900.1|  unknown                                                 171   9e-45    
ref|XP_004506552.1|  PREDICTED: 3'-hydroxy-N-methyl-(S)-coclaurin...    171   1e-44    
gb|ACO90225.1|  putative norcoclaurine 6-O-methyltransferase            171   1e-44    
ref|XP_006376386.1|  hypothetical protein POPTR_0013s12560g             171   1e-44    
ref|XP_010058047.1|  PREDICTED: trans-resveratrol di-O-methyltran...    171   1e-44    
ref|XP_010689116.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    171   2e-44    
gb|ABZ89565.1|  O-methyltransferase 1                                   171   2e-44    
emb|CAJ65596.1|  putative orcinol O-methyltransferase                   170   2e-44    
gb|AFK45011.1|  unknown                                                 166   2e-44    
ref|XP_006376381.1|  6a-hydroxymaackiain methyltransferase family...    170   2e-44    
ref|XP_006582298.1|  PREDICTED: trans-resveratrol di-O-methyltran...    170   3e-44    
ref|XP_002517827.1|  o-methyltransferase, putative                      170   3e-44    
gb|AJD20223.1|  norcoclaurine 6-O-methyltransferase                     170   3e-44    
gb|KCW75545.1|  hypothetical protein EUGRSUZ_E04305                     170   3e-44    
ref|XP_009597678.1|  PREDICTED: trans-resveratrol di-O-methyltran...    171   3e-44    
ref|XP_006366298.1|  PREDICTED: trans-resveratrol di-O-methyltran...    170   3e-44    
ref|XP_010040912.1|  PREDICTED: trans-resveratrol di-O-methyltran...    169   5e-44    
emb|CAN78992.1|  hypothetical protein VITISV_005827                     169   5e-44    
ref|XP_011085639.1|  PREDICTED: chavicol O-methyltransferase-like       169   5e-44    
emb|CAQ76879.1|  resveratrol O-methyltransferase                        169   6e-44    
ref|XP_009398848.1|  PREDICTED: trans-resveratrol di-O-methyltran...    169   7e-44    
ref|XP_010058046.1|  PREDICTED: trans-resveratrol di-O-methyltran...    169   9e-44    
ref|XP_004490687.1|  PREDICTED: trans-resveratrol di-O-methyltran...    169   9e-44    
ref|XP_010920172.1|  PREDICTED: trans-resveratrol di-O-methyltran...    169   1e-43    
emb|CAQ58423.1|  O-methyltransferase                                    168   1e-43    
ref|XP_008229106.1|  PREDICTED: trans-resveratrol di-O-methyltran...    169   1e-43    
gb|KCW74499.1|  hypothetical protein EUGRSUZ_E03211                     169   1e-43    
ref|XP_010057348.1|  PREDICTED: trans-resveratrol di-O-methyltran...    169   1e-43    
gb|KDP24061.1|  hypothetical protein JCGZ_25718                         168   1e-43    
ref|XP_009351009.1|  PREDICTED: trans-resveratrol di-O-methyltran...    169   2e-43    
ref|XP_004248183.1|  PREDICTED: trans-resveratrol di-O-methyltran...    168   2e-43    
ref|XP_009344934.1|  PREDICTED: trans-resveratrol di-O-methyltran...    168   2e-43    
ref|XP_002522500.1|  o-methyltransferase, putative                      168   2e-43    
dbj|BAN63362.1|  matairesinol O-methyltransferase                       167   2e-43    
ref|XP_008364163.1|  PREDICTED: trans-resveratrol di-O-methyltran...    167   2e-43    
gb|AEF97347.1|  O-methyltransferase                                     167   2e-43    
ref|XP_008364164.1|  PREDICTED: trans-resveratrol di-O-methyltran...    167   3e-43    
gb|KDP24057.1|  hypothetical protein JCGZ_25714                         166   3e-43    
gb|AAU20768.1|  3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltra...    167   3e-43    
gb|KHG19153.1|  RS-norcoclaurine 6-O-methyltransferase                  163   3e-43    
ref|XP_009791021.1|  PREDICTED: trans-resveratrol di-O-methyltran...    168   3e-43    
ref|XP_010691168.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    167   3e-43    
ref|XP_002522501.1|  o-methyltransferase, putative                      167   4e-43    
gb|EMS45259.1|  O-methyltransferase ZRP4                                167   4e-43    
gb|AFB74612.1|  O-methyltransferase 2                                   166   6e-43    
ref|XP_010920173.1|  PREDICTED: trans-resveratrol di-O-methyltran...    166   6e-43    
ref|XP_004303135.1|  PREDICTED: trans-resveratrol di-O-methyltran...    166   8e-43    
ref|XP_002278316.1|  PREDICTED: trans-resveratrol di-O-methyltran...    166   9e-43    
ref|XP_009779391.1|  PREDICTED: trans-resveratrol di-O-methyltran...    166   9e-43    
gb|AIY62760.1|  N-acetylserotonin O-methyltransferase                   166   9e-43    
ref|XP_008455944.1|  PREDICTED: trans-resveratrol di-O-methyltran...    166   1e-42    
ref|XP_011037442.1|  PREDICTED: trans-resveratrol di-O-methyltran...    166   1e-42    
gb|KDP27138.1|  hypothetical protein JCGZ_20950                         160   1e-42    
ref|NP_001268044.1|  trans-resveratrol di-O-methyltransferase           166   1e-42    
gb|KCW89599.1|  hypothetical protein EUGRSUZ_A01884                     166   1e-42    
ref|XP_010070255.1|  PREDICTED: trans-resveratrol di-O-methyltran...    166   1e-42    
ref|XP_003633249.1|  PREDICTED: trans-resveratrol di-O-methyltran...    166   1e-42    
ref|XP_003633248.1|  PREDICTED: trans-resveratrol di-O-methyltran...    165   1e-42    
ref|XP_002281368.2|  PREDICTED: trans-resveratrol di-O-methyltran...    165   1e-42    



>ref|XP_006353588.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Solanum 
tuberosum]
Length=366

 Score =   397 bits (1020),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 216/411 (53%), Positives = 267/411 (65%), Gaps = 60/411 (15%)
 Frame = -1

Query  1360  RRQEVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSA  1181
              + +  +E +  +WK+VFGFTEMAV+KCAIELGI DFLE  ++ ++L+QLS  LGC  S+
Sbjct  15    EKNQESHEAQANMWKFVFGFTEMAVIKCAIELGIADFLEKNQEPISLNQLSIALGCCSSS  74

Query  1180  LYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSM  1001
             LYRI+RFLINRGIFKE                         GYVQTPLS LL ++GE SM
Sbjct  75    LYRILRFLINRGIFKETS--------------------TKSGYVQTPLSRLLIKEGENSM  114

Query  1000  AAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAH  821
             AAF+  ESSPVMLA W  LS R+   DN         S  +FEAA+GKDVW+YAE+DP H
Sbjct  115   AAFLLFESSPVMLASWHNLSARISSKDN---------SLSSFEAAHGKDVWKYAEADPKH  165

Query  820   SKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGV  641
             S L+ +AMAC AR+AV AI+  CP++            +VDVGGGDGTT+ +LV+AFP +
Sbjct  166   SNLLNNAMACDARIAVSAIIDDCPEIF------EGVNTMVDVGGGDGTTLRLLVEAFPWI  219

Query  640   KGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCRE  461
              GINFDLPHV SVAP   GV HVGG+MF  +PKADA FLMWVLHDW DEEC+QIL+KCRE
Sbjct  220   NGINFDLPHVASVAPHAIGVVHVGGDMFNYVPKADAAFLMWVLHDWSDEECIQILTKCRE  279

Query  460   AIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEV  281
             AIP++ GKVII EAI+   +E I                          R +NN    +V
Sbjct  280   AIPQDNGKVIILEAIIGGKEESI-------------------------IRGSNNEKLKDV  314

Query  280   GLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             GLMLDMVMMAHT  G ERT K+W++VL  AGF  +T++  + V S+IQA P
Sbjct  315   GLMLDMVMMAHTSNGKERTSKEWAYVLNEAGFGRHTISHINAVQSVIQAYP  365



>ref|XP_009793237.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Nicotiana 
sylvestris]
Length=361

 Score =   396 bits (1018),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 216/409 (53%), Positives = 269/409 (66%), Gaps = 61/409 (15%)
 Frame = -1

Query  1360  RRQEVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSA  1181
             R +  D + +  IWKYVFGFTEMAVVKCAIELGI DFLES +Q V+L+QLS  LGC  S+
Sbjct  12    REENQDSQAQADIWKYVFGFTEMAVVKCAIELGIADFLESNQQPVSLNQLSVALGCCSSS  71

Query  1180  LYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSM  1001
             LYR++RFLINRGIFKE       IS                 YVQTPLS LL ++GE SM
Sbjct  72    LYRVLRFLINRGIFKETSTGNGEIS-----------------YVQTPLSRLLRKEGENSM  114

Query  1000  AAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAH  821
             AAFV  ESSPVMLAPW  LS RVL  +N         +  AF+AA+GKDVW++AE+DP +
Sbjct  115   AAFVLFESSPVMLAPWHNLSARVLSKEN---------TVPAFDAAHGKDVWKFAETDPGY  165

Query  820   SKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGV  641
             + L+ +AMAC AR++VPAI+  CP++            +VDVGGGDGT + +LV+AFP +
Sbjct  166   NNLLNNAMACDARVSVPAIINGCPEIF------KGISSLVDVGGGDGTALRILVEAFPWI  219

Query  640   KGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCRE  461
             KGINFDLPHV SVAP   GV HVGG+MF  +PKADA F+MWVLHDWGD EC+QIL KC E
Sbjct  220   KGINFDLPHVASVAPHSNGVQHVGGDMFHYVPKADAAFIMWVLHDWGDGECIQILKKCGE  279

Query  460   AIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEV  281
             AIP++TGKVII EA++                             ++ D    ++   +V
Sbjct  280   AIPKDTGKVIIVEAVI-----------------------------EKGDGRKEDDKLKDV  310

Query  280   GLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQA  134
             GLMLDMVMMAHT  G ERT K+W++VL+AAGF  +T+   + V S+IQA
Sbjct  311   GLMLDMVMMAHTSNGKERTAKEWAYVLSAAGFSRHTINHINAVQSVIQA  359



>ref|XP_006353587.1| PREDICTED: 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase-like 
[Solanum tuberosum]
Length=394

 Score =   390 bits (1002),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 212/405 (52%), Positives = 264/405 (65%), Gaps = 57/405 (14%)
 Frame = -1

Query  1342  YEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMR  1163
             +E +  +WK+VFGFTE+AV+KCAIELGI DFLE  ++ ++L+QLS  LGC  S+LYRI+R
Sbjct  21    HEAQANMWKFVFGFTELAVIKCAIELGIADFLEKNQEPISLNQLSVALGCCSSSLYRILR  80

Query  1162  FLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRL  983
             FLINRGIFKE                         GYVQTPLS LL ++GE SMAAF+  
Sbjct  81    FLINRGIFKETSTK-----------------SGKSGYVQTPLSRLLIKEGENSMAAFLLF  123

Query  982   ESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIED  803
             ESSPVMLA W  LS R+   DN         S  +FEAA+GKDVW+YAE+DP HS L+ +
Sbjct  124   ESSPVMLASWHNLSARISSKDN---------SLSSFEAAHGKDVWKYAEADPKHSNLLNN  174

Query  802   AMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFD  623
             AMAC AR+A+ AI+  CP++            +VDVGGGDGTT+ +LV+AFP + GINFD
Sbjct  175   AMACDARIAISAIIDDCPEIF------KGVNTIVDVGGGDGTTLRLLVEAFPWINGINFD  228

Query  622   LPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEET  443
             LPHV SVAP   GV HVG +MF  +PKADA FLMWVLHDW DEEC+QIL+KCREAIP++ 
Sbjct  229   LPHVASVAPHAIGVVHVGDDMFNYVPKADAAFLMWVLHDWSDEECIQILTKCREAIPQDN  288

Query  442   GKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDM  263
             GKV I EAI+ + +E I                          R +NN    +VGLMLDM
Sbjct  289   GKVKILEAIIGEKEENI-------------------------IRGSNNKKLKDVGLMLDM  323

Query  262   VMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             VMMAHT  G ERT K+W++VL  AGF  +T++  + V S+IQA P
Sbjct  324   VMMAHTSNGKERTTKEWAYVLNEAGFNRHTISHINVVQSVIQAYP  368



>ref|XP_004251689.1| PREDICTED: 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase-like 
[Solanum lycopersicum]
Length=369

 Score =   388 bits (996),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 209/405 (52%), Positives = 264/405 (65%), Gaps = 56/405 (14%)
 Frame = -1

Query  1342  YEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMR  1163
             +E +  +WK+VFGFTEMAV+KCAIELGI DFLE  ++ ++L+QLS  LGC  ++LYRI+R
Sbjct  20    HEAQANMWKFVFGFTEMAVIKCAIELGIADFLEKNQEPISLNQLSIALGCCSTSLYRILR  79

Query  1162  FLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRL  983
             FLINRGIFKE                         GYVQTPLS LL ++GE SMAAF+  
Sbjct  80    FLINRGIFKETSTK-----------------SGKNGYVQTPLSRLLIKEGENSMAAFLLF  122

Query  982   ESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIED  803
             ESSPVMLAPW  LS R+   DN         S+ +F+AA+GKD+W+YAE+D   S L+ +
Sbjct  123   ESSPVMLAPWHNLSARISSKDN---------STPSFDAAHGKDIWKYAEADSGLSNLLNN  173

Query  802   AMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFD  623
             AMAC A++AV AI+  CP++            +VDVGGGDGTT+ +LV+AFP + GIN D
Sbjct  174   AMACDAKVAVSAIIDGCPEIF------EGVNTMVDVGGGDGTTLRLLVEAFPWINGINLD  227

Query  622   LPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEET  443
             LPHV SVAP   GV H GG+MF  +PKADA FLMWVLHDWGDEEC+QIL+KCREAIP++ 
Sbjct  228   LPHVASVAPHAIGVVHFGGDMFNYVPKADAAFLMWVLHDWGDEECIQILTKCREAIPKDK  287

Query  442   GKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDM  263
             GKVII EAI+ + +E                            R +NN    +VGLMLDM
Sbjct  288   GKVIILEAIIGEKEE------------------------NNIIRGSNNEKLKDVGLMLDM  323

Query  262   VMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             VMMAHT  G ERT K+W++VL  AGF  +T++  + V S+IQA P
Sbjct  324   VMMAHTSNGKERTSKEWAYVLNEAGFGRHTISHINAVQSVIQAYP  368



>ref|XP_009606162.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=357

 Score =   383 bits (984),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 212/409 (52%), Positives = 267/409 (65%), Gaps = 65/409 (16%)
 Frame = -1

Query  1360  RRQEVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSA  1181
             R +  D + +  IWKYVFGFTEMAVVKCAIELGI DFLES +Q V+L+QLS+ LGC  S+
Sbjct  12    REENEDSQAQADIWKYVFGFTEMAVVKCAIELGIADFLESNQQPVSLNQLSAALGCCSSS  71

Query  1180  LYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSM  1001
             LYR++RFLINRGIF+E       IS                 YVQTPLS LL ++G  SM
Sbjct  72    LYRVLRFLINRGIFEETSTGNGEIS-----------------YVQTPLSRLLRKEGGNSM  114

Query  1000  AAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAH  821
             AAFV  ESSPVMLAPW  LS RVL  +N         +  AF+AA+GKDVW+ AE+DP +
Sbjct  115   AAFVLFESSPVMLAPWHNLSARVLSKEN---------TVPAFDAAHGKDVWKLAETDPGY  165

Query  820   SKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGV  641
             + L+ +AMAC AR+++ AI+  CP++            +VDVGGGDGT + +LV+AFP +
Sbjct  166   NNLLNNAMACDARVSISAIINGCPEIF------KGISSLVDVGGGDGTALRILVEAFPWI  219

Query  640   KGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCRE  461
             KGINFDLPHV SVAP    V HVGGNMF  +PKADA FLMWVLHDWGD+EC+QIL KC E
Sbjct  220   KGINFDLPHVASVAPHSNSVQHVGGNMFDYVPKADAAFLMWVLHDWGDDECIQILRKCGE  279

Query  460   AIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEV  281
             AIP++TGKVII EA++        G +G                         ++   +V
Sbjct  280   AIPKDTGKVIIVEAVI--------GRKG-------------------------DDKLKDV  306

Query  280   GLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQA  134
             GLMLD+VMMAHT  G ERT K+W+++L+AAGF  +T+   + V S+IQA
Sbjct  307   GLMLDLVMMAHTSNGKERTAKEWAYLLSAAGFSRHTINHINAVQSVIQA  355



>ref|XP_009602880.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=361

 Score =   377 bits (967),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 217/409 (53%), Positives = 258/409 (63%), Gaps = 65/409 (16%)
 Frame = -1

Query  1351  EVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSA-LY  1175
             + + + ++ IWKY FGFTEMA VKCAIELGIPDFLE+ ++ +TL+QLSS LGCS S  LY
Sbjct  17    KAESQAQEDIWKYTFGFTEMAAVKCAIELGIPDFLENHQKPITLNQLSSALGCSSSNFLY  76

Query  1174  RIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAA  995
             RI+RFLINRGIFKE       I                 GYVQTPLS LL RDG  SMAA
Sbjct  77    RILRFLINRGIFKEESTGHGEI-----------------GYVQTPLSRLLRRDGGNSMAA  119

Query  994   FVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSK  815
              V LE+SPVMLAPW  LS RVL   N          + AF A +GKDVW YAE++P HSK
Sbjct  120   LVLLEASPVMLAPWHFLSARVLAKGN----------TAAFSAVHGKDVWEYAETNPEHSK  169

Query  814   LIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKG  635
             LI DAMACHAR+A+ AI+  CP++            +VDVGGGDGTT+ +LVK FP ++G
Sbjct  170   LINDAMACHARVAIRAIIDNCPEIF------KGIETLVDVGGGDGTTISLLVKTFPWIRG  223

Query  634   INFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAI  455
             INFDLPHVVSVAP   GV HV GNMF  IPKADA FLM VLHDW DEEC+QIL  C + I
Sbjct  224   INFDLPHVVSVAPPCHGVRHVEGNMFDSIPKADAAFLMSVLHDWSDEECIQILKNCIKII  283

Query  454   PEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGL  275
             P++TGKVII E +L                              EK+R  N     +VG 
Sbjct  284   PKDTGKVIIVEVVL------------------------------EKERGGNEKLK-DVGF  312

Query  274   MLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             ML MVMMAHT  G ERT K+W+H+LTAAGF  + +   + + S+I A P
Sbjct  313   MLAMVMMAHTTNGKERTAKEWAHILTAAGFNRHCIKHINAIASVILAYP  361



>ref|XP_009802633.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Nicotiana 
sylvestris]
Length=361

 Score =   375 bits (964),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 211/409 (52%), Positives = 261/409 (64%), Gaps = 64/409 (16%)
 Frame = -1

Query  1351  EVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSA-LY  1175
             + + + ++ IWKY+FGFTEMA VKCAIELGIPDFLE+ ++ +TL+QLSS LGCS S  LY
Sbjct  16    KAESQAQEDIWKYIFGFTEMAAVKCAIELGIPDFLENHQEPITLNQLSSVLGCSCSNFLY  75

Query  1174  RIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAA  995
             RI+RFLINRGIFKE       I                 GYVQTPLS LL +DGE SMAA
Sbjct  76    RILRFLINRGIFKEESTGHGEI-----------------GYVQTPLSRLLRKDGENSMAA  118

Query  994   FVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSK  815
              V LE+SPVMLAPW  LSGR L   N          + +F A +GKDVW YAE++P HSK
Sbjct  119   LVLLEASPVMLAPWHFLSGRALAKGN----------TASFSAVHGKDVWEYAETNPEHSK  168

Query  814   LIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKG  635
             LI DA+ACH+R+ + AIV  CP++            +VDVGGGDGTT+ +LVK FP ++G
Sbjct  169   LINDALACHSRVTILAIVDNCPEIF------KGIETLVDVGGGDGTTISLLVKTFPWIRG  222

Query  634   INFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAI  455
             INFDLPHVVSVAP   GV HV GNMF  IPKADA FLM +LHDW D+EC+QIL  C + I
Sbjct  223   INFDLPHVVSVAPHCHGVQHVEGNMFDSIPKADAAFLMSILHDWSDDECIQILKNCIKII  282

Query  454   PEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGL  275
             P++TGKVI+ E +L                              EK++   N    +VG 
Sbjct  283   PKDTGKVIMVEVVL------------------------------EKEKGEGNEKLKDVGF  312

Query  274   MLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             MLDMVMMAHT  G ERT K+W+ +LTAAGF S+++   + + S+I A P
Sbjct  313   MLDMVMMAHTTNGKERTAKEWAQILTAAGFNSHSIKHINAIESVILAYP  361



>ref|XP_006364535.1| PREDICTED: 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase-like 
[Solanum tuberosum]
Length=354

 Score =   371 bits (952),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 213/409 (52%), Positives = 260/409 (64%), Gaps = 64/409 (16%)
 Frame = -1

Query  1354  QEVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALY  1175
             QE + + +  IW+ + GFTEMAV KCAIELGI DFLE+ ++ V L QLSS LGCS S+L+
Sbjct  10    QEGESQVQADIWRCISGFTEMAVAKCAIELGISDFLENHQEPVPLSQLSSALGCSASSLH  69

Query  1174  RIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAA  995
             RI+RFLINRGIFK V                  +     GYVQTP+S LL RDGE SMAA
Sbjct  70    RILRFLINRGIFKLVS-----------------TGNGEMGYVQTPVSRLLKRDGENSMAA  112

Query  994   FVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSK  815
             FV LESSPVMLAPW  LS RVL  +N          S AF AA+GKDVW YA+++P HSK
Sbjct  113   FVLLESSPVMLAPWHYLSARVLSNEN----------SGAFSAAHGKDVWEYAKTNPEHSK  162

Query  814   LIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKG  635
             LI DA+ACHAR+ + AI+  C ++            +VDVGGG+GTT+ MLVKAFP + G
Sbjct  163   LINDALACHARVTMHAIINNCAEIF------KGIESLVDVGGGNGTTLGMLVKAFPWING  216

Query  634   INFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAI  455
             INFDLPHVVSVAP   GV HV G+MF  +PKA A FLMWVLHDW DEEC+QIL KC EAI
Sbjct  217   INFDLPHVVSVAPPCHGVVHVEGDMFHSVPKAQAAFLMWVLHDWSDEECIQILKKCIEAI  276

Query  454   PEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGL  275
             P++TGKVII EA L    E I   +G +                            +VGL
Sbjct  277   PKDTGKVIIVEAAL---DEKIGKEKGLK----------------------------DVGL  305

Query  274   MLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             MLDM+M+AHT  G ERT K+W+H+L+AAGF  +++     +  +I A P
Sbjct  306   MLDMMMLAHTTNGKERTAKEWAHILSAAGFSRHSILQIPAIQPVIVAYP  354



>ref|XP_004231071.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Solanum 
lycopersicum]
Length=357

 Score =   366 bits (939),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 209/404 (52%), Positives = 256/404 (63%), Gaps = 63/404 (16%)
 Frame = -1

Query  1339  EEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRF  1160
             E +  IW+ + GF EMAV KCAIELGI DFLE+ ++ V L QLSS LGCS S+L+RI+RF
Sbjct  17    EVQADIWRCISGFAEMAVAKCAIELGISDFLENHQEPVPLSQLSSALGCSASSLHRILRF  76

Query  1159  LINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLE  980
             LINRGIFK V +T                     GYVQTP+S LL RDGE SMAA V LE
Sbjct  77    LINRGIFKLVSIT----------------GNGEMGYVQTPVSRLLKRDGENSMAALVLLE  120

Query  979   SSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDA  800
             SSPVMLAPW  LS RVL  +N            AF AA+GKD+W YA+ +P HSKLI DA
Sbjct  121   SSPVMLAPWHYLSARVLSKENGG----------AFCAAHGKDLWEYAKINPEHSKLINDA  170

Query  799   MACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDL  620
             +ACHAR+ + AI+  C ++            +VDVGGG+GTTV MLVKAFP + GINFDL
Sbjct  171   LACHARVTMHAIINNCAEIF------KGIESLVDVGGGNGTTVGMLVKAFPWINGINFDL  224

Query  619   PHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETG  440
             PHVVSVAP   GV HV G+MF  +PKA A+FLM VLHDWGD+EC+QIL KC EAIP++TG
Sbjct  225   PHVVSVAPPCHGVVHVEGDMFHSVPKAHAVFLMSVLHDWGDDECIQILKKCIEAIPKDTG  284

Query  439   KVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMV  260
             KVII EA++                                ++     N  +VGLMLDM+
Sbjct  285   KVIIVEAVI-------------------------------DEKIGKGKNLKDVGLMLDMI  313

Query  259   MMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             MMAHT  G ER+ K+W H+L+AAGF S+++  TS +  +I A P
Sbjct  314   MMAHTTNGKERSAKEWDHILSAAGFSSHSILQTSAIEPLILAYP  357



>gb|AGK93044.1| OMT3 protein [Vitis vinifera]
Length=347

 Score =   347 bits (889),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 210/399 (53%), Positives = 248/399 (62%), Gaps = 63/399 (16%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRG  1145
             +WKY+FGF EMAVVKCAIELGI D +ES    +TL  LSS LGCSPS LYRIMRFL+NR 
Sbjct  12    MWKYIFGFVEMAVVKCAIELGIADVIESHSGPITLSSLSSSLGCSPSGLYRIMRFLVNRR  71

Query  1144  IFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSPVM  965
             +FKEV  +                 +   GY QTPLS  L    E  MAA + LESSPVM
Sbjct  72    LFKEVATS-----------------QGDTGYQQTPLSRRLMTRSENGMAALLLLESSPVM  114

Query  964   LAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMACHA  785
             LAPW  LS R+L           G  +  F+AA+G+DVW YA S PAHSKLI DAMAC A
Sbjct  115   LAPWHGLSARLL-----------GKGNATFDAAHGQDVWGYAASHPAHSKLINDAMACDA  163

Query  784   RMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPHVVS  605
             RMAV AIV  CP++            +VDVGGGDGT +  L+KA P ++GINFDLPHVVS
Sbjct  164   RMAVSAIVNGCPEVF------DGVSTLVDVGGGDGTALRTLIKARPLIRGINFDLPHVVS  217

Query  604   VAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKVIIA  425
              APK  GV +  G+MF  +PKADA FLMWVLHDWGDEEC+QIL KCR+AIP + GKVII 
Sbjct  218   SAPKCNGVEYASGDMFDTVPKADAAFLMWVLHDWGDEECIQILEKCRQAIPGDKGKVIIV  277

Query  424   EAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMMAHT  245
             EA++                             QE ++  ++NN  +VGLMLDMVMMAHT
Sbjct  278   EAVI-----------------------------QENEKEGDHNNLKDVGLMLDMVMMAHT  308

Query  244   GKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
               G ERT K+W +VL  AGF  YTV     V S+I+A P
Sbjct  309   TTGKERTLKEWDYVLKKAGFNRYTVKPIRAVKSVIEAYP  347



>ref|XP_007041719.1| RS-norcoclaurine 6-O-methyltransferase [Theobroma cacao]
 gb|EOX97550.1| RS-norcoclaurine 6-O-methyltransferase [Theobroma cacao]
Length=353

 Score =   347 bits (889),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 197/406 (49%), Positives = 246/406 (61%), Gaps = 67/406 (17%)
 Frame = -1

Query  1345  DYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIM  1166
             D E    +W+Y+FGF EMAVVKCAIELGI D +E+    +TL +LS+ LGC PS L+RIM
Sbjct  15    DAEAAIDVWRYIFGFVEMAVVKCAIELGIADAIENHGSPMTLSELSAALGCEPSRLHRIM  74

Query  1165  RFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVR  986
             RF+++  +FKE  ++  +I                 GY QTPLS  LT  G  SMAA V 
Sbjct  75    RFMVHNQVFKEEPISQGSI-----------------GYAQTPLSRRLTSSGVNSMAALVL  117

Query  985   LESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIE  806
             LESSPVMLAPW  L  RVL            S    FEAA+GKD+W YAE++P HS LI 
Sbjct  118   LESSPVMLAPWHSLRARVL-----------ASGDSPFEAAHGKDIWSYAEANPGHSTLIN  166

Query  805   DAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINF  626
             +AMAC AR++VPAI++ CP++            +VDVGGG+GT +  LVKAFP ++GINF
Sbjct  167   EAMACAARVSVPAIIEGCPEVF------DGLGSLVDVGGGNGTALTTLVKAFPWIRGINF  220

Query  625   DLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEE  446
             DLPHVV+ A +  G+ +VGG+MF+ IPKADA F MWVLHDW DEEC +IL KCREAIPE+
Sbjct  221   DLPHVVAAATQFDGIENVGGDMFESIPKADAAFFMWVLHDWDDEECTKILKKCREAIPED  280

Query  445   TGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLD  266
              GKVII EA+L D                                 + ++    + LMLD
Sbjct  281   KGKVIIVEAVLED---------------------------------DTDDKLDFLRLMLD  307

Query  265   MVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             MVMMAHT KG ERT K+W +VL  AGF    V     V S+I+A P
Sbjct  308   MVMMAHTNKGKERTLKEWRYVLGHAGFTRINVKRIRAVQSVIEAYP  353



>ref|XP_011045540.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Populus 
euphratica]
Length=355

 Score =   346 bits (888),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 201/397 (51%), Positives = 246/397 (62%), Gaps = 67/397 (17%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRG  1145
             IWKY+FGFT MAVVKCAIELGI D +E+ E  +TL +LSS LGC+PS+LYRIMRFL++  
Sbjct  24    IWKYIFGFTNMAVVKCAIELGIADAIENSEGPMTLSELSSSLGCAPSSLYRIMRFLVHHN  83

Query  1144  IFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSPVM  965
             IFKE                   S++ T  YVQT LS  L + GEKSM   +  ES+ VM
Sbjct  84    IFKE-----------------KPSSQGTTVYVQTALSRRLLKKGEKSMVDLLLFESNHVM  126

Query  964   LAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMACHA  785
             LAPW  LS RVL  DNN+           FE A+G DVW+YA  +P HSKLI+DAMAC A
Sbjct  127   LAPWHNLSSRVL-NDNNS----------PFEGAHGDDVWKYALVNPVHSKLIDDAMACDA  175

Query  784   RMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPHVVS  605
             ++ VP IV+ CP++            +VDVGGG+GT ++MLVKAFP ++G NFDLPHVVS
Sbjct  176   KLVVPEIVEGCPEVF------DGVKTLVDVGGGNGTALQMLVKAFPWIQGTNFDLPHVVS  229

Query  604   VAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKVIIA  425
              AP+  GV HVGGN F+ +PKADA FLMWVLHDW DEEC+QIL  C+EAI  + GKVII 
Sbjct  230   AAPESEGVKHVGGNFFESVPKADAAFLMWVLHDWNDEECIQILKNCKEAIQSDEGKVIIV  289

Query  424   EAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMMAHT  245
             EA++                             +EKD     +    V LMLDMVMM+HT
Sbjct  290   EAVV----------------------------GEEKD-----DKLEFVRLMLDMVMMSHT  316

Query  244   GKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQA  134
               G ERT K+W +VL  AGF SYT+     V S+I A
Sbjct  317   DAGKERTSKEWEYVLKEAGFSSYTIKPIRAVQSVIVA  353



>gb|AGN70880.1| O-methyltransferase OMT4 [Vitis vinifera]
Length=359

 Score =   346 bits (887),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 198/400 (50%), Positives = 242/400 (61%), Gaps = 64/400 (16%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRG  1145
             +WKY++GF EMA VKC IELGI D +ES    +TL  LSS LGC PS L RIMRFL++R 
Sbjct  23    MWKYIYGFAEMAAVKCGIELGIADVMESHGGPITLSALSSSLGCPPSGLNRIMRFLVSRR  82

Query  1144  IFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSPVM  965
             IFKEVE +                 +   GY QTP+S  L   G   MAAFV LESSPVM
Sbjct  83    IFKEVETS-----------------QGDTGYQQTPMSRCLMTSGGDGMAAFVLLESSPVM  125

Query  964   LAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMACHA  785
             LAPW  LS RVL           G  +  FEAA+G D+W YA  +P HSKLI DAMA +A
Sbjct  126   LAPWHGLSARVL-----------GKGNSTFEAAHGDDIWGYAAKNPDHSKLINDAMASNA  174

Query  784   RMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPHVVS  605
             R  VPA+V  CP++            +VDVGGG+GT +  LVKA P ++GINFDLPHVV+
Sbjct  175   RRVVPAMVNDCPEVF------DGVSTLVDVGGGNGTALRTLVKACPWIRGINFDLPHVVA  228

Query  604   VAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKVIIA  425
              APK   V HVGGNMF  +PKADA+F+M VLHDWGDE+C++IL KCREAIPE+ GKV+I 
Sbjct  229   TAPKCNDVEHVGGNMFDSVPKADAVFIMKVLHDWGDEKCIKILEKCREAIPEDKGKVVIV  288

Query  424   EAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMMAHT  245
             EA++ D                              D   ++    +V LM+DMVMMAHT
Sbjct  289   EAVIED-----------------------------GDPQGDDQKLKDVKLMVDMVMMAHT  319

Query  244   GKGLERTEKQWSHVLTAAGFKSYTVTDTSDVV-SIIQARP  128
               G ERT K+W +VL  AGF  YT+    ++V SII+A P
Sbjct  320   TTGKERTFKEWDYVLLNAGFSRYTIKPIRNIVQSIIEAYP  359



>gb|AGK93042.1| OMT3 protein [Vitis vinifera]
Length=347

 Score =   345 bits (886),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 209/399 (52%), Positives = 248/399 (62%), Gaps = 63/399 (16%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRG  1145
             +WKY+FGF EMAVVKCAIELGI D +ES    +TL  LSS LGCSPS LYRIMRFL+NR 
Sbjct  12    MWKYIFGFVEMAVVKCAIELGIADVMESHSGPITLSSLSSSLGCSPSGLYRIMRFLVNRR  71

Query  1144  IFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSPVM  965
             +FKEV  +                 +   GY QTPLS  L    E  MAA + LESSPVM
Sbjct  72    LFKEVATS-----------------QGDTGYQQTPLSRRLMTRSENGMAALLLLESSPVM  114

Query  964   LAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMACHA  785
             LAPW  LS R+L           G  +  F+AA+G+DVW YA S PAHSKLI DAMAC A
Sbjct  115   LAPWHGLSARLL-----------GKGNATFDAAHGQDVWGYAASHPAHSKLINDAMACDA  163

Query  784   RMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPHVVS  605
             RMAV AIV  CP++            +VDVGGGDGT +  L+KA P ++GINFDLPHVVS
Sbjct  164   RMAVSAIVNGCPEVF------DGVSTLVDVGGGDGTALRTLIKARPLIRGINFDLPHVVS  217

Query  604   VAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKVIIA  425
              APK  GV +  G+MF  +PKADA FLMWVLHDWGDEEC+QIL KCR+AIP + GKVII 
Sbjct  218   SAPKCNGVEYASGDMFDTVPKADAAFLMWVLHDWGDEECIQILEKCRQAIPGDKGKVIIV  277

Query  424   EAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMMAHT  245
             EA++                             QE ++  ++NN  +VGLMLDMVMMAHT
Sbjct  278   EAVI-----------------------------QENEKEGDHNNLKDVGLMLDMVMMAHT  308

Query  244   GKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
               G ERT K+W +VL  AGF  YT+     V S+I+A P
Sbjct  309   TTGKERTLKEWDYVLKKAGFNRYTMKPIRAVKSVIEAYP  347



>gb|AGN70871.1| O-methyltransferase OMT3 [Vitis vinifera]
 gb|AGN70872.1| O-methyltransferase OMT3 [Vitis vinifera]
Length=354

 Score =   345 bits (886),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 209/399 (52%), Positives = 248/399 (62%), Gaps = 63/399 (16%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRG  1145
             +WKY+FGF EMAVVKCAIELGI D +ES    +TL  LSS LGCSPS LYRIMRFL+NR 
Sbjct  19    MWKYIFGFVEMAVVKCAIELGIADVMESHSGPITLSSLSSSLGCSPSGLYRIMRFLVNRR  78

Query  1144  IFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSPVM  965
             +FKEV  +                 +   GY QTPLS  L    E  MAA + LESSPVM
Sbjct  79    LFKEVATS-----------------QGDTGYQQTPLSRRLMTRSENGMAALLLLESSPVM  121

Query  964   LAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMACHA  785
             LAPW  LS R+L           G  +  F+AA+G+DVW YA S PAHSKLI DAMAC A
Sbjct  122   LAPWHGLSARLL-----------GKGNATFDAAHGQDVWGYAASHPAHSKLINDAMACDA  170

Query  784   RMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPHVVS  605
             RMAV AIV  CP++            +VDVGGGDGT +  L+KA P ++GINFDLPHVVS
Sbjct  171   RMAVSAIVNGCPEVF------DGVSTLVDVGGGDGTALRTLIKARPLIRGINFDLPHVVS  224

Query  604   VAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKVIIA  425
              APK  GV +  G+MF  +PKADA FLMWVLHDWGDEEC+QIL KCR+AIP + GKVII 
Sbjct  225   SAPKCNGVEYASGDMFDTVPKADAAFLMWVLHDWGDEECIQILEKCRQAIPGDKGKVIIV  284

Query  424   EAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMMAHT  245
             EA++                             QE ++  ++NN  +VGLMLDMVMMAHT
Sbjct  285   EAVI-----------------------------QENEKEGDHNNLKDVGLMLDMVMMAHT  315

Query  244   GKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
               G ERT K+W +VL  AGF  YT+     V S+I+A P
Sbjct  316   TTGKERTLKEWDYVLKKAGFNRYTMKPIRAVKSVIEAYP  354



>gb|AGN70875.1| O-methyltransferase OMT3 [Vitis vinifera]
Length=354

 Score =   345 bits (884),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 209/399 (52%), Positives = 247/399 (62%), Gaps = 63/399 (16%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRG  1145
             +WKY+FGF EMAVVKC IELGI D +ES    +TL  LSS LGCSPS LYRIMRFL+NR 
Sbjct  19    MWKYIFGFVEMAVVKCGIELGIADVIESHAGPITLSSLSSSLGCSPSGLYRIMRFLVNRR  78

Query  1144  IFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSPVM  965
             IFKEV  +                 +   GY QTPLS  L    E  MAA + LESSPVM
Sbjct  79    IFKEVATS-----------------QGDTGYQQTPLSRRLMTRSENGMAALLLLESSPVM  121

Query  964   LAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMACHA  785
             LAPW  LS R+L           G  +  F+AA+G+DVW YA S PAHSKLI DAMAC A
Sbjct  122   LAPWHGLSARLL-----------GKGNATFDAAHGQDVWGYAASHPAHSKLINDAMACDA  170

Query  784   RMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPHVVS  605
             RMAV AIV  CP++            +VDVGGGDGT +  L+KA P ++GINFDLPHVVS
Sbjct  171   RMAVSAIVNGCPEVF------DGVSTLVDVGGGDGTALRTLIKARPLIRGINFDLPHVVS  224

Query  604   VAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKVIIA  425
              APK  GV +  G+MF  +PKADA FLMWVLHDWGDEEC+QIL KCR+AIP + GKVII 
Sbjct  225   SAPKCNGVEYASGDMFDTVPKADAAFLMWVLHDWGDEECIQILEKCRQAIPGDKGKVIIV  284

Query  424   EAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMMAHT  245
             EA++                             QE ++  ++NN  +VGLMLDMVMMAHT
Sbjct  285   EAVI-----------------------------QENEKEGDHNNLKDVGLMLDMVMMAHT  315

Query  244   GKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
               G ERT K+W +VL  AGF  YT+     V S+I+A P
Sbjct  316   TTGKERTLKEWDYVLKKAGFNRYTMKPIRAVKSVIEAYP  354



>ref|XP_002312933.2| hypothetical protein POPTR_0009s14170g [Populus trichocarpa]
 gb|EEE86888.2| hypothetical protein POPTR_0009s14170g [Populus trichocarpa]
Length=350

 Score =   344 bits (883),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 202/411 (49%), Positives = 254/411 (62%), Gaps = 69/411 (17%)
 Frame = -1

Query  1351  EVDYEEEDG---IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSA  1181
             ++D EE      IWKY+FGFT MAVVKCAIELGI D +E+ E  +TL +LSS LGC+PS+
Sbjct  6     KIDEEEAQAQVEIWKYIFGFTNMAVVKCAIELGIADAIENNEGPMTLSELSSSLGCAPSS  65

Query  1180  LYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSM  1001
             LYRIMRFL++  IFKE                  +S   T  YVQT LS  L + GEKSM
Sbjct  66    LYRIMRFLVHHNIFKE----------------KPSSQLGTTVYVQTALSRRLLKKGEKSM  109

Query  1000  AAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAH  821
                +  ESS VM+APW  LS RVL  DNN+           FE A+G D+W+YA ++P H
Sbjct  110   VDLLLFESSHVMMAPWHNLSSRVL-NDNNS----------PFEGAHGDDIWKYALANPVH  158

Query  820   SKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGV  641
             SKLI+DAMAC A++ VP IV+  P++            +VDVGGG+GTT++MLVKAFP +
Sbjct  159   SKLIDDAMACDAKLVVPEIVEGFPEVF------DGVKTLVDVGGGNGTTLQMLVKAFPWI  212

Query  640   KGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCRE  461
             +GINFDLPHVVSVA +  GV HVGG+ F+ +PKADA FLMWVLHDW DEEC+QIL  C+E
Sbjct  213   QGINFDLPHVVSVASESEGVKHVGGDFFESVPKADAAFLMWVLHDWNDEECIQILKNCKE  272

Query  460   AIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEV  281
             AI  + GKVII EA++ +        +G +++                           V
Sbjct  273   AIQSDKGKVIIVEAVVGEE-------KGDKLEF--------------------------V  299

Query  280   GLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
              LMLDMVMM+HT  G ERT K+W +VL  AGF SYT+     V S+I A P
Sbjct  300   RLMLDMVMMSHTDAGKERTSKEWGYVLKEAGFSSYTIKPIRAVQSVIVASP  350



>ref|XP_002529795.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF32577.1| o-methyltransferase, putative [Ricinus communis]
Length=345

 Score =   343 bits (881),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 196/399 (49%), Positives = 251/399 (63%), Gaps = 66/399 (17%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRG  1145
             +WKYVFGFT MAVVKCAIELGI D +E++++ VTL +LSS LGC+PS+LYRIMRFL+++ 
Sbjct  13    MWKYVFGFTNMAVVKCAIELGIADAIENRKEPVTLSELSSTLGCAPSSLYRIMRFLMHQN  72

Query  1144  IFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSPVM  965
             IFKE+     T                + GYV TPLS  L   GE +MAAF+ LESSPVM
Sbjct  73    IFKEIPTHQGT----------------SIGYVHTPLSRRLLGRGEDNMAAFLLLESSPVM  116

Query  964   LAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMACHA  785
             LAPW  LS RV             +   AFEA +G DVW+YA ++P HSKLI+DAMAC+A
Sbjct  117   LAPWHFLSARV-----------QQNGRAAFEAVHGDDVWKYAAANPGHSKLIDDAMACNA  165

Query  784   RMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPHVVS  605
             R AV  I++ CP +            +VDVGGG+GT + MLVKAFP ++GINFDL HVVS
Sbjct  166   RTAVTTIIEQCPKVF------DGIKTLVDVGGGNGTALRMLVKAFPWIQGINFDLHHVVS  219

Query  604   VAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKVIIA  425
             +A +   V ++GG+MF+ +PKADA FLMWVLHDW D++C+QIL KC+EA+ E  GKVII 
Sbjct  220   IAHECNNVTYIGGDMFESVPKADAAFLMWVLHDWNDDDCIQILKKCKEAVTEGNGKVIIV  279

Query  424   EAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMMAHT  245
             EA++ + ++    Y                                 V LMLDMVMMAHT
Sbjct  280   EAVIGEAKDDKLEY---------------------------------VRLMLDMVMMAHT  306

Query  244   GKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
               G ERT K+W +VL  AGF+S+T+     V S+I+A P
Sbjct  307   NTGKERTSKEWGYVLQKAGFRSHTIKPIGAVQSVIEAFP  345



>gb|AGK93045.1| VvOMT4 protein [Vitis vinifera]
Length=352

 Score =   343 bits (881),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 197/400 (49%), Positives = 241/400 (60%), Gaps = 64/400 (16%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRG  1145
             +WKY++GF EMA VKC IELGI D +ES    +TL  LSS LGC PS L RIMRFL++R 
Sbjct  16    MWKYIYGFAEMAAVKCGIELGIADVMESHGGPITLSALSSSLGCPPSGLNRIMRFLVSRR  75

Query  1144  IFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSPVM  965
             IFKEV  +                 +   GY QTP+S  L   G   MAAFV LESSPVM
Sbjct  76    IFKEVATS-----------------QGDTGYQQTPMSRCLMTSGGDGMAAFVLLESSPVM  118

Query  964   LAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMACHA  785
             LAPW  LS RVL           G  +  FEAA+G D+W YA  +P HSKLI DAMA +A
Sbjct  119   LAPWHGLSARVL-----------GKGNSTFEAAHGDDIWGYAAKNPDHSKLINDAMASNA  167

Query  784   RMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPHVVS  605
             R  VPA+V  CP++            +VDVGGG+GT +  LVKA P ++GINFDLPHVV+
Sbjct  168   RRVVPAMVNDCPEVF------DGVSTLVDVGGGNGTALRTLVKACPWIRGINFDLPHVVA  221

Query  604   VAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKVIIA  425
              APK   V HVGGNMF  +PKADA+F+M VLHDWGDE+C++IL KCREAIPE+ GKV+I 
Sbjct  222   TAPKCNDVEHVGGNMFDSVPKADAVFIMKVLHDWGDEKCIKILEKCREAIPEDKGKVVIV  281

Query  424   EAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMMAHT  245
             EA++ D                              D   ++    +V LM+DMVMMAHT
Sbjct  282   EAVIED-----------------------------GDPQGDDQKLKDVKLMVDMVMMAHT  312

Query  244   GKGLERTEKQWSHVLTAAGFKSYTVTDTSDVV-SIIQARP  128
               G ERT K+W +VL  AGF  YT+    ++V SII+A P
Sbjct  313   TTGKERTFKEWDYVLLNAGFSRYTIKPIRNIVQSIIEAYP  352



>ref|XP_011092949.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Sesamum 
indicum]
Length=350

 Score =   343 bits (880),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 201/417 (48%), Positives = 259/417 (62%), Gaps = 67/417 (16%)
 Frame = -1

Query  1378  MDAKSIRRQEVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGL  1199
             M+ KS +  E    + D +WKYV GFT MA+VKCAIEL I D LES   A+TL +LS+ L
Sbjct  1     MEMKSFKVDEEANAQLD-MWKYVLGFTPMALVKCAIELQIADVLESHGGAMTLSELSAAL  59

Query  1198  GCSPSALYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTR  1019
             GCS S L+RIMR+L++RGIFK+V                +     +  Y QTPLS LL +
Sbjct  60    GCSSSTLHRIMRYLMHRGIFKQV----------------VRGQESSICYAQTPLSRLLIK  103

Query  1018  DGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYA  839
             +G  SMAA V LESS  MLAPW +LS   L+           S + AFEAA+G+D+W+YA
Sbjct  104   NGGNSMAALVLLESSHAMLAPWHRLSKSALI-----------SGASAFEAAHGQDLWQYA  152

Query  838   ESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLV  659
              ++P HSKLI DAMACHAR+ + AIV   P+             +VDVGGGDGT +++LV
Sbjct  153   AANPVHSKLINDAMACHARVDISAIVNQYPEAF------KGISSLVDVGGGDGTALQILV  206

Query  658   KAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQI  479
             KA+P + GINFDLPHVVSVAP+  G+ HV GNMF+ +PKADA FLM VLHDWGD+EC+ I
Sbjct  207   KAYPWIHGINFDLPHVVSVAPQCQGIKHVQGNMFEIVPKADAAFLMSVLHDWGDDECIDI  266

Query  478   LSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNN  299
             L KCREAIP++TGKVIIAEA++ + +E                                 
Sbjct  267   LRKCREAIPKDTGKVIIAEAVIDEGEE---------------------------------  293

Query  298   NNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             +   +V L LDMVM+AHT KG ERT ++W +V+ AAGF  +TV      +S+I+A P
Sbjct  294   DKYTDVRLALDMVMLAHTEKGKERTIEEWEYVVNAAGFTRFTVKHIQATISVIEAYP  350



>ref|XP_006422511.1| hypothetical protein CICLE_v10028731mg [Citrus clementina]
 gb|ESR35751.1| hypothetical protein CICLE_v10028731mg [Citrus clementina]
Length=354

 Score =   343 bits (880),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 196/412 (48%), Positives = 253/412 (61%), Gaps = 67/412 (16%)
 Frame = -1

Query  1363  IRRQEVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPS  1184
             ++++E D + E  IWKYVFGFT MAVVKCA+ELGI + +E +   +TL++L+S L C PS
Sbjct  10    MKKEEDDAKVE--IWKYVFGFTNMAVVKCAVELGIAEAVEEKGSPITLNELASALKCDPS  67

Query  1183  ALYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKS  1004
              L RIMRFLI+   FKEV    PT             ++ +  + QTPLS  L R GE +
Sbjct  68    LLQRIMRFLIHLKFFKEV----PT-------------SQGSMAFQQTPLSRRLMRHGENN  110

Query  1003  MAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPA  824
             MAAF+ LESSPVMLAPW  L  RVL            + + AF+ A+GKDVW YA +D A
Sbjct  111   MAAFILLESSPVMLAPWHSLGTRVL-----------ANGTSAFDKAHGKDVWSYAAADAA  159

Query  823   HSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPG  644
             HSKLI DAMAC  R+A+ AI++ CP++            +VD+GG DGTT+  L KAFP 
Sbjct  160   HSKLINDAMACDTRLAMRAIIEGCPEVF------DGIETLVDIGGNDGTTLRTLTKAFPR  213

Query  643   VKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCR  464
             ++GINFDLPHVV VA K  GV HVGG+MF  +P+ADA  + WVLHDWGD+EC++IL  C+
Sbjct  214   IRGINFDLPHVVCVAEKCHGVEHVGGDMFDGVPEADAAIIKWVLHDWGDDECIKILKNCK  273

Query  463   EAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYE  284
             EAI ++ GKVII EAI+ +  E+ N ++  R                             
Sbjct  274   EAITKDKGKVIIVEAIIEEDDEVDNKFKSVR-----------------------------  304

Query  283   VGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
               LMLDMVMMAHT KG ER+ K+W +VL  AGF  Y +T    V S+I+A P
Sbjct  305   --LMLDMVMMAHTNKGKERSLKEWDYVLRQAGFSRYNITSIHAVQSLIEAFP  354



>ref|XP_002281110.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Vitis 
vinifera]
 gb|AGN70878.1| O-methyltransferase OMT4 [Vitis vinifera]
 gb|AGN70879.1| O-methyltransferase OMT4 [Vitis vinifera]
Length=359

 Score =   343 bits (880),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 197/400 (49%), Positives = 241/400 (60%), Gaps = 64/400 (16%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRG  1145
             +WKY++GF EMA VKC IELGI D +ES    +TL  LSS LGC PS L RIMRFL++R 
Sbjct  23    MWKYIYGFAEMAAVKCGIELGIADVMESHGGPITLSALSSSLGCPPSGLNRIMRFLVSRR  82

Query  1144  IFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSPVM  965
             IFKEV  +                 +   GY QTP+S  L   G   MAAFV LESSPVM
Sbjct  83    IFKEVATS-----------------QGDTGYQQTPMSRCLMTSGGDGMAAFVLLESSPVM  125

Query  964   LAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMACHA  785
             LAPW  LS RVL           G  +  FEAA+G D+W YA  +P HSKLI DAMA +A
Sbjct  126   LAPWHGLSARVL-----------GKGNSTFEAAHGDDIWGYAAKNPDHSKLINDAMASNA  174

Query  784   RMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPHVVS  605
             R  VPA+V  CP++            +VDVGGG+GT +  LVKA P ++GINFDLPHVV+
Sbjct  175   RRVVPAMVNDCPEVF------DGVSTLVDVGGGNGTALRTLVKACPWIRGINFDLPHVVA  228

Query  604   VAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKVIIA  425
              APK   V HVGGNMF  +PKADA+F+M VLHDWGDE+C++IL KCREAIPE+ GKV+I 
Sbjct  229   TAPKCNDVEHVGGNMFDSVPKADAVFIMKVLHDWGDEKCIKILEKCREAIPEDKGKVVIV  288

Query  424   EAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMMAHT  245
             EA++ D                              D   ++    +V LM+DMVMMAHT
Sbjct  289   EAVIED-----------------------------GDPQGDDQKLKDVKLMVDMVMMAHT  319

Query  244   GKGLERTEKQWSHVLTAAGFKSYTVTDTSDVV-SIIQARP  128
               G ERT K+W +VL  AGF  YT+    ++V SII+A P
Sbjct  320   TTGKERTFKEWDYVLLNAGFSRYTIKPIRNIVQSIIEAYP  359



>emb|CBI37808.3| unnamed protein product [Vitis vinifera]
Length=400

 Score =   344 bits (883),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 200/405 (49%), Positives = 251/405 (62%), Gaps = 40/405 (10%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRG  1145
             +WKY++GF EMA VKC IELGI D +ES    +TL  LSS LGC PS L RIMRFL++R 
Sbjct  30    MWKYIYGFAEMAAVKCGIELGIADVMESHGGPITLSALSSSLGCPPSGLNRIMRFLVSRR  89

Query  1144  IFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSPVM  965
             IFKEV  +                 +   GY QTP+S  L   G   MAAFV LESSPVM
Sbjct  90    IFKEVATS-----------------QGDTGYQQTPMSRCLMTSGGDGMAAFVLLESSPVM  132

Query  964   LAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMACHA  785
             LAPW  LS RVL           G  +  FEAA+G D+W YA  +P HSKLI DAMA +A
Sbjct  133   LAPWHGLSARVL-----------GKGNSTFEAAHGDDIWGYAAKNPDHSKLINDAMASNA  181

Query  784   RMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPHVVS  605
             R  VPA+V  CP++            +VDVGGG+GT +  LVKA P ++GINFDLPHVV+
Sbjct  182   RRVVPAMVNDCPEVF------DGVSTLVDVGGGNGTALRTLVKACPWIRGINFDLPHVVA  235

Query  604   VAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKVIIA  425
              APK   V HVGGNMF  +PKADA+F+M VLHDWGDE+C++IL KCREAIPE+ GKV+I 
Sbjct  236   TAPKCNDVEHVGGNMFDSVPKADAVFIMKVLHDWGDEKCIKILEKCREAIPEDKGKVVIV  295

Query  424   EA-ILRD--HQEMINGYQGTR--MklknntntknnskLQEKDRNNNNNNSYEVGLMLDMV  260
             EA +L D   ++ I   +  R  +           + +++ D   ++    +V LM+DMV
Sbjct  296   EAKVLHDWGDEKCIKILEKCREAIPEDKGKVVIVEAVIEDGDPQGDDQKLKDVKLMVDMV  355

Query  259   MMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVV-SIIQARP  128
             MMAHT  G ERT K+W +VL  AGF  YT+    ++V SII+A P
Sbjct  356   MMAHTTTGKERTFKEWDYVLLNAGFSRYTIKPIRNIVQSIIEAYP  400



>ref|XP_004144871.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Cucumis 
sativus]
 ref|XP_004153164.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Cucumis 
sativus]
 ref|XP_004170291.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Cucumis 
sativus]
 gb|KGN43290.1| hypothetical protein Csa_7G018720 [Cucumis sativus]
Length=359

 Score =   342 bits (878),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 198/422 (47%), Positives = 255/422 (60%), Gaps = 71/422 (17%)
 Frame = -1

Query  1375  DAKSIRRQEVDYEEEDG-----IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQL  1211
             D  S    ++  EEED      IWKY+FGF EMAV+KCAIEL I D +ES   ++TL QL
Sbjct  3     DTSSKASNKLKIEEEDSDIKVQIWKYIFGFVEMAVIKCAIELKIGDVIESHGDSMTLSQL  62

Query  1210  SSGLGCSPSALYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSA  1031
             SS L CSP  L+RI+RFL++RGIFKE                     + T+ Y  TP+S 
Sbjct  63    SSSLNCSPLLLHRILRFLVHRGIFKE--------------------EKTTKCYSHTPMSR  102

Query  1030  LLTRDGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDV  851
             LLT  G  SMA    LESSPVM+APW  LS  V   D+ N        S  FE A+G D+
Sbjct  103   LLTTTGPNSMAPLHLLESSPVMIAPWHNLSACVKASDHEN-------GSQPFEMAHGMDL  155

Query  850   WRYAESDPAHSKLIEDAMACHARMAV-PAIVQACPDLLLLHgaagvecvvvdvgggdgtt  674
             W YA ++P+HS LI ++MAC AR+ + PA+++ C ++            +VDVGGG+GT 
Sbjct  156   WTYAAANPSHSSLINESMACFARLVILPAVLERCGEIF------DGVGCLVDVGGGNGTC  209

Query  673   vEMLVKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDE  494
             + +LVKA P +KGINFDLPHVVSV+ +  G+ HVGGNMF  +PKADA F+M VLHDW DE
Sbjct  210   LSILVKACPWIKGINFDLPHVVSVSKEYEGIQHVGGNMFDSVPKADAAFIMEVLHDWDDE  269

Query  493   ECVQILSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKD  314
             EC++IL  C+EAIPE+TGKVII E ++ D +E I+ Y   R                   
Sbjct  270   ECIKILKNCKEAIPEKTGKVIIVEVVI-DEKEEISKYSDAR-------------------  309

Query  313   RNNNNNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQA  134
                         LM+DM+MMAHT KG ERT ++W++VL  AGF  YT+T TS + S+IQA
Sbjct  310   ------------LMMDMIMMAHTIKGKERTNEEWANVLQKAGFSYYTITPTSTIQSVIQA  357

Query  133   RP  128
              P
Sbjct  358   FP  359



>ref|XP_004144927.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Cucumis 
sativus]
 ref|XP_004154248.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Cucumis 
sativus]
 ref|XP_004166913.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Cucumis 
sativus]
 gb|KGN43289.1| hypothetical protein Csa_7G017720 [Cucumis sativus]
Length=358

 Score =   342 bits (878),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 202/414 (49%), Positives = 249/414 (60%), Gaps = 66/414 (16%)
 Frame = -1

Query  1369  KSI-RRQEVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGC  1193
             KSI ++QE + E    IWKY+FGF EMA+VKCAIEL I D +ES    +TL QLS+ L C
Sbjct  7     KSIPKKQEEEEEARVEIWKYIFGFVEMAIVKCAIELRIGDTIESHGSPMTLSQLSTALNC  66

Query  1192  SPSALYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDG  1013
             S S LYRI+RFL+ RGIFK+ E+    +                  Y QTPLS LL    
Sbjct  67    SASLLYRILRFLVRRGIFKQ-EINEANVI----------------SYDQTPLSRLLASSN  109

Query  1012  EKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAES  833
               SMA F+ LESSPVMLAPW +LS R+            G+    FEAA+GKDVW +A +
Sbjct  110   NNSMAPFLLLESSPVMLAPWHRLSARI-----------KGNGETPFEAAHGKDVWSFAAA  158

Query  832   DPAHSKLIEDAMACHAR-MAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVK  656
             DP H+ +I DAM+C AR + VPAI++ CP +            +VDVGGG+GT + M+VK
Sbjct  159   DPIHNIVINDAMSCTARVLTVPAILEECPQIF------EGIGSLVDVGGGNGTCLSMIVK  212

Query  655   AFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQIL  476
             AFP +KGINFDLPHV+S + +  GV HVGGNM   IPKADA F+MWVLHDW DE C++IL
Sbjct  213   AFPWIKGINFDLPHVISSSQQYIGVEHVGGNMLDSIPKADAAFIMWVLHDWDDETCIKIL  272

Query  475   SKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNN  296
               C+ AI E+ GKVII EA++ +  E                               NNN
Sbjct  273   KNCKGAISEKRGKVIIVEALIEERSE------------------------------ENNN  302

Query  295   NSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQA  134
                +VGLMLDMVMMAHT  G ERT K+W HVL  AGF  YT+T    V S+IQA
Sbjct  303   KLGDVGLMLDMVMMAHTKNGKERTSKEWGHVLHQAGFTQYTITPIRAVHSVIQA  356



>ref|XP_002281120.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase [Vitis vinifera]
 gb|AGN70873.1| O-methyltransferase OMT3 [Vitis vinifera]
 gb|AGN70874.1| O-methyltransferase OMT3 [Vitis vinifera]
Length=353

 Score =   342 bits (876),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 208/399 (52%), Positives = 247/399 (62%), Gaps = 64/399 (16%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRG  1145
             +WKY+FGF EMAVVKC IELGI D +ES    +TL  LSS LGCSPS LYRIMRFL+NR 
Sbjct  19    MWKYIFGFVEMAVVKCGIELGIADVIESHAGPITLSSLSSSLGCSPSGLYRIMRFLVNRR  78

Query  1144  IFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSPVM  965
             IFKEV  +                 +   GY QTPLS  L    E  MAA + LESSPVM
Sbjct  79    IFKEVATS-----------------QGDTGYQQTPLSRRLMTRSENGMAALLLLESSPVM  121

Query  964   LAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMACHA  785
             LAPW  LS R+L           G  +  F+AA+G+DVW YA S PAHSKLI DAMAC A
Sbjct  122   LAPWHGLSARLL-----------GKGNATFDAAHGQDVWGYAASHPAHSKLINDAMACDA  170

Query  784   RMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPHVVS  605
             RMAV AIV  CP++            +VDVGGGDGT +  L+KA P ++GINFDLPHVVS
Sbjct  171   RMAVSAIVNGCPEVF------DGVSTLVDVGGGDGTALRTLIKARPLIRGINFDLPHVVS  224

Query  604   VAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKVIIA  425
              APK  GV +  G+MF  +PKADA FLMWVLHDWGDEEC+QIL KCR+AIP + GKVII 
Sbjct  225   SAPKCNGVEYASGDMFDTVPKADAAFLMWVLHDWGDEECIQILEKCRQAIPGDKGKVIIV  284

Query  424   EAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMMAHT  245
             EA+++++++                                +NN  +VGLMLDMVMMAHT
Sbjct  285   EAVIQENEK------------------------------EGDNNLKDVGLMLDMVMMAHT  314

Query  244   GKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
               G ERT K+W +VL  AGF  YTV     V S+I+A P
Sbjct  315   TTGKERTLKEWDYVLKKAGFNRYTVKPIRAVKSVIEAYP  353



>gb|AGK93043.1| OMT3 protein [Vitis vinifera]
Length=346

 Score =   342 bits (876),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 208/399 (52%), Positives = 247/399 (62%), Gaps = 64/399 (16%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRG  1145
             +WKY+FGF EMAVVKC IELGI D +ES    +TL  LSS LGCSPS LYRIMRFL+NR 
Sbjct  12    MWKYIFGFVEMAVVKCGIELGIADVIESHAGPITLSSLSSSLGCSPSGLYRIMRFLVNRR  71

Query  1144  IFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSPVM  965
             IFKEV  +                 +   GY QTPLS  L    E  MAA + LESSPVM
Sbjct  72    IFKEVATS-----------------QGDTGYQQTPLSRRLMTRSENGMAALLLLESSPVM  114

Query  964   LAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMACHA  785
             LAPW  LS R+L           G  +  F+AA+G+DVW YA S PAHSKLI DAMAC A
Sbjct  115   LAPWHGLSARLL-----------GKGNATFDAAHGQDVWGYAASHPAHSKLINDAMACDA  163

Query  784   RMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPHVVS  605
             RMAV AIV  CP++            +VDVGGGDGT +  L+KA P ++GINFDLPHVVS
Sbjct  164   RMAVSAIVNGCPEVF------DGVSTLVDVGGGDGTALRTLIKARPLIRGINFDLPHVVS  217

Query  604   VAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKVIIA  425
              APK  GV +  G+MF  +PKADA FLMWVLHDWGDEEC+QIL KCR+AIP + GKVII 
Sbjct  218   SAPKCNGVEYASGDMFDTVPKADAAFLMWVLHDWGDEECIQILEKCRQAIPGDKGKVIIV  277

Query  424   EAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMMAHT  245
             EA+++++++                                +NN  +VGLMLDMVMMAHT
Sbjct  278   EAVIQENEK------------------------------EGDNNLKDVGLMLDMVMMAHT  307

Query  244   GKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
               G ERT K+W +VL  AGF  YTV     V S+I+A P
Sbjct  308   TTGKERTLKEWDYVLKKAGFNRYTVKPIRAVKSVIEAYP  346



>gb|KDO68213.1| hypothetical protein CISIN_1g018565mg [Citrus sinensis]
Length=354

 Score =   340 bits (872),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 195/412 (47%), Positives = 252/412 (61%), Gaps = 67/412 (16%)
 Frame = -1

Query  1363  IRRQEVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPS  1184
             ++++E D + E  IWKYVFGFT MAVVKCA+ELGI + +E +   +TL++L+S L C PS
Sbjct  10    MKKEEDDAKVE--IWKYVFGFTNMAVVKCAVELGIAEAVEEKGSPITLNELASALKCDPS  67

Query  1183  ALYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKS  1004
              L RIMRFLI+   FKEV    PT             ++ +  + QTPLS  L R GE +
Sbjct  68    LLQRIMRFLIHLKFFKEV----PT-------------SQGSMAFQQTPLSRRLMRHGENN  110

Query  1003  MAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPA  824
             MAAF+ LESSPVMLAPW  L  RVL            + + AF+ A+GKDVW YA +D A
Sbjct  111   MAAFILLESSPVMLAPWHSLGTRVL-----------ANGTSAFDKAHGKDVWSYAAADAA  159

Query  823   HSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPG  644
             HSKLI DAMAC  R+A+ AI++ CP++            +VD+GG DGTT+  L KAFP 
Sbjct  160   HSKLINDAMACDTRLAMRAIIEGCPEVF------DGIETLVDIGGNDGTTLRTLTKAFPR  213

Query  643   VKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCR  464
             ++GINFDLPHVV VA K  GV HVGG+MF  +P+ADA  + WVLHDWGD+EC++IL  C+
Sbjct  214   IRGINFDLPHVVCVAEKCHGVEHVGGDMFDGVPEADAAIIKWVLHDWGDDECIKILKNCK  273

Query  463   EAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYE  284
             EAI ++ GKVII EAI+ +   + N ++  R                             
Sbjct  274   EAITKDKGKVIIVEAIIEEDDGVDNKFKSVR-----------------------------  304

Query  283   VGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
               LMLDMVMMAHT KG ER+ K+W +VL  AGF  Y +T    V S+I+A P
Sbjct  305   --LMLDMVMMAHTNKGKERSLKEWDYVLRQAGFSRYNITSIHAVQSLIEAFP  354



>ref|XP_006486669.1| PREDICTED: 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase-like 
[Citrus sinensis]
Length=346

 Score =   340 bits (871),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 195/412 (47%), Positives = 252/412 (61%), Gaps = 67/412 (16%)
 Frame = -1

Query  1363  IRRQEVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPS  1184
             ++++E D + E  IWKYVFGFT MAVVKCA+ELGI + +E +   +TL++L+S L C PS
Sbjct  2     MKKEEDDAKVE--IWKYVFGFTNMAVVKCAVELGIAEAVEEKGSPITLNELASALKCDPS  59

Query  1183  ALYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKS  1004
              L RIMRFLI+   FKEV    PT             ++ +  + QTPLS  L R GE +
Sbjct  60    LLQRIMRFLIHLKFFKEV----PT-------------SQGSMAFQQTPLSRRLMRHGENN  102

Query  1003  MAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPA  824
             MAAF+ LESSPVMLAPW  L  RVL            + + AF+ A+GKDVW YA +D A
Sbjct  103   MAAFILLESSPVMLAPWHSLGTRVL-----------ANGTSAFDKAHGKDVWSYAAADAA  151

Query  823   HSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPG  644
             HSKLI DAMAC  R+A+ AI++ CP++            +VD+GG DGTT+  L KAFP 
Sbjct  152   HSKLINDAMACDTRLAMRAIIEGCPEVF------DGIETLVDIGGNDGTTLRTLTKAFPR  205

Query  643   VKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCR  464
             ++GINFDLPHVV VA K  GV HVGG+MF  +P+ADA  + WVLHDWGD+EC++IL  C+
Sbjct  206   IRGINFDLPHVVCVAEKCHGVEHVGGDMFDGVPEADAAIIKWVLHDWGDDECIKILKNCK  265

Query  463   EAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYE  284
             EAI ++ GKVII EAI+ +   + N ++  R                             
Sbjct  266   EAITKDKGKVIIVEAIIEEDDGVDNKFKSVR-----------------------------  296

Query  283   VGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
               LMLDMVMMAHT KG ER+ K+W +VL  AGF  Y +T    V S+I+A P
Sbjct  297   --LMLDMVMMAHTNKGKERSLKEWDYVLRQAGFSRYNITSIHAVQSLIEAFP  346



>ref|XP_011092948.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Sesamum 
indicum]
Length=349

 Score =   337 bits (863),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 199/417 (48%), Positives = 259/417 (62%), Gaps = 68/417 (16%)
 Frame = -1

Query  1378  MDAKSIRRQEVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGL  1199
             M+ KS +  E    + D IWKYVFGFT MAVVKCAIEL I + LES    +TL +LS+ L
Sbjct  1     METKSFKVDEEAQAQVD-IWKYVFGFTPMAVVKCAIELQIAEVLESHGGGITLSELSAAL  59

Query  1198  GCSPSALYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTR  1019
             GCS   L RIMR+L++RGIFK+ E+T               +      YVQTPLS LL R
Sbjct  60    GCSSLPLNRIMRYLMHRGIFKQ-ELT---------------TQESEICYVQTPLSRLLIR  103

Query  1018  DGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYA  839
             +G  SMA F+ LESSPVML+PW +L   +           SG+SS  FEAA+G+DVW YA
Sbjct  104   NGGNSMADFILLESSPVMLSPWHRLKSAL----------TSGASS--FEAAHGEDVWEYA  151

Query  838   ESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLV  659
              ++P+HSKLI DAMACHAR+A+ AI+   P+             +VDVGGG+GT +++LV
Sbjct  152   AANPSHSKLINDAMACHARLAMSAIINRYPEAF------KGISSLVDVGGGNGTALQILV  205

Query  658   KAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQI  479
             KA P ++GINFDL HVVSVAP+  G+ HV G+MF+ +P ADA FLM VLHDWGD+EC+ I
Sbjct  206   KACPWIRGINFDLAHVVSVAPQYDGIEHVSGDMFEIVPNADAAFLMSVLHDWGDDECIDI  265

Query  478   LSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNN  299
             L  CREAIP++TGKV+I EA++ + +E                                 
Sbjct  266   LKNCREAIPKDTGKVMIVEAVMDEGEE---------------------------------  292

Query  298   NNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             +   +V L LDMVM+AHT KG ER+ K+W +V+ AAGF  +TV     V+S+I+A P
Sbjct  293   DEYVDVRLALDMVMLAHTEKGKERSRKEWEYVVKAAGFTRFTVRHIQTVLSVIEAYP  349



>ref|XP_002529799.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF32581.1| o-methyltransferase, putative [Ricinus communis]
Length=353

 Score =   335 bits (860),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 198/421 (47%), Positives = 262/421 (62%), Gaps = 71/421 (17%)
 Frame = -1

Query  1387  DLSMDAKSIRRQEVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLS  1208
             D      +IR +E + + E  IW YV GF+++A VKCAIELG+ D +ES E  +TL +LS
Sbjct  3     DTRRSDSTIRDEEEEADVE--IWNYVLGFSKIAAVKCAIELGLADVIESNEAPLTLFELS  60

Query  1207  SGLGCSPSALYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSAL  1028
             S LGC+PS+LYRIMRFL+++ IFKE     PT             ++ T GYVQTPLS  
Sbjct  61    STLGCAPSSLYRIMRFLVHQKIFKE----KPT-------------SQGTTGYVQTPLSRR  103

Query  1027  LTRDGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVW  848
             L R GE SMA F+ +ESSP MLAPW  LS  V            G+   AFE ++G+ +W
Sbjct  104   LLRQGENSMADFILMESSPDMLAPWQCLSNCV-----------RGNVHSAFEESHGQHLW  152

Query  847   RYAESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvE  668
             ++ E++PAHSKL  DAMAC AR+ VP+I++ CP++            VVDVGGG+GTT+ 
Sbjct  153   KHTEANPAHSKLFNDAMACDARIIVPSIIEVCPEVF------NGVKSVVDVGGGNGTTLG  206

Query  667   MLVKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEEC  488
             +LVKA P ++GINFDLPHVVSVA +  GV HVGG+MF  +P+ADA FLMWVLHDW D+EC
Sbjct  207   LLVKACPWIQGINFDLPHVVSVALECDGVKHVGGDMFDSVPQADAAFLMWVLHDWNDDEC  266

Query  487   VQILSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRN  308
             +QIL KC+EA+PE+ GKVII EA++ + +                               
Sbjct  267   IQILKKCKEAVPEDNGKVIIVEAVIGEAK-------------------------------  295

Query  307   NNNNNSYE-VGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQAR  131
                ++ +E V LMLD+V+MAHT  G E T K+W  V+  AGF+S+T+     V SII+A 
Sbjct  296   ---DDKFEYVRLMLDIVIMAHTNTGKETTSKEWESVIQKAGFRSHTIKPIGAVQSIIEAV  352

Query  130   P  128
             P
Sbjct  353   P  353



>gb|AGN70876.1| O-methyltransferase OMT4 [Vitis vinifera]
 gb|AGN70877.1| O-methyltransferase OMT4 [Vitis vinifera]
Length=359

 Score =   335 bits (858),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 194/400 (49%), Positives = 238/400 (60%), Gaps = 64/400 (16%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRG  1145
             +WKY++GF  MA VKC IELGI D +ES    +TL  LSS LGC PS L RIMRFL++R 
Sbjct  23    MWKYIYGFAAMAAVKCGIELGIADVMESHGGPITLSALSSSLGCPPSGLNRIMRFLVSRR  82

Query  1144  IFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSPVM  965
             IF+EV  +                 +   GY QTP+S  L       MAAFV LESSPVM
Sbjct  83    IFREVATS-----------------QGDTGYQQTPMSRCLMTSRGDGMAAFVLLESSPVM  125

Query  964   LAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMACHA  785
             LAPW  LS RVL           G  +  FEAA+G D+W YA  +P HSKLI DAMA +A
Sbjct  126   LAPWHGLSARVL-----------GKGNSTFEAAHGDDIWGYAAKNPDHSKLINDAMASNA  174

Query  784   RMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPHVVS  605
             R  VPA+V  CP++            +VDVGGG+GT +  LVKA P ++GINFDLPHVV+
Sbjct  175   RRVVPAMVNDCPEVF------DGVGTLVDVGGGNGTALRTLVKACPWIRGINFDLPHVVA  228

Query  604   VAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKVIIA  425
              APK   V HVGGNMF  +PKADA+F+M VLHDWGDE+C++IL KCREAIPE+ GKVII 
Sbjct  229   TAPKCNDVEHVGGNMFDSVPKADAVFIMKVLHDWGDEKCIKILEKCREAIPEDKGKVIIV  288

Query  424   EAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMMAHT  245
             EA++                             +  D   ++    +V LM+DMVMMAHT
Sbjct  289   EAVI-----------------------------EGDDPQGDDQKLKDVKLMVDMVMMAHT  319

Query  244   GKGLERTEKQWSHVLTAAGFKSYTVTDTSDVV-SIIQARP  128
               G ERT K+W +VL  AGF  YT+     +V SII+A P
Sbjct  320   TTGKERTFKEWDYVLLNAGFSRYTIKPIRSIVQSIIEAYP  359



>ref|XP_008236081.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Prunus 
mume]
Length=357

 Score =   334 bits (857),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 194/399 (49%), Positives = 247/399 (62%), Gaps = 63/399 (16%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRG  1145
             IWKYVFGF E+AVVKC+IELGI D +ES    +TL +LSS L C PS LYRIMR L++  
Sbjct  22    IWKYVFGFVEIAVVKCSIELGIADAIESHGSPMTLLELSSALRCDPSPLYRIMRVLVHLK  81

Query  1144  IFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSPVM  965
             IFKE   T                    + Y QTPLS  L + G+ SMAAF+ LESSPVM
Sbjct  82    IFKEKPAT----------------QLGPKVYAQTPLSKRLLKSGKNSMAAFILLESSPVM  125

Query  964   LAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMACHA  785
             LAPW  LS R+            G S+ +FEA +G+DVW YA ++P HSKLI +AMAC A
Sbjct  126   LAPWHGLSARI-----------QGVSNPSFEAVHGEDVWSYAAANPNHSKLINEAMACDA  174

Query  784   RMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPHVVS  605
             R+AVPA++++C ++            +VDVGGGDGTT+ +LV+  P ++G+NFDLPHVVS
Sbjct  175   RVAVPAVLESCLEVF------KGLETIVDVGGGDGTTLRLLVEECPWIRGVNFDLPHVVS  228

Query  604   VAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKVIIA  425
             VA +   + +VGG+MF  +PKADA  +MWVLHDWGD+EC++IL KCREAIPE+ GKVII 
Sbjct  229   VAQECDRIENVGGDMFDCVPKADAAIIMWVLHDWGDDECIRILKKCREAIPEDKGKVIIV  288

Query  424   EAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMMAHT  245
             EA++                              E+D    +    +V LMLDMVMMAHT
Sbjct  289   EAVI------------------------------EEDNEKQDKKLTDVRLMLDMVMMAHT  318

Query  244   GKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
               G ERT K+W +VL  AGF  +T+T    V S+IQA P
Sbjct  319   NTGKERTLKEWGYVLGEAGFSRHTITPIHAVQSVIQAFP  357



>ref|XP_003601618.1| O-methyltransferase [Medicago truncatula]
 gb|AES71869.1| flavonoid O-methyltransferase-like protein [Medicago truncatula]
Length=361

 Score =   334 bits (856),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 192/397 (48%), Positives = 243/397 (61%), Gaps = 64/397 (16%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRG  1145
             IWKY+FGF E+AVVKCAIELGI + +E  ++ ++L +LSS L C  S + RIMRFL++R 
Sbjct  27    IWKYIFGFVELAVVKCAIELGIAEAIEKHKKPMSLLELSSTLKCDSSYVNRIMRFLVHRK  86

Query  1144  IFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSPVM  965
             IFK +                     P+  YVQTPLS  L R+GE SM A + LESSPVM
Sbjct  87    IFKTMNTN--------------HDDYPS--YVQTPLSRRLIRNGEHSMVAILLLESSPVM  130

Query  964   LAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMACHA  785
             +APWL LS RVL+  N            +FE  +G+DVW YA S+  HS LI DAMAC A
Sbjct  131   VAPWLSLSDRVLVNGN-----------PSFEKVHGEDVWHYAASNLDHSNLINDAMACDA  179

Query  784   RMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPHVVS  605
             ++ VPAIV+ C ++            +VDVGGG+GTT+ +L KAFP ++GINFDLPHV+ 
Sbjct  180   KVVVPAIVEGCSEVF------DGVGSLVDVGGGNGTTMSILAKAFPRIRGINFDLPHVID  233

Query  604   VAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKVIIA  425
             VAPK  GV HV G+MF  +PKADA  + WVLHDWGDEEC+QIL  CREAIP+E GKVII 
Sbjct  234   VAPKYDGVEHVAGDMFTSVPKADAAIIKWVLHDWGDEECIQILKNCREAIPKENGKVIIV  293

Query  424   EAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMMAHT  245
             EA++ + +   N Y+                               +VGLMLDMVMMAHT
Sbjct  294   EAVIEEGEGKHNKYK-------------------------------DVGLMLDMVMMAHT  322

Query  244   GKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQA  134
               G ERT K+W +V+  AGFK+  V   + V S+I A
Sbjct  323   NIGKERTLKEWEYVIKMAGFKALIVKSINAVQSVIVA  359



>ref|XP_007201642.1| hypothetical protein PRUPE_ppa021776mg [Prunus persica]
 gb|EMJ02841.1| hypothetical protein PRUPE_ppa021776mg [Prunus persica]
Length=357

 Score =   333 bits (855),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 193/399 (48%), Positives = 246/399 (62%), Gaps = 63/399 (16%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRG  1145
             IWKYVFGF E+AVVKCAI+LGI D +ES    +TL +LSS L C PS LYRIMR L++  
Sbjct  22    IWKYVFGFVEIAVVKCAIQLGIADAIESHGSPMTLLELSSALRCDPSPLYRIMRVLVHLK  81

Query  1144  IFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSPVM  965
             IFKE   T                    + Y QTPLS  L + G+ SMAA + LESSPVM
Sbjct  82    IFKEKPAT----------------QLGPKVYAQTPLSKWLLKSGKNSMAALILLESSPVM  125

Query  964   LAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMACHA  785
             LAPW  LS R+            G ++ AFEA +G+DVW YA ++P HSKLI +AMAC A
Sbjct  126   LAPWHGLSARI-----------QGVNNSAFEAVHGEDVWSYAAANPNHSKLINEAMACDA  174

Query  784   RMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPHVVS  605
             R+AVPA++++C ++            +VDVGGGDGTT+ +LV+A P ++GINFDLPHVVS
Sbjct  175   RVAVPAVLESCLEVF------KGLETIVDVGGGDGTTLRLLVEACPWIRGINFDLPHVVS  228

Query  604   VAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKVIIA  425
             VA +   + +VGG+MF  +PKADA  +MWVLHDWGD+EC++IL KCREA+PE+ G+VII 
Sbjct  229   VAQECDRIENVGGDMFDCVPKADAAIIMWVLHDWGDDECIRILKKCREAVPEDKGQVIIV  288

Query  424   EAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMMAHT  245
             EA++                              E+D    +     V LMLDMVMMAHT
Sbjct  289   EAVI------------------------------EEDNEKQDKKLTNVRLMLDMVMMAHT  318

Query  244   GKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
               G ERT K+W +VL  AGF  +T+T    V S+IQA P
Sbjct  319   NTGKERTMKEWGYVLGEAGFSRHTITPIHAVQSVIQAFP  357



>ref|XP_007201351.1| hypothetical protein PRUPE_ppa007692mg [Prunus persica]
 gb|EMJ02550.1| hypothetical protein PRUPE_ppa007692mg [Prunus persica]
Length=359

 Score =   333 bits (853),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 196/399 (49%), Positives = 247/399 (62%), Gaps = 63/399 (16%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRG  1145
             +WKYVFGF E+AVVKCAIELGI D +ES    +TL +LSS L C PS LYRIMR L++  
Sbjct  24    VWKYVFGFVEIAVVKCAIELGIADTIESHGSPMTLLELSSALRCDPSPLYRIMRVLVHLK  83

Query  1144  IFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSPVM  965
             IFKE   T                    + + QTPLS  L + GE SM+A + LESSPVM
Sbjct  84    IFKEKPAT----------------QLGPKVFAQTPLSKWLLKSGETSMSALILLESSPVM  127

Query  964   LAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMACHA  785
             LAPW  LS R+            G S+ AFEA +G+DVW YA+++P HSKLI +AMAC A
Sbjct  128   LAPWHGLSARI-----------QGISNPAFEAVHGEDVWSYAKANPDHSKLINEAMACDA  176

Query  784   RMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPHVVS  605
             R+AVPA++++C ++            +VDVGGGDGTT+ +LV+A P V+GINFDLPHVVS
Sbjct  177   RVAVPAVIESCLEVF------KGIATIVDVGGGDGTTLRLLVEACPWVQGINFDLPHVVS  230

Query  604   VAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKVIIA  425
             VA +   + +VGG+MF  +PKADA+ + WVLHDWGD+EC++IL KCREAIPE  GKVII 
Sbjct  231   VAQECDHIKNVGGDMFDSVPKADAVIMKWVLHDWGDDECIRILKKCREAIPENKGKVIIV  290

Query  424   EAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMMAHT  245
             EA++                              EKD   +   +  V LMLDMVMMAHT
Sbjct  291   EAVI-----------------------------DEKDEKEDIKLT-NVRLMLDMVMMAHT  320

Query  244   GKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
               G ERT K+W +VL  AGF  +T+T    V S+IQA P
Sbjct  321   NTGKERTLKEWGYVLGEAGFSRHTITPIHAVQSVIQAFP  359



>ref|XP_010066313.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Eucalyptus 
grandis]
Length=365

 Score =   330 bits (847),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 200/413 (48%), Positives = 254/413 (62%), Gaps = 72/413 (17%)
 Frame = -1

Query  1351  EVDYEEEDG--IWKYVFGFTEMAVVKCAIELGIPDFLESQ-EQAVTLDQLSSGLGCSPSA  1181
             E D E + G  IWKY+ GFTEMAVVKCAI+LGI D +ES  + +++L QLSS LGC PS+
Sbjct  20    EDDEEAKAGVDIWKYILGFTEMAVVKCAIDLGIADAIESHPDPSISLSQLSSKLGCCPSS  79

Query  1180  LYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSM  1001
             L RI+RFL++R IF+ +                      T  Y QTPLS LL   GEKSM
Sbjct  80    LRRILRFLVHRKIFRHLA--------------------DTNTYSQTPLSRLLLARGEKSM  119

Query  1000  AAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAH  821
             AA + LE++PVMLAPWLKLS  V           + ++   F  A+G D+W Y+E++P H
Sbjct  120   AALILLETTPVMLAPWLKLSSHV--------SATAATAPPPFMVAHGDDIWVYSEANPGH  171

Query  820   SKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGV  641
             S+LI++AMAC AR+AVPA+ + CP++            +VDVGGG+GTT+ +L KAFP +
Sbjct  172   SRLIDEAMACDARVAVPALAEDCPEVF------EGVLTMVDVGGGNGTTLRLLRKAFPWI  225

Query  640   KGINFDLPHVVSVA-PKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCR  464
             +GINFDLPHVVSVA P   GV H GG+MF+ +PKADA FL  VLHDW D EC+QIL  CR
Sbjct  226   RGINFDLPHVVSVALPPCEGVEHAGGDMFEGVPKADAAFLKSVLHDWSDSECIQILKNCR  285

Query  463   EAIPE-ETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSY  287
             EAI E ++GKVII EA++                             +EKD         
Sbjct  286   EAISESKSGKVIIVEAVI----------------------------DEEKD-----GKWT  312

Query  286   EVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             +V L LDMVMMAHTG G ERTEK+W+HVL  AGF  YT+     V S+I+A P
Sbjct  313   DVRLTLDMVMMAHTGGGKERTEKEWAHVLRQAGFAKYTIKPVRAVQSVIEAFP  365



>ref|XP_010526871.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Tarenaya 
hassleriana]
Length=361

 Score =   329 bits (844),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 202/423 (48%), Positives = 254/423 (60%), Gaps = 77/423 (18%)
 Frame = -1

Query  1375  DAKSIRRQEVDYEEEDG-------IWKYVFGFTEMAVVKCAIELGIPDFLESQ-EQAVTL  1220
             + K++R +   YEEED        IW+YVFGFT+MAVVKCAI+L IP+ +E+   Q VTL
Sbjct  4     NGKTLRNRV--YEEEDEEAKASTEIWRYVFGFTDMAVVKCAIDLKIPEAIENHTSQPVTL  61

Query  1219  DQLSSGLGCSPSALYR-IMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQT  1043
               LS+ +  SP  L R IMRFL +RGIFKEV +T   I                 GY+ T
Sbjct  62    ADLSTAVSSSPPPLLRRIMRFLAHRGIFKEV-LTKDGIV----------------GYLNT  104

Query  1042  PLSALLTRDGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAAN  863
             PLS L+     KSMA F+ LE++PVMLAPWL LS  V           SG  S  F+AA+
Sbjct  105   PLSRLMM---SKSMAPFILLETTPVMLAPWLNLSSVV--------SAVSGEGSPPFDAAH  153

Query  862   GKDVWRYAESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggd  683
             GKDVW YA  +P HS++I  AMAC AR  VPA+  AC D+            VVDVGGG+
Sbjct  154   GKDVWAYAAENPGHSEIINQAMACDARRVVPAVAGACADVF------NGASTVVDVGGGN  207

Query  682   gttvEMLVKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDW  503
             G  + +LVKAFP VKG+NFDLPHVV  A K  GV +VGG+MF  +P AD +F+ WVLHDW
Sbjct  208   GEALGILVKAFPWVKGLNFDLPHVVEAAEKFDGVENVGGDMFDSVPNADVVFIKWVLHDW  267

Query  502   GDEECVQILSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQ  323
             GDEE V+IL KCREAIP+E GKV+I EA++ + +      +G R++              
Sbjct  268   GDEEYVKILKKCREAIPKEEGKVVIVEAVVGEKK------KGDRLEYAR-----------  310

Query  322   EKDRNNNNNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSI  143
                            LMLDMVMMAHT +G ERT ++W HVLTAAGF  Y + D +DV S+
Sbjct  311   ---------------LMLDMVMMAHTTRGRERTSEEWDHVLTAAGFARYEIRDINDVQSV  355

Query  142   IQA  134
             + A
Sbjct  356   VVA  358



>ref|XP_010066314.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Eucalyptus 
grandis]
Length=365

 Score =   327 bits (839),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 195/402 (49%), Positives = 250/402 (62%), Gaps = 70/402 (17%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQ-EQAVTLDQLSSGLGCSPSALYRIMRFLINR  1148
             IWKYVFGFTEMAVVKCAI+LGI D +ES  E +++L +LSS LGC PS+L RI+RFL++R
Sbjct  31    IWKYVFGFTEMAVVKCAIDLGIADAMESHPEPSISLSRLSSELGCCPSSLRRILRFLVHR  90

Query  1147  GIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSPV  968
              IF++                       T  Y QTPLS  L   GE SMAAF+RLE++PV
Sbjct  91    RIFRQ--------------------HADTDTYSQTPLSRRLLTRGENSMAAFIRLETTPV  130

Query  967   MLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMACH  788
             MLAPWL LS  V           + ++   F A +G DVW Y+ ++P HS+LI++AMAC 
Sbjct  131   MLAPWLNLSSHV--------SAAAATAPPPFVAVHGDDVWVYSAANPGHSRLIDEAMACD  182

Query  787   ARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPHVV  608
             AR+AVPA+ + CP++            +VDVGGG+GTT+ +L KAFP ++GINFDLPHVV
Sbjct  183   ARVAVPALAKDCPEVF------EGVLTMVDVGGGNGTTLRLLRKAFPWIRGINFDLPHVV  236

Query  607   SVA-PKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIP-EETGKV  434
             S A P   GV HVGG+MF+ +PKADA+FL WVLHDW D ECVQIL  C+EAI   ++GKV
Sbjct  237   SGASPPCEGVEHVGGDMFEGVPKADAVFLKWVLHDWSDSECVQILKNCKEAISGSKSGKV  296

Query  433   IIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMM  254
             II EA++                             +E+D     +   +V L LDMVMM
Sbjct  297   IIMEAVI----------------------------GKEED-----DKLTDVRLTLDMVMM  323

Query  253   AHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             AHTG G ERTEK+W+HVL  AGF  YT+     + S+I+A P
Sbjct  324   AHTGGGKERTEKEWAHVLCQAGFTKYTIKPIRAIQSVIEAFP  365



>ref|XP_010526872.1| PREDICTED: LOW QUALITY PROTEIN: (R,S)-reticuline 7-O-methyltransferase-like 
[Tarenaya hassleriana]
Length=361

 Score =   326 bits (835),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 196/421 (47%), Positives = 255/421 (61%), Gaps = 73/421 (17%)
 Frame = -1

Query  1375  DAKSIRRQEVDYEEEDG-----IWKYVFGFTEMAVVKCAIELGIPDFLESQ-EQAVTLDQ  1214
             + K++R +  + E+E+      IW+YVFGFT+MAVVKCAI+L IP+ +E+   Q VTL  
Sbjct  4     NGKTLRNRVYEEEDEEAKASTEIWRYVFGFTDMAVVKCAIDLKIPEAIENHTSQPVTLAD  63

Query  1213  LSSGLGCSP-SALYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPL  1037
             LS+ +  SP   L RIMRFL +RGIFKEV +T   I                 GY+ TPL
Sbjct  64    LSTAVSSSPLPLLRRIMRFLAHRGIFKEV-LTKDGIV----------------GYLNTPL  106

Query  1036  SALLTRDGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGK  857
             S L+     KSMA F+ LE++PVMLAPWL LS  V           SG  S  F+AA+GK
Sbjct  107   SRLMM---SKSMALFILLETTPVMLAPWLNLSSVV--------SAVSGEGSPPFDAAHGK  155

Query  856   DVWRYAESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgt  677
             +VW YA  +P HS++I  AMAC +R  VPA+  AC D+            VVDVGGG+G 
Sbjct  156   NVWAYATENPGHSEIINQAMACDSRRMVPAVAGACADVF------NGASTVVDVGGGNGE  209

Query  676   tvEMLVKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGD  497
              + +LVKAFP VKG+NFDLPHVV  A K  GV +VGG+MF+ +P AD +F+ WVLHDWGD
Sbjct  210   ALGILVKAFPWVKGLNFDLPHVVEAAEKFDGVENVGGDMFESVPNADVVFIKWVLHDWGD  269

Query  496   EECVQILSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEK  317
             +ECV+IL KCREAIP+E GKV+I EA++ + +      +G  ++                
Sbjct  270   KECVKILKKCREAIPKEEGKVVIVEAVVGEKK------KGDMLEYAR-------------  310

Query  316   DRNNNNNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQ  137
                          LMLDMVMMAHT +G ERT ++W HVLTAAGF  Y + D +DV S++ 
Sbjct  311   -------------LMLDMVMMAHTTRGRERTSEEWDHVLTAAGFARYEIRDINDVQSVVV  357

Query  136   A  134
             A
Sbjct  358   A  358



>ref|XP_008447906.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Cucumis 
melo]
Length=358

 Score =   326 bits (835),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 197/412 (48%), Positives = 244/412 (59%), Gaps = 64/412 (16%)
 Frame = -1

Query  1366  SIRRQEVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSP  1187
             SI ++E + E    IWKY+FGF EMA+VKCAIEL I D +ES    +TL QLS+ L CS 
Sbjct  8     SISKKE-EEEARVQIWKYIFGFVEMAIVKCAIELRIGDTIESHGSPMTLSQLSTALNCSS  66

Query  1186  SALYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEK  1007
             S LYRI+RFL+ RGIFK+ E+T   +                  Y  TPLS LL      
Sbjct  67    SLLYRILRFLVRRGIFKQ-EITEENVI----------------SYDHTPLSRLLASSNNN  109

Query  1006  SMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDP  827
             SMA  + LESSPVMLAPW +LS R+            G+    FEAA+GKDVW +A +DP
Sbjct  110   SMAPLLLLESSPVMLAPWHRLSARI-----------KGNGETPFEAAHGKDVWSFAAADP  158

Query  826   AHSKLIEDAMACHARM-AVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAF  650
              H+ +I DAM+C AR+  VPAI++ CP +            +VDVGGG+GT + M+VKAF
Sbjct  159   IHNIVINDAMSCTARVHTVPAILEDCPQIF------EGIGSLVDVGGGNGTCLSMIVKAF  212

Query  649   PGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSK  470
             P +KGINFDLPHV+S + +  GV HVGGNM   IPKADA F+MWVLHDW DE C++IL  
Sbjct  213   PWIKGINFDLPHVISSSQQYIGVEHVGGNMLDSIPKADAAFIMWVLHDWDDETCIKILKN  272

Query  469   CREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNS  290
             C+EAI E+ GKVII EAI+ +  E  N                                 
Sbjct  273   CKEAISEKRGKVIIVEAIIEERSEEENNNNNLG---------------------------  305

Query  289   YEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQA  134
              +VGLMLDMVMMAHT  G ERT K+W +VL  AGF  YT+T    V S+IQ 
Sbjct  306   -DVGLMLDMVMMAHTENGKERTIKEWGNVLRQAGFTRYTITPIRAVHSVIQG  356



>ref|XP_008236085.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Prunus 
mume]
Length=357

 Score =   325 bits (833),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 191/401 (48%), Positives = 247/401 (62%), Gaps = 67/401 (17%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRG  1145
             IWKYVFGF E+AVVKCAIELGI D +ES    +TL +LSS L C PS LYRIMR L++  
Sbjct  22    IWKYVFGFAEIAVVKCAIELGIADAIESHGSPMTLLELSSALRCDPSPLYRIMRVLVHLK  81

Query  1144  IFKEVEMTL--PTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSP  971
             IFKE   T   P +                  Y QTPLS  L + G+ SMAAF+ LE+SP
Sbjct  82    IFKEKPTTQLGPEV------------------YAQTPLSKRLLKSGQNSMAAFILLENSP  123

Query  970   VMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMAC  791
             VMLAP+  LS R+            G S+ AFEA +G+DVW YA ++P HSKL  +AMAC
Sbjct  124   VMLAPFHGLSARI-----------QGISNPAFEAVHGEDVWSYAAANPDHSKLFNEAMAC  172

Query  790   HARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPHV  611
              AR+ VPA++++C ++            +VDVGGGDGTT+ +L++A P ++GINFDLPHV
Sbjct  173   DARVTVPAVIESCSEVF------KGIETIVDVGGGDGTTLRLLIEACPWIRGINFDLPHV  226

Query  610   VSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKVI  431
             VS+A +   + +VGG+MF+ +PK DA+ + WVLHDWGD+EC++IL KCREAIPE+ GKVI
Sbjct  227   VSLAQECDRIENVGGDMFEFVPKVDAVIMKWVLHDWGDDECIRILKKCREAIPEDKGKVI  286

Query  430   IAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMMA  251
             I EA++                              EKD   ++  +  V LMLDMVMMA
Sbjct  287   IIEAVI-----------------------------DEKDEKEDSKLT-NVRLMLDMVMMA  316

Query  250   HTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             H   G ERT K+W +VL  AGF  +T+T    V S+IQA P
Sbjct  317   HNSTGKERTLKEWGYVLGEAGFSRHTITPIHAVQSVIQAFP  357



>ref|XP_008236084.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Prunus 
mume]
Length=389

 Score =   326 bits (835),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 193/399 (48%), Positives = 245/399 (61%), Gaps = 63/399 (16%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRG  1145
             + KYVFGF E+AVVKCAIELGI D +ES    +TL +LSS L C PS+LYRIMR L++  
Sbjct  52    VLKYVFGFVEIAVVKCAIELGIADTIESHGSPMTLLELSSALSCDPSSLYRIMRVLVHLK  111

Query  1144  IFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSPVM  965
             IFKE   T                    + +VQTPLS  L + GE SMAA + LESSPVM
Sbjct  112   IFKEKPST----------------QLGPKVFVQTPLSKWLLKSGENSMAALILLESSPVM  155

Query  964   LAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMACHA  785
             LAPW  LS R+            G S+ AFEA +G+D+W YA ++P HSKLI +AMAC A
Sbjct  156   LAPWHGLSARI-----------QGISNPAFEAVHGEDIWSYAAANPDHSKLINEAMACDA  204

Query  784   RMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPHVVS  605
             R+AVPA++++C ++            +VDVGGGDGTT+ + V+A P ++GINFDLPHVVS
Sbjct  205   RVAVPAVIESCLEVF------KGIETIVDVGGGDGTTLRLWVEACPWIQGINFDLPHVVS  258

Query  604   VAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKVIIA  425
             VA +   + +VGG+MF  +PKADA+ + WVLHDWGD+EC++IL KCREAI E  GKVII 
Sbjct  259   VAQECDRIKNVGGDMFDSVPKADAVIMKWVLHDWGDDECIRILKKCREAILENKGKVIIV  318

Query  424   EAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMMAHT  245
             EA++                              EKD   +   +  V LMLDMVMMAHT
Sbjct  319   EAVI-----------------------------DEKDEKEDIKLT-NVRLMLDMVMMAHT  348

Query  244   GKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
               G ERT K+W +VL  AGF  +T+T    V S+IQA P
Sbjct  349   NTGKERTLKEWGYVLREAGFSRHTITPIHAVQSVIQAFP  387



>ref|XP_010690296.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Beta 
vulgaris subsp. vulgaris]
Length=364

 Score =   325 bits (833),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 190/414 (46%), Positives = 249/414 (60%), Gaps = 67/414 (16%)
 Frame = -1

Query  1369  KSIRRQEVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCS  1190
             K I  QE + + +  IWKYVFGFTEMA+VKCAI+LG+ + + +   +++L +L+S L CS
Sbjct  18    KEIEDQE-EAQADIEIWKYVFGFTEMAIVKCAIDLGLANIIHTNGGSMSLIELASTLKCS  76

Query  1189  PSALYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGE  1010
             PS+LYR+MRFL +R IF++   +  T+                  Y QTPLS  L    E
Sbjct  77    PSSLYRVMRFLNHRRIFRQSRTSQGTLI-----------------YSQTPLSRRLLSHEE  119

Query  1009  KSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESD  830
              +MAAF+ LES+PVML+PWL LS RVL             S  AF+AANG+DVW Y+  +
Sbjct  120   NNMAAFILLESTPVMLSPWLGLSNRVL-----------EKSGSAFDAANGEDVWSYSSKN  168

Query  829   PAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAF  650
              AHSKLI DAMAC AR+ VP I++ C +L          C  VDVGGGDGTT  MLV++ 
Sbjct  169   VAHSKLINDAMACDARVVVPQIIKGCANLF------DGVCSFVDVGGGDGTTSSMLVRSI  222

Query  649   PGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSK  470
             P ++GINFD PHVVS      GV HVGGNMF  +PKAD  F+MWVLHDWGD+EC+QIL K
Sbjct  223   PSIQGINFDFPHVVSNGVLCEGVQHVGGNMFDSVPKADVAFIMWVLHDWGDDECIQILKK  282

Query  469   CREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNS  290
             C+EAI ++ GKVII EA++ + ++  + ++  R                           
Sbjct  283   CKEAISKDKGKVIIVEAVI-EAEDTKDEFENAR---------------------------  314

Query  289   YEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
                 L+LDMVM+AHT  G ERT K+WS +L  AGF  + V     V S+I+A P
Sbjct  315   ----LLLDMVMLAHTTNGKERTLKEWSCLLNKAGFGHFNVHPIQAVQSVIEAFP  364



>ref|XP_008382454.1| PREDICTED: 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase-like 
[Malus domestica]
Length=360

 Score =   325 bits (832),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 188/399 (47%), Positives = 244/399 (61%), Gaps = 65/399 (16%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRG  1145
             +WKYVFGF E+AVVKCAIELGI D +E     +TL +LSS L C PS LYR+MR L++  
Sbjct  27    MWKYVFGFVEIAVVKCAIELGIADAIEIHGSPMTLLELSSALSCDPSHLYRVMRVLVHLK  86

Query  1144  IFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSPVM  965
             IFKE    L                   +GY QTPLS  L + GE SMAA + LESSPVM
Sbjct  87    IFKEKTTELGP-----------------KGYAQTPLSKRLLKSGENSMAALILLESSPVM  129

Query  964   LAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMACHA  785
             LAPW  LS R+            G+S+ +FEA +G+D+W +A ++P HSKLI DAMAC A
Sbjct  130   LAPWHGLSARL-----------RGNSNPSFEAVHGEDLWSFAAANPDHSKLINDAMACDA  178

Query  784   RMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPHVVS  605
             R+AVPA++++C ++            +VDVGGGDGTT+ +LV+  P ++GINFD PHVVS
Sbjct  179   RVAVPAVIESCLEVF------KGLETIVDVGGGDGTTLRLLVETCPWIRGINFDRPHVVS  232

Query  604   VAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKVIIA  425
             VA +   + +VGG+ F  +PKADA  +MWVLHDWGD++C++IL KCREAIP + GKVII 
Sbjct  233   VAHECDRIENVGGDFFYCVPKADAAIIMWVLHDWGDDDCIRILKKCREAIPNDKGKVIII  292

Query  424   EAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMMAHT  245
             EA++                               ++    +N   +V LMLDMVM+AHT
Sbjct  293   EAVI-------------------------------EEDGKEDNKLADVRLMLDMVMLAHT  321

Query  244   GKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
               G ERT K+W +VL  AGF  YT+T    V S+IQA P
Sbjct  322   NTGKERTFKEWGYVLGEAGFSRYTITPIHAVQSVIQAFP  360



>ref|XP_011092950.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Sesamum 
indicum]
Length=326

 Score =   321 bits (822),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 183/389 (47%), Positives = 234/389 (60%), Gaps = 63/389 (16%)
 Frame = -1

Query  1294  MAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRGIFKEVEMTLP  1115
             MAV+KCAIELGI D LES    ++L QLS+ LGCS S L+RIMR+L +R IFK +  +  
Sbjct  1     MAVMKCAIELGIADVLESHGGPMSLSQLSAALGCSSSVLHRIMRYLTHRRIFKRMSTS--  58

Query  1114  TIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSPVMLAPWLKLSGR  935
                                 YVQTPLS LL  +G  SMAAFV +ESSPVMLAPW KLS  
Sbjct  59    --------------QESEISYVQTPLSRLLISNGGNSMAAFVLMESSPVMLAPWHKLSAS  104

Query  934   VLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMACHARMAVPAIVQA  755
              L+             + AFEAA+G  VW+YA  +P HSKL  D MACHAR+A+  IV  
Sbjct  105   ALM-----------KGTSAFEAAHGDHVWKYAAENPGHSKLFNDGMACHARLAMSTIVDQ  153

Query  754   CPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPHVVSVAPKRPGVHH  575
              P+             +V+VGGGDGT + +LVKA P ++GIN DLPHVVSVAPK  G+ H
Sbjct  154   YPEAF------KGIMSLVNVGGGDGTALHVLVKACPWIRGINLDLPHVVSVAPKCHGIEH  207

Query  574   VGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKVIIAEAILRDHQEM  395
             VGG+MF+ +PKADA FLMWVLHDW D+EC+ IL KCREAIPE+ GKVIIAEA++ D    
Sbjct  208   VGGDMFELVPKADAAFLMWVLHDWSDDECIDILRKCREAIPEDRGKVIIAEAVIDD----  263

Query  394   INGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMMAHTGKGLERTEKQ  215
                                       +   + +   +V L LDMV++ HT +G ER+ ++
Sbjct  264   --------------------------ELGEDEDKYRDVRLALDMVILTHTQRGKERSMRE  297

Query  214   WSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             W +V+  AGF  +TV    D++S+I+A P
Sbjct  298   WEYVVNGAGFTRFTVKPIEDIISVIEAYP  326



>ref|XP_008236091.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like isoform 
X3 [Prunus mume]
 ref|XP_008236092.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like isoform 
X4 [Prunus mume]
Length=357

 Score =   319 bits (817),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 191/404 (47%), Positives = 246/404 (61%), Gaps = 73/404 (18%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRG  1145
             IWKYV+GF E+AVVKCAIELGI D +ES    +TL +LSS L C PS LYRIMR L++  
Sbjct  22    IWKYVYGFIEIAVVKCAIELGIADAIESHGSPMTLLELSSALRCDPSPLYRIMRVLVHLK  81

Query  1144  IFKEVEMTLPTIsstssteaalasTRPT-----RGYVQTPLSALLTRDGEKSMAAFVRLE  980
             IFKE                     +PT     + Y QTPLS LL + GE SMAA + LE
Sbjct  82    IFKE---------------------KPTTQLGPKVYAQTPLSKLLLKSGENSMAALILLE  120

Query  979   SSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDA  800
             SSPVMLA W  LS R+            G ++ AFE+ +G+DVW +A ++P HSKL  +A
Sbjct  121   SSPVMLATWHGLSARI-----------QGITNSAFESVHGEDVWSHAAANPDHSKLFNEA  169

Query  799   MACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDL  620
             MAC AR+AVPA++++C ++            +VDVGGGDGTT+ +LV+A P ++GINFDL
Sbjct  170   MACDARVAVPAVIESCLEVF------KGIETIVDVGGGDGTTLRLLVEACPWIQGINFDL  223

Query  619   PHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETG  440
             PHVVSVA +   + +VGG+MF  +PKADA+ + WVLHDWGD+EC++IL KCREAIPE+  
Sbjct  224   PHVVSVAQECDRIENVGGDMFDCVPKADAVIMKWVLHDWGDDECIRILKKCREAIPEDKR  283

Query  439   KVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMV  260
             KVII EA++ +  E                        +E  +  N      V LMLDMV
Sbjct  284   KVIIIEAVIDEKYE------------------------KEDSKLTN------VRLMLDMV  313

Query  259   MMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             MMAH     ERT K+W +VL  AGF  +T+T    V S+IQA P
Sbjct  314   MMAHNSTENERTLKEWGYVLGEAGFSRHTITLIHAVQSVIQAFP  357



>gb|KDP27133.1| hypothetical protein JCGZ_20945 [Jatropha curcas]
Length=347

 Score =   317 bits (812),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 188/398 (47%), Positives = 237/398 (60%), Gaps = 67/398 (17%)
 Frame = -1

Query  1321  WKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRGI  1142
             WKY+FGF+ +AVVKCA ELGI + +E+ +  +TL  LSS + C+PS L+RIMRFL++  I
Sbjct  17    WKYMFGFSNIAVVKCAFELGIANAIENHQGPITLTDLSSTIECNPSYLHRIMRFLVHHNI  76

Query  1141  FKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSPVML  962
             FKE ++T                   T+GY+QTPLS  L   GE +MAA   LESSPVML
Sbjct  77    FKE-QLT----------------ADGTKGYIQTPLSRRLLGPGENNMAALFLLESSPVML  119

Query  961   APWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMACHAR  782
             APW  LS RV L           + S AFEAA+G DVW+YA   P HS LI DAMAC+AR
Sbjct  120   APWHFLSCRVTL-----------NGSAAFEAAHGDDVWKYAAEYPGHSNLINDAMACNAR  168

Query  781   MAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPHVVSV  602
               V  IV+ C ++            +VDVGGG+GT +  LVK  P ++GINFDLPHVV V
Sbjct  169   KMVSGIVEGCVEVF------DGVKTLVDVGGGNGTALRTLVKLCPWIQGINFDLPHVVDV  222

Query  601   APKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKVIIAE  422
             A +  GV HVGG+MFQ +PKADA  LMWVLHDW D+EC+ IL KC+EAIP E GKVII E
Sbjct  223   AEECDGVRHVGGDMFQSVPKADAALLMWVLHDWNDDECINILKKCKEAIPNEIGKVIIVE  282

Query  421   AILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMMAHTG  242
             A++                                D   ++   + V L LDMVMMAHT 
Sbjct  283   AVV--------------------------------DEAKDDKLEF-VRLALDMVMMAHTD  309

Query  241   KGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
              G ERT ++W +VL  AGF  +T+   + V S+I+A P
Sbjct  310   TGKERTSEEWEYVLKQAGFSRHTIKSIAAVQSVIEAFP  347



>ref|XP_011045555.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Populus 
euphratica]
Length=353

 Score =   317 bits (813),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 190/410 (46%), Positives = 245/410 (60%), Gaps = 74/410 (18%)
 Frame = -1

Query  1339  EEEDG-----IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALY  1175
             EEED      IWKYV GF+ +AVVKCAIELGI + +E+ E  + L +LSS LGC P +L 
Sbjct  12    EEEDAQAGVEIWKYVLGFSGIAVVKCAIELGIAEAIENHEGPMALSELSSNLGCVPCSLD  71

Query  1174  RIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAA  995
             RIMRFL++   FKE     PTI             + T GYV TPLS  L R GE SMA 
Sbjct  72    RIMRFLVHHHFFKEE----PTI-------------QGTAGYVHTPLSRRLLRQGEDSMAD  114

Query  994   FVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSK  815
             F+ LESSPVMLAPW  LS RV +           + + AFEAA G D+W+YA ++PA ++
Sbjct  115   FILLESSPVMLAPWHHLSSRVRI-----------NGTAAFEAAYGGDIWKYAAANPAFNR  163

Query  814   LIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKG  635
             LI DAMAC AR+AV AI+++CP L            +VDVGGG+GT +   VKAFP ++G
Sbjct  164   LINDAMACDARLAVSAIIESCPKLF------DGLKTLVDVGGGNGTALGKFVKAFPWIEG  217

Query  634   INFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAI  455
             INFDLPHVVSVA +  GV  VGG+MF  +PKADA+F+M VL DW +++CV+IL KC+EAI
Sbjct  218   INFDLPHVVSVAAECEGVKQVGGDMFDSVPKADAVFIMKVLQDWNNDDCVRILRKCKEAI  277

Query  454   PEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYE-VG  278
             P++ GKV+I E ++ + ++                                  +S+E V 
Sbjct  278   PQDKGKVVIVETVIGEEKQ----------------------------------DSFEFVR  303

Query  277   LMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
              M DM MMA T  G ERT ++W  VL  AGF SY +     V S+I+A P
Sbjct  304   FMKDMAMMAFTNSGKERTSEEWDCVLKEAGFSSYNINPIRAVQSVIEAFP  353



>gb|KDP24054.1| hypothetical protein JCGZ_26737 [Jatropha curcas]
Length=347

 Score =   315 bits (807),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 183/399 (46%), Positives = 239/399 (60%), Gaps = 67/399 (17%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRG  1145
             +WKY+FGF+ +AVVKCA+ELGI + +E+ +  +TL  LSS + C+PS L+RIMRFL++  
Sbjct  16    VWKYMFGFSNIAVVKCALELGIANAIENHQGPITLTDLSSTIECNPSYLHRIMRFLVHHN  75

Query  1144  IFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSPVM  965
             IFKE ++T                   T+GY+QTPLS  L   GE +M A   LE+SPVM
Sbjct  76    IFKE-QLT----------------ADGTKGYIQTPLSRRLLGPGENNMTALFLLENSPVM  118

Query  964   LAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMACHA  785
             LAPW  L  RV L           + S AFEAA+G D+W+YA  +P HS LI DA+AC+A
Sbjct  119   LAPWHFLRCRVRL-----------NGSAAFEAAHGDDIWKYAAENPGHSNLINDALACNA  167

Query  784   RMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPHVVS  605
             R  V  IV+ C ++            +VDVGGG+GT +  LVK  P ++GINFDLPHVV 
Sbjct  168   RKMVSGIVEGCVEVF------DGVKTLVDVGGGNGTALRTLVKLCPWIQGINFDLPHVVD  221

Query  604   VAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKVIIA  425
             VA +  GV HVGG+MFQ +PKADA  LMWVLHDW D+EC+ IL KC+EAIP E GKVII 
Sbjct  222   VAEECDGVRHVGGDMFQSVPKADAALLMWVLHDWNDDECINILKKCKEAIPNEIGKVIIV  281

Query  424   EAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMMAHT  245
             EA++                                D   ++   + V L LDMVMMAHT
Sbjct  282   EAVV--------------------------------DEAKDDKLEF-VRLALDMVMMAHT  308

Query  244   GKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
               G ERT ++W +VL  AGF  +T+   + V+S+I+A P
Sbjct  309   DTGKERTSEEWEYVLKQAGFSRHTIKSIAAVLSVIEAFP  347



>gb|AJD20228.1| 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase [Podophyllum 
peltatum]
Length=352

 Score =   315 bits (807),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 189/406 (47%), Positives = 239/406 (59%), Gaps = 66/406 (16%)
 Frame = -1

Query  1345  DYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIM  1166
             D   E  +W+Y+FGF EMAVVKCAIEL IPD +++  Q +TL +LS+ LGC  S+LYRIM
Sbjct  13    DARAESDVWRYIFGFVEMAVVKCAIELRIPDVIKAHGQPMTLTELSATLGCDSSSLYRIM  72

Query  1165  RFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVR  986
             RFL+++ IFK                    S+  T  Y  TP+S L  R GE+SMA  V 
Sbjct  73    RFLVHQKIFKX-----------------KCSSNGTECYALTPISXLXMRQGERSMADLVL  115

Query  985   LESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIE  806
             LESS VMLAPW  LS  V               S  F+A +G DVW YA   P HS+LI 
Sbjct  116   LESSQVMLAPWQALSTCV-----------QKHGSPPFKAVHGVDVWDYATGHPEHSELIN  164

Query  805   DAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINF  626
             +AMAC+AR A PAI+  C  +          C VVDVGGGDG+T+ +LV+AFP +KG+NF
Sbjct  165   NAMACNARFAAPAIIDGCAKVF------DGVCTVVDVGGGDGSTLRVLVEAFPWLKGLNF  218

Query  625   DLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEE  446
             DLPHVV+VAP+   V HV G+MF  +P+ADA+FL WVLHDWGDEEC++IL  CR+AIPE+
Sbjct  219   DLPHVVAVAPQSNNVQHVAGDMFLSVPRADAVFLKWVLHDWGDEECMKILKNCRKAIPED  278

Query  445   TGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLD  266
              GKVII EA+L +  + +                                +  +VGLMLD
Sbjct  279   GGKVIIVEAVLEEQCDEL--------------------------------HFKDVGLMLD  306

Query  265   MVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             MVMMAHT  G ERT ++W +VL  AGF    +     V S+I A P
Sbjct  307   MVMMAHTNHGKERTLEEWKYVLRQAGFSRVIMQPIRAVQSLILAYP  352



>ref|XP_004290757.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=360

 Score =   315 bits (807),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 194/398 (49%), Positives = 246/398 (62%), Gaps = 62/398 (16%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRG  1145
             +WKYV GF+++AVVKCAIELGI D +ES   A+TL +L++ L C PS+LYRIMRFL++  
Sbjct  22    VWKYVLGFSKIAVVKCAIELGIADAIESHGSAMTLSELAAILKCDPSSLYRIMRFLVHHQ  81

Query  1144  IFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSPVM  965
             IFKEV+   P I                R Y QTPLS  L + G+ SMAA + LE+SPVM
Sbjct  82    IFKEVQ---PKIQLG------------PRSYAQTPLSRCLLKSGKNSMAALILLEASPVM  126

Query  964   LAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMACHA  785
             L PW  LS  V  GD        G S+ AFEA +G+DVW +A ++P HS+LI +AMAC A
Sbjct  127   LEPWHGLSAGVQ-GD--------GMSTPAFEAVHGEDVWSFAAANPGHSELINEAMACDA  177

Query  784   RMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGV-KGINFDLPHVV  608
             R+AVPA++++C ++            +VDVGGGDGTT+ +LVKA P + +GINFDLPHVV
Sbjct  178   RLAVPAVIESCIEVF------HGIESIVDVGGGDGTTLSLLVKACPWITRGINFDLPHVV  231

Query  607   SVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKVII  428
             SVA +   V +VGG+MF  IPKADA  +  VLHDWGDEEC+ IL  CREAIP++ GKVII
Sbjct  232   SVAKESDRVENVGGDMFDCIPKADAAIIKSVLHDWGDEECICILRNCREAIPKDKGKVII  291

Query  427   AEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMMAH  248
              EA                                 ++     +   +V LMLDMVMMAH
Sbjct  292   LEA-------------------------------IIEEDELEEDELTDVRLMLDMVMMAH  320

Query  247   TGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQA  134
             T  G ERT K+W +VL  AGF  +TVT  S V S+IQA
Sbjct  321   TNTGKERTLKEWGYVLQQAGFSRHTVTPISAVQSVIQA  358



>ref|XP_007200597.1| hypothetical protein PRUPE_ppa007742mg [Prunus persica]
 gb|EMJ01796.1| hypothetical protein PRUPE_ppa007742mg [Prunus persica]
Length=357

 Score =   314 bits (804),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 187/399 (47%), Positives = 240/399 (60%), Gaps = 63/399 (16%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRG  1145
             IWKYVFGF E+ VVKCAIELGI D +ES    +TL +LSS L C PS LYRIMR L++  
Sbjct  22    IWKYVFGFVEIGVVKCAIELGIADAIESHGSPMTLLELSSALRCDPSPLYRIMRVLVHLK  81

Query  1144  IFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSPVM  965
             IFKE   T                    + Y QTPLS  L + GE SMAA + L +SPV+
Sbjct  82    IFKEKPAT----------------QLGPKVYAQTPLSKQLLKSGENSMAALILLGNSPVV  125

Query  964   LAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMACHA  785
             LAPW  LS R+            G S+ AFEA  G+D+W YA ++P HSKL  +AMAC A
Sbjct  126   LAPWHGLSARI-----------QGISNPAFEAERGEDIWSYAAANPDHSKLFNEAMACDA  174

Query  784   RMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPHVVS  605
             R+AVPA++++C ++            +VDVGGGDGTT+ +L++A P ++GINFDLPHVVS
Sbjct  175   RVAVPAVIESCSEVF------KGIEKIVDVGGGDGTTLRLLIEACPWIRGINFDLPHVVS  228

Query  604   VAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKVIIA  425
             VA +   + +VGG+MF  +PKADA+ + WVLH+WGD+EC++IL KCREAIP + GKVII 
Sbjct  229   VAQECDRIENVGGDMFDFVPKADAVIMKWVLHNWGDDECIRILKKCREAIPADKGKVIIV  288

Query  424   EAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMMAHT  245
             EA++                              EKD   +   +  V LMLDM MMA T
Sbjct  289   EAVI-----------------------------DEKDEKEDIKLT-NVRLMLDMAMMAAT  318

Query  244   GKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
               G ERT K+W +VL  AGF  +T+T    V S+IQA P
Sbjct  319   QIGKERTLKEWGYVLADAGFSQHTITPIHAVQSVIQAFP  357



>ref|XP_010526877.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like isoform 
X1 [Tarenaya hassleriana]
Length=354

 Score =   313 bits (803),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 187/401 (47%), Positives = 236/401 (59%), Gaps = 66/401 (16%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQ-EQAVTLDQLSSGLGCSPSALYRIMRFLINR  1148
             IW+YVFGFT+MAVVKCAIEL IP+ +ES   Q VTL +LS+ + CSP  L RIMRFL ++
Sbjct  12    IWRYVFGFTDMAVVKCAIELKIPEAVESHPSQPVTLAELSTAVACSPPLLGRIMRFLSHQ  71

Query  1147  GIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALL---TRDGEKSMAAFVRLES  977
             GIFKEV      +                 GY+ TPLS L+    RD +KS A  + +ES
Sbjct  72    GIFKEVITKDGLVG----------------GYLNTPLSRLMMSSNRD-DKSKAPLILMES  114

Query  976   SPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAM  797
             SPVMLAPWLKLS  V           +   S  FE  +GKDVW Y   DP HS++  +AM
Sbjct  115   SPVMLAPWLKLSAVV-------SNAATEEGSQPFEVVHGKDVWAYCAEDPRHSEMFNEAM  167

Query  796   ACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLP  617
             AC  R  VP I  AC D+            VVDVGGG G  + +LVKAFP +KG NFDLP
Sbjct  168   ACDTRRLVPVIAGACSDVF------EGVSTVVDVGGGKGDALGVLVKAFPWIKGFNFDLP  221

Query  616   HVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGK  437
             HVV  A K  GV +VGG+MF+R+P ADA+F+ WVLHDW DE C+++L KCREAIP + GK
Sbjct  222   HVVETALKFDGVENVGGDMFERVPNADAVFIKWVLHDWNDEVCIKLLEKCREAIPRKGGK  281

Query  436   VIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVM  257
             V+I +A++ + +      +G R++                             LMLDMVM
Sbjct  282   VVIVDAVVGEKK------KGDRLEYAR--------------------------LMLDMVM  309

Query  256   MAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQA  134
             MAHT +G ERT ++W HV+T AGF  Y V D  D+ S+I A
Sbjct  310   MAHTTRGRERTLEEWDHVITEAGFARYEVRDIDDISSVIIA  350



>ref|XP_010526874.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like isoform 
X1 [Tarenaya hassleriana]
Length=351

 Score =   312 bits (800),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 187/401 (47%), Positives = 235/401 (59%), Gaps = 68/401 (17%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQ-EQAVTLDQLSSGLGCSPSALYRIMRFLINR  1148
             IW+YVFGFT+MAVVKCAIEL IP+ +ES   Q VTL  LS+ + CSP  L RIMRFL ++
Sbjct  12    IWRYVFGFTDMAVVKCAIELKIPEAVESHPAQPVTLADLSAAVACSPPLLGRIMRFLSHQ  71

Query  1147  GIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGE--KSMAAFVRLESS  974
             GIFKEV +T   I                 GY+ TPLS L+       KS+A  + +ESS
Sbjct  72    GIFKEV-ITKDGIV----------------GYLSTPLSRLMMGSNRVNKSLAPLILMESS  114

Query  973   PVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMA  794
             PVMLAPWLKLS  V           +   S  FEA +GKD+W Y   DP HS++  +AMA
Sbjct  115   PVMLAPWLKLSAVV-------SNASADEGSQPFEAEHGKDLWGYCAEDPIHSEVFNEAMA  167

Query  793   CHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPH  614
             C  R  VPA+  AC D+            VVDVGGG G  + ++VKAFP +KG+NFDLPH
Sbjct  168   CDTRRVVPAVAGACADVF------EGVSTVVDVGGGKGDALGVMVKAFPWIKGLNFDLPH  221

Query  613   VVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKV  434
             VV  A K  GV +VGG+MF+R+P AD +F+ WVLHDW DE C+++L KC+EA+P+E GKV
Sbjct  222   VVETALKFDGVENVGGDMFERVPNADVVFIKWVLHDWDDEACIKLLKKCKEAVPKEKGKV  281

Query  433   IIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVG-LMLDMVM  257
             +I EA+L                                   N   +  E   LMLDMVM
Sbjct  282   VIVEAVL----------------------------------GNKKGDKLEYARLMLDMVM  307

Query  256   MAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQA  134
             +AHT KG ERT ++W +VLT AGF  Y V D +DV S+I A
Sbjct  308   IAHTTKGKERTMEEWDYVLTEAGFVRYEVRDINDVQSVIIA  348



>ref|XP_002312934.1| hypothetical protein POPTR_0009s14160g [Populus trichocarpa]
 gb|EEE86889.1| hypothetical protein POPTR_0009s14160g [Populus trichocarpa]
Length=354

 Score =   312 bits (800),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 189/412 (46%), Positives = 246/412 (60%), Gaps = 70/412 (17%)
 Frame = -1

Query  1357  RQEVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQE-QAVTLDQLSSGLGCSPSA  1181
             ++E D +    IWKYV GF+ +AVVKCAIELGI + +E+ E   + L +LSS LGC P +
Sbjct  11    KEEEDVQAGVEIWKYVLGFSGIAVVKCAIELGIAEAIENHEGTPMALSELSSTLGCVPFS  70

Query  1180  LYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSM  1001
             L RIMRFL++   FKE     PTI             + T GYV TPLS  L R GE SM
Sbjct  71    LDRIMRFLVHHHFFKEE----PTI-------------QGTAGYVHTPLSRRLLRQGEDSM  113

Query  1000  AAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAH  821
             A F+ LESSPVMLAPW  LS RV +           + + AFEAA G D+W+YA ++PA 
Sbjct  114   ADFILLESSPVMLAPWHHLSSRVRI-----------NGTAAFEAAYGGDIWKYAAANPAF  162

Query  820   SKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGV  641
             ++LI DAMAC AR+AV AI+++CP L            +VDVGGG+GT +   VKAFP +
Sbjct  163   NRLINDAMACDARLAVSAIIESCPKLF------DGLKTLVDVGGGNGTALGKFVKAFPWI  216

Query  640   KGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCRE  461
             +GINFDLPHVVSVA +  GV  VGG+MF  +PKADA+F+M VL DW +++CV+IL KC+E
Sbjct  217   EGINFDLPHVVSVAAECEGVKQVGGDMFDSVPKADAVFIMKVLQDWNNDDCVRILKKCKE  276

Query  460   AIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYE-  284
             AIP++ GKVII E ++ + ++                                  +S+E 
Sbjct  277   AIPKDKGKVIIVETVIGEEKQ----------------------------------DSFEF  302

Query  283   VGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             V  M DM MMA T  G ERT ++W  VL  AGF SY +     V S+I+A P
Sbjct  303   VRFMKDMAMMAFTNSGKERTSEEWDCVLKEAGFSSYNIIPIRAVQSVIEAFP  354



>ref|XP_008236083.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Prunus 
mume]
Length=358

 Score =   311 bits (796),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 187/399 (47%), Positives = 242/399 (61%), Gaps = 62/399 (16%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRG  1145
             IWKYVFGF E+AVVKCAIELGI D +ES    +TL +LSS L C PS LYRIMR L++  
Sbjct  22    IWKYVFGFAEIAVVKCAIELGIADAIESHGSPMTLLELSSALRCDPSPLYRIMRVLVHLK  81

Query  1144  IFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSPVM  965
             IFKE   T                    + Y QTPLS  L + G+ SMAA + LESSPVM
Sbjct  82    IFKEKPAT----------------QLGPKVYAQTPLSKRLLKSGQNSMAALILLESSPVM  125

Query  964   LAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMACHA  785
             LAPW  LS R+  G+  N           FE  +G+D+W +  ++P H+KL  +AMAC A
Sbjct  126   LAPWHGLSARIQ-GNIRN---------PVFEEVHGEDLWSFGAANPDHNKLFNEAMACDA  175

Query  784   RMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPHVVS  605
             R+ VPA++++C ++            +VDVGGGDG+T+ +LV+A P ++GINFDLPHVVS
Sbjct  176   RVNVPAVIESCLEMF------KGIETIVDVGGGDGSTMCLLVEACPWIQGINFDLPHVVS  229

Query  604   VAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKVIIA  425
             VA +   + +VGG+MF  +PKADA+ +  VLHDWGD+EC++IL KCREAIPE+ GKVII 
Sbjct  230   VAQECDRIENVGGDMFDCVPKADAVIIKGVLHDWGDDECIRILKKCREAIPEDKGKVIIV  289

Query  424   EAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMMAHT  245
             EA++ +  E                        +E  +  N      V LMLDMVMMAHT
Sbjct  290   EAVIDEKDE------------------------KEDIKLTN------VRLMLDMVMMAHT  319

Query  244   GKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
               G ERT K+W +VL  AGF  +T+T    V S+IQA P
Sbjct  320   NTGKERTLKEWGYVLGEAGFSRHTITPIHAVPSVIQAFP  358



>ref|XP_008236088.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Prunus 
mume]
Length=357

 Score =   309 bits (792),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 187/404 (46%), Positives = 243/404 (60%), Gaps = 73/404 (18%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRG  1145
             IWKYV+GF E+AVVKCAIELGI D +ES    +TL +LSS L C PS LYRIMR L++  
Sbjct  22    IWKYVYGFIEIAVVKCAIELGIADAIESHGSPMTLLELSSALRCDPSPLYRIMRVLVHLK  81

Query  1144  IFKEVEMTLPTIsstssteaalasTRPT-----RGYVQTPLSALLTRDGEKSMAAFVRLE  980
             IFKE                     +PT     + Y QTPLS LL + GE SMAA + L 
Sbjct  82    IFKE---------------------KPTTQLCPKVYAQTPLSKLLLKSGENSMAALILLG  120

Query  979   SSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDA  800
             SSPVMLAPW  L+ ++            G S+ AFEA +G+D+W +A ++P HSKL  +A
Sbjct  121   SSPVMLAPWHGLTAQI-----------QGISNQAFEAVHGEDLWSHAAANPDHSKLFNEA  169

Query  799   MACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDL  620
             MAC AR+AVPA++++C ++            +VDVGGGDGTT+ +LV+A P ++GINFDL
Sbjct  170   MACDARVAVPAVIESCLEVF------KGIETIVDVGGGDGTTLRLLVEACPWIQGINFDL  223

Query  619   PHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETG  440
             PHVVSVA +   + +VGG+MF  +PKADA+ +  VLHDWGD+EC++IL KCREAIP + G
Sbjct  224   PHVVSVAQECDRIENVGGDMFDCVPKADAVIMKSVLHDWGDDECIRILKKCREAIPADKG  283

Query  439   KVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMV  260
             +VII EA++                              EKD   +   +  V LMLDM 
Sbjct  284   EVIIIEAVI-----------------------------DEKDEKEDIKLT-NVRLMLDMA  313

Query  259   MMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             MMA T  G ERT K+W +VL  AGF  + +T    V S+IQA P
Sbjct  314   MMAATETGKERTLKEWGYVLAEAGFSRHAITPIHAVQSVIQAFP  357



>ref|XP_008236089.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like isoform 
X1 [Prunus mume]
 ref|XP_008236090.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like isoform 
X2 [Prunus mume]
Length=357

 Score =   309 bits (791),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 188/404 (47%), Positives = 242/404 (60%), Gaps = 73/404 (18%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRG  1145
             IWKYV+GF E+AVVKCAIELGI D +ES    +TL +LSS L C PS LYRIMR L++  
Sbjct  22    IWKYVYGFIEIAVVKCAIELGIADAIESHGSPMTLLELSSALRCDPSPLYRIMRVLVHLK  81

Query  1144  IFKEVEMTLPTIsstssteaalasTRPT-----RGYVQTPLSALLTRDGEKSMAAFVRLE  980
             IFKE                     +PT     + Y QTPLS LL + GE SMAA + LE
Sbjct  82    IFKE---------------------KPTTQLGPKVYAQTPLSKLLLKSGENSMAALILLE  120

Query  979   SSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDA  800
             SSPVMLA W  LS R+            G ++ AFE+ +G+DVW +A ++P HSKL  +A
Sbjct  121   SSPVMLATWHGLSARI-----------QGITNSAFESVHGEDVWSHAAANPDHSKLFNEA  169

Query  799   MACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDL  620
             MAC AR+AVPA++++C ++            +VDVGGGDGTT+ +LV+A P ++GINFDL
Sbjct  170   MACDARVAVPAVIESCLEVF------KGIETIVDVGGGDGTTLRLLVEACPWIQGINFDL  223

Query  619   PHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETG  440
             PHVVSVA +   + +VGG+MF  +PKADA+ +  VLH  GD+EC++IL KCREAIP+  G
Sbjct  224   PHVVSVAQECDRIENVGGDMFDCVPKADAVIMKSVLHGCGDDECIRILKKCREAIPDHKG  283

Query  439   KVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMV  260
             KVII E ++                              EKD   +   +  V LMLD V
Sbjct  284   KVIIIEVVI-----------------------------DEKDEKEDIKLT-NVRLMLDTV  313

Query  259   MMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             MMAHT  G ERT K+W +VL  AGF  +T+T    V S+IQA P
Sbjct  314   MMAHTNTGKERTLKEWGYVLGEAGFSQHTITPIHAVYSVIQAFP  357



>ref|XP_010102650.1| 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase [Morus 
notabilis]
 gb|EXB93812.1| 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase [Morus 
notabilis]
Length=420

 Score =   310 bits (793),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 190/451 (42%), Positives = 248/451 (55%), Gaps = 112/451 (25%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRG  1145
             IWKY+FGF EMAVVKCAIELGI D + +  + +TL +LSS L C P  L+RIMRFL+NR 
Sbjct  29    IWKYIFGFVEMAVVKCAIELGIADVIATHGRPMTLLELSSALDCDPQNLHRIMRFLVNRA  88

Query  1144  IFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSPVM  965
             IFKE+ +    +              PT  Y QTP+S  L R GE SMAAF+ LESSP M
Sbjct  89    IFKEILIRNDAV--------------PTAYYAQTPISRRLMRTGENSMAAFILLESSPPM  134

Query  964   LAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMACHA  785
             LAPW  LS RV+              + AFEAA+G+D+W+YAE++P H++LI++AMAC A
Sbjct  135   LAPWHGLSARVM-----------ARGTSAFEAAHGEDIWKYAEANPGHARLIDEAMACDA  183

Query  784   RMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGV-KGINFDLPHVV  608
             R+AVPAI+  C D+            +VDVGGG+GT + MLVK  P + KGINFDLPHV 
Sbjct  184   RVAVPAIIDGCSDVF------DGVRTLVDVGGGNGTALRMLVKGCPWISKGINFDLPHVA  237

Query  607   SVAPKRPGVHHVGG-NMFQR----------------------------------------  551
             SVA K  G+ HVGG  +F R                                        
Sbjct  238   SVAEKCEGIEHVGGLEVFGRKCTASRKDFVVHFEDEWCSLDNAIKEIQHGGNNVKEEVFE  297

Query  550   ----------IPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKVIIAEAILRDHQ  401
                       +  ++   + WVLHDW D+EC+ IL KCR AIP++ GKVIIAEA++ +  
Sbjct  298   CISPIGVSNSLELSELFIVWWVLHDWADDECIHILKKCRAAIPKDIGKVIIAEAVIGN--  355

Query  400   EMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMMAHTGKGLERTE  221
                                        K++   +N   +VGL+LDMVMMAHT KG ERT 
Sbjct  356   ---------------------------KEQQKEDNKLKDVGLVLDMVMMAHTTKGKERTL  388

Query  220   KQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
              +W++V+  AGF  +TV   + V S+I+A P
Sbjct  389   DEWAYVIREAGFSRHTVRSIAAVQSVIEAFP  419



>ref|XP_006412140.1| hypothetical protein EUTSA_v10025519mg [Eutrema salsugineum]
 gb|ESQ53593.1| hypothetical protein EUTSA_v10025519mg [Eutrema salsugineum]
Length=367

 Score =   306 bits (785),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 182/406 (45%), Positives = 236/406 (58%), Gaps = 68/406 (17%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQ--EQAVTLDQLSSGLGCSPSALYRIMRFLIN  1151
             IW+YVFGF ++A  KCAI+L IP+ +E+    Q VTL +LSS +  SPS L RIMRFL++
Sbjct  19    IWRYVFGFADIAAAKCAIDLKIPEAIENHPSSQPVTLAELSSAVSASPSHLLRIMRFLVH  78

Query  1150  RGIFKEVEMTLPTIsstssteaalasTRPTR-----GYVQTPLS--ALLTRDGEKSMAAF  992
             +GIFKEV                     PT+     GY  TPLS   ++T+   KS+A F
Sbjct  79    QGIFKEV---------------------PTKDGLATGYTNTPLSRRMMITKRDGKSLAPF  117

Query  991   VRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKL  812
             V  E+SP MLAPWL+LS  V           +GS    F+A +GKDVW +AE +P  S +
Sbjct  118   VLFETSPEMLAPWLRLSSVV-------SSPVNGSHPPPFDAVHGKDVWAFAEDNPCLSVM  170

Query  811   IEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGI  632
             I +AMAC +R  VP +  AC DL            VVDVGG  G T+ +LVK FP +KG 
Sbjct  171   ISEAMACDSRRVVPRVAGACHDLFDG------VGTVVDVGGATGETMGILVKEFPWIKGF  224

Query  631   NFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIP  452
             NFDLPHV  VA    GV H+GG+MF  IPK DA+F+ WVLHDWGD++C++IL  C+EAIP
Sbjct  225   NFDLPHVTEVAQVMDGVEHIGGDMFVSIPKCDAVFIKWVLHDWGDKDCIKILKNCKEAIP  284

Query  451   EETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLM  272
                GKV+I E+++R+ +E +                     ++E+D    +     V LM
Sbjct  285   PNIGKVLIVESVIREKKETM--------------------IVEERDEKLEH-----VRLM  319

Query  271   LDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQA  134
             LDMVMMAHT  G ERT K+W  VL  +GF  Y V D  DV S+I A
Sbjct  320   LDMVMMAHTSTGKERTLKEWDFVLNQSGFARYEVRDIDDVQSVIIA  365



>ref|XP_003538520.1| PREDICTED: 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase-like 
[Glycine max]
Length=366

 Score =   306 bits (785),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 182/400 (46%), Positives = 234/400 (59%), Gaps = 67/400 (17%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRG  1145
             IWKY+FGF E+AV+KCAIELGI + +E     +TL ++SS LGC  S L RIMRFL+ R 
Sbjct  29    IWKYIFGFVELAVIKCAIELGIAEAIEKHGSPMTLSEISSSLGCDTSHLKRIMRFLVQRK  88

Query  1144  IFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSPVM  965
             IFK                        +RGY Q+ LS  L R+GE SMA+F+ LESSPVM
Sbjct  89    IFK--------------------GDGCSRGYSQSALSRRLMRNGEHSMASFLLLESSPVM  128

Query  964   LAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMACHA  785
             LAPW  LS RV+   N            +F  A+G+DVWRYA ++  HS LI +AMAC A
Sbjct  129   LAPWHSLSARVMANGN-----------PSFAKAHGEDVWRYAAANLDHSNLINEAMACDA  177

Query  784   RMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPHVVS  605
             ++ +P I+Q+C +             +VDVGGG+GT + +L KA P ++ INFDLPHV++
Sbjct  178   KLVMPIIIQSCSEAF------HGLKSLVDVGGGNGTAMRILAKACPSIRPINFDLPHVIA  231

Query  604   VAP-KRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAI--PEETGKV  434
             +      GV HV G+MF  +PKADA FLMWVLHDW DEEC+QIL KCREAI   +E G+V
Sbjct  232   LCDGDGDGVQHVSGDMFLSVPKADAAFLMWVLHDWSDEECIQILKKCREAISNSKENGRV  291

Query  433   IIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMM  254
             II EA++                             + +     ++   +VGLMLDMVMM
Sbjct  292   IIVEAVIE---------------------------GEGEGEGGKHDGLKDVGLMLDMVMM  324

Query  253   AHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQA  134
             AHT  G ERT K+W +V+  AGF SYTV     V S+I A
Sbjct  325   AHTNFGKERTLKEWEYVIKMAGFSSYTVKPIHAVQSVIMA  364



>gb|ACU21493.1| unknown [Glycine max]
Length=366

 Score =   306 bits (784),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 182/400 (46%), Positives = 234/400 (59%), Gaps = 67/400 (17%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRG  1145
             IWKY+FGF E+AV+KCAIELGI + +E     +TL ++SS LGC  S L RIMRFL+ R 
Sbjct  29    IWKYIFGFVELAVIKCAIELGIAEAIEKHGSPMTLSEISSSLGCDTSHLKRIMRFLVQRK  88

Query  1144  IFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSPVM  965
             IFK                        +RGY Q+ LS  L R+GE SMA+F+ LESSPVM
Sbjct  89    IFK--------------------GDGCSRGYSQSALSRRLMRNGEHSMASFLLLESSPVM  128

Query  964   LAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMACHA  785
             LAPW  LS RV+   N            +F  A+G+DVWRYA ++  HS LI +AMAC A
Sbjct  129   LAPWHSLSARVMANGN-----------PSFAKAHGEDVWRYAAANLDHSNLINEAMACDA  177

Query  784   RMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPHVVS  605
             ++ +P I+Q+C +             +VDVGGG+GT + +L KA P ++ INFDLPHV++
Sbjct  178   KLVMPIIIQSCSEAF------HGLKSLVDVGGGNGTAMRILAKACPSIRPINFDLPHVIA  231

Query  604   VAP-KRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAI--PEETGKV  434
             +      GV HV G+MF  +PKADA FLMWVLHDW DEEC+QIL KCREAI   +E G+V
Sbjct  232   LCDGDGDGVQHVSGDMFLSVPKADAAFLMWVLHDWSDEECIQILRKCREAISNSKENGRV  291

Query  433   IIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMM  254
             II EA++                             + +     ++   +VGLMLDMVMM
Sbjct  292   IIVEAVIE---------------------------GEGEGEGGKHDGLKDVGLMLDMVMM  324

Query  253   AHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQA  134
             AHT  G ERT K+W +V+  AGF SYTV     V S+I A
Sbjct  325   AHTNFGKERTLKEWEYVIKMAGFSSYTVKPIHAVQSVIMA  364



>ref|XP_008358432.1| PREDICTED: 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase-like 
isoform X1 [Malus domestica]
Length=358

 Score =   305 bits (780),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 177/411 (43%), Positives = 245/411 (60%), Gaps = 68/411 (17%)
 Frame = -1

Query  1342  YEEED-----GIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSAL  1178
             +EEE+      +WKYVFGF E+AVVKCAIELGI + +ES    +TL +LSS L C PS L
Sbjct  10    WEEEEEHAKVDVWKYVFGFVEIAVVKCAIELGIAEAIESHGSPMTLLELSSALSCDPSHL  69

Query  1177  YRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMA  998
             YR+MR L++  +FKE+                      ++GY QTPLS  L + GE SM 
Sbjct  70    YRVMRVLVHLKLFKEITTN----------------QLGSKGYAQTPLSHRLLKSGENSMV  113

Query  997   AFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHS  818
             A + LESSPVMLAPW  LS R+              S+  FE  +G+D+W +  ++P HS
Sbjct  114   ALILLESSPVMLAPWHGLSARIR----------GNISNQLFEEVHGEDLWSFGAANPDHS  163

Query  817   KLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVK  638
             KL  DAM C  + AVPA++++C ++            +VDVGGG+GT + +LV+  P ++
Sbjct  164   KLFNDAMTCDVKAAVPAVIKSCIEVF------KGLETIVDVGGGNGTMLRLLVEGCPWIR  217

Query  637   GINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREA  458
             GINFDLPHVVS A     V +VGG+MF R+PKADA+ +  VLH+WGD++C++IL KCREA
Sbjct  218   GINFDLPHVVSAAQDCDRVENVGGDMFDRVPKADAVIIKGVLHNWGDDDCIRILKKCREA  277

Query  457   IPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVG  278
             +P++TGKVII +A++ +  E                         ++D+   N     + 
Sbjct  278   VPKDTGKVIIIDAVIDEKYE-------------------------KEDKKLAN-----LK  307

Query  277   LMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDV-VSIIQARP  128
             LMLDMVM+AHT KG ER+ K+W +VL  AGF  +T+T    +  S+IQA P
Sbjct  308   LMLDMVMIAHTNKGKERSLKEWEYVLGGAGFSGHTITPVPAIQYSVIQAFP  358



>ref|XP_004144872.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Cucumis 
sativus]
 ref|XP_004152955.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Cucumis 
sativus]
 ref|XP_004170290.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Cucumis 
sativus]
 gb|KGN43291.1| hypothetical protein Csa_7G018730 [Cucumis sativus]
Length=357

 Score =   303 bits (776),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 182/418 (44%), Positives = 244/418 (58%), Gaps = 69/418 (17%)
 Frame = -1

Query  1363  IRRQEVDYE-EEDG-----IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSG  1202
             ++ +E   E EEDG     +W+Y+F FTEMA +KC ++L I D +ES    VTL QLSS 
Sbjct  3     VKHKESSSEKEEDGQAIIQMWRYIFRFTEMAAIKCVVDLKIADIIESYGSPVTLSQLSST  62

Query  1201  LGCSPSALYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLT  1022
             L CS S L+RI+RFLI+RGIFK+  +    I                 GY QTP+S LL 
Sbjct  63    LNCSSSLLHRILRFLIHRGIFKQETIDENQI-----------------GYSQTPMSRLLA  105

Query  1021  RDGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRY  842
              + E SMA  + LE+SPVMLAPW  LSG +             S +  FE A+GKD+WRY
Sbjct  106   TNVENSMAPLLLLETSPVMLAPWQHLSGHL-----------KNSDTLPFEIAHGKDLWRY  154

Query  841   AESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEML  662
             AE++  H+ L  +AMAC A+M V AI++ C D+            +VDVGGG+G+T+ +L
Sbjct  155   AEANHEHNLLFNEAMACGAKMIVSAIIEGCGDVF------DGVRCLVDVGGGNGSTLSIL  208

Query  661   VKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQ  482
             VKA+P +KGINFDLPHVV  +P+   V HV GNMF  +P AD  FL W+LHDW DEEC++
Sbjct  209   VKAYPWMKGINFDLPHVVCASPQYENVEHVAGNMFDFVPNADVAFLKWILHDWDDEECIK  268

Query  481   ILSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNN  302
             IL KC+E+IP+  GKVII EAI+   +                                 
Sbjct  269   ILKKCKESIPKSGGKVIIIEAIIEAEK-----------------------------GEKK  299

Query  301   NNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             N    +VGLM D+VMMAHT +G ERT ++W+ ++  AGF ++T+T    + S+IQ  P
Sbjct  300   NKKLSDVGLMFDLVMMAHTNRGKERTAQEWAFLIHQAGFTTHTITPIQAIQSLIQCFP  357



>ref|XP_007200810.1| hypothetical protein PRUPE_ppa025618mg [Prunus persica]
 gb|EMJ02009.1| hypothetical protein PRUPE_ppa025618mg [Prunus persica]
Length=358

 Score =   303 bits (776),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 186/401 (46%), Positives = 241/401 (60%), Gaps = 66/401 (16%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRG  1145
             IWKYVFGF E+AVVKCAI+LGI D +ES    +TL +LSS L C PS LYRIMR L++  
Sbjct  22    IWKYVFGFAEIAVVKCAIQLGIADAIESHGSPMTLLELSSALRCDPSPLYRIMRVLVHLK  81

Query  1144  IFKEVEMTL--PTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSP  971
             IFKE   T   P +                  Y QTPLS  L + G+ SMAA + LESSP
Sbjct  82    IFKEKPATQLGPEV------------------YTQTPLSKRLLKSGQNSMAALILLESSP  123

Query  970   VMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMAC  791
             VMLAPW  LS R+  G+  N           FE  +G+D+W +  ++P H+KL  +AMAC
Sbjct  124   VMLAPWHGLSARIQ-GNIRN---------PVFEEVHGEDLWSFGAANPDHNKLFNEAMAC  173

Query  790   HARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPHV  611
              AR+ VPA++++  ++            +VDVGGGDG+T+ +LV+A P ++GINFDLPHV
Sbjct  174   DARVHVPAVIESRLEVF------KGIETIVDVGGGDGSTMRLLVEACPWIQGINFDLPHV  227

Query  610   VSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKVI  431
             VSVA +   + +VGG+MF  +PKADA+ +  VLHDWGD+EC++IL KCREAIPE+ GKVI
Sbjct  228   VSVAQECDRIENVGGDMFDCVPKADAVIIKGVLHDWGDDECIRILKKCREAIPEDKGKVI  287

Query  430   IAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMMA  251
             I EA++                              EKD   +   +  V LMLDMVMMA
Sbjct  288   IVEAVI-----------------------------DEKDEKADIKLT-NVRLMLDMVMMA  317

Query  250   HTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             HT  G ERT K+W +VL  AGF  +T+T    V S+IQA P
Sbjct  318   HTNTGKERTLKEWGYVLGEAGFSRHTITPIHAVPSVIQAFP  358



>gb|KHN44492.1| 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase [Glycine 
soja]
Length=336

 Score =   302 bits (773),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 180/398 (45%), Positives = 231/398 (58%), Gaps = 67/398 (17%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRG  1145
             IWKY+FGF E+AV+KCAIELGI + +E     +TL ++SS LGC  S L RIMRFL+ R 
Sbjct  3     IWKYIFGFVELAVIKCAIELGIAEAIEKHGSPMTLSEISSSLGCDTSHLKRIMRFLVQRK  62

Query  1144  IFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSPVM  965
             IFK                        +RGY Q+ LS  L R+GE SMA+ + LESSPVM
Sbjct  63    IFK--------------------GDGCSRGYSQSALSRRLMRNGEHSMASLLLLESSPVM  102

Query  964   LAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMACHA  785
             LAPW  LS RV+   N            +F  A+G+DVWRYA ++  HS LI +AMAC A
Sbjct  103   LAPWHSLSARVMANGN-----------PSFAKAHGEDVWRYAAANLDHSNLINEAMACDA  151

Query  784   RMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPHVVS  605
             ++ +P I+Q+C +             +VDVGGG+GT + +L KA P ++ INFDLPHV++
Sbjct  152   KLVMPIIIQSCSEAF------HGLKSLVDVGGGNGTAMRILAKACPSIRPINFDLPHVIA  205

Query  604   VAP-KRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKVII  428
             +      GV HV G+MF  +PKADA FLMWVLHDW DEEC+QIL KCREA   E G+VII
Sbjct  206   LCDGDGDGVQHVSGDMFLSVPKADAAFLMWVLHDWSDEECIQILKKCREA--SENGRVII  263

Query  427   AEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMMAH  248
              EA++                             + +     ++   +VGLMLDMVMMAH
Sbjct  264   VEAVIE---------------------------GEGEGEGGKHDGLKDVGLMLDMVMMAH  296

Query  247   TGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQA  134
             T  G ERT K+W +V+  AGF SYTV     V S+I A
Sbjct  297   TNFGKERTLKEWEYVIKMAGFSSYTVKPIHAVQSVIMA  334



>gb|KHG12207.1| 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase [Gossypium 
arboreum]
Length=356

 Score =   302 bits (774),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 178/411 (43%), Positives = 236/411 (57%), Gaps = 68/411 (17%)
 Frame = -1

Query  1354  QEVDYEEED----GIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSP  1187
             +EV  +EE      IW YVFG+ ++A VKCAIELGI D +E+    + L +L++ L C P
Sbjct  4     KEVTIKEEARAEIKIWNYVFGYAKIAAVKCAIELGIADVIENYGSPMPLSELATALRCDP  63

Query  1186  SALYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEK  1007
             S L+RIMR +++  IFK+  +   T+                 G+  TPLS  L + GEK
Sbjct  64    SRLHRIMRLMVHDQIFKQEPINQHTV-----------------GFSSTPLSRCLIKGGEK  106

Query  1006  SMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDP  827
             SMAAF+ L S P  LAPW  LS RVL   NN            FE ANGKD+W Y E++P
Sbjct  107   SMAAFILLMSGPTCLAPWHSLSARVLETGNN---------ISPFEVANGKDLWSYTEANP  157

Query  826   AHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFP  647
                +L+ ++M C AR+ V A ++ CP++            +VDVGGG+GT + + VKAFP
Sbjct  158   DFRELLNNSMGCKARLTVQATIEGCPEVF------DGVESLVDVGGGNGTALSLFVKAFP  211

Query  646   GVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKC  467
              ++GINFDLPHVV+VA K  G+ +VGG+MF  IPKADA FLMWVLHDW DEEC++IL KC
Sbjct  212   WIRGINFDLPHVVAVAEKSDGIENVGGDMFMFIPKADAAFLMWVLHDWDDEECIKILKKC  271

Query  466   REAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSY  287
             REAIPE+ GKVII EA+L + +E      G  + +                         
Sbjct  272   REAIPEDKGKVIIVEAVLEEDKE------GDELGVAR-----------------------  302

Query  286   EVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQA  134
                LMLD  MM  T KG ERT K+WS+VL  +GF  + V     V ++I+ 
Sbjct  303   ---LMLDTAMMVITNKGRERTLKEWSYVLRQSGFTRFNVKPIRAVETVIET  350



>emb|CBI37807.3| unnamed protein product [Vitis vinifera]
Length=326

 Score =   301 bits (770),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 193/399 (48%), Positives = 227/399 (57%), Gaps = 91/399 (23%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRG  1145
             +WKY+FGF EMAVVKC IELGI D +ES    +TL  LSS LGCSPS LYRIMRFL+NR 
Sbjct  19    MWKYIFGFVEMAVVKCGIELGIADVIESHAGPITLSSLSSSLGCSPSGLYRIMRFLVNRR  78

Query  1144  IFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSPVM  965
             IFKEV  +                 +   GY QTPLS  L    E  MAA + LESSP  
Sbjct  79    IFKEVATS-----------------QGDTGYQQTPLSRRLMTRSENGMAALLLLESSP--  119

Query  964   LAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMACHA  785
                                                 DVW YA S PAHSKLI DAMAC A
Sbjct  120   ------------------------------------DVWGYAASHPAHSKLINDAMACDA  143

Query  784   RMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPHVVS  605
             RMAV AIV  CP++            +VDVGGGDGT +  L+KA P ++GINFDLPHVVS
Sbjct  144   RMAVSAIVNGCPEVF------DGVSTLVDVGGGDGTALRTLIKARPLIRGINFDLPHVVS  197

Query  604   VAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKVIIA  425
              APK  GV +  G+MF  +PKADA FLMWVLHDWGDEEC+QIL KCR+AIP + GKVII 
Sbjct  198   SAPKCNGVEYASGDMFDTVPKADAAFLMWVLHDWGDEECIQILEKCRQAIPGDKGKVIIV  257

Query  424   EAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMMAHT  245
             EA+++++++                                +NN  +VGLMLDMVMMAHT
Sbjct  258   EAVIQENEK------------------------------EGDNNLKDVGLMLDMVMMAHT  287

Query  244   GKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
               G ERT K+W +VL  AGF  YTV     V S+I+A P
Sbjct  288   TTGKERTLKEWDYVLKKAGFNRYTVKPIRAVKSVIEAYP  326



>ref|XP_010526878.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like isoform 
X2 [Tarenaya hassleriana]
Length=342

 Score =   300 bits (768),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 180/384 (47%), Positives = 227/384 (59%), Gaps = 66/384 (17%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQ-EQAVTLDQLSSGLGCSPSALYRIMRFLINR  1148
             IW+YVFGFT+MAVVKCAIEL IP+ +ES   Q VTL +LS+ + CSP  L RIMRFL ++
Sbjct  12    IWRYVFGFTDMAVVKCAIELKIPEAVESHPSQPVTLAELSTAVACSPPLLGRIMRFLSHQ  71

Query  1147  GIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALL---TRDGEKSMAAFVRLES  977
             GIFKEV      +                 GY+ TPLS L+    RD +KS A  + +ES
Sbjct  72    GIFKEVITKDGLVG----------------GYLNTPLSRLMMSSNRD-DKSKAPLILMES  114

Query  976   SPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAM  797
             SPVMLAPWLKLS  V           +   S  FE  +GKDVW Y   DP HS++  +AM
Sbjct  115   SPVMLAPWLKLSAVV-------SNAATEEGSQPFEVVHGKDVWAYCAEDPRHSEMFNEAM  167

Query  796   ACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLP  617
             AC  R  VP I  AC D+            VVDVGGG G  + +LVKAFP +KG NFDLP
Sbjct  168   ACDTRRLVPVIAGACSDVF------EGVSTVVDVGGGKGDALGVLVKAFPWIKGFNFDLP  221

Query  616   HVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGK  437
             HVV  A K  GV +VGG+MF+R+P ADA+F+ WVLHDW DE C+++L KCREAIP + GK
Sbjct  222   HVVETALKFDGVENVGGDMFERVPNADAVFIKWVLHDWNDEVCIKLLEKCREAIPRKGGK  281

Query  436   VIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVM  257
             V+I +A++ + +      +G R++                             LMLDMVM
Sbjct  282   VVIVDAVVGEKK------KGDRLEYAR--------------------------LMLDMVM  309

Query  256   MAHTGKGLERTEKQWSHVLTAAGF  185
             MAHT +G ERT ++W HV+T AGF
Sbjct  310   MAHTTRGRERTLEEWDHVITEAGF  333



>gb|KHF98068.1| RS-norcoclaurine 6-O-methyltransferase [Gossypium arboreum]
Length=300

 Score =   298 bits (764),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 178/365 (49%), Positives = 221/365 (61%), Gaps = 67/365 (18%)
 Frame = -1

Query  1228  VTLDQLSSGLGCSPSALYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYV  1049
             +TL QL++ L C PS LYRIMRFL++  IFKE  +T  +I                 G+ 
Sbjct  1     MTLSQLTTTLKCQPSRLYRIMRFLVHYQIFKEEPITKDSI-----------------GFA  43

Query  1048  QTPLSALLTRDGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEA  869
              TPLS  L+R GE+SMAA + L+SSPV LA W  LS RVL            S +  FE 
Sbjct  44    LTPLSRRLSRHGERSMAAMILLQSSPVTLATWHSLSARVL-----------DSGNSPFET  92

Query  868   ANGKDVWRYAESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgg  689
             A+GKDVW YAE +P HS+LI++AMAC AR+AV AI++ CP +            +VDVGG
Sbjct  93    AHGKDVWSYAEENPGHSELIDEAMACDARVAVRAIIEGCPQVF------DGIKSLVDVGG  146

Query  688   gdgttvEMLVKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLH  509
             G+GT + MLVK FP + GINFDLPHVV+VAPK  G+ +VGG+MF+ +PKADA F +WVLH
Sbjct  147   GNGTALSMLVKEFPWMHGINFDLPHVVAVAPKVDGIEYVGGDMFECVPKADAAFFLWVLH  206

Query  508   DWGDEECVQILSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnsk  329
             DW DEEC+QIL KCREAIP++ GKVII EA+L                            
Sbjct  207   DWDDEECIQILKKCREAIPQDKGKVIIVEAVL----------------------------  238

Query  328   LQEKDRNNNNNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVV  149
               E+D+N+       VGLMLDMVMMAHT KG ERT K+W +VL  AGF    V     V 
Sbjct  239   --EEDKNDKLEF---VGLMLDMVMMAHTKKGKERTLKEWKYVLGEAGFTRINVKPIHAVQ  293

Query  148   SIIQA  134
              II+A
Sbjct  294   FIIEA  298



>ref|XP_010103289.1| 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase [Morus 
notabilis]
 gb|EXB95356.1| 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase [Morus 
notabilis]
Length=366

 Score =   300 bits (769),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 182/399 (46%), Positives = 240/399 (60%), Gaps = 61/399 (15%)
 Frame = -1

Query  1318  KYVFG-FTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRGI  1142
             KY FG   EMAVVKCAIELG+ D + +  + +TL +LSS L C    L+R+MRFL+N GI
Sbjct  26    KYYFGGVVEMAVVKCAIELGMADAIANHGRPMTLLELSSALDCDLQNLHRVMRFLVNHGI  85

Query  1141  FKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSPVML  962
             FKE+                   T PT  Y QTP S  L R GE SMAA + ++SSP  +
Sbjct  86    FKEI-------------IIRNEDTVPTAYYAQTPSSRRLMRTGENSMAALILMQSSPPAM  132

Query  961   APWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMACHAR  782
             A W  LS  V            G ++ AFE  +G+DVW+YAE++PAH +LI +AMAC AR
Sbjct  133   ATWHCLSACV-----------KGKATSAFEVVHGEDVWKYAEANPAHGQLINEAMACKAR  181

Query  781   MAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGV-KGINFDLPHVVS  605
             +   AI+  C D+            +VDVGGG GT +  LVKA P + KGI FDLPHVVS
Sbjct  182   VMASAIIDGCLDVF------EGVETLVDVGGGTGTIMRRLVKACPWISKGITFDLPHVVS  235

Query  604   VAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKVIIA  425
             +A +  G+ +VGG+MF+ IPKADA+ L+ VLHDWGD+EC++IL KCREAIP++ GKVII 
Sbjct  236   LAEQCEGIEYVGGDMFEFIPKADAVLLVTVLHDWGDDECIRILKKCREAIPKDKGKVIIV  295

Query  424   EAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMMAHT  245
             EA++ + +                         Q+K+ N  N+    VGL+LDMVMMAHT
Sbjct  296   EAVIGNKE-------------------------QQKEDNKLND----VGLVLDMVMMAHT  326

Query  244   GKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
              KG ERT  +W++VL  AGF  +TV   + + S+I+A P
Sbjct  327   YKGKERTLDEWAYVLREAGFSRHTVRSIAAIQSVIEAFP  365



>ref|XP_006283957.1| hypothetical protein CARUB_v10005080mg [Capsella rubella]
 gb|EOA16855.1| hypothetical protein CARUB_v10005080mg [Capsella rubella]
Length=369

 Score =   298 bits (764),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 183/420 (44%), Positives = 245/420 (58%), Gaps = 63/420 (15%)
 Frame = -1

Query  1369  KSIRRQEVDYEEEDG--IWKYVFGFTEMAVVKCAIELGIPDFLESQ--EQAVTLDQLSSG  1202
             + ++R+ +D EE+    IWKYVFGF ++A  KCAI+L IP+ +E+    Q VTLD+LSS 
Sbjct  2     EEVKRKILDEEEKASVDIWKYVFGFADIAAAKCAIDLKIPEAIENHPSSQPVTLDELSSA  61

Query  1201  LGCSPSALYRIMRFLINRGIFKEVEMT--LPTIsstssteaalasTRPTRGYVQTPLS--  1034
             +  SPS L RIMRFL ++G+FKEV +   L T                  GY  TPLS  
Sbjct  62    VSASPSHLRRIMRFLAHQGLFKEVPIKDGLAT------------------GYTNTPLSRR  103

Query  1033  ALLTRDGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKD  854
              ++T+   KS+A FV  E+ P MLAPWL+LS  V    N       GS+   F+A +GKD
Sbjct  104   MMITKRDGKSLAPFVLFETRPEMLAPWLRLSSVVSAPVN-------GSTPPPFDAVHGKD  156

Query  853   VWRYAESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgtt  674
             VW +A+ +P  S+LI +AMAC  R  VP + +AC      HG       VVDVGG  G T
Sbjct  157   VWSFAQDNPGLSELINEAMACDTRRVVPRVAEAC------HGLLNGVDTVVDVGGSTGET  210

Query  673   vEMLVKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDE  494
             + +LVK FP +KGINFDLPHV+ VA    GV +V G+MF  +P  DA+ + WVLHDWGD+
Sbjct  211   LGILVKEFPWIKGINFDLPHVIEVAQVLDGVLNVEGDMFDSVPACDAVIIKWVLHDWGDK  270

Query  493   ECVQILSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKD  314
             +C++IL  C+EA+P+  GKV+I E+++ ++ +                       + E+D
Sbjct  271   DCIKILKNCKEAVPQNVGKVLIVESVIGENTK-------------------KTMIVDERD  311

Query  313   RNNNNNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQA  134
                 +     V LMLDMVMMAHT  G ERT K+W  VLT AGF  Y V D  DV S+I A
Sbjct  312   EKLEH-----VRLMLDMVMMAHTSTGKERTLKEWDFVLTEAGFARYEVRDIDDVQSLIIA  366



>ref|XP_008447904.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Cucumis 
melo]
Length=358

 Score =   298 bits (763),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 186/418 (44%), Positives = 244/418 (58%), Gaps = 68/418 (16%)
 Frame = -1

Query  1363  IRRQEVDYE-EEDG-----IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSG  1202
             ++ +E   E EEDG     +W+Y+F FTEMA +KCAI+L I D +ES    VTL QLSS 
Sbjct  3     VKHKESSSEKEEDGQAIIQMWRYIFRFTEMAAIKCAIDLKIADIIESYGSPVTLSQLSST  62

Query  1201  LGCSPSALYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLT  1022
             L CS S LYRI+RFLI+RGIFK   +    I                 GY QTP+S LL 
Sbjct  63    LNCSSSLLYRILRFLIHRGIFKRETIDENQI-----------------GYSQTPMSRLLA  105

Query  1021  RDGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRY  842
              + E SMA  + LE+SPVMLAPW  LS  +             S +  FE A+GKD+W Y
Sbjct  106   INVENSMAPLLLLETSPVMLAPWQHLSAHL-----------KNSDTSPFEIAHGKDLWNY  154

Query  841   AESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEML  662
             AE++  H+ L  +AMAC A++ V AI++ C D+            +VDVGGG+G+T+ +L
Sbjct  155   AEANHEHNLLFNEAMACSAKVIVSAIIEGCGDVF------DGVGCLVDVGGGNGSTLNIL  208

Query  661   VKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQ  482
             VK  P +KGINFDLPHVV  +P+   V HV GNMF  +P AD  FL W+LHDW DEEC++
Sbjct  209   VKVCPWMKGINFDLPHVVCASPQYENVEHVAGNMFDFVPHADVAFLKWILHDWEDEECIK  268

Query  481   ILSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNN  302
             IL KC+EAIP+  GKVII EA       +I   +G +MK K +                 
Sbjct  269   ILKKCKEAIPKSGGKVIIIEA------IIIEAEKGEKMKKKLS-----------------  305

Query  301   NNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
                  +VGLM D+VMMAHT KG ERT ++W+ ++  AGF  +T+T    + S+IQ  P
Sbjct  306   -----DVGLMFDLVMMAHTNKGRERTAEEWAFLIHQAGFTRHTITPLQAIQSLIQCFP  358



>ref|NP_195242.1| O-methyltransferase family protein [Arabidopsis thaliana]
 emb|CAB36723.1| O-methyltransferase-like protein [Arabidopsis thaliana]
 emb|CAB80233.1| O-methyltransferase-like protein [Arabidopsis thaliana]
 gb|AAM20654.1| O-methyltransferase-like protein [Arabidopsis thaliana]
 gb|AAN15621.1| O-methyltransferase-like protein [Arabidopsis thaliana]
 gb|AEE86474.1| O-methyltransferase family protein [Arabidopsis thaliana]
Length=382

 Score =   298 bits (764),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 184/420 (44%), Positives = 244/420 (58%), Gaps = 70/420 (17%)
 Frame = -1

Query  1360  RRQEVDYEEEDG--IWKYVFGFTEMAVVKCAIELGIPDFLESQ--EQAVTLDQLSSGLGC  1193
             +R+ +D E +    IWKYVFGF ++A  KCAI+L IP+ +E+    Q VTL +LSS +  
Sbjct  19    KRKVLDEEAKASLDIWKYVFGFADIAAAKCAIDLKIPEAIENHPSSQPVTLAELSSAVSA  78

Query  1192  SPSALYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTR-----GYVQTPLSA-  1031
             SPS L RIMRFL+++GIFKE+                     PT+     GYV TPLS  
Sbjct  79    SPSHLRRIMRFLVHQGIFKEI---------------------PTKDGLATGYVNTPLSRR  117

Query  1030  -LLTRDGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKD  854
              ++TR   KS+A FV  E++P MLAPWL+LS  V           +GS+   F+A +GKD
Sbjct  118   LMITRRDGKSLAPFVLFETTPEMLAPWLRLSSVV-------SSPVNGSTPPPFDAVHGKD  170

Query  853   VWRYAESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgtt  674
             VW +A+ +P  S +I +AMAC AR  VP +  AC      HG       +VDVGGG G T
Sbjct  171   VWSFAQDNPFLSDMINEAMACDARRVVPRVAGAC------HGLFDGVTTMVDVGGGTGET  224

Query  673   vEMLVKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDE  494
             + MLVK FP +KG NFDLPHV+ VA    GV +V G+MF  IP  DAIF+ WVLHDWGD+
Sbjct  225   MGMLVKEFPWIKGFNFDLPHVIEVAEVLDGVENVEGDMFDSIPACDAIFIKWVLHDWGDK  284

Query  493   ECVQILSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKD  314
             +C++IL  C+EA+P   GKV+I E+++ ++++ +                     + E+D
Sbjct  285   DCIKILKNCKEAVPPNIGKVLIVESVIGENKKTM--------------------IVDERD  324

Query  313   RNNNNNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQA  134
                 +     V LMLDMVMMAHT  G ERT K+W  VL  AGF  Y V D  DV S+I A
Sbjct  325   EKLEH-----VRLMLDMVMMAHTSTGKERTLKEWDFVLKEAGFARYEVRDIDDVQSLIIA  379



>ref|XP_007163840.1| hypothetical protein PHAVU_001G268700g [Phaseolus vulgaris]
 gb|ESW35834.1| hypothetical protein PHAVU_001G268700g [Phaseolus vulgaris]
Length=352

 Score =   297 bits (760),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 169/395 (43%), Positives = 234/395 (59%), Gaps = 71/395 (18%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRG  1145
             IWKY+FGF EMAVVKCAIELGI + +E   + +TL ++SS +GC PS L RIMRFL+ R 
Sbjct  25    IWKYIFGFVEMAVVKCAIELGIAEAIEKHGRPMTLSEISSAIGCDPSLLKRIMRFLVRRK  84

Query  1144  IFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSPVM  965
             IFK V                      T GY QTPLS    R+G++SMAA + LESSPVM
Sbjct  85    IFKPV----------------------TNGYSQTPLSRRFIREGKQSMAALLLLESSPVM  122

Query  964   LAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMACHA  785
             LAPW  LS RV+            +   +F+  +G+DVWR+A ++  HS LI + MAC  
Sbjct  123   LAPWHSLSARVM-----------ANGRPSFQNTHGEDVWRFAAANLDHSNLINEGMACDT  171

Query  784   RMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPHVVS  605
             ++ +P I+++C +             VVDVGGG+G+ + +L++A P ++ +NFDLPHV++
Sbjct  172   KLVIPVIIRSCSEAF------DGVESVVDVGGGNGSAMRILLEALPSIRAMNFDLPHVIA  225

Query  604   VAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKVIIA  425
              AP   G+ HV GNMF+ +P+ADA+FL WVLHDW DEEC++IL KCRE + +E G+V+I 
Sbjct  226   QAPPCDGLQHVAGNMFESVPEADAVFLKWVLHDWSDEECIEILKKCREGVSKEKGRVVIV  285

Query  424   EAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMMAHT  245
             E        +    +G+++                           +VG++LDMVMMAHT
Sbjct  286   E------AVIEEEEEGSKLA--------------------------DVGVVLDMVMMAHT  313

Query  244   GKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSII  140
               G ERT K+W +V+  AGF S+TV     V S+I
Sbjct  314   NFGKERTLKEWEYVIKTAGFSSFTVKPIHAVQSVI  348



>ref|XP_009108679.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Brassica 
rapa]
Length=368

 Score =   296 bits (758),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 181/415 (44%), Positives = 240/415 (58%), Gaps = 60/415 (14%)
 Frame = -1

Query  1360  RRQEVDYEEEDG--IWKYVFGFTEMAVVKCAIELGIPDFLESQ--EQAVTLDQLSSGLGC  1193
             +R  VD E +    IW+YVFGF ++A  KCAI+L IP+ +E+    Q +TL +LSS +  
Sbjct  5     KRNLVDEEAKASLDIWRYVFGFADIAAAKCAIDLKIPEAIENHPSSQPMTLAELSSTVSA  64

Query  1192  SPSALYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLS--ALLTR  1019
             SPS L RIMRFL+++GIFKEV +                    T GY  TPLS   ++T+
Sbjct  65    SPSHLRRIMRFLVHQGIFKEVPIK----------------DGLTTGYTNTPLSRRMMITK  108

Query  1018  DGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYA  839
                KS+A FV  E+S  MLAPWL+LS  V           +GS    F+A + KDVW  A
Sbjct  109   RDGKSLAPFVLFETSHEMLAPWLRLSSVV-------SSPVNGSHPPPFDAVHNKDVWALA  161

Query  838   ESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLV  659
             E +P  S++I +AMAC  R  VP + +AC DL            VVDVGGG+G  V +LV
Sbjct  162   EDNPCFSEMINEAMACDTRRVVPRVARACHDLF------DGVATVVDVGGGNGEAVGILV  215

Query  658   KAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQI  479
             K FP +KG NFDLPHV+ VA    GV +VGG+MF  IPK DA+F+ WVLHDWGD++C++I
Sbjct  216   KEFPWIKGFNFDLPHVIDVAQVLDGVENVGGDMFDSIPKCDAVFIKWVLHDWGDKDCIKI  275

Query  478   LSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNN  299
             L  C+EA+P   GKV I E+++R++++ +                     ++E+D    +
Sbjct  276   LKNCKEAVPANIGKVFIVESVIRENKKTM--------------------IVEERDEKLEH  315

Query  298   NNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQA  134
                  V LMLDMVMMAHT  G ERT K+W  VL  AGF  Y V D  DV  +I A
Sbjct  316   -----VRLMLDMVMMAHTSTGKERTLKEWDFVLNEAGFARYEVRDIDDVQCVIIA  365



>gb|AFK49425.1| unknown [Lotus japonicus]
Length=366

 Score =   296 bits (757),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 181/400 (45%), Positives = 234/400 (59%), Gaps = 63/400 (16%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRG  1145
             IWKY+FGF E AVVKCAIELGI + +E+  + +TL +LSS L C PS L RIMRFL+ R 
Sbjct  29    IWKYIFGFVEQAVVKCAIELGIAEAIEAHGKPMTLSELSSTLRCDPSYLNRIMRFLVRRK  88

Query  1144  IFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSPVM  965
             IFK    T               +      YVQ+PLS  L R+GE SM A + LESS VM
Sbjct  89    IFKTTTST--------------TNHGCDLSYVQSPLSRRLLRNGEHSMTALLMLESSHVM  134

Query  964   LAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMACHA  785
             LAPW  LS RVL+  N            +F+  +G+DVW YA ++  HS LI +AMAC A
Sbjct  135   LAPWHGLSDRVLVDGN-----------PSFKKVHGEDVWDYAATNLEHSNLINEAMACDA  183

Query  784   RMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPHVVS  605
              + VP +V+ C ++            +VDVGGG+G  + ++ K+ P +K INFDLPHV++
Sbjct  184   NLVVPVMVEGCSEVF------EGLTTLVDVGGGNGAAMGVVAKSCPWIKAINFDLPHVIA  237

Query  604   -VAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKVII  428
              VAPK  GV  V G+MF  +PKADA+F+ WVLHDWGDEEC+QIL  CREAIP+E G+VII
Sbjct  238   AVAPKCNGVEFVAGDMFASVPKADAVFIKWVLHDWGDEECIQILKNCREAIPKENGRVII  297

Query  427   AEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMMAH  248
              EA                                 ++    ++   +VGLMLDMVMMAH
Sbjct  298   VEA-------------------------------VIEEEEGKHDKLKDVGLMLDMVMMAH  326

Query  247   TGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             T  G ERT K+W +V+  AGF ++TV   + V S+I A P
Sbjct  327   TNFGKERTLKEWEYVIKMAGFSTFTVKAINAVQSVILALP  366



>gb|KFK30150.1| hypothetical protein AALP_AA7G223500 [Arabis alpina]
Length=363

 Score =   295 bits (756),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 181/407 (44%), Positives = 235/407 (58%), Gaps = 70/407 (17%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQ--EQAVTLDQLSSGLGCSPSALYRIMRFLIN  1151
             IW+YVFGF ++A  KCAI+L IP+ +E+    Q VTL +LSS +  SPS L R+MRFL++
Sbjct  14    IWRYVFGFADIAAAKCAIDLKIPEAIENHLSAQPVTLAELSSAISASPSHLRRLMRFLVH  73

Query  1150  RGIFKEVEMTLPTIsstssteaalasTRPTR-----GYVQTPLSALL---TRDGEKSMAA  995
             +GIFKEV                     PT+     GY  TPLS L+    RDG KS+A 
Sbjct  74    QGIFKEV---------------------PTKDGLATGYTNTPLSCLMMITKRDG-KSLAP  111

Query  994   FVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSK  815
             FV  E+SP MLAPWL+LS  V           +GSS   F+A +GKDVW +A+ +P  S+
Sbjct  112   FVLFETSPEMLAPWLRLSSVV-------SSPVNGSSPPPFDAVHGKDVWSFAQDNPCLSE  164

Query  814   LIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKG  635
             +I +AMAC AR  VP +  AC  L            VVDVGGG G T+ +LVK FP +KG
Sbjct  165   MINEAMACDARRVVPRVAGACQGLF------DHVATVVDVGGGTGETMGILVKEFPWIKG  218

Query  634   INFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAI  455
              NFDLPHVV VA    GV +V G+MF  IP  DA+ + WVLHDWGD++C++IL  C+EA+
Sbjct  219   YNFDLPHVVEVAQVLDGVENVKGDMFDSIPACDAVIIKWVLHDWGDKDCIKILKNCKEAV  278

Query  454   PEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGL  275
                 GKV+I E+++RD ++ +                     ++E+D    +     V L
Sbjct  279   SPNNGKVLIVESVIRDKKKTM--------------------IVEERDEKLEH-----VRL  313

Query  274   MLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQA  134
             MLDMVMMAHT  G ERT K+W  VL  AGF  Y V D  DV  +I A
Sbjct  314   MLDMVMMAHTSTGKERTLKEWDFVLNEAGFARYEVRDIDDVQCVIVA  360



>ref|XP_009138346.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Brassica 
rapa]
Length=366

 Score =   295 bits (754),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 172/405 (42%), Positives = 233/405 (58%), Gaps = 67/405 (17%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQ-EQAVTLDQLSSGLGCSPSALYRIMRFLINR  1148
             IW+YVFGF ++A  KCAI+L IP+ +E+   Q VTL +LS  +  SPS L+RIM+FL+++
Sbjct  19    IWRYVFGFADIAAAKCAIDLKIPEAIENHPSQPVTLAELSGAVSASPSHLHRIMKFLVHQ  78

Query  1147  GIFKEVEMTLPTIsstssteaalasTRPTR-----GYVQTPLS--ALLTRDGEKSMAAFV  989
             G+FKEV                     PT+     GY  TPLS   ++T+   KS+A FV
Sbjct  79    GVFKEV---------------------PTKDGLATGYTNTPLSRRMMITKRDGKSLAPFV  117

Query  988   RLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLI  809
               E+SP +LAPWL+LS  V    N       GS    F+  +GKD+W  AE +P  + +I
Sbjct  118   LFETSPELLAPWLRLSSVVSSPAN-------GSHPPPFDTVHGKDLWALAEDNPCFNDVI  170

Query  808   EDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGIN  629
              +AMACH R+ VP +  AC DL            VVDVGG  G T+ +LVK FP +KG N
Sbjct  171   NEAMACHTRLVVPRVAAACHDLF------EGVATVVDVGGCTGETLAILVKEFPWIKGFN  224

Query  628   FDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPE  449
             FDLPHV+ VA    GV +VGG+MF  +PK D +F+ WVLHDWGD++C++IL  C+EA+P 
Sbjct  225   FDLPHVIEVAQVLDGVENVGGDMFDSVPKCDNVFIKWVLHDWGDKDCIRILKNCKEAVPS  284

Query  448   ETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLML  269
               GKV+I E+++RD ++ +                     ++++D         +V LML
Sbjct  285   NIGKVLIVESVIRDQKKTM--------------------IVEDRDEKLE-----QVRLML  319

Query  268   DMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQA  134
             DM MMAHT  G ERT K+W  VL  AGF  Y V D  DV  +I A
Sbjct  320   DMGMMAHTSTGKERTLKEWDFVLNEAGFARYEVRDIDDVQCVIIA  364



>ref|XP_010526873.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Tarenaya 
hassleriana]
Length=350

 Score =   292 bits (748),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 169/400 (42%), Positives = 232/400 (58%), Gaps = 67/400 (17%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQ-EQAVTLDQLSSGLGCSPSALYRIMRFLINR  1148
             IW+Y +GF EM VVKCAIEL IP+ +ES   Q VTL +L++ + CSP  L RIMRFL+++
Sbjct  12    IWRYAYGFPEMTVVKCAIELKIPEAVESHTSQPVTLAELATAVDCSPPLLGRIMRFLVHQ  71

Query  1147  GIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLS--ALLTRDGEKSMAAFVRLESS  974
             GIFKEV +T   +                 GY  TPLS   +++   +KS+AAF+ ++++
Sbjct  72    GIFKEV-LTKDGLV----------------GYSNTPLSRRMMISNPHDKSLAAFILMDNN  114

Query  973   PVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMA  794
             PVM APWLKL+  +           S   S  FEA  GKD+W Y   DP+H+++  D MA
Sbjct  115   PVMRAPWLKLTSLI--------SNSSDEGSQPFEAVYGKDIWAYGAEDPSHNEIFNDTMA  166

Query  793   CHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPH  614
             C  R  VPA+ +AC D+            VVDVGGG G  + +LVK FP +KG NFDLPH
Sbjct  167   CDTRRVVPAVARACADVF------EGVSTVVDVGGGKGDALGVLVKEFPWIKGFNFDLPH  220

Query  613   VVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKV  434
             VV  A K   V  VGG+MF+ +P AD +FL W+LHDWGDEEC+++L KC++A+P+  GKV
Sbjct  221   VVETAQKLDRVESVGGDMFKHVPNADLVFLKWILHDWGDEECIKLLRKCKDAVPKGKGKV  280

Query  433   IIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMM  254
             +I E++L                                 +  ++   Y V LM+D+ MM
Sbjct  281   MIVESVL--------------------------------GKKKDDKLEY-VRLMIDIGMM  307

Query  253   AHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQA  134
              +T KG ERT K+W +V+T AGF  Y + D +DV S+I A
Sbjct  308   VYTSKGKERTLKEWDYVITEAGFARYEIRDINDVQSVIIA  347



>ref|XP_009138347.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Brassica 
rapa]
Length=367

 Score =   293 bits (749),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 180/413 (44%), Positives = 238/413 (58%), Gaps = 67/413 (16%)
 Frame = -1

Query  1342  YEEEDG---IWKYVFGFTEMAVVKCAIELGIPDFLESQEQA--VTLDQLSSGLGCSPSAL  1178
             YEE      IW+YVFGF ++A  KCAI+L IP+ +E+   +  VTL +LS  +  SPS L
Sbjct  10    YEEAKASLDIWRYVFGFADIAAAKCAIDLKIPEAIENHPSSLPVTLAELSVAVSASPSHL  69

Query  1177  YRIMRFLINRGIFKEVEMT--LPTIsstssteaalasTRPTRGYVQTPLSALL---TRDG  1013
             +RIMRFL+++GIFK+V +   L T                  GY  TPLS L+    RDG
Sbjct  70    HRIMRFLVHQGIFKQVPIKDGLAT------------------GYTNTPLSRLMMITKRDG  111

Query  1012  EKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAES  833
              KS+A FV  E+SP MLAPWL+LS  V    N       GS    F+A +GKDVW  AE 
Sbjct  112   -KSLAPFVLFETSPEMLAPWLRLSSVVASPAN-------GSHPPPFDAVHGKDVWALAED  163

Query  832   DPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKA  653
             +P  S +I +AMAC  R  VP + +AC DL            VVDVGG  G T+ +LVK 
Sbjct  164   NPCLSHMINEAMACDTRRVVPRVARACHDLF------EGVATVVDVGGCTGETMGILVKE  217

Query  652   FPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILS  473
             FP +KG NFD+PHV+ VA    GV +VGG+MF  +PK DA+ + WVLHDWGD++C++IL 
Sbjct  218   FPWIKGFNFDVPHVIQVAQVLDGVENVGGDMFDSVPKCDAVLIKWVLHDWGDKDCIRILK  277

Query  472   KCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNN  293
              C+EA+P   GKV+I E+++R+ ++ +                     ++++D    +  
Sbjct  278   NCKEAVPPNIGKVLIVESVIREKKKAM--------------------IVEDRDEKLEH--  315

Query  292   SYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQA  134
                V LMLDMVMMAHT  G ERT K+W  VL  AGF  Y V D  DV  +I A
Sbjct  316   ---VRLMLDMVMMAHTTTGKERTLKEWDFVLNEAGFARYEVRDIDDVQCVIIA  365



>ref|XP_007199647.1| hypothetical protein PRUPE_ppa015631mg, partial [Prunus persica]
 gb|EMJ00846.1| hypothetical protein PRUPE_ppa015631mg, partial [Prunus persica]
Length=351

 Score =   292 bits (747),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 179/399 (45%), Positives = 235/399 (59%), Gaps = 62/399 (16%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRG  1145
             IWKYVFGF E+AVVKCAI+LGI D +ES    +TL +LSS L C PS  YRIMR L++  
Sbjct  15    IWKYVFGFAEIAVVKCAIQLGIADAIESHGGPMTLLELSSALRCDPSPPYRIMRVLVHLK  74

Query  1144  IFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSPVM  965
             IFK    T                    + Y QTPLS  L + G+ SMAAF+ LE+SPVM
Sbjct  75    IFKNKPAT----------------QLGPKVYAQTPLSKRLLKSGQNSMAAFILLENSPVM  118

Query  964   LAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMACHA  785
             LAPW  LS R+     N+           FE  +G+D+W +  ++P H+KL  +AMAC A
Sbjct  119   LAPWHVLSTRIKGNIRNS----------VFEEVHGEDIWSFGAANPDHNKLFNEAMACDA  168

Query  784   RMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPHVVS  605
             R+ V A+ ++C ++            +VDVGGGDGTT+ +LV+A P ++GINFDLPHVV 
Sbjct  169   RVVVSAMTESCIEVF------EGIETIVDVGGGDGTTLRLLVEACPWIQGINFDLPHVVP  222

Query  604   VAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKVIIA  425
             VA +   + +VGG+MF  +PKADA+ +  VL DWGD+EC++IL KCREAI E+ GKVII 
Sbjct  223   VAQECDRIENVGGDMFDCVPKADAVIIKSVLQDWGDDECIRILKKCREAIAEDKGKVIIV  282

Query  424   EAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMMAHT  245
             EA++ +  E                        +E  +  N      V LMLDMVMMA+T
Sbjct  283   EAVIDEKDE------------------------KEDIKLTN------VRLMLDMVMMAYT  312

Query  244   GKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
               G ERT K+W +VL  AGF  +T+T    V S+IQA P
Sbjct  313   NTGKERTLKEWEYVLEEAGFSRHTITPIHAVCSVIQAFP  351



>ref|XP_010432319.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Camelina 
sativa]
Length=368

 Score =   290 bits (743),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 180/417 (43%), Positives = 240/417 (58%), Gaps = 64/417 (15%)
 Frame = -1

Query  1360  RRQEVDYEEEDG--IWKYVFGFTEMAVVKCAIELGIPDFLESQEQA--VTLDQLSSGLGC  1193
             ++Q VD E +    IW+YVFGF ++A  KCAI+L IP+ +E+   +  VTL +LSS +  
Sbjct  5     KKQLVDEEAKASLDIWRYVFGFADIAAAKCAIDLNIPEAIENHPSSHPVTLAELSSAVSA  64

Query  1192  SPSALYRIMRFLINRGIFKEVEMT--LPTIsstssteaalasTRPTRGYVQTPLS--ALL  1025
             SPS L RIMRFL+++G+FKEV     L T                  GY  TPLS   ++
Sbjct  65    SPSHLRRIMRFLVHQGLFKEVATKDGLAT------------------GYTNTPLSRRMMI  106

Query  1024  TRDGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWR  845
             T+   KS+A FV  E+ P MLAPWL+LS  V           +GS+   F+A +GKDVW 
Sbjct  107   TKRDGKSLAPFVLFETRPEMLAPWLRLSSVV-------PSPVNGSTPPPFDAVHGKDVWS  159

Query  844   YAESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEM  665
             +A+ +P  S LI +AMAC  R  VP +  AC      HG       VVDVGGG G T+ +
Sbjct  160   FAQGNPGLSDLINEAMACDTRRVVPRVAGAC------HGLLDDVDTVVDVGGGTGETLGI  213

Query  664   LVKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECV  485
             LVK FP +KG NFDLPHV+ VA    GV +V G+MF  +P  DA+F+ WVLHDWGD++C+
Sbjct  214   LVKEFPWIKGFNFDLPHVIGVAQNLDGVTNVEGDMFDSVPACDAVFIKWVLHDWGDKDCI  273

Query  484   QILSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNN  305
             +IL  C+EA+P   GKV+I EA++ ++++ +                     + E+D   
Sbjct  274   KILKNCKEAVPPIVGKVLIVEAVIGENKKTM--------------------IVNERDEKL  313

Query  304   NNNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQA  134
              +     V LMLDMVMMAHT  G ERT K+W  VLT AGF  Y V D  DV  +I A
Sbjct  314   EH-----VRLMLDMVMMAHTSTGKERTLKEWDFVLTEAGFARYEVRDIDDVQCLIIA  365



>ref|XP_008447905.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Cucumis 
melo]
Length=360

 Score =   290 bits (742),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 189/422 (45%), Positives = 255/422 (60%), Gaps = 70/422 (17%)
 Frame = -1

Query  1375  DAKSIRRQEVDYEEEDG-----IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQL  1211
             D  +    ++  EEE+      +WKY+FGF EMAVVKCAIEL I D +ES   ++TL QL
Sbjct  3     DTGNKESNKLKIEEENSDIKVQVWKYIFGFVEMAVVKCAIELKIGDVIESHGDSMTLSQL  62

Query  1210  SSGLGCSPSALYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSA  1031
             SS L CSP  L+RI+RFL++RGIFKE                     + ++ Y  TP+S 
Sbjct  63    SSSLSCSPLLLHRILRFLVHRGIFKE--------------------EKSSKSYSHTPMSR  102

Query  1030  LLTRDGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDV  851
             LLT  G  SMA    LESSPVM+APW  LS  V     N H+    + S  FE A+G D+
Sbjct  103   LLTTTGPNSMAPIHLLESSPVMIAPWHNLSACV---KANGHE----NGSQPFEMAHGMDL  155

Query  850   WRYAESDPAHSKLIEDAMACHARMAV-PAIVQACPDLLLLHgaagvecvvvdvgggdgtt  674
             W YA ++P+HS L+ + MAC AR+ + PA+++ C ++            +VDVGGG+GT 
Sbjct  156   WTYAAANPSHSSLLNEGMACFARLFILPAVLERCGEIF------DGVGCLVDVGGGNGTC  209

Query  673   vEMLVKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDE  494
             + +LVKA P +KGINFDLPHVVSV+ +  GV HVGG+MF  +PKADA F+M VLHDW DE
Sbjct  210   LSILVKACPWIKGINFDLPHVVSVSKEYEGVQHVGGDMFDSVPKADAAFIMEVLHDWDDE  269

Query  493   ECVQILSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKD  314
             EC++IL  C+EAIPE+TGKVII E ++ + ++ I+ Y                       
Sbjct  270   ECIKILRNCKEAIPEKTGKVIIVEIVIDEKEDQISKYS----------------------  307

Query  313   RNNNNNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQA  134
                      +V L +DM+MMAHT KG ERT ++W+++L  AGF  YT+T T+ + S+IQA
Sbjct  308   ---------DVKLRMDMIMMAHTIKGKERTNEEWANLLQKAGFSYYTITPTTTIQSVIQA  358

Query  133   RP  128
              P
Sbjct  359   FP  360



>ref|XP_010437514.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Camelina 
sativa]
Length=368

 Score =   289 bits (739),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 179/420 (43%), Positives = 244/420 (58%), Gaps = 64/420 (15%)
 Frame = -1

Query  1369  KSIRRQEVDYEEEDG--IWKYVFGFTEMAVVKCAIELGIPDFLESQEQA--VTLDQLSSG  1202
             + I+++ VD E +    IW+YVFGF ++A  KCAI+L IP+ +E+   +  VTL +LSS 
Sbjct  2     EDIKKKIVDEEAKASLDIWRYVFGFADIAAAKCAIDLKIPEAIENHPSSHPVTLAELSSA  61

Query  1201  LGCSPSALYRIMRFLINRGIFKEVEMT--LPTIsstssteaalasTRPTRGYVQTPLS--  1034
             +  SPS L RIMRFL+++G+FKEV +   L T                  GY  TPLS  
Sbjct  62    VSASPSHLRRIMRFLVHQGLFKEVPIKDGLAT------------------GYTNTPLSRR  103

Query  1033  ALLTRDGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKD  854
              ++T+   KS+A FV  E+ P MLAPWL+LS  V           +GS+   F+A +GKD
Sbjct  104   MMITKRDGKSLAPFVLFETRPEMLAPWLRLSSVV-------SSPVNGSTPPPFDAVHGKD  156

Query  853   VWRYAESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgtt  674
             VW +A+ +P  S+LI +AMAC  R  VP +  AC      HG       VVDVGGG G T
Sbjct  157   VWSFAQDNPGLSELINEAMACDTRRVVPRVAGAC------HGLLDGVDTVVDVGGGTGET  210

Query  673   vEMLVKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDE  494
             + +LVK FP +KG NFDLPHV+ VA    GV ++ G+MF  IP  DA+F+ WVLHDWGD+
Sbjct  211   LGILVKEFPWIKGYNFDLPHVIEVAQFLDGVTNIEGDMFDSIPACDAVFIKWVLHDWGDK  270

Query  493   ECVQILSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKD  314
             +C++IL  C+EA+P   GKV+I E+++ ++++ +                     + E+D
Sbjct  271   DCIKILKNCKEAVPPIVGKVLIVESVIGENKKTM--------------------IVDERD  310

Query  313   RNNNNNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQA  134
                 +     V LMLDMVMMAHT  G ERT K+W  VLT AGF  Y V D  DV  +I A
Sbjct  311   EKLEH-----VRLMLDMVMMAHTSTGKERTLKEWDFVLTEAGFARYEVKDIDDVQCLIIA  365



>gb|KHG19041.1| 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase [Gossypium 
arboreum]
Length=328

 Score =   287 bits (735),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 169/383 (44%), Positives = 220/383 (57%), Gaps = 64/383 (17%)
 Frame = -1

Query  1276  AIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRGIFKEVEMTLPTIssts  1097
             +IELGI D +E+    + L +L++ L C PS L+RIMR +++  IFK+  +   T+    
Sbjct  10    SIELGIADVIENYGSPMPLSELATALRCDPSRLHRIMRLMVHDQIFKQEPINQHTV----  65

Query  1096  steaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDN  917
                          G+  TPLS  L + GEKSMAAF+ L S P  LAPW  LS RVL   N
Sbjct  66    -------------GFSSTPLSRCLIKGGEKSMAAFILLMSGPTCLAPWHSLSARVLETGN  112

Query  916   NNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMACHARMAVPAIVQACPDLLL  737
             N            FE ANGKD+W YAE++P  S+L  +AM C AR+ V A ++ CP++  
Sbjct  113   N---------ISPFEVANGKDIWSYAEANPDFSELFNNAMGCKARLTVQATIEGCPEVF-  162

Query  736   LHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMF  557
                       +VD+GGG+ T + +LVKAFP ++GINFDLPHVV+VAPK   + +VGG+MF
Sbjct  163   -----DGVENLVDIGGGNATALSILVKAFPWIRGINFDLPHVVAVAPKSDSIENVGGDMF  217

Query  556   QRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKVIIAEAILRDHQEMINGYQG  377
               IP ADA FLM VLHDW DEECV+IL KCREAIPE+ GKVII EA+L + +E+      
Sbjct  218   MSIPNADAAFLMTVLHDWDDEECVKILKKCREAIPEDKGKVIIVEAVLEEDKEV------  271

Query  376   TRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLT  197
                                       +    VGLMLD  MMA T KG ERT K+WS+VL 
Sbjct  272   --------------------------DEVGVVGLMLDTAMMAITNKGKERTLKEWSYVLR  305

Query  196   AAGFKSYTVTDTSDVVSIIQARP  128
              +GF  + V     V S+I+A P
Sbjct  306   QSGFTRFNVKPIRAVQSVIEAYP  328



>ref|XP_002867087.1| O-methyltransferase family 2 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43346.1| O-methyltransferase family 2 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=368

 Score =   288 bits (738),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 177/420 (42%), Positives = 242/420 (58%), Gaps = 70/420 (17%)
 Frame = -1

Query  1360  RRQEVDYEEEDG--IWKYVFGFTEMAVVKCAIELGIPDFLESQ--EQAVTLDQLSSGLGC  1193
             +R+ +D E +    IW+Y+FGF ++A  KCAI+L IP+ +E+    Q VTL +LSS +  
Sbjct  5     KRRVLDEEAKASLDIWRYIFGFADIAAAKCAIDLKIPEAIENHPSSQPVTLAELSSAVSA  64

Query  1192  SPSALYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTR-----GYVQTPLS--  1034
             SPS L RIMRFL+++GIFKE+                     PT+     GY  TPLS  
Sbjct  65    SPSHLRRIMRFLVHQGIFKEI---------------------PTKDGLATGYANTPLSHR  103

Query  1033  ALLTRDGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKD  854
              ++T+   KS+A FV  E++P MLAPWL+LS  V           +GS+   F+A +GKD
Sbjct  104   MMITKRDGKSLAPFVLFETTPEMLAPWLRLSSVV-------SSPFNGSAPPPFDAVHGKD  156

Query  853   VWRYAESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgtt  674
             VW +A+ +P  S +I +AMAC AR  VP +  AC      HG       V+DVGGG G T
Sbjct  157   VWSFAQDNPFLSDMINEAMACDARRVVPRVAGAC------HGLFDGVVTVIDVGGGTGET  210

Query  673   vEMLVKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDE  494
             + +LVK FP +KG NFDLPHV+ VA    GV +V G+MF  IP  DA+ + WVLHDWGD+
Sbjct  211   MGILVKEFPWIKGFNFDLPHVIEVAQVLDGVENVEGDMFDSIPACDAVIIKWVLHDWGDK  270

Query  493   ECVQILSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKD  314
             +C++IL  C+EA+P   GKV+I E+++ ++++ +                     + E+D
Sbjct  271   DCIKILKNCKEAVPPNNGKVLIVESVIGENKKTM--------------------IVDERD  310

Query  313   RNNNNNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQA  134
                  +    V LMLDMVMMAHT  G ERT K+W  VL  AGF  Y V D  DV S+I A
Sbjct  311   -----DKLEHVRLMLDMVMMAHTSTGKERTLKEWDFVLKEAGFARYEVRDIDDVQSLIIA  365



>ref|XP_008358438.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Malus 
domestica]
Length=355

 Score =   288 bits (736),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 174/405 (43%), Positives = 234/405 (58%), Gaps = 76/405 (19%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRG  1145
             +WKYVFGFTE+AVV+CAI+LGI + +E+    +TL +LS+ L C PS LYRIMR L++R 
Sbjct  21    MWKYVFGFTEIAVVRCAIDLGIAEAIENHGSPMTLLELSTALSCDPSHLYRIMRVLVHRK  80

Query  1144  IFKEVEMTLPTIsstssteaalasTRPTR----GYVQTPLSALLTRDGEKSMAAFVRLES  977
             IFKE                     +PT+    GY QTPLS  L +  E SM   + + S
Sbjct  81    IFKE---------------------KPTQSGSNGYAQTPLSRRLLKSAENSMVDLLLMGS  119

Query  976   SPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDA-FEAANGKDVWRYAESDPAHSKLIEDA  800
             +PVM+AP+L+LS +V             ++SDA F+  +G D+W Y   +P H K   D+
Sbjct  120   NPVMMAPYLRLSTQV-----------QRNTSDAVFDEVHGSDLWNYGAENPDHGKAFNDS  168

Query  799   MACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGV-KGINFD  623
             MAC AR+AVPA +++CP+             +VD GGG+GTT  +LV+A P + KGI FD
Sbjct  169   MACDARLAVPAALESCPEAF------KGIETIVDAGGGNGTTARLLVEACPWITKGIIFD  222

Query  622   LPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEET  443
             LPHVVS  P+   +  +GG+ F+ IPKADA+ +MW+LHDW DEEC+ IL  CREAIP + 
Sbjct  223   LPHVVSTIPECDRIEKIGGDFFKCIPKADAVVMMWILHDWTDEECISILKNCREAIPNDK  282

Query  442   GKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDM  263
             GKVII +A++ D+                           EKD N        V LMLD+
Sbjct  283   GKVIIIDAVVEDN---------------------------EKDYNKLT----RVKLMLDI  311

Query  262   VMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
              MM  T KG ERT K+W +V+  AGF  +T+T T  V S+IQ  P
Sbjct  312   AMMNGT-KGKERTAKEWEYVIREAGFSRHTITPTRTVQSVIQVFP  355



>ref|XP_010446970.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Camelina 
sativa]
Length=368

 Score =   288 bits (737),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 179/420 (43%), Positives = 243/420 (58%), Gaps = 64/420 (15%)
 Frame = -1

Query  1369  KSIRRQEVDYEEEDG--IWKYVFGFTEMAVVKCAIELGIPDFLESQEQA--VTLDQLSSG  1202
             + I+++ VD E +    IW+YVFGF ++A  KCAI+L IP+ +E+   +  VTL +LSS 
Sbjct  2     EDIKKKLVDEEAKASLDIWRYVFGFADIAAAKCAIDLKIPEAIENHPSSHPVTLAELSSA  61

Query  1201  LGCSPSALYRIMRFLINRGIFKEVEMT--LPTIsstssteaalasTRPTRGYVQTPLS--  1034
             +  SPS L RIMRFL+++G+FKEV +   L T                  GY  TPLS  
Sbjct  62    VSASPSHLRRIMRFLVHQGLFKEVPIKDGLAT------------------GYTNTPLSRC  103

Query  1033  ALLTRDGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKD  854
              ++T+   KS+A FV  E+ P MLAPWL+LS  V           +GS+   F+A +GKD
Sbjct  104   MMITKRDGKSLAPFVLFETRPEMLAPWLRLSSVV-------SSPVNGSTPPPFDAVHGKD  156

Query  853   VWRYAESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgtt  674
             VW +A+ +P  S LI +AMAC  R  VP +  AC      HG       VVDVGGG G T
Sbjct  157   VWSFAQDNPGLSDLINEAMACDTRRVVPRVAGAC------HGLLDGVDTVVDVGGGTGET  210

Query  673   vEMLVKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDE  494
             + +LVK FP +KG NFDLPHV+ VA    GV ++ G+MF  IP  DA+F+ WVLHDWGD+
Sbjct  211   LGILVKEFPWIKGYNFDLPHVIEVAQILDGVTNIEGDMFDSIPACDAVFIKWVLHDWGDK  270

Query  493   ECVQILSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKD  314
             +C++IL  C+EA+P   GKV+I E+++ ++++ +                     + E+D
Sbjct  271   DCIKILKNCKEAVPPIVGKVLIVESVIGENKKTM--------------------IVDERD  310

Query  313   RNNNNNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQA  134
                 +     V LMLDMVMMAHT  G ERT K+W  VLT AGF  Y V D  DV  +I A
Sbjct  311   EKLEH-----VRLMLDMVMMAHTSTGKERTLKEWDFVLTEAGFARYEVRDIDDVQCLIIA  365



>ref|XP_009113527.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Brassica 
rapa]
Length=367

 Score =   286 bits (731),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 178/406 (44%), Positives = 233/406 (57%), Gaps = 69/406 (17%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQ--EQAVTLDQLSSGLGCSPSALYRIMRFLIN  1151
             IW+Y+FGF ++A  KCAI+L IP+ LE+    Q +TL +LSS    SPS  +RIMRFL++
Sbjct  19    IWRYLFGFADIAAAKCAIDLKIPEALENNPSSQPMTLTELSSATSASPSHFHRIMRFLVH  78

Query  1150  RGIFKEVEMTLPTIsstssteaalasTRPTR-----GYVQTPLS--ALLTRDGEKSMAAF  992
             +G+FK+V                     PT+     GY  TPLS   ++T+   KS+A  
Sbjct  79    QGVFKKV---------------------PTKDGLATGYTNTPLSRRMMITKSDGKSLAPL  117

Query  991   VRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKL  812
             + LE+SP MLAPWLKLS  V    N        +S   F+A +GK++W +A+ +P HS+L
Sbjct  118   LLLETSPEMLAPWLKLSLVVSSPVN--------ASVPPFDAVHGKELWSFAKDNPRHSEL  169

Query  811   IEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGI  632
               +AMAC AR  VP I  AC      HG       VVDVGGG G T+ +LVK FP VKGI
Sbjct  170   FNEAMACDARRVVPRIAGAC------HGLFDGVATVVDVGGGTGETMGILVKEFPWVKGI  223

Query  631   NFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIP  452
             NFDLPHVV VA     V +VGG+MF  IP  DA+F+ WVLHDWGDEEC++IL  C+E +P
Sbjct  224   NFDLPHVVEVAQAMESVENVGGDMFDSIPACDAVFIKWVLHDWGDEECIKILKNCKEVLP  283

Query  451   EETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLM  272
              + GKV+I E+I+        G +   M +                ++ ++   Y V L 
Sbjct  284   PKIGKVLIVESIV--------GEKKNTMIM----------------KDKDDKLEY-VRLA  318

Query  271   LDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQA  134
             LDMVMM HT  G ERT K+W  V+  AGF  Y V D  DV S+I A
Sbjct  319   LDMVMMVHTSTGKERTLKEWDFVIKEAGFARYEVRDIDDVQSVIIA  364



>ref|XP_010103004.1| 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase [Morus 
notabilis]
 gb|EXB94571.1| 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase [Morus 
notabilis]
Length=370

 Score =   284 bits (727),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 177/399 (44%), Positives = 237/399 (59%), Gaps = 61/399 (15%)
 Frame = -1

Query  1318  KYVFGF-TEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRGI  1142
             KY FG   EMAVVKCAI+LG+ D + +  + +TL +LSS L C    L+R+MRFL+N GI
Sbjct  30    KYYFGGDVEMAVVKCAIDLGMADAIANHGRPMTLLELSSALDCDLQNLHRVMRFLVNHGI  89

Query  1141  FKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSPVML  962
             FKE+                   T PT  Y QT  S  L R GE SMAAF+ ++SSP   
Sbjct  90    FKEI-------------IIRNEDTVPTAYYAQTHSSRRLMRTGENSMAAFILMQSSPPAK  136

Query  961   APWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMACHAR  782
             A W  LS  V            G ++ AFE  +G+DVW++AE++PA S+LI +AMAC AR
Sbjct  137   AAWHCLSACV-----------KGKATSAFEVVHGEDVWKHAEANPAQSQLINEAMACLAR  185

Query  781   MAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGV-KGINFDLPHVVS  605
             + V AI+  C D+            +VDVGGG GT +  LVKA P + KGI FDLPHVVS
Sbjct  186   VIVSAIIDGCLDMF------EGVETLVDVGGGTGTIMRRLVKACPWISKGITFDLPHVVS  239

Query  604   VAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKVIIA  425
             +A +  G+ +VGG+MF+ IPKADA+ L+ VLHDWGD+EC++IL KCR+AIP++ GKVII 
Sbjct  240   LAEQCEGIEYVGGDMFEFIPKADAVLLVAVLHDWGDDECIRILKKCRKAIPKDKGKVIIV  299

Query  424   EAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMMAHT  245
             E ++ + +                         Q+K+ N  N+    VGL+LDM MMA T
Sbjct  300   EVVIGNKE-------------------------QQKEDNKLND----VGLVLDMAMMALT  330

Query  244   GKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
              KG ERT  +W++VL  AGF  +TV   + + S+I+A P
Sbjct  331   HKGKERTLDEWAYVLREAGFSRHTVRSIAAIQSVIEAFP  369



>gb|KHG11439.1| RS-norcoclaurine 6-O-methyltransferase [Gossypium arboreum]
Length=303

 Score =   280 bits (717),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 165/365 (45%), Positives = 210/365 (58%), Gaps = 64/365 (18%)
 Frame = -1

Query  1222  LDQLSSGLGCSPSALYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQT  1043
             L +L++ L   PS LYRIMRF+++  IFK+  +   T+                 G+  T
Sbjct  3     LSELATALRWEPSRLYRIMRFMVHYRIFKQEHINHHTV-----------------GFSST  45

Query  1042  PLSALLTRDGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAAN  863
             PLS LL + GEKSM AF+   SSP  LAPW  LS RVL   NN            FE AN
Sbjct  46    PLSRLLIKGGEKSMVAFILFVSSPTWLAPWHSLSARVLETGNN---------ISPFEVAN  96

Query  862   GKDVWRYAESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggd  683
             GKD+W YAE++P  S+L  +AM C AR+ V A ++ CP++            +VDVGGG+
Sbjct  97    GKDLWSYAEANPDFSELFNNAMGCDARLTVQATIEGCPEVF------DGVKSLVDVGGGN  150

Query  682   gttvEMLVKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDW  503
             GT + +LVKAFP ++GINFDLPHVV+VAPK   + +VGG+MF  IP ADA FLMWVLHDW
Sbjct  151   GTALSLLVKAFPWIRGINFDLPHVVAVAPKSDSIENVGGDMFMSIPNADAAFLMWVLHDW  210

Query  502   GDEECVQILSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQ  323
              DEEC++IL KCREAIPE+ GKVII EA+L + +E                         
Sbjct  211   DDEECIKILKKCREAIPEDKGKVIIVEAVLEEDKE-------------------------  245

Query  322   EKDRNNNNNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSI  143
                     +    VGLMLDMVMMA T KG ERT K+WS+VL  +GF  + V     V  +
Sbjct  246   -------GDELGAVGLMLDMVMMAITNKGKERTLKEWSYVLQQSGFTRFNVKPIRAVKFV  298

Query  142   IQARP  128
              +A P
Sbjct  299   SEAHP  303



>ref|XP_010530940.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Tarenaya 
hassleriana]
Length=353

 Score =   275 bits (704),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 170/404 (42%), Positives = 226/404 (56%), Gaps = 73/404 (18%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQ-EQAVTLDQLSSGLGCSPSALYRIMRFLINR  1148
             IW+Y  GF EMA VKCAIEL IP+ +E+Q  Q VTL  LSS +G  P  L RIMRFL ++
Sbjct  13    IWRYALGFAEMAAVKCAIELKIPEAVENQTSQPVTLADLSSAVGFPPPLLRRIMRFLAHQ  72

Query  1147  GIFKEVEMTLPTIsstssteaalasTRPTR----GYVQTPLS--ALLTRDGEKSMAAFVR  986
             GIFK V                     PT+    GY  TPLS   ++T   +KSMA  + 
Sbjct  73    GIFKAV---------------------PTKDGATGYTNTPLSRRMMITNRDDKSMAHMIL  111

Query  985   LESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIE  806
             L S+PV +A +LKLS  V+          SG     FEAA+GKD W YA  DP + +   
Sbjct  112   LSSNPVAVASYLKLSSAVV----------SGKGFQPFEAAHGKDAWAYAAEDPGYRETFN  161

Query  805   DAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINF  626
             +AMAC  R  VPA+   C D+            VVDVG G G  + M+VKAFP +K  NF
Sbjct  162   EAMACDTRRVVPAVTNTCADIF------DGVSTVVDVGCGTGEAMGMVVKAFPWIKAFNF  215

Query  625   DLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEE  446
             DLPHV++ A +  GV +V G+MF  IP+ADA+F+ W+LHDW DE+CV+IL + REA+P+E
Sbjct  216   DLPHVMAGASEFEGVENVAGDMFGLIPRADAVFIKWILHDWSDEDCVKILKRSREAVPKE  275

Query  445   TGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLD  266
              GKVII EA++                             Q+K+ ++++   Y   L+LD
Sbjct  276   KGKVIIVEAVVE----------------------------QKKEDDDDDKLEY-ARLLLD  306

Query  265   MVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQA  134
             +VMMA    G ER  ++W H+LT AGF  + V D +D+ S+I A
Sbjct  307   VVMMAQMKNGRERNMEEWDHLLTEAGFVRHEVRDINDLQSVIIA  350



>emb|CDY51573.1| BnaAnng10770D [Brassica napus]
Length=393

 Score =   275 bits (702),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 178/432 (41%), Positives = 235/432 (54%), Gaps = 95/432 (22%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQ--EQAVTLDQLSSGLGCSPSALYRIMRFLIN  1151
             IW+Y+FGF ++A  KCAI+L +P+ LE+    Q +TL +LSS    SPS L+RIMRFL++
Sbjct  19    IWRYLFGFADIAAAKCAIDLKVPEALENNPSSQPMTLTELSSATSASPSHLHRIMRFLVH  78

Query  1150  RGIFKEVEMTLPTIsstssteaalasTRPTR-----GYVQTPLS--ALLTRDGEKSMAAF  992
             +G+FKEV                     PT+     GY  TPLS   ++T+   KS+A  
Sbjct  79    QGVFKEV---------------------PTKDGLATGYTNTPLSRRMMITKSDGKSLAPL  117

Query  991   VRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKL  812
             + LE+SP MLAPWLKLS  V    N        +S   F+A +GK++W +A+ +P H++L
Sbjct  118   LLLETSPEMLAPWLKLSLVVSSPVN--------ASVPPFDAVHGKELWSFAKDNPRHNEL  169

Query  811   IEDAMACHARM--------------------------AVPAIVQACPDLLLLHgaagvec  710
               +AMAC AR+                           VP I  AC      HG      
Sbjct  170   FNEAMACDARLKSLPFLVINWRDRLSSNSRAIELLLRVVPRIAGAC------HGLFDGVA  223

Query  709   vvvdvgggdgttvEMLVKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAI  530
              VVDVGGG G T+ +LVK FP VKGINFDLPHVV VA     V +VGG+MF  IP  DA+
Sbjct  224   TVVDVGGGTGETMGILVKEFPWVKGINFDLPHVVEVAQAMESVENVGGDMFDSIPACDAV  283

Query  529   FLMWVLHDWGDEECVQILSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknnt  350
             F+ WVLHDWGDEEC++IL  C+E +P + GKV+I E+I+        G +   M +    
Sbjct  284   FIKWVLHDWGDEECIKILKNCKEVLPPKIGKVLIVESIV--------GEKKNTMIM----  331

Query  349   ntknnskLQEKDRNNNNNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTV  170
                         ++ ++   Y V L LDMVMM HT  G ERT K+W  V+  AGF  Y V
Sbjct  332   ------------KDKDDKLEY-VRLALDMVMMVHTSTGKERTLKEWDFVIKEAGFARYEV  378

Query  169   TDTSDVVSIIQA  134
              D  DV S+I A
Sbjct  379   RDIDDVQSVIIA  390



>ref|XP_010548126.1| PREDICTED: LOW QUALITY PROTEIN: (RS)-norcoclaurine 6-O-methyltransferase-like 
[Tarenaya hassleriana]
Length=351

 Score =   272 bits (696),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 172/420 (41%), Positives = 229/420 (55%), Gaps = 77/420 (18%)
 Frame = -1

Query  1378  MDAKSIRRQEVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQ-EQAVTLDQLSSG  1202
             M+   I +  V+ EEE  IW+Y FG  ++AVVKCAI+L IPD +E+   Q VTL  LS+ 
Sbjct  1     MEEGKIMQVRVEEEEEAKIWRYAFGLADVAVVKCAIDLKIPDAVENHTSQPVTLADLSAA  60

Query  1201  LGCSPSALYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTR----GYVQTPLS  1034
             + CSP+ L RIMRFL+++GIF+E                      PT+    GY  TPLS
Sbjct  61    VSCSPALLRRIMRFLVHQGIFRE---------------------EPTKDGGAGYTNTPLS  99

Query  1033  ALLTRDGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKD  854
                       MA  + L  SPVM+APWLKL+  V+ G+        G     FEAA+GKD
Sbjct  100   RRRPP---PPMALPILLACSPVMMAPWLKLTD-VVSGN--------GPRKQPFEAAHGKD  147

Query  853   VWRYAESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgtt  674
              W Y   DP  +++   A     RM VPA+V +C D+            VVDVGG DG  
Sbjct  148   AWAYTAEDPRFNEMFSQARVSDTRMVVPAVVGSCADVF------DGVSTVVDVGGRDGEA  201

Query  673   vEMLVKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDE  494
             + +LVKAFP +KG+NFDLPHVV  A K  GV +VGG+MF  IP ADA+F+ W+LH+W DE
Sbjct  202   IGILVKAFPWIKGVNFDLPHVVEAANKVEGVENVGGDMFDSIPHADAVFIKWILHNWNDE  261

Query  493   ECVQILSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKD  314
             +C++IL KC+EA+PEE GKVII EA++                             Q+KD
Sbjct  262   DCIKILRKCKEAMPEEKGKVIIVEAVV----------------------------GQKKD  293

Query  313   RNNNNNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQA  134
                  +      L+ DM MM    +G ERT  +W++VL  AGF  + + D + V S+I A
Sbjct  294   -----DKLEYARLLFDMTMMTQMYEGKERTLGEWAYVLREAGFARHEIRDINCVQSVIVA  348



>ref|XP_011091586.1| PREDICTED: 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase-like 
[Sesamum indicum]
Length=341

 Score =   271 bits (694),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 167/399 (42%), Positives = 218/399 (55%), Gaps = 68/399 (17%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRG  1145
             +WKY +GF  M VVKC IELG+PD LE+    +TL QLSS +GC  ++LYRI+RFL + G
Sbjct  11    VWKYAYGFDTMRVVKCVIELGLPDVLENHGSPMTLSQLSSAVGCPETSLYRILRFLTHNG  70

Query  1144  IFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSPVM  965
             IFK++  +                   +  Y QTPLS LLTRD   +M  FV L++ P  
Sbjct  71    IFKKLGNS--------------TEDPASVSYAQTPLSRLLTRD---NMGPFVLLQAGP--  111

Query  964   LAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMACHA  785
                     G+       + K   GS     EAA  +D+    E DPA  KL ++ +ACHA
Sbjct  112   -------PGKQFGMSAKDLKAGKGS---GLEAAPSEDIIWKGEVDPAFDKLFQEFLACHA  161

Query  784   RMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPHVVS  605
             R +  AI+  CP+ L           +VDVGG +GT V MLVKAFP +KGINFD P VV+
Sbjct  162   RASTKAIIDCCPEAL------QGIGCLVDVGGHEGTAVGMLVKAFPWMKGINFDRPEVVA  215

Query  604   VAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKVIIA  425
              AP   G+ HVGGNMF+ +PKADA+ LMW+LHDW D  C+ IL KC+EA+P ETGKVII 
Sbjct  216   EAPPIDGIEHVGGNMFESVPKADAVMLMWILHDWSDSMCIDILKKCKEAVPAETGKVIIV  275

Query  424   EAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMMAHT  245
             EA++   +E  + Y G                                 L LDM +MA T
Sbjct  276   EAVI--DEEGGDEYTGAH-------------------------------LALDMTIMAAT  302

Query  244   GKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
               G ERT K+W  +L AAGF  +T+     + S+I+A P
Sbjct  303   VNGKERTAKEWGQLLDAAGFSRHTIKHMKAIESVIEAYP  341



>ref|XP_011091582.1| PREDICTED: 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase-like 
[Sesamum indicum]
Length=341

 Score =   265 bits (677),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 161/399 (40%), Positives = 219/399 (55%), Gaps = 68/399 (17%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRG  1145
             +WKY +GF  M VVKC IELG+PD LE+    +TL QLSS +GC  ++LYRI+RFL + G
Sbjct  11    VWKYAYGFDTMRVVKCVIELGLPDVLENHGSPMTLSQLSSAVGCPETSLYRILRFLTHNG  70

Query  1144  IFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSPVM  965
             IFK++  +                   +  Y QTPLS LLTRD   +M  FV L++ P  
Sbjct  71    IFKKLGNS--------------TEDPASVSYAQTPLSRLLTRD---NMGPFVLLQAGP--  111

Query  964   LAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMACHA  785
                     G+       + K   GS     EAA  +D+    + D A+ KL ++ +ACHA
Sbjct  112   -------PGQQFGMSAKDLKAGKGS---GLEAAPSEDIIWMGDVDAAYDKLFQEFLACHA  161

Query  784   RMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPHVVS  605
             R +  AI+  CP+             +VDVGG +GT V MLVKAFP +KGINFD P VV+
Sbjct  162   RASTKAIIDYCPEAF------QGIGCLVDVGGHEGTAVGMLVKAFPWIKGINFDRPEVVA  215

Query  604   VAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKVIIA  425
              AP   G+ HVGGNMF+ +PKADA+ LMW+LHDW D  C+ IL KC+EA+P ETGKVII 
Sbjct  216   EAPPIDGIEHVGGNMFESVPKADAVMLMWILHDWSDSMCIDILKKCKEAVPPETGKVIIV  275

Query  424   EAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMMAHT  245
             EA++                              +++  + +  ++   L LDM +MA T
Sbjct  276   EAVI------------------------------DEEGGDEHTGAH---LALDMTIMAAT  302

Query  244   GKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
               G ERT K+W  +L AAGF  +T+     + S+I+A P
Sbjct  303   VNGKERTAKEWGQLLDAAGFSRHTIKHMKAIESVIEAYP  341



>emb|CDY17512.1| BnaC03g65510D [Brassica napus]
Length=355

 Score =   262 bits (669),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 171/403 (42%), Positives = 218/403 (54%), Gaps = 70/403 (17%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQ--EQAVTLDQLSSGLGCSPSALYRIMRFLIN  1151
             IW+Y  G  ++A  KCAI+L IP+ +E+    Q VTL +LSS +  SPS L RIMRFL++
Sbjct  19    IWRYALGIADIAAAKCAIDLKIPEAIETHPSSQPVTLAELSSTISASPSHLRRIMRFLVH  78

Query  1150  RGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLS--ALLTRDGEKSMAAFVRLES  977
              G+FKEV    PT                T GY  TPLS   L+T+   KSMA  +  E+
Sbjct  79    LGVFKEV----PTEDGL------------TTGYTNTPLSRRMLITKRDGKSMAPLILFET  122

Query  976   SPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAM  797
             +  MLAPWL LS  V    N       GS    F+A +GKDVW   + +P   ++I +AM
Sbjct  123   NHEMLAPWLSLSSVVSSPVN-------GSHPPPFDAVHGKDVWALTKDNPCFGEMINEAM  175

Query  796   ACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLP  617
             AC AR  VP +  AC DL            VVDVGGG G  + +LVK FP +KG NFDLP
Sbjct  176   ACDARRVVPRLAGACHDLF------DGVATVVDVGGGTGEAMGILVKEFPWIKGFNFDLP  229

Query  616   HVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGK  437
             HV+ VA    GV +VGG+MF  IPK DA+F+ WVLHDWGDE+C++IL  C+E+     GK
Sbjct  230   HVIEVAQVLDGVENVGGDMFDSIPKCDAVFIKWVLHDWGDEDCIKILKNCKES---NIGK  286

Query  436   VIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVM  257
             V I E+I+RD ++ +                                    V LMLD+ M
Sbjct  287   VFIVESIIRDKKKTM----------------------------------MYVRLMLDIAM  312

Query  256   MAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             MAHT  G ERT K+W  VL  AGF  Y V D  +V  +I A P
Sbjct  313   MAHTTTGKERTLKEWDFVLNEAGFARYEVRDIDNVHCVIIAYP  355



>gb|KDP20353.1| hypothetical protein JCGZ_06876 [Jatropha curcas]
Length=321

 Score =   256 bits (654),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 169/410 (41%), Positives = 218/410 (53%), Gaps = 92/410 (22%)
 Frame = -1

Query  1357  RQEVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSAL  1178
             ++E   + E  +WKYVFGF+ +AVVKCA ELGI + +E+ +  +TL  LSS +GC+PS+L
Sbjct  4     KEEAAAQTEIEMWKYVFGFSNIAVVKCAFELGIANAIENHQGPITLTDLSSTIGCNPSSL  63

Query  1177  YRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMA  998
             YRIMRFL++  IF E                   +   T+GY+QTPLS  L   GE +MA
Sbjct  64    YRIMRFLVHHNIFNE-----------------QLTADGTKGYIQTPLSRRLLGPGENNMA  106

Query  997   AFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHS  818
             AFV LESSPVMLAPW  LS  V L           +    FEAA G   W+Y  ++P HS
Sbjct  107   AFVLLESSPVMLAPWHFLSSHVRL-----------NGPTPFEAAYGDHQWKYTAANPGHS  155

Query  817   KLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVK  638
              L  D MAC+AR  V  +V+ C ++            +VDVGGG+GT +  LVK  P ++
Sbjct  156   NLFNDGMACNARNMVSNMVEKCIEVF------DGVKTLVDVGGGNGTALRTLVKLCPWIQ  209

Query  637   GINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREA  458
             GINFDLPHVV VA +  GV HVGG+MFQ IP ADA FLM                     
Sbjct  210   GINFDLPHVVDVAEECVGVKHVGGDMFQCIPNADAAFLM---------------------  248

Query  457   IPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVG  278
                E GKVII EA++                                D  N++   + V 
Sbjct  249   ---ENGKVIIVEAVI--------------------------------DEANDDKLEF-VR  272

Query  277   LMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             L LDMVMMAHT  G ERT K+W +VL  AGF  +T+   + + S+I+A P
Sbjct  273   LALDMVMMAHT-TGKERTSKEWEYVLKEAGFSRHTIKSIATLQSVIEAFP  321



>ref|XP_004144926.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Cucumis 
sativus]
 ref|XP_004153975.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Cucumis 
sativus]
 ref|XP_004166914.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Cucumis 
sativus]
 gb|KGN43288.1| hypothetical protein Csa_7G017710 [Cucumis sativus]
Length=364

 Score =   256 bits (654),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 173/425 (41%), Positives = 240/425 (56%), Gaps = 76/425 (18%)
 Frame = -1

Query  1381  SMDAKSIRRQEVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQ-AVTLDQLSS  1205
             ++  +SI ++E + E +  I+KYVFGF E AV+KCAIEL I + +ES  +  +TL QLS+
Sbjct  4     TITKESIWKKE-EEEAKIQIYKYVFGFAEAAVIKCAIELKIANVIESHGRPTMTLSQLST  62

Query  1204  GLGCSPSALYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALL  1025
              L CSP  L+RIMRFL +RGIFKE E+T   +                  Y QTPLS +L
Sbjct  63    VLICSPPLLFRIMRFLTHRGIFKE-EITPENLI----------------AYSQTPLSHML  105

Query  1024  TRDGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSD---AFEAANGKD  854
                   ++A  + LE+SP ++A W  LS R+    NNN        SD    FE A+GKD
Sbjct  106   I-----NVAPLLLLENSPEIVASWQNLSARLQNSYNNN------DDSDLLVPFEVAHGKD  154

Query  853   VWRYAESDPAHSKLIEDAMACHAR-MAVPAIVQACPDLLLLHgaagvecvvvdvgggdgt  677
             +W Y   +P  +++  + +AC+AR + +PAI++ C D+            +VDVGGG+GT
Sbjct  155   IWSYGARNPGFNRMFNEGLACNARVITLPAILENCGDIF------NGVESLVDVGGGNGT  208

Query  676   tvEMLVKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGD  497
             T+ +LVKAFP +KGINFDLP+VV  + K  GV HVGGNM   +PKADA F MW+LH W D
Sbjct  209   TLSVLVKAFPWMKGINFDLPNVVLTSEKYDGVEHVGGNMLDFVPKADAAFFMWILHAWDD  268

Query  496   EECVQILSKCREAIPEET--GKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQ  323
             E+C++IL  C+EAI E    GKVII ++++                              
Sbjct  269   EDCIKILKNCKEAIGENKAGGKVIIIDSVI------------------------------  298

Query  322   EKDRNNNNNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVL-TAAGFKSYTVTDTSDVV-  149
               D N  N  + ++ L LD++MM  + KG ERT  +W+ +L   AGF   T+T     V 
Sbjct  299   --DENEENKMATDIRLTLDIMMMTRSRKGRERTADEWTQLLINKAGFSRCTITPIPAAVP  356

Query  148   SIIQA  134
             SIIQA
Sbjct  357   SIIQA  361



>emb|CDX76316.1| BnaA08g10840D [Brassica napus]
Length=330

 Score =   253 bits (645),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 164/415 (40%), Positives = 218/415 (53%), Gaps = 98/415 (24%)
 Frame = -1

Query  1360  RRQEVDYEEEDG--IWKYVFGFTEMAVVKCAIELGIPDFLESQ--EQAVTLDQLSSGLGC  1193
             +R  VD E +    IW+YVFGF ++A  KCAI+L IP+ +E+    Q +TL +LSS +  
Sbjct  5     KRNLVDEEAKASLDIWRYVFGFADIAAAKCAIDLKIPEAIENHPSSQPMTLAELSSTVSA  64

Query  1192  SPSALYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLS--ALLTR  1019
             SPS L RIMRFL+++GIFKEV +                    T GY  TPLS   ++T+
Sbjct  65    SPSHLRRIMRFLVHQGIFKEVPIK----------------DGLTTGYTNTPLSRRMMITK  108

Query  1018  DGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYA  839
                KS+A F                                             DVW  A
Sbjct  109   RDGKSLAPF---------------------------------------------DVWALA  123

Query  838   ESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLV  659
             E +P  S++I +AMAC  R  VP + +AC DL            VVDVGGG+G  V +LV
Sbjct  124   EDNPCFSEMINEAMACDTRRVVPRVARACHDLF------NGVATVVDVGGGNGEAVGILV  177

Query  658   KAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQI  479
             K FP +KG NFDLPHV+ VA    GV +VGG+MF  IPK DA+F+ WVLHDWGD++C++I
Sbjct  178   KEFPWIKGFNFDLPHVIDVAQVLDGVENVGGDMFDSIPKCDAVFIKWVLHDWGDKDCIKI  237

Query  478   LSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNN  299
             L  C+EA+P   GKV I E+++R++++ +                     ++E+D    +
Sbjct  238   LKNCKEAVPANIGKVFIVESVIRENKKTM--------------------IVEERDEKLEH  277

Query  298   NNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQA  134
                  V LMLDMVMMAHT  G ERT K+W  VL  AGF  Y V D  DV  +I A
Sbjct  278   -----VRLMLDMVMMAHTSTGKERTLKEWDFVLNEAGFARYEVRDIDDVQCVIIA  327



>emb|CDY17514.1| BnaC03g65490D [Brassica napus]
Length=349

 Score =   252 bits (644),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 163/415 (39%), Positives = 219/415 (53%), Gaps = 98/415 (24%)
 Frame = -1

Query  1360  RRQEVDYEEEDG--IWKYVFGFTEMAVVKCAIELGIPDFLESQ--EQAVTLDQLSSGLGC  1193
             +R  VD E +    IW+YVFGF ++A  KCAI+L IP+ +E+    Q +TL +LSS +  
Sbjct  5     KRNLVDEEAKASVDIWRYVFGFADIAAAKCAIDLKIPEAIENHPSSQPMTLAELSSTVSA  64

Query  1192  SPSALYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLS--ALLTR  1019
             SPS L RIMRFL+++GIFKEV +                    T GY  TPLS   ++T+
Sbjct  65    SPSHLRRIMRFLVHQGIFKEVPIK----------------DGLTTGYTNTPLSRRMMITK  108

Query  1018  DGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYA  839
                KS+A F                                             D+W  A
Sbjct  109   RDGKSLAPF---------------------------------------------DLWALA  123

Query  838   ESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLV  659
             E +P  S++I +AMAC  R  VP + +AC DL            VVDVGGG+G  V +LV
Sbjct  124   EDNPCFSEMINEAMACDTRRVVPRVARACDDLF------DGVATVVDVGGGNGEAVGILV  177

Query  658   KAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQI  479
             K FP +KG NFDLPHV+ VA    GV +VGG+MF  IPK DA+F+ WVLHDWGD++C++I
Sbjct  178   KEFPWIKGFNFDLPHVIEVAQVLDGVENVGGDMFDSIPKCDAVFIKWVLHDWGDKDCIKI  237

Query  478   LSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNN  299
             L  C+EA+P   GKV+I E+++R++++ +                     ++E+D    +
Sbjct  238   LKNCKEAVPANIGKVVIVESVIRENKKTM--------------------IVEERDEKLEH  277

Query  298   NNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQA  134
                  V LMLDMVMMAHT  G ERT K+W  VL  AGF  Y V D  DV  +I A
Sbjct  278   -----VRLMLDMVMMAHTSTGKERTLKEWDFVLNEAGFARYEVRDIDDVQCVIIA  327



>emb|CDY09084.1| BnaC08g10380D [Brassica napus]
Length=340

 Score =   252 bits (643),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 161/401 (40%), Positives = 216/401 (54%), Gaps = 86/401 (21%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQ--EQAVTLDQLSSGLGCSPSALYRIMRFLIN  1151
             IW+Y+FGF +MA  KCAI+L +P+ LE+    + +TL +LSS    SPS L+RIMRFL+ 
Sbjct  19    IWRYLFGFADMAAAKCAIDLKVPEALENHPSSRPMTLAELSSATSASPSHLHRIMRFLVY  78

Query  1150  RGIFKEVEMT--LPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLES  977
             +G+FKEV     L T                  GY  TPLS  +            +L S
Sbjct  79    QGVFKEVSTKDGLAT------------------GYTNTPLSRRMM---------ITKLVS  111

Query  976   SPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAM  797
             SPV        +G V                  F+A +GKD+W +A+  P HS+L+ +AM
Sbjct  112   SPV--------NGPV----------------PPFDAVHGKDLWSFAKDHPRHSELLNEAM  147

Query  796   ACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLP  617
             AC AR  VP +  AC  L            VVDVGGG G T+ +LVK FPG+KGINFDLP
Sbjct  148   ACDARRVVPRVAGACQGLF------DGVATVVDVGGGTGETIGILVKEFPGIKGINFDLP  201

Query  616   HVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGK  437
             HVV V      V +VGG+MF  IP  DA+F+ WVLHDWGD++C++IL  C++A+P +TGK
Sbjct  202   HVVEVVQAMDNVDNVGGDMFDSIPSCDAVFIKWVLHDWGDKDCIKILKNCKKALPPKTGK  261

Query  436   VIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVM  257
             V+I E+++ + ++ +                     ++E+D          V L LDMVM
Sbjct  262   VLIVESVVGEKKKTM--------------------IMEERDEKLEY-----VKLALDMVM  296

Query  256   MAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQA  134
             M HT  G ERT K+W  V+  AGF  Y V D  DV S+I A
Sbjct  297   MVHTSTGKERTLKEWDFVIKEAGFARYEVRDIDDVQSVIIA  337



>ref|XP_008365879.1| PREDICTED: LOW QUALITY PROTEIN: (RS)-norcoclaurine 6-O-methyltransferase-like 
[Malus domestica]
Length=349

 Score =   248 bits (632),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 147/386 (38%), Positives = 218/386 (56%), Gaps = 71/386 (18%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRG  1145
             +WK    F E+AVVKC IELG  + ++S    +   +LSS L C PS LYR+MR L++R 
Sbjct  21    VWKX---FVEIAVVKCGIELGXAEAIDSHGSPMKFLELSSALSCDPSHLYRLMRALVHRK  77

Query  1144  IFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSPVM  965
             IF+++  T                 + + GY QTPLS  L + GE SMAA + + S+PVM
Sbjct  78    IFRDINTT----------------QKGSSGYAQTPLSRRLLKSGENSMAALILMGSNPVM  121

Query  964   LAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMACHA  785
             +AP L LS R+             +S+ AF+    +D+W +  ++P  SKL  DAM C A
Sbjct  122   MAPLLGLSARIQ----------GNTSNPAFQEVX-EDLWSFGATNPDXSKLFNDAMTCGA  170

Query  784   RMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPHVVS  605
             ++ VPA +++C  L  +          VD G G+G  + +LV+A P ++GINFDL HVVS
Sbjct  171   KVVVPAEIKSCKGLETI----------VDGGRGNGILLRLLVEALPLIRGINFDLSHVVS  220

Query  604   VAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKVIIA  425
             V+P+   + +V G+MF  +PKAD +    VLHDWGD++C++IL+KCREAIP++TGKVII 
Sbjct  221   VSPECDRIENVAGDMFDCVPKADTVITKGVLHDWGDDDCIRILNKCREAIPKDTGKVIII  280

Query  424   EAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMMAHT  245
             +A++ +                           +++D+   N     V LMLD VM+  T
Sbjct  281   DAVIDED--------------------------EKEDKKLAN-----VKLMLDAVMIVDT  309

Query  244   GKGLERTEKQWSHVLTAAGFKSYTVT  167
              KG ER+ ++W ++L  A F  +T+T
Sbjct  310   NKGKERSLEEWEYILGEAHFTGHTIT  335



>emb|CDX72521.1| BnaC07g45430D [Brassica napus]
Length=327

 Score =   244 bits (624),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 156/403 (39%), Positives = 209/403 (52%), Gaps = 102/403 (25%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQ-EQAVTLDQLSSGLGCSPSALYRIMRFLINR  1148
             IW+YVFGF +MA  KCAI+L IP+ +E+   Q VTL ++S  +  SPS L+RIMRFL+++
Sbjct  19    IWRYVFGFADMAAAKCAIDLKIPEAIENHPSQPVTLAEISGAVSASPSHLHRIMRFLVHQ  78

Query  1147  GIFKEVEMTLPTIsstssteaalasTRPTR-----GYVQTPLSALLTRDGEKSMAAFVRL  983
             G+FKEV                     PT+     GY  TPLS        + M    R 
Sbjct  79    GVFKEV---------------------PTKDGLATGYTNTPLS--------RRMMITKR-  108

Query  982   ESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIED  803
                                 D N H               G+D+W  A+ +P  + +I +
Sbjct  109   --------------------DGNVH---------------GQDLWALADDNPCFNDVINE  133

Query  802   AMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFD  623
             AMACH R+ VP +  AC DL            VVDVGG  G T+ +LVK FP +KG NFD
Sbjct  134   AMACHTRLVVPRVAAACHDLF------EGVPTVVDVGGSTGETLAILVKEFPWIKGFNFD  187

Query  622   LPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEET  443
             L HV+ VA    GV +VGG+MF  +PK DA+F+ WVLHDWGD++C++IL  C+EA+P   
Sbjct  188   LHHVIEVAQVLDGVENVGGDMFDSVPKCDAVFVKWVLHDWGDKDCIRILKNCKEAVPPNI  247

Query  442   GKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDM  263
             GKV+I E+I+RD ++ +                     ++++D         +V LMLDM
Sbjct  248   GKVLIVESIIRDQKKTM--------------------IVEDRDE-----KLQQVRLMLDM  282

Query  262   VMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQA  134
              MMAHT  G ERT K+W  VL  AGF  Y V D  DV  +I A
Sbjct  283   GMMAHTSTGKERTLKEWDFVLNEAGFARYEVRDIDDVQCVIIA  325



>gb|KHG16452.1| 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase [Gossypium 
arboreum]
Length=325

 Score =   239 bits (609),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 156/399 (39%), Positives = 207/399 (52%), Gaps = 92/399 (23%)
 Frame = -1

Query  1333  EDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLI  1154
             E  IW YVFG+ ++A VKCAIELGI D +E+    + L +L++ L C PS L+RIMR ++
Sbjct  12    EIKIWNYVFGYAKIAAVKCAIELGIADVIENYGSPMPLSELATALRCDPSRLHRIMRLMV  71

Query  1153  NRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESS  974
             +  IFK+  +   T+                 G+  TPLS  L + GEKSMAAF+ L S 
Sbjct  72    HDQIFKQEPINQHTV-----------------GFSSTPLSRCLIKGGEKSMAAFILLMSG  114

Query  973   PVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMA  794
             P  LAPW  LS RVL   NN            FE ANGKD+W YAE++P  S+L  +AM 
Sbjct  115   PTCLAPWHSLSARVLETGNN---------ISPFEVANGKDIWSYAEANPDFSELFNNAMG  165

Query  793   CHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPH  614
             C AR+ V A ++ CP++            +VDVGGG+GT + + VKAFP ++GINFDLPH
Sbjct  166   CKARLTVQATIEGCPEVF------DGVESLVDVGGGNGTALSLFVKAFPWIRGINFDLPH  219

Query  613   VVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKV  434
             VV+VA K  G+ +VGG+MF  IPKADA FLM                            V
Sbjct  220   VVAVAEKSDGIENVGGDMFMFIPKADAAFLM----------------------------V  251

Query  433   IIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMM  254
             II EA+L + +E      G  + +                            LMLD  MM
Sbjct  252   IIVEAVLEEDKE------GDELGVAR--------------------------LMLDTAMM  279

Query  253   AHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQ  137
               T KG ERT K+WS+VL  +GF  + V     V ++I+
Sbjct  280   VITNKGRERTLKEWSYVLRQSGFTRFNVKPIRAVETVIE  318



>gb|AGN70864.1| O-methyltransferase OMT2 [Vitis vinifera]
 gb|AGN70865.1| O-methyltransferase OMT2 [Vitis vinifera]
Length=367

 Score =   240 bits (612),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 157/412 (38%), Positives = 215/412 (52%), Gaps = 70/412 (17%)
 Frame = -1

Query  1351  EVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPS----  1184
             E+  + +  IW+++F F +   +KCA+EL I D + S  + +TL Q+++ +  SPS    
Sbjct  21    ELMLQGQANIWRHMFAFADSMALKCAVELRIADIIHSHARPITLSQIATCID-SPSPDIT  79

Query  1183  ALYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKS  1004
              L RIMRFL+   IF     T P  S    T            Y  TP S  L  D E S
Sbjct  80    CLARIMRFLVRAKIFTA---TPPPQSDGGETL-----------YGLTPSSKWLLHDAELS  125

Query  1003  MAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPA  824
             +A  V +E+ P ++APW            +    C      AFE A+G  +W  A   P 
Sbjct  126   LAPMVLMENHPSLMAPW------------HCFGTCVKEGGIAFEKAHGHQIWDLASEKPE  173

Query  823   HSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPG  644
              +KL  D MAC A++++ A++ A  D        G    +VDVGGG G  V  +VKA+P 
Sbjct  174   FNKLFNDGMACTAKISIKAVIAAYKDGF------GSIGTLVDVGGGTGGAVAEVVKAYPH  227

Query  643   VKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCR  464
             +KGINFDLPHVV+ AP   GV HVGG+MF+ IP ADAIF+ W+LHDW DE+CV+IL  CR
Sbjct  228   IKGINFDLPHVVATAPAYKGVSHVGGDMFESIPNADAIFMKWILHDWNDEDCVKILKNCR  287

Query  463   EAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYE  284
             +AIPE+TGKVII + ++R+     +GY+                               E
Sbjct  288   KAIPEKTGKVIIVDGVIRE-----DGYEPFD----------------------------E  314

Query  283   VGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
               L+LD+VMMAHT  G ERTE +W  +L   GF  Y +     +  II+A P
Sbjct  315   TRLVLDLVMMAHTSHGQERTEVEWKKLLEEGGFPRYRILKIPTLQMIIEAYP  366



>gb|AGN70870.1| O-methyltransferase OMT2 [Vitis vinifera]
Length=367

 Score =   238 bits (608),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 155/412 (38%), Positives = 213/412 (52%), Gaps = 70/412 (17%)
 Frame = -1

Query  1351  EVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPS----  1184
             E+  + +  IW+++F F +   +KCA+EL I D + S  + +TL Q+++ +  SPS    
Sbjct  21    ELMLQGQANIWRHMFAFADSMALKCAVELRIADIIHSHARPITLSQIATCID-SPSPDIT  79

Query  1183  ALYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKS  1004
              L RIMRFL+   IF       P   S                Y  TP S  L  D E S
Sbjct  80    CLARIMRFLVRAKIFTAA----PPPQSDGGETL----------YGLTPSSKWLLHDAELS  125

Query  1003  MAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPA  824
             +A  V +E+ P ++APW            +    C      AFE A+G  +W  A   P 
Sbjct  126   LAPMVLMENHPSLMAPW------------HCFGTCVKEGGIAFEKAHGHQIWDLASEKPE  173

Query  823   HSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPG  644
              +KL  D MAC A++++ A++ A  D        G    +VDVGGG G  V  +VKA+P 
Sbjct  174   FNKLFNDGMACTAKISIKAVIAAYKDGF------GSIGTLVDVGGGTGGAVAEVVKAYPH  227

Query  643   VKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCR  464
             +KGINFDLPHVV+ AP   GV HVGG+MF+ IP ADAIF+ W+LHDW DE+CV+IL  CR
Sbjct  228   IKGINFDLPHVVATAPAYKGVSHVGGDMFESIPNADAIFMKWILHDWNDEDCVKILKNCR  287

Query  463   EAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYE  284
             +AIPE+TGKVII + ++R+     +GY+                               E
Sbjct  288   KAIPEKTGKVIIVDGVIRE-----DGYEPFD----------------------------E  314

Query  283   VGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
               L+LD+VMMAHT  G ERTE +W  +L   GF  Y +     +  II+A P
Sbjct  315   TRLVLDLVMMAHTSHGQERTEVEWKKLLEEGGFPRYRILKIPTLQMIIEAYP  366



>gb|AGN70869.1| O-methyltransferase OMT2 [Vitis vinifera]
Length=367

 Score =   238 bits (607),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 156/412 (38%), Positives = 215/412 (52%), Gaps = 70/412 (17%)
 Frame = -1

Query  1351  EVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPS----  1184
             E+  + +  IW+++F F +   +KCA+EL I D + S  + +TL Q+++ +  SPS    
Sbjct  21    ELMLQGQANIWRHMFAFADSMALKCAVELRIADIIHSHARPITLSQIATCID-SPSPDIT  79

Query  1183  ALYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKS  1004
              L RIMRFL+   IF     T P  S    T            Y  TP S  L  D E S
Sbjct  80    CLARIMRFLVRAKIFTA---TPPPQSDGGETL-----------YGLTPSSKWLLHDAELS  125

Query  1003  MAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPA  824
             +A  V +E+ P ++APW            +    C      AFE A+G  +W  A   P 
Sbjct  126   LAPMVLMENHPSLMAPW------------HCFGTCVKEGGIAFEKAHGHQIWDLASEKPE  173

Query  823   HSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPG  644
              +KL  D MAC A++++ A++ A  D        G    +VDVGGG G  V  +VKA+P 
Sbjct  174   FNKLFNDGMACTAKISIKAVIAAYKDGF------GSIGTLVDVGGGTGGAVAEVVKAYPH  227

Query  643   VKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCR  464
             +KGINFDLPHVV+ AP   GV HVGG+MF+ IP ADAIF+ W+LHDW DE+CV+IL  CR
Sbjct  228   IKGINFDLPHVVATAPAYKGVSHVGGDMFESIPDADAIFMKWILHDWNDEDCVKILKNCR  287

Query  463   EAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYE  284
             +AIPE+TGKVII + ++R+     +GY+                               E
Sbjct  288   KAIPEKTGKVIIVDGVIRE-----DGYEPFD----------------------------E  314

Query  283   VGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
               L+LD+VMMAH+  G ERTE +W  +L   GF  Y +     +  II+A P
Sbjct  315   TRLVLDLVMMAHSSHGQERTEVEWKKLLEEGGFPRYRILKIPTLQMIIEAYP  366



>ref|XP_002277476.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase [Vitis vinifera]
Length=367

 Score =   238 bits (607),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 155/412 (38%), Positives = 213/412 (52%), Gaps = 70/412 (17%)
 Frame = -1

Query  1351  EVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPS----  1184
             E+  + +  IW+++F F +   +KCA+EL I D + S  + +TL Q+++ +  SPS    
Sbjct  21    ELMLQGQANIWRHMFAFADSMALKCAVELRIADIIHSHARPITLSQIATCID-SPSPDIT  79

Query  1183  ALYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKS  1004
              L RIMRFL+   IF       P   S                Y  TP S  L  D E S
Sbjct  80    CLARIMRFLVRAKIFTAA----PPPQSDGGETL----------YGLTPSSKWLLHDAELS  125

Query  1003  MAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPA  824
             +A  V +E+ P ++APW            +    C      AFE A+G  +W  A   P 
Sbjct  126   LAPMVLMENHPSLMAPW------------HCFGTCVKEGGIAFEKAHGHQIWDLASEKPE  173

Query  823   HSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPG  644
              +KL  D MAC A++++ A++ A  D        G    +VDVGGG G  V  +VKA+P 
Sbjct  174   FNKLFNDGMACTAKISIKAVIAAYKDGF------GSIGTLVDVGGGTGGAVAEVVKAYPH  227

Query  643   VKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCR  464
             +KGINFDLPHVV+ AP   GV HVGG+MF+ IP ADAIF+ W+LHDW DE+CV+IL  CR
Sbjct  228   IKGINFDLPHVVATAPAYEGVSHVGGDMFESIPDADAIFMKWILHDWNDEDCVKILKNCR  287

Query  463   EAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYE  284
             +AIPE+TGKVII + ++R+     +GY+                               E
Sbjct  288   KAIPEKTGKVIIVDGVIRE-----DGYEPFD----------------------------E  314

Query  283   VGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
               L+LD+VMMAHT  G ERTE +W  +L   GF  Y +     +  II+A P
Sbjct  315   TRLVLDLVMMAHTSHGQERTEVEWKKLLEEGGFPRYRILKIPTLQMIIEAYP  366



>ref|XP_002529797.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF32579.1| o-methyltransferase, putative [Ricinus communis]
Length=259

 Score =   234 bits (598),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 139/268 (52%), Positives = 180/268 (67%), Gaps = 34/268 (13%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRG  1145
             IWKYV GF+++A VKCA+ELG+ D +ES E  +TL +LSS LGC+PS+LYRIMRF +++ 
Sbjct  25    IWKYVLGFSKIAAVKCAVELGLADAIESNEAPMTLFELSSTLGCAPSSLYRIMRFPVHQK  84

Query  1144  IFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSPVM  965
             IFKE     PT             ++ T GY QTPLS  L R GE SMA F+ +ESSP M
Sbjct  85    IFKE----KPT-------------SQGTTGYEQTPLSRRLLRQGENSMADFILMESSPDM  127

Query  964   LAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMACHA  785
             LAPW  LS RV            G+   AFE ++G+ +W++ E++PAHSKL  DAMAC A
Sbjct  128   LAPWQCLSNRV-----------RGNIHSAFEESHGQHLWKHTEANPAHSKLFNDAMACDA  176

Query  784   RMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPHVVS  605
             R+ VP+I++ CP++            VVDVGGG+GTT+ +LVKA P ++GINFDLPHVVS
Sbjct  177   RIIVPSIIEVCPEVF------NGVKSVVDVGGGNGTTLGLLVKASPWIQGINFDLPHVVS  230

Query  604   VAPKRPGVHHVGGNMFQRIPKADAIFLM  521
             VA +  GV HVGG+MF  +P+ADA FLM
Sbjct  231   VALECDGVKHVGGDMFDSVPQADAAFLM  258



>gb|KFK41372.1| hypothetical protein AALP_AA2G121800 [Arabis alpina]
Length=296

 Score =   236 bits (601),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 150/353 (42%), Positives = 197/353 (56%), Gaps = 68/353 (19%)
 Frame = -1

Query  1168  MRFLINRGIFKEVEMTLPTIsstssteaalasTRPTR-----GYVQTPLSALL---TRDG  1013
             MRFL+++GIFKEV                     PT+     GY  TPLS L+    RDG
Sbjct  1     MRFLVHQGIFKEV---------------------PTKDGLATGYTNTPLSRLMMITKRDG  39

Query  1012  EKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAES  833
              KSMA F+  E+SP MLAPWL+LS  V    N       GS+   FEA +GKDVW  ++ 
Sbjct  40    -KSMAPFILFETSPEMLAPWLRLSSVVASPVN-------GSNPPPFEAVHGKDVWSLSQD  91

Query  832   DPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKA  653
             +P  S+L+  AMAC +R  VP +  AC  L            VVDVGGG G  + +LVK 
Sbjct  92    NPCLSELLNKAMACESRRVVPRVAGACQGLF------DDVATVVDVGGGTGEAMGILVKE  145

Query  652   FPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILS  473
             FP +K  NFDLPHVV VA    GV +V G+MF  IPK DA+F+ +VLH+WGD++C+++L 
Sbjct  146   FPWIKSYNFDLPHVVEVAQVLDGVENVKGDMFDSIPKCDAVFIRFVLHNWGDKDCIKVLK  205

Query  472   KCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNN  293
              C+EA+P   GKV+I ++++RD ++ +                     ++E+D N  +  
Sbjct  206   NCKEAVPPNIGKVLIVDSVIRDKRKTM--------------------IVEERDENLEH--  243

Query  292   SYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQA  134
                V LMLDMVMMAHT  G ERT K+W  VL  AGF  Y V D  DV  +I A
Sbjct  244   ---VRLMLDMVMMAHTRTGKERTLKEWDFVLNEAGFARYEVKDIDDVQCVIVA  293



>gb|KCW64163.1| hypothetical protein EUGRSUZ_G01808 [Eucalyptus grandis]
Length=277

 Score =   235 bits (599),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 141/281 (50%), Positives = 183/281 (65%), Gaps = 38/281 (14%)
 Frame = -1

Query  1354  QEVDYEEEDG--IWKYVFGFTEMAVVKCAIELGIPDFLESQ-EQAVTLDQLSSGLGCSPS  1184
              E D E + G  IWKY+ GFTEMAVVKCAI+LGI D +ES  + +++L QLSS LGC PS
Sbjct  19    DEDDEEAKAGVDIWKYILGFTEMAVVKCAIDLGIADAIESHPDPSISLSQLSSKLGCCPS  78

Query  1183  ALYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKS  1004
             +L RI+RFL++R IF+ +                      T  Y QTPLS LL   GEKS
Sbjct  79    SLRRILRFLVHRKIFRHLA--------------------DTNTYSQTPLSRLLLARGEKS  118

Query  1003  MAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPA  824
             MAA + LE++PVMLAPWLKLS  V           + ++   F  A+G D+W Y+E++P 
Sbjct  119   MAALILLETTPVMLAPWLKLSSHV--------SATAATAPPPFMVAHGDDIWVYSEANPG  170

Query  823   HSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPG  644
             HS+LI++AMAC AR+AVPA+ + CP++            +VDVGGG+GTT+ +L KAFP 
Sbjct  171   HSRLIDEAMACDARVAVPALAEDCPEVF------EGVLTMVDVGGGNGTTLRLLRKAFPW  224

Query  643   VKGINFDLPHVVSVA-PKRPGVHHVGGNMFQRIPKADAIFL  524
             ++GINFDLPHVVSVA P   GV H GG+MF+ +PKADA FL
Sbjct  225   IRGINFDLPHVVSVALPPCEGVEHAGGDMFEGVPKADAAFL  265



>gb|ADJ66851.1| O-methyltransferase [Vitis vinifera]
 gb|AGN70866.1| O-methyltransferase OMT2 [Vitis vinifera]
 gb|AGN70867.1| O-methyltransferase OMT2 [Vitis vinifera]
 gb|AGN70868.1| O-methyltransferase OMT2 [Vitis vinifera]
Length=367

 Score =   237 bits (604),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 154/412 (37%), Positives = 213/412 (52%), Gaps = 70/412 (17%)
 Frame = -1

Query  1351  EVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPS----  1184
             E+  + +  IW+++F F +   +KCA+EL I D + S  + +TL Q+++ +  SPS    
Sbjct  21    ELMLQGQANIWRHMFAFADSMALKCAVELRIADIIHSHARPITLSQIATCID-SPSPDIT  79

Query  1183  ALYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKS  1004
              L RIMRFL+   IF       P   S                Y  TP S  L  D E S
Sbjct  80    CLARIMRFLVRAKIFTAA----PPPQSDGGETL----------YGLTPSSKWLLHDAELS  125

Query  1003  MAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPA  824
             +A  V +E+ P ++APW            +    C      AFE A+G  +W  A   P 
Sbjct  126   LAPMVLMENHPSLMAPW------------HCFGTCVKEGGIAFEKAHGHQIWDLASEKPE  173

Query  823   HSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPG  644
              +KL  D MAC A++++ A++ A  D        G    +VDVGGG G  V  +VKA+P 
Sbjct  174   FNKLFNDGMACTAKISIKAVIAAYKDGF------GSIGTLVDVGGGTGGAVAEVVKAYPH  227

Query  643   VKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCR  464
             +KGINFDLPHVV+ AP   GV HVGG+MF+ IP ADAIF+ W+LHDW DE+CV+IL  CR
Sbjct  228   IKGINFDLPHVVATAPAYKGVSHVGGDMFESIPDADAIFMKWILHDWNDEDCVKILKNCR  287

Query  463   EAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYE  284
             +AIPE+TGKVII + ++R+     +GY+                               E
Sbjct  288   KAIPEKTGKVIIVDGVIRE-----DGYEPFD----------------------------E  314

Query  283   VGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
               L+LD+VMMAH+  G ERTE +W  +L   GF  Y +     +  II+A P
Sbjct  315   TRLVLDLVMMAHSSHGQERTEVEWKKLLEEGGFPRYRILKIPTLQMIIEAYP  366



>gb|ACC63885.1| caffeic acid 3-O-methyltransferase [Populus trichocarpa]
Length=351

 Score =   235 bits (599),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 152/426 (36%), Positives = 219/426 (51%), Gaps = 90/426 (21%)
 Frame = -1

Query  1381  SMDAKSIRRQEVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSG  1202
             S+D +++ R +V+      +W+ +FGF E   +KCAIELGI D + S    VTL+Q++SG
Sbjct  3     SLDEEALLRGQVE------VWQLMFGFAESMALKCAIELGIADIINSLGGPVTLNQIASG  56

Query  1201  LGCSPSA----LYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRG----YVQ  1046
             +  SP      L RIMRFL+ + +F +                      P+ G    Y  
Sbjct  57    ID-SPCVDIPYLARIMRFLVRKRVFTQ--------------------HNPSDGGETLYGL  95

Query  1045  TPLSALLTRDGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAA  866
             T  S  L RD E S+A  V +++ P  LAPW  LS             C      AF+ A
Sbjct  96    TDSSKWLLRDSEVSLAPMVLMQNYPWQLAPWHYLS------------QCVKEGGIAFKKA  143

Query  865   NGKDVWRYAESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvggg  686
             +G ++W  A  +P  +++  DA+AC A++ + A+V         H   G + V   V  G
Sbjct  144   HGCEIWDLASQNPEFNRIFNDALACTAKIIMRAVVS--------HYKGGFDDVETLVDVG  195

Query  685   dgttvEM--LVKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVL  512
              GT   +  +VKA+P +KGINFDLPHVV+ AP   GV HVGGN F+ IP AD+IF+ WVL
Sbjct  196   GGTGGNLAEIVKAYPHIKGINFDLPHVVAAAPAYNGVSHVGGNFFEAIPNADSIFMKWVL  255

Query  511   HDWGDEECVQILSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknns  332
             HDWGDE+CV+IL  CR+A+PE+TGK+I+ E +L+                          
Sbjct  256   HDWGDEDCVKILKNCRKAMPEKTGKLILVEIVLQPE------------------------  291

Query  331   kLQEKDRNNNNNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDV  152
                       N    ++G++ D+VM AH+  G ERTE +W  +L   GF  Y + +   +
Sbjct  292   ---------GNGQFGDMGMVSDLVMFAHSTGGKERTELEWKKLLDEGGFPRYKIINIPAL  342

Query  151   VSIIQA  134
              SII+A
Sbjct  343   PSIIEA  348



>gb|AFZ78576.1| caffeic acid O-methyltransferase [Populus tomentosa]
Length=351

 Score =   235 bits (599),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 152/426 (36%), Positives = 219/426 (51%), Gaps = 90/426 (21%)
 Frame = -1

Query  1381  SMDAKSIRRQEVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSG  1202
             S+D + + R +V+      +W+ +FGF E   +KCAIELGIPD + S    VTL+Q++SG
Sbjct  3     SLDEEKLLRGQVE------VWQLMFGFAESMALKCAIELGIPDIINSLGGPVTLNQIASG  56

Query  1201  LGCSPSA----LYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRG----YVQ  1046
             +  SP      L RIMRFL+ + +F +                      P+ G    Y  
Sbjct  57    ID-SPCVDIPYLARIMRFLVRKRVFTQ--------------------HIPSDGGETLYGL  95

Query  1045  TPLSALLTRDGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAA  866
             T  S  L RD E S+A  V +++ P  LAPW  LS             C      AF+ A
Sbjct  96    TDSSKWLLRDSEVSLAPMVLMQNYPWQLAPWHYLS------------QCVKEGGIAFKKA  143

Query  865   NGKDVWRYAESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvggg  686
             +G ++W  A  +P  +++  DA+AC A++ + A+V         H   G + V   V  G
Sbjct  144   HGCEIWDLASQNPEFNRIFNDALACTAKIIMRAVVS--------HYKGGFDDVETLVDVG  195

Query  685   dgttvEM--LVKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVL  512
              GT   +  +VKA+P +KGINFDLPHVV+ AP   GV HVGG+ F+ IP AD+IF+ WVL
Sbjct  196   GGTGGNLAEIVKAYPHIKGINFDLPHVVAAAPAYNGVSHVGGSFFEAIPNADSIFMKWVL  255

Query  511   HDWGDEECVQILSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknns  332
             HDWGDE+CV+IL  CR+A+PE+TGK+I+ E +L+                          
Sbjct  256   HDWGDEDCVKILKNCRKAMPEKTGKLILVEIVLQPE------------------------  291

Query  331   kLQEKDRNNNNNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDV  152
                       N    ++G++ D+VM AH+  G ERTE +W  +L   GF  Y + +   +
Sbjct  292   ---------GNGQFGDMGMVSDLVMFAHSTGGKERTELEWKKLLEEGGFPRYKIINIPAL  342

Query  151   VSIIQA  134
              SII+A
Sbjct  343   PSIIEA  348



>ref|XP_008236086.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like isoform 
X1 [Prunus mume]
Length=268

 Score =   232 bits (591),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 139/280 (50%), Positives = 179/280 (64%), Gaps = 33/280 (12%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRG  1145
             IWKYVFGF E+AVVKCAIELGI D +ES    +TL +LSS L C PS LYRIMR L++  
Sbjct  22    IWKYVFGFVEIAVVKCAIELGIADAIESHGSPMTLLELSSALRCDPSPLYRIMRVLVHLK  81

Query  1144  IFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSPVM  965
             IFKE   T                    + Y QTPLS  L + GE SMAA + LESSP+M
Sbjct  82    IFKENPAT----------------QIGPKVYAQTPLSKRLLKSGENSMAALILLESSPLM  125

Query  964   LAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMACHA  785
             LAPW  LS R+            G S+  FE+ +G+DVW +A ++P HSKL  +AMAC A
Sbjct  126   LAPWHGLSARI-----------QGISNSEFESVHGEDVWSHAAANPDHSKLFNEAMACDA  174

Query  784   RMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPHVVS  605
             R+AVPA++++C ++            +VDVGGGDGTT+ +LV+A P ++GINFDLPHVVS
Sbjct  175   RVAVPAVIESCLEVF------KGIETIVDVGGGDGTTLRLLVEACPWIQGINFDLPHVVS  228

Query  604   VAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECV  485
             VA +   + +VGG+MF  +PKADA+    VLH  GD+EC+
Sbjct  229   VAQECDRIENVGGDMFDCVPKADAVIKKSVLHGRGDDECI  268



>ref|XP_006371585.1| caffeic acid O-methyltransferase family protein [Populus trichocarpa]
 gb|ERP49382.1| caffeic acid O-methyltransferase family protein [Populus trichocarpa]
Length=351

 Score =   234 bits (597),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 152/426 (36%), Positives = 219/426 (51%), Gaps = 90/426 (21%)
 Frame = -1

Query  1381  SMDAKSIRRQEVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSG  1202
             S+D +++ R +V+      +W+ +FGF E   +KCAIELGI D + S    VTL+Q++SG
Sbjct  3     SLDEEALLRGQVE------VWQLMFGFAESMALKCAIELGIADIINSLGGPVTLNQIASG  56

Query  1201  LGCSPSA----LYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRG----YVQ  1046
             +  SP      L RIMRFL+ + +F +                      P+ G    Y  
Sbjct  57    ID-SPCVDIPYLARIMRFLVRKRVFTQ--------------------HIPSDGGETLYGL  95

Query  1045  TPLSALLTRDGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAA  866
             T  S  L RD E S+A  V +++ P  LAPW  LS             C      AF+ A
Sbjct  96    TDSSKWLLRDSEVSLAPMVLMQNYPWQLAPWHYLS------------QCVKEGGIAFKKA  143

Query  865   NGKDVWRYAESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvggg  686
             +G ++W  A  +P  +++  DA+AC A++ + A+V         H   G + V   V  G
Sbjct  144   HGCEIWDLASQNPEFNRIFNDALACTAKIIMRAVVS--------HYKGGFDDVETLVDVG  195

Query  685   dgttvEM--LVKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVL  512
              GT   +  +VKA+P +KGINFDLPHVV+ AP   GV HVGGN F+ IP AD+IF+ WVL
Sbjct  196   GGTGGNLAEIVKAYPHIKGINFDLPHVVAAAPAYNGVSHVGGNFFEAIPNADSIFMKWVL  255

Query  511   HDWGDEECVQILSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknns  332
             HDWGDE+CV+IL  CR+A+PE+TGK+I+ E +L+                          
Sbjct  256   HDWGDEDCVKILKNCRKAMPEKTGKLILVEIVLQPE------------------------  291

Query  331   kLQEKDRNNNNNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDV  152
                       N    ++G++ D+VM AH+  G ERTE +W  +L   GF  Y + +   +
Sbjct  292   ---------GNGQFGDMGMVSDLVMFAHSTGGKERTELEWKKLLEEGGFPRYKIINIPAL  342

Query  151   VSIIQA  134
              SII+A
Sbjct  343   PSIIEA  348



>gb|KCW64164.1| hypothetical protein EUGRSUZ_G01810 [Eucalyptus grandis]
Length=303

 Score =   231 bits (589),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 145/304 (48%), Positives = 190/304 (63%), Gaps = 45/304 (15%)
 Frame = -1

Query  1375  DAKSIRRQEVDYEEEDG-----IWKYVFGFTEMAVVKCAIELGIPDFLESQ-EQAVTLDQ  1214
             + KS  +   D + E+      IWKYVFGFTEMAVVKCAI+LGI D +ES  E +++L +
Sbjct  9     EPKSTAQAPGDEDNEEARAGLDIWKYVFGFTEMAVVKCAIDLGIADAMESHPEPSISLSR  68

Query  1213  LSSGLGCSPSALYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLS  1034
             LSS LGC PS+L RI+RFL++R IF++                       T  Y QTPLS
Sbjct  69    LSSELGCCPSSLRRILRFLVHRRIFRQ--------------------HADTDTYSQTPLS  108

Query  1033  ALLTRDGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKD  854
               L   GE SMAAF+RLE++PVMLAPWL LS  V           + ++   F A +G D
Sbjct  109   RRLLTRGENSMAAFIRLETTPVMLAPWLNLSSHV--------SAAAATAPPPFVAVHGDD  160

Query  853   VWRYAESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgtt  674
             VW Y+ ++P HS+LI++AMAC AR+AVPA+ + CP++            +VDVGGG+GTT
Sbjct  161   VWVYSAANPGHSRLIDEAMACDARVAVPALAKDCPEVF------EGVLTMVDVGGGNGTT  214

Query  673   vEMLVKAFPGVKGINFDLPHVVS-VAPKRPGVHHVGGNMFQRIPKADAIFL----MWVLH  509
             + +L KAFP ++GINFDLPHVVS  +P   GV HVGG+MF+ +PKADA+FL    M  LH
Sbjct  215   LRLLRKAFPWIRGINFDLPHVVSGASPPCEGVEHVGGDMFEGVPKADAVFLKSYSMPTLH  274

Query  508   DWGD  497
                D
Sbjct  275   SLSD  278



>emb|CDP18090.1| unnamed protein product [Coffea canephora]
Length=521

 Score =   236 bits (602),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 137/299 (46%), Positives = 178/299 (60%), Gaps = 52/299 (17%)
 Frame = -1

Query  1021  RDGEKSM---AAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDV  851
             R G + M   A  + LESSPVML+PWL L  RVL            +S   F+  +G D+
Sbjct  270   RSGNEEMERKATILLLESSPVMLSPWLGLGRRVL-----------ANSPPPFDTYHGHDI  318

Query  850   WRYAESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttv  671
             WRYA+++PAHSKLI DAMAC AR+AV A++  CP +            +VDVG GDGT +
Sbjct  319   WRYAQNNPAHSKLINDAMACDARVAVSAMIYRCPQVF------EGISSLVDVGRGDGTAL  372

Query  670   EMLVKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEE  491
               L+KA P + GINFDLPHVVS+AP+  GV HVGG+MF   P AD  F+M VLHDWGD+ 
Sbjct  373   RTLLKACPWIHGINFDLPHVVSIAPRSDGVEHVGGDMFHSFPNADTAFIMSVLHDWGDDN  432

Query  490   CVQILSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDR  311
             C+ IL  C+EAIP++TGKVII EA++ DH+E                             
Sbjct  433   CISILMNCKEAIPQDTGKVIIVEAVI-DHEE-----------------------------  462

Query  310   NNNNNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQA  134
                ++   +VGL LDMVMMAHT  G ERT ++W+H+L   GF  +T+T    V S+I+A
Sbjct  463   --GDDKLKDVGLTLDMVMMAHTTTGKERTSEEWAHILNQVGFSRHTMTHIQAVQSVIEA  519



>ref|NP_195241.1| O-methyltransferase family protein [Arabidopsis thaliana]
 emb|CAB36722.1| O-methyltransferase-like protein [Arabidopsis thaliana]
 emb|CAB80232.1| O-methyltransferase-like protein [Arabidopsis thaliana]
 gb|AEE86473.1| O-methyltransferase family protein [Arabidopsis thaliana]
Length=325

 Score =   230 bits (587),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 152/404 (38%), Positives = 201/404 (50%), Gaps = 107/404 (26%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQ--EQAVTLDQLSSGLGCSPSALYRIMRFLIN  1151
             IW+YVFGF ++A  KCAI+L IP+ +E+    Q VTL +LSS +  SPS L RIMRFL++
Sbjct  19    IWRYVFGFADIAAAKCAIDLKIPEAIENHPSSQPVTLSELSSAVSASPSHLRRIMRFLVH  78

Query  1150  RGIFKEVEMTLPTIsstssteaalasTRPTR-----GYVQTPLSALLTRDGEKSMAAFVR  986
             +G+FKEV                     PT+     GY  TPLS  +             
Sbjct  79    QGLFKEV---------------------PTKDGLATGYTNTPLSRRMM------------  105

Query  985   LESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIE  806
                                                     +GKD+W +A+ +  HS+LI 
Sbjct  106   ------------------------------------ITKLHGKDLWAFAQDNLCHSQLIN  129

Query  805   DAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINF  626
             +AMAC AR  VP +  AC  L            VVDVGGG G T+ +LVK FP +KG NF
Sbjct  130   EAMACDARRVVPRVAGACQGLF------DGVATVVDVGGGTGETMGILVKEFPWIKGFNF  183

Query  625   DLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEE  446
             DLPHV+ VA    GV +V G+MF  IP +DA+ + WVLHDWGD++C++IL  C+EA+   
Sbjct  184   DLPHVIEVAQVLDGVENVEGDMFDSIPASDAVIIKWVLHDWGDKDCIKILKNCKEAVLPN  243

Query  445   TGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLD  266
              GKV+I E ++ + +  +                      +E+D     +    V L LD
Sbjct  244   IGKVLIVECVIGEKKNTM--------------------IAEERD-----DKLEHVRLQLD  278

Query  265   MVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQA  134
             MVMM HT  G ERT K+W  VLT AGF  Y V D  DV S+I A
Sbjct  279   MVMMVHTSTGKERTLKEWDFVLTEAGFARYEVRDFDDVQSLIIA  322



>ref|XP_002517958.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF44476.1| o-methyltransferase, putative [Ricinus communis]
Length=351

 Score =   231 bits (588),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 140/406 (34%), Positives = 211/406 (52%), Gaps = 78/406 (19%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSP---SALYRIMRFLI  1154
             IWK +FGF +  V+K A+EL IPD + S  + +TL Q++SG+  S    S L RIMR+L+
Sbjct  16    IWKLMFGFADSMVLKAAVELRIPDIINSHARPITLSQIASGIDSSSPDISYLARIMRYLV  75

Query  1153  NRGIFKEVEMTLPTIsstssteaalasTRPTRG----YVQTPLSALLTRDGEKSMAAFVR  986
              +GIF                     + +P+ G    Y     +  L RD + ++   V 
Sbjct  76    CKGIF--------------------TAHQPSDGGESFYGLAENTRWLLRDSDLTLHPMVI  115

Query  985   LESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIE  806
             +E+ P  + PW  L              C      AF+ A+G ++W +A  +P  +++  
Sbjct  116   MENHPWQVTPWHYLG------------QCVKEGGIAFKKAHGCEMWDFASQNPEFNRIFN  163

Query  805   DAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINF  626
              A+AC A++ + A++    D             +VDVGGG G  +  +VKA+P +K +NF
Sbjct  164   QALACTAKIVMKAVLSGYKD------GFDAITTLVDVGGGTGGNLAEIVKAYPHIKTLNF  217

Query  625   DLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEE  446
             DLPHVV+ AP   G+ HVGGNMF+ IP ADAIF+ W+LHDWGDE CV+IL  CR+AIPE+
Sbjct  218   DLPHVVATAPAFDGIAHVGGNMFESIPNADAIFMKWILHDWGDEYCVKILKNCRKAIPEK  277

Query  445   TGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLD  266
             TGK+++ E +L++                                 + NN   ++GL+ D
Sbjct  278   TGKLVLVEIVLQE---------------------------------DGNNQFGDMGLVFD  304

Query  265   MVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             ++M AHT  G ER+E +W  +L   GF  Y + +   + SII+A P
Sbjct  305   LLMFAHTTGGKERSEIEWKKLLEEGGFPRYKIINIPALPSIIEAYP  350



>gb|EYU32603.1| hypothetical protein MIMGU_mgv1a009168mg [Erythranthe guttata]
Length=351

 Score =   230 bits (587),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 157/421 (37%), Positives = 218/421 (52%), Gaps = 85/421 (20%)
 Frame = -1

Query  1354  QEVDYEEEDG-----IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCS  1190
             Q++ ++E++      +W Y FG+  + VVK A+EL IPD +E     ++L +LSS +G  
Sbjct  4     QKMGFDEKEARARAQVWNYAFGYINLRVVKTAVELEIPDIVEKHGGPISLPELSSSVGVP  63

Query  1189  PSALYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGE  1010
               +L+RIMRFLI  GIFK+       +S                 Y  TPLS L+TR+  
Sbjct  64    TESLHRIMRFLIVNGIFKKAPPPHGEVSGE------------VHYYAPTPLSGLMTRE--  109

Query  1009  KSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAE--  836
              ++AAF+ L+  P               G N     C G +  A       DV    E  
Sbjct  110   -NLAAFMLLQDMPT--------------GSN-----C-GITPAALRTGKRPDVKPVKEED  148

Query  835   --SDPAHS---KLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttv  671
               +DPAH    KL  D+M  HAR+A  A+V   P              +VDVGG  G  +
Sbjct  149   TWADPAHGNHVKLFTDSMEAHARVATQAMVDNFP------AGFEGIESLVDVGGRHGMAL  202

Query  670   EMLVKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEE  491
              +LVKAFP V G   DLP VV+ AP R GVH VGG+MF+++P ADA+ LMW+LHDW DE 
Sbjct  203   SILVKAFPWVSGTVLDLPEVVADAPPRGGVHFVGGSMFEKVPNADAVMLMWILHDWSDEA  262

Query  490   CVQILSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDR  311
             C+ IL KC++A+P++TGKV+I EA++ +  E  + Y G R                    
Sbjct  263   CIDILKKCKDAVPKDTGKVMIVEAVIDEDGEG-DEYAGAR--------------------  301

Query  310   NNNNNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQAR  131
                        L+LDMVMM+ T KG ERT K+W+++L  AGF  + V +   VVS+I+A 
Sbjct  302   -----------LLLDMVMMSVTVKGKERTYKEWAYLLEEAGFSRHNVVNIKTVVSVIEAY  350

Query  130   P  128
             P
Sbjct  351   P  351



>gb|ADJ66850.1| O-methyltransferase [Vitis vinifera]
 gb|AGN70860.1| O-methyltransferase OMT1 [Vitis vinifera]
 gb|AGN70861.1| O-methyltransferase OMT1 [Vitis vinifera]
 gb|AGN70862.1| O-methyltransferase OMT1 [Vitis vinifera]
 gb|AGN70863.1| O-methyltransferase OMT1 [Vitis vinifera]
Length=369

 Score =   231 bits (588),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 147/405 (36%), Positives = 212/405 (52%), Gaps = 72/405 (18%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPS----ALYRIMRFL  1157
             IW+++F F +   +KCA+EL I D + SQ + +TL Q+++ +  SPS     L RIMRFL
Sbjct  30    IWRHMFAFADSMALKCAVELRIADIIHSQARPITLSQIATCID-SPSPDITCLARIMRFL  88

Query  1156  INRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLES  977
             +   IF       P   S                Y  TP S  L  D + S+A  V +E+
Sbjct  89    VRAKIFT----AAPPPQSDGGETL----------YGLTPSSKWLLHDADLSLAPMVLMEN  134

Query  976   SPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAM  797
              P ++APW            +    C      AFE A+G+ +W +A  +P  +KL  D M
Sbjct  135   HPFLMAPW------------HCFGTCVKEGGIAFEKAHGRQIWDFASENPEFNKLFNDGM  182

Query  796   ACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLP  617
             AC A++ +  +V A  D        G    +VDVGGG G  V  +VKA+P +KGINFDLP
Sbjct  183   ACTAKVVMGEVVAAYKDGF------GSIRTLVDVGGGTGGAVAEVVKAYPHIKGINFDLP  236

Query  616   HVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGK  437
             HVV+ AP   GV HVGG+MF+ IP ADAIF+ W++HDW DE+C++IL  CR+A+PE+TGK
Sbjct  237   HVVASAPAYEGVSHVGGDMFESIPNADAIFMKWIMHDWSDEDCIKILKNCRKAVPEKTGK  296

Query  436   VIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVM  257
             +II + ++R+  +  + +  TR                               L+ D++M
Sbjct  297   IIIVDGVIREDSD--DPFDKTR-------------------------------LVFDLLM  323

Query  256   MAHTGKGLERTEKQWSHVLTAAGFKSYTVTD--TSDVVSIIQARP  128
             MAH+  G ER+E +W  VL   GF  Y + +   S +  II+A P
Sbjct  324   MAHSSNGKERSEVEWKKVLEEGGFPRYRIMEISISTLPMIIEAYP  368



>gb|EYU40461.1| hypothetical protein MIMGU_mgv1a023007mg [Erythranthe guttata]
Length=235

 Score =   226 bits (576),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 143/282 (51%), Positives = 176/282 (62%), Gaps = 49/282 (17%)
 Frame = -1

Query  967  MLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMACH  788
            ML+PWLKLS RV    + N  Y S      FEAA+GKDVW YA S+P H+ LI  AMA H
Sbjct  1    MLSPWLKLSSRV----SGNGDYNS-----PFEAAHGKDVWAYASSNPGHNSLINGAMASH  51

Query  787  ARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVK-GINFDLPHV  611
            AR+A+ AIV  CP+             +VDVGGGDGT +  L+K+ P +  GINFDLPHV
Sbjct  52   ARIAMSAIVDRCPEAF------EGVGCLVDVGGGDGTALRTLMKSCPSISHGINFDLPHV  105

Query  610  VSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKVI  431
            VSVAP+  GV +VGG+MF+ +PKADA FLMWVLHDW DEEC+ IL KCREAIPE  GKVI
Sbjct  106  VSVAPEFDGVENVGGDMFEVVPKADAAFLMWVLHDWSDEECIVILRKCREAIPEGWGKVI  165

Query  430  IAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMMA  251
            IAEA++                              EKD  +  N+   V L LDMVM+A
Sbjct  166  IAEAVI-----------------------------GEKDEVDKYND---VRLALDMVMLA  193

Query  250  HTGKGLERTEKQWSHVLTAAGFKSYTVTDT-SDVVSIIQARP  128
            HT KG ER+ ++W +V+ +AGF S+TV    S +VS+IQA P
Sbjct  194  HTEKGKERSIEEWEYVVKSAGFSSFTVKHIHSSIVSVIQAYP  235



>gb|AGN70858.1| O-methyltransferase OMT1 [Vitis vinifera]
 gb|AGN70859.1| O-methyltransferase OMT1 [Vitis vinifera]
Length=369

 Score =   230 bits (587),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 147/405 (36%), Positives = 212/405 (52%), Gaps = 72/405 (18%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPS----ALYRIMRFL  1157
             IW+++F F +   +KCA+EL I D + S  + +TL Q+++ +  SPS     L RIMRFL
Sbjct  30    IWRHMFAFADSMALKCAVELRIADIIHSHARPITLSQIATCID-SPSPDITCLARIMRFL  88

Query  1156  INRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLES  977
             +   IF  V    P   S                Y  TP S  L  D + S+A  V +E+
Sbjct  89    VRAKIFTAV----PPPQSDGGETL----------YGLTPSSKWLLHDADLSLAPMVLMEN  134

Query  976   SPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAM  797
              P ++APW            +    C      AFE A+G+ +W +A  +P  +KL  D M
Sbjct  135   HPFLMAPW------------HCFGTCVKEGGIAFEKAHGRQIWDFASENPEFNKLFNDGM  182

Query  796   ACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLP  617
             AC A++ +  +V A  D        G    +VDVGGG G  V  +VKA+P +KGINFDLP
Sbjct  183   ACTAKVVMGEVVAAYKDGF------GSIRTLVDVGGGTGGAVAEVVKAYPHIKGINFDLP  236

Query  616   HVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGK  437
             HVV+ AP   GV HVGG+MF+ IP ADAIF+ W++HDW DE+C++IL  CR+A+PE+TGK
Sbjct  237   HVVASAPAYEGVSHVGGDMFESIPNADAIFMKWIMHDWSDEDCIKILKNCRKAVPEKTGK  296

Query  436   VIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVM  257
             +II + ++R+  +  + +  TR                               L+ D++M
Sbjct  297   IIIVDGVIREDSD--DPFDKTR-------------------------------LVFDLLM  323

Query  256   MAHTGKGLERTEKQWSHVLTAAGFKSYTVTD--TSDVVSIIQARP  128
             MAH+  G ER+E +W  VL   GF  Y + +   S +  II+A P
Sbjct  324   MAHSSNGKERSEVEWKKVLEEGGFPRYRIMEISISTLPMIIEAYP  368



>gb|AFM73600.1| caffeate O-methyltransferase, partial [Populus simonii]
Length=315

 Score =   228 bits (581),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 148/383 (39%), Positives = 205/383 (54%), Gaps = 68/383 (18%)
 Frame = -1

Query  1276  AIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRGIFKEVEMTLPTIssts  1097
             AIELG+ D +++    +TL +LSS LGC PS L+R+MRFL+ R +F E       +    
Sbjct  1     AIELGVADAIDANGDPMTLAELSSKLGCQPSPLHRLMRFLVQRRVFGEKRDEAGQV----  56

Query  1096  steaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDN  917
                          GYV TP+S+ L +  +  +A  +  ++ P ML P   LS        
Sbjct  57    -------------GYVLTPISSRLLKSDDTKVAPIL-FQNDPDMLLPMHVLSA-------  95

Query  916   NNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMACHARMAVPAIVQACPDLLL  737
                 +  G     FE  +G + W Y ++ P   +L+ +AMA +AR  VPA+V  CP L  
Sbjct  96    ----HLRGDKRLPFEIVHGTEEWTYMDAHPLQRELLNNAMAANARPVVPAVVDGCPGLF-  150

Query  736   LHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMF  557
                       VVDVGGG+GT +  LV+A P VK INFDLP VV+ AP+  GV HVGG+MF
Sbjct  151   -----EGVGTVVDVGGGNGTAMRTLVEACPWVKAINFDLPQVVAGAPECNGVVHVGGDMF  205

Query  556   QRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKVIIAEAILRDHQEMINGYQG  377
               IPKAD +F+ WVLHDW DE C++IL KC+EAIPEE GKVII + ++          +G
Sbjct  206   AAIPKADVVFIKWVLHDWSDESCIKILKKCKEAIPEEKGKVIIVDTVI----TEEVEEEG  261

Query  376   TRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLT  197
              R                            +V LMLD++M+AHT  G ERTE +W ++ T
Sbjct  262   LR----------------------------DVRLMLDIMMLAHT-PGRERTEAEWKNIFT  292

Query  196   AAGFKSYTVTDTSDVVSIIQARP  128
              AGF++YT+     + S+I+  P
Sbjct  293   KAGFRTYTIKPIRALQSVIEVFP  315



>gb|ADE76636.1| unknown [Picea sitchensis]
Length=379

 Score =   229 bits (585),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 141/414 (34%), Positives = 218/414 (53%), Gaps = 61/414 (15%)
 Frame = -1

Query  1354  QEVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFL--ESQEQAVTLDQLSSGLGC-SP-  1187
             +E + + +   WK  F F E   VKC + LGIPD +  E     ++L+++++ L   SP 
Sbjct  21    EEEELQGQAEAWKSTFAFAESLAVKCVVLLGIPDMIAREGPRATLSLNEIAARLPADSPD  80

Query  1186  -SALYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGE  1010
              S L+RIMRFL+ +G+F+            S  ++A A    TR Y  TP S    ++ E
Sbjct  81    TSCLFRIMRFLVAKGVFR-----------ASVVKSAEAGAFETR-YGLTPASKWFVKERE  128

Query  1009  KSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESD  830
              SM   + +++    +APW            ++   C      AFE ANG ++W YA   
Sbjct  129   LSMVPMLLMQNDERTVAPW------------HHFNECVVDGGIAFERANGAEIWSYASDH  176

Query  829   PAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAF  650
             P  + L  DAMAC+AR+ + A++        L+    V                 +V+A+
Sbjct  177   PDFNHLFNDAMACNARIVMKALLSKFQGFQSLNSLVDVGGGTGTAVAE-------IVRAY  229

Query  649   PGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSK  470
             P +KGIN+DLPHVV+ A + PGV HVGG+MF+ +P  DAIF+ W++HDW DE+C++IL  
Sbjct  230   PFIKGINYDLPHVVATARRLPGVEHVGGDMFETVPSGDAIFMKWIMHDWSDEDCIKILKN  289

Query  469   CREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNS  290
             CR+AIP +TGKVII + +L       +  QG  +             +++K +  + N  
Sbjct  290   CRKAIP-DTGKVIIVDVVL-------DANQGDDI-------------VKKKKKALDPN--  326

Query  289   YEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
               +G++ D+VM+AH+  G ERTEK+W  +L   GF  Y + D   + S+I+A P
Sbjct  327   --LGIVFDLVMVAHSSGGKERTEKEWKTILLEGGFGRYNIIDIPALQSVIEAFP  378



>ref|XP_002277602.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase [Vitis vinifera]
Length=375

 Score =   229 bits (585),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 148/405 (37%), Positives = 212/405 (52%), Gaps = 72/405 (18%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPS----ALYRIMRFL  1157
             IW+++F F +  V+KCA+EL I D + S  + +TL Q+++ +  SPS     L RIMRFL
Sbjct  36    IWRHMFAFADSMVLKCALELRIADIIHSHARPITLSQIATCID-SPSPDITCLARIMRFL  94

Query  1156  INRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLES  977
             +   IF       P   S                Y  TP S  L  D E S+A  V +E+
Sbjct  95    VCAKIFT----AAPPPQSDGGETL----------YGLTPSSKWLLHDAELSLAPMVLMEN  140

Query  976   SPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAM  797
              P ++APW  L              C      AFE A+G+ +W +A  +P  +KL  D M
Sbjct  141   HPFLMAPWHCLG------------TCVKEGGIAFEKAHGRQIWDFASENPEFNKLFNDGM  188

Query  796   ACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLP  617
             AC A++ +  +V A  D        G    +VDVGGG G  V  +VKA+P +KGINFDLP
Sbjct  189   ACTAKVVMGEVVAAYKDGF------GSIRTLVDVGGGTGGAVAEVVKAYPHIKGINFDLP  242

Query  616   HVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGK  437
             HVV+ AP   GV HVGG+MF+ IP ADAIF+ W++HDW DE+C++IL  CR+A+PE+TGK
Sbjct  243   HVVASAPAYEGVSHVGGDMFESIPNADAIFMKWIMHDWSDEDCIKILKNCRKAVPEKTGK  302

Query  436   VIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVM  257
             +II + ++R+  +  + +  TR                               L+ D++M
Sbjct  303   IIIVDGVIREDSD--DPFDKTR-------------------------------LVFDLLM  329

Query  256   MAHTGKGLERTEKQWSHVLTAAGFKSYTVTD--TSDVVSIIQARP  128
             +AH+  G ER+E +W  VL   GF  Y + +   S +  II+A P
Sbjct  330   IAHSSNGKERSEVEWKKVLEEGGFPRYRILEISISTLPMIIEAYP  374



>ref|XP_010051712.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Eucalyptus 
grandis]
 gb|KCW89505.1| hypothetical protein EUGRSUZ_A01796 [Eucalyptus grandis]
Length=361

 Score =   229 bits (583),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 141/411 (34%), Positives = 204/411 (50%), Gaps = 81/411 (20%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQE-QAVTLDQLSSGLGCSPSA----LYRIMRF  1160
             IW+Y+ GF +   + CA+EL I D + S   + VTL Q++  +  SPS     L R+MR 
Sbjct  19    IWRYMLGFADSMALNCAVELRIADIIHSHSGRPVTLAQIARSIEGSPSPDLPYLSRVMRL  78

Query  1159  LINRGIFKEVEMTLPTIsstssteaalasTRPTRG----YVQTPLSALLTRDGEKSMAAF  992
             L+ R IF                       RP+ G    Y  T LS  L RD E ++   
Sbjct  79    LVRRNIFS--------------------VHRPSDGGDLLYSLTDLSRWLVRDSELNLVPM  118

Query  991   VRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKL  812
             V +E+ P+ LAPW  L              C      AF+ A+G ++W +A  +P  +K+
Sbjct  119   VIMENHPLQLAPWHCLG------------QCVREGGIAFQKAHGVEIWEFARDNPEFNKI  166

Query  811   IEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGI  632
               DAMAC A++ + A  +A  +   L G+             +      +V+A+P ++GI
Sbjct  167   FNDAMACTAKIIMKAAFEAYGEGFSLVGSVVDVGGGTGGVIAE------IVRAYPRIRGI  220

Query  631   NFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIP  452
             NFDLPHVV+ AP   GV HVGGNMF+ IPKADA+FL WVLHDWGDE+CV+IL  CR+AI 
Sbjct  221   NFDLPHVVATAPAHDGVEHVGGNMFEAIPKADAVFLKWVLHDWGDEDCVKILKNCRKAIA  280

Query  451   ---EETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEV  281
                ++ GK+II + +LRD +   + ++                               +V
Sbjct  281   SSDQKPGKLIIVDLVLRDQEGSGDPFE-------------------------------DV  309

Query  280   GLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             G+  D++MMA    G ERTE +W  +L   GF  + +     + SII+A P
Sbjct  310   GVTFDLIMMALQSGGKERTEAEWKVLLEQGGFPRHNIIKIQALPSIIEAFP  360



>emb|CAN64492.1| hypothetical protein VITISV_006040 [Vitis vinifera]
Length=375

 Score =   228 bits (582),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 146/405 (36%), Positives = 211/405 (52%), Gaps = 72/405 (18%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPS----ALYRIMRFL  1157
             IW+++F F +   +KCA+EL I D + S  + +TL Q+++ +  SPS     L RIMRFL
Sbjct  36    IWRHMFAFADSMALKCAVELRIADIIHSXARPITLSQIATCID-SPSPDITCLARIMRFL  94

Query  1156  INRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLES  977
             +   IF       P   S                Y  TP S  L  D + S+A  V +E+
Sbjct  95    VRAKIFT----AAPPPQSDGGETL----------YGLTPSSKWLLHDADLSLAPMVLMEN  140

Query  976   SPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAM  797
              P ++APW            +    C      AFE A+G+ +W +A  +P  +KL  D M
Sbjct  141   HPXLMAPW------------HCFGTCVKEGGIAFEKAHGRQIWDFASENPEFNKLFNDGM  188

Query  796   ACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLP  617
             AC A++ +  +V A  D        G    +VDVGGG G  V  +VKA+P +KGINFDLP
Sbjct  189   ACTAKVVMGEVVAAYKDGF------GSIRTLVDVGGGTGGAVAEVVKAYPHIKGINFDLP  242

Query  616   HVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGK  437
             HVV+ AP   GV HVGG+MF+ IP ADAIF+ W++HDW DE+C++IL  CR+A+PE+TGK
Sbjct  243   HVVASAPAYEGVSHVGGDMFESIPNADAIFMKWIMHDWSDEDCIKILKNCRKAVPEKTGK  302

Query  436   VIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVM  257
             +II + ++R+  +  + +  TR                               L+ D++M
Sbjct  303   IIIVDGVIREDSD--DPFDKTR-------------------------------LVFDLLM  329

Query  256   MAHTGKGLERTEKQWSHVLTAAGFKSYTVTD--TSDVVSIIQARP  128
             MAH+  G ER+E +W  VL   GF  Y + +   S +  II+A P
Sbjct  330   MAHSSNGKERSEVEWKKVLEEGGFPRYRIMEISISTLPMIIEAYP  374



>ref|XP_002517957.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF44475.1| o-methyltransferase, putative [Ricinus communis]
Length=352

 Score =   227 bits (578),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 144/407 (35%), Positives = 207/407 (51%), Gaps = 80/407 (20%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGL-GCSPSALY--RIMRFLI  1154
             +W+ +F F +   +KCA+EL IPD + S  +++TL Q++S +   SP   Y  RIMR L+
Sbjct  17    VWQLMFAFADSMALKCAVELHIPDIIHSHGKSITLSQIASSIDSTSPDIPYLQRIMRLLV  76

Query  1153  NRGIFKEVEMTLPTIsstssteaalasTRPTRG----YVQTPLSALLTRDGEKSMAAFVR  986
              R IF                     +  P+ G    Y  T +S  L  D ++++A  V 
Sbjct  77    RRNIF--------------------TADHPSDGGETLYGLTHVSKWLVHDSDRTLAPMVL  116

Query  985   LESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIE  806
             +E+ P  + PW   S             C      AFE ANG ++W +A  +P  +K+  
Sbjct  117   MENHPWTINPWHCFS------------QCVKKGGIAFEKANGHEIWDFAARNPEFNKMFN  164

Query  805   DAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINF  626
               M+C AR+ + AI++   D             +VDVGGG G  V  +VK+ P +KGIN+
Sbjct  165   GGMSCTARLTIRAILEGYKDGFC------SMKSLVDVGGGTGDLVTEIVKSHPHIKGINY  218

Query  625   DLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEE  446
             DL HVVS AP   GV HVGG+MFQ IP ADA+ + W++HDWGDE+CV+IL  CR+AIPE+
Sbjct  219   DLAHVVSTAPAYEGVCHVGGDMFQAIPNADAVIMKWIMHDWGDEDCVRILKNCRKAIPEK  278

Query  445   TGKVIIAEAILRDHQEMING-YQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLML  269
             TGKV+I + +L   Q   NG +  TR                               L+ 
Sbjct  279   TGKVMIVDIVL---QPEGNGLFDDTR-------------------------------LVF  304

Query  268   DMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             D++M+AH+  G ERTE +W  +L   GF  Y +     + SII+A P
Sbjct  305   DLLMIAHSSGGKERTEAEWKKILEEGGFPRYRIIKIPALTSIIEAYP  351



>ref|XP_007043544.1| O-methyltransferase [Theobroma cacao]
 gb|EOX99375.1| O-methyltransferase [Theobroma cacao]
Length=365

 Score =   227 bits (578),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 145/427 (34%), Positives = 216/427 (51%), Gaps = 86/427 (20%)
 Frame = -1

Query  1363  IRRQEVDYEEEDG-------IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSS  1205
             + ++E+D +E          IW+++FGF +   +KCA+EL I D + S  + +TL Q++S
Sbjct  9     LEKKEMDSKEAKALVQGQATIWQFMFGFADSMALKCAVELRIADIINSHHRPITLAQIAS  68

Query  1204  GLGCSPS----ALYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRG----YV  1049
              +  S S     L RIMRFLI R +F                     +  P+ G    Y 
Sbjct  69    CIDGSASPDITCLARIMRFLIRRKLF--------------------IAHHPSDGGECLYG  108

Query  1048  QTPLSALLTRDGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEA  869
              T  S  L  D E S+A  + ++  P ++APW   S             C+     AF+ 
Sbjct  109   LTHSSRWLLHDSELSLAPLILMQDHPWLMAPWHYFS------------RCAREGGIAFKV  156

Query  868   ANGKDVWRYAESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgg  689
             A+G++V+ +A ++P  +KL  DAMAC +++   AI+    D             +VDVGG
Sbjct  157   AHGREVFEFASANPTFNKLFNDAMACTSKVVTRAILSEYKD------GFSSIGSLVDVGG  210

Query  688   gdgttvEMLVKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLH  509
             G G  +  +V+A+P VKG NFDLPHV+  AP   GV H+GG+MFQ IP ADA+ + W+LH
Sbjct  211   GTGGMISEIVRAYPHVKGTNFDLPHVIETAPTYHGVCHIGGDMFQAIPNADAVIMKWILH  270

Query  508   DWGDEECVQILSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnsk  329
             DW  E+C++IL  CR+AIP ETGKVI+ E +L+                           
Sbjct  271   DWSSEDCIKILRNCRDAIPSETGKVILVECVLQP--------------------------  304

Query  328   LQEKDRNNNNNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVV  149
                    + +    +V L+LD+VM+AH+  G +RTE +W  +L  AGF  Y V +   + 
Sbjct  305   -------DGSGLFDDVSLILDLVMLAHSSGGKQRTELEWKKLLNEAGFPRYKVLNIPALP  357

Query  148   SIIQARP  128
              II+A P
Sbjct  358   CIIEAYP  364



>emb|CAN77813.1| hypothetical protein VITISV_028341 [Vitis vinifera]
Length=375

 Score =   227 bits (579),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 145/404 (36%), Positives = 211/404 (52%), Gaps = 70/404 (17%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGC-SP--SALYRIMRFLI  1154
             IW+++F F +   +KCA+EL I D + S  + +TL Q+++ +   SP  + L RIMRFL+
Sbjct  36    IWRHMFAFADSMALKCAVELRIADIIHSHARPITLSQIATCIDFPSPDITCLARIMRFLV  95

Query  1153  NRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESS  974
                IF       P   S                Y  TP S  L  D + S+A  V +E+ 
Sbjct  96    RAKIFT----AAPPPQSDGGETL----------YGLTPSSKWLLHDADLSLAPMVLMENH  141

Query  973   PVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMA  794
             P ++APW            +    C      AFE A+G+ +W +A  +P  +KL  D MA
Sbjct  142   PSLMAPW------------HCFGTCVKEGGIAFEKAHGRQIWDFASENPEFNKLFNDGMA  189

Query  793   CHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPH  614
             C A++ +  +V A  D        G    +VDVGGG G  V  +VKA+P +KGINFDLPH
Sbjct  190   CTAKVVMGEVVAAYKDGF------GSIRTLVDVGGGTGGAVAEVVKAYPHIKGINFDLPH  243

Query  613   VVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKV  434
             VV+ AP   GV HVGG+MF+ IP ADAIF+ W++HDW DE+C++IL  CR+A+PE+TGK+
Sbjct  244   VVASAPAYEGVSHVGGDMFESIPNADAIFMKWIMHDWSDEDCIKILKNCRKAVPEKTGKI  303

Query  433   IIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMM  254
             II + ++R+  +  + +  TR                               L+ D++MM
Sbjct  304   IIVDGVIREDSD--DPFDKTR-------------------------------LVFDLLMM  330

Query  253   AHTGKGLERTEKQWSHVLTAAGFKSYTVTD--TSDVVSIIQARP  128
             AH+  G ER+E +W  VL   GF  Y + +   S +  II+A P
Sbjct  331   AHSSNGKERSEVEWKKVLEEGGFPRYRILEISISTLPMIIEAYP  374



>ref|XP_010035708.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Eucalyptus 
grandis]
 gb|KCW47147.1| hypothetical protein EUGRSUZ_K00951 [Eucalyptus grandis]
Length=360

 Score =   226 bits (576),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 152/418 (36%), Positives = 218/418 (52%), Gaps = 64/418 (15%)
 Frame = -1

Query  1369  KSIRRQEVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQA-VTLDQLSSGLGC  1193
             +S+   E     +  IWK++F F +   +KCA+EL IPD + S     VTL Q++S +  
Sbjct  2     ESLDDTEATLRGQAHIWKHMFAFVDSMALKCAVELRIPDIIHSYGGGPVTLVQIASRIPS  61

Query  1192  -SPSALY--RIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLT  1022
              SP   Y  RIMR L+ + IF       P   S  S E   +  + +R  +Q P S    
Sbjct  62    PSPGTTYLARIMRLLVRKNIFS-AHRRQPD-GSQESHEMLYSLNQSSRWLLQGPGS----  115

Query  1021  RDGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRY  842
                E S+A  V +E    +++PW        LGD      C  +   AFE A+G+ +W +
Sbjct  116   ---ENSLAPMVLMEDHQWLMSPWH------CLGD------CVRTGGVAFEIAHGRKIWDF  160

Query  841   AESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEML  662
             A  +P  + L  D MAC +++ V AIV+                 +VDVGGG G  V  +
Sbjct  161   ASENPEFNHLFNDGMACTSKILVKAIVEG------YKHGFESIGSLVDVGGGTGGAVAEI  214

Query  661   VKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQ  482
             +K++P ++GINFDLPHVV+ AP   GV HVGG+MF+ IP ADA+F+ W++HDWG+E+CV+
Sbjct  215   IKSYPHIQGINFDLPHVVATAPAHAGVTHVGGDMFETIPHADAVFMKWIMHDWGNEDCVK  274

Query  481   ILSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNN  302
             IL  CREAIPE  GKVIIAE +L+         +G  M                      
Sbjct  275   ILKNCREAIPERNGKVIIAEVVLKP--------EGDGMFD--------------------  306

Query  301   NNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
                  E+GL+ D++M+AH+  G ER E +W  +L   GF  Y +  T  ++SII+A P
Sbjct  307   -----EIGLVFDLLMIAHSSGGKERDELEWKKILEEGGFPRYNIIKTPSMLSIIEAYP  359



>gb|AAC49708.1| caffeic acid O-methyltransferase [Pinus taeda]
Length=381

 Score =   226 bits (575),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 141/414 (34%), Positives = 207/414 (50%), Gaps = 63/414 (15%)
 Frame = -1

Query  1354  QEVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFL--ESQEQAVTLDQLSSGLGC-SPS  1184
             +E + + +   WK  F F E   VKC + LGIPD +  E     ++L ++ + L   SP 
Sbjct  25    EEEELQGQAEAWKCTFAFAESLAVKCVVLLGIPDMIAREGPRATLSLCEIVANLPTESPD  84

Query  1183  A--LYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGE  1010
             A  L+RIMRFL+ +GIF              ++++A      TR Y  TP S  L +  E
Sbjct  85    AACLFRIMRFLVAKGIFP-------------ASKSARRRAFETR-YGLTPASKWLVKGRE  130

Query  1009  KSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESD  830
              SMA  + +++    LAPW   +  VL G              AF+ ANG ++W YA   
Sbjct  131   LSMAPMLLMQNDETTLAPWHHFNECVLEG------------GVAFQKANGAEIWSYASDH  178

Query  829   PAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAF  650
             P  + L  +AMAC+AR+ + AI+        L+    V                 +V+A+
Sbjct  179   PDFNNLFNNAMACNARIVMKAILSKYQGFHSLNSLVDVGGGTGTAVAE-------IVRAY  231

Query  649   PGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSK  470
             P ++GIN+DLPHVV+ A    GV HVGG+MF+ +P ADAIF+ W++HDW DE+C++IL  
Sbjct  232   PFIRGINYDLPHVVATASSLSGVQHVGGDMFETVPTADAIFMKWIMHDWNDEDCIKILKN  291

Query  469   CREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNS  290
             CR+AIP+ TGKVII + +L   Q                            D+       
Sbjct  292   CRKAIPD-TGKVIIVDVVLDADQ------------------------GDNTDKKRKKAVD  326

Query  289   YEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
               VG + D+VM+AH+  G ERTEK+W  +L   GF  Y + +   + S+I+A P
Sbjct  327   PIVGTVFDLVMVAHSSGGKERTEKEWKRILLEGGFSRYNIIEIPALQSVIEAFP  380



>gb|KDP24165.1| hypothetical protein JCGZ_25822 [Jatropha curcas]
Length=360

 Score =   224 bits (572),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 139/402 (35%), Positives = 210/402 (52%), Gaps = 63/402 (16%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSP---SALYRIMRFLI  1154
             IW+ +FGF +  V+K A+ELGIPD + S  + ++L Q++SG+  S    + L RIMR+L+
Sbjct  18    IWQLLFGFADSMVLKAAVELGIPDIIHSHARPISLSQIASGIDSSSPDIACLERIMRYLV  77

Query  1153  NRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESS  974
              + IF      LP+  S    E     TR +R          L RD E ++   V +E+ 
Sbjct  78    RKDIFT-AHHDLPSEESDGGGEILYGLTRKSR---------WLLRDTELTLNPMVIMENH  127

Query  973   PVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMA  794
             P    PW  LS             C      AF+ A+G ++W +A  +P  +++  + +A
Sbjct  128   PWQQKPWHYLS------------QCVKEGGIAFKKAHGCEMWDFASKNPEFNRVFNEGLA  175

Query  793   CHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPH  614
             C A++ + A++    D             +VDVGGG G  +  +VK +P +KGINFDLPH
Sbjct  176   CTAKIVMRAVLSGYKD------GFEGIRTLVDVGGGTGGNLAEIVKVYPHIKGINFDLPH  229

Query  613   VVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKV  434
             VV+ A    GV HVGGNMF++IP AD +F+ W+LHDWGDE C +IL  CR+AI E+ GK+
Sbjct  230   VVATATAFDGVSHVGGNMFEQIPVADVVFMKWILHDWGDEYCAKILRNCRKAISEKNGKL  289

Query  433   IIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMM  254
             ++ E I+++                                + N N   ++G++ D++M+
Sbjct  290   VLVEIIVKE--------------------------------DGNKNEFGDMGMVFDLLML  317

Query  253   AHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             AHT  G ERTE QW  +L   GF  Y + +   + SII+A P
Sbjct  318   AHTTGGKERTEIQWKKLLEEGGFPRYNIINIPALPSIIEAFP  359



>ref|XP_010094294.1| (RS)-norcoclaurine 6-O-methyltransferase [Morus notabilis]
 gb|EXB55626.1| (RS)-norcoclaurine 6-O-methyltransferase [Morus notabilis]
Length=356

 Score =   224 bits (572),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 145/420 (35%), Positives = 209/420 (50%), Gaps = 73/420 (17%)
 Frame = -1

Query  1363  IRRQEVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGL--GCS  1190
             +   E    + + IWKY+    +   +KCA+EL IPD + S    ++L Q+++ +    S
Sbjct  1     MESNEASLRDREEIWKYMLNHADSMAIKCAVELRIPDIINSHGGPMSLAQIAAAIPDTSS  60

Query  1189  P--SALYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALL---  1025
             P  S L RIMR L+ R IF   + +               S   T  Y  T  S  L   
Sbjct  61    PDISCLARIMRLLVRRNIFTAHQSS-------------DGSGDSTTLYGLTHSSRWLLSD  107

Query  1024  TRDGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWR  845
             T D + ++A F  +E+ P ++APW   S             C      AF+ A+G+++W 
Sbjct  108   TSDDQLTLAPFFLMETHPWLMAPWHCFS------------RCVKEGGSAFQKAHGREIWD  155

Query  844   YAESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEM  665
             +A  +P  +KL  D M C AR+ + AI+    D        G    +VDVGGG G  +  
Sbjct  156   FASENPEFNKLFNDGMECTARIILKAILSEYRDGF------GSLGSLVDVGGGTGRALSE  209

Query  664   LVKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECV  485
             +VK+ P + GINFDLPHVV  AP  PGV HVGG+MF+ IP ADA+F+ W++HDWGDE+CV
Sbjct  210   IVKSHPHINGINFDLPHVVGTAPVYPGVSHVGGDMFESIPNADAVFMKWIMHDWGDEDCV  269

Query  484   QILSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNN  305
             +IL  CR+AIPE++GKV+I + +L                                  N 
Sbjct  270   KILKNCRKAIPEKSGKVVIVDLVL----------------------------------NP  295

Query  304   NNNNSY-EVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
               N  + ++ L+ D+VM+A    G ERTE QW  +L   GF  Y +     + SII+A P
Sbjct  296   EGNTLFDDMSLIWDLVMVADASGGKERTENQWKKILKEGGFPRYKIIKIPSLTSIIEAYP  355



>gb|AAD24001.1|AF119225_1 caffeic acid ortho-methyltransferase [Pinus radiata]
Length=382

 Score =   224 bits (572),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 140/414 (34%), Positives = 205/414 (50%), Gaps = 62/414 (15%)
 Frame = -1

Query  1354  QEVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFL--ESQEQAVTLDQLSSGLGC-SPS  1184
             +E + + +   WK  F F E   VKC + LGIPD +  E     ++L ++ + L   SP 
Sbjct  25    EEEELQGQAEAWKCTFAFAESLAVKCVVLLGIPDMIAREGPRATLSLGEIVAKLPTESPD  84

Query  1183  A--LYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGE  1010
             A  L+RIMRFL+ +GIF+            +S  A       TR Y  TP S  L +  E
Sbjct  85    AACLFRIMRFLVAKGIFR------------ASKSAREGGAFETR-YGLTPASKWLVKGRE  131

Query  1009  KSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESD  830
              SMA  + +++    LAPW   +  VL G              AF+ ANG ++W YA   
Sbjct  132   LSMAPMLLMQNDETTLAPWHHFNECVLEG------------GVAFQKANGAEIWSYASDH  179

Query  829   PAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAF  650
             P  + L  +AMAC+AR+ + AI+        L+    V                 +V+A+
Sbjct  180   PDFNNLFNNAMACNARIVMKAILSKYQGFHSLNSLVDVGGGTGTAVAE-------IVRAY  232

Query  649   PGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSK  470
             P ++GIN+DLPHVV+ A    GV HVGG+MF+ +P  DAIF+ W++HDW DE+C++IL  
Sbjct  233   PFIRGINYDLPHVVATASSLSGVQHVGGDMFETVPTGDAIFMKWIMHDWNDEDCIKILKN  292

Query  469   CREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNS  290
             CR+AIP+ TGKVII + +L   Q                            D+       
Sbjct  293   CRKAIPD-TGKVIIVDVVLDADQ------------------------GDNTDKKRKKAVD  327

Query  289   YEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
               VG + D+VM+AH+  G ER+EK+W  +L   GF  Y + +   + S+I+A P
Sbjct  328   PIVGTVFDLVMVAHSSGGKERSEKEWKRILLEGGFSRYNIIEIPALQSVIEAFP  381



>ref|XP_007043543.1| O-methyltransferase [Theobroma cacao]
 gb|EOX99374.1| O-methyltransferase [Theobroma cacao]
Length=353

 Score =   223 bits (569),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 140/407 (34%), Positives = 202/407 (50%), Gaps = 79/407 (19%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSP----SALYRIMRFL  1157
             IW+Y+F F +   +K A+EL I D + S   A+TL Q++S +G SP    S L RIMR L
Sbjct  17    IWQYMFSFADSMALKSAVELRIADIIHSHGGAITLSQIASCIGGSPPPDNSYLARIMRLL  76

Query  1156  INRGIFKEVEMTLPTIsstssteaalasTRPTRG----YVQTPLSALLTRDGEKSMAAFV  989
             + R +F                        P+ G    Y  T  S  L  D + ++A  V
Sbjct  77    VRRKVFS--------------------VQNPSDGGEPLYGLTLSSTWLIHDSDLTLAPMV  116

Query  988   RLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLI  809
              +E+ P  +APW   S             C      AF+ A+G+++W +A  +P  ++L 
Sbjct  117   LMENHPWQMAPWHCFS------------ECVKEGGIAFKKAHGREIWDFASENPEFNRLF  164

Query  808   EDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGIN  629
              D MAC +++   AI+    +             +VDVGGG G  +  +VKA P +KG+N
Sbjct  165   NDGMACTSKIVTRAILTGYKEGF------SCIGSLVDVGGGIGGLISEIVKANPHIKGVN  218

Query  628   FDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPE  449
             FDLPHVVS AP   GV HVGG+MF  IP ADA+ + W+LHDWGDE+C++IL  CR+AIP 
Sbjct  219   FDLPHVVSTAPAYHGVCHVGGDMFHAIPDADAVMMKWILHDWGDEDCIKILRNCRKAIPR  278

Query  448   ETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLML  269
             E GKVII E +L+                                  +  +   ++G + 
Sbjct  279   ENGKVIIVECVLKP---------------------------------DGTDPFDDMGFIF  305

Query  268   DMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             D++M+AH+  G ERTE +W  +L   GF  Y + +     SII+A P
Sbjct  306   DLLMIAHSSGGKERTELEWKKILEEGGFPRYKIINIPAFASIIEAYP  352



>gb|EYU32600.1| hypothetical protein MIMGU_mgv1a009130mg [Erythranthe guttata]
Length=352

 Score =   223 bits (567),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 150/404 (37%), Positives = 211/404 (52%), Gaps = 69/404 (17%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQA-----VTLDQLSSGLGCSPSALYRIMRF  1160
             +W Y FG+    VVKCA+EL IPD +     A     V+L +LSS +G     L+RIMRF
Sbjct  13    VWNYAFGYINCRVVKCAVELEIPDIVRKHAGAGAGGPVSLSELSSAVGVPTEPLHRIMRF  72

Query  1159  LINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLE  980
             LI+  IFK    T P      S+ +          Y  TPLS LLTRD   ++A F+ L+
Sbjct  73    LIHHRIFK----TSPPPPHAESSSSDEVH------YAATPLSGLLTRD---NLAPFMLLQ  119

Query  979   SSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDA  800
              +P    P   ++   L          +G   D  ++ NG+D W   +    H K+  D+
Sbjct  120   GTPP--GPNRGITPEALR---------TGRRPD-LKSVNGEDTWSVPDFG-YHMKVFTDS  166

Query  799   MACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDL  620
             MA HAR+A  A++   P+             ++DVGG  G  + MLVKAFP ++G   DL
Sbjct  167   MAAHARVATQAVIDNFPEGF------EGIETLLDVGGRHGMALSMLVKAFPWLRGTVLDL  220

Query  619   PHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETG  440
             P +V  AP   G+H VGG+MF+ IP ++A+ LMW+LHDW DE C+ IL KC++AIP++TG
Sbjct  221   PKIVDHAPPLEGIHFVGGSMFENIPNSNAVMLMWILHDWSDEACIDILKKCKDAIPKDTG  280

Query  439   KVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMV  260
             KV+I EA++ +  E  + Y G R                               L LDMV
Sbjct  281   KVMIVEAVIDEDGEG-DEYAGAR-------------------------------LSLDMV  308

Query  259   MMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             MM+   KG ERT K+W+++L  AGF  + V +   VVS+I+A P
Sbjct  309   MMSVMVKGKERTYKEWAYLLEEAGFSRHNVVNIKTVVSVIEAYP  352



>gb|AAB09044.1| O-methyltransferase [Pinus radiata]
Length=382

 Score =   223 bits (567),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 139/414 (34%), Positives = 203/414 (49%), Gaps = 62/414 (15%)
 Frame = -1

Query  1354  QEVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFL--ESQEQAVTLDQLSSGLGC-SPS  1184
             +E + + +   WK  F F E   VKC + LGIPD +  E     ++L ++ + L   SP 
Sbjct  25    EEEELQGQAEAWKCTFAFAESLAVKCVVLLGIPDMIAREGSRATLSLGEIVAKLPTESPD  84

Query  1183  A--LYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGE  1010
             A  L+RIMRFL+ +GIF+            +S  A       TR Y  TP S  L +  E
Sbjct  85    AACLFRIMRFLVAKGIFR------------ASKSAREGGAFETR-YGLTPASKWLVKGRE  131

Query  1009  KSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESD  830
              SMA  + +++    LAPW   +  VL G              AF+ ANG ++W YA   
Sbjct  132   LSMAPMLLMQNDETTLAPWHHFNECVLEG------------GVAFQKANGAEIWSYASDH  179

Query  829   PAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAF  650
             P  + L  +AMAC+AR+ +  I+        L+    V                 +V+A+
Sbjct  180   PDFNNLFNNAMACNARIVMKGILSKYQGFHSLNSLVDVGGGTGTAVAE-------IVRAY  232

Query  649   PGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSK  470
             P + GIN+DLPHVV+ A    GV HVGG+MF+ +P  DAIF+ W++HDW DE+C++IL  
Sbjct  233   PFITGINYDLPHVVATASSLSGVQHVGGDMFETVPTGDAIFMKWIMHDWNDEDCIKILKN  292

Query  469   CREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNS  290
             CR+AIP+ TGKVII + +L   Q                            D+       
Sbjct  293   CRKAIPD-TGKVIIVDVVLDADQ------------------------GDNTDKKRKKAVD  327

Query  289   YEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
               VG + D+VM+AH+  G ER+EK+W  +L   GF  Y + +   + S+I+A P
Sbjct  328   PIVGTVFDLVMVAHSSGGKERSEKEWKRILLEGGFSRYNIIEIPALQSVIEAFP  381



>ref|XP_008236087.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like isoform 
X2 [Prunus mume]
Length=260

 Score =   218 bits (555),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 132/266 (50%), Positives = 170/266 (64%), Gaps = 33/266 (12%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRG  1145
             IWKYVFGF E+AVVKCAIELGI D +ES    +TL +LSS L C PS LYRIMR L++  
Sbjct  22    IWKYVFGFVEIAVVKCAIELGIADAIESHGSPMTLLELSSALRCDPSPLYRIMRVLVHLK  81

Query  1144  IFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSPVM  965
             IFKE   T                    + Y QTPLS  L + GE SMAA + LESSP+M
Sbjct  82    IFKENPAT----------------QIGPKVYAQTPLSKRLLKSGENSMAALILLESSPLM  125

Query  964   LAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMACHA  785
             LAPW  LS R+            G S+  FE+ +G+DVW +A ++P HSKL  +AMAC A
Sbjct  126   LAPWHGLSARI-----------QGISNSEFESVHGEDVWSHAAANPDHSKLFNEAMACDA  174

Query  784   RMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPHVVS  605
             R+AVPA++++C ++            +VDVGGGDGTT+ +LV+A P ++GINFDLPHVVS
Sbjct  175   RVAVPAVIESCLEVF------KGIETIVDVGGGDGTTLRLLVEACPWIQGINFDLPHVVS  228

Query  604   VAPKRPGVHHVGGNMFQRIPKADAIF  527
             VA +   + +VGG+MF  +PKADA+ 
Sbjct  229   VAQECDRIENVGGDMFDCVPKADAVI  254



>gb|AFU50297.1| flavonoid O-methyltransferase 3 [Ocimum basilicum]
Length=336

 Score =   220 bits (560),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 146/401 (36%), Positives = 206/401 (51%), Gaps = 81/401 (20%)
 Frame = -1

Query  1321  WKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRGI  1142
             W++   +     +  A+EL IPD LE     ++L +LS+  GC    LYR+MRFLI  GI
Sbjct  14    WEHALSYINSTALSAAVELEIPDILEDHGGLMSLSELSAASGCPREPLYRLMRFLIFHGI  73

Query  1141  FKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSPVML  962
             F + +                        Y Q+PLS L TR+   ++  ++ ++++PV  
Sbjct  74    FTKSDDC----------------------YAQSPLSRLFTRE---NLGPYMLMQATPVTR  108

Query  961   APWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPA---HSKLIEDAMAC  791
             +P   LSG  L             +S   ++  G+D W    SDPA   H K   +AM  
Sbjct  109   SP-AGLSGEAL----------KTGTSLYLKSIRGEDSW----SDPAYGYHMKAFTNAMIA  153

Query  790   HARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPHV  611
             HAR+   AIV   P       A      VVDVGG  GT +  LV+AFP V+GI FDLP +
Sbjct  154   HARLTAAAIVSNYP------AAFDGLRSVVDVGGRHGTAIGRLVEAFPWVRGIAFDLPEI  207

Query  610   VSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKVI  431
             V+ AP R GV  VGG+MF+ +PKADA+ LMW+LHDW D++C++IL KC+EAIP  TGKV+
Sbjct  208   VADAPPRKGVDFVGGDMFESVPKADAVMLMWILHDWSDDKCIEILKKCKEAIPASTGKVM  267

Query  430   IAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMMA  251
             I +AI+ +  E  + + G R                               L LDM+M+A
Sbjct  268   IVDAIINEDGEG-DEFSGAR-------------------------------LSLDMIMLA  295

Query  250   HTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
                +G ERT K+W H+L  AGF  +TV +   + S+I+A P
Sbjct  296   VMAQGKERTYKEWVHLLNEAGFSKHTVKNIKSIESVIEAYP  336



>ref|XP_004299536.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=359

 Score =   219 bits (559),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 141/406 (35%), Positives = 202/406 (50%), Gaps = 72/406 (18%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGC-SPS----ALYRIMRF  1160
             +WKY+ GF +   +K A+EL IPD + S  QA++L  + S +   SPS     L RIMR 
Sbjct  18    VWKYMLGFADSMALKSAVELRIPDIINSHCQALSLSDIVSNIDSKSPSPDITCLSRIMRL  77

Query  1159  LINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLE  980
             L+ R IF                            Y  TP S  L +D E ++A  V L+
Sbjct  78    LVRRNIF---------------AAHHDDGDSGETLYGLTPSSRWLLQDSELTLAPMVLLQ  122

Query  979   SSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDA  800
             + P+++AP    S  V  G            + AF  A+G+D+W++   +   ++L  DA
Sbjct  123   TDPILMAPMQYFSQCVKQG-----------GTHAFSKAHGRDIWQFFSENLEANQLFNDA  171

Query  799   MACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDL  620
             MAC A + +  I+  C               +VDVGGG G     +VKA+P +K INFDL
Sbjct  172   MACSANIIMKVILARCKGAF------DDVTTLVDVGGGTGRAAAEIVKAYPSIKAINFDL  225

Query  619   PHVVSVAPKRPGVHHVGGNMFQR--IPKADAIFLMWVLHDWGDEECVQILSKCREAIPEE  446
             P+VV+ AP   GV HVGG+MF    IP ADAIF+ W++HDW D +C++IL  CR+AIPE 
Sbjct  226   PYVVATAPAYHGVSHVGGDMFDEGNIPNADAIFMKWIMHDWSDGDCIKILKNCRKAIPER  285

Query  445   TGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLD  266
             +GKVII +A+L                                   N +    + GL+ D
Sbjct  286   SGKVIIVDAVLEP---------------------------------NGDGLFDDTGLVFD  312

Query  265   MVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             ++M+ H+  G ER+E +W  +L  AGF  Y + +   VVSII+A P
Sbjct  313   LLMITHSSGGKERSESEWKQMLEQAGFPRYNIINIPAVVSIIEAYP  358



>ref|XP_010094297.1| (RS)-norcoclaurine 6-O-methyltransferase [Morus notabilis]
 gb|EXB55629.1| (RS)-norcoclaurine 6-O-methyltransferase [Morus notabilis]
Length=354

 Score =   219 bits (558),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 142/409 (35%), Positives = 203/409 (50%), Gaps = 79/409 (19%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPS-----ALYRIMRF  1160
             IWKY+F F +   ++CA+EL IPD + S    +TL Q++S +  + S      L RIMR 
Sbjct  14    IWKYMFNFADSLALRCAVELKIPDIINSHGGPITLAQIASSIPNTSSDPDISCLARIMRL  73

Query  1159  LINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRD----GEKSMAAF  992
             L+ R IF   + +               S   T  Y  T  S  L RD     + ++A  
Sbjct  74    LVRRKIFTAHQPS-------------DGSGNSTILYGLTHSSKWLLRDTLGDDQHTLAPI  120

Query  991   VRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKL  812
               +E+ P +++PW   S             C      AFE ++G+++W +A  +P  +KL
Sbjct  121   FLMETHPWLVSPWHCFS------------RCIKEGGIAFEKSHGREIWDFASENPEFNKL  168

Query  811   IEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGI  632
               D M C A++ + AI+    D             +VDVGGG G  +  +VK+ P +KG 
Sbjct  169   FNDGMECTAKIILKAILSEYKDGF------DYLGSLVDVGGGTGGALSEIVKSHPHIKGT  222

Query  631   NFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIP  452
             NFDLPHVV+ AP  PGV HVGG+MF+ IP ADA    W++HDWGDE+CV+IL  CR+AIP
Sbjct  223   NFDLPHVVATAPAYPGVSHVGGDMFESIPNADA----WIMHDWGDEDCVKILKNCRKAIP  278

Query  451   EETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSY-EVGL  275
             E++GKVII + +L                                  N   N  + + GL
Sbjct  279   EKSGKVIIIDVVL----------------------------------NPEGNGLFDDTGL  304

Query  274   MLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             + D+VM+AH   G ERTE +W  +L   GF  Y +     + SII+A P
Sbjct  305   IFDLVMVAHASGGKERTENEWKKILKEGGFSRYKIVKIPALTSIIEAYP  353



>ref|XP_008230261.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Prunus 
mume]
Length=356

 Score =   218 bits (556),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 149/427 (35%), Positives = 213/427 (50%), Gaps = 87/427 (20%)
 Frame = -1

Query  1375  DAKSIRRQEVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQ---EQAVTLDQLSS  1205
             +A+++ R + D      IWKY+FGF +   +KCA+EL I D + S    +  +TL Q++S
Sbjct  5     EAEAMLRGQAD------IWKYMFGFADSMALKCAVELRIADIIHSHAPTDHMITLSQIAS  58

Query  1204  GL-GCSP--SALYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRG----YVQ  1046
              L   SP  + L RIMR L+ R IF                        P+ G    Y  
Sbjct  59    HLVAPSPDITCLTRIMRLLVRRNIFA--------------------VHHPSEGGEPLYGL  98

Query  1045  TPLSALLTRDGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAA  866
             T  S  L  D E S+A  + +E+ P ++APW   S  V  G              AF+ A
Sbjct  99    TYSSRWLLHDSEMSLAPMLVMENHPSLMAPWHYFSQCVKEG-----------GPGAFKKA  147

Query  865   NGKDVWRYAESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvggg  686
             +G ++W +A  +P  +KL  D MAC AR+ + AI      L            +VDVGGG
Sbjct  148   HGLEIWDFASENPGFNKLFNDGMACTARIVMKAI------LTEYGHGFDGVGSLVDVGGG  201

Query  685   dgttvEMLVKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQ-RIPKADAIFLMWVLH  509
              G+ V  +V+A+P +KG NFDLPHVV+ AP   GV HVGG+MF+  IP ADA+F+ W++H
Sbjct  202   TGSAVAEIVQAYPNIKGFNFDLPHVVATAPAYHGVSHVGGDMFEDHIPNADAVFMKWIMH  261

Query  508   DWGDEECVQILSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnsk  329
             DW D +C++IL  CREAIPE  GK++I + +L    + +     TR              
Sbjct  262   DWNDCDCIKILKNCREAIPERGGKIMIVDIVLEPSGDGV--LDDTR--------------  305

Query  328   LQEKDRNNNNNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVV  149
                              L+ D+VM+AH   G+ERTE +W  +L   GF  Y +     ++
Sbjct  306   -----------------LVFDLVMIAHASGGMERTENEWEKILKEGGFPRYKIIKIPALL  348

Query  148   SIIQARP  128
             SII+A P
Sbjct  349   SIIEAYP  355



>ref|XP_010526875.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like isoform 
X2 [Tarenaya hassleriana]
Length=271

 Score =   214 bits (546),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 135/280 (48%), Positives = 169/280 (60%), Gaps = 38/280 (14%)
 Frame = -1

Query  1339  EEEDG-----IWKYVFGFTEMAVVKCAIELGIPDFLESQ-EQAVTLDQLSSGLGCSPSAL  1178
             EEE+      IW+YVFGFT+MAVVKCAIEL IP+ +ES   Q VTL  LS+ + CSP  L
Sbjct  2     EEEEARASVDIWRYVFGFTDMAVVKCAIELKIPEAVESHPAQPVTLADLSAAVACSPPLL  61

Query  1177  YRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGE--KS  1004
              RIMRFL ++GIFKEV +T   I                 GY+ TPLS L+       KS
Sbjct  62    GRIMRFLSHQGIFKEV-ITKDGIV----------------GYLSTPLSRLMMGSNRVNKS  104

Query  1003  MAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPA  824
             +A  + +ESSPVMLAPWLKLS  V           +   S  FEA +GKD+W Y   DP 
Sbjct  105   LAPLILMESSPVMLAPWLKLSAVV-------SNASADEGSQPFEAEHGKDLWGYCAEDPI  157

Query  823   HSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPG  644
             HS++  +AMAC  R  VPA+  AC D+            VVDVGGG G  + ++VKAFP 
Sbjct  158   HSEVFNEAMACDTRRVVPAVAGACADVF------EGVSTVVDVGGGKGDALGVMVKAFPW  211

Query  643   VKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFL  524
             +KG+NFDLPHVV  A K  GV +VGG+MF+R+P AD +F+
Sbjct  212   IKGLNFDLPHVVETALKFDGVENVGGDMFERVPNADVVFI  251



>ref|XP_010051722.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Eucalyptus 
grandis]
Length=359

 Score =   217 bits (553),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 138/411 (34%), Positives = 202/411 (49%), Gaps = 83/411 (20%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQE-QAVTLDQLSSGLGCSPSA----LYRIMRF  1160
             IW+Y+ GF +   + CA+EL I D + S   + VTL Q++  +  SPS     L  +MR 
Sbjct  19    IWRYMHGFADPMALNCAVELRIADIIHSHGGRPVTLAQIAWSIEGSPSPDLPYLSPVMRL  78

Query  1159  LINRGIFKEVEMTLPTIsstssteaalasTRPTRG----YVQTPLSALLTRDGEKSMAAF  992
             L+ R IF                       RP+ G    Y  T LS  L RD E ++   
Sbjct  79    LVRRNIFS--------------------VHRPSDGGDPLYGLTNLSRWLVRDSELNLVPM  118

Query  991   VRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKL  812
             V +++ PV LAPW  L              C      AF+ A+G ++W +A  +P  +K+
Sbjct  119   VIMQNHPVQLAPWHYLG------------QCVREGGIAFQKAHGVEMWEFARDNPEFNKI  166

Query  811   IEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGI  632
               DA+ C A++   A+++A  D   L G+             +      +V+A+P ++GI
Sbjct  167   FNDAVVCTAKIITKAVLEAYGDGFSLVGSVVDVGGGTGGMIAE------IVRAYPRIRGI  220

Query  631   NFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIP  452
             NFDLPHVV+ AP   G  HVGGNMF+ IPKADA+FL WVLHDWGDE+CV+IL  CR+AI 
Sbjct  221   NFDLPHVVATAPAHDG--HVGGNMFEAIPKADAVFLKWVLHDWGDEDCVKILKNCRKAIA  278

Query  451   ---EETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEV  281
                ++ GK+II + +LRD +   + ++                               + 
Sbjct  279   SSDQKPGKLIIVDLVLRDQEGSGDPFE-------------------------------DF  307

Query  280   GLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             G+  D++MMAH   G ERTE +W  +L   GF  + +     + SII+A P
Sbjct  308   GVTFDLLMMAHQSGGKERTEAEWKVLLEQGGFPRHNIIKIQALPSIIEAFP  358



>ref|XP_011039887.1| PREDICTED: LOW QUALITY PROTEIN: (R,S)-reticuline 7-O-methyltransferase-like 
[Populus euphratica]
Length=351

 Score =   217 bits (552),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 149/426 (35%), Positives = 214/426 (50%), Gaps = 90/426 (21%)
 Frame = -1

Query  1381  SMDAKSIRRQEVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSG  1202
             S+D +++ R +V+      +W+ VFGF E   +KCAIE+GI D + S +  +TL+Q++S 
Sbjct  3     SIDEETLLRGQVE------VWQLVFGFVESMALKCAIEIGIVDIINSLDGPLTLNQIASR  56

Query  1201  LGCSPSA----LYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRG----YVQ  1046
             +  SPS     L R MRFL+ + +F +                      P+ G    Y  
Sbjct  57    ID-SPSVDIPFLARXMRFLVRKRVFTQ--------------------HNPSNGGETLYRL  95

Query  1045  TPLSALLTRDGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAA  866
             T  S  L RD E S+AA V +++ P  LAPW  LS             C      AF+ A
Sbjct  96    TDNSKWLLRDSEVSLAAMVLMQNYPSHLAPWHYLS------------QCVKDGGIAFKKA  143

Query  865   NGKDVWRYAESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvggg  686
             +G + W  A  +P  +++  DA+AC A++ + A+V         H   G + V      G
Sbjct  144   HGCETWDLASQNPEFNRIFNDALACTAKIIMRAVVS--------HYKGGFDDVETLADVG  195

Query  685   dgttvEM--LVKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVL  512
              GT   +  +VKA+P +KGINF+LPHVV+ AP   GV HVGGN F+ IP AD+IF+ WVL
Sbjct  196   GGTGGNLAEIVKAYPHIKGINFELPHVVAAAPAYNGVSHVGGNFFEAIPVADSIFMKWVL  255

Query  511   HDWGDEECVQILSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknns  332
             HDWGDE CV+IL   R A+ E+TGK+I+ E +L   Q   NG  G               
Sbjct  256   HDWGDECCVKILKNYRTAMTEKTGKLILVEIVL---QPEGNGQFG---------------  297

Query  331   kLQEKDRNNNNNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDV  152
                            ++G++ D+VM AH+  G E TE +W  +L   GF  Y + +    
Sbjct  298   ---------------DMGMVSDLVMFAHSTGGKESTELEWKKLLEEGGFPRYKIFNIPAX  342

Query  151   VSIIQA  134
              SII+A
Sbjct  343   PSIIEA  348



>gb|ACO90220.1| putative O-methyltransferase [Eschscholzia californica]
Length=362

 Score =   217 bits (552),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 146/415 (35%), Positives = 210/415 (51%), Gaps = 70/415 (17%)
 Frame = -1

Query  1354  QEVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGL-GCSPS--  1184
             +E++ + +  I K +  F +   +KCA+ELGIPD + S  Q +TL ++ +G+   SPS  
Sbjct  10    EEMELQGQADICKLMLAFIDSMALKCAVELGIPDIIHSHGQPITLSEIINGIPNLSPSFD  69

Query  1183  --ALYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGE  1010
                L+RIMR L+   +F   E  L   SS + T            Y  TP S  L +D +
Sbjct  70    INYLFRIMRLLVRNRVFSAYEPDLKDGSSGTKTL-----------YGLTPSSKWLVKDSK  118

Query  1009  KSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESD  830
              S+A  V  E+ P +L PW  L              C      AF  A+G ++W++   +
Sbjct  119   ISLAPLVLAENHPWLLDPWHYLG------------KCVQEGGFAFAKAHGSEIWKFGSEN  166

Query  829   PAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAF  650
             P  +KL    MAC + + V AI+         H   G    +VDVGG  GT +  +VK +
Sbjct  167   PEFNKLFSVGMACSSTLVVDAILDN------YHEGFGDLESIVDVGGAIGTLINEIVKKY  220

Query  649   PGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSK  470
             P ++G NFDLPHVV+ A + PGV HVGG+MF  IP ADA+ L WVLHDW DE+CV+IL  
Sbjct  221   PHIRGTNFDLPHVVAEALENPGVAHVGGDMFVEIPSADAVILKWVLHDWNDEDCVKILKN  280

Query  469   CREAIPEETGKVIIAEAILR-DHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNN  293
             C +AI  + GK+II E +L+ D + + +G                               
Sbjct  281   CNKAISNK-GKLIIIECVLKPDGEGLFDG-------------------------------  308

Query  292   SYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
                +GL  D++M+AH+  G ERTE +W  +L A GF  Y +T    + SII+A P
Sbjct  309   ---LGLAFDLLMIAHSSGGRERTEAEWKKLLKAGGFSRYKITPIKGIPSIIEAYP  360



>gb|AGB06348.1| o-methyltransferase [Camellia sinensis]
Length=354

 Score =   216 bits (550),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 147/403 (36%), Positives = 205/403 (51%), Gaps = 72/403 (18%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPS----ALYRIMRFL  1157
             IWKY++ F +   +K A+EL I D + S    +TL Q+++G+  SPS     L RIMR L
Sbjct  19    IWKYMYQFADSMALKSAVELRIADIIHSHGSPITLSQIAAGIIDSPSPDITCLARIMRLL  78

Query  1156  INRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLES  977
             + R IF        T++  S    AL        Y  T +S  L    E S+A  + +E+
Sbjct  79    VRRKIF--------TVTPQSDGGEAL--------YGPTHMSRWLLHGAELSLAPMLMMEN  122

Query  976   SPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAM  797
                 LAPW  LS             C       F+ A+G+++W Y   +P  + +  DAM
Sbjct  123   DHRALAPWHYLSN------------CVREGGIGFQKAHGREIWDYCSMNPEFNNIFNDAM  170

Query  796   ACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLP  617
              C AR+ + AI+    D             +VDVGGG G  +  +VK  P +KGINFDLP
Sbjct  171   GCTARITMKAIMTGYKDAFC------GVGSMVDVGGGTGAAMGEIVKVHPHIKGINFDLP  224

Query  616   HVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGK  437
             HV++ AP+  GV HVGG+MF+ IP ADA+F+  ++HDW DE+CV IL  CR+AIPE+TGK
Sbjct  225   HVIATAPEYGGVSHVGGDMFKAIPSADAVFMKRIMHDWNDEDCVNILKNCRKAIPEKTGK  284

Query  436   VIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVM  257
             VII + +L          +G  M                           + GL+LD++M
Sbjct  285   VIIIDVVLNP--------EGDGMFD-------------------------DTGLVLDLLM  311

Query  256   MAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             +AHTG G ERTE +W  VL   GF  Y +   +   SII+A P
Sbjct  312   IAHTG-GKERTELEWKKVLEEGGFPCYNIIKIAAFPSIIEAFP  353



>ref|XP_007215606.1| hypothetical protein PRUPE_ppa007776mg [Prunus persica]
 gb|EMJ16805.1| hypothetical protein PRUPE_ppa007776mg [Prunus persica]
Length=356

 Score =   216 bits (550),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 149/429 (35%), Positives = 215/429 (50%), Gaps = 87/429 (20%)
 Frame = -1

Query  1381  SMDAKSIRRQEVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQ---EQAVTLDQL  1211
             + +A+++ R + D      IWKY+FGF +   +KCA+EL I D + S    +  +TL Q+
Sbjct  3     ATEAEAMLRGQAD------IWKYMFGFADSMALKCAVELRIADIIHSHAPTDHMITLSQI  56

Query  1210  SSGL-GCSP--SALYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRG----Y  1052
             +S L   SP  + L RIMR L+ R IF                    A   P+ G    Y
Sbjct  57    ASHLIAPSPDITCLTRIMRLLVRRNIF--------------------AVHHPSEGGEPVY  96

Query  1051  VQTPLSALLTRDGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFE  872
               T  S  L  D E S+A  + +E+ P ++APW   S  V  G              AF+
Sbjct  97    GLTYSSRWLLHDSEMSLAPMLVMENHPSLMAPWHYFSQCVREG-----------GPWAFK  145

Query  871   AANGKDVWRYAESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvg  692
              A+G ++W +A  +P  +KL  D MAC AR+ + AI+                  +VDVG
Sbjct  146   KAHGLEIWDFASENPGFNKLFNDGMACTARIVMKAILTEYGRWF------DGVGSLVDVG  199

Query  691   ggdgttvEMLVKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQ-RIPKADAIFLMWV  515
             GG G+ V  +V+A+P +KG NFDLPHVV+ AP   GV HVGG+MF+  IP ADA+F+ W+
Sbjct  200   GGTGSAVADIVQAYPNIKGFNFDLPHVVATAPAYHGVSHVGGDMFEDHIPNADAVFMKWI  259

Query  514   LHDWGDEECVQILSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknn  335
             +HDW D +C++IL  CR+AIPE  GK++IA+ +L    + +     TR            
Sbjct  260   MHDWNDSDCIKILKNCRKAIPERGGKIMIADIVLEPSGDGV--LDDTR------------  305

Query  334   skLQEKDRNNNNNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSD  155
                                L+ D+VM+AH   G ERTE +W  +L   GF  Y +     
Sbjct  306   -------------------LVFDLVMIAHASGGKERTENEWEKILKEGGFPRYKIIKIPA  346

Query  154   VVSIIQARP  128
             ++SII+A P
Sbjct  347   LLSIIEAYP  355



>ref|XP_006481835.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Citrus 
sinensis]
Length=353

 Score =   216 bits (550),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 135/402 (34%), Positives = 202/402 (50%), Gaps = 69/402 (17%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCS-PSALY--RIMRFLI  1154
             +W+ +F F +   +K A+EL + D + S    +TL QL+S +  S P   Y  R+MR L+
Sbjct  17    VWQLMFAFADSMALKSAVELRLADIMHSHGSPITLPQLASRIDSSCPDIPYLARLMRMLV  76

Query  1153  NRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESS  974
              +GIF                    +       Y  T +S  L  D E S+A  + +E++
Sbjct  77    RKGIF---------------AVHQSSDGGDETLYKMTHISKWLLHDSELSLAPMILVENN  121

Query  973   PVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMA  794
               +L PW  LS             C      AF+ A+G ++W +A   P  + L  DAMA
Sbjct  122   QWLLEPWHYLS------------QCVKEGGIAFKKAHGCEIWDFASQSPQFNNLFNDAMA  169

Query  793   CHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPH  614
             C A++ + A+V    D             + DVGGG G  +  +VK++P +KGINFDLPH
Sbjct  170   CTAKIVMKALVSHYKD------GFDSIQSLADVGGGTGGALAEIVKSYPHIKGINFDLPH  223

Query  613   VVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKV  434
             VV+ AP   G+ HVGG+MF  IPKADA+F+ W+LHDW DE CV+IL  CR+AIP+++GK+
Sbjct  224   VVATAPVCEGIFHVGGDMFDAIPKADAVFMKWILHDWDDEACVKILKNCRQAIPDKSGKL  283

Query  433   IIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMM  254
             ++ E ++++                                 + NN   ++GL+ D+VM 
Sbjct  284   VLVEIVVQE---------------------------------DGNNIFGDMGLVFDLVMF  310

Query  253   AHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             AHT  G ERTE++W  +L   GF    +     + SII+A P
Sbjct  311   AHTTGGKERTEQEWMKLLEQGGFHRCKIISMPALYSIIEAYP  352



>gb|KDO61043.1| hypothetical protein CISIN_1g018775mg [Citrus sinensis]
Length=350

 Score =   216 bits (550),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 135/402 (34%), Positives = 202/402 (50%), Gaps = 69/402 (17%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCS-PSALY--RIMRFLI  1154
             +W+ +F F +   +K A+EL + D + S    +TL QL+S +  S P   Y  R+MR L+
Sbjct  14    VWQLMFAFADSMALKSAVELRLADIMHSHGSPITLPQLASRIDSSCPDIPYLARLMRMLV  73

Query  1153  NRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESS  974
              +GIF                    +       Y  T +S  L  D E S+A  + +E++
Sbjct  74    RKGIF---------------AVHQSSDGGDETLYKMTHISKWLLHDSELSLAPMILVENN  118

Query  973   PVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMA  794
               +L PW  LS             C      AF+ A+G ++W +A   P  + L  DAMA
Sbjct  119   QWLLEPWHYLS------------QCVKEGGIAFKKAHGCEIWDFASQSPQFNNLFNDAMA  166

Query  793   CHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPH  614
             C A++ + A+V    D             + DVGGG G  +  +VK++P +KGINFDLPH
Sbjct  167   CTAKIVMKALVSHYKD------GFDSIQSLADVGGGTGGALAEIVKSYPHIKGINFDLPH  220

Query  613   VVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKV  434
             VV+ AP   G+ HVGG+MF  IPKADA+F+ W+LHDW DE CV+IL  CR+AIP+++GK+
Sbjct  221   VVATAPVCEGIFHVGGDMFDAIPKADAVFMKWILHDWDDEACVKILKNCRQAIPDKSGKL  280

Query  433   IIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMM  254
             ++ E ++++                                 + NN   ++GL+ D+VM 
Sbjct  281   VLVEIVVQE---------------------------------DGNNIFGDMGLVFDLVMF  307

Query  253   AHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             AHT  G ERTE++W  +L   GF    +     + SII+A P
Sbjct  308   AHTTGGKERTEQEWMKLLEQGGFHRCKIISMPALYSIIEAYP  349



>gb|KHG03500.1| 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase [Gossypium 
arboreum]
Length=354

 Score =   216 bits (549),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 141/421 (33%), Positives = 204/421 (48%), Gaps = 81/421 (19%)
 Frame = -1

Query  1363  IRRQEVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLG---C  1193
             I   E   + +  IW+Y++ F +   +KCA+EL I D + S    +TL Q++S +     
Sbjct  4     IELDEAMLQGQAEIWRYLYSFADSMALKCAVELRIADIIHSNGGPLTLSQIASCINGDLT  63

Query  1192  SP--SALYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRG----YVQTPLSA  1031
             SP  + L RIMR LI R IF                        P+ G    Y  T  S 
Sbjct  64    SPDITTLARIMRLLIRRKIF--------------------TVHHPSDGGDLLYDLTHSSR  103

Query  1030  LLTRDGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDV  851
              L  D ++++   V +E+ P+ +APW   S             C      AF+ A+G ++
Sbjct  104   WLLHDSKQTLMPMVLMENHPLQMAPWHYFS------------QCVKEGGFAFKKAHGCEI  151

Query  850   WRYAESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttv  671
             W  A  +P  +KL  D +AC ++     I+ +    L           +VDVGGG G  +
Sbjct  152   WDLASRNPDFNKLFNDGLACTSKFLTSVILSSYKQGL------SSIGSLVDVGGGTGGLI  205

Query  670   EMLVKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEE  491
               +VK +P +KGINFDLPHVVS AP   GV H+GG++F  IP ADA+ L W+LH WGDE+
Sbjct  206   SEIVKKYPHIKGINFDLPHVVSTAPTYNGVSHIGGDLFHAIPNADAVILKWILHCWGDED  265

Query  490   CVQILSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDR  311
             C++IL  C++AIP E GKVII E IL++                                
Sbjct  266   CIKILRNCKKAIPRENGKVIIVEIILKE--------------------------------  293

Query  310   NNNNNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQAR  131
              + +    E+G +LD+VM+AH   G ERTE +W  +L   GF  Y + +   + SII+A 
Sbjct  294   -DGSGVFDEIGFLLDLVMIAHA-NGKERTEAEWKKILEGGGFSHYKIINIPALASIIEAY  351

Query  130   P  128
             P
Sbjct  352   P  352



>ref|XP_009357074.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Pyrus 
x bretschneideri]
Length=362

 Score =   215 bits (548),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 147/415 (35%), Positives = 202/415 (49%), Gaps = 86/415 (21%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQA---------VTLDQLSSGLGCSPSALY-  1175
             IWKY+FGF +   +KCA+EL I D + S   +         + L Q++S +  SP+  Y 
Sbjct  17    IWKYMFGFADSMALKCAVELRIADIIHSHRPSDGAPNSNPMIALSQIASCIAPSPNITYL  76

Query  1174  -RIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRG----YVQTPLSALLTRDGE  1010
              RIMR L+ R IF                    A   P+ G    Y  T  S  L  D E
Sbjct  77    TRIMRLLVRRNIF--------------------AVHHPSDGGETLYGLTNSSRWLLHDAE  116

Query  1009  KSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESD  830
              S+A  + L++ P ++APW   S RV  G              AF+ A+G D+W YA  +
Sbjct  117   LSLAPMLVLQNHPCLMAPWHYFSRRVKEG-----------GPCAFKMAHGLDIWDYASQN  165

Query  829   PAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAF  650
             P  +KL  D MAC +R+   AI                   +VDVGGG G+ V  +VKA+
Sbjct  166   PEINKLFNDGMACSSRVVTKAIFTG------YEHGFDGVGSLVDVGGGTGSAVAEIVKAY  219

Query  649   PGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQ-RIPKADAIFLMWVLHDWGDEECVQILS  473
             P +KG NFDLPHVV+ AP   GV HV G+MF+  IP ADA+F+  ++HDW D +C++IL 
Sbjct  220   PNIKGFNFDLPHVVATAPVYHGVSHVAGDMFEGNIPNADAVFMKHIMHDWSDSDCIKILK  279

Query  472   KCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNN  293
              CR+AIPE++GK+II + +L  + E       TR                          
Sbjct  280   NCRKAIPEKSGKIIIVDVVLEPNGE--GTLNDTR--------------------------  311

Query  292   SYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
                  L+LD+VM+AH   G ERTE +W  +L   GF  Y V       SI++A P
Sbjct  312   -----LILDLVMIAHASGGRERTEIEWKKLLEEGGFPRYKVIKIPAFASIVEAYP  361



>gb|AFU50299.1| flavonoid O-methyltransferase 5 [Ocimum basilicum]
Length=336

 Score =   214 bits (546),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 143/401 (36%), Positives = 204/401 (51%), Gaps = 81/401 (20%)
 Frame = -1

Query  1321  WKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRGI  1142
             W +   + +   +  A+EL IPD LE+    +TL +LS+  GC    LYR+MRFLI  GI
Sbjct  14    WDHALSYIKPTALSAAVELEIPDILENHGGPMTLSELSAASGCPREPLYRLMRFLIFHGI  73

Query  1141  FKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSPVML  962
             F + +                        Y Q+PLS L T +   ++  ++ ++++PV  
Sbjct  74    FTKSD----------------------DCYAQSPLSRLFTTE---NLGPYMLMQATPVTR  108

Query  961   APWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPA---HSKLIEDAMAC  791
              P   LSG  L             +S   ++  G+D W    SDPA   H K   +AM  
Sbjct  109   CP-TGLSGEAL----------KTGTSLYLKSIRGEDSW----SDPAYGYHMKAFTNAMTA  153

Query  790   HARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPHV  611
             HAR+   AIV+  P       A      VVDVG   GT +  LV+AFP V+GI FDLP +
Sbjct  154   HARLTAAAIVRNYP------AAFDGVQSVVDVGSRHGTAIGKLVEAFPWVRGIAFDLPEI  207

Query  610   VSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKVI  431
             V+ AP R GV  VGG+MF+ +PKADA+ LMW+LHDW D++C++IL KC+EAIP   GKV+
Sbjct  208   VADAPPRKGVDFVGGDMFESVPKADAVMLMWILHDWSDDKCIEILKKCKEAIPANIGKVM  267

Query  430   IAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMMA  251
             I +AI+ +  E  + + GTR                               L LDM+M+A
Sbjct  268   IVDAIINEDGEG-DEFSGTR-------------------------------LSLDMIMLA  295

Query  250   HTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
                +G ERT K+W H+L  AGF  +T+ +   +  +I+A P
Sbjct  296   VMAQGKERTYKEWVHLLNEAGFSKHTIKNIKAMEFVIEAYP  336



>gb|KHG18226.1| RS-norcoclaurine 6-O-methyltransferase [Gossypium arboreum]
Length=355

 Score =   215 bits (547),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 143/421 (34%), Positives = 204/421 (48%), Gaps = 81/421 (19%)
 Frame = -1

Query  1363  IRRQEVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLG---C  1193
             I   E   + +  IW+Y+F F +   +K A+EL I D + S   A TL Q++S +     
Sbjct  4     IELDEARLQGQAEIWRYMFSFADSMALKSAVELRIADIIYSYGGAATLSQIASCINDGLT  63

Query  1192  SP--SALYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRG----YVQTPLSA  1031
             SP  + L RIMR L  R IF                        P+ G    Y  T  S 
Sbjct  64    SPDITTLARIMRLLARRKIF--------------------TIHHPSDGRDSLYNLTHSSR  103

Query  1030  LLTRDGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDV  851
              L  D E+S+A  V +E+ P  +APW   S             C     DAF+ A+G ++
Sbjct  104   WLLHDSEQSLAPMVLMENHPWQMAPWHYFS------------QCVKEGGDAFKKAHGCEI  151

Query  850   WRYAESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttv  671
             W  A  +P  +KL  D +AC +++   AI+                  +VDVGGG G  +
Sbjct  152   WDLASRNPDFNKLFNDGLACTSKVITSAILSG------YKQGFNSIGSLVDVGGGTGGLI  205

Query  670   EMLVKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEE  491
               ++K +P +K +NFDLPHVVS AP   GV H+GG+MF  IP  DAI + W+LHDW DE+
Sbjct  206   SEIIKVYPHIKCVNFDLPHVVSTAPAYNGVSHIGGDMFHAIPNTDAIIMKWILHDWDDED  265

Query  490   CVQILSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDR  311
             C++IL  C++AIP+E GKVII E IL++         G+ +                   
Sbjct  266   CIKILKNCKKAIPKENGKVIIIEIILKE--------DGSGLFD-----------------  300

Query  310   NNNNNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQAR  131
                     E+G +LD+ M+AHT  G ERTE +W  +L   GF  Y + +   ++SII+A 
Sbjct  301   --------EIGFILDLAMIAHT-NGKERTEVEWKKILEGGGFFHYKIINIPSLLSIIEAY  351

Query  130   P  128
             P
Sbjct  352   P  352



>ref|XP_008358433.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like isoform 
X2 [Malus domestica]
Length=291

 Score =   213 bits (542),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 126/284 (44%), Positives = 170/284 (60%), Gaps = 37/284 (13%)
 Frame = -1

Query  1342  YEEED-----GIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSAL  1178
             +EEE+      +WKYVFGF E+AVVKCAIELGI + +ES    +TL +LSS L C PS L
Sbjct  10    WEEEEEHAKVDVWKYVFGFVEIAVVKCAIELGIAEAIESHGSPMTLLELSSALSCDPSHL  69

Query  1177  YRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMA  998
             YR+MR L++  +FKE+                      ++GY QTPLS  L + GE SM 
Sbjct  70    YRVMRVLVHLKLFKEITTN----------------QLGSKGYAQTPLSHRLLKSGENSMV  113

Query  997   AFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHS  818
             A + LESSPVMLAPW  LS R+              S+  FE  +G+D+W +  ++P HS
Sbjct  114   ALILLESSPVMLAPWHGLSARIR----------GNISNQLFEEVHGEDLWSFGAANPDHS  163

Query  817   KLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVK  638
             KL  DAM C  + AVPA++++C ++            +VDVGGG+GT + +LV+  P ++
Sbjct  164   KLFNDAMTCDVKAAVPAVIKSCIEVF------KGLETIVDVGGGNGTMLRLLVEGCPWIR  217

Query  637   GINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHD  506
             GINFDLPHVVS A     V +VGG+MF R+PKADA+ +   L D
Sbjct  218   GINFDLPHVVSAAQDCDRVENVGGDMFDRVPKADAVIIKCKLVD  261



>ref|XP_008346111.1| PREDICTED: LOW QUALITY PROTEIN: (RS)-norcoclaurine 6-O-methyltransferase-like 
[Malus domestica]
Length=262

 Score =   211 bits (537),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 128/278 (46%), Positives = 170/278 (61%), Gaps = 37/278 (13%)
 Frame = -1

Query  1342  YEEED-----GIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSAL  1178
             +EEE+      +WKYVFGF E+ V+KCAIELGI + +E++   +TL +LSS L C PS +
Sbjct  10    WEEEEEHVKVDVWKYVFGFVEIVVIKCAIELGIAEAIETRGSPMTLLELSSALRCDPSHI  69

Query  1177  YRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMA  998
             YRIMR L++  IFKE                       ++ Y QTPLS LL + GE SMA
Sbjct  70    YRIMRVLVHLKIFKE----------------QTTIQLGSKSYAQTPLSRLLLKSGEXSMA  113

Query  997   AFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHS  818
               + LESSP MLAPW  LS RV  G+  N           FE  +GKD+W +  ++P H+
Sbjct  114   ELILLESSPTMLAPWHSLSSRV-QGNLRN---------PVFEELHGKDLWSFGVANPDHN  163

Query  817   KLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVK  638
             KL  +AMAC AR+AVPA+V++C  +            +VDVGGG+ TT+ +LV+A P ++
Sbjct  164   KLFNEAMACDARLAVPALVKSCVKVF------KGVGTLVDVGGGNETTLRLLVEACPWIQ  217

Query  637   GINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFL  524
             GINFDLPHVVS A K   + +VGGNMF  +PKADAI +
Sbjct  218   GINFDLPHVVSDAQKPDRIEYVGGNMFDCVPKADAIII  255



>ref|XP_006430285.1| hypothetical protein CICLE_v10012087mg [Citrus clementina]
 gb|ESR43525.1| hypothetical protein CICLE_v10012087mg [Citrus clementina]
Length=350

 Score =   214 bits (544),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 136/401 (34%), Positives = 201/401 (50%), Gaps = 69/401 (17%)
 Frame = -1

Query  1321  WKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCS-PSALY--RIMRFLIN  1151
             W+ +F F +   +K A+EL + D + S    +TL QL+S +  S P   Y  R+MR L+ 
Sbjct  15    WQLMFAFADSMALKSAVELRLADIMHSHGSPITLPQLASRIDSSCPDIPYLARLMRMLVR  74

Query  1150  RGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSP  971
             +GIF                    +       Y  T +S  L  D E S+A  + +E++ 
Sbjct  75    KGIF---------------AVHQSSDGGDETLYKMTHISKWLLHDSELSLAPMILVENNQ  119

Query  970   VMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMAC  791
              +L PW  LS             C      AF+ A+G  +W +A  +P  + L  DAMAC
Sbjct  120   WLLEPWHYLS------------QCVKEGGIAFKKAHGCGIWDFASQNPQFNNLFNDAMAC  167

Query  790   HARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPHV  611
              A++ + A+V    D             +VDVGGG G  +  +VK++P +KGINFDLPHV
Sbjct  168   TAKIVMKALVSHYKD------GFDSIQSLVDVGGGTGGALAEIVKSYPHIKGINFDLPHV  221

Query  610   VSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKVI  431
             V+ AP   G+ HVGG+MF  IPKADA+F+ W+LHDW DE CV+IL  CR+AIP++ GK++
Sbjct  222   VATAPVCEGIFHVGGDMFDAIPKADAVFMKWILHDWDDEACVKILKNCRQAIPDKNGKLV  281

Query  430   IAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMMA  251
             + E ++++                                 + NN   ++GL+ D+VM A
Sbjct  282   LVEIVVQE---------------------------------DGNNIFGDMGLVFDLVMFA  308

Query  250   HTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             HT  G ERTE++W  +L   GF    +     + SII+A P
Sbjct  309   HTTGGKERTEQEWMKLLEQGGFHRCKIISMPALYSIIEAYP  349



>ref|XP_004139935.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Cucumis 
sativus]
 ref|XP_004154552.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Cucumis 
sativus]
 gb|KGN46755.1| hypothetical protein Csa_6G128650 [Cucumis sativus]
Length=357

 Score =   214 bits (544),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 144/410 (35%), Positives = 204/410 (50%), Gaps = 83/410 (20%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCS-PSA------LYRIM  1166
             IWKY+  F +   +KCA+EL + D + S    ++L Q++S +  S PS+      L RIM
Sbjct  19    IWKYMLCFADSMALKCAVELHLADIINSHGSPISLSQIASSIAASNPSSAPQISYLNRIM  78

Query  1165  RFLINRGIFKEVEMTLPTIsstssteaalasTRPTRG----YVQTPLSALLTRDGEKSMA  998
             R L+ R IF                    A+  P+ G    Y  T  S  L RD   ++A
Sbjct  79    RLLVRRNIF--------------------AAHHPSDGGDALYGLTHSSKWLLRDSPLTLA  118

Query  997   AFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHS  818
                  E    M+ PWL  +G V  G               F+ ANG D+W +A  +P  +
Sbjct  119   PMAFSELHQWMVNPWLCFTGAVKEG------------GSPFKIANGLDIWDFAFKNPQFN  166

Query  817   KLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVK  638
                 +AMA  +++ + A++    D             + DVGGG G ++  +VKA P +K
Sbjct  167   HFFNNAMASTSKVVMNAVLSVYLD------GFNSVHSLADVGGGIGGSISEIVKALPHIK  220

Query  637   GINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREA  458
             GIN+DLPHVVS AP   GV H+GG+MF+ IPKADAIF+ W+LHDW D+ECV+IL  C++A
Sbjct  221   GINYDLPHVVSTAPVYEGVIHIGGDMFEDIPKADAIFMKWILHDWNDKECVKILENCKKA  280

Query  457   IPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVG  278
             IPE+ GKVII + +L  ++E    +  TR                               
Sbjct  281   IPEKRGKVIIVDVVL--NEEGKGAFDDTR-------------------------------  307

Query  277   LMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
                D++M+AHT  G ERTEK+W  +L  AGF  Y +     +VSII+A P
Sbjct  308   FYFDLLMLAHTN-GKERTEKEWKTILEEAGFSRYKLIPLPALVSIIEAYP  356



>dbj|BAC78828.1| caffeic acid O-methyltransferase [Rosa chinensis var. spontanea]
Length=359

 Score =   214 bits (544),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 144/430 (33%), Positives = 209/430 (49%), Gaps = 91/430 (21%)
 Frame = -1

Query  1378  MDAKSIRRQEVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGL  1199
             +D  S+R Q         +WKY+  F +   +K A+EL IPD + S + A+TL +++   
Sbjct  7     LDEASLRGQA-------DVWKYMLRFADSMALKSAVELRIPDIIHSHDHALTLSEITCSF  59

Query  1198  -GCSPS----ALYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRG------Y  1052
                SPS     L RIMR L+ R IF                       +P  G      Y
Sbjct  60    DSASPSPDITCLSRIMRLLVRRNIFT---------------------AQPDGGDSGETLY  98

Query  1051  VQTPLSALLTRDGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFE  872
               T  S  L  D E ++A  V +E++  ++ PW   S  V  G           +  AFE
Sbjct  99    GLTHSSRWLLHDSEFTLAPMVLMETNSTLMEPWHCFSQCVKQG-----------TPCAFE  147

Query  871   AANGKDVWRYAESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvg  692
              A+G+D+W++    P  ++L  D M+C A++ + A++          G       +VDVG
Sbjct  148   KAHGRDIWQFFSEKPEFNRLFNDGMSCTAKITMKAMLTG------YKGGFDNVATLVDVG  201

Query  691   ggdgttvEMLVKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQ--RIPKADAIFLMW  518
             GG G+ V  +VK +P +KGINFDLPHVV++AP+  GV HVGG+MF    IP  DAIF+ W
Sbjct  202   GGTGSAVAEIVKLYPSIKGINFDLPHVVAIAPEYHGVSHVGGDMFDGGNIPNTDAIFMKW  261

Query  517   VLHDWGDEECVQILSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntkn  338
             ++HDW D +CV+IL  CR+AIPE +GKVII + +L                         
Sbjct  262   IMHDWSDNDCVKILKNCRKAIPERSGKVIIVDVVLEP-----------------------  298

Query  337   nskLQEKDRNNNNNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTS  158
                       N +    + GL+ D++M+AH   G ERTE +W  +L  AGF  Y +    
Sbjct  299   ----------NGDGMFDDTGLVFDLLMIAHASGGKERTESEWKKMLELAGFPRYKIIKIP  348

Query  157   DVVSIIQARP  128
              + SII+A P
Sbjct  349   ALSSIIEAYP  358



>ref|XP_006858228.1| hypothetical protein AMTR_s00062p00190100 [Amborella trichopoda]
 gb|ERN19695.1| hypothetical protein AMTR_s00062p00190100 [Amborella trichopoda]
Length=353

 Score =   213 bits (542),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 156/423 (37%), Positives = 211/423 (50%), Gaps = 76/423 (18%)
 Frame = -1

Query  1378  MDAKSIRRQEVDYEEEDG---IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLS  1208
             M  K  + Q+   EE +    IW+++FG  +   + CA+ LG+ D + +  + +TL  L+
Sbjct  1     MAFKETQHQQQGKEEVEAQAVIWEHMFGMAKTMALNCAVRLGLADIIHAHGRPITLFHLA  60

Query  1207  SGLG---CSPSALYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPL  1037
             S L     +P  L+R+MRFL++  +F +                          Y  TP 
Sbjct  61    SLLPIQPVNPDRLHRLMRFLVHTHLFAKT----------------TGLNGDEETYWLTPS  104

Query  1036  SALLTRDGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGK  857
             S LL R  EKSM+ F R+    V  +PWL L   +  G            + AFE   G 
Sbjct  105   SQLLLRHAEKSMSGFARVHEMTV--SPWLSLGPCLEEG-----------VASAFEKTYGM  151

Query  856   DVWRYAESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgt  677
               W Y+ S P  ++   +AMAC AR+ +PAIV  C  LL           VVDVGGG GT
Sbjct  152   SRWEYSASHPDENRAFNEAMACLARLVMPAIVGGCERLL------QGARSVVDVGGGTGT  205

Query  676   tvEMLVKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGD  497
              V  L KAFP VK   +DLPHVV+   +  GV  VGG+MF  IPKAD +FLM +LHDWGD
Sbjct  206   AVGALAKAFPSVKFTLYDLPHVVATVGELNGVDTVGGDMFSAIPKADVVFLMRILHDWGD  265

Query  496   EECVQILSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEK  317
             +EC++IL + R+AIPEE GKVII + +L++ +E +  ++  RM                 
Sbjct  266   KECLEILKQIRKAIPEE-GKVIIVDVVLKEEEEHV--FRHARMG----------------  306

Query  316   DRNNNNNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQ  137
                            LDMVMM  TG G ER E +W+ +L  AGFK Y V     V SII 
Sbjct  307   ---------------LDMVMMVQTG-GKERDEGEWAKLLHDAGFKKYEVVPIMAVYSIIV  350

Query  136   ARP  128
             A P
Sbjct  351   AFP  353



>ref|XP_010052213.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Eucalyptus 
grandis]
 gb|KCW89562.1| hypothetical protein EUGRSUZ_A01846 [Eucalyptus grandis]
Length=361

 Score =   213 bits (542),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 137/407 (34%), Positives = 202/407 (50%), Gaps = 73/407 (18%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQ-EQAVTLDQLSSGLGCSPSA----LYRIMRF  1160
             IW+Y+  F +  V+ CA+EL I D + S   + VTL Q++  +  SPS     L R+MR 
Sbjct  19    IWRYMLSFADSMVLNCAVELRIADIIHSHGGRPVTLAQIARSIEGSPSPDLPYLSRVMRL  78

Query  1159  LINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLE  980
             L+ R IF    +  P+            S  P  G   +  S  L RD E ++   V +E
Sbjct  79    LVRRNIFS---VHHPS-----------DSGDPLYGLTDS--SRWLVRDSELNLVPMVIME  122

Query  979   SSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDA  800
             + P+ LAPW  L              C      AF+ A+G  +W +A  +P  +K+  +A
Sbjct  123   NHPLQLAPWHCLG------------QCVREGGIAFQKAHGVKMWEFAGDNPEFNKMFNEA  170

Query  799   MACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDL  620
             MAC A++ + A+++A  D   L G+             +      +V+A+P ++GINFDL
Sbjct  171   MACTAKIIMKAVLEAYGDGFSLVGSVVDVGGGTGGVIAE------IVRAYPHIRGINFDL  224

Query  619   PHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIP---E  449
              HVV+ AP   GV HVGG+MF+ IPKADA+FL WVLHDWGDE+CV+IL  CR+AI    +
Sbjct  225   LHVVATAPAHDGVEHVGGSMFEAIPKADAVFLKWVLHDWGDEDCVKILKNCRKAIASSDQ  284

Query  448   ETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLML  269
             + GK+I+ + +L                                DR  +     +VG+  
Sbjct  285   KPGKLIMVDLVLL-------------------------------DREGSGGLFEDVGVTF  313

Query  268   DMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             D++MMAH   G ERTE +W  +L   GF  + +     + SII+A P
Sbjct  314   DLLMMAHQSGGKERTESEWKLLLEQGGFPRHNIIKIQALPSIIEAFP  360



>gb|KCW89506.1| hypothetical protein EUGRSUZ_A01797 [Eucalyptus grandis]
Length=370

 Score =   212 bits (540),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 137/420 (33%), Positives = 202/420 (48%), Gaps = 90/420 (21%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQE-QAVTLDQLSSGLGCSPSA----LYRIMRF  1160
             IW+Y+ GF +   + CA+EL I D + S   + VTL Q++  +  SPS     L  +MR 
Sbjct  19    IWRYMHGFADPMALNCAVELRIADIIHSHGGRPVTLAQIAWSIEGSPSPDLPYLSPVMRL  78

Query  1159  LINRGIFKEVEMTLPTIsstssteaalasTRPTRG----YVQTPLSALLTRDGEKSMAAF  992
             L+ R IF                       RP+ G    Y  T LS  L RD E ++   
Sbjct  79    LVRRNIFS--------------------VHRPSDGGDPLYGLTNLSRWLVRDSELNLVPM  118

Query  991   VRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKL  812
             V +++ PV LAPW  L              C      AF+ A+G ++W +A  +P  +K+
Sbjct  119   VIMQNHPVQLAPWHYLG------------QCVREGGIAFQKAHGVEMWEFARDNPEFNKI  166

Query  811   IEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGI  632
               DA+ C A++   A+++A  D   L G+             +      +V+A+P ++GI
Sbjct  167   FNDAVVCTAKIITKAVLEAYGDGFSLVGSVVDVGGGTGGMIAE------IVRAYPRIRGI  220

Query  631   NFDLPHVVSVAPKR---------PGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQI  479
             NFDLPHVV+ AP             + HVGGNMF+ IPKADA+FL WVLHDWGDE+CV+I
Sbjct  221   NFDLPHVVATAPAHDVCFLWILISNMEHVGGNMFEAIPKADAVFLKWVLHDWGDEDCVKI  280

Query  478   LSKCREAIP---EETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRN  308
             L  CR+AI    ++ GK+II + +LRD +   + ++                        
Sbjct  281   LKNCRKAIASSDQKPGKLIIVDLVLRDQEGSGDPFE------------------------  316

Query  307   NNNNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
                    + G+  D++MMAH   G ERTE +W  +L   GF  + +     + SII+A P
Sbjct  317   -------DFGVTFDLLMMAHQSGGKERTEAEWKVLLEQGGFPRHNIIKIQALPSIIEAFP  369



>gb|KDP26293.1| hypothetical protein JCGZ_22278 [Jatropha curcas]
Length=242

 Score =   208 bits (529),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 131/292 (45%), Positives = 169/292 (58%), Gaps = 50/292 (17%)
 Frame = -1

Query  1003  MAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPA  824
             MAAFV LESSPVMLAPW  LS  V L           +    F+AA+G  +W+Y  ++P 
Sbjct  1     MAAFVLLESSPVMLAPWHFLSSHVRL-----------NGPTPFDAAHGDHLWKYTAANPG  49

Query  823   HSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPG  644
             HS L  DAMAC+AR  V ++V+ C ++            +VDVGGG GT +  LVK  P 
Sbjct  50    HSNLFNDAMACNARNMVSSMVEGCIEVF------DGLKTLVDVGGGKGTALSTLVKLCPW  103

Query  643   VKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCR  464
             ++GINFDLPHVV VA +  GV HVGG+MFQ +PKADA FLMWVLHDW D+EC+ IL KC+
Sbjct  104   IQGINFDLPHVVDVAEECDGVKHVGGDMFQSVPKADAAFLMWVLHDWNDDECIHILKKCK  163

Query  463   EAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYE  284
             EAIP+E GKVII E ++ + ++                                 +    
Sbjct  164   EAIPKENGKVIIVEVVVDEAKD---------------------------------DKLEF  190

Query  283   VGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             V L LDMVMMAH+  G ERT K W +VL  AGF  +T+   + + S+I+A P
Sbjct  191   VRLALDMVMMAHSTTGKERTSKDWEYVLKEAGFSRHTIKSIATLQSVIEAFP  242



>gb|KCW89504.1| hypothetical protein EUGRSUZ_A01795 [Eucalyptus grandis]
Length=353

 Score =   211 bits (536),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 144/411 (35%), Positives = 209/411 (51%), Gaps = 78/411 (19%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQE-QAVTLDQLSSGLGCSPSA----LYRIMRF  1160
             IW+Y+ GF +   + CA+EL I D + S   + VTL Q++  +  SPS     L R+MR 
Sbjct  8     IWRYMLGFADSMALNCAVELRIADIIHSHGGRRVTLAQIARSIEGSPSPDLPYLSRVMRL  67

Query  1159  LINRGIFKEVEMTLPTIsstssteaalasTRPTRG----YVQTPLSALLTRDGEKSMAAF  992
             L+ R IF                       RP+ G    Y  T LS  L RD E ++   
Sbjct  68    LVRRNIFS--------------------VHRPSDGGDPLYGLTDLSRWLVRDSEMNLVPM  107

Query  991   VRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKL  812
             V +++ PV LAPW  L              C      AF+ A+G ++W +A  +P  +K+
Sbjct  108   VIMQNHPVQLAPWHFLG------------QCVREGGIAFQKAHGVEMWEFAGDNPKLNKM  155

Query  811   IEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGI  632
               DAMAC A++ + A+++      +     G+   VVDVGGG G  +  +V+A+P ++GI
Sbjct  156   FNDAMACTAKIIMKAVLE------VYGDGVGLVGSVVDVGGGTGGVIAEIVRAYPHIRGI  209

Query  631   NFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIP  452
             NFDLPHVV+ AP    V H+GG+MF+ IP ADA+FL WVLHDWGDE+CV+IL  CR++I 
Sbjct  210   NFDLPHVVATAPAYDRVEHMGGSMFEAIPTADAVFLKWVLHDWGDEDCVKILKNCRKSIA  269

Query  451   ---EETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEV  281
                ++ GK+II + +L  H     G  G   +                          ++
Sbjct  270   SSDQKPGKLIIVDVVL--HDRDDGGGSGDLFE--------------------------DI  301

Query  280   GLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             G+  D++MMAH   G ERTE +W  +L   GF  Y +     + SII+A P
Sbjct  302   GVTFDLLMMAHQSGGKERTEAEWKVLLEQGGFPRYNIIKIQALPSIIEAFP  352



>gb|AAR09599.1| flavonoid 7-O-methyltransferase [Mentha x piperita]
Length=344

 Score =   210 bits (534),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 145/404 (36%), Positives = 208/404 (51%), Gaps = 79/404 (20%)
 Frame = -1

Query  1321  WKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRGI  1142
             W + FGF + ++VK A+ELGIPD LES+   V++ +L++ + CS   LYR+MRFL   GI
Sbjct  14    WNHGFGFIKTSIVKTAVELGIPDILESRGAPVSIPELAAAVDCSADRLYRVMRFLAYHGI  73

Query  1141  FKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRL-----ES  977
             FK  E    +    S              Y QT +S  LTR+   ++  FV L     E 
Sbjct  74    FKRTEPPPESTGGGSVY------------YAQTLVSRRLTRE---NLGPFVLLQGTMREP  118

Query  976   SPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHS-KLIEDA  800
             S  + A  L++S R  L D+N+       S   +E             DP  S K+  DA
Sbjct  119   SGCVTAETLRMSKRPGLVDDND-------SDRLYE-------------DPVFSMKVFRDA  158

Query  799   MACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDL  620
             MA HARM   A+++   +  L          +VDVGG  G  + MLVKAFP ++GI FDL
Sbjct  159   MASHARMTTAAVIENYGEGFL------GVGSLVDVGGSYGMALSMLVKAFPWLRGICFDL  212

Query  619   PHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETG  440
             P VV+ A    GV  V G+MF+ IPKAD + LM+VLH+W DEECV+IL +C++A+P+  G
Sbjct  213   PEVVARASPLKGVEFVAGSMFESIPKADVVMLMFVLHNWSDEECVEILKRCKDAVPKNKG  272

Query  439   KVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMV  260
             KVII +A++                                D + N +      L LD+ 
Sbjct  273   KVIIIDAVI--------------------------------DEDGNGDEFTGARLGLDVT  300

Query  259   MMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             MMA+  +G ERT  +W+H++  AGF+ + V +   + S+I+A P
Sbjct  301   MMANMFEGRERTYVEWAHIINEAGFRRHVVKNIKTLESVIEAYP  344



>ref|XP_010051706.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Eucalyptus 
grandis]
Length=364

 Score =   211 bits (536),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 144/411 (35%), Positives = 209/411 (51%), Gaps = 78/411 (19%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQE-QAVTLDQLSSGLGCSPSA----LYRIMRF  1160
             IW+Y+ GF +   + CA+EL I D + S   + VTL Q++  +  SPS     L R+MR 
Sbjct  19    IWRYMLGFADSMALNCAVELRIADIIHSHGGRRVTLAQIARSIEGSPSPDLPYLSRVMRL  78

Query  1159  LINRGIFKEVEMTLPTIsstssteaalasTRPTRG----YVQTPLSALLTRDGEKSMAAF  992
             L+ R IF                       RP+ G    Y  T LS  L RD E ++   
Sbjct  79    LVRRNIFS--------------------VHRPSDGGDPLYGLTDLSRWLVRDSEMNLVPM  118

Query  991   VRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKL  812
             V +++ PV LAPW  L              C      AF+ A+G ++W +A  +P  +K+
Sbjct  119   VIMQNHPVQLAPWHFLG------------QCVREGGIAFQKAHGVEMWEFAGDNPKLNKM  166

Query  811   IEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGI  632
               DAMAC A++ + A+++      +     G+   VVDVGGG G  +  +V+A+P ++GI
Sbjct  167   FNDAMACTAKIIMKAVLE------VYGDGVGLVGSVVDVGGGTGGVIAEIVRAYPHIRGI  220

Query  631   NFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIP  452
             NFDLPHVV+ AP    V H+GG+MF+ IP ADA+FL WVLHDWGDE+CV+IL  CR++I 
Sbjct  221   NFDLPHVVATAPAYDRVEHMGGSMFEAIPTADAVFLKWVLHDWGDEDCVKILKNCRKSIA  280

Query  451   ---EETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEV  281
                ++ GK+II + +L  H     G  G   +                          ++
Sbjct  281   SSDQKPGKLIIVDVVL--HDRDDGGGSGDLFE--------------------------DI  312

Query  280   GLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             G+  D++MMAH   G ERTE +W  +L   GF  Y +     + SII+A P
Sbjct  313   GVTFDLLMMAHQSGGKERTEAEWKVLLEQGGFPRYNIIKIQALPSIIEAFP  363



>ref|XP_006446728.1| hypothetical protein CICLE_v10015708mg [Citrus clementina]
 gb|ESR59968.1| hypothetical protein CICLE_v10015708mg [Citrus clementina]
Length=362

 Score =   210 bits (535),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 134/410 (33%), Positives = 207/410 (50%), Gaps = 67/410 (16%)
 Frame = -1

Query  1339  EEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPS---ALYRI  1169
             E +  +W ++F F     +KCA+ELGIPD +    + +TL++L S L  +PS    +YR+
Sbjct  14    EAQAHVWNHIFNFINSMSLKCAVELGIPDLINKHGKPMTLNELVSALTINPSKTRCVYRL  73

Query  1168  MRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFV  989
             MR LI+ G F +  +            ++  +    +GYV T  S LL +D   S+  F+
Sbjct  74    MRILIHSGFFAQQTLN-----------SSRNNNDEEQGYVLTNASKLLLKDNPLSVTPFL  122

Query  988   RLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLI  809
             +    P++L+PWLKLS            +        F+ A+GK  W YA  +P  +   
Sbjct  123   QAMLDPILLSPWLKLS-----------TWFQNDDPTPFDTAHGKSFWEYAGDEPKINNFF  171

Query  808   EDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGIN  629
              +AMA  AR+A   ++  C D+            +VDVGGG GT  + + KAFP ++  +
Sbjct  172   NEAMASDARLATSVVIHKCKDVF------EGLNSLVDVGGGTGTVAKAIAKAFPNLECTD  225

Query  628   FDLPHVVS-VAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIP  452
             FDLPHVV+ +      + +VGG++F+ IP ADA+   W+LHDW DEECV+IL KC+EAI 
Sbjct  226   FDLPHVVNGLESDLANLKYVGGDVFEAIPPADAVLFKWILHDWNDEECVKILQKCKEAIT  285

Query  451   EET--GKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVG  278
              +   GKVII + ++R++++                                ++ S E  
Sbjct  286   SDVKKGKVIIID-MMRENKK-------------------------------GDSESIETQ  313

Query  277   LMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             L  DM+MM     G ER EK+W+ +   AGF  Y +T    + S+I+  P
Sbjct  314   LFFDMLMMVLV-TGTERDEKEWAKLFADAGFSDYKITPILGLRSLIEVYP  362



>ref|XP_006841690.1| hypothetical protein AMTR_s00003p00247710 [Amborella trichopoda]
 gb|ERN03365.1| hypothetical protein AMTR_s00003p00247710 [Amborella trichopoda]
Length=351

 Score =   210 bits (534),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 139/412 (34%), Positives = 209/412 (51%), Gaps = 71/412 (17%)
 Frame = -1

Query  1354  QEVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGC-SPSA-  1181
             Q+ D   +   W+    F +   +KCA+ELGIP  + ++ Q +TL ++ + L   SP + 
Sbjct  4     QDEDARGQAEFWQLTLAFADSLTLKCAVELGIPQLIHAKGQPLTLSEIITSLQAPSPDSW  63

Query  1180  -LYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKS  1004
              L R+MRFL+ + +F E                          Y  T  S  L R G   
Sbjct  64    CLSRVMRFLVKKRVFSE------------------EVKEGEAYYGLTRASKWLVRPGTSG  105

Query  1003  MAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPA  824
             +A  + + + P+ LAPW  LS  V+ G N            AFE A+G  +++YA ++P 
Sbjct  106   LAPMLTMLNHPIFLAPWQCLSQCVVEGGN------------AFEKAHGSKIFKYALNNPG  153

Query  823   HSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPG  644
              +++  +AMA  AR+ + A++                  +VDVGGG GT V  +VKA P 
Sbjct  154   SNEIFNEAMASDARVVLDALLSQ------YKSGFAGLTSLVDVGGGTGTAVIAIVKAHPH  207

Query  643   VKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCR  464
             + GINFDLPHVVS AP+ PGV +V G+MF  IP ADA+F+ W+LHDW DE+CV+IL +CR
Sbjct  208   ISGINFDLPHVVSSAPEHPGVVNVSGDMFISIPHADAVFMKWILHDWKDEDCVKILKQCR  267

Query  463   EAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYE  284
             +A+P ++GK+II + +L   +E  + +  +R                             
Sbjct  268   KALPSKSGKLIIVDVVLH-LKEDTSAFADSR-----------------------------  297

Query  283   VGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
               L  DM+M A T  GLERTE++W  +L+  GF +  +     + SII+A P
Sbjct  298   --LAFDMLMFAVTSGGLERTEEEWRALLSKGGFSNCNIKPLPTLQSIIEAYP  347



>ref|XP_008341892.1| PREDICTED: LOW QUALITY PROTEIN: (R,S)-reticuline 7-O-methyltransferase-like 
[Malus domestica]
Length=369

 Score =   210 bits (535),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 143/431 (33%), Positives = 204/431 (47%), Gaps = 93/431 (22%)
 Frame = -1

Query  1351  EVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQ---------EQAVTLDQLSSGL  1199
             E     +  IWKY+FGF +   +KC +EL I D + S          +  +TL QL+S +
Sbjct  8     EASLRGQADIWKYMFGFADSMALKCVVELRIADIIHSHSPNAGASNSKPMITLSQLASCI  67

Query  1198  GCS--PSALYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRG----YVQTPL  1037
               S   + L RIMR L+ + IF                        P+ G    Y  T  
Sbjct  68    APSLEITCLTRIMRLLVRQNIFT--------------------VHHPSDGGEPLYGLTHS  107

Query  1036  SALLTRDGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGK  857
             S  L  D E S+A  + +E+ P ++ PW   +           +   G    AF+ A+G 
Sbjct  108   SRWLLHDAELSLAPMLMMENHPCLMVPWHYFA-----------QCIKGGGPCAFKMAHGL  156

Query  856   DVWRYAESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgt  677
             ++W YA  +P  +KL  D MAC AR+ + AI+                  +VDVGGG G 
Sbjct  157   EIWDYASQNPEFNKLFNDGMACTARVVMKAILTG------YEHGFDSIGSLVDVGGGTGG  210

Query  676   tvEMLVKAFPGVKGINFDLPH-------VVSVAPKRPGVHHVGGNMFQ-RIPKADAIFLM  521
              V  +VKA+P +KG NFDLPH       VV++AP   GV HVGG+MF+  IP ADAIF+ 
Sbjct  211   AVAEIVKAYPNIKGFNFDLPHLRRGSKSVVAMAPVYHGVSHVGGDMFEGNIPNADAIFMK  270

Query  520   WVLHDWGDEECVQILSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntk  341
             WV+HDW D +C++IL  CR+ IPE++GK+II + +L  + E I                 
Sbjct  271   WVMHDWSDSDCIKILKNCRKVIPEKSGKIIIVDIVLEPNGEGILD---------------  315

Query  340   nnskLQEKDRNNNNNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDT  161
                               + GL+ D++M+AH   G ERTE +W  +L   GF  Y V   
Sbjct  316   ------------------DTGLVFDLLMIAHASGGRERTESEWKKILEGGGFPRYKVIKI  357

Query  160   SDVVSIIQARP  128
               + SI++A P
Sbjct  358   PAIASIVEAYP  368



>ref|XP_010036415.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Eucalyptus 
grandis]
Length=360

 Score =   210 bits (535),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 143/428 (33%), Positives = 211/428 (49%), Gaps = 84/428 (20%)
 Frame = -1

Query  1369  KSIRRQEVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQA-VTLDQLSSGLGC  1193
             +S+   E     +  IWK ++ + +   +KCA+EL +PD + S     VTL Q++S +  
Sbjct  2     ESLDETEATLRGQAHIWKLMYAYADSMALKCAVELRVPDIIHSYGGGPVTLAQIASRIPS  61

Query  1192  -SPSALY--RIMRFLINRGIFK----------EVEMTLPTIsstssteaalasTRPTRGY  1052
              SP   Y  RIMR L+ + IF           E   TL +++ +            +R  
Sbjct  62    PSPGTAYLARIMRLLVRKNIFSANHCEPDGGHESHETLYSLTPS------------SRWL  109

Query  1051  VQTPLSALLTRDGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFE  872
             +Q P S L       S+A  V +E+ P +++PW         GD      C  +   AFE
Sbjct  110   LQGPGSEL-------SLAPLVLMENHPWLMSPWH------CFGD------CVKTGGIAFE  150

Query  871   AANGKDVWRYAESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvg  692
              A+G+ +W +A  +P  ++L  D MAC + + V  IV+   D             +VDVG
Sbjct  151   MAHGRKIWDFASENPEFNRLFNDGMACVSGVVVRGIVEVYKDGF------ESIGSLVDVG  204

Query  691   ggdgttvEMLVKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVL  512
             GG G T+  + K+F  ++GINFDLPHVV+ AP   GV HVGGNMF+ IP ADA+F+ W++
Sbjct  205   GGVGKTLAEITKSFSHIQGINFDLPHVVATAPAHDGVTHVGGNMFETIPHADAVFMKWIM  264

Query  511   HDWGDEECVQILSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknns  332
             HDWGD++CV+IL  C++ IPE+ GKVIIA+ +L+                          
Sbjct  265   HDWGDKDCVKILKNCKKEIPEKNGKVIIADVVLKP-------------------------  299

Query  331   kLQEKDRNNNNNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDV  152
                       N    E  L+ D+VMM H   G ER E +W  +L   GF  + +  T  +
Sbjct  300   --------EGNGMFDETRLVSDLVMMVHRSGGKERDELEWKKILEEGGFPHFNIIKTPSL  351

Query  151   VSIIQARP  128
              SII+A P
Sbjct  352   FSIIEAYP  359



>gb|AAR09602.1| flavonoid 4'-O-methyltransferase [Mentha x piperita]
Length=343

 Score =   209 bits (533),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 141/401 (35%), Positives = 205/401 (51%), Gaps = 74/401 (18%)
 Frame = -1

Query  1321  WKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRGI  1142
             W   FG+ +   V  A+ELG+PD LE+ +  ++L +LS+   C    L+R+MRFL+  GI
Sbjct  14    WNNAFGYIKPTAVATAVELGLPDILENHDGPMSLLELSAATDCPAEPLHRLMRFLVFHGI  73

Query  1141  FKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSPVML  962
             FK+     P +S+ +              Y +T LS L TRD    +  F+ L++ P+  
Sbjct  74    FKKTAK--PPLSNEAVY------------YARTALSRLFTRD---ELGDFMLLQTGPLSQ  116

Query  961   APWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPA---HSKLIEDAMAC  791
              P    +  +  G                 + NG+D W    +DP    H K+  DAMA 
Sbjct  117   HPAGLTASSLRTG-----------KPQFIRSVNGEDSW----TDPVNGYHMKVFSDAMAA  161

Query  790   HARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPHV  611
             HAR    AIV+ CP       A      VVDVGG  G  +E LV AFP V+GI+FDLP +
Sbjct  162   HARETTAAIVRYCP------AAFEGIGTVVDVGGRHGVALEKLVAAFPWVRGISFDLPEI  215

Query  610   VSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKVI  431
             V+ AP RPG+  VGG+ F+ +PK D + LMW+LHDW DE C++I+ KC+EAIP  +GKV+
Sbjct  216   VAKAPPRPGIEFVGGSFFESVPKGDLVLLMWILHDWSDESCIEIMKKCKEAIP-TSGKVM  274

Query  430   IAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMMA  251
             I +AI+ +  E  + + G R                               L LD++MMA
Sbjct  275   IVDAIVDEDGEG-DDFAGAR-------------------------------LSLDLIMMA  302

Query  250   HTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
                +G ERT ++W ++L  AGF  + V + + V  +I+A P
Sbjct  303   VLARGKERTYREWEYLLREAGFTKFVVKNINTVEFVIEAYP  343



>ref|XP_006469135.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=402

 Score =   211 bits (537),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 133/410 (32%), Positives = 204/410 (50%), Gaps = 67/410 (16%)
 Frame = -1

Query  1339  EEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPS---ALYRI  1169
             E +  +W ++F F     +KCA+ELGIPD +    + +TL++L S L  +PS    +YR+
Sbjct  54    EAQAHVWNHIFNFINSMSLKCAVELGIPDIINKHGKPMTLNELVSALTINPSKTRCVYRL  113

Query  1168  MRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFV  989
             MR LI+ G F +  +            ++  +    +GYV T  S LL +D   S+  F+
Sbjct  114   MRILIHSGFFAQQTLN-----------SSRNNNDEEQGYVLTNASKLLLKDNPLSVTPFL  162

Query  988   RLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLI  809
             +    P++L+PWLKLS            +        F+ A+GK +W YA  +P  +   
Sbjct  163   QAMLDPILLSPWLKLS-----------TWFQNDDPTPFDTAHGKSLWEYAGDEPKINNFF  211

Query  808   EDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGIN  629
              +AMA  AR+A   ++  C D+            +VDVGGG GT  + + KAFP ++  +
Sbjct  212   NEAMASDARLATRVVIHKCKDVF------EGLNSLVDVGGGTGTVAKAIAKAFPNLECTD  265

Query  628   FDLPHVVS-VAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIP  452
             FDLPHVV+ +      + ++GG+MF+ IP ADA+   W+LHDW DEECV+IL KC+EAI 
Sbjct  266   FDLPHVVNGLESDLANLKYIGGDMFEAIPPADAVLFKWILHDWNDEECVKILKKCKEAIT  325

Query  451   EE--TGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVG  278
              +   GKVII + +                                ++    ++ S E  
Sbjct  326   SDGKKGKVIIIDMM--------------------------------RENKKGDSESIETQ  353

Query  277   LMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             L  DM+MM     G ER EK+W+ +   AGF  Y +T    + S+I+  P
Sbjct  354   LFFDMLMMVLV-TGTERDEKEWAKLFADAGFSDYKITPILGLRSLIEVYP  402



>ref|XP_008365438.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Malus 
domestica]
Length=364

 Score =   210 bits (534),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 142/429 (33%), Positives = 207/429 (48%), Gaps = 78/429 (18%)
 Frame = -1

Query  1378  MDAKSIRRQEVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQA---------V  1226
             M+ +     E     +  IWKY+ GF +   +KCA+EL I D + S             +
Sbjct  1     MEMQEATEVEASLRGQADIWKYMXGFADSMALKCAVELRIADIIHSHSPTDGASNSXPMI  60

Query  1225  TLDQLSSGLGCSPSALY--RIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGY  1052
             TL Q +S +  SP   Y  RIMR L+ R IF              +   +     P  G 
Sbjct  61    TLSQXASSIAPSPDMTYLTRIMRLLVRRNIF--------------AIHHSSDGEEPLYGL  106

Query  1051  VQTPLSALLTRDGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFE  872
               +  S  L  + E S+A  + +E+ P ++APW   S  V  G              AF+
Sbjct  107   THS--SRWLLHNXELSLAPMLVMENHPCLMAPWHYFSQCVKEG-----------GPYAFK  153

Query  871   AANGKDVWRYAESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvg  692
              A+G ++W YA  +P  +KL  D MAC AR+ + AI+                  +VDVG
Sbjct  154   MAHGLEIWDYASQNPEFNKLFNDGMACTARVVMKAILTG------YEHGFDGVGSLVDVG  207

Query  691   ggdgttvEMLVKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQ-RIPKADAIFLMWV  515
             GG G+ V  +VK++P +KG NFDLPHVV+ AP   GV HVGG+MF+  IP ADA+F+  +
Sbjct  208   GGTGSAVAEIVKSYPNIKGFNFDLPHVVATAPVYHGVSHVGGDMFEGSIPNADAVFMKXI  267

Query  514   LHDWGDEECVQILSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknn  335
             +H+W D +C++IL  CR+AIPE++GK+II + +L  + E I     TR            
Sbjct  268   MHBWSDXDCIKILKNCRKAIPEKSGKIIIVDIVLEPNGEGI--LDDTR------------  313

Query  334   skLQEKDRNNNNNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSD  155
                                L+ D++M+AH   G ERTE +W ++L   GF  Y V     
Sbjct  314   -------------------LVFDLLMIAHXSGGRERTETEWKNILEEGGFPRYKVIKIPA  354

Query  154   VVSIIQARP  128
             + SI++A P
Sbjct  355   LASIVEAYP  363



>ref|XP_009357073.1| PREDICTED: LOW QUALITY PROTEIN: (R,S)-reticuline 7-O-methyltransferase-like 
[Pyrus x bretschneideri]
Length=362

 Score =   209 bits (533),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 145/424 (34%), Positives = 207/424 (49%), Gaps = 86/424 (20%)
 Frame = -1

Query  1351  EVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQA---------VTLDQLSSGL  1199
             E     +  I KY+FGF +   +KCA+EL I D + S             +TL QL+S +
Sbjct  8     EASLRGQANIRKYMFGFVDSMALKCAVELRIADIIHSHSPTDGASNSKPMITLSQLASSI  67

Query  1198  GCSPSALY--RIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRG----YVQTPL  1037
               SP   Y  RIMR L++R IF                    A   P+ G    Y  T  
Sbjct  68    APSPDMTYLTRIMRLLVHRNIF--------------------AIHHPSDGGEPLYGLTHS  107

Query  1036  SALLTRDGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGK  857
             S  L  + E S+A  + +E+ P ++APW      V  G              AF+ A+G 
Sbjct  108   SRWLLHNAELSLAPMLVMENHPCLMAPWHYFGQCVKEG-----------GPYAFKMAHGL  156

Query  856   DVWRYAESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgt  677
             ++W YA  +P  +KL  D MAC AR+ + AI+                  +VDVGGG G+
Sbjct  157   EIWDYASQNPEFNKLFNDGMACTARVVMKAILTG------YEHGFDGVGSLVDVGGGTGS  210

Query  676   tvEMLVKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQ-RIPKADAIFLMWVLHDWG  500
              V  +VK++P +KG NFDLPHVV+ AP   GV HVGG+MF+  IP ADA+F+ W++HDW 
Sbjct  211   AVAEIVKSYPNIKGFNFDLPHVVATAPVYHGVSHVGGDMFEGSIPNADAVFMKWIMHDWS  270

Query  499   DEECVQILSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQE  320
             D +C++IL  CR+AIPE++GK+II + +L  + E I     TR                 
Sbjct  271   DSDCIKILKNCRKAIPEKSGKIIIVDIVLEPNGEGI--LDDTR-----------------  311

Query  319   KDRNNNNNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSII  140
                           L+ D++M+AHT  G ERTE +  ++L   GF  + V     + SI+
Sbjct  312   --------------LVFDLLMIAHTPGGRERTETEXKNILEEGGFPRHKVIKIPALASIV  357

Query  139   QARP  128
             +A P
Sbjct  358   EAYP  361



>gb|AFU50300.1| flavonoid O-methyltransferase 6 [Ocimum basilicum]
Length=336

 Score =   208 bits (530),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 137/401 (34%), Positives = 200/401 (50%), Gaps = 81/401 (20%)
 Frame = -1

Query  1321  WKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRGI  1142
             W +   + +   +  A+EL IPD LE     ++L +LS+  GC    LYR+MRFLI  GI
Sbjct  14    WDHALSYIKPTALDAAVELEIPDILEDHGGPMSLSELSAATGCPREPLYRLMRFLIFHGI  73

Query  1141  FKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSPVML  962
             F + +                        Y Q+PLS L TR+   ++  ++ ++++P   
Sbjct  74    FTKSD----------------------DCYAQSPLSRLFTRE---NLGLYMLMQATPATR  108

Query  961   APWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPA---HSKLIEDAMAC  791
             +P   LSG  L             +    ++  G+D W    +DPA   H +   +AM  
Sbjct  109   SP-AGLSGEAL----------KTGTPLYLKSIRGEDSW----NDPAYGFHMRAFTNAMTA  153

Query  790   HARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPHV  611
             H+R+   AIV   P              VVDVGG  G  +  LV+AFP V+GI FDLP +
Sbjct  154   HSRLTAAAIVTNYPTAF------DGVRSVVDVGGRHGMAIGRLVEAFPWVRGITFDLPEI  207

Query  610   VSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKVI  431
             V+ AP   GV  VGG+MF+ +PKADA+ LMW+LHDW D++C++IL KC+EAIP  TGKV+
Sbjct  208   VADAPPLKGVDFVGGDMFKSVPKADAVMLMWILHDWSDDKCIEILKKCKEAIPTSTGKVM  267

Query  430   IAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMMA  251
             I +AI+ +  E  + + G R                               L LDM+MMA
Sbjct  268   IVDAIINEEGEG-DEFSGAR-------------------------------LSLDMIMMA  295

Query  250   HTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
              T +G ER+ K+W H+L  AGF  ++V +   +  +I A P
Sbjct  296   TTTQGKERSYKEWVHLLNKAGFSKHSVKNIKTIEFVIDAYP  336



>ref|XP_006446726.1| hypothetical protein CICLE_v10015705mg [Citrus clementina]
 gb|ESR59966.1| hypothetical protein CICLE_v10015705mg [Citrus clementina]
Length=362

 Score =   209 bits (531),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 135/410 (33%), Positives = 206/410 (50%), Gaps = 67/410 (16%)
 Frame = -1

Query  1339  EEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPS---ALYRI  1169
             E +  +W ++F F     +KCA+EL IPD +    + +TL++L S L  +PS    +YR+
Sbjct  14    EAQAHVWNHIFNFINSMSLKCAVELSIPDIINKHGKPMTLNKLVSALTINPSKTRCVYRL  73

Query  1168  MRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFV  989
             MR LI+ G F +  +            ++  +    +GYV T  S LL +D   S+  F+
Sbjct  74    MRILIHSGFFAQQTLN-----------SSRNNNDEEQGYVLTNASKLLLKDSPLSVTPFL  122

Query  988   RLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLI  809
             +    P++L+PWLKLS            +        F+ A+GK  W YA  +P  +   
Sbjct  123   QAMLDPILLSPWLKLS-----------TWFQSDDPAPFDTAHGKSFWEYAGDEPKINNFF  171

Query  808   EDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGIN  629
              +AMA  AR+A   ++  C D+            +VDVGGG GT  + +  AFP ++  +
Sbjct  172   NEAMASDARLATRVVIHKCKDVF------QGLNSLVDVGGGTGTVAKAIAIAFPNLECTD  225

Query  628   FDLPHVVS-VAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIP  452
             FDLPHVV+ +      + +VGG+MF+ IP ADA+ L W+LHDW DEECV+IL KC+EAI 
Sbjct  226   FDLPHVVNGLESDLANLKYVGGDMFEAIPPADAVVLKWILHDWNDEECVKILKKCKEAIT  285

Query  451   EE--TGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVG  278
              +   GKVII + ++R++++                                N+ S E  
Sbjct  286   SDGKKGKVIIID-MMRENKK-------------------------------GNDESTETQ  313

Query  277   LMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             L  DM+MM     G ER EK+W+ +   AGF  Y +T    + S+I+  P
Sbjct  314   LFFDMLMMV-LATGTERDEKEWAKLFADAGFSDYKITSILGLRSLIEVCP  362



>ref|XP_010035715.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Eucalyptus 
grandis]
 gb|KCW47152.1| hypothetical protein EUGRSUZ_K00957 [Eucalyptus grandis]
Length=360

 Score =   208 bits (529),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 144/428 (34%), Positives = 210/428 (49%), Gaps = 84/428 (20%)
 Frame = -1

Query  1369  KSIRRQEVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQA-VTLDQLSSGLGC  1193
             +S+   E     +  I   +  + +   +KCA+EL +PD + S     VTL Q++S +  
Sbjct  2     ESLDETEATRRGQAHILNLLHAYADSMALKCAVELRVPDIIHSYGGGPVTLAQIASRIP-  60

Query  1192  SPSA----LYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRG-------YVQ  1046
             SPS     L RIMR L+   IF                       +P  G       Y  
Sbjct  61    SPSLGTAYLARIMRLLVRENIFS------------------ANRCQPDGGHESHEILYSL  102

Query  1045  TPLSALLTR--DGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFE  872
             TP S  L +  + E S+A  V LE+ P +++PW                 C  +   AFE
Sbjct  103   TPSSRWLLQGPESELSLAPLVLLETHPWLMSPWHCFGN------------CVKTGGIAFE  150

Query  871   AANGKDVWRYAESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvg  692
              A+G+ +W +A  +P  ++L  D M C + + V  I++   D             +VDVG
Sbjct  151   MAHGRKIWDFASENPEFNRLFNDGMVCVSGIMVRGIIEVYKD------GFERIGSLVDVG  204

Query  691   ggdgttvEMLVKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVL  512
             GG G T+  ++K+FP ++GINFDLPHVV+ AP   GV HVGGNMF+ IP ADA+F+  ++
Sbjct  205   GGIGKTLAEIIKSFPHIQGINFDLPHVVATAPAHDGVTHVGGNMFETIPHADAVFMRGIM  264

Query  511   HDWGDEECVQILSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknns  332
             HDWGDE+CV+IL  CR+AIPE+ GKVIIA+ +L+   + +  +  TR             
Sbjct  265   HDWGDEDCVKILKNCRKAIPEKNGKVIIADIVLKPEGDSM--FDKTR-------------  309

Query  331   kLQEKDRNNNNNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDV  152
                               L++D+VMMAH   G ER E +W  +L   GF  Y +  T  +
Sbjct  310   ------------------LVMDLVMMAHCSGGKERDEPEWKKILEEGGFPCYNIIKTPSL  351

Query  151   VSIIQARP  128
             +SII+A P
Sbjct  352   LSIIEAYP  359



>ref|XP_008448276.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Cucumis 
melo]
Length=392

 Score =   209 bits (531),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 151/451 (33%), Positives = 217/451 (48%), Gaps = 86/451 (19%)
 Frame = -1

Query  1438  YDGAACICIIVN---LLLQIDLSMDAKSIRRQEVDYEEEDGIWKYVFGFTEMAVVKCAIE  1268
             Y   + I ++ N   L  +  + M+AK     E   + +  IWKY+  F +   +KCA+E
Sbjct  13    YKSQSSISLLQNKTTLTKKRKIEMEAKETNEAEALLQGQAEIWKYMLCFADSMALKCAVE  72

Query  1267  LGIPDFLESQ-----EQAVTLDQLSSGLGCSP--SALYRIMRFLINRGIFKEVEMTLPTI  1109
             L + D + S         ++    +S    SP  S L RIMR L+ R IF          
Sbjct  73    LHLADIINSHGSPISLSQISSSIAASNPSSSPQISYLNRIMRLLVRRNIF----------  122

Query  1108  sstssteaalasTRPTRG----YVQTPLSALLTRDGEKSMAAFVRLESSPVMLAPWLKLS  941
                       A+  P+ G    Y  T  S  L RD   ++A     E    M++PWL  +
Sbjct  123   ----------AAHHPSDGGDTLYGLTHSSKWLLRDSPLTLAPMAFSELHQWMVSPWLCFT  172

Query  940   GRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMACHARMAVPAIV  761
               V  G         GS    F+ A+G D+W +A  +P  +    DAMA  +++ + AI+
Sbjct  173   EAVKEG---------GS---PFKIAHGLDIWDFASKNPQFNHFFNDAMASTSKVVMNAIL  220

Query  760   QACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPHVVSVAPKRPGV  581
                 D             + DVGGG G ++  +VKAFP +KGIN+DLPHV+S AP   GV
Sbjct  221   SVYQD------GFNSLDSLADVGGGIGGSISEIVKAFPHIKGINYDLPHVISTAPVYEGV  274

Query  580   HHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKVIIAEAILRDHQ  401
              H+GG+MF+ IPK DAIF+ W+LHDW D+ECV+IL  C++AIPE+ GKVII E +L  ++
Sbjct  275   THIGGDMFEDIPKVDAIFMKWILHDWNDKECVKILENCKKAIPEKRGKVIIVEVVL--NE  332

Query  400   EMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMMAHTGKGLERTE  221
             E    +  T+                                  D++M+AHT  G ERTE
Sbjct  333   EGKGAFDDTK-------------------------------FYFDLLMLAHTN-GKERTE  360

Query  220   KQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             K+W  +L  AGF  Y +     +VSII+A P
Sbjct  361   KEWKTILEEAGFSRYNLIPLPALVSIIEAYP  391



>ref|XP_008357818.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Malus 
domestica]
Length=364

 Score =   207 bits (527),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 140/429 (33%), Positives = 204/429 (48%), Gaps = 78/429 (18%)
 Frame = -1

Query  1378  MDAKSIRRQEVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQA---------V  1226
             M+ +     E     +  IWKY+ GF +   +KCA+EL I D + S             +
Sbjct  1     MEMQEATEVEASLRGQADIWKYMXGFADSMALKCAVELRIADIIHSHSPTDGASNSXPMI  60

Query  1225  TLDQLSSGLGCSPSALY--RIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGY  1052
             TL Q +S +  SP   Y  RIMR L+ R IF              +         P  G 
Sbjct  61    TLSQXASSIAPSPDMTYLTRIMRLLVRRNIF--------------AIHHXSDGXEPLYGL  106

Query  1051  VQTPLSALLTRDGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFE  872
               +  S  L  + E S+A  + +E+ P ++APW      V  G              AF+
Sbjct  107   THS--SRWLLHNXELSLAPMLXMENHPCLMAPWHYFXQCVKEG-----------GPYAFK  153

Query  871   AANGKDVWRYAESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvg  692
              A+G ++W YA  +P  +KL  D MAC  R+ + AI+                  +VDVG
Sbjct  154   MAHGLEIWDYASQNPEFNKLFNDGMACTXRVVMKAILTG------YEHGFDGVGSLVDVG  207

Query  691   ggdgttvEMLVKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQ-RIPKADAIFLMWV  515
             GG G+ V  +VK++P +KG NFDLPHVV+ AP   GV HVGG+MF+  IP ADA+F+  +
Sbjct  208   GGTGSAVAEIVKSYPNIKGFNFDLPHVVATAPXYHGVSHVGGDMFEGSIPNADAVFMKXI  267

Query  514   LHDWGDEECVQILSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknn  335
             +H+W D +C++IL  CR+AIPE++GK+II + +L  + E I     TR            
Sbjct  268   MHBWSDXDCIKILKNCRKAIPEKSGKIIIVDIVLEPNGEGI--LDDTR------------  313

Query  334   skLQEKDRNNNNNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSD  155
                                L+ D++M+AH   G ERTE +W ++L   GF  Y V     
Sbjct  314   -------------------LVFDLLMIAHXSGGRERTETEWKNILEEGGFPRYKVIKIPA  354

Query  154   VVSIIQARP  128
             + SI++A P
Sbjct  355   LASIVEAYP  363



>ref|XP_004304125.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like isoform 
1 [Fragaria vesca subsp. vesca]
Length=353

 Score =   207 bits (526),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 150/424 (35%), Positives = 208/424 (49%), Gaps = 85/424 (20%)
 Frame = -1

Query  1378  MDAKSIRRQEVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGL  1199
             +D  S+R Q         +WKY+ GF +   ++ A+EL IPD + S  +A+TL +++S  
Sbjct  7     LDEASLRGQA-------DVWKYMLGFADSMALRSAVELRIPDIIHSHGRALTLSEIASSF  59

Query  1198  -GCSPS----ALYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLS  1034
                SPS     L RIMR L+ R IF                      +  T  Y  T  S
Sbjct  60    DSASPSPDISCLARIMRLLVRRNIFT--------------AHHDGEDSEKTGLYGLTHSS  105

Query  1033  ALLTRDGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKD  854
               L  D E ++A  V +E++P ++APW   S  V          C      AF+ A+G+D
Sbjct  106   RWLLHDSELTLAPMVLMETNPTLMAPWHCFSQCV-----KQRGPC------AFKRAHGRD  154

Query  853   VWRYAESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgtt  674
             +W++   +   ++L  D MAC A++ + AI+          G       +VDVGGG G+ 
Sbjct  155   IWQFFSENLKFNRLFNDGMACTAKITMKAILAG------YKGGFEDVATLVDVGGGTGSA  208

Query  673   vEMLVKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQR--IPKADAIFLMWVLHDWG  500
             V  +VKA+P +KGINFDLPHVV+ AP   GV HVGG+MF    IP ADAIF+  V+HDW 
Sbjct  209   VAEIVKAYPSIKGINFDLPHVVATAPVYHGVSHVGGDMFDEGSIPNADAIFMKRVMHDWS  268

Query  499   DEECVQILSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQE  320
             D +CV+IL  CR  IPE TGKVII + IL       NG                      
Sbjct  269   DSDCVKILKNCRNVIPERTGKVIIVDVILEP-----NG----------------------  301

Query  319   KDRNNNNNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSII  140
                         VG M D++M+AHT  G ERTE +W+ +L  AGF    +     ++ II
Sbjct  302   ------------VG-MFDLLMIAHTSGGKERTESEWTKMLEQAGFPRLKIIKIPALMLII  348

Query  139   QARP  128
             +A P
Sbjct  349   EAYP  352



>ref|XP_011045483.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like isoform 
X1 [Populus euphratica]
Length=352

 Score =   206 bits (525),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 139/406 (34%), Positives = 204/406 (50%), Gaps = 78/406 (19%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGC-SP--SALYRIMRFLI  1154
             I +   GF +   +KCA+EL + D + S  + ++L Q+++G+   SP  S L RIMR+L+
Sbjct  17    ISQLALGFADSMALKCAVELRLADIINSHGRPISLSQIAAGINSPSPDISYLARIMRYLV  76

Query  1153  NRGIFKEVEMTLPTIsstssteaalasTRPTRG----YVQTPLSALLTRDGEKSMAAFVR  986
              + IF                        P+ G    +     S LL  D E+S+ + V 
Sbjct  77    RKEIFTS--------------------HPPSDGGETLFGLNQKSRLLIHDSEQSLTSLVI  116

Query  985   LESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIE  806
             ++ SP +LAPW  LS  +  G              AF  A+G ++W  A  +P  +++  
Sbjct  117   MQHSPWLLAPWHCLSQSIKEGGT------------AFSKAHGCEMWDLASRNPEVNRIFN  164

Query  805   DAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINF  626
             +AMAC +++ +  I+    D             +VDV GG G  V  +V+A+P +KGIN 
Sbjct  165   EAMACTSKIVMREILSQYKDGF------NNIRSLVDVAGGIGGHVAEIVRAYPHIKGINL  218

Query  625   DLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEE  446
             DLPHVV+ APK  GV HV GNMF  IP ADAIF+  +LHDW DE CV+IL  C++AIPE+
Sbjct  219   DLPHVVATAPKYEGVSHVAGNMFDAIPNADAIFIKRILHDWTDESCVEILRNCKKAIPEK  278

Query  445   TGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLD  266
             TGK+IIA+ +L+   +  + +  TRM                                +D
Sbjct  279   TGKLIIADIVLQTDDQR-DQFDDTRMA-------------------------------MD  306

Query  265   MVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             + M AHTG G ERTE++W  +L   GF  Y +     + SII+A P
Sbjct  307   LAMFAHTG-GKERTEQEWKKLLEEGGFSRYKIIKIPALESIIEAYP  351



>dbj|BAM37634.1| O-methyltransferase [Eschscholzia californica]
Length=351

 Score =   206 bits (523),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 134/411 (33%), Positives = 212/411 (52%), Gaps = 71/411 (17%)
 Frame = -1

Query  1351  EVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSP---SA  1181
             ++D   +  IWK+++GF E  ++K A+EL I D + +  + +TL +L+S L   P     
Sbjct  8     KIDQATQAKIWKHIYGFAESLILKSAVELEIADTIHNHGKPMTLSELASKLPVQPVDLDR  67

Query  1180  LYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSM  1001
             LYR+MR+L++  +FK+ E                     +  Y   P +  L +  EKSM
Sbjct  68    LYRVMRYLVHMKLFKKQE----------------DEDEESIKYSLLPPAKFLIKGWEKSM  111

Query  1000  AAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAH  821
              + + L +    ++PW  L   ++            ++S+AF+ A GK +W Y  ++P  
Sbjct  112   VSAILLINDKDFMSPWHHLKEGLV------------NNSNAFDKALGKSIWDYMSANPDK  159

Query  820   SKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGV  641
             +K+  + MAC +R+   A+V  C ++            +VDVGGG GT V+ + KAFP +
Sbjct  160   NKVFNEGMACDSRLVSSALVNECGNIF------QGIQTLVDVGGGTGTAVKAVSKAFPHI  213

Query  640   KGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCRE  461
             K   +DLPHV+S +P  P +  + G MF+ IP ADAI +  +LHDW D+EC++IL KC+E
Sbjct  214   KCSIYDLPHVISDSPDIPNIVKIEGEMFKSIPSADAILMKCILHDWNDDECIEILKKCKE  273

Query  460   AIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEV  281
             A+P+E GKVII + +L    E  + Y   R                              
Sbjct  274   AVPKEGGKVIIVDIVL--DMESKHPYSKVR------------------------------  301

Query  280   GLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
              L LD+ MM +T +G ERTE++W  ++  AGF SY +T  S + S+I+A P
Sbjct  302   -LTLDLDMMLNT-EGKERTEEEWKKLIDGAGFASYKITQISALQSVIEAFP  350



>gb|KDP24163.1| hypothetical protein JCGZ_25820 [Jatropha curcas]
Length=354

 Score =   204 bits (520),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 140/404 (35%), Positives = 201/404 (50%), Gaps = 72/404 (18%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSP-----SALYRIMRF  1160
             +W+++F F +   +K A+EL I D + S    VTL QLSS +         S L RIMR 
Sbjct  17    LWQHMFAFADSMALKSAVELRIADIIHSHGGPVTLSQLSSSINSPSNNPDISYLKRIMRL  76

Query  1159  LINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLE  980
             L+ R IF  V+++                 + T  Y  T +S  L  D + ++A  + +E
Sbjct  77    LVRRNIFT-VDLS--------------PDGKETL-YGLTNVSRWLVHDSDLTLAPMLIME  120

Query  979   SSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDA  800
             + P  + PW  LS             C      AF+ ANG ++W +A   P  + +    
Sbjct  121   NHPSAMNPWHFLS------------ECVKEGGIAFQKANGYEIWEFASRYPEFNVMFNSG  168

Query  799   MACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDL  620
             MAC AR+ + AI+    D        G    +VDVGGG G  V  +VK+ P +KGINFDL
Sbjct  169   MACTARVVIRAILVGYKD------GFGCMGSLVDVGGGTGNLVAEIVKSHPHIKGINFDL  222

Query  619   PHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETG  440
             PHVV  AP   GV HVGG+MF+ IP ADA+ + W++HDWGD++CV+IL  CR+AIPE+ G
Sbjct  223   PHVVDTAPVYEGVSHVGGDMFKAIPNADAVIMKWIMHDWGDDDCVKILKNCRKAIPEKKG  282

Query  439   KVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMV  260
             KVII + +L+                                    N+   + GL+ D++
Sbjct  283   KVIIVDIVLKP---------------------------------EGNDLFDDTGLVFDLL  309

Query  259   MMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             M+AH+  G ERTE +W  +L   GF  Y +     + SII+A P
Sbjct  310   MIAHSSGGKERTEAEWKILLEEGGFPRYNIIKIPALTSIIEAFP  353



>ref|XP_010035712.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Eucalyptus 
grandis]
 gb|KCW47150.1| hypothetical protein EUGRSUZ_K00955 [Eucalyptus grandis]
Length=359

 Score =   204 bits (518),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 146/428 (34%), Positives = 214/428 (50%), Gaps = 85/428 (20%)
 Frame = -1

Query  1369  KSIRRQEVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQA-VTLDQLSSGLGC  1193
             +S+   E     +  IWK ++ + +   +KCA+EL +PD + S     VTL Q++S +  
Sbjct  2     ESLYETEAPLRGQAHIWKLMYAYADSMALKCAVELRVPDIIHSYGGGPVTLAQIASRIPS  61

Query  1192  -SPSALY--RIMRFLINRGIFK----------EVEMTLPTIsstssteaalasTRPTRGY  1052
              SP   Y  RIMRFL+ + IF           E   TL +++++            +R  
Sbjct  62    PSPGTAYLARIMRFLVRKNIFSANRCQPDGGHESHETLYSLTTS------------SRWL  109

Query  1051  VQTPLSALLTRDGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFE  872
             +Q P S L       S+A  V +E+ P +++PW         GD      C  +   AFE
Sbjct  110   LQGPGSEL-------SLAPLVLMENHPWVMSPWH------YFGD------CIKTGGIAFE  150

Query  871   AANGKDVWRYAESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvg  692
              A+G+ VW +A  +P  ++L  D MA  + + V  IV+   D             +VDVG
Sbjct  151   MAHGRKVWDFASENPEFNRLFNDGMAGLSGVVVRGIVEVYKDGF------ESIGSLVDVG  204

Query  691   ggdgttvEMLVKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVL  512
             GG G T+  ++K+F  ++GINFDLPHVV+ AP   GV HVG NMF+ IP ADA+F+  ++
Sbjct  205   GGVGKTLAEIIKSFSHIQGINFDLPHVVATAPAHDGVTHVGRNMFETIPHADAVFMKGIM  264

Query  511   HDWGDEECVQILSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknns  332
             HDWGDE+C++IL  CR+AI ++ GKVII + +L+                          
Sbjct  265   HDWGDEDCIKILKNCRKAILKKNGKVIIVDVVLKP-------------------------  299

Query  331   kLQEKDRNNNNNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDV  152
                     + N    E GL+LDMVMMAH   G ER E +W  +L   GF  Y +  T  +
Sbjct  300   --------DGNGMFDENGLVLDMVMMAHCSGGKERDELEWK-ILEEGGFPRYNIIKTPSL  350

Query  151   VSIIQARP  128
              SII+A P
Sbjct  351   SSIIEAYP  358



>gb|ABK94890.1| unknown [Populus trichocarpa]
Length=354

 Score =   203 bits (516),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 134/409 (33%), Positives = 206/409 (50%), Gaps = 83/409 (20%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSA----LYRIMRFL  1157
             I++   GF +   +KCA+EL +P+ + S  + ++L Q++SG+  SPS+    L RIMR+L
Sbjct  16    IFQLSLGFVDSMALKCAVELRLPEIINSHGRPISLSQIASGIN-SPSSDISYLARIMRYL  74

Query  1156  INRGIFKEVEMTLPTIsstssteaalasTRPTRG----YVQTPLSALLTRDGEKSMAAFV  989
             + + IF                     +  P+ G    +     S +L  D E+S+ + +
Sbjct  75    VRKEIF--------------------TAHPPSDGGETLFGLNQKSRMLMHDSERSLVSII  114

Query  988   RLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLI  809
              ++ S   LA W  LS             C      AF  A+G ++W +A  +P  +++ 
Sbjct  115   TMQHSSWFLAAWHCLS------------QCIKEGGTAFSKAHGCELWDFASRNPEVNRIF  162

Query  808   EDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGIN  629
              +AMAC + + + AI+    D             +VDV GG G  V  +V+A+P ++GIN
Sbjct  163   NEAMACTSNITMRAILSHYKDGF------NNIRSLVDVAGGIGGHVAEIVRAYPHIEGIN  216

Query  628   FDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPE  449
             FDLPHVV+ APK  GV HV GNMF+ IP ADAIF+  +LHDW DE CV+IL  C++AIPE
Sbjct  217   FDLPHVVATAPKYEGVSHVAGNMFEAIPNADAIFMQRILHDWTDESCVEILRNCKKAIPE  276

Query  448   ETGKVIIAEAIL--RDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGL  275
             +TGK+II + +L   DH +  +                                  ++ +
Sbjct  277   KTGKLIIVDIVLPTDDHCDQFD----------------------------------DIRM  302

Query  274   MLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             ++D+VM A T  G ERTE++W  +L   GF  Y +     + SII+A P
Sbjct  303   VMDLVMFALTTGGKERTEQEWKKLLEEGGFSRYKIIKIPALESIIEAYP  351



>gb|ACO90232.1| putative norcoclaurine 6-O-methyltransferase [Papaver bracteatum]
Length=346

 Score =   203 bits (516),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 139/413 (34%), Positives = 215/413 (52%), Gaps = 78/413 (19%)
 Frame = -1

Query  1351  EVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGC----SPS  1184
             ++D + +  IWK ++GF E  V+KCA++L I + L +  + ++L +L+S L      +  
Sbjct  6     KIDQQNQAKIWKQIYGFAESLVLKCAVQLEIAETLHNNVKPMSLSELASKLPVPQPVNED  65

Query  1183  ALYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKS  1004
              L+RIMR+L++  +FK ++ T                   T+ Y   P +  L R  EKS
Sbjct  66    RLFRIMRYLVHMELFK-IDAT-------------------TQKYSLAPPAKYLLRGWEKS  105

Query  1003  MAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPA  824
             M   +   +    LAPW  L G  L G+            DAFE A GK +W Y   +P 
Sbjct  106   MVDSILCINDKDFLAPWHHL-GDGLTGN-----------CDAFEKALGKSIWVYMSENPE  153

Query  823   HSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPG  644
              ++L   AMAC  R+   A+   C  +      +     +VDVGGG GT V+ + KAFP 
Sbjct  154   KNQLFNAAMACDTRLVTSALANECKSIF-----SDGIKTLVDVGGGTGTAVKTISKAFPD  208

Query  643   VKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCR  464
             +K   +DLPHV++ +P+ P +  + G+MF+ IP ADAIF+  +LHDW DEEC+QIL +C+
Sbjct  209   IKCTIYDLPHVIADSPEIPNITKISGDMFKSIPSADAIFMKCILHDWNDEECIQILKRCK  268

Query  463   EAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSY-  287
             EA+P++ GKVII + ++                                  + ++ + Y 
Sbjct  269   EALPKD-GKVIIVDVVI----------------------------------DMDSTHPYA  293

Query  286   EVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             ++ L LD+ MM +TG G ERT+++W  +  AAGF S+ VT  S V S+I+A P
Sbjct  294   KIRLTLDLDMMLNTG-GKERTKEEWKILFDAAGFASHKVTQISAVQSVIEAYP  345



>ref|XP_002319364.2| hypothetical protein POPTR_0013s13990g [Populus trichocarpa]
 gb|EEE95287.2| hypothetical protein POPTR_0013s13990g [Populus trichocarpa]
Length=354

 Score =   203 bits (516),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 135/421 (32%), Positives = 211/421 (50%), Gaps = 83/421 (20%)
 Frame = -1

Query  1360  RRQEVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSA  1181
             +  E  ++ +  I++   GF +   +KCA+EL +P+ + S  + ++L Q++SG+  SPS+
Sbjct  4     QEAEAFFKSQFEIFQLSLGFVDSMALKCAVELRLPEIINSHGRPISLSQIASGIN-SPSS  62

Query  1180  ----LYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRG----YVQTPLSALL  1025
                 L RIMR+L+ + IF                     +  P+ G    +     S +L
Sbjct  63    DISYLARIMRYLVRKEIF--------------------TAHPPSDGGETLFGLNQKSRML  102

Query  1024  TRDGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWR  845
               D E+S+ + + ++ S   LA W  LS             C      AF  A+G ++W 
Sbjct  103   MHDSERSLVSIIIMQHSSWFLAAWHCLS------------QCIKEGGTAFSKAHGCELWD  150

Query  844   YAESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEM  665
             +A  +P  +++  +AMAC + + + AI+    D             +VDV GG G  V  
Sbjct  151   FASRNPEVNRIFNEAMACTSNITMRAILSHYKDGF------NNIRSLVDVAGGIGGHVAE  204

Query  664   LVKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECV  485
             +V+A+P ++GINFDLPHVV+ APK  GV HV GNMF+ IP ADAIF+  +LHDW DE CV
Sbjct  205   IVRAYPHIEGINFDLPHVVATAPKYEGVSHVAGNMFEAIPNADAIFIQRILHDWTDESCV  264

Query  484   QILSKCREAIPEETGKVIIAEAIL--RDHQEMINGYQGTRMklknntntknnskLQEKDR  311
             +IL  C++AIPE+TGK+II + +L   DH +  +                          
Sbjct  265   EILRNCKKAIPEKTGKLIIVDIVLPTDDHCDQFD--------------------------  298

Query  310   NNNNNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQAR  131
                     ++ +++D+VM A T  G ERTE++W  +L   GF  Y +     + SII+A 
Sbjct  299   --------DIRMVMDLVMFALTTGGKERTEQEWKKLLEEGGFSRYKIIKIPALESIIEAY  350

Query  130   P  128
             P
Sbjct  351   P  351



>ref|XP_002319365.2| hypothetical protein POPTR_0013s14000g [Populus trichocarpa]
 gb|EEE95288.2| hypothetical protein POPTR_0013s14000g [Populus trichocarpa]
Length=354

 Score =   202 bits (514),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 134/421 (32%), Positives = 210/421 (50%), Gaps = 83/421 (20%)
 Frame = -1

Query  1360  RRQEVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSA  1181
             +  E  ++ +  I++   GF +   +KCA+EL +P+ + S  + ++L Q++SG+  SPS+
Sbjct  4     QEAEAFFKSQFEIFQLSLGFVDSMALKCAVELRLPEIINSHGRPISLSQIASGIN-SPSS  62

Query  1180  ----LYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRG----YVQTPLSALL  1025
                 L RIMR+L+ +  F                     +  P+ G    +     S +L
Sbjct  63    DISYLARIMRYLVRKEFF--------------------TAHPPSDGGETLFGLNQKSRML  102

Query  1024  TRDGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWR  845
               D E+S+ + + ++ S   LA W  LS             C      AF  A+G ++W 
Sbjct  103   MHDSERSLVSIITMQHSSWFLAAWHCLS------------QCIKEGGTAFSKAHGCELWD  150

Query  844   YAESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEM  665
             +A  +P  +++  +AMAC + + + AI+    D             +VDV GG G  V  
Sbjct  151   FASRNPEVNRIFNEAMACTSNITMRAILSHYKDGF------NNIRSLVDVAGGIGGHVAE  204

Query  664   LVKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECV  485
             +V+A+P ++GINFDLPHVV+ APK  GV HV GNMF+ IP ADAIF+  +LHDW DE CV
Sbjct  205   IVRAYPHIEGINFDLPHVVATAPKYEGVSHVAGNMFEAIPNADAIFIQRILHDWTDESCV  264

Query  484   QILSKCREAIPEETGKVIIAEAIL--RDHQEMINGYQGTRMklknntntknnskLQEKDR  311
             +IL  C++AIPE+TGK+II + +L   DH +  +                          
Sbjct  265   EILRNCKKAIPEKTGKLIIVDIVLPTDDHCDQFD--------------------------  298

Query  310   NNNNNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQAR  131
                     ++ +++D+VM A T  G ERTE++W  +L   GF  Y +     + SII+A 
Sbjct  299   --------DIRMVMDLVMFALTTGGKERTEQEWKKLLEEGGFSRYKIIKIPALESIIEAY  350

Query  130   P  128
             P
Sbjct  351   P  351



>gb|AAP45315.1| S-adenosyl-L-methionine:norcoclaurine 6-O-methyltransferase [Papaver 
somniferum]
Length=346

 Score =   202 bits (513),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 138/413 (33%), Positives = 214/413 (52%), Gaps = 78/413 (19%)
 Frame = -1

Query  1351  EVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSA---  1181
             ++D + +  IWK ++GF E  V+KCA++L I + L +  + ++L +L+S L  +      
Sbjct  6     KIDQQNQAKIWKQIYGFAESLVLKCAVQLEIAETLHNNVKPMSLSELASKLPVAQPVNED  65

Query  1180  -LYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKS  1004
              L+RIMR+L++  +FK ++ T                   T+ Y   P +  L R  EKS
Sbjct  66    RLFRIMRYLVHMELFK-IDAT-------------------TQKYSLAPPAKYLLRGWEKS  105

Query  1003  MAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPA  824
             M   +   +    LAPW  L G  L G+            DAFE A GK +W Y   +P 
Sbjct  106   MVDSILCINDKDFLAPWHHL-GDGLTGN-----------CDAFEKALGKSIWVYMSENPE  153

Query  823   HSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPG  644
              ++L   AMAC  R+   A+   C  +      +     +VDVGGG GT V+ + KAFP 
Sbjct  154   KNQLFNAAMACDTRLVTSALANECKSIF-----SDGISTLVDVGGGTGTAVKAISKAFPD  208

Query  643   VKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCR  464
             +K   +DLPHV++ +P+ P +  + G+MF+ IP ADAIF+  +LHDW D+EC+QIL +C+
Sbjct  209   IKCTIYDLPHVIADSPEIPNITKISGDMFKSIPSADAIFMKCILHDWNDDECIQILKRCK  268

Query  463   EAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSY-  287
             EA+P + GKVII + ++                                  + ++ + Y 
Sbjct  269   EALP-KVGKVIIVDVVI----------------------------------DMDSTHPYA  293

Query  286   EVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             ++ L LD+ MM +TG G ERT+++W  +  AAGF S+ VT  S V S+I+A P
Sbjct  294   KIRLTLDLDMMLNTG-GKERTKEEWKTLFDAAGFASHKVTQISAVQSVIEAYP  345



>ref|XP_006841695.1| hypothetical protein AMTR_s00003p00249810 [Amborella trichopoda]
 gb|ERN03370.1| hypothetical protein AMTR_s00003p00249810 [Amborella trichopoda]
Length=361

 Score =   202 bits (514),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 137/425 (32%), Positives = 210/425 (49%), Gaps = 76/425 (18%)
 Frame = -1

Query  1378  MDAKSIRRQEVDYEEEDGI-----WKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQ  1214
             M  ++++  +++ ++ED +     W+    F +   +KCA+ELGIP  + ++ Q +TL +
Sbjct  1     MRLRNVQGLKMEMQDEDALGQAEFWQITLAFVDSLTLKCAVELGIPQIIHAKGQPLTLSE  60

Query  1213  LSSGLGC-SP--SALYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQT  1043
             + + L   SP  S L R+MRFL+ + +F E              +   A  R TR     
Sbjct  61    IITSLQAPSPDSSCLSRVMRFLVKKQVFSE------------EVKVGEAYYRLTRA----  104

Query  1042  PLSALLTRDGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAAN  863
               S LL R G   +A  + + + P+ LAPW   S             C     DAFE A+
Sbjct  105   --SKLLVRPGASGLAPMLTMLNHPIFLAPWHCFS------------RCVVERVDAFEKAH  150

Query  862   GKDVWRYAESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggd  683
             G  +W Y  ++   + +  +AMA    + + A++                  +VDV GG 
Sbjct  151   GSKLWMYTANNTGANDIFNEAMASDTVVVLEALLSE------YKSGFAGLTSLVDVAGGT  204

Query  682   gttvEMLVKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDW  503
             GT V  +VKA P +  INFDLP VVS AP+ PGV HV G+MF  IP ADA+F+ W+LHDW
Sbjct  205   GTAVSAIVKAHPHISRINFDLPQVVSSAPEHPGVVHVSGDMFISIPHADAVFMKWILHDW  264

Query  502   GDEECVQILSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQ  323
              DE+CV+IL +CR+A+P ++GK+II + +L   +E  + +  +R                
Sbjct  265   NDEDCVKILKQCRKALPSKSGKLIIVDVVLH-LKEDTSAFADSR----------------  307

Query  322   EKDRNNNNNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSI  143
                            L  DM+M A T  GLERTE++W  +L+  GF +  +     + SI
Sbjct  308   ---------------LAFDMLMFAVTSGGLERTEEEWRALLSKGGFSNCNIKPLPTLQSI  352

Query  142   IQARP  128
             I+A P
Sbjct  353   IEAYP  357



>emb|CDY67665.1| BnaA03g59140D [Brassica napus]
Length=280

 Score =   199 bits (507),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 124/289 (43%), Positives = 167/289 (58%), Gaps = 44/289 (15%)
 Frame = -1

Query  1360  RRQEVDYEEEDG--IWKYVFGFTEMAVVKCAIELGIPDFLESQ-EQAVTLDQLSSGLGCS  1190
             +R  +D E +    IW+YVFGF ++A  KCAI+L IP+ +E+   Q VTL +LS  +  S
Sbjct  5     KRNLLDEEAKASLDIWRYVFGFADIAAAKCAIDLKIPEAIENHPSQPVTLAELSGAVSAS  64

Query  1189  PSALYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTR-----GYVQTPLS--A  1031
             PS L+RIMRFL+++G+FKEV                     PT+     GY  TPLS   
Sbjct  65    PSHLHRIMRFLVHQGVFKEV---------------------PTKDGLATGYTNTPLSRRM  103

Query  1030  LLTRDGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDV  851
             ++T+   KS+A FV  E+SP +LAPWL+LS  V    N       GS    F+  +GKD+
Sbjct  104   MITKRDGKSLAPFVLFETSPELLAPWLRLSSVVSSPAN-------GSHPPPFDTVHGKDL  156

Query  850   WRYAESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttv  671
             W  AE +P  + +I +AMACH R+ VP +  AC DL            VVDVGG  G T+
Sbjct  157   WALAEDNPCFNDVINEAMACHTRLVVPRVAAACHDLF------EGVATVVDVGGCTGETL  210

Query  670   EMLVKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFL  524
              +LVK FP +KG NFDLPHV+ VA    GV +VGG+MF  +PK D +F+
Sbjct  211   AILVKEFPWIKGFNFDLPHVIEVAQVLDGVENVGGDMFDSVPKCDNVFI  259



>ref|XP_007200242.1| hypothetical protein PRUPE_ppa015101mg [Prunus persica]
 gb|EMJ01441.1| hypothetical protein PRUPE_ppa015101mg [Prunus persica]
Length=248

 Score =   198 bits (504),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 115/285 (40%), Positives = 150/285 (53%), Gaps = 79/285 (28%)
 Frame = -1

Query  1054  YVQTPLSALLTRDGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAF  875
             Y QTPL   L + G+ +MAAF+  ESSPVMLAPW  LS R+  G+  N           F
Sbjct  39    YAQTPLCKRLLKSGQNNMAAFILPESSPVMLAPWHGLSARIQ-GNIRN---------PVF  88

Query  874   EAANGKDVWRYAESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdv  695
             E   G+D+W +  ++P HSKL  +AMAC AR+ VPA++++C                   
Sbjct  89    EEVYGEDLWSFGAANPDHSKLFNEAMACDARVVVPAVIESC-------------------  129

Query  694   gggdgttvEMLVKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWV  515
                                 IN DLPHVVSVA +   + +VGG+MF  +PKAD + + WV
Sbjct  130   --------------------INSDLPHVVSVAQEYDRIENVGGDMFDYVPKADVVIIKWV  169

Query  514   LHDWGDEECVQILSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknn  335
             LHDW D+EC++IL KCREAIPE+ GKVII EA++ +  E                     
Sbjct  170   LHDWEDDECIRILKKCREAIPEDKGKVIIIEAVIDEEDE---------------------  208

Query  334   skLQEKDRNNNNNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVL  200
                +E  +  N      V LMLDMVMMAHT  G ERT K+W +VL
Sbjct  209   ---KEDSKLTN------VRLMLDMVMMAHTNTGKERTLKEWVYVL  244



>ref|XP_011045485.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Populus 
euphratica]
Length=352

 Score =   201 bits (512),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 139/428 (32%), Positives = 214/428 (50%), Gaps = 89/428 (21%)
 Frame = -1

Query  1381  SMDAKSIRRQEVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSG  1202
             S +A+++ + +V+      I + V GF +   +KCA+EL + D + S  + ++L Q+++G
Sbjct  3     SQEAEAMLKSQVE------ISQLVLGFADSMALKCAVELRLADIINSHGRPISLSQIAAG  56

Query  1201  LGCSPSA----LYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRG----YVQ  1046
             +  SPS+    L RIMR+L+ +  F                     +  P+ G    +  
Sbjct  57    IN-SPSSGISSLARIMRYLVRKEFF--------------------TAHPPSDGGETLFGL  95

Query  1045  TPLSALLTRDGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAA  866
                S LL  D E+S+A  V ++ +P +LAPW  LS             C      AF  A
Sbjct  96    NQKSRLLIHDSEQSLAPVVIMQLNPWLLAPWHCLS------------QCIKEGGTAFSKA  143

Query  865   NGKDVWRYAESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvggg  686
             +G +VW  A  +P  +++  +AMAC +++ +  I+    D             +VDV GG
Sbjct  144   HGCEVWDLASRNPEVNRIFNEAMACTSKIVMREILSQYKD------GFNNIRSLVDVAGG  197

Query  685   dgttvEMLVKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHD  506
              G  V  +V+A+P ++GIN DLPHVV+ APK  GV HV GNMF  IP ADAIF+  +LHD
Sbjct  198   IGGHVAEIVRAYPHIEGINLDLPHVVATAPKYEGVSHVAGNMFDAIPNADAIFIKRILHD  257

Query  505   WGDEECVQILSKCREAIPEETGKVIIAEAILR--DHQEMINGYQGTRMklknntntknns  332
             W DE CV+IL  C+ AIPE+TGK+IIA+ +L+  DH + ++                   
Sbjct  258   WTDESCVEILRNCKRAIPEKTGKLIIADIVLQTDDHCDQLD-------------------  298

Query  331   kLQEKDRNNNNNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDV  152
                            ++ + +D+ M A T  G ERTE++W  +L   GF  Y +     +
Sbjct  299   ---------------DIRMAMDLAMFAVTTGGKERTEQEWKKLLEEGGFPRYKIIKIPAL  343

Query  151   VSIIQARP  128
              SII+A P
Sbjct  344   ESIIEAYP  351



>ref|XP_011045486.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Populus 
euphratica]
Length=352

 Score =   201 bits (511),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 137/427 (32%), Positives = 214/427 (50%), Gaps = 87/427 (20%)
 Frame = -1

Query  1381  SMDAKSIRRQEVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSG  1202
             S +A+++ + +V+      I + V GF +   +KCA+EL + D + S  + ++L Q++SG
Sbjct  3     SQEAEAMLKSQVE------ISQLVLGFADSMALKCAVELRLADIINSHGRPISLSQIASG  56

Query  1201  LGC-SP--SALYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRG----YVQT  1043
             +   SP  S L RIMR+++ + IF                     +  P+ G    +   
Sbjct  57    INSPSPDISYLARIMRYVVRKDIFS--------------------AHPPSDGGETLFGLN  96

Query  1042  PLSALLTRDGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAAN  863
               S +L  D E+S+   + ++ SP + APW  LS             C      +F  A+
Sbjct  97    QKSRMLMHDSERSLVPILTIQHSPWLQAPWHCLS------------QCIKEGGTSFSKAH  144

Query  862   GKDVWRYAESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggd  683
             G ++W ++  +P  S++  +AMAC +++ + AI+    D             +VDVGGG 
Sbjct  145   GCELWDFSSRNPEASRIFNEAMACTSKITMTAILSHYKDGF------NNIRSLVDVGGGI  198

Query  682   gttvEMLVKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDW  503
             G  V    +A+P +KGIN DLPHVV+ APK  GV HV GNMF+ IP ADAIF+  +LHDW
Sbjct  199   GGHVAEFARAYPHIKGINLDLPHVVATAPKYEGVSHVAGNMFEAIPNADAIFIKRILHDW  258

Query  502   GDEECVQILSKCREAIPEETGKVIIAEAILR--DHQEMINGYQGTRMklknntntknnsk  329
              DE CV+IL  C++AIPE+TGK+II + +L+  DH +  +                    
Sbjct  259   TDESCVEILRNCKKAIPEKTGKLIIVDIVLQTDDHCDKFD--------------------  298

Query  328   LQEKDRNNNNNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVV  149
                           ++ + +D+VM A T  G ERTE++W  +L   GF  Y +     + 
Sbjct  299   --------------DIRMGMDLVMFAVTTGGKERTEQEWKKLLEEGGFSRYKIIKIPALE  344

Query  148   SIIQARP  128
             SII+A P
Sbjct  345   SIIEAYP  351



>ref|XP_010035711.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Eucalyptus 
grandis]
Length=360

 Score =   201 bits (512),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 144/430 (33%), Positives = 212/430 (49%), Gaps = 88/430 (20%)
 Frame = -1

Query  1369  KSIRRQEVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQA-VTLDQLSSGLGC  1193
             +S+   E +   +  I   +  +     +KCA+EL +PD + S     VTL Q++S +  
Sbjct  2     ESLDETEANLRGQAHILNLLNAYAGSMALKCAVELRVPDIIHSYGGGLVTLAQIASRI--  59

Query  1192  SPSA------LYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRG-------Y  1052
              PSA      L RIMR L+   IF                       +P  G       Y
Sbjct  60    -PSASLETAYLARIMRLLVRENIFS------------------ANRCQPDGGHESHETLY  100

Query  1051  VQTPLSALLTRDG--EKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDA  878
                P S  L +    E S+A  V + + P +++PW        LGD      C  +   A
Sbjct  101   SLPPSSRWLLQGPGFELSLAPVVLMLNHPWVMSPWH------CLGD------CIKTGGIA  148

Query  877   FEAANGKDVWRYAESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvd  698
             FE A+G+ +W +A  +P  ++L  DAMAC + + + AI++   D             +VD
Sbjct  149   FEMAHGRKIWDFASENPEFNRLFNDAMACVSGITIRAILEVNKD------GFESIGSLVD  202

Query  697   vgggdgttvEMLVKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMW  518
             VGGG G T+  ++K+FP ++GIN+DLPHVV+ AP   GV HVGGNMF+ IP ADA+ +MW
Sbjct  203   VGGGIGKTLVEIIKSFPHIQGINYDLPHVVATAPAHDGVTHVGGNMFETIPHADAVLMMW  262

Query  517   VLHDWGDEECVQILSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntkn  338
             ++HDWGDE+CV+IL  CR+AI ++ GKVIIA  +L+         +G  M          
Sbjct  263   IMHDWGDEDCVKILKNCRKAISKKNGKVIIANIVLK--------AEGDGMFD--------  306

Query  337   nskLQEKDRNNNNNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTS  158
                              ++GL++D+VMMA    G ER E +W  +L   GF  Y + +T 
Sbjct  307   -----------------KIGLVMDLVMMALCSGGKERDEPEWKKILEDGGFPRYNIIETP  349

Query  157   DVVSIIQARP  128
              + SII+A P
Sbjct  350   SLSSIIEAYP  359



>ref|XP_006420396.1| hypothetical protein CICLE_v10005309mg [Citrus clementina]
 gb|ESR33636.1| hypothetical protein CICLE_v10005309mg [Citrus clementina]
Length=351

 Score =   201 bits (511),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 131/410 (32%), Positives = 192/410 (47%), Gaps = 84/410 (20%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCS---PSALYRIMRFLI  1154
             +W+++F FT    +K A+EL + D + S    +TL QL+S +  S    S L RIMR L+
Sbjct  14    VWQFMFAFTYSMALKSAVELRLADIMHSHGCPITLSQLASRIDSSCPDISHLARIMRMLV  73

Query  1153  NRGIFKEVEMTLPTIsstssteaalasTRPTRG-----YVQTPLSALLTRDGEKSMAAFV  989
              +GIF                    A+  P+ G     Y  T +S  L  D E S+A  +
Sbjct  74    YKGIF--------------------AAHHPSDGGDETLYGTTHISKWLLHDSELSLAPMI  113

Query  988   RLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLI  809
              ++++  +LAPW  LS             C       F  A+G   W +A  +P  + L 
Sbjct  114   LVQNNQWLLAPWHYLS------------QCVKKGGIPFRKAHGSTFWDFASQNPQFNNLF  161

Query  808   EDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEML---VKAFPGVK  638
              +AMAC  ++ + A V         H        +  +    G T   L   VK++P +K
Sbjct  162   NEAMACTTKITMKAFVS--------HYKVDGFNNIRSMVDVGGGTGTALAEIVKSYPHIK  213

Query  637   GINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREA  458
             GINFDL HV++ AP   GV HVGG+MF  IP ADA+F+ W+LHDWGDE C++IL  CR+A
Sbjct  214   GINFDLQHVIATAPTHEGVSHVGGDMFDAIPNADAVFMKWILHDWGDEACIKILKNCRKA  273

Query  457   IPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVG  278
             IPE+ GKVII + +L+          G+ +                           E  
Sbjct  274   IPEKIGKVIIVDIVLQP--------DGSGLFD-------------------------ETR  300

Query  277   LMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             L+ D++MM     G ERTE +W  +L   GF  Y +     ++ I++A P
Sbjct  301   LVFDLLMMVDLSGGKERTELEWKKILENGGFPRYRIIKIPALLWIVEAYP  350



>ref|XP_010036413.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Eucalyptus 
grandis]
Length=360

 Score =   201 bits (511),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 140/420 (33%), Positives = 209/420 (50%), Gaps = 68/420 (16%)
 Frame = -1

Query  1369  KSIRRQEVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQ-EQAVTLDQLSSGLGC  1193
             +S+   E     +  +WK ++ + +  V+KCA+EL +PD + S  +  VTL Q++S +  
Sbjct  2     ESLDETEATLRGQAHVWKLLYAYADSMVLKCAVELRLPDIIHSYGDGPVTLAQIASRIPS  61

Query  1192  SPSA---LYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLT  1022
             S      L RIMR L+ + IF      LP  S  S              Y  TP S  L 
Sbjct  62    SSHGTAYLARIMRLLVRKNIFS-ANHCLPDGSHESHETL----------YSLTPSSRWLL  110

Query  1021  RD--GEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVW  848
             +    E S+A  V +E+ P +++ W  L   V  G              AFE A+G+ VW
Sbjct  111   QGCGSELSLAPMVLMENHPWLMSSWHCLGDSVRTG------------GIAFEMAHGRKVW  158

Query  847   RYAESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvE  668
              +A  +P  ++L  D MA  +R+ V  IV+A  D             +VDVGGG G  + 
Sbjct  159   DFASENPEFNRLFNDGMASTSRILVRGIVEAYKD------GFESIGSLVDVGGGIGGALT  212

Query  667   MLVKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEEC  488
              ++K++P ++G NFDLPHV++ AP    + HVGG+MF+ IP ADA+F+  ++HDWGDE+C
Sbjct  213   EIIKSYPHIQGTNFDLPHVIATAPAHNRITHVGGDMFETIPHADAVFMKGIMHDWGDEDC  272

Query  487   VQILSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRN  308
             ++IL  CR+AI E+ GKVII++ +L+         +G  M                    
Sbjct  273   IKILKNCRKAILEKKGKVIISDIVLKP--------KGDGMFD------------------  306

Query  307   NNNNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
                    E GL++D+VMM H   G ER E +W  +L   GF  Y +  T  +  II+A P
Sbjct  307   -------ETGLVMDLVMMTHCSGGKERDELEWKKILEEGGFHRYNIIKTPYLSFIIEAFP  359



>sp|Q6WUC1.1|6OMT_PAPSO RecName: Full=(RS)-norcoclaurine 6-O-methyltransferase; Short=6OMT 
[Papaver somniferum]
 gb|AAQ01669.1| (R,S)-norcoclaurine 6-O-methyltransferase [Papaver somniferum]
 gb|AHF27395.1| (R,S)-norcoclaurine 6-O-methyltransferase [synthetic construct]
Length=346

 Score =   201 bits (510),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 138/413 (33%), Positives = 214/413 (52%), Gaps = 78/413 (19%)
 Frame = -1

Query  1351  EVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSA---  1181
             ++D + +  IWK ++GF E  V+KCA++L I + L +  + ++L +L+S L  +      
Sbjct  6     KIDQQNQAKIWKQIYGFAESLVLKCAVQLEIAETLHNNVKPMSLSELASKLPVAQPVNED  65

Query  1180  -LYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKS  1004
              L+RIMR+L++  +FK ++ T                   T+ Y   P +  L R  EKS
Sbjct  66    RLFRIMRYLVHMELFK-IDAT-------------------TQKYSLAPPAKYLLRGWEKS  105

Query  1003  MAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPA  824
             M   +   +    LAPW  L G  L G+            DAFE A GK +W Y   +P 
Sbjct  106   MVDSILCINDKDFLAPWHHL-GDGLTGN-----------CDAFEKALGKSIWVYMSVNPE  153

Query  823   HSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPG  644
              ++L   AMAC  R+   A+   C  +      +     +VDVGGG GT V+ + KAFP 
Sbjct  154   KNQLFNAAMACDTRLVTSALANECKSIF-----SDGISTLVDVGGGTGTAVKAISKAFPD  208

Query  643   VKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCR  464
             +K   +DLPHV++ +P+ P +  + G+MF+ IP ADAIF+  +LHDW D+EC+QIL +C+
Sbjct  209   IKCTIYDLPHVIADSPEIPNITKISGDMFKSIPSADAIFMKCILHDWNDDECIQILKRCK  268

Query  463   EAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSY-  287
             EA+P + GKVII + ++                                  + ++ + Y 
Sbjct  269   EALP-KGGKVIIVDVVI----------------------------------DMDSTHPYA  293

Query  286   EVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             ++ L LD+ MM +TG G ERT+++W  +  AAGF S+ VT  S V S+I+A P
Sbjct  294   KIRLTLDLDMMLNTG-GKERTKEEWKTLFDAAGFASHKVTQISAVQSVIEAYP  345



>gb|KHN31955.1| 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase [Glycine 
soja]
Length=369

 Score =   200 bits (509),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 137/427 (32%), Positives = 205/427 (48%), Gaps = 77/427 (18%)
 Frame = -1

Query  1375  DAKSIRRQEVDYEEEDG------IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQ  1214
             D+  +  + +  EEED       IW+Y+  FT+   +K  IEL I D ++   + ++L Q
Sbjct  8     DSPPLEFKGMSKEEEDSLLGQVEIWRYMTCFTDSVALKSVIELRIADIIDRYGKPLSLSQ  67

Query  1213  LSSGLGCSPSA----LYRIMRFLINRGIFK-EVEMTLPTIsstssteaalasTRPTRGYV  1049
             +   +  +PS     L R+MR ++ R IF  E   T  T+                  Y 
Sbjct  68    IVENIDDAPSPDASLLQRVMRVMVRRKIFSAEQSETGETL------------------YG  109

Query  1048  QTPLSALLTRDGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEA  869
              T  S  + RD + ++A  + LE+ P+ L P   +S  +  G  N           AF  
Sbjct  110   LTRASKWILRDTKMTLAPMLLLENHPIHLNPAHYISEIIREGTKN---------GTAFFK  160

Query  868   ANGKDVWRYAESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgg  689
              +G + +     DP +++L  + M C AR+   A++    D             +VDVGG
Sbjct  161   CHGHEQFEMTGLDPEYNRLFNEGMVCTARVVSKAVITGYKD------GFNQIKSLVDVGG  214

Query  688   gdgttvEMLVKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLH  509
             G G ++  +V+A+P +  INFDLPHVV+ APK  G+ HVGG+MF  IP ADAI++ W+LH
Sbjct  215   GIGGSLSEIVRAYPHINAINFDLPHVVATAPKYDGITHVGGDMFVSIPDADAIYMKWILH  274

Query  508   DWGDEECVQILSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnsk  329
             DW DE CV+IL  CR+AIPE+TGKVII + +LR                           
Sbjct  275   DWSDEHCVKILKNCRKAIPEKTGKVIIVDHVLRPE-------------------------  309

Query  328   LQEKDRNNNNNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVV  149
                      N    +VG+  DM+++AH   G ERTE+ W  +    GF  Y +   + + 
Sbjct  310   --------GNELFTDVGIAFDMMLLAHNAGGKERTEENWKWLFKETGFARYNIIKINALP  361

Query  148   SIIQARP  128
             SII+A P
Sbjct  362   SIIEAFP  368



>gb|AFU50298.1| flavonoid O-methyltransferase 4 [Ocimum basilicum]
Length=336

 Score =   199 bits (507),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 142/401 (35%), Positives = 200/401 (50%), Gaps = 81/401 (20%)
 Frame = -1

Query  1321  WKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRGI  1142
             W +   +     +  A+EL IPD LE     ++L +LS+  GC    LYR+MRFLI  GI
Sbjct  14    WDHALSYITPTALSAAVELEIPDILEDHGGLMSLSELSAASGCPREPLYRLMRFLIFHGI  73

Query  1141  FKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSPVML  962
             F                       +    Y Q+PLS + TR+   ++  ++ ++++PV  
Sbjct  74    FT----------------------KSNDCYAQSPLSRVFTRE---NLGPYMLMQATPVTR  108

Query  961   APWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPA---HSKLIEDAMAC  791
             +P   LSG  L             +    ++  G+D W    +DPA   H +   + MA 
Sbjct  109   SP-AGLSGEAL----------KTGTPLYLKSIRGEDSW----NDPAYGFHMRAFTNGMAA  153

Query  790   HARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPHV  611
             HAR+   AIV   P              VVDVGG  G  +  LV+AFP V+GI FDLP V
Sbjct  154   HARLTAAAIVTNYPTAF------NGVRSVVDVGGRHGMAIGKLVEAFPWVRGIAFDLPEV  207

Query  610   VSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKVI  431
             V+ AP R GV  VGG+MF+ +PKADA+ LMWVLHDW D++C++IL KC+EAIP  TGKV+
Sbjct  208   VADAPPRKGVDFVGGDMFESLPKADAVMLMWVLHDWSDDKCIEILKKCKEAIPTSTGKVM  267

Query  430   IAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMMA  251
             I +AI+ +  E  + + G R                               L LDM MMA
Sbjct  268   IVDAIINEEGEG-DEFSGAR-------------------------------LSLDMTMMA  295

Query  250   HTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
              T +G ER+ K+W H+L  AGF  +TV +   +  +I+A P
Sbjct  296   MTTQGKERSYKEWVHLLNEAGFSKHTVKNIKTIEFVIEAYP  336



>ref|XP_006480224.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Citrus 
sinensis]
Length=351

 Score =   200 bits (508),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 129/410 (31%), Positives = 191/410 (47%), Gaps = 84/410 (20%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCS---PSALYRIMRFLI  1154
             +W+++F FT    +K A+EL + D + S    +TL QL+S +  S    S L RIMR L+
Sbjct  14    VWQFMFAFTYSMALKSAVELRLADIMHSHGCPITLSQLASRIDSSCPDISHLARIMRMLV  73

Query  1153  NRGIFKEVEMTLPTIsstssteaalasTRPTRG-----YVQTPLSALLTRDGEKSMAAFV  989
              +GIF                    A+  P+ G     Y  T +S  L  D E S+A  +
Sbjct  74    YKGIF--------------------AAHHPSDGGDETMYGTTHISKWLLHDSELSLAPMI  113

Query  988   RLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLI  809
              ++++  +LAPW  LS             C       F  A+G   W +A  +P  + L 
Sbjct  114   LVQNNQWLLAPWHYLS------------QCVKKGGIPFRKAHGSTFWDFASQNPQFNNLF  161

Query  808   EDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEML---VKAFPGVK  638
              +AMAC  ++ + A V         H        +  +    G T   L   VK++P +K
Sbjct  162   NEAMACTTKITMKAFVS--------HYKVDGFNNIRSMVDVGGGTGTALAEIVKSYPHIK  213

Query  637   GINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREA  458
             G+NFDL HV++ AP   GV H+GG+MF  IP ADA+F+ W+LHDWGDE C++IL  CR+A
Sbjct  214   GVNFDLQHVIATAPTHEGVSHIGGDMFDAIPNADAVFMKWILHDWGDEACIKILKNCRKA  273

Query  457   IPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVG  278
             IPE+ GKVII + +L+                                  + +    E  
Sbjct  274   IPEKIGKVIIVDIVLQP---------------------------------DGSGLFDETR  300

Query  277   LMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             L+ D++MM     G ERTE +W  +L   GF  + +     + SII+A P
Sbjct  301   LVFDLLMMVDLSGGKERTELEWKKILEKGGFPRHRIIKIPALQSIIEAYP  350



>ref|XP_009108678.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Brassica 
rapa]
Length=318

 Score =   199 bits (505),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 128/285 (45%), Positives = 167/285 (59%), Gaps = 35/285 (12%)
 Frame = -1

Query  1360  RRQEVDYEEEDG--IWKYVFGFTEMAVVKCAIELGIPDFLESQ--EQAVTLDQLSSGLGC  1193
             +R  VD E +    IW+YVFGF ++A  KCAI+L IP+ +E+    Q +TL +LSS +  
Sbjct  5     KRNLVDEEAKASLDIWRYVFGFADIAAAKCAIDLKIPEAIENHPSSQPMTLAELSSTVSA  64

Query  1192  SPSALYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLS--ALLTR  1019
             SPS L RIMRFL+++GIFKEV +                    T GY  TPLS   ++T+
Sbjct  65    SPSHLRRIMRFLVHQGIFKEVPIK----------------DGLTTGYTNTPLSRRMMITK  108

Query  1018  DGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYA  839
                KS+A FV  E+S  MLAPWL+LS  V           +GS    F+A + KDVW  A
Sbjct  109   RDGKSLAPFVLFETSHEMLAPWLRLSSVV-------SSPVNGSHPPPFDAVHNKDVWALA  161

Query  838   ESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLV  659
             E +P  S++I +AMAC  R  VP + +AC DL            VVDVGGG+G  V +LV
Sbjct  162   EDNPCFSEMINEAMACDTRRVVPRVARACHDLF------DGVATVVDVGGGNGEAVGILV  215

Query  658   KAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFL  524
             K FP +KG NFDLPHV+ VA    GV +VGG+MF  IPK DA+F+
Sbjct  216   KEFPWIKGFNFDLPHVIDVAQVLDGVENVGGDMFDSIPKCDAVFI  260



>ref|XP_006428632.1| hypothetical protein CICLE_v10012033mg [Citrus clementina]
 gb|ESR41872.1| hypothetical protein CICLE_v10012033mg [Citrus clementina]
Length=362

 Score =   200 bits (508),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 131/410 (32%), Positives = 201/410 (49%), Gaps = 67/410 (16%)
 Frame = -1

Query  1339  EEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPS---ALYRI  1169
             E +  +W ++F F     +KCAI+LGIPD +    + +TL++L S L  +PS    +YR+
Sbjct  14    EAQTHVWNHIFNFINSMTLKCAIQLGIPDIISKHGKPMTLNELVSALTINPSKSRCVYRL  73

Query  1168  MRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFV  989
             MR LI+ G F + ++            ++  +    +GYV T  S LL +D   S+  F+
Sbjct  74    MRILIHTGFFAQQKLI-----------SSRNNNDEEQGYVLTNASKLLLKDNPLSVTPFL  122

Query  988   RLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLI  809
             +    P++L+PW +L             +        F+ A+GK +W YA  +P  +   
Sbjct  123   QAMLDPILLSPWQQL-----------RTWFQNDDPTPFDTAHGKTLWEYAGDEPKLNNFF  171

Query  808   EDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGIN  629
              +AMA  A +A   ++  C D+            +VDVGGG GT  + + KAFP ++   
Sbjct  172   NEAMASDAWLATSVMIHKCKDVF------EGLNSLVDVGGGIGTAAKAIAKAFPKLECTC  225

Query  628   FDLPHVVS-VAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIP  452
             FDLPHVV+ +      + +VGG+MF+ I  ADA+ L W+LHDW DEECV+IL KC+EAI 
Sbjct  226   FDLPHVVNGLDSDLANLKYVGGDMFEAISPADAVLLKWILHDWNDEECVKILKKCKEAIT  285

Query  451   EE--TGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVG  278
              +   GKVII + I                                ++    ++ S E  
Sbjct  286   SDGKKGKVIIIDMI--------------------------------RENKKGDDKSIETQ  313

Query  277   LMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             L  DM+MM     G ER EK+W+ + T AGF  Y +     + S+I+  P
Sbjct  314   LFFDMLMMVLL-TGTERDEKEWTKLFTYAGFSDYKIIPILGLRSLIEVYP  362



>ref|XP_002278127.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=354

 Score =   200 bits (508),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 143/413 (35%), Positives = 202/413 (49%), Gaps = 79/413 (19%)
 Frame = -1

Query  1342  YEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSP---SALYR  1172
             +E +  I+K+VF F +   +KCA++LGIPD + +  Q +TL +L+S +   P   S L++
Sbjct  13    FEAQSFIYKHVFSFMDSMSLKCAVQLGIPDAIHNHNQPITLPELASAIQVPPEKTSRLHQ  72

Query  1171  IMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAF  992
             +MR L++ G F                 A         GYV TP S LL +    S+A  
Sbjct  73    LMRLLVHSGFF-----------------AMQKVDENQEGYVLTPPSRLLVKGNATSLAPI  115

Query  991   VRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKL  812
             V     PV++ PW  L             +  GSS  AFEAA+G D+W Y   +P    L
Sbjct  116   VLGMLDPVLVTPWHFLG-----------SWLQGSSLTAFEAAHGMDLWNYGNQNPEFFSL  164

Query  811   IEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGI  632
             I + MA  +RM   AI + C ++            +VDVGGG GT    + +AFP +K  
Sbjct  165   IGEIMATDSRMMSLAI-RECKEIF------EGLSSLVDVGGGTGTMARGICEAFPHLKCT  217

Query  631   NFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIP  452
               DLP VV+  PK   + +VGG+MFQ IP ADAIF+  VLH+WGDE+CV+IL +CREAIP
Sbjct  218   VLDLPQVVANLPKSENLDYVGGDMFQSIPSADAIFIKSVLHNWGDEDCVKILKRCREAIP  277

Query  451   E--ETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVG  278
                E GKVII + +L                                   +N  + +E+ 
Sbjct  278   SSAEGGKVIIIDLVL-----------------------------------SNKKDEHELA  302

Query  277   ---LMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
                L  DM+MM     G ER E++W  +   AGF  Y +T    V+S+I+  P
Sbjct  303   KTKLFNDMMMMVLVA-GKERCEEEWEKLFLEAGFSHYKITPRFGVLSLIEVYP  354



>ref|XP_006469137.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=362

 Score =   200 bits (508),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 130/410 (32%), Positives = 201/410 (49%), Gaps = 67/410 (16%)
 Frame = -1

Query  1339  EEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPS---ALYRI  1169
             E +  +W ++F F     +KCA+EL IPD +    +  TL+ L S L  +PS    +YR+
Sbjct  14    EAQAHVWNHIFNFINSMSLKCAVELSIPDIINKHGKPTTLNDLVSALTINPSKTRCVYRL  73

Query  1168  MRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFV  989
             MR LI+ G F +  +            ++  +    +GYV T  S LL +D   S+   +
Sbjct  74    MRILIHSGFFAQQTLN-----------SSRNNNDEEQGYVLTNASKLLLKDSPLSVTPLL  122

Query  988   RLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLI  809
             +    P++L+PWLKLS            +        F+  +GK  W YA  +P  +   
Sbjct  123   QAVLDPILLSPWLKLS-----------TWFQSDDPAPFDMVHGKSFWEYAGDEPKINNFF  171

Query  808   EDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGIN  629
              +AMA  AR+A   ++  C ++            +VDVGG  GT  + + KAFP ++  +
Sbjct  172   NEAMASDARLATRVVIHKCKNVF------EGLNSLVDVGGATGTVAKAIAKAFPNLECTD  225

Query  628   FDLPHVVS-VAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIP  452
             FDLPHVV+ +      + +VGG+MF+ IP ADA+ L W+LHDW DEECV+IL KC+EAI 
Sbjct  226   FDLPHVVNGLESDLANLKYVGGDMFEAIPPADAVVLKWILHDWNDEECVKILKKCKEAIT  285

Query  451   EET--GKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVG  278
               +  GKVII + ++R++++                                ++ S E  
Sbjct  286   SNSKIGKVIIID-MMRENKK-------------------------------GDDESTETQ  313

Query  277   LMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             L   M+MM     G ER EK+W+ +L   GF  Y +T    + S+I+  P
Sbjct  314   LFFYMLMMV-LATGTERDEKEWAKLLADVGFSDYKITSILGLRSLIEVYP  362



>ref|XP_003539906.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Glycine 
max]
Length=363

 Score =   199 bits (507),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 136/415 (33%), Positives = 200/415 (48%), Gaps = 77/415 (19%)
 Frame = -1

Query  1339  EEEDG------IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSA-  1181
             EEED       IW+Y+  FT+   +K  IEL I D ++   + ++L Q+   +  +PS  
Sbjct  14    EEEDSLLGQVEIWRYMTCFTDSVALKSVIELRIADIIDRYGKPLSLSQIVENIDDAPSPD  73

Query  1180  ---LYRIMRFLINRGIFK-EVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDG  1013
                L R+MR ++ R IF  E   T  T+                  Y  T  S  + RD 
Sbjct  74    ASLLQRVMRVMVRRKIFSAEQSETGETL------------------YGLTRASKWILRDT  115

Query  1012  EKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAES  833
             + ++A  + LE+ P+ L P   +S  +  G  N           AF   +G + +     
Sbjct  116   KMTLAPMLLLENHPIHLNPAHYISEIIREGTKN---------GTAFFKCHGHEQFEMTGL  166

Query  832   DPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKA  653
             DP +++L  + M C AR+   A++    D             +VDVGGG G ++  +V+A
Sbjct  167   DPEYNRLFNEGMVCTARVVSKAVITGYKD------GFNQIKSLVDVGGGIGGSLSEIVRA  220

Query  652   FPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILS  473
             +P +  INFDLPHVV+ APK  G+ HVGG+MF  IP ADAI++ W+LHDW DE CV+IL 
Sbjct  221   YPHINAINFDLPHVVATAPKYDGITHVGGDMFVSIPDADAIYMKWILHDWSDEHCVKILK  280

Query  472   KCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNN  293
              CR+AIPE+TGKVII + +LR                                    N  
Sbjct  281   NCRKAIPEKTGKVIIVDHVLRP---------------------------------EGNEL  307

Query  292   SYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
               +VG+  DM+++AH   G ERTE+ W  +    GF  Y +   + + SII+A P
Sbjct  308   FTDVGIAFDMMLLAHNAGGKERTEENWKWLFKETGFARYNIIKINALPSIIEAFP  362



>sp|Q6WUC2.1|7OMT_PAPSO RecName: Full=(R,S)-reticuline 7-O-methyltransferase; Short=7OMT 
[Papaver somniferum]
 gb|AAQ01668.1| (R,S)-reticuline 7-O-methyltransferase [Papaver somniferum]
Length=355

 Score =   199 bits (506),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 137/408 (34%), Positives = 205/408 (50%), Gaps = 76/408 (19%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGC-SPSA------LYRIM  1166
             IW+++F F +   +KCA+ELGIPD + S  + VT+ ++   L   +PS+      L RIM
Sbjct  14    IWEHMFAFVDSMALKCAVELGIPDIINSHGRPVTISEIVDSLKTNTPSSSPNIDYLTRIM  73

Query  1165  RFLINRGIF-KEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFV  989
             R L+++ +F  E+      +                  Y  T  S  L +D + +++  V
Sbjct  74    RLLVHKRLFTSELHQESNQLL-----------------YNLTRSSKWLLKDSKFNLSPLV  116

Query  988   RLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLI  809
               E++P++L PW  L              C+   S  FE A+G ++W  A +DP  +  +
Sbjct  117   LWETNPILLKPWQYLGK------------CAQEKSSPFERAHGCEIWDLALADPKFNNFL  164

Query  808   EDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGIN  629
               AM C     +  ++    D     G +G+   +VDVGGG G+ +  +VKA P ++GIN
Sbjct  165   NGAMQCSTTTIINEMLLEYKD-----GFSGIAGSLVDVGGGTGSIIAEIVKAHPHIQGIN  219

Query  628   FDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAI-P  452
             FDLPHVV+ A + PGV HVGG+MF  IP+ADA+ + W+LHDW DE+C  IL  C  AI  
Sbjct  220   FDLPHVVATAAEFPGVKHVGGDMFVDIPEADAVIMKWILHDWSDEDCTIILKNCYRAIRK  279

Query  451   EETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLM  272
             ++ GKVII + +LR                                  + N+   ++GL+
Sbjct  280   KKNGKVIIVDCVLRP---------------------------------DGNDLFDKMGLI  306

Query  271   LDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
              D++MMAHT  G ERTE +W  +L  AGF  Y V  T     II+A P
Sbjct  307   FDVLMMAHTTAGKERTEAEWKILLNNAGFPRYNVIRTPAFPCIIEAFP  354



>ref|XP_010088827.1| (RS)-norcoclaurine 6-O-methyltransferase [Morus notabilis]
 gb|EXB37024.1| (RS)-norcoclaurine 6-O-methyltransferase [Morus notabilis]
Length=351

 Score =   199 bits (506),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 139/410 (34%), Positives = 200/410 (49%), Gaps = 85/410 (21%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGL--GCSP--SALYRIMRFL  1157
             IWKY+F F +   ++C +EL IPD + S    +TL Q+ S +    SP  S L RIMRFL
Sbjct  15    IWKYMFRFVDSMALRCVVELRIPDIINSHGGPITLAQIVSSIPEASSPDISCLARIMRFL  74

Query  1156  INRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSAL--LTR---DGEKSMAAF  992
             + R IF                     +  P+ G     L  L  L+R     E+++A  
Sbjct  75    VRRNIFT--------------------AHHPSNGSEDITLYGLTHLSRWLLTCEQTLAPM  114

Query  991   VRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKL  812
             +  ++ P ++ P    SG            C       FE A+G+ ++ +   +    K 
Sbjct  115   LLWQTDPTLMTPMHYFSG------------CVKGGGVPFEKAHGRGMFAFMSENEEFGKA  162

Query  811   IEDAMACHARMAVPAIVQ--ACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVK  638
               DAM C AR+ +  I+    C D +      G    ++DVGGG G  +  +VK++P +K
Sbjct  163   CNDAMECTARIILKEILSDSQCGDHVF-----GCLGSLIDVGGGTGGALSEIVKSYPHIK  217

Query  637   GINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREA  458
             GINFDLPHVVS AP   GV HV G+MF+ IP ADA    W++HDW DE+CV+IL  CR+A
Sbjct  218   GINFDLPHVVSKAPVYAGVSHVAGDMFESIPSADA----WIMHDWMDEDCVKILKNCRKA  273

Query  457   IPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVG  278
             +PE++GKVII + +L                                     N    ++G
Sbjct  274   VPEKSGKVIIVDVVL---------------------------------DLKGNGLFDDMG  300

Query  277   LMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             L+LD++M AH+  G ERTEK+W  +L   GF  Y +   S  +SII+A P
Sbjct  301   LILDLLMAAHSLGGKERTEKEWKKILKEGGFSCYKIIRISTFLSIIEAYP  350



>ref|XP_006480453.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=362

 Score =   199 bits (505),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 131/410 (32%), Positives = 200/410 (49%), Gaps = 67/410 (16%)
 Frame = -1

Query  1339  EEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPS---ALYRI  1169
             E +  +W ++F F     +KCAI+LGIPD +    + +TL++L S L  +PS    +YR+
Sbjct  14    EAQTHVWNHIFNFINSMTLKCAIQLGIPDIISKHGKPMTLNELVSALTINPSKSRCVYRL  73

Query  1168  MRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFV  989
             MR LI+ G F + ++            ++  +     GYV T  S LL +D   S+  F+
Sbjct  74    MRILIHTGFFAQQKLI-----------SSRNNNDEELGYVLTNASKLLLKDNPLSVTPFL  122

Query  988   RLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLI  809
             +    P++L+PW +L             +        F+ A+GK +W YA  +P  +   
Sbjct  123   QAMLDPILLSPWQQL-----------RTWFQNDDPTPFDTAHGKTLWEYAGDEPKLNNFF  171

Query  808   EDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGIN  629
              +AMA  A +A   ++  C D+            +VDVGGG GT  + + KAFP ++   
Sbjct  172   NEAMASDAWLATSVMIHKCKDVF------EGLNSLVDVGGGIGTAAKAIAKAFPKLECTC  225

Query  628   FDLPHVVS-VAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIP  452
             FDLPHVV+ +      + +VGG+MF+ I  ADA+ L W+LHDW DEECV+IL KC+EAI 
Sbjct  226   FDLPHVVNGLDSDLANLKYVGGDMFEAISPADAVLLKWILHDWNDEECVKILKKCKEAIT  285

Query  451   EE--TGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVG  278
              +   GKVII + I                                ++    ++ S E  
Sbjct  286   SDGKKGKVIIIDMI--------------------------------RENKKGDDKSIETQ  313

Query  277   LMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             L  DM+MM     G ER EK+W+ + T AGF  Y +     + S+I+  P
Sbjct  314   LFFDMLMMVLL-TGTERDEKEWTKLFTYAGFSDYKIIPILGLRSLIEVYP  362



>gb|AAP45314.1| S-adenosyl-L-methionine:3'-hydroxy-N-methylcoclaurine 4'-O-methyltransferase 
2 [Papaver somniferum]
 gb|AHF27397.1| S-adenosyl-L-methionine:3'-hydroxy-N-methylcoclaurine 4'- O-methyltransferase 
2 [synthetic construct]
Length=357

 Score =   199 bits (505),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 131/422 (31%), Positives = 212/422 (50%), Gaps = 71/422 (17%)
 Frame = -1

Query  1381  SMDAK-SIRRQEVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSS  1205
             S+DAK +   QEV  +++  +W  ++GF +  V++CA+E+GI D +++ + A+TL QL++
Sbjct  3     SLDAKPAAATQEVSIKDQAQLWNIIYGFADSLVLRCAVEIGIADIIKNNDGAITLAQLAA  62

Query  1204  GL---GCSPSALYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLS  1034
              L     S   LYR++R+L++  I ++                   +    + Y   P+ 
Sbjct  63    KLPITNVSSDYLYRMVRYLVHLNIIEQ----------------ETCNGGVEKVYSLKPVG  106

Query  1033  ALLTRDGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKD  854
              LL RD E+SM   +   +    +  W  +            +     S+ AFE   G D
Sbjct  107   TLLLRDAERSMVPMILGMTQKDFMVSWHFMK-----------EGLGNGSTTAFEKGMGMD  155

Query  853   VWRYAESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgtt  674
             +W+Y E +P  S+L  + MA   R+    +++ C D             +VD+GGG+GTT
Sbjct  156   IWKYLEGNPDQSQLFNEGMAGETRLLTKTLIEDCRDTF------QGLDSLVDIGGGNGTT  209

Query  673   vEMLVKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDE  494
             ++ + +AFP +K   +DLPHVV+ +   P +  V G+MF+ +P A AI L  +LHDW DE
Sbjct  210   IKAIYEAFPHIKCTLYDLPHVVANSHDLPNIEKVPGDMFKSVPSAQAILLKLILHDWTDE  269

Query  493   ECVQILSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKD  314
             ECV IL KC+EAIP+ETGKVII +  L +                               
Sbjct  270   ECVNILKKCKEAIPKETGKVIIVDVALEEE------------------------------  299

Query  313   RNNNNNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQA  134
                +N+   +  L+LD+ M+ +TG G ERT   W ++L  AGF+S+ +     + S+I+A
Sbjct  300   ---SNHELTKTRLILDIDMLVNTG-GRERTADDWENLLKRAGFRSHKIRPIRAIQSVIEA  355

Query  133   RP  128
              P
Sbjct  356   FP  357



>ref|XP_006480221.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Citrus 
sinensis]
Length=351

 Score =   198 bits (504),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 130/411 (32%), Positives = 192/411 (47%), Gaps = 86/411 (21%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCS---PSALYRIMRFLI  1154
             +W+++F FT    +K A+EL + D + S    +TL QL+S +  S    S L R+MR L+
Sbjct  14    VWQFMFAFTYSMALKSAVELRLADIMHSHGCPITLSQLASRIDSSCPDISHLARVMRMLV  73

Query  1153  NRGIFKEVEMTLPTIsstssteaalasTRPTRG-----YVQTPLSALLTRDGEKSMAAFV  989
              +GIF                    A+  P+ G     Y  T +S  L  D E S+A  +
Sbjct  74    YKGIF--------------------AARHPSDGGDETLYGTTHISKWLLHDSELSLAPMI  113

Query  988   RLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLI  809
              ++++  +LAPW  LS             C       F  A+G   W +A  +P  + L 
Sbjct  114   LVQNNQWLLAPWHYLS------------QCVKKGGIPFRKAHGSTFWDFASQNPQFNNLF  161

Query  808   EDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEML---VKAFPGVK  638
              +AMAC  ++ + A V         H        +  +    G T  +L   VK++P +K
Sbjct  162   NEAMACTTKITMKAFVS--------HYKVDGFNNIRSMVDVGGGTGTVLAEIVKSYPHIK  213

Query  637   GINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREA  458
             GINFDL HV++ AP   GV HVGG+MF  IP ADA+F+ W+LHDWGDE C++IL  CR+A
Sbjct  214   GINFDLQHVIATAPTHEGVSHVGGDMFDAIPNADAVFMKWILHDWGDEACIKILKNCRKA  273

Query  457   IPEETGKVIIAEAILR-DHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEV  281
             IPE+  KVII + +L+ D   + +                                  E 
Sbjct  274   IPEKIRKVIIVDIVLQPDGSGLFD----------------------------------ET  299

Query  280   GLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
              L+ D++MM     G ERTE +W  +L   GF  Y +     ++ II+A P
Sbjct  300   RLVFDLLMMVDLSGGKERTELEWKKILENGGFPRYRIIKIPALLWIIEAYP  350



>gb|AAR09598.1| flavonoid 7-O-methyltransferase [Mentha x piperita]
Length=344

 Score =   197 bits (501),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 141/416 (34%), Positives = 207/416 (50%), Gaps = 88/416 (21%)
 Frame = -1

Query  1336  EEDGI-----WKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYR  1172
             EED +     W + FGF + ++VK A+EL IPD LES+   V++ +L++ + CS   +YR
Sbjct  4     EEDSLALAEAWNHGFGFIKTSIVKTAVELEIPDILESRGAPVSIPELATAVDCSADRIYR  63

Query  1171  IMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAF  992
             +MRFL   GIFK  +    +    S              Y QTP+S  LTR+   ++  F
Sbjct  64    VMRFLAYHGIFKRTKPPPESTEGGSVY------------YAQTPVSRRLTRE---NLGPF  108

Query  991   VRL-----ESSPVMLAPWLKLSGR--VLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAES  833
             V L     E S  + A  L+ S R  V+  + ++H Y                       
Sbjct  109   VLLQGTMREPSGCVTAETLRTSKRPGVVNENESDHLY----------------------E  146

Query  832   DPAHS-KLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVK  656
             DP  S K+  DAMA HARM   A+++   +             +VDVGG  G  + MLVK
Sbjct  147   DPVFSMKVFRDAMASHARMTTAAVIENYGEGF------QGVGSLVDVGGSYGMALSMLVK  200

Query  655   AFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQIL  476
             AFP ++GI FDLP VV+ A    GV  VGG MF+ IPKAD + LM+VLH+W DEECV+IL
Sbjct  201   AFPWLRGICFDLPEVVARASPLKGVEFVGGTMFESIPKADVVMLMFVLHNWSDEECVEIL  260

Query  475   SKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNN  296
              +C++A+ ++ GKVII +A++                                D + + +
Sbjct  261   KRCKDAVSKDKGKVIIIDAVI--------------------------------DEDGDGD  288

Query  295   NSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
                   L LD+ MMA   +G ERT  +W+ ++  AGF+ + V +   + S+I+A P
Sbjct  289   EFTGARLGLDVTMMATMFEGRERTYVEWARIINEAGFRRHVVKNIKTLESVIEAYP  344



>emb|CAN75970.1| hypothetical protein VITISV_009881 [Vitis vinifera]
Length=354

 Score =   197 bits (501),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 142/413 (34%), Positives = 201/413 (49%), Gaps = 79/413 (19%)
 Frame = -1

Query  1342  YEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSP---SALYR  1172
             +E +  I+K+VF F +   +KCA++LGIPD + +  Q +TL +L+S +   P   S L++
Sbjct  13    FEAQSFIYKHVFSFMDSMSLKCAVQLGIPDAIHNHNQPITLPELASAIQVPPEKTSRLHQ  72

Query  1171  IMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAF  992
             +MR L++ G F                 A         GYV TP S LL +    S+A  
Sbjct  73    LMRLLVHSGFF-----------------AMQKVDENQEGYVLTPPSRLLVKGNATSLAPI  115

Query  991   VRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKL  812
             V     PV++ PW  L             +  GSS  AFEAA+G D+W Y   +P     
Sbjct  116   VLGMLDPVLVTPWHFLG-----------SWLQGSSLTAFEAAHGMDLWNYGNQNPEXFSX  164

Query  811   IEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGI  632
             I + MA  +RM   AI + C ++            +VDVGGG GT    + +AFP +K  
Sbjct  165   IGEIMATDSRMMSLAI-RECKEIF------EGXSSLVDVGGGTGTMARGICEAFPHLKCT  217

Query  631   NFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIP  452
               DLP VV+  PK   + +VGG+MFQ IP ADAIF+  VLH+WGDE+CV+IL +CREAIP
Sbjct  218   VLDLPQVVANLPKSENLDYVGGDMFQSIPSADAIFIKSVLHNWGDEDCVKILKRCREAIP  277

Query  451   E--ETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVG  278
                E GKVII + +L                                   +N  + +E+ 
Sbjct  278   SSAEGGKVIIIDLVL-----------------------------------SNKKDEHELA  302

Query  277   ---LMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
                L  DM+MM     G ER E++W  +   AGF  Y +T    V+S+I+  P
Sbjct  303   KTKLFNDMMMMVLVA-GKERCEEEWEKLFLEAGFSHYKITPRFGVLSLIEVYP  354



>gb|ABZ89566.1| O-methyltransferase 2 [Humulus lupulus]
Length=360

 Score =   197 bits (501),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 139/416 (33%), Positives = 201/416 (48%), Gaps = 70/416 (17%)
 Frame = -1

Query  1357  RQEVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSA-  1181
             + E     E  +WK + G  +  V+KCA+EL IPD + S    +TL Q++S +  SPS  
Sbjct  8     QTEAALRGEANVWKSINGIADFMVMKCALELRIPDIVHSHSAPITLAQIASSVPDSPSLN  67

Query  1180  ---LYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGE  1010
                L RIMR L+ R IF +            S +       PT  +    L +  T   +
Sbjct  68    LSYLSRIMRLLVRRKIFSQ----------HKSLDGEEVLYGPT--HSSRLLLSKTTLPDQ  115

Query  1009  KSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANG-KDVWRYAES  833
              ++A FV   + P + APW  L+             C     + FE  +G + +W  +  
Sbjct  116   VTLAPFVAFMTHPYLSAPWSCLA------------RCVKEGGNGFEMVHGGRQLWDLSPG  163

Query  832   DPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKA  653
             +P  +K+  D MA  AR+   AI+    D+          C +VDVGG  G ++  +VK+
Sbjct  164   NPEFNKVFNDGMASTARITTMAILSEYRDVFC------GICSLVDVGGEFGGSISAIVKS  217

Query  652   FPGVKGINFDLPHVVSVAPKRPG-VHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQIL  476
              P +KGIN+DLPHVV+ AP   G V HVGGNMF+ IP A A+F+ W+LHDW DE+CV+IL
Sbjct  218   HPHIKGINYDLPHVVATAPTYTGLVSHVGGNMFEWIPTAVAVFMKWILHDWADEDCVKIL  277

Query  475   SKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNN  296
               CR A+PE+ GK+II + +L                                     N 
Sbjct  278   KNCRRAMPEKGGKIIIVDIVLEP---------------------------------EGNG  304

Query  295   NSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
                +  +MLD+ +MA T +G ERTEK+W  VL   GF  Y +     + S+I+A P
Sbjct  305   LFDDAAVMLDIALMALT-RGKERTEKEWKRVLEEGGFPRYQILKIPALTSVIEAYP  359



>ref|XP_010035710.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Eucalyptus 
grandis]
Length=360

 Score =   196 bits (499),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 141/400 (35%), Positives = 199/400 (50%), Gaps = 84/400 (21%)
 Frame = -1

Query  1285  VKCAIELGIPDFLESQEQA-VTLDQLSSGLGCSPSA----LYRIMRFLINRGIFKEVEMT  1121
             +KCA+EL IPD + S     VTL Q++S +  SPS     L RIMR L+   IF      
Sbjct  30    LKCAVELRIPDIIHSYGGGPVTLAQIASRIP-SPSLETTYLARIMRLLVRENIFS-----  83

Query  1120  LPTIsstssteaalasTRPTRG-------YVQTPLSALLTRDG--EKSMAAFVRLESSPV  968
                              +P  G       Y   P S  L +    E S+A  V + + P 
Sbjct  84    -------------ANRCQPDDGHESHETLYSLPPSSRWLLQGPGFELSLAPVVLMLNHPW  130

Query  967   MLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMACH  788
             +++PW         GD      C  +   AFE A+G+ +W +A  +P  ++L  D MAC 
Sbjct  131   LMSPWH------CFGD------CIKTGGVAFEMAHGRKIWDFASENPEFNRLFNDGMACV  178

Query  787   ARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPHVV  608
             +R+ +  I++   D             +VDVGGG G T+  ++K+FP ++GIN+DLPHVV
Sbjct  179   SRITIGGIIEVYKD------GFESIGSLVDVGGGIGKTLVEIIKSFPHIQGINYDLPHVV  232

Query  607   SVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKVII  428
             + AP   GV HVGGNMF+ IP ADA+ +M ++HDWGDE+CV+IL  CR+AIPE+ GKVII
Sbjct  233   ATAPAHDGVTHVGGNMFETIPHADAVLMMEIMHDWGDEDCVKILKNCRKAIPEKNGKVII  292

Query  427   AEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMMAH  248
             A  +L+         +G  M                           + GL++D+VMMA 
Sbjct  293   ANIVLK--------AEGDGMFD-------------------------KTGLVMDLVMMAL  319

Query  247   TGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
                G ER E +W  +L   GF  Y +  T  + SII+A P
Sbjct  320   CSGGKERDEPEWKKILEEGGFPRYNIIKTPCLQSIIEAYP  359



>gb|ABK22503.1| unknown [Picea sitchensis]
Length=377

 Score =   197 bits (501),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 124/403 (31%), Positives = 195/403 (48%), Gaps = 63/403 (16%)
 Frame = -1

Query  1321  WKYVFGFTEMAVVKCAIELGIPDFL--ESQEQAVTLDQLSSGLGC-SP--SALYRIMRFL  1157
             W   F F E   VKCAI L IPD +  E     ++L+++++ L   SP  S ++RIMRFL
Sbjct  32    WNCTFAFVESLAVKCAILLEIPDMIAREGPRATLSLNEIAARLPRESPDVSCVFRIMRFL  91

Query  1156  INRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLES  977
             + +G+F+          ++    +    +  TR Y  TP+S    ++ E+SM   + L++
Sbjct  92    VAKGVFR----------ASVVKSSEDGGSYETR-YGLTPVSKWFVKEREQSMVPMLLLQN  140

Query  976   SPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAM  797
                ++APW   +  VL G               F+  NG D+W Y  + P  + L  +AM
Sbjct  141   DERIVAPWHCFNECVLDG------------GLPFQRTNGGDMWSYTSAHPDFNHLFNNAM  188

Query  796   ACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLP  617
             AC   + + A++        L+    V                 +V+ +P +K IN+DL 
Sbjct  189   ACDTGIVMKALLSKYRGFHALNSLVDVGGGTGTATAE-------IVRTYPSIKAINYDLA  241

Query  616   HVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGK  437
             HVV+ A + PGV HVGG+MF+ +P  DAIF+ W++H+W DE+C++IL  CR+AIP ETGK
Sbjct  242   HVVATARQLPGVEHVGGDMFETVPSGDAIFMKWIMHNWSDEDCIKILKNCRKAIP-ETGK  300

Query  436   VIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVM  257
             VII + ++                             Q  ++N        + L+ D++M
Sbjct  301   VIIVDMVVDS---------------------------QHNNKNERAALDPNLCLVFDLLM  333

Query  256   MAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
               H   G ERTE++W  +L   GF  Y +     V S+I+A P
Sbjct  334   ATHCTGGKERTEEEWKKILWEGGFGDYNIIAIPAVQSVIEAFP  376



>ref|NP_001243073.1| 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase-like 
[Glycine max]
 gb|AEV53337.1| inositol methyltransferase [Glycine max]
 gb|KHN41138.1| 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase [Glycine 
soja]
Length=369

 Score =   197 bits (500),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 134/415 (32%), Positives = 200/415 (48%), Gaps = 77/415 (19%)
 Frame = -1

Query  1339  EEEDG------IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSA-  1181
             EEED       IW+Y+  FT+   +K  IEL I D L+   + ++L Q+   +  +PS  
Sbjct  20    EEEDSLLGQVEIWRYMTCFTDSVALKAVIELRIADILDRYGKPLSLSQIVENIEDAPSPD  79

Query  1180  ---LYRIMRFLINRGIFKEVEM-TLPTIsstssteaalasTRPTRGYVQTPLSALLTRDG  1013
                L R++R ++ R IF   E  T  T+                  +  T  S  + RD 
Sbjct  80    ASLLQRVLRVMVRRKIFSAQESETGETL------------------FGLTRASKWILRDT  121

Query  1012  EKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAES  833
             + ++A  + LE+ P+ L P   +S  +  G  N           AF   +G + +     
Sbjct  122   KMTLAPMLLLENHPIHLNPAHYISEIIREGTKN---------GTAFFKCHGHEQFEMTGL  172

Query  832   DPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKA  653
             DP +++L  + M C AR+   A++    D             +VDVGGG G ++  +V+A
Sbjct  173   DPEYNRLFNEGMVCTARVVSKAVITGYKD------GFNQIKSLVDVGGGIGGSLSEIVRA  226

Query  652   FPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILS  473
             +P +  INFDLPHVV+ APK  G+ HVGG+MF  IP ADAI++ W+LHDW DE C++IL 
Sbjct  227   YPHINAINFDLPHVVATAPKFDGITHVGGDMFVSIPSADAIYMKWILHDWSDEHCIKILK  286

Query  472   KCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNN  293
              CR+AIPE+TGKVII + +LR                                    N  
Sbjct  287   NCRKAIPEKTGKVIIVDHVLRP---------------------------------EGNEL  313

Query  292   SYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
               +VG+  DM+++AH   G ERTE+ W  +    GF  Y +   + + SII+A P
Sbjct  314   FTDVGIAFDMMLLAHNAGGKERTEENWKWLFKETGFARYNIIKINALPSIIEAFP  368



>ref|XP_010244054.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Nelumbo 
nucifera]
Length=346

 Score =   195 bits (496),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 132/402 (33%), Positives = 198/402 (49%), Gaps = 73/402 (18%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSP---SALYRIMRFLI  1154
             IWK+V+GF +  V++CAI+LGI D +  Q + +TL +L + +   P     L+R+MR+L+
Sbjct  14    IWKFVYGFADCLVLRCAIDLGIADIIHKQGEPLTLSELGAQIPVQPVNTDHLHRLMRYLV  73

Query  1153  NRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESS  974
             +  IF +  +                       Y   P +  + +  +KS+ + + + + 
Sbjct  74    HMKIFTKETLD------------------GEARYGLAPPAKFIVKGWDKSIVSIILVVTD  115

Query  973   PVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMA  794
                +APW  L    L G+             AFE A G+ +W Y    P  +KL  + MA
Sbjct  116   KDFMAPWHCLKDS-LCGEGT-----------AFEKALGRSIWTYMADHPEKNKLFNEGMA  163

Query  793   CHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPH  614
             C  ++ + A+VQ C DL            +VDVGGG GT +  + KAFP +K   +DLPH
Sbjct  164   CDTKLLISALVQDCKDLF------QGIMSLVDVGGGTGTAMRAIAKAFPHLKCTIYDLPH  217

Query  613   VVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKV  434
             V++ +P  P V  + G+MF+ IP ADAI L  +LHDW D EC++IL +C+E++P E GKV
Sbjct  218   VIADSPDYPEVDRIAGDMFKHIPSADAILLKCILHDWDDGECIEILKRCKESVPREGGKV  277

Query  433   IIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMM  254
             II + ++    E  +    TR                               L LD+ MM
Sbjct  278   IIVDIVV--DLESKHPLTKTR-------------------------------LSLDLDMM  304

Query  253   AHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
               TG G ERTE +W  +L AAGF  + +T  S V S+I A P
Sbjct  305   VTTG-GKERTEAEWKKLLNAAGFPVFKITHISAVQSVIVAYP  345



>ref|XP_006364318.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=357

 Score =   196 bits (497),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 134/412 (33%), Positives = 200/412 (49%), Gaps = 71/412 (17%)
 Frame = -1

Query  1342  YEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSP---SALYR  1172
             ++ +  I+K+ F F    V+ CAI+LGIPD + S +Q +TL QL S L   P    A++R
Sbjct  10    FQGQAHIYKHAFSFANSMVLGCAIQLGIPDVIHSHKQPMTLSQLVSELKLLPEKSDAIHR  69

Query  1171  IMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAF  992
             +MR L+  G F   E                 ++   +GYV TP S LL R    +++ F
Sbjct  70    LMRLLVYSGFFATREF-------------LDENSENQQGYVLTPSSKLLLRSEIPNLSPF  116

Query  991   VRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKL  812
              R    PVM+ PW  L   +L           G+ +  FE A+G  +W++ + +P  + +
Sbjct  117   ARAMVDPVMVNPWQSLGDWIL-----------GNETTPFETAHGAPMWQFCDQNPRFNNV  165

Query  811   IEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGI  632
               +AMA  ++M    +V+ C  +            +VDVGGG G     ++ AFP +K  
Sbjct  166   FNEAMASDSQMMC-LVVKDCKQVF------QDMDSLVDVGGGTGIIANTILAAFPHLKCT  218

Query  631   NFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIP  452
               DLPHVV+  P    + +VGG+MF  IP ADAI    V+H+W DE CV+IL +CREAI 
Sbjct  219   VLDLPHVVANMPDTENLKYVGGDMFHSIPSADAILFKHVMHNWSDENCVKILKRCREAIK  278

Query  451   EET----GKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYE  284
             ++     GKV+I + +L                                DR+    N  E
Sbjct  279   DKNEGRKGKVLIIDMVL--------------------------------DRDEEAANMTE  306

Query  283   VGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             V L+ D++MM     G ERTEK+W ++   AGF SY +T    + S+I+  P
Sbjct  307   VKLIFDVLMMVLV-TGRERTEKEWENLFLEAGFMSYKITPLFGLRSLIEVFP  357



>ref|XP_011002662.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=357

 Score =   194 bits (492),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 130/403 (32%), Positives = 192/403 (48%), Gaps = 69/403 (17%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPS---ALYRIMRFLI  1154
             IW ++F F     +KCAI+LGIPD +    + VTL +L + L   PS    + R+MR LI
Sbjct  20    IWNHIFSFINSMSLKCAIDLGIPDIINKHSKPVTLPELIAALPVHPSKARCVPRLMRLLI  79

Query  1153  NRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESS  974
             + G F++ +++                     GYV T  S LL +D   S+A F++    
Sbjct  80    HSGFFEKQKVS---------------EDDQEEGYVLTNASQLLLKDNPFSVAPFLQAVLD  124

Query  973   PVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMA  794
             P++  PW  +S            +        F+ A+G+  W Y   +P  + L  DAMA
Sbjct  125   PILTKPWHFVS-----------TWLKNDDPTPFDTAHGRTFWDYVGHEPVFNHLFNDAMA  173

Query  793   CHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPH  614
               AR+    ++  C ++            +VDVGGG GT    + KAFP +    FDLPH
Sbjct  174   SDARLVTRVLINECKEVF------EGLGSLVDVGGGTGTVANSIAKAFPHLDCTVFDLPH  227

Query  613   VVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPE-ETGK  437
             VV+       + +VGG+MF+ IP AD I L W+LHDW DEECV+IL KC+EAI + E GK
Sbjct  228   VVADLQGSENLKYVGGDMFEAIPPADGIVLKWILHDWNDEECVKILKKCKEAIKDREGGK  287

Query  436   VIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVM  257
             V+I E ++ + +                                  + S E  +  DM+M
Sbjct  288   VMIIEMMMENQK--------------------------------GEDESIETQIFFDMLM  315

Query  256   MAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             M     G ER EK+W+ + + AGF +Y +T    + SII+  P
Sbjct  316   MI-LFTGQERNEKEWAKLFSDAGFSNYKITPILGLRSIIEVFP  357



>ref|XP_011002663.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=357

 Score =   193 bits (491),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 130/403 (32%), Positives = 192/403 (48%), Gaps = 69/403 (17%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPS---ALYRIMRFLI  1154
             IW ++F F     +KCAI+LGIPD +    + VTL +L + L   PS    + R+MR LI
Sbjct  20    IWNHIFSFINSMSLKCAIDLGIPDIINKHSKPVTLPELIATLPVHPSKARCVPRLMRLLI  79

Query  1153  NRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESS  974
             + G F++ +++                     GYV T  S LL +D   S+A F++    
Sbjct  80    HSGFFEKQKVS---------------EDDQEEGYVLTNASQLLLKDNPFSVAPFLQAVLD  124

Query  973   PVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMA  794
             P++  PW  +S            +        F+ A+G+  W Y   +P  + L  DAMA
Sbjct  125   PILTKPWHFVS-----------TWLKNDDPTPFDTAHGRTFWDYVGHEPVFNHLFNDAMA  173

Query  793   CHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPH  614
               AR+    ++  C ++            +VDVGGG GT    + KAFP +    FDLPH
Sbjct  174   SDARLVTRVLINECKEVF------EGLGSLVDVGGGTGTVANSIAKAFPHLDCTVFDLPH  227

Query  613   VVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPE-ETGK  437
             VV+       + +VGG+MF+ IP AD I L W+LHDW DEECV+IL KC+EAI + E GK
Sbjct  228   VVADLQGSENLKYVGGDMFEAIPPADGIVLKWILHDWNDEECVKILKKCKEAIKDREGGK  287

Query  436   VIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVM  257
             V+I E ++ + +                                  + S E  +  DM+M
Sbjct  288   VMIIEMMMENQK--------------------------------GEDESIETQIFFDMLM  315

Query  256   MAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             M     G ER EK+W+ + + AGF +Y +T    + SII+  P
Sbjct  316   MI-LFTGQERNEKEWAKLFSDAGFSNYKITPILGLRSIIEVFP  357



>ref|XP_010276063.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Nelumbo 
nucifera]
Length=345

 Score =   193 bits (490),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 132/411 (32%), Positives = 196/411 (48%), Gaps = 70/411 (17%)
 Frame = -1

Query  1351  EVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGL---GCSPSA  1181
             E D + +  +WK+++GF E   +KCAIELGI D L    Q +TL +L+S +     S   
Sbjct  2     EEDMKAQAQVWKHIYGFVESFTLKCAIELGIADILYEHGQPMTLSELASSIPLPSVSQDG  61

Query  1180  LYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSM  1001
             LYR++R+L++  +F                      +   + Y  TP S LL ++ EK++
Sbjct  62    LYRVLRYLVHMKLFD-----------------LQVDSDGLKKYRLTPASKLLVKNQEKNL  104

Query  1000  AAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAH  821
             A+FV L+   +    W  LS  V  G     + C G          G D   Y + D   
Sbjct  105   ASFVLLQLYEI--DTWNHLSAAVE-GTVTPWEKCHG----------GVDYIEYFKKDSVA  151

Query  820   SKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGV  641
             ++L+ DAM  H  M   A+V+ C    +L G   +  V    G         + K FP +
Sbjct  152   NQLLSDAMTSHTSMVTDALVKGCKKAHILDGVGSLIDVGGCTGVAARA----IAKWFPSI  207

Query  640   KGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCRE  461
             K   FDLPHVV+ AP+ P V  +GG+MF  IPK D +F+  VLHDWGDE+CV+IL KC+E
Sbjct  208   KCAVFDLPHVVANAPECPEVTRIGGDMFVSIPKTDVVFMKSVLHDWGDEDCVKILKKCKE  267

Query  460   AIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEV  281
             AI E+ GK +I + I+ D +   N + G R+                             
Sbjct  268   AISEKGGKAVIVD-IVMDVESSPNEFTGARL-----------------------------  297

Query  280   GLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             G+ +DM++      G ER+EK+W  +   AG+  Y +T    + SII+  P
Sbjct  298   GMEMDMLVAV---GGKERSEKEWHKLFKEAGYSGYKITPIVAIESIIEVFP  345



>gb|AFK39321.1| unknown [Lotus japonicus]
Length=369

 Score =   193 bits (490),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 133/430 (31%), Positives = 204/430 (47%), Gaps = 77/430 (18%)
 Frame = -1

Query  1384  LSMDAKSIRRQEVDYEEEDG------IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVT  1223
             LS  +  +  + V  EEE+       IW+Y+  FT+   +K  IEL + D ++   + ++
Sbjct  5     LSKHSPPLAFKGVSKEEEESLLGQVEIWRYMCAFTDSVALKSIIELRVADIIDRFGKPLS  64

Query  1222  LDQLSSGLGCSPSA----LYRIMRFLINRGIFK-EVEMTLPTIsstssteaalasTRPTR  1058
             L Q+++ +  +PS     L R+MR ++ R IF  E   +  T+                 
Sbjct  65    LSQIAANIEDAPSPDVKLLERLMRVMVRRKIFSAEKSESGETL-----------------  107

Query  1057  GYVQTPLSALLTRDGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDA  878
              Y  T  S  + RD + ++A  + LE+ P+ L P   +S  V  G  N   +      D 
Sbjct  108   -YGLTRASKWILRDTKMTLAPMLLLENHPIHLNPAHYISDTVREGKENGTPFLRCHGHDQ  166

Query  877   FEAANGKDVWRYAESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvd  698
             FE             D  +++L  + M C AR+   A++    D             +VD
Sbjct  167   FEMTG---------LDEEYNRLFNEGMVCTARIVPRAVISGYKDGF------NQIESLVD  211

Query  697   vgggdgttvEMLVKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMW  518
             VGGG G ++  +V+A+P +K INFDLPHVV+ AP   G+ HVGG+MF  +P ADAI++ W
Sbjct  212   VGGGIGGSLSEIVRAYPHIKAINFDLPHVVATAPPYDGITHVGGDMFVSVPNADAIYMKW  271

Query  517   VLHDWGDEECVQILSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntkn  338
             +LHDW DE C++IL  CREAIPE+TGKVII + +L+                        
Sbjct  272   ILHDWSDEHCIKILKNCREAIPEKTGKVIIVDHVLQP-----------------------  308

Query  337   nskLQEKDRNNNNNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTS  158
                         N    + G   DM+++AH   G ERTE+ W ++    GF  Y +   +
Sbjct  309   ----------EGNEPFSDTGHAFDMMLLAHNSGGKERTEENWQYLFKETGFPRYNIIKIN  358

Query  157   DVVSIIQARP  128
              + SII+A P
Sbjct  359   ALPSIIEAFP  368



>ref|XP_003633245.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=357

 Score =   192 bits (489),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 134/401 (33%), Positives = 191/401 (48%), Gaps = 67/401 (17%)
 Frame = -1

Query  1321  WKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPS---ALYRIMRFLIN  1151
             WK+   F    V+KCAI+LGIPD + S  Q + L QL + L   P+    LYR+MR L++
Sbjct  21    WKHTTNFVNSMVLKCAIQLGIPDVIHSHGQPMALSQLITALSLEPTKAPCLYRLMRVLVH  80

Query  1150  RGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSP  971
              G F + ++              L ++    GY  T  S  L +D   S   F+ L+  P
Sbjct  81    SGFFAQQKL--------------LHNSEEEEGYSLTFASQFLLKDEPVSGVPFLLLQLDP  126

Query  970   VMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMAC  791
             ++ APW        LGD     +        F  A+ K  W YA  +P  + +  + M  
Sbjct  127   ILTAPWH------FLGD-----WFQNEDPTPFHTAHRKSFWDYAVHEPKLNDIFNETMVS  175

Query  790   HARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPHV  611
              +R+    IV+   ++            +VDVGGG GT V+ + KAFP +K I FD PHV
Sbjct  176   DSRLIANMIVRQYKEVF------EGLASLVDVGGGTGTMVKAIAKAFPQLKCIVFDQPHV  229

Query  610   VSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKVI  431
             V+       +  VGGN+F+ IP ADAI L W+LHDW DEECV+IL KC+ AIP + GKVI
Sbjct  230   VANLEVGENLEIVGGNIFEAIPPADAILLKWILHDWSDEECVKILKKCKGAIPNKGGKVI  289

Query  430   IAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMMA  251
             I + ++                                + N  +N + E  L +DM+MM 
Sbjct  290   IIDMVV--------------------------------ESNKGDNKAVETQLFIDMLMMV  317

Query  250   HTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
                 G ER EK+W  +  AAGF  Y +T    + S+I+  P
Sbjct  318   VVA-GKERNEKEWEKLFLAAGFTHYKITPALGLRSLIEVYP  357



>ref|XP_010035709.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Eucalyptus 
grandis]
Length=360

 Score =   192 bits (489),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 141/428 (33%), Positives = 204/428 (48%), Gaps = 84/428 (20%)
 Frame = -1

Query  1369  KSIRRQEVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQA-VTLDQLSSGLGC  1193
             +S+   E     +  I   +  +     +KCA+EL IPD + S     VTL Q++S +  
Sbjct  2     ESLHETEATLRGQAHILNLLNAYAGSMALKCAVELRIPDIIHSYGGGPVTLAQIASRIP-  60

Query  1192  SPSA----LYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRG-------YVQ  1046
             SPS     L RIMR L+   IF                       +P  G       Y  
Sbjct  61    SPSLETAYLARIMRLLVRENIFS------------------ANRCQPDDGHESHETLYSL  102

Query  1045  TPLSALLTRDG--EKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFE  872
              P S  L +    E S+A  V + + P M++PW         GD      C  +   AFE
Sbjct  103   PPSSRWLLQGPGFELSLAPVVLMLNHPWMMSPWQ------FFGD------CIKTGGIAFE  150

Query  871   AANGKDVWRYAESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvg  692
              A+G+ +W +A  +P  ++L  D MAC +R+ +  I++   D             +VDVG
Sbjct  151   MAHGRKIWDFASENPEFNRLFNDGMACVSRITIGGIIEVYKD------GFESIGSLVDVG  204

Query  691   ggdgttvEMLVKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVL  512
             GG G  +  ++K+ P ++GIN+DLPHVV+ AP   GV HVGGNMF+ IP ADA+ LM ++
Sbjct  205   GGIGKNLVEIIKSCPHIQGINYDLPHVVATAPAHDGVTHVGGNMFETIPHADAVLLMEIM  264

Query  511   HDWGDEECVQILSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknns  332
             HDWGDE+CV+IL  CR+AIPE+ GKVIIA  +L+   + +  +  T+             
Sbjct  265   HDWGDEDCVKILKNCRKAIPEKNGKVIIANIVLKAEDDGM--FDKTK-------------  309

Query  331   kLQEKDRNNNNNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDV  152
                               L++D+ MMA    G ER E +W  +L   GF  Y +  T  +
Sbjct  310   ------------------LVMDLAMMALCSGGKERDELEWKKILEEGGFPRYNIIKTPCL  351

Query  151   VSIIQARP  128
              SII+A P
Sbjct  352   QSIIEAYP  359



>ref|XP_010247901.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Nelumbo 
nucifera]
Length=346

 Score =   192 bits (488),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 130/406 (32%), Positives = 193/406 (48%), Gaps = 73/406 (18%)
 Frame = -1

Query  1336  EEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSP---SALYRIM  1166
             +E  IWK+ + F +  V++CAIE GI D +  Q + +TL +L + +   P     L+R+M
Sbjct  10    DEVEIWKFGYDFADTLVLRCAIEFGIADIIHKQGEPLTLFELGAQIPVQPVNTDHLHRLM  69

Query  1165  RFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVR  986
             R++++  IF +  +                       Y  +P    L +  +KSMA+ + 
Sbjct  70    RYMVHMKIFTKETLG------------------GEEXYGLSPHGKFLVKGWDKSMASAIL  111

Query  985   LESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIE  806
               +     APW  L   VL G+             AFE A GK +W Y    P  +KL  
Sbjct  112   AITDEDFFAPWHCLKD-VLAGEGT-----------AFEKALGKSIWAYVADHPEKNKLFN  159

Query  805   DAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINF  626
             + MAC        ++Q C D+            VVDVGGG GT +  + KAFP +K   +
Sbjct  160   EVMACDTSFITSVLIQDCKDVF------QGIKSVVDVGGGTGTAMRDIAKAFPHLKCTIY  213

Query  625   DLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEE  446
             DLPHV++ +P  P V  + G+MF+ IP ADAI L W+LHDW D EC++IL +C+E++P E
Sbjct  214   DLPHVIADSPDYPEVDRIAGDMFKHIPSADAILLKWILHDWDDGECIEILKRCKESVPRE  273

Query  445   TGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLD  266
              GKVII + +L                                    + +   +  L LD
Sbjct  274   GGKVIIVDIVL---------------------------------DPESKDPLTKARLRLD  300

Query  265   MVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             + MM +TG G ER+E +W  +L AAGF  Y +   + V S+I A P
Sbjct  301   LDMMVYTG-GKERSEAEWKKLLNAAGFPGYKILHVAAVQSVIMAYP  345



>ref|XP_003544914.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
X1 [Glycine max]
Length=358

 Score =   192 bits (489),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 127/404 (31%), Positives = 196/404 (49%), Gaps = 69/404 (17%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSA---LYRIMRFLI  1154
             IW ++F F     +KC ++LGIPD + +  Q + L  L + L   PS    ++R+MR +I
Sbjct  19    IWNHIFSFINSMSLKCVVDLGIPDIIHNYGQPMPLSNLIASLPIHPSKTCFVHRLMRIMI  78

Query  1153  NRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESS  974
             + G F +    +                +    YV T  S LL ++   S+  F+     
Sbjct  79    HSGFFSQQNHDMEN--------------QLDAKYVLTDASVLLLKNHPMSVTPFLHAMLD  124

Query  973   PVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMA  794
             P++  PW + S     GD           +  FE A+G  +W YA +DP H+ L  DAMA
Sbjct  125   PILTNPWNQFSTWFKNGD-----------TTPFETAHGMMLWDYAGADPKHNNLFNDAMA  173

Query  793   CHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPH  614
               AR     +++ C  + +          +VDVGGG GT  + + K+FP V+ I FDLPH
Sbjct  174   SDARFVTSLVIEKCKGMFM------GLESLVDVGGGTGTMAKAIAKSFPRVECIVFDLPH  227

Query  613   VVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPE--ETG  440
             VVS       + +V G+MF+ IP ADAI L W+LHDW D+ECV IL KC+EAI    + G
Sbjct  228   VVSGLKGSENLKYVAGDMFEAIPPADAILLKWILHDWNDKECVDILKKCKEAITRKGKEG  287

Query  439   KVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMV  260
             KVII + ++ + +                                 ++ S E  L  DM+
Sbjct  288   KVIIIDMVVENEKR--------------------------------DDESVETQLFFDML  315

Query  259   MMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             MM     G ER++K+W+ ++++AG+ +Y +T    + S+I+  P
Sbjct  316   MMVLV-TGKERSKKEWAKLISSAGYNNYKITPVLGLRSLIEIYP  358



>ref|XP_003527407.1| PREDICTED: trans-resveratrol di-O-methyltransferase isoform 1 
[Glycine max]
Length=352

 Score =   192 bits (488),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 126/403 (31%), Positives = 192/403 (48%), Gaps = 73/403 (18%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPS---ALYRIMRFLI  1154
             +W ++F F     +KCAIEL IPD +    Q + L +L++ L   PS    +YR+MR L 
Sbjct  19    VWNHIFSFINSMSLKCAIELDIPDIIHKYGQPMPLSKLTTSLSIHPSKANCIYRLMRILT  78

Query  1153  NRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESS  974
             + G F + ++    +                 GYV T  S LL +D   SM  F+     
Sbjct  79    HSGFFSQHKVNENELEM---------------GYVLTDASTLLLKDNPLSMVPFLHAMLD  123

Query  973   PVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMA  794
             P +  PWL+L             +        F+ A+G  +W YA+ +P  + L  DAMA
Sbjct  124   PTLTQPWLQLP-----------TWFKNDDPSPFQTAHGMKIWDYADREPRLNDLFNDAMA  172

Query  793   CHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPH  614
                ++    +++ C  +            +VDVGGG GT    + K+FP ++   FDLPH
Sbjct  173   SDTQLVANVVIERCKGVF------NGLESLVDVGGGTGTMAMAIAKSFPQLECTVFDLPH  226

Query  613   VVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKV  434
             VV+       + +VGG+MF+ IP ADAI L W+LHDW DE+CV+IL KC+EAI     KV
Sbjct  227   VVATLQGSENLKYVGGDMFESIPSADAILLKWILHDWNDEQCVKILKKCKEAI---KSKV  283

Query  433   IIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMM  254
             II + ++ + +                                 ++ S E  L +DMV+M
Sbjct  284   IIIDMVVENEK--------------------------------GDDESIETQLFIDMVVM  311

Query  253   A-HTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
               + GK  ERTEK+W+ ++ + GF  Y +T    + S+I+  P
Sbjct  312   VLYPGK--ERTEKEWAKLIFSTGFSDYKITPVLGLRSLIEIYP  352



>ref|XP_010932727.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Elaeis 
guineensis]
Length=350

 Score =   192 bits (488),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 132/411 (32%), Positives = 201/411 (49%), Gaps = 77/411 (19%)
 Frame = -1

Query  1339  EEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGC---SPSALYRI  1169
             E +  +W+ +  F +  V++CA+ELGI D +    + ++L  L+S +     +P++  RI
Sbjct  9     EGQTWVWQTMLAFADSMVLRCAVELGIADIIHQHGEPLSLPHLASLIPSPPPNPTSFLRI  68

Query  1168  MRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRG---YVQTPLSALLTRDGEKSMA  998
             MRFL ++ IF                      + P  G   Y  TP S +L R  + S+ 
Sbjct  69    MRFLTHKKIFS-------------------THSHPDTGETLYGLTPASRVLVRSSDFSLV  109

Query  997   AFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKD-VWRYAESDPAH  821
               V  E+ P  +A W   S  V  G               +  A+G D ++  A ++P  
Sbjct  110   PMVLFETHPFPIAAWHSFSASVRQG------------GAPYIMAHGMDMLFGTAATNPEF  157

Query  820   SKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGV  641
             + +  +AMAC A+  + A++ A  D             + DVGGG G T+  +VK  PG+
Sbjct  158   NAVFNNAMACTAKGTLDAVISAYGDGF------AGLGSLADVGGGTGATLGEIVKLHPGI  211

Query  640   KGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCRE  461
             KGINFDLPHV+  AP+ PGV HV G+MFQ IP ADA+F+  V+H +GDEEC ++L  CR 
Sbjct  212   KGINFDLPHVIEGAPEYPGVTHVAGDMFQTIPPADAVFMKTVMHCFGDEECEKVLRNCRG  271

Query  460   AIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEV  281
              IPE+TGKVII + +L                                   ++N+   ++
Sbjct  272   VIPEKTGKVIIVDVVLYP---------------------------------DDNSPLGDI  298

Query  280   GLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
                 DM+M A+T  G ERTE++W  +L A+GF  + +     + SII+A P
Sbjct  299   RAKFDMLMFAYTSTGKERTEEEWKKLLKASGFPRWNIIRIPAIWSIIEAFP  349



>ref|XP_004232928.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
lycopersicum]
Length=357

 Score =   192 bits (488),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 132/412 (32%), Positives = 197/412 (48%), Gaps = 71/412 (17%)
 Frame = -1

Query  1342  YEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGC---SPSALYR  1172
             +E +  I+K+ F F    V+ CAI+LGIPD + S +Q +TL QL S L        A++R
Sbjct  10    FEAQAHIYKHAFSFANSMVLGCAIQLGIPDVIHSHKQPMTLSQLVSHLKLPLEKSDAIHR  69

Query  1171  IMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAF  992
             +MR L+  G F   +                 ++   +GYV TP S LL +    +++ F
Sbjct  70    LMRLLVYSGFFATTDF-------------LDENSESQQGYVLTPSSKLLLKSEIPNLSPF  116

Query  991   VRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKL  812
              R    PVM+ PW  L    L           G+ +  FE A+G  +W++ + +P  S +
Sbjct  117   ARAMIDPVMVNPWQSLGDWFL-----------GNETTPFETAHGAPMWKFCDQNPRFSNV  165

Query  811   IEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGI  632
               +AMA  ++M    +V+ C  +            +VDVGGG G     ++ AFP +K  
Sbjct  166   FNEAMASDSQMMC-LVVKDCKQVF------QEIDSLVDVGGGTGIIANTILAAFPHLKCT  218

Query  631   NFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIP  452
               DLPHVV+  P    + +VGG+MF  IP ADAI  M V+H+W DE CV+IL +C EAI 
Sbjct  219   VLDLPHVVANMPDTENLKYVGGDMFHSIPSADAILFMHVMHNWSDENCVKILKRCGEAIK  278

Query  451   EET----GKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYE  284
             ++     GKV+I + +L                                DR+    N  E
Sbjct  279   DKNEGRKGKVLIIDMVL--------------------------------DRDKEEANMTE  306

Query  283   VGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             V L+ D++MM     G +RTEK+W  +   AGF SY +T    + S+I+  P
Sbjct  307   VKLIFDVLMMVLV-TGRQRTEKEWEKLFLEAGFMSYKITPLFGLRSLIEVFP  357



>ref|XP_008448112.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Cucumis 
melo]
Length=291

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 124/278 (45%), Positives = 167/278 (60%), Gaps = 39/278 (14%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQ-AVTLDQLSSGLGCSPSALYRIMRFLINR  1148
             I+KYVFGF E AV+KCAIEL I + +ES  +  +TL QLS+ L CSP  L+RIMRFL +R
Sbjct  23    IYKYVFGFAEAAVIKCAIELKIANVIESHGRPTMTLSQLSTALNCSPPLLFRIMRFLTHR  82

Query  1147  GIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSPV  968
             GIF+E E T   +                  Y QTPLS +L      ++A  + LE+SP 
Sbjct  83    GIFRE-ETTPENLI----------------AYSQTPLSHMLI-----NVAPLLLLENSPE  120

Query  967   MLAPWLKLSGRVLLGDNNNHKYCSGSSSD---AFEAANGKDVWRYAESDPAHSKLIEDAM  797
             ++A W  LS ++    NNN       +SD    FE A+GKD+W Y   +P  +++  + +
Sbjct  121   IVASWHNLSAKLKNSYNNNE------NSDLVVPFEVAHGKDIWSYGARNPGFNRMFNEGL  174

Query  796   ACHAR-MAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDL  620
              C+AR + +PAI++ C D+            +VDVGGG+GTT+ +LVKAFP +KGINFDL
Sbjct  175   GCNARVITLPAILENCGDIF------NGVESLVDVGGGNGTTLSVLVKAFPWMKGINFDL  228

Query  619   PHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHD  506
             P+VVS + K  GV HVGGNM   +PKADA F M  L D
Sbjct  229   PNVVSTSEKYDGVEHVGGNMLDFVPKADAAFFMCSLTD  266



>sp|Q9LEL6.1|6OMT_COPJA RecName: Full=(RS)-norcoclaurine 6-O-methyltransferase; AltName: 
Full=S-adenosyl-L-methionine:norcoclaurine 6-O-methyltransferase; 
Short=6-OMT [Coptis japonica]
 dbj|BAB08004.1| S-adenosyl-L-methionine:norcoclaurine 6-O-methyltransferase [Coptis 
japonica]
Length=347

 Score =   191 bits (485),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 128/402 (32%), Positives = 203/402 (50%), Gaps = 72/402 (18%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSP---SALYRIMRFLI  1154
             +W +++GF E  V+KCA++L + + + +   ++TL +LSS L   P    ALYR+MR+L+
Sbjct  14    LWNFIYGFAESLVLKCAVQLDLANIIHNSGTSMTLSELSSRLPSQPVNEDALYRVMRYLV  73

Query  1153  NRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESS  974
             +  +F +  +                       Y   P +  L +  +K M   +   + 
Sbjct  74    HMKLFTKASID------------------GELRYGLAPPAKYLVKGWDKCMVGSILAITD  115

Query  973   PVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMA  794
                +APW  L   +           SG S  AFE A G ++W Y    P  ++L  +AMA
Sbjct  116   KDFMAPWHYLKDGL-----------SGESGTAFEKALGTNIWGYMAEHPEKNQLFNEAMA  164

Query  793   CHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPH  614
               +R+ + A+V+ C ++            +VDVGGG GT V  +  AFP +K   +DLPH
Sbjct  165   NDSRLIMSALVKECGNIF------NGITTLVDVGGGTGTAVRNIANAFPHIKCTVYDLPH  218

Query  613   VVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKV  434
             V++ +P    VH V G+MF+ IPKADAI +  +LHDW D+EC++IL +C+EA+P + GKV
Sbjct  219   VIADSPGYSEVHCVAGDMFKFIPKADAIMMKCILHDWDDKECIEILKRCKEAVPVKGGKV  278

Query  433   IIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMM  254
             II + +L    E    +  T+M+                             L LD+ MM
Sbjct  279   IIVDIVLNVQSE----HPYTKMR-----------------------------LTLDLDMM  305

Query  253   AHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
              +TG G ERTE++W  ++  AG+K + +T  + V S+I+A P
Sbjct  306   LNTG-GKERTEEEWKKLIHDAGYKGHKITQITAVQSVIEAYP  346



>gb|KCW47151.1| hypothetical protein EUGRSUZ_K00956 [Eucalyptus grandis]
Length=361

 Score =   191 bits (486),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 143/435 (33%), Positives = 212/435 (49%), Gaps = 97/435 (22%)
 Frame = -1

Query  1369  KSIRRQEVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQA-VTLDQLSSGLGC  1193
             +S+   E +   +  I   +  +     +KCA+EL +PD + S     VTL Q++S +  
Sbjct  2     ESLDETEANLRGQAHILNLLNAYAGSMALKCAVELRVPDIIHSYGGGLVTLAQIASRI--  59

Query  1192  SPSA------LYRIMRFLINRGIFK-------------EVEMTLPTIsstssteaalasT  1070
              PSA      L RIMR L+   IF              E   +LP               
Sbjct  60    -PSASLETAYLARIMRLLVRENIFSANRCQPDGGHESHETLYSLPP--------------  104

Query  1069  RPTRGYVQTPLSALLTRDGEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGS  890
               +R  +Q P         E S+A  V + + P +++PW        LGD      C  +
Sbjct  105   -SSRWLLQGP-------GFELSLAPVVLMLNHPWVMSPWH------CLGD------CIKT  144

Query  889   SSDAFEAANGKDVWRYAESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvec  710
                AFE A+G+ +W +A  +P  ++L  DAMAC + + + AI++   D            
Sbjct  145   GGIAFEMAHGRKIWDFASENPEFNRLFNDAMACVSGITIRAILEVNKD------GFESIG  198

Query  709   vvvdvgggdgttvEMLVKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAI  530
              +VDVGGG G T+  ++K+FP ++GIN+DLPHVV+ AP   GV HVGGNMF+ IP ADA+
Sbjct  199   SLVDVGGGIGKTLVEIIKSFPHIQGINYDLPHVVATAPAHDGVTHVGGNMFETIPHADAV  258

Query  529   FLMW-VLHDWGDEECVQILSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknn  353
              +M  ++HDWGDE+CV+IL  CR+AI ++ GKVIIA  +L+         +G  M     
Sbjct  259   LMMVRIMHDWGDEDCVKILKNCRKAISKKNGKVIIANIVLK--------AEGDGMFD---  307

Query  352   tntknnskLQEKDRNNNNNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYT  173
                                   ++GL++D+VMMA    G ER E +W  +L   GF  Y 
Sbjct  308   ----------------------KIGLVMDLVMMALCSGGKERDEPEWKKILEDGGFPRYN  345

Query  172   VTDTSDVVSIIQARP  128
             + +T  + SII+A P
Sbjct  346   IIETPSLSSIIEAYP  360



>ref|XP_011002666.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=357

 Score =   191 bits (484),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 127/403 (32%), Positives = 192/403 (48%), Gaps = 69/403 (17%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPS---ALYRIMRFLI  1154
             IW ++F F     +KCAI+LGIPD +    + VTL +L + L   P     + R+MR LI
Sbjct  20    IWNHIFNFINSMSLKCAIDLGIPDIINKHSKPVTLPELIAALPVHPGKARCVPRLMRLLI  79

Query  1153  NRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESS  974
             + G F++ +++                     GY+ T  S LL +D   S+A F++    
Sbjct  80    HSGFFEKQKVS---------------EDDQEEGYILTNASQLLLKDNPFSVAPFLQAVLD  124

Query  973   PVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMA  794
             P++  PW  +S            +        F+ A+G+  W Y   +P  + L  DAMA
Sbjct  125   PILTKPWHFVS-----------TWLKNDDPTPFDTAHGRTFWDYVGHEPVFNHLFNDAMA  173

Query  793   CHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPH  614
               AR+    ++  C ++            +VDVGGG GT  + + KAFP +    FDLPH
Sbjct  174   SDARLVTRVLINECKEVF------EGLGSLVDVGGGTGTVAKSIAKAFPHLDCTVFDLPH  227

Query  613   VVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPE-ETGK  437
             VV+       + +VGG+MF+ IP AD I L W+LHDW DEECV+IL KC+EAI + E GK
Sbjct  228   VVADLQGSENLKYVGGDMFEAIPPADGIVLKWILHDWNDEECVKILKKCKEAIKDREGGK  287

Query  436   VIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVM  257
             V+I E ++ + +                                  ++S E  +  DM+M
Sbjct  288   VMIIEMMMENQK--------------------------------GEDDSIETQIFFDMLM  315

Query  256   MAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             M     G ER EK+W+ + + A F +Y +T    + SII+  P
Sbjct  316   MILV-TGQERNEKEWAKLFSDASFSNYKITPILGLRSIIEVFP  357



>emb|CDP15888.1| unnamed protein product [Coffea canephora]
Length=362

 Score =   190 bits (482),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 129/407 (32%), Positives = 190/407 (47%), Gaps = 67/407 (16%)
 Frame = -1

Query  1342  YEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSA---LYR  1172
             ++ +  IW ++F F     +KCAI+LGIPD +    Q + L QL   L  + +    +YR
Sbjct  14    FQAQAHIWNHIFNFINSMSLKCAIQLGIPDIIHKHGQPMALAQLIDALPINNAKAPFVYR  73

Query  1171  IMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAF  992
             +MR LI+ G F  ++  +P                   GY  T  S LL  +   S+  F
Sbjct  74    LMRILIHSGFF--IKAKIPD-------------NEGQEGYALTSASKLLLANDPFSVTPF  118

Query  991   VRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKL  812
             +     P++  PW   S           ++   S    F   +G  +W  A   P  ++ 
Sbjct  119   LLAMLDPILTDPWHHFS-----------QWFQNSEETPFHTCHGTSLWELAGRQPQLNQF  167

Query  811   IEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGI  632
               + MA  AR+    +++ C D+ +          ++DVGGG GT  + +  AFP ++  
Sbjct  168   FNEGMASDARLVSTMVIENCKDVFM------GLNSLIDVGGGTGTVAKAIADAFPHLQCS  221

Query  631   NFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIP  452
               DLPHVV        + +VGG+MF+ IP ADA+ L W+LHDW DEECVQIL KC+EAIP
Sbjct  222   VLDLPHVVDGWESSKNLAYVGGDMFEAIPPADAVLLKWILHDWSDEECVQILRKCKEAIP  281

Query  451   --EETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVG  278
               E+ GKVII + +L+  Q   NG                          +++  + E  
Sbjct  282   SMEKGGKVIIIDMLLKSQQ---NG--------------------------DDDAEAIETQ  312

Query  277   LMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQ  137
             L  DM+MM H  KG ER EK W  +   AGF  Y +T    + SII+
Sbjct  313   LFFDMLMMVHV-KGRERNEKDWEKLFLEAGFNGYKITPVLGLRSIIE  358



>ref|XP_003557042.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Glycine 
max]
Length=358

 Score =   189 bits (481),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 129/404 (32%), Positives = 194/404 (48%), Gaps = 69/404 (17%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSA---LYRIMRFLI  1154
             IW ++F F     +KC ++LGIPD + +  Q + L  L + L   PS    ++R+MR +I
Sbjct  19    IWNHIFSFINSMSLKCVVDLGIPDIIHNYGQPMPLSNLIASLPIHPSKTCFVHRLMRIMI  78

Query  1153  NRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESS  974
             + G F + +  L                     YV T  S LL ++   S+  F+     
Sbjct  79    HSGFFSQQKHDLEN--------------ELEAKYVLTDASVLLLKNHPMSVTPFLHAMLD  124

Query  973   PVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMA  794
             PV+  PW + S     GD              FE A+G  +W YA +DP  + L  DAMA
Sbjct  125   PVLTNPWNQFSTWFKNGD-----------PTPFETAHGMMLWDYAGADPKLNNLFNDAMA  173

Query  793   CHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPH  614
               AR     +++ C  + +          +VDVGGG GT  + + K+FP V+ I FDLPH
Sbjct  174   SDARFVTSLVIEKCKGVFM------GLESLVDVGGGTGTMAKAIAKSFPRVECIVFDLPH  227

Query  613   VVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPE--ETG  440
             VVS       + +V G+MF+ IP ADAI L W+LHDW DEECV IL KC+EAI    + G
Sbjct  228   VVSGLKGSENLKYVSGDMFEAIPPADAILLKWILHDWNDEECVDILKKCKEAITRKGKEG  287

Query  439   KVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMV  260
             KVII + ++ + +                                 ++ S E  L  DM+
Sbjct  288   KVIIIDMVVENEKR--------------------------------DDESVETQLFFDML  315

Query  259   MMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             MM     G ER++K+W+ ++++AG+ +Y +T    + S+I+  P
Sbjct  316   MMVLV-TGKERSKKEWAKLISSAGYNNYKITPVFGLRSLIEIYP  358



>ref|XP_011045482.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Populus 
euphratica]
Length=352

 Score =   189 bits (480),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 130/418 (31%), Positives = 206/418 (49%), Gaps = 83/418 (20%)
 Frame = -1

Query  1351  EVDYEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSP----S  1184
             E  ++ E  I + +  F +   +KCAIELG+ D + S  + ++L Q++SG+  SP    S
Sbjct  7     EALFKSEVEISQLLLRFADSMALKCAIELGLADIINSHGRPISLSQIASGIN-SPRSDMS  65

Query  1183  ALYRIMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRG----YVQTPLSALLTRD  1016
              L RIMR+L+ +  F                     +  P+ G    +     S LL  D
Sbjct  66    YLARIMRYLVRKEFF--------------------TAHPPSDGGETLFGLNQKSRLLMHD  105

Query  1015  GEKSMAAFVRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAE  836
              E+S+A+ + +++ P  L PW  LS             C      AF   +G +VW  A 
Sbjct  106   SERSLASLIIMQNHPWFLEPWHCLS------------QCVKEGGTAFSKVHGCEVWDLAS  153

Query  835   SDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVK  656
              +P  +++  +AMAC +++   A +    D             +VDV GG G  V  +V+
Sbjct  154   RNPEVNRIFNEAMACTSKIVTTASLSQYKD------GFNNIRSLVDVAGGIGGHVAEIVR  207

Query  655   AFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQIL  476
             A+P ++GIN DLPHVV+ APK  GV HV GNMF+ IP ADAI++  +LH + DE  V+IL
Sbjct  208   AYPHIEGINLDLPHVVATAPKYDGVSHVAGNMFEAIPNADAIYMQRILHGFTDESGVEIL  267

Query  475   SKCREAIPEETGKVIIAEAILR--DHQEMINGYQGTRMklknntntknnskLQEKDRNNN  302
               C++AIPE+TGK+II + +L+  D+++  +                             
Sbjct  268   RNCKKAIPEKTGKLIIVDIVLQTDDYRDQFD-----------------------------  298

Query  301   NNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
                  ++ +++D++M+A T  G ERTE++W  +L   GF  Y +     + SII+A P
Sbjct  299   -----DIRMVMDLMMIAQTSGGKERTEQEWKKLLEEGGFPRYKIIKIPALQSIIEAYP  351



>emb|CDX72522.1| BnaC07g45440D [Brassica napus]
Length=320

 Score =   188 bits (478),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 107/242 (44%), Positives = 144/242 (60%), Gaps = 31/242 (13%)
 Frame = -1

Query  859  KDVWRYAESDPAHSKLIEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdg  680
            K VW  AE +P  S +I +AMACH R  VP + +AC DL            VVDVGG  G
Sbjct  108  KHVWALAEDNPCLSHMINEAMACHTRRVVPRVARACHDLF------EGVATVVDVGGCTG  161

Query  679  ttvEMLVKAFPGVKGINFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWG  500
             T+ +LVK FP +KG NFDLPHV+ VA    GV +VGG+MF  +PK DA+F+ WVLHDWG
Sbjct  162  ETLGILVKEFPWIKGFNFDLPHVIQVAQVLDGVENVGGDMFDSVPKCDAVFIKWVLHDWG  221

Query  499  DEECVQILSKCREAIPEETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQE  320
            D++C+++L  C+EA+P   GKV+I E+++R+ ++ +                     +++
Sbjct  222  DKDCIRLLKNCKEAVPPNIGKVLIVESVIREKKKAM--------------------IVED  261

Query  319  KDRNNNNNNSYEVGLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSII  140
            +D    +     V LMLDMVMMAHT  G ERT K+W  VL  AGF+ Y V D  DV  +I
Sbjct  262  RDEKLEH-----VRLMLDMVMMAHTSTGKERTLKEWDFVLNEAGFERYEVRDIDDVQCVI  316

Query  139  QA  134
             A
Sbjct  317  IA  318


 Score = 80.5 bits (197),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 62/104 (60%), Gaps = 22/104 (21%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQA--VTLDQLSSGLGCSPSALYRIMRFLIN  1151
             IW+YVFGF ++A  KCAI+L IP+ +E+   +  VTL +LS  +  SPS L+RIMRFL++
Sbjct  19    IWRYVFGFADIAAAKCAIDLKIPEAIENHPSSLPVTLAELSVAVSASPSHLHRIMRFLVH  78

Query  1150  RGIFKEVEMT--LPTIsstssteaalasTRPTRGYVQTPLSALL  1025
             +GIFK+V +   L T                  GY  TPLS L+
Sbjct  79    QGIFKQVPIKDGLAT------------------GYTNTPLSRLM  104



>ref|XP_003544912.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
1 [Glycine max]
Length=358

 Score =   189 bits (480),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 130/404 (32%), Positives = 192/404 (48%), Gaps = 69/404 (17%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSA---LYRIMRFLI  1154
             IW ++F F     +KC ++LGIPD + +  Q + L  L + L   PS    ++R+MR +I
Sbjct  19    IWNHIFSFINSMSLKCVVDLGIPDIIHNYGQPMPLSNLIASLPIHPSKTCFVHRLMRIMI  78

Query  1153  NRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESS  974
             + G F      L                     YV T  S LL ++   S+  F+     
Sbjct  79    HSGFFSLQNHDLEN--------------ELEAKYVLTDASVLLLKNHPMSVTPFLHAMLD  124

Query  973   PVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMA  794
             PV+  PW + S     GD              FE A+GK  W YA +DP  + L  DAMA
Sbjct  125   PVLTNPWNQFSTWFKNGD-----------PTPFETAHGKMFWDYAGADPKLNHLFNDAMA  173

Query  793   CHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPH  614
               AR     +++ C  + +          +VDVGGG GT  + + K+FP V+ I FDLPH
Sbjct  174   SDARFVTSLVIEKCKGVFM------GLESLVDVGGGTGTMAKAIAKSFPRVECIVFDLPH  227

Query  613   VVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPE--ETG  440
             VVS       + +V G+MF+ IP ADAI L W+LHDW DEECV IL KC+EAI    + G
Sbjct  228   VVSGLKGSENLKYVAGDMFEAIPPADAILLKWILHDWNDEECVDILKKCKEAITRKGKEG  287

Query  439   KVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMV  260
             KVII + ++ + +                                 ++ S E  L  DM+
Sbjct  288   KVIIIDMVVENEKR--------------------------------DDESVETQLFFDML  315

Query  259   MMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             MM     G ER++K+W+ ++++AG+ +Y +T    + S+I+  P
Sbjct  316   MMVLV-TGKERSKKEWAKLISSAGYNNYKITPVLGLRSLIEIYP  358



>ref|XP_010097399.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
 gb|EXB67905.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
Length=384

 Score =   189 bits (481),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 130/408 (32%), Positives = 190/408 (47%), Gaps = 58/408 (14%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSA------LYRIMR  1163
             IW Y+F F     +KCA++LGIPD + S  + +TL QL S L    +       +YR+MR
Sbjct  26    IWNYIFNFINSMSLKCAVQLGIPDAIHSHGKPMTLSQLISALPIHQNKKSDSRLIYRLMR  85

Query  1162  FLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRL  983
              L+N G F   E+ +                    GYV T  S LL RD   S+   +  
Sbjct  86    ILVNSGFFVLQEVVVGETDLLE------------EGYVLTTASKLLLRDNPLSVTPLLLS  133

Query  982   ESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIED  803
                P+M  PW  LS            +        F A +G  +W Y E DP    L  +
Sbjct  134   MLDPIMTKPWHSLS-----------TWLQSDDPTPFAATHGMGIWDYNEYDPRLGNLFNE  182

Query  802   AMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFD  623
             AMA  AR+    ++  C  +L           +VD+ GG GT  + +  AFP +    FD
Sbjct  183   AMASDARLVTSVLIDKCKSVL------EGLESLVDLAGGTGTVAKAIAYAFPHLACTVFD  236

Query  622   LPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIP---  452
             LPHV++       +  VGG+MF  IP ADAIF+ W+LHDW DE+CV++L +C+ AI    
Sbjct  237   LPHVIADLQGSKNLKFVGGDMFDEIPPADAIFMKWILHDWSDEDCVKLLERCKVAITCKG  296

Query  451   EETGKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLM  272
              + GKVI+ + ++ + Q   N   G                      +++++ SYE  L 
Sbjct  297   NKNGKVILVDMVIVEEQN--NKDIGHDHH-----------------AHDHDHQSYETQLF  337

Query  271   LDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
              DM+MM     G ER E +W+ + + AGF +Y +T    V S+I+  P
Sbjct  338   FDMLMMV-LYPGRERKETEWAKLFSDAGFNTYKITPILGVRSLIEVFP  384



>gb|AFU50296.1| flavonoid O-methyltransferase 2 [Ocimum basilicum]
Length=340

 Score =   188 bits (478),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 134/399 (34%), Positives = 197/399 (49%), Gaps = 73/399 (18%)
 Frame = -1

Query  1321  WKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPSALYRIMRFLINRGI  1142
             W + FGF + +V+K AIEL IPD L +    ++L  LSS +G  P  L+RIMRFL + G+
Sbjct  14    WNHGFGFIKTSVIKTAIELEIPDILHNHGAPLSLSALSSAVGVPPDRLHRIMRFLTHHGV  73

Query  1141  FKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESSPVML  962
              K+                A         Y +T +S  LT+D   ++ AFV L+ +    
Sbjct  74    SKKT---------------ASPPGESDYYYAETAVSRSLTKD---NLGAFVLLQGAQRGP  115

Query  961   APWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLI-EDAMACHA  785
             +  +   G   L            S   +E             DP  +K++  DAMACHA
Sbjct  116   SACITAQG---LKSRERPGVEELGSDPLYE-------------DPIFTKMVFRDAMACHA  159

Query  784   RMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPHVVS  605
             R+   A+++   +             +VDVGG  G T+ MLV+AFP ++GI +DLP VV+
Sbjct  160   RLTTSAVIENYGEGF------RGVGSLVDVGGSYGMTLGMLVEAFPWIRGICYDLPQVVA  213

Query  604   VAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGKVIIA  425
              A    GV  V G+MF+ +P+AD + LM+VLH+W D EC+ IL +C+EAIP ETGKV+I 
Sbjct  214   KAKPLHGVEFVAGSMFESVPEADVVMLMFVLHNWSDNECIDILKRCKEAIPRETGKVMII  273

Query  424   EAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMVMMAHT  245
             +AI+ +  E                                 +   E  L LD+ MMA T
Sbjct  274   DAIIEEDGE--------------------------------GDEFAEARLGLDVTMMAVT  301

Query  244   GKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
              +G ERT ++W+ +L  AGF+ Y V +   + S+I+A P
Sbjct  302   FEGKERTHREWAFILKEAGFRKYVVKNIKALESLIEAYP  340



>ref|XP_006480226.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Citrus 
sinensis]
 ref|XP_006480227.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Citrus 
sinensis]
Length=353

 Score =   189 bits (479),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 132/404 (33%), Positives = 185/404 (46%), Gaps = 72/404 (18%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLG--CSPSALY--RIMRFL  1157
             IWK++F F +   +KCAIEL IPD + S    +T  Q++S +   CSP   Y  RIMR L
Sbjct  16    IWKHMFAFIDSLALKCAIELRIPDIIHSHGGPITSSQIASSIDSPCSPEISYIERIMRLL  75

Query  1156  INRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLES  977
              ++ IF     +                  P  G   +    L+T      +     +E+
Sbjct  76    GHKNIFAAQHPS--------------DGGEPLYGLTHSS-RWLVTGSDSNQLGPVFLVEN  120

Query  976   SPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAM  797
              P ++  W  LS             C      A E A G      A  D   +K+  + M
Sbjct  121   HPYIVNSWHFLS------------QCVKEGGSAIEKAFGDAYIDLASKDQQFNKIFNEGM  168

Query  796   ACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLP  617
             AC++++    I+                  +VDV GG G  +  +VK++P +KGINFDLP
Sbjct  169   ACNSKILTREILAG------YKHGFDSLKSLVDVAGGIGGLISEIVKSYPHIKGINFDLP  222

Query  616   HVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIPEETGK  437
             HV++ AP   GV HV G+MF  IP ADA+ L WVLH+W DE CV+IL  CR+AIPE+TGK
Sbjct  223   HVITTAPVYDGVTHVSGDMFHTIPNADALLLKWVLHNWSDEACVKILKNCRKAIPEKTGK  282

Query  436   VIIAEAILR-DHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMV  260
             VII + IL+ D Q + +                                  + G   D+V
Sbjct  283   VIIIDVILQPDGQGLFD----------------------------------DAGYAFDLV  308

Query  259   MMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             MM +T  G ERTE +W  +L   GF  Y +     + SII+A P
Sbjct  309   MMVNTAGGKERTELEWKKLLEEGGFPRYQIIKIPALQSIIEAYP  352



>ref|XP_006364328.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=354

 Score =   188 bits (478),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 130/411 (32%), Positives = 197/411 (48%), Gaps = 68/411 (17%)
 Frame = -1

Query  1342  YEEEDGIWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSP---SALYR  1172
             ++ +  I+K+   +    V+ CAI+LGIPD + S +Q +TL QL S L   P    A+YR
Sbjct  6     FQGQAHIYKHALSYANCMVLSCAIQLGIPDVIHSHKQPMTLSQLVSQLKLPPQKSDAVYR  65

Query  1171  IMRFLINRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAF  992
             +MR L+  G F   +                 ++   +GY+ TP S LL +    +++ F
Sbjct  66    VMRLLVYSGFFATRDF-------------LDENSENQQGYILTPSSKLLLKSEIPNLSTF  112

Query  991   VRLESSPVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKL  812
             VR    P M+ PW  L G   LGD           +  FE ANG  +W + + +P  + +
Sbjct  113   VRAMVEPAMVNPWQSL-GDWFLGD----------KTTPFETANGAPIWEFGDQNPRFNNV  161

Query  811   IEDAMACHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGI  632
               +AMA  ++M    + + C  +            +VDVGGG G   + ++ AFP +K  
Sbjct  162   FNEAMASDSQMMC-LVAKDCKQVF------QDMNSLVDVGGGTGVIAKAILAAFPHLKCT  214

Query  631   NFDLPHVVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIP  452
               DLP VV+  P    + +VGG+MF  IP ADAI    V+H+W DE+CV+IL KCREAI 
Sbjct  215   VLDLPQVVANMPDTNNLKYVGGDMFHSIPSADAILFKHVMHNWSDEDCVKILKKCREAIK  274

Query  451   EET---GKVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEV  281
             +     GKVII + +L                              ++D + +  N  EV
Sbjct  275   DNKKNEGKVIIIDMVL------------------------------DRDEDEDKANMTEV  304

Query  280   GLMLDMVMMAHTGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
              L+ D+ M+     G ERTEK+W  +   AGF +Y +T    + S+I+  P
Sbjct  305   KLIYDVAMIVLL-TGRERTEKEWEKLFLEAGFMTYKITPLFGLRSLIEIFP  354



>ref|XP_004303127.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=367

 Score =   189 bits (479),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 129/405 (32%), Positives = 189/405 (47%), Gaps = 73/405 (18%)
 Frame = -1

Query  1324  IWKYVFGFTEMAVVKCAIELGIPDFLESQEQAVTLDQLSSGLGCSPS---ALYRIMRFLI  1154
             IW ++F F     +K AI+LGIPD +    + +TL +L+S L  +P+   ++YR+MR LI
Sbjct  30    IWNHIFSFINSMSLKSAIQLGIPDIINKHGRPMTLSELTSALPINPTKSHSIYRLMRILI  89

Query  1153  NRGIFKEVEMTLPTIsstssteaalasTRPTRGYVQTPLSALLTRDGEKSMAAFVRLESS  974
             + G F + +++                     GYV T  S LL +D   S+  F+     
Sbjct  90    HSGFFAKKKLS----------------KSDEEGYVLTDASQLLLKDHPLSITPFLNAMLD  133

Query  973   PVMLAPWLKLSGRVLLGDNNNHKYCSGSSSDAFEAANGKDVWRYAESDPAHSKLIEDAMA  794
             PV+  PW   S            +        F+ A+G   W Y    P+ +    DAMA
Sbjct  134   PVLTKPWHYFS-----------TWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMA  182

Query  793   CHARMAVPAIVQACPDLLLLHgaagvecvvvdvgggdgttvEMLVKAFPGVKGINFDLPH  614
               AR+    IV  C  +            +VDVGGG GT  + +  AFP +K    DLPH
Sbjct  183   SDARLVTSVIVDECRGVF------EGLDSLVDVGGGTGTVAKAIADAFPHIKCTVLDLPH  236

Query  613   VVSVAPKRPGVHHVGGNMFQRIPKADAIFLMWVLHDWGDEECVQILSKCREAIP--EETG  440
             VV+       + + GG+MF+ +P ADA+ L W+LHDW DEECV+IL + +EAI   ++ G
Sbjct  237   VVADLQGSKNLKYTGGDMFEAVPPADAVLLKWILHDWNDEECVKILERSKEAITGKDKKG  296

Query  439   KVIIAEAILRDHQEMINGYQGTRMklknntntknnskLQEKDRNNNNNNSYEVGLMLDMV  260
             KVII + ++ + +                                 +  S E  L  DM+
Sbjct  297   KVIIIDMMMENQK--------------------------------GDEESMETQLFFDML  324

Query  259   MMAH-TGKGLERTEKQWSHVLTAAGFKSYTVTDTSDVVSIIQARP  128
             MMA  TGK  ER EK+WS + T AGF  Y +T    + S+I+  P
Sbjct  325   MMALVTGK--ERNEKEWSKLFTDAGFSDYKITPILGLRSLIEVYP  367



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4042190923560