BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c73016_g1_i1 len=237 path=[1:0-236]

Length=237
                                                                      Score     E

ref|XP_011094629.1|  PREDICTED: serine/threonine-protein kinase B...  76.3    3e-14   
gb|EPS66828.1|  hypothetical protein M569_07954                       63.9    1e-10   
ref|XP_011094617.1|  PREDICTED: serine/threonine-protein kinase B...  65.9    2e-10   
ref|XP_009613367.1|  PREDICTED: serine/threonine-protein kinase B...  62.4    2e-09   
ref|XP_004248628.2|  PREDICTED: serine/threonine-protein kinase B...  61.2    6e-09   
ref|XP_009773712.1|  PREDICTED: serine/threonine-protein kinase O...  59.3    2e-08   
ref|XP_006345543.1|  PREDICTED: serine/threonine-protein kinase B...  59.3    3e-08   
ref|XP_009783130.1|  PREDICTED: serine/threonine-protein kinase B...  58.2    5e-08   
ref|XP_010321617.1|  PREDICTED: serine/threonine-protein kinase B...  57.4    1e-07   
ref|XP_004248629.1|  PREDICTED: serine/threonine-protein kinase B...  56.6    3e-07   
ref|XP_004248625.1|  PREDICTED: serine/threonine-protein kinase B...  55.5    5e-07   
ref|XP_004248630.1|  PREDICTED: serine/threonine-protein kinase B...  55.1    7e-07   
ref|XP_010648975.1|  PREDICTED: serine/threonine-protein kinase B...  47.4    3e-04   
emb|CAN68408.1|  hypothetical protein VITISV_022912                   45.8    9e-04   Vitis vinifera



>ref|XP_011094629.1| PREDICTED: serine/threonine-protein kinase BLUS1-like [Sesamum 
indicum]
Length=396

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 41/81 (51%), Positives = 56/81 (69%), Gaps = 3/81 (4%)
 Frame = +1

Query  1    IMLGFAATVYE-HQVSNVECSSHSALPATQISTWAAAPEVYDGGNGN--KAADIWLVGIT  171
            I L F+A+V++ ++  N   SS S LPA  I  WA APEV++  +    +AADIWL+GIT
Sbjct  221  IKLAFSASVFDLNEEQNESSSSSSFLPAVSIYDWATAPEVHESNHSEYPQAADIWLIGIT  280

Query  172  AMELVYGGIRVPNREALEVLI  234
            A+EL YGG+RV NREAL  ++
Sbjct  281  ALELAYGGVRVMNREALVAMV  301



>gb|EPS66828.1| hypothetical protein M569_07954, partial [Genlisea aurea]
Length=233

 Score = 63.9 bits (154),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    IMLGFAATVYEHQVSN-VECSSHSALPATQISTWAAAPEVYDGGNGNKAADIWLVGITAM  177
            I LGFAATV++      +  SS S L A +I  WAAAPE+Y G    +  D+W+VG+ A+
Sbjct  80   IKLGFAATVHDEDDDEPIPESSSSYLRAAEICEWAAAPELYGGSRATQGGDMWMVGVAAL  139

Query  178  ELVYGGIRVPNREAL  222
            E+ YG +   +R+  
Sbjct  140  EMGYGRLEFGSRDEF  154



>ref|XP_011094617.1| PREDICTED: serine/threonine-protein kinase BLUS1-like [Sesamum 
indicum]
Length=469

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 40/84 (48%), Positives = 52/84 (62%), Gaps = 6/84 (7%)
 Frame = +1

Query  1    IMLGFAATVYE----HQVSNVECSSHSALPATQISTWAAAPEVYDGGNG--NKAADIWLV  162
            I L F+A+V+E       S+   SS S LPA  I  WAAAPE+ +  N    + ADIW +
Sbjct  300  IKLAFSASVFELYEDQDQSSSSSSSSSFLPAASICEWAAAPEIQESVNSEYTQKADIWSI  359

Query  163  GITAMELVYGGIRVPNREALEVLI  234
            GITA+EL YGG+ V NRE LE ++
Sbjct  360  GITALELAYGGLTVMNREVLENIV  383



>ref|XP_009613367.1| PREDICTED: serine/threonine-protein kinase BLUS1-like [Nicotiana 
tomentosiformis]
Length=360

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 37/82 (45%), Positives = 46/82 (56%), Gaps = 7/82 (9%)
 Frame = +1

Query  1    IMLGFAATVYEHQVSNVECSSHSA-----LPATQISTWAAAPEVYDGGNGNKA--ADIWL  159
            I L FAA+VY  +  N E     +     L    IS W AAPEVY+  N      +DIWL
Sbjct  182  IKLAFAASVYNSENINTEEEEGGSSSSVFLDLKSISKWGAAPEVYEKDNATNGPKSDIWL  241

Query  160  VGITAMELVYGGIRVPNREALE  225
            +GITA+EL YG + V NRE L+
Sbjct  242  LGITALELGYGELPVKNREDLD  263



>ref|XP_004248628.2| PREDICTED: serine/threonine-protein kinase BLUS1-like [Solanum 
lycopersicum]
Length=485

 Score = 61.2 bits (147),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 38/84 (45%), Positives = 50/84 (60%), Gaps = 8/84 (10%)
 Frame = +1

Query  1    IMLGFAATVYEHQ---VSNVECSSHSALPATQISTWAAAPEVYDGGN-GNKAA--DIWLV  162
            I L F  +VY+ +    + VE SS   L +  IS W AAPEV+   N  N+ A  DIWL+
Sbjct  320  IKLAFETSVYDSEPPDCNRVEDSSF--LNSKSISIWGAAPEVFGSENEDNRGAKSDIWLL  377

Query  163  GITAMELVYGGIRVPNREALEVLI  234
            GITA+ELVYG + V NR   + +I
Sbjct  378  GITALELVYGNLPVKNRTDFDYII  401



>ref|XP_009773712.1| PREDICTED: serine/threonine-protein kinase OSR1-like [Nicotiana 
sylvestris]
Length=416

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 39/91 (43%), Positives = 52/91 (57%), Gaps = 13/91 (14%)
 Frame = +1

Query  1    IMLGFAATVYEH----QVSNVECSSHSALPA-TQISTWAAAPEVY-------DGGNG-NK  141
            I L F A  Y+     +V+    +  S++P  T IS WAAAPE+Y       D  N  + 
Sbjct  174  IKLAFEAAGYDSDPQFKVNKEVDAGDSSVPRLTNISAWAAAPEIYYTYEDSDDIENDYSV  233

Query  142  AADIWLVGITAMELVYGGIRVPNREALEVLI  234
             +DIWLVGITA+EL YG IRV +RE  + +I
Sbjct  234  KSDIWLVGITALELAYGNIRVSDREDFDDMI  264



>ref|XP_006345543.1| PREDICTED: serine/threonine-protein kinase BLUS1-like [Solanum 
tuberosum]
Length=401

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 41/121 (34%), Positives = 51/121 (42%), Gaps = 42/121 (35%)
 Frame = +1

Query  1    IMLGFAATVYEHQVSNVECSSHSALPATQ--------------------ISTWAAAPEVY  120
            I LG+ AT+YE  +           P  Q                    +S WAAAPEV+
Sbjct  177  IKLGYEATIYESDLETPVVLERGPEPGNQPYLTLKGKNPGGPPILDLSLLSDWAAAPEVF  236

Query  121  -------DGGNGNKA---------------ADIWLVGITAMELVYGGIRVPNREALEVLI  234
                   D  N N A               +DIWLVGI A+EL YG +R+ +RE LE LI
Sbjct  237  HSKYYDSDDENRNPAKSSSRSEDDDDYSFKSDIWLVGIAALELAYGNLRISHREELEGLI  296

Query  235  R  237
            R
Sbjct  297  R  297



>ref|XP_009783130.1| PREDICTED: serine/threonine-protein kinase BLUS1-like [Nicotiana 
sylvestris]
Length=357

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 34/83 (41%), Positives = 45/83 (54%), Gaps = 8/83 (10%)
 Frame = +1

Query  1    IMLGFAATVYEHQVSNVE------CSSHSALPATQISTWAAAPEVYDGGNGNKA--ADIW  156
            I L   A+VY  +  N E       SS   L    IS W +APE+++  N      +DIW
Sbjct  182  IKLANGASVYNSENINTEEIQETGSSSCVFLDLKSISKWGSAPEIFEKDNATNGPKSDIW  241

Query  157  LVGITAMELVYGGIRVPNREALE  225
            L+GITA+EL YG + V NRE L+
Sbjct  242  LLGITALELGYGDLPVKNREDLD  264



>ref|XP_010321617.1| PREDICTED: serine/threonine-protein kinase BLUS1-like [Solanum 
lycopersicum]
Length=395

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 33/102 (32%), Positives = 50/102 (49%), Gaps = 23/102 (23%)
 Frame = +1

Query  1    IMLGFAATVYEHQVSNVECSSHSA--------------------LPATQISTWAAAPEVY  120
            I LGFAAT+Y+ ++ +    SH                      L   ++  WAAAPEV+
Sbjct  190  IKLGFAATIYDSELESPLFVSHGTELGVDSTVTDLQDDPPGHPNLELGELYRWAAAPEVF  249

Query  121  DGGNGNKA---ADIWLVGITAMELVYGGIRVPNREALEVLIR  237
                 +     +DIWLVG+ A+EL YG +R+ + E  E +I+
Sbjct  250  YSPCDDAHTVHSDIWLVGVAALELAYGNLRISDHEEFEAMIK  291



>ref|XP_004248629.1| PREDICTED: serine/threonine-protein kinase BLUS1-like [Solanum 
lycopersicum]
Length=413

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 30/57 (53%), Positives = 37/57 (65%), Gaps = 3/57 (5%)
 Frame = +1

Query  73   LPATQISTWAAAPEVYDGGN-GNKAA--DIWLVGITAMELVYGGIRVPNREALEVLI  234
            L    IS W AAPEV++  N  N+ A  DIWL+GITA+ELVYG + V NR  L  +I
Sbjct  274  LNTKSISIWGAAPEVFESENEDNRGAKSDIWLLGITALELVYGTLPVMNRTDLNYII  330



>ref|XP_004248625.1| PREDICTED: serine/threonine-protein kinase BLUS1-like [Solanum 
lycopersicum]
Length=413

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 43/75 (57%), Gaps = 4/75 (5%)
 Frame = +1

Query  1    IMLGFAATVYEHQVSNVECSSHSA-LPATQISTWAAAPEVYDGGNGNKA---ADIWLVGI  168
            I L +  + Y+ +  N   + ++  L    I  W AAPEVY+  N  ++   +DIWL GI
Sbjct  246  IKLAYEVSAYDSETQNQGNNQYAPFLNPKNIFRWGAAPEVYERENEGRSGPKSDIWLFGI  305

Query  169  TAMELVYGGIRVPNR  213
            TA+ELVYG + V NR
Sbjct  306  TALELVYGDLPVRNR  320



>ref|XP_004248630.1| PREDICTED: serine/threonine-protein kinase BLUS1-like [Solanum 
lycopersicum]
Length=366

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 27/57 (47%), Positives = 36/57 (63%), Gaps = 3/57 (5%)
 Frame = +1

Query  73   LPATQISTWAAAPEVYDGGNGN---KAADIWLVGITAMELVYGGIRVPNREALEVLI  234
            L    IS W AAPEV+   N +   + +D+WL+GITA+ELVYG + V NR  L  +I
Sbjct  227  LNPNNISMWGAAPEVFGSENEDNRGEKSDMWLLGITALELVYGNLPVKNRTDLNYII  283



>ref|XP_010648975.1| PREDICTED: serine/threonine-protein kinase BLUS1-like [Vitis 
vinifera]
Length=303

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 31/79 (39%), Positives = 46/79 (58%), Gaps = 10/79 (13%)
 Frame = +1

Query  1    IMLGFAATVYEHQVSNVECSSHSALPATQISTWAAAPEVYDGGNGNKAADIWLVGITAME  180
            I L FAA  Y+H  ++    + +ALP   +  W A PEV   G     +DIWLVGITA++
Sbjct  164  IRLAFAAAEYDHGQNH----TTTALP--NLCDWPA-PEVQ--GCCTTMSDIWLVGITALQ  214

Query  181  LVYGGIRVPNREALEVLIR  237
            L + G+RV  R+ +  +I+
Sbjct  215  LAF-GLRVSTRQGMARMIK  232



>emb|CAN68408.1| hypothetical protein VITISV_022912 [Vitis vinifera]
Length=311

 Score = 45.8 bits (107),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 29/79 (37%), Positives = 43/79 (54%), Gaps = 7/79 (9%)
 Frame = +1

Query  1    IMLGFAATVYEHQVSNVECSSHSALPATQISTWAAAPEVYDGGNGNKAADIWLVGITAME  180
            I L FAA++YE   + +      A+P      W A PE     N    AD+WLVGITA++
Sbjct  167  IKLAFAASLYEQNTNFLGHGPSYAMPHCM---WPA-PEA--SLNYTSKADVWLVGITALQ  220

Query  181  LVYGGIRVPNREALEVLIR  237
            L Y G+RV N  ++  +++
Sbjct  221  LGY-GLRVANHNSMVAMVK  238



Lambda      K        H        a         alpha
   0.318    0.132    0.397    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 517576194536